2JELL

Jel42 fab/hpr complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
217
structure length
217
Chain Sequence
DVLMTQTPLSLPVSLGDQASISCRSSQSIVHGNGNTYLEWYLQKPGQSPKLLIYKISNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIGDGARQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSDSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords JEL42 FAB FRAGMENT
publication title The 2.5 A resolution structure of the jel42 Fab fragment/HPr complex
pubmed doi rcsb
molecule tags Complex (antibody/antigen)
total genus 47
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 1998-02-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2jelL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2jelL01
2XQYG 3O4OB 3A6CH 4HC1A 1S7TA 2P8PB 4JY5L 5KVMC 3HE6C 4NRZA 2CGRL 3CLFL 4PD4J 5F9WC 3P4NA 5I75C 4O51B 3VD5A 4X4XB 1HH6B 4TTGA 1I4FB 4IS6A 3RL1A 4X99A 2IC2A 1YN7B 2VZ3A 3O6FB 2Q6WA 3M8OL 3BZ4B 1KN2H 2X4TB 4R90H 5I1KH 2FBOJ 1BFVH 1WTLA 4X9HA 4YHMH 4QYOA 4LSSL 4C54A 5FECA 1A7RH 5HHOB 3O3UN 2APWA 2P8MA 1M05B 5F70A 2IPTH 2V5SA 1T1XB 3LEXB 3BX7C 4ZS7H 1ZGLA 5HHPA 3MFGB 3VG0L 1TLKA 3KYKL 2Y72A 3I9GL 4ZDHB 3ARWA 5CINL 5IHZA 2OQJB 3GRWL 1U8IB 3ZKQD 1BQLH 5HVHC 4P2QA 3TO4A 3I3DA 1N3NB 1HNGA 1DANU 4DUVA 1D5MB 4XP1H 2VDPL 4M00A 5CCKL 4RMWA 2ZNWA 1FORL 2ZOLB 1YEIH 1T83A 1AXIB 1T7VA 3KPMB 4LPVA 4PP1D 4LPTA 4NO0D 1N2RA 3LS5L 1YEHH 5E8DL 1WC7A 3BESR 3DNKA 2BVPA 4KV5F 4R4FL 4XGZB 5DRXB 2H9GB 2EDKA 1EX0A 1JMZA 5L8LB 4BZ2H 4E5XA 2ZKHH 4U1SB 1DBAL 1BD2B 5EO9B 1TXKA 5J12B 3K80A 1U8OB 4Q2ZA 4JQIH 1OTTC 5ISZB 2ESVB 3V6FA 5BRZA 5DEZA 5CBEA 4C59B 1OTSC 1MHCB 5GRUH 5DURD 2ZCKL 4HC1H 1UH3A 4XNUL 1T21B 3ARDA 4BSVA 1IJ9A 4UU9A 2CLZB 1G7IA 3JV5A 5FYJH 1CG9B 4HMCA 4ETYA 3DMMA 3DHMA 4H26B 3BE1L 5DD3H 1CU4H 2X4SA 3W81A 3CK0H 1HNFA 3QCUH 3NIDF 1J5OL 3BH8B 5I8OH 2AJUL 3EZ8A 3OJDA 3VRJA 4GBXC 4ZNEE 3SQOL 2EIDA 1T5WA 3W39A 5SX5K 3BPLB 3GBNH 5D96C 4ZPTB 5DDHB 2DMCA 4RZCB 5IB2A 1AIFA 2ADIA 5CJXC 4M7ZC 4NRYB 1D5IH 4FQPA 4MJID 1DFBL 1SBSH 3PGCA 2WK2A 3PWPB 2I60H 4X7DC 3T08A 4PJAB 9CGTA 4WO4A 5E4EC 5HI3D 3VH8B 3EJZC 2X70A 1CDHA 1HINH 2D7PA 3TH2T 3ZDXF 1FYTA 3D85D 1PD6A 5D1QC 1A7OL 3MLRH 1I85A 4W68A 1FNGB 1NMBL 1U36A 5D6DC 4DGIL 4PJ8A 2G5RA 4XCEB 1P6AB 1S5IH 1CK0H 4NRZB 3SDXE 4Y4FC 1JBJA 5BQ7A 4Y2DA 3NA4A 5C9KA 2AI0L 4PV8A 2X10A 3CFIC 4X99B 3LKOB 4CADA 1FL3A 1XEDA 4LBEA 3E6HB 4WFGE 4JO3L 5DLMH 3ZDXE 3G5ZA 4POZC 3BT2L 3DX7A 5KVGL 1HK6A 3F7VA 1F2QA 5TH2B 3WNKA 1UYWH 2P5WD 5FECB 1N0XL 5FGCE 2XI9A 2YN3A 1JWSA 1E6OH 4NQED 3BZDA 4PJEA 5I6XB 2VXSH 2EKJA 4JRYB 4P5KA 4M6NH 2FEEL 3Q6GL 1NAMA 2C3HA 1A6AA 5JA8B 5C07B 5J56B 5IHZB 1NEUA 2CKNA 1IM9B 5BXFA 2JCCB 1G9MC 4AMKH 1FO0A 4QHMB 1MCKA 2XWJA 3RWFB 3GIZH 3L95B 5F72S 4JHAH 3P9MB 4KI5F 2YD5A 1NDGA 1M6OB 1I8IA 1UC6A 5F1OB 4IBLT 3S35H 3MRKB 5B4MC 3DV4B 3L3HB 4KRMB 2FJFB 3DGCR 2G5BA 5JUEH 3M17B 1CGXA 5M94B 2DQJL 2GKIA 1DQJB 3WFBH 4MQTB 1PSKH 2PXYB 5I1EH 5DI8B 5E70A 1A0QH 3N50A 3QFDB 4HH9A 3SBWA 4CW1A 5DJYA 1HYSD 1TQBB 1XF4B 1CICB 4DFIA 4O4YL 4FQIH 3T1FB 1I3GH 3DJ9A 2DIBA 4OZGB 1ZGLP 1AO7E 1DANT 2ADFL 1MWAA 4KI5E 4U1LA 4XRCA 4PJ9C 5EU3B 1F45A 1VKXA 5BRZB 4JHWH 2OXHA 4RGNE 3QDHA 5CS7A 2NXYC 3OAUH 4CVZA 2BNQA 3ULVL 3F12B 1G7IB 4RGOL 3K2UH 1OP3H 4JANA 1YJDL 3JWNC 1MCBA 3GKWL 3O41A 4FQJH 5I0DA 5FF6A 1KV3A 2I07A 2R1YB 3MGTA 2VNCA 1NUGA 3OJDB 3VRJB 1TPXC 4U0RB 3FQUA 32C2B 3JWDH 5I1LB 4L9LB 2K9UA 2J8OA 3QDJD 1CD1B 1N4XH 3P0YL 5IB2B 2R39A 4LLWB 3B9EA 1AIFB 2ADIB 3VG9B 3IU4L 5F71A 5EO0A 3X12A 5E8EA 1FGNL 3IS1X 4V2BA 3HUJA 5CLWA 1H0DA 3DSFH 4WO4B 1NAMH 1NGYA 4XC1L 3IETB 2X70B 1DLHB 1ONQA 1DBBL 2EC9T 3VMPA 2EYSA 4YDLC 1WFNA 2ENYA 1WIPA 3GK8L 4P48A 1EAPB 2YK1L 3NPSB 1KPUB 3FO9B 4YDVA 1WWCA 2NX5A 4YXLL 3KS0H 2VLKD 5T3ZH 4CU7A 3QNZB 5LGJA 3E1F1 4PJ5E 3OKMB 3H2WA 1BVLB 1QPPA 5ADPH 5JDSA 2VLRE 3VH8G 1MQKH 4HSQA 3RWJA 1GHFL 1PFCA 4PV8B 3GMPB 1KB5L 4P4RA 2Q76B 4PGZA 2BP3A 3VFWA 1YC8A 5EZJA 2VR4A 1IFHL 5MEOA 3BUTA 1AD9B 1I3RB 3UTQA 4Q9RH 2AGJH 5EU4B 1MWAH 3PL6C 4ZMAT 1JHLL 4MNQD 2CSPA 5HYSB 1WBZB 3O8XB 3K1DA 3BRFA 1OF2A 4F7MA 4W4OC 1NAMB 4PBVC 1ZHLA 1GXEA 3ARFB 2VITA 4FZ8L 3VWJA 3LDBC 3QXDA 4MJ5B 5GS0D 1SM3L 1G9NL 1OGAB 5C08E 1MLCA 1RZIA 1MY7A 2DS4A 4NJ9L 2WZPD 3QIBD 1II4E 2NY5H 5C6TL 1C5BH 4V1DD 3KYOB 3HMXA 4NNYB 2X09A 4X6CF 1BFSA 3VU2A 1QZ1A 3RUGF 5IOPA 2G5BB 3LIZL 3GJFA 3MV9D 1UM5H 1UXWB 2ORBH 3QDGE 3O3BB 2AJYL 5AZ2L 5FYKL 3CXHK 3PF2A 3FMGL 1ULVA 4BZ1H 2HRLA 4HH9B 1MJJB 5GS2H 2IANB 5TQ2H 2XV6B 2IPKA 4WUUB 1CFVH 1ZTXL 1LHZA 3C6SB 5E6YA 1C1EL 1LP9A 4LCUA 1MWAB 1EHXA 4XRCB 1Q0XL 4WFHD 1VKXB 1CL7L 4YBQD 5IM7B 1MCOL 2CKBL 2R0WL 4X6CE 1P7QB 3HZKA 3NZ8A 3O6KL 3OZ9H 1K3IA 5IMMB 4OIIL 3IFLH 5F3BA 2EH7L 2QSQA 3JVGC 1F13A 4ODVH 5BJTB 4JO4L 3X13B 1EV2E 4JANB 1S9XA 5CILL 5EC1A 3PG2A 3UDWC 4QTIH 5FF6B 2MHAB 4YWGH 2I07B 4QRUA 3SJVD 2R8SL 1R3IL 2L0DA 3U4AA 1KUMA 3MJ7A 5HI4D 4PIRF 3G04B 2NY2C 2ITDA 1H5BA 1HOCA 4I0PD 4KKBD 4OBSA 1QLEH 2ZCLL 4QOKD 4OFVA 3PNWA 3I6KB 5D7IA 3OR6B 3WFCL 5J3HC 1VDGA 1ETZA 4XCNA 3FO1B 4KKCD 1INQA 3BGMA 3SDDD 4Q9CA 4HUKB 2IALA 15C8L 3X12B 3VD4A 3HUJB 4K7PY 1H0DB 5GSVB 2FJGA 1NGYB 4NN7B 2H2SD 5IMKA 1OQXA 4DN4H 4Z95L 1A6ZA 1S3KH 2ZWLT 4XI5C 5EDXA 5CZKA 1DLFL 4BH8A 1F11A 4OCSL 1YNLH 4YDVB 3KPSD 3A6BL 5DC0A 3X14A 2NX5B 3HMXH 2GSIB 1RK1B 4M02A 3SDYH 1AY1L 1KXVC 2FWOB 5GRVK 2WWMC 2DYPA 4GRMB 5L2KE 3UTSA 1L4IA 4QRRA 3KPOA 5GZOD 4GXVH 2C9AA 5EUKA 1Z3GH 3O45A 4U33A 4ZG1A 2XPGA 3QWRA 2DQCH 3WFDL 3WSQL 1QLFB 5F7LB 4PY7B 1S8DB 5EZJB 4OCWL 3O9WD 2OSLB 4G9FE 4FXKB 3P11H 3KR3H 2VDNL 5IVXE 3HZYB 1CDYA 3V6OC 1XGUB 4CAGA 1NCNA 2E7BA 3N1MC 1UB5B 3TT3L 2VH5L 4TULL 4Y4KD 4TQEL 1A4JB 1OF2B 5I18H 4CNIA 3ILQC 4XX1G 5HGGS 1S7SB 4F7MB 1ZMYA 5D72L 3WS3A 1KCRH 1ZHLB 4K94C 3MX0A 2YHGA 1B90A 4LRNL 4JDVA 5EB9A 1RZIB 2HTKD 1QSED 2OR8A 3GMQA 1FNAA 3BP7B 1MY5A 1DVFD 5ETUA 4PJHA 1BZ7A 4WHTA 5HYSG 1EXUA 1JNLL 5KVDL 3KPRD 3SE9H 4JFQB 3BSZL 4JFZH 3WFEH 5EA0H 2NTFA 4JLRB 3MRFA 3SHSA 5DD5L 8FABB 3OXRB 4PRDA 1EZVX 2ZUQB 1MF2L 3ALPA 5EUOE 4WWKC 5D2LB 3NA9L 2CMRL 2AKRA 2IGFL 3QG7H 4KXZH 4RAUB 4BZYA 4L8SB 1YEJL 4NGHL 4RAHA 4NZJA 1XF3A 5C0AE 5K9JL 1NJ9A 4NQCA 3P73B 3NZ8B 3VRIA 4P3WA 4FTVE 3OR7A 4HLJA 4M5ZL 1AQDB 4N5ED 4ZQKA 1PYWA 5K9QG 2W59A 4JFFA 5F93C 3BGAA 4R2GD 4UNTA 1S9XB 2AEPH 3QUXD 2EDFA 1KELH 2DD8L 5CP7A 5E03A 4JKLA 4MD4B 4YK4C 4AIZA 3P9LA 4DFHA 1BEYH 4U3CA 5FYJU 3TBTB 3BJLA 4AQ1B 1FNEA 1HOCB 2R9HD 2QSVA 4S1QH 1M71B 2QL1A 2JIXA 4OLYL 5J4MA 1OWRM 4OQTA 4XCNB 3NACH 1INQB 1KFAL 2VXQL 1FNFA 5IB1B 1GZQB 2FECL 1YN6A 5F7YC 1GZPB 4P9ML 4EI5C 1C16A 1F90H 2D31A 5FK9B 5ACMA 5CZXC 5C0BE 1JCKA 4UIMA 3ECBA 4QXGH 3ARGD 1S9YB 4DEPB 3MNVB 1P69B 2X6MA 1MCEA 2GI7A 3X14B 1BLNB 1U2CA 2N4IA 4BFIA 4WHYH 4UQ3A 2WP3O 3IF1A 1SEQH 5IHUH 5IR1B 4RAVB 1RUAL 1CLYL 3O3EB 1D6VH 4PRPE 5IHLB 1G7HA 3MV8E 3QXAA 1HZHH 4G8EA 5J11C 1U6AL 3O45B 3O6FD 5DQDH 3HTLX 3LQZA 3IXAB 2Y6SC 3D25A 1ZSDB 1JHKL 2JJTC 3UBXI 4CL7A 3N1QC 3KS0J 5HHOD 3L7FB 2FR4B 1FGVH 5IJVA 5ANMA 1CD0A 2D0FA 3QA3B 1I8LC 1A9EA 1ES0A 4LVOB 4NT6B 1T7XA 3AXLB 3EYOB 3CFKB 3D2UA 3MJ8A 4J7RA 1U93B 1U8JA 3S34L 1J8HE 5IJKC 3GGWA 2Z31A 3AUVA 3VFVA 1FRGL 1JGEA 4POUB 5JXEC 3HLAA 4GMTL 3QIUC 2LE9A 4K23H 3BW9A 3TNMA 3I2CH 4Z7UB 2ZNXA 3GMQB 4MVBC 5D7SH 3ULVH 5J1AB 5ETUB 1EIBA 3MREA 4N1EA 2XQBL 1ADQA 4H0HB 2H26B 1EXUB 1GL4B 4TN9A 2XWTB 3KLAA 2DQEL 5INCB 5CBAA 4U2YA 5IEHB 2NTFB 2YSSB 3PWNA 5BO1L 5BS0A 1SJVA 4U6VL 2OP4L 4F57H 4PJGA 2PYFA 3IDUA 1YEFH 3SOBL 1JGUL 3F8UB 4JRWA 5ISZD 2B1HH 2ESVD 2HWZL 2KQMA 1IKFL 1JFQL 1MFEL 2Q8BL 3F7PC 5HPMB 3LY6A 4EDXA 4LCYA 3OAYK 1NJ9B 1KLUA 2XA8L 2AJVH 4QXUL 4NQCB 4OV5A 4Y5VB 1MCSA 2HRPH 3OR7B 2DM7A 2XG4A 4I48B 1PYWB 5I19L 4NQUA 1QFWI 4JFFB 5ID0A 1MUJA 3WL9B 4Z7OF 1RMFH 3VXSE 1UENA 5L8JB 5CP7B 4AIZB 1JF1A 2GUOA 4F58L 2AEQL 2EDJA 1A9BB 3DO7B 1R5VA 1MRDL 3L9RA 4HS8H 1OVZA 4Z77B 1U8HA 3PWPD 3MLUH 3FQNA 1W72L 3WN5B 1TIUA 1YN6B 3P4OB 5JMRA 1MCJA 3D18A 5FHBH 3S6CA 4XNYL 1C16B 1A6UH 5D70L 1J1XL 1T66C 5D6CA 3RKDD 1QR1B 4JPVL 3WJLA 5ICYA 2VE6B 4JFEE 4LLVB 3KYMA 3LEYL 4AL8L 3RIAK 5T1KB 1B4JL 4BQ6A 1ADQH 3N1GC 5FYJD 4KK6C 2Q3AA 1U3HC 2WW8A 3RZCA 2I26N 1G7HB 1PBYA 1F58L 5HGAB 3D0VB 4U1JB 1C5CL 1HSBB 5D93C 3LKSA 3VD3A 3VXTA 5JDJA 3V0AC 4LU5H 3TVMA 2A6KA 2VLLA 1OSPL 5FYKH 5IJVB 4XNQB 5F7UA 3SO3C 1KB5B 4JRYD 4JVWA 1ES0B 4H8WL 5C7XL 5C07D 3WYRA 5IW6A 1Z2KA 3KGRA 1IM9D 4NC2B 3RNKA 3VGGA 4NUGL 4X98B 4M1CC 4M5YL 5FKPA 5E4IA 2P47B 3GGWB 3HB3C 4FQHA 1NEZA 3ZKXC 3H42H 2GK0A 4X7TA 2BXZA 1CGWA 1CGUA 2Y06L 2F53B 2VDRH 3O6KH 5SX5H 3OX8A 4DN3H 3LKPA 4NSKB 35C8H 1R3HA 5C0EA 3THML 1CFNB 1UGNA 4OSUL 4KI5C 3QPXH 3QQ3A 2PXYD 3C5JA 3R8QA 4LARL 4LLUB 4PRAB 4QGYA 3C8KB 3NN8A 1A3LL 4RGNC 2J88H 1R3IH 4CMMA 4FQQA 5LVEA 3PWNB 3LOWA 4PGCA 1CICD 1D7FA 3U36B 3NMEA 5HHME 4ELKA 1R5WA 4H5SA 4D9RD 2ICWB 3IJHA 5IBTL 3MA7B 1ZWIB 4JJ5A 5BRZD 3FQWB 1DZBA 3GMLA 4WHYG 4JPKL 2VC2L 4KAQL 4LCYB 3MUJA 4KMLB 2VUOA 5F7NC 1CF8H 4IEFB 4OJFL 1A6TA 3SKMB 4PYHA 3W9EB 3MV11 3GHBL 4P23A 5D7LE 3VMNA 5JO5A 5D9SA 5ID0B 1MUJB 3UTTE 2O5ZL 4KJWD 3JXAA 4LVEA 4IOIA 1D9KC 3BEVB 3ZE1F 1HWHB 4Q58C 4JFOB 4EVNB 3SKJH 1EEYA 3IDGB 1LD9A 1R5VB 4LL9A 4QRSB 3T1WA 3S36H 5IT2H 1CI5A 2JTDA 5IV2A 2HG5B 5IQ9A 1JYNA 4M7KH 3C6LC 3RWIB 3QYCA 4P9HH 1A2YA 4WO4D 4MNHB 3K8LA 5F7KC 4XBPA 3FQNB 4PJCA 2BC4A 4OZ4A 4RMVA 4HQQL 4Z7VF 1G7PB 3MBEA 4J4PA 4QHUB 3B2VL 2Y7QB 3FT2A 3K1KC 3KHQA 1F4WL 1P4LA 2OL3L 3EOTH 5D6CB 3VFGL 2UZXB 5HTSA 4MNGA 2O5YH 5HHVL 2ZSWB 5DRZA 4DGVL 3T0ED 2GTZA 3V0WL 3BPNB 4P2RB 3LEVH 4RA3A 1WBYB 3T2NH 3MV7B 4WRLA 4FABL 4OM1L 3GBMH 5DO2C 3QG6B 3MV01 3RZCB 2BFVL 1F4XH 1KT2A 2W9DH 3QFJE 3P77B 3NCMA 1ZVHA 5I9QC 3HE6A 3UC0L 4G6KL 2Y07L 3TVMB 5DD1L 2A6KB 5B3JF 4QOKE 1KOAA 2JKXA 1FJ1A 1QO3A 3JWOH 2GY5A 5ALBH 2AJ3B 1I7ZA 3O8XD 4M48H 4DW2L 5EWIL 4GW1A 4RFNC 1A4KA 4HGMA 3BP5A 3ARFD 3AU1A 3NA9H 5TPWL 4MCYB 1OGAD 1QBAA 2R2BA 5FKPB 4KKAC 5SWQA 4X4ME 4X5XA 4X7TB 4PRBB 4ZO6A 4O2CA 2EYTA 3O2VH 3D9AH 3CSBA 5T3ZD 5B3JE 1R5IB 5C0EB 4P57B 4XPTH 5LCVL 3L3OA 1FO0L 1MIEH 1N59B 1LEKA 3U0PB 2R15A 3RWHB 2V2XB 4KHTL 5IEKA 4UBDC 2HVKA 2CO6B 3JBG7 3QQ3B 4O58L 4OLEA 4DKEL 1DDHB 1ZS8B 2IAND 4TNWK 2CDFA 4IRSB 4PGCB 3U7WL 2W0FA 3IU3A 4WUUD 5F7WC 1SYVA 4ENEC 4ELKB 1R5WB 3FOLB 4JB9H 2AQ1A 4JDZB 1MCHA 1EGJL 3OHXB 3G6AB 1NGQH 3K4AA 4PB0L 4OLYH 3IJHB 4JVUA 3QNXB 4X9GA 4N8PA 5L0QB 3DIFA 2X5PA 4JJ5B 1KIPB 1HILB 5KSBF 1P7QD 4Q97A 1IC5H 1U8QA 2Z8WC 1YMMA 4P4KB 3L3DA 4XCYA 4NJAL 3T0WA 4YHLL 3DBXA 4DTGL 2AQ2A 3EYQC 4PGBA 3BRDA 5D9SB 5C0GA 3WNMA 1IM3A 2V2TA 2AV7A 4TVSa 5LXGH 4UTAL 4OFKA 3C09B 1CIDA 4NWTH 2ITCA 2R4RL 2FL5B 3CMGA 1EEYB 3OB0H 3BJ91 2HFFA 5JW3L 5EORH 3SDAC 3KPRE 1ROWA 3MUGB 5KSBE 2YC1B 5T3XD 5IFAL 2IH3B 3SE4C 5DJZA 4XXCC 3OMZA 4UDTB 4HD9A 2BNRE 4XBPB 2XY1A 3GSWA 5IMOB 1QSZA 4HIHA 3I84A 5CJXA 3FT2B 4GRLC 2BHZA 5SWZE 2WIMA 1T20A 5CEXB 2H3NA 1L0YA 3VW3H 3EFFB 1K4CA 2NX5D 4GRWH 5DRZB 3GMOB 4X5WA 3FFDA 5J57B 4F8QA 1L6ZA 1MCDA 5FYLL 1TCMA 5D1QA 4GH7B 2DL9A 5F9AC 1Q9WA 1N6UA 4C56E 1FPTL 1V7NL 4G7YH 5D6DA 1G0XA 1ZANH 3V6ZB 5LWYH 2VLMD 1KT2B 3ARYA 1U8PA 2C1OB 3I50H 3QQNA 3B8SA 3MRQB 4GAGL 2HMIC 2ICCA 4Y4FA 2DLTA 3U30C 3JTSA 4NDMB 1OAXL 4XNZC 1SYSB 1JRHI 5CFHA 43C9A 4G42A 2ILLA 2E3VA 4NBZB 3L3IA 1G7MA 4XVSH 4LDOB 4RDQF 4ZPVB 4HKBB 4OFIA 5JOPE 4Z8FL 3MACL 4EDWL 2HTLD 2DBJA 2BVUA 3MRIB 4FQCL 3TPKA 1QR4A 1JGDB 3B5GA 3CMOL 1J0YA 4Y4HB 3NGBC 3GSQA 2EYTB 4O2CB 1NH6A 1T2XA 4JEGB 1U9KA 4WJ5B 4GRWB 1U58B 2IBGA 2VISB 3QUZB 5ID1B 1RZ7H 4KHXL 4N0FB 3TIEB 5HVHB 1LEKB 1BJ8A 3NAAL 5ILTL 3W11D 2QQQA 3NCEB 1ORQB 3WNNA 1TVDA 2A1WL 3V7AE 3HNVH 2CDFB 4AIXA 1NEZG 2I9TB 5F3HB 1DQDL 1SYVB 3OGCB 1NAKL 1PEZA 3CDCA 1KB9K 2DQUH 4UT6H 5IB5B 5IK3B 1W72H 5ESVB 1UZ8A 3HI1B 3EKCA 2X41A 4FZEH 5IVNA 1NCAL 3VFNA 1SY6L 4XCYB 1CE6B 1FHGA 4PP1C 2ADJA 3KYNA 4PJ9A 2D0GA 4O2FB 1U91B 2WP3T 3WLBB 2A0LC 1WK0A 4YE4L 2OS7A 1UWGL 5FV2A 5AD0A 1EK3A 4F2MA 5C0GB 1IM3B 1M7DA 3LV3A 4OLWH 5EOQH 3NVQA 3VFOA 1P4IH 2J8HA 1DJSA 5FO8B 1SBBA 1K3ZA 5DQJA 1IC1A 4MAYC 2PO6B 1ZLWH 3KJ6H 5EU6A 4GBXB 4PRHE 4YHYC 4PTUA 1T0MB 4XP9H 1UH4A 5E8NA 1NANH 1Q1JH 4IHOB 3GSWB 3CFEB 1T2JA 1VERA 4HHAA 2WBKA 1YEKL 1OSPH 5AG8A 5E2JA 3EOYG 5E4EB 1Y6KR 4XP6L 4JKMA 5JHDB 1RSFA 1B9ZA 1K4CB 1W72B 5F7EL 2P24B 4X5WB 5L6YH 1CXEA 1G9MH 1MI5E 1U2HA 4L3CA 4OT1L 1KYOK 4P2OC 1FL5B 2J4WL 4HPOH 4M7LH 3S9DB 2VZSA 4PJIA 1JPFB 2HYMA 1RVFL 1X5ZA 3HFML 5CEYB 2P46B 5HI3C 1X9QA 1Y18A 1OCWL 4K9EL 4ZSOA 4N1HB 2BVOA 4MHHI 4UB0L 3CXDH 5C09B 5JW4N 2N56A 43C9B 1QQDA 2CR3A 3SGJC 3HI5H 2Z93A 5KS9F 1FVCB 1X5IA 3CX5K 1NCWH 3PL6A 5FYKU 3UJIH 3I75A 4MA7L 4AM0A 1OT2A 5TJWK 4YC2C 3HG1E 3MXWH 4P0DA 2AW2A 4GS7B 4U6XA 3ZHDA 4W4OA 4FQ1H 4ODSH 5LBSH 1DEEA 5T1DH 1DBKL 2F5BL 2J8UA 1I8MA 1MH5B 1JNNH 4GSDL 3LB6C 4LHUA 2QTEA 1SJEA 1XMWA 1P2CA 5BMFH 2JCCF 1AGFA 4F80A 4CU8A 1QFUL 3CH8A 5KS9E 2BOBB 4OF3A 1D3CA 4MA3B 1JJUA 1XF2B 5GJTL 3NFPB 4NZRH 4EN3D 3B2UD 1XIWC 3JV4B 1HHKA 1LILA 3QHZL 4K7PH 1QSFA 4M62L 5MEPA 5K9KB 3UPAA 1A7QH 2X2YA 3KLDA 2EDTA 4HQQH 4OCYL 4OZHA 5AEAA 1YY8B 2FGWL 2DQGL 5DMIL 4JN1H 4JFFD 4A6YH 4U6YB 1A6PA 1JPGB 3GO1L 3KYNB 4WW1B 3QEHA 5CEZE 5ADOH 3O3AA 5AD0B 4F2MB 2RFXA 1M7DB 3LV3B 3VFOB 1OAZL 3E0GA 5DSCB 5C92A 1VCAA 2JJSC 3VD7A 1QPXA 3JVGA 1HYSC 3ULVD 1HSAB 4GG8A 4X5LA 3U7AA 3UDWA 3PXHA 1QFWL 1YPZB 3WFHB 4DKFH 1DQLL 3B9KC 3VGEA 4EJ1C 1A7BA 4GT7A 3MRNA 2UV3A 1MELA 3KJ4B 3LVEA 4TSCH 2QR0B 4WV1C 5I8EA 5ALCH 3PIQB 4JKWA 3MRMB 2XNAA 1BIIB 2A6IA 2E8YA 3ELAT 4I3SH 4X6DF 1ITCA 1FL6B 4HEPG 4HHAB 1OAQL 3CNKA 2RIKA 3FL7A 4HKZB 3HNSH 4OQTL 2V5TA 5FB8B 4U1HA 2R23A 4C83A 3LKNA 3L7EB 3KXFA 5T1KD 4J2XA 4M7JH 4LVHC 3QQ9D 1GC1L 5TPWH 3OL2A 5C2UB 1FLRL 4A6YB 2YKLL 1JPSH 1RJCA 4X6BA 1BVKB 1JK8B 2W9EH 2ARWA 2P5EA 2IH1A 3TZVB 5B39B 4MJ6B 2OR9H 1M7IA 5HGBB 1I7TA 4X6DE 4IRZL 3CZJA 4J3WA 4X8JA 4G8GA 5CGYD 1Y18B 4ESKA 1YQVH 4ZSOB 4R0LC 1QRNE 3OXSA 5DD0H 3MROA 4PUBL 4S1DC 3OAYH 3ZT6A 4Z76A 1QQDB 1DSFH 4HK0A 1BIHA 2X40A 1LDPL 3EDKA 1FNHA 2GQHA 4HJGB 2WIIA 2MNUA 1CFQB 1S7RA 2WAHA 4QF1A 3V6OA 3PL6B 2W0KA 3MZTA 4OD1H 43CAA 3BYYA 3T65A 1DUYA 4JREC 2F53D 3VXQA 1ZVSB 4D0DA 1NKOA 2DMKA 5GRYA 4G9DA 4GKSA 1ODAA 1IGFH 2XZCL 3T0EE 3VXOB 1CYGA 3LDBB 2GAZB 1I8MB 3GIVA 2BDNL 3GHEL 4LHUB 5DUPL 2F5AL 2IFFL 4JO2L 4RWHA 1I1FB 3MLXL 4KKLD 1NGPH 1AGFB 4OAWA 4LSRH 4Y5XC 1YQ2A 4YHKL 4WI6A 5HXMA 3O2WL 4RIRB 3ES6B 2R4RH 5FA4A 4MDIB 2CRYA 3EFDH 7CGTA 5FO7A 3PWLA 3E8UH 4JG0H 1PAMA 3REVB 1X4ZA 3B5HA 1MFNA 3U7YL 5GS0C 5FYKD 2ATPB 1HHKB 5A2FA 2AQ3A 2W60B 2AK4B 2DJSA 2R0LH 1X5YA 1QSFB 2XKNB 2Y36L 4ZFGH 1JI2A 2YBRA 4K8RL 1E4WL 4XH2B 1DBML 1I7RA 2VZOA 4LSPL 1HHHB 4YHPB 3O4LE 4LVNC 1N7ML 5JA9A 5E2WL 3GB7A 5DVLA 1JHTB 3M45A 5F7MC 5HHXL 5I1JH 3ZL4L 1NSNL 2RFXB 1RU9L 4LLDA 4UUJA 2GSGA 3ZYZA 5HD8D 2HLAB 4LHQB 5BZDA 3QEGH 5KOMC 4JFDE 5JW4Q 4L4TE 3B3IA 5DYOB 1HIMH 2R1XB 3NFSH 1VEMA 4JRXE 4XP5L 1IGIL 3IFNL 1ED3A 3NTCH 4TPRL 4FG6D 1RZGA 3TJHC 4YJZL 1UWEL 2NY2B 1NCUA 3GM0A 3O0RL 3TFKD 4LEXH 1VHPA 3EOAA 1IGCH 2GFBA 2XNAB 1YA5A 5J7CC 2FZ3A 1QYGL 1I1YB 1LGVA 5D2NE 4JFYA 2F74A 3VGFA 3MBXH 3KPPB 4TOYL 3T3PF 3KXFB 4GG6B 4P2RD 4EI5A 3MACH 4Y1AB 5GPRA 4OZFH 3ROLA 3MV7D 1EHNA 4NO2B 4I0PC 4KKBC 4FQCH 4PP2A 2XXMB 3RZCD 1A5FL 1MCIA 1T5XB 4I0CC 2BY2A 4LASL 2P48B 3O3DA 3Q6FB 1MFCL 4Q0XL 2XT1B 4KKCC 2IH1B 3SDDC 1GOFA 1QBMH 1FC2D 2FYYA 3ZYJA 2EDOA 3TVMD 3B9AA 5IF0B 1RZKL 1D5XB 1NMCB 2EH8H 2Z0BA 3FOMA 3RKPA 3F6LA 3T3PE 4FQLL 2NYYD 5T3XE 1O7SA 5E94A 4L5FL 4HK0B 4ZFFB 3VGDA 2D7NA 4XBEH 1S7RB 2BSTA 2Z92A 2X4QB 4D9QD 4QHKI 1QKZH 1QNZL 1I8LA 1DUYB 1MREH 2R0ZL 5GZOC 3QH3B 3VXQB 4U7KA 4YXHH 3TH3T 3RRQA 4O9HH 4GKSB 5HHQA 1YEDA 2QSCL 4QWWC 4HFUH 4OZFB 4NQSA 3O9WC 3OKEB 3GIVB 4JY4A 4LMQE 2KL6A 5JXEA 3MODH 3QIUA 4DCQB 1ZAGA 1G0DA 3FB5B 1EZVY 1PDKA 4IRSD 3UYRH 2VN4A 4DKAA 4WIQA 3RP1A 1WIOA 4Q6IA 2VXUH 4OIBA 4K3DH 4L8DB 1KENH 2M2DA 1I9IL 1FIGL 3IB4A 1ORSB 4PRIB 5DFVC 1AGDA 4F33A 2HTKC 3MRCA 2Z8RA 3H3BC 3PJSA 4LHUG 4WWKB 1K6QL 2YBRB 4P4KD 4LSQH 5E2UH 1UT9A 3NCYP 4C58B 1MLBB 4YDJB 2CK2A 4XXDB 4U1KA 4UT7L 5D2LF 3VFTA 1H3TA 4ZNEA 5TDNA 4HIIA 3MCLH 1O5DT 4U2ZA 4XC3L 4NWUL 3GFUA 1LO0H 7FABH 1EJOH 2E6JA 4HS3B 5HDLA 1YYLH 5BZDB 1LO4H 3ZE2F 4D0BB 4XCCL 4PLJD 1A22B 3B3IB 1AGCB 5KAQF 1PX4A 3PP3K 4PB9L 2V2WB 4WWID 1VPOL 2J12B 4HMEA 3WXVL 3MOQA 4Y19B 4AENB 2HJFA 4HIJB 2EDXA 5KTEL 3G5VB 2YEZA 2YA1A 1LVEA 1V3KA 5EU5A 3VWKB 4R2GC 2F74B 3QUXC 3AB0C 1BAFL 2APXA 4NM8L 4I5BB 4UOW0 4PY8I 3NCYS 1EBPA 4O2EB 1A7PH 2RR3A 3UZVB 3FO2B 4PJXE 3FZUD 4RCAA 2Z4QB 4HWBA 2R1WB 2DQHH 4Q9BA 1ZLVK 1P5VA 5D1XA 2DI7A 4CVUA 1EVUA 3FQXA 1F42A 1UVQA 3ARBB 2IFGA 1E6JL 1R3KA 1U3HA 1CLOH 3DO3A 4FXGA 5J11B 3U0WH 4NKDA 3RPIB 4K3HA 4WENB 3SO5A 1MFAH 1KJVA 3C2AL 3IKCB 1A6WL 1OGTB 3MPCA 3RIFK 1E4XH 3QRFM 2NY0C 4FQXB 5DHYA 3LH2H 5E94B 1BREA 4Z0BL 2CXGA 2MMXA 4FN0A 1JPTH 1TDQA 1EMTL 3CIQA 5JPNB 2Z92B 4KTYA 5IROC 1JWMB 1JRHL 4Y4HD 1FYHB 5I1IH 3O6FC 4G6AD 3QUZD 1K4DA 3UBXB 2XN9A 5K9OA 1AC6A 4HUVA 3BPOB 4R96A 3TM6A 5HHQB 1YEDB 4JKKA 1G6RA 1ZVYA 3HI6L 2BVYA 5I15H 3G9AB 2ZPKL 3QQ4A 3DLQR 1RUPL 2PYEA 3FHAA 3TH4T 4LQFH 3BQUC 1ZE3C 3KWWB 1K2DA 2GJ6E 1IBGH 2W38A 3S98A 3D0LA 4YHNB 1OAKH 2V9QA 2EYRB 4JFHE 3TA3A 1OW0C 4R7DA 4Z7UF 1Q9LA 2X4RA 2D7MA 4LF3A 3VI4F 5GGVL 1R6VA 4HIXL 3FRPA 3MGAA 1MRFH 5E08H 4OZFG 4LSTL 1GIGL 1AGDB 5A2IH 5LKNA 2YRZA 1UKSA 3JV0A 1P4BH 3PJSB 3L5JA 3TN0D 1OTTD 5EBWA 5C3TA 1IGYB 4UV4L 1ZHBB 1I1RA 1ZT7A 4NBYB 4U1KB 5BVJA 5H2BB 4L8CA 4W81A 4O5LL 3WIFB 1RZFH 1OTSD 5K33A 4J3VA 2V7NB 2WUCL 1YEEL 4HIIB 4QTHB 1FZMA 4Z7UE 2DI8A 1GC1H 3GSXA 3RWGA 5DJDB 3P30L 1FAIL 1G7LB 2PO6D 4GXUN 1CFBA 3FT3A 2ZSVB 4MD0B 4YGVA 4Y0GA 3B4NA 4HT1L 4GBXD 1D6EB 4XBGB 2OI9B 3T09A 1MJ8H 1D9KA 4KTEH 4AK1A 1E27A 2HJFB 2YUVA 4BUGA 4ODHH 3HZVA 3CCHA 1A14L 2YEZB 1S5HB 3CZFA 4EZMA 2NZ9D 1HHIB 3ULVF 3C6LA 5EU5B 1OPGL 5KZCB 3GI8H 5I16B 5JHDD 2NZIA 3EJZD 1T7ZA 3MCKA 3PWUA 1OB1A 3GSUA 3MRRA 5F9OL 3D3VE 3G5XB 4PJ5A 3HC4H 4ALAH 3C5SA 4H1LA 1VGEL 5JOEA 3SDXB 2VLRA 3HE7C 1G6RH 1FZJB 4N8VB 2XWBA 3MLZH 2LAGB 2VR9A 2DWDA 4QHKJ 2BHUA 1F97A 1BBDL 4D3CL 2ZOKA 2DMBA 1PW3A 1AR1D 5GRVL 2DWEA 2VAAA 5FUOL 3VXUE 3WXWL 3HS0A 3ULUL 1KBGL 4DK6A 1U3HB 1R3KB 1JTOA 5FGCB 3U4EB 2XQYK 5IFJA 3HPLB 3W0WD 3RKDC 5C09D 3G08B 4M1DL 4GO6B 3PE9A 1UKTA 2VZVA 5D93B 4MJ4A 2WM0A 4POZD 3FCTB 5E00A 4UTBL 1RIHL 2DDQH 4WFFD 3P4MA 1UZ6E 2ZZUT 3U6RA 4HDIA 1C7SA 1PKQA 1QA9B 2IQAB 1RJYA 5DK0A 2X9WA 4PBWD 4ZOAA 4ZUUA 3IJSA 3LN5B 4M7LT 4JZOA 3GSRB 5GGSB 4WU5B 5HYJA 2E5EA 1AFVL 2OR7A 1XZ0A 1W0WA 5EULV 1PG7H 4ZAKB 4ZTPL 4GUPB 2IMMA 4Y16C 3ZYOA 3VD9A 4QY8B 4N9GB 1K2DB 4HKXA 5GGQL 3D0LB 4AEFA 2NY7H 1IEAB 4JQXC 1AO7B 5D7KE 5CSGA 3UBXG 5MENA 3MLYL 1IE5A 4YNYA 4RGNB 4HJ0C 4X6CA 4JHBA 3BKMH 3RUGA 1CQYA 4UNUA 3QDMA 4H20L 2AXGB 5C8JA 2GT9A 4QCIA 1ZT4B 4R97B 2D3VA 5EBWB 1BQHB 2QHRH 2IQ9H 2V7HA 1WT5C 1MCPH 4FFVD 2EIEA 1NCTA 4BKLA 2PXYC 1F3JA 2FX9L 5GRJL 1KCSL 3UP1A 1TQBC 1GRWA 2AJSL 1CICC 1BWWA 3CVHA 3GSXB 3TESA 4PY8J 3RI5F 2FCBA 3BO8A 3BISA 2B2XH 5SWSD 4WW2F 1BGXH 1DQML 2H1PL 1S7VA 3D39B 1F3RB 4D0CA 5F88A 5I1HL 1XGTA 4HIEA 5F9JB 4LEOA 1T6WA 4N1CA 1FNSL 1JN6B 4M93B 2A74B 1EO8H 3CZFB 5TE4H 3TCLA 2XZAH 4IDJL 2OXGA 3H3KA 2E27H 2YD3A 4Z6AT 1TJGH 4XXCA 5CZVH 2YS4A 4JR9H 5L88L 1UA6L 3PWJB 3MCKB 3PWUB 4U0RC 1MFBH 3PHOB 2HKHL 4PJ5B 2VXTH 1NC4B 1MAKA 1M7XA 4L9LC 3RZWA 1GAFL 2BSSB 2VLRB 3L3KA 1HXYA 1OLLA 2E9JA 1L9MA 3KYAA 3CX2A 3VG9C 4YAQA 5DMKA 4U31A 5F7HA 4JN2B 3TZVD 1S7XB 4KUCD 3S97C 2GJZA 5E8PA 3UTPE 4MLIA 4WTXA 4G9FA 1TZHA 3F6IA 1DCLA 4G3YL 2Z9TA 1GGIH 5DGRA 2Q7YB 3N85H 2PCPB 3EHBC 4K3EH 2F54E 4MA8L 1LO3H 4GW4B 1MIML 4P5TC 4MQSB 4CU6A 1SEBA 3OKOB 3CSYA 4N0UE 4BFGA 4ELMF 4KJQD 1LE5B 4KPHL 3T0EC 5E00B 2WLYA 1TVHA 1DL7L 3V6BR 1U8KB 5C08B 4UZGA 4W6YB 3P4MB 5I8KL 5ITBH 4YH6A 1CBVH 4KKNA 3GSNA 4UI2A 3LZFL 4HDIB 4HKJA 3NIFF 4YPJA 5KSVA 1WV7T 1DE4A 1RUKH 4I4WB 3LMJL 4CDGC 5EIVA 3IFPA 2N1KA 4JZOB 1JPST 4AEHH 3QDGB 4ZUSA 1AXSA 4LHUD 5EOCJ 2AV1A 4X7FC 4ELME 2FX7H 1OY3B 1IC4H 2B4CC 3HMWL 1FBIL 5I1GL 4DGYL 2X1WL 3O8XC 4PBXA 4S1RH 4QLRA 4HKXB 3PDOA 1N8ZB 3ARFC 5CWSA 3GSOA 2A9ML 3BD3A 1J0HA 5C0AA 3NIFE 3IRZA 4HJJH 4EOWL 2AK4D 3T2OA 4PB9H 5TE7L 4MB3A 4X6CB 3FT4A 3R06A 4Y8AA 3MC0A 4KROC 3C5ZB 3FB6A 4ISVA 3ZSTA 3J7HA 3BXNA 3AS1A 3K74B 4NZDA 2UY6A 1K5NA 4MLSA 5HYQA 3DX8B 4D9QE 5D8JH 2V7HB 3KDMB 4JVPA 5TE6L 5EU7E 5I74B 4JKPH 4KH2A 4GLRI 3SQBA 3FRPG 4NBXB 5L2JB 3BHBB 2XFXA 4NO0A 1QLRA 1UB6A 4ZUTA 1LO2H 1P6FA 2JB6B 4X80H 1UXSA 4PFEA 1WFUA 4TVPL 3IGAA 1S7VB 2XRAH 2B39A 4PV9B 1M1SA 1XGRB 1BQHG 1N5AA 1U42A 4NOBA 1XGTB 4LEOB 4LLMB 2YD9A 4DAGH 5ELIA 4MAYA 1E6JH 3DGGB 4J3UA 5J3HD 4X6FA 4OGYH 1Q9OA 1BJ1H 3SDAB 1B2WL 1OAUH 3IJYA 4QXTB 2CDGA 5JIPA 5HHNA 2Q86B 3KXFD 2COQA 3RWDB 4Y1AD 4M8QA 3V5DA 2Z91B 4JFPB 5L2KB 5ABDE 5FKAA 4GRLB 4OB5H 4PRPA 2Q8AL 3H7BA 1I7UB 1J86A 1L9NA 3JV6A 2VXVH 4F7PA 4KY1L 2Z8SA 1QVOB 3PQYE 2GJZB 2I9LA 2WWMD 2XICA 1RHHB 1CDJA 4HXAH 4G9FB 4PG2C 5FHAL 5IVXB 4UV7L 4LCCC 5C0RL 1V3MA 3HPJB 4MJIA 4Q9QL 4WNQA 4CKVX 1ZHNB 1G7JB 4PJDE 1INEH 3BDXA 3FQRA 3N1FC 1PX3A 4LIQH 5ESAA 1V5JA 5H94B 4B53A 5TFSL 2BOCB 4K7PX 1J8HA 5I1DA 4RFOH 3SKNA 3CC5A 1F3DH 3D85A 4KMTL 4F3FB 1KB9J 4OKDA 1RK0A 1RZJC 2WSKA 4M4RA 3SGJA 1Q94B 1AE6L 1DE4B 4KQ3L 4YXKH 4OTXH 4ETQA 4HUWB 4OZIF 4YPGA 3G6DL 3MOAH 3IFPB 3T2QA 3FONA 1CGVA 3DVNB 4ZUSB 1AXSB 5ESQB 5JNYA 1FE8H 2FB4L 4P2YA 3JUZA 5FUZL 4G5ZL 1OAYH 3IT8D 3OKNB 2HFEB 1IKNC 5EUOB 1DUZA 2BCKB 1X6NA 1IAOB 2H32B 3MR9A 2VLJE 3LRSA 2J5LC 3DROA 5KVEL 2P5WA 2HTLC 4JFXA 4S11A 1LNUA 4PRID 5C0AB 5CJOL 2OTUB 3QJHA 1JVKA 3INUL 5EFIA 4YHOL 1PZ5B 2O5XH 3FT4B 3TV3H 4WWKD 2C1PB 3R06B 4FTVB 4OZIE 3U9PL 1DQTA 2AXFB 2GHWB 3WNPA 2NW2B 1LE9B 1I9JL 3DECA 12E8L 3WO4C 2Y4SA 3V5KA 1RZ8B 5FDWA 1K5NB 1YECH 3W11C 4NM4H 4Z78A 5DK2A 4M6AA 3TJEH 3LQAL 5GISL 5F9OH 1V8HA 25C8H 3QO1A 4J6RL 2PN5A 1VGEH 4NZUL 4HUUB 3GNMH 1QLRB 4H0IA 1KYOJ 3EO9L 4LNRA 4NQTA 5CGTA 1UXSB 1VGKB 4OD3L 3IGAB 2RHEA 4XZUA 4L8SC 4AT6A 4GAYB 2MPAH 5FDYA 1CZ8H 4Y19D 1N5AB 2JJSA 1T03H 3TC9A 2FSEA 5D71L 5GGTL 2FX8H 5CUSL 2DQTL 4F37F 4XPFL 4MAYB 2X4PA 4DUXA 5C0BB 2ICEA 4X6FB 4WTZA 3RX5A 4CN4A 3V4UH 3VWKD 1WWAX 3IJYB 4QRQB 5EZIH 5L9DH 1NBQA 4HUMB 4WV1A 5DURB 4TUJB 5CZXD 4HCRA 3CX5J 5FKAB 1S9WA 3EO0B 4PRPB 3MV8B 4PYGA 3L5WA 3RDTB 3RJDA 4N68A 6FABL 1TQCB 3OAZH 3DX9A 3HAEA 2L7UA 4R3SB 1AP2A 5LGHL 1KPVA 4I2XE 4ZXBB 5I30H 5DMJB 3ARBD 4WI8A 3CDYA 3ZO0A 4DZBB 3KPLA 3QDJA 3AC0A 3P4LA 4P2OB 4NNPL 4PJBF 1N64L 1AFVH 3QO0A 4QGTA 2X9XA 2Y6SD 3CJJA 3WLWD 4C57C 1IL1A 3RWEB 4HG4K 3DURB 4FQXD 4DEPC 5ESAB 1V7ML 4HFWA 5E6ZA 3FN9A 1J8HB 5T1LB 3WO3B 4R0LA 3UJJL 1GOHA 1YUHB 1VADB 3T3ME 2FIRT 1WGOA 1Y0LA 4J3XA 1A3RH 3VFSB 1FAKT 2W9LA 4OGXL 3C9NA 3DRTA 4OI9A 5GGRY 4KQ4H 1XGQB 5HYFA 1FH5H 2DTSA 4PJBE 1JZ6A 1L7IL 3EYVA 3VGAB 2MCPH 4HF5L 2D03H 2AABL 1OP3K 1KTDA 2EXWD 1GGUA 2VABA 2VDLH 4YC2B 5F8RC 5JNYB 4XTRC 1FG9C 2HVJA 5INDA 3NH7L 4MVBD 4B41A 3A67L 1E4KA 1HDMA 3N0PB 4LVOC 4BM7A 4Q6YA 4NN5C 1DUZB 5CKGA 4GKNA 1IQWH 2BSRA 4NRXA 5ICZB 3JUYA 2XYCA 2XZQH 5T33H 3U46B 3DARA 1AGEA 3WIHA 4MNQA 5HI5D 1JNHA 3CVIH 4DVRL 4Y5XA 3QJHB 3JTTA 5M7QA 4ONHB 3U82B 3W0WE 4A2MA 4E41B 3ARQA 4S1SH 2VDML 3IDJA 2LAAA 2K3TA 5IWLA 3HNTH 1KC5H 2E7HA 2X1XR 2UUDH 3NZHH 4HCRH 1UQSA 4ERSL 5KJRH 1T4KA 1XIWB 1CGSH 1NLBL 5F6HI 5DWUL 2WQRA 3VXSB 4XWOD 5BV7H 1XGPB 1Q72L 5DK2B 4MYWB 4D2NA 4V1DA 4NQVA 2EDLA 2X89D 4ZD3L 3QO1B 3V4VL 5EOCL 3Q1SH 4LSUL 2GCYA 3MV9A 2LABA 4D9LH 4YFDB 4EN3C 1INDH 5FFLA 1KIUA 4NKQB 3PUCA 3MJ9L 3B2UC 4XZUB 1EAJA 3JZ7A 1U92B 2Q3ZA 4HUXA 4ZTOH 3HR5A 5TQ0L 4HPYL 4UT9L 2VKXA 3QRGH 4Y5VC 1DN0B 3IDIA 3ZMRA 4P46B 4P2QE 4RQQB 3B9KB 1KCKA 1WZ1L 1WBXB 3NCJH 5KZCD 1T04B 1YPZF 4JFEB 1LEGA 5TDOA 4WCYH 4W6WB 4RBPH 3LN4A 1YNKH 4OF5A 2D9QB 4P5MA 1FVEA 4YGAB 3ULVC 3MLWH 2SEBA 1S9WB 4PR5A 1NBVH 1YJDC 1J8KA 3DI2B 1KEML 2R69L 5F1NA 4Z7VA 5CMAA 5BV7B 2H2PC 3SJVA 4MXWH 3OF6D 3VFMA 2GW5A 3BMVA 4WFGD 4ONFH 2V17L 3A0OA 4DVBA 1QBBA 4XCFH 4LLQA 2RJMA 3ZTNH 4TRPH 4I0PA 1U3HD 2ZG2A 4QOKA 5GJSH 5BVPH 1RFDL 5EOTA 4MQ7A 3TBVA 4HWBL 4RFEA 4XVTH 3RAJL 5IGXH 1MHHA 2VJXA 2B7DT 5SWSE 3SDDA 2OTWA 4H25B 1IL1B 5C0JB 3H9ZA 4PTTB 1V3LA 2NLJA 5C3LD 4HFWB 3ALWA 3QQ9C 3WHE1 1WIUA 4R0LB 5GS0H 4OLZL 1CTOA 3MRLA 4X4MA 5LAXB 1RIVH 2FO1A 3ME0A 3UAJD 1WFTA 4LAQL 5DUBB 1BECA 1LEIB 4QHLB 3DRTB 3SGEH 5E24E 4P3CH 4XVJL 1OARL 2FD6H 5MHSD 3U48A 1FIEA 3EYVB 3C08L 3QIWB 1WCBA 4HWZA 3DPBA 4TYUA 4ZAKD 5ACZA 2VQUA 2RCSH 3PP4L 3SDCB 3T4AA 1YYMH 3MOBL 4QHNA 1NDMA 1HDMB 5HHMB 3L3GA 4BSJA 3LKRB 1AO7D 4GKNB 3O9WA 1BOGA 3JSSA 2QQLL 5GSRB 4NRXB 4CN6A 1CN4A 1FYTE 2IG2L 2JJVA 4G43A 4RGND 1EUUA 3MRJA 5AZEL 1SVCP 3F5WA 4FQ2H 4Y4KA 5HBBA 4G7VL 5GXBB 3ABZA 5I66B 3UO1H 5D7LB 2C7UB 3TYGL 1EHLL 5C0NC 1XF1A 1G9NC 3UTTB 3EZJB 1KJ2L 1QSEA 3PABA 3VRLF 1A1NA 3H9HB 1XCQA 4KKLC 4K8RD 1W0YT 4KK5D 1ZEAH 4LVNB 2ADGA 2P8LA 4PRNB 3KPRA 2J1KA 5KSBA 3LN9A 1J1PL 3D39D 2GK2A 3K0WA 1J18A 2VL5A 2DB8A 4UAOC 3QXTA 4MQXD 4PJEE 4L8BB 2BNRA 2QLVB 1A1OB 4HUXB 3T8XA 2A83B 3HR5B 3CFDB 1YEGH 3OTTA 4WW2C 4LQ1A 5SWZA 1A1MA 5C0RH 5F96L 4WY7H 1UCBL 4ODTL 5DJ0A 4DQOH 2JELL 5T1MA 3VRLE 4ZYKA 4LCWB 3H3PH 3TWCH 3WMSA 1YMHA 1JUFB 1LEGB 5JOFA 2QADB 4K71B 4WGVB 1NC4D 3RVUD 2YPKB 1MOEA 4JM4H 5A40E 2VLRD 4KJYB 3W9DA 5HD8C 4URTB 5CSZB 3V95A 2EO1A 4JDTH 1UADC 3AREB 3K2MC 2RBLA 3QUXA 1MHPL 3WHXA 1NLDL 3QFJB 3QEUB 4NKOA 3UJTH 3BDYL 4X8XA 2JK5A 3VFMB 1K9TA 5B38A 3O11B 3MYZA 3BZEB 3SKOA 4LLQB 3WS6C 2W65A 5DO2D 3TFKC 4GG6F 3MFFA 4LK4A 3TBVB 2DTML 4RFEB 4KTDL 1BFOA 5JR1H 1GGBH 3F7YB 4R8WH 1P5UA 5LQBL 2BNQE 3WE6B 3BPNC 1TETH 2KBGA 4WU7A 5C08D 4NHCH 1MFDH 2YPLB 4TSBL 4EBQH 1MCLA 2D7TL 1JWUA 3MRLB 1KIRA 1T7YA 2X1PA 3ARGA 3GI9H 5CJOH 5I0ZA 1N5YL 4MB4A 4NQXA 4MS8D 5EC2B 3SE3C 2P8PA 4GG6E 5IKCB 1FCGA 3QPQD 3QHFH 1GGCH 3O6LH 2YUXA 3QDGD 2AP2A 4O51A 5IROA 1HH6A 2W92A 4HWZB 4YR6B 1YN7A 2R0KH 4QKXB 3T0AA 4ODBD 3O6FA 5FA3B 4OGZA 3BZ4A 2WNGA 4QHNB 4WI7A 2NYYC 3MXVH 5IW3A 2NY6B 2YA0A 1NDMB 2D2OA 1B6UA 2ZCHH 2ZJSL 5IIEB 3SCMB 2PKDA 5FYLE 1M05A 1T1XA 3LEXA 4G43B 4TTDD 3BQUA 1CLZL 1ZLSH 4HEME 4OM0L 5GS1B 3RBGA 3SGDI 5IQ7H 5EU7C 4YIQA 3C5ZD 1EJ6A 4U4BA 4ENED 4JZNB 2OQJA 1OW0A 1PG7W 2DQTH 5A2LH 3ZKND 1UFUA 2XTLA 3S8WA 1KEGL 1U8MB 1N3NA 2OJZL 1H9VA 4NO5B 1IGMH 3FAXA 3CLEL 5LG1A 3LSOB 1D5MA 2FLBT 1Z6JT 2FATH 4MAUL 3O81A 3MNZB 2J6EA 2ZOLA 3W2DH 4BFEA 4KZEH 4IOFD 4XPHL 1MJ7L 2FNBA 3AS2A 4XWGL 1FNLA 4YO0B 3MUZ1 4IRSC 3EYFB 3MLSL 4WEBH 5JZ7D 2PW2B 4C4KO 4M43H 4X7SL 1NMAL 5KSBB 1DN2A 5JTWA 4IOSD 4XPAL 1JIBA 1HHGB 4EEEA 3MNWA 1X5XA 4XGZA 4UIKH 4U49A 5E9DE 1WWBX 3JWOC 4U1SA 4U1GB 5FGRA 2BNUA 2BNRB 3X3FL 5DJ8B 5EO9A 3RY6C 1KACB 2F19L 2Q20A 4P4KC 1U8OA 3SDAD 3PGFH 5ISZA 2G75B 5SWZB 1A1MB 2ESVA 2NMSA 4NP4L 3CFCH 4FP8H 1GPOH 1QFWM 2MQ3A 1I9RH 5AYQA 2P44B 2CDEB 1MHCA 1YMHB 3TBYB 1T21A 4XP4L 2DQIL 3VXRE 2CLZA 5L2KD 1B0GB 3C09C 1CG9A 4GRLD 1PVHA 1KXQE 4F7EB 4H26A 4C56B 5JHLL 3HRPA 4E9LA 4PLJC 4L3ED 2VUYA 1NBZB 5DD6B 5CLTA 2JK5B 1QFOA 1AI1L 5J1TC 4ZPTA 5DDHA 1L7IH 3VGHA 4G9FD 4R4NC 5B38B 3SKOB 1BM3L 2W65B 4NRYA 3TT1L 1N6QL 4OCXH 2DOCA 2YPVH 3GSVA 4XNMB 3IXTA 3WIIL 3CD4A 1LP9E 3S5LB 2G2RB 1CCZA 1KULA 3PWPA 1FV1B 3F58H 4PJAA 3MTRA 3VH8A 2I5YH 2HMID 4Y19E 3AMKA 3NBNA 1TENA 5L7XL 4NUJB 1KTLB 3EYUL 5DR5H 4ODUB 1QEWB 4GQ9L 4KFZC 3IVKB 4ZFOL 3FZUC 5D1ZC 1FNGA 4NKIL 3IAGC 1B4RA 2EDQA 3NABH 4N0YL 2NY0B 4XCEA 3E6FB 1BVZA 5FGBC 2NW3B 1PY4A 3U4BH 1UJTA 2VQ1B 5CJQH 2X4NB 4WDIB 1MEXL 1NLBH 4G6JH 5D7IE 1E4JA 4JQVC 4XPGH 1TNNA 5KS9A 2VDOL 2VSDA 4YHZH 3LKOA 1QD0A 4K3JL 4LCIH 3LD8C 4H88H 3E6HA 3IDXH 1J1OH 4WHDA 2E6QA 5TH2A 1F8TH 2R56L 4AG4H 2FO4B 5E6IC 1R0AH 5C0AD 2EDRA 4Y16A 3V52H 3BQUB 4OFDA 3MRBA 4FTVD 4JRYA 4Y4HC 3H9SB 4YIQB 3ROOA 4AEIH 5C07A 2UZYB 4JQXA 4G6AC 3DV6B 1IM9A 3QUZC 5FUCE 4ACPA 1VEPA 2H8PB 2JCCA 2Y5TB 4QHMA 3EDJA 1VSCA 4QRRE 5A2KH 3RWFA 3L95A 3P9MA 4P59H 1FDLL 2EC8A 2FBJH 3G9VA 1M6OA 2WLZA 3SPVB 1XH3B 5HDQL 3MRKA 3DV4A 3L3HA 2FJFA 2JB5L 1RV6X 3M17A 1F6FB 4UQ2B 2A0LD 3DOSA 4LLAA 4PJHF 1WT5A 1DQJA 2O61B 1Z5LA 2PXYA 1U3YA 4PRHB 3MNWB 4LP5A 5DI8A 3QFDA 3FO0L 4F15C 5D5MF 3TIDA 3KPTA 1XF4A 1CICA 4HBCH 4N8CL 2BNUB 4BQCA 3T1FA 1TTFA 3FN3A 4GAJH 4MAYD 1W2KT 5C0BD 4OZGA 1RFDH 2XKUA 3TN0C 5C70A 4WUKH 1KGCE 3LRHA 5EU3A 2VZUA 5DFWH 3B9VA 3RGVD 4LDLB 5DQ9A 5I73B 3FB7B 3OJ2C 5KVFH 4FMKA 4YX2H 1MI5B 3F12A 4YHIA 4PJHE 4XMKH 3EAKA 4JPIB 4PRPD 3MV8D 3IYLW 2PO6C 3RDTD 5D5ME 2OZ4A 2FRGP 2R1YA 2VDQH 4LSVH 2WBJB 4HGWB 2KH2B 4AY0A 2AJZB 4IIQB 4X6DA 1MJUH 1U95B 2DLGA 32C2A 4ZXBD 5I1LA 1PKOA 4L9LA 1JZ7A 3HE7B 1CD1A 4P2OD 4KDWA 3Q3GB 4LLWA 1QRNA 1YDPA 4XPBH 2PR4H 3OKYA 3SDXF 2NZ9C 3GSVB 3IXTB 3O2DL 4FFZL 5EBMA 1VESA 1RURH 1F4YH 2PW1B 4KDTC 4HLZH 1KLGB 1J9CT 1NCDL 2YOCA 5IFHH 4B0MM 3IETA 4J8RA 1J8HD 1DLHA 5T1LD 4OCRL 3EYSH 5F1IB 2QEJA 4Z7NF 2FJHB 4PJFF 5CEZH 4P5TA 1K8IB 4GMSH 1EAPA 5B38G 1AQKL 3HG1B 3RA7L 4IDLA 4ODXB 3BWUC 5GZNC 1KPUA 3FO9A 4EXKA 2BVQA 2A6JB 3T0EA 3C8HA 1MCNA 3QNZA 3S5LG 1AR1C 1MPAL 3OKMA 3FN0H 4DZ8B 1BVLA 3FRUA 5B21A 4ONGH 2X9YA 5TF1H 2VRAA 3GMPA 3P2TA 4QRTB 4ZUWB 4NKMB 5KS9B 4M6ML 2Q76A 3X11A 4OLXH 4W4NA 1IAIH 4Z7NE 4PJFE 2DQDH 4OUUB 2AJXL 3LB6D 1DBJL 2E6PA 1AD9A 3U2SB 1I3RA 1KN4L 5EU4A 3Q0HA 4UDUA 4WHCA 1WVZA 3R1GL 3U1SL 1WBZA 4Y16B 5HYSA 3O8XA 1IT9L 2EDHA 4E41D 2J3SA 3MRDA 3MRBB 2H41A 4GS7C 5JPMB 1T0NB 3ROOB 3DUUB 4H8WC 4RDQG 2CLRA 3O4LA 3ARFA 3V7AG 3HC3L 1NC2B 4LHJB 1XIWD 2A9NL 4MJ5A 3MA9H 1OGAA 4TUKL 3LS4L 4HXBH 4G6ML 3VXSD 2OZ4H 2B8OT 2O93L 4RNRB 2QQNH 3KYOA 3QI9C 1OM3L 4NNYA 2AK1L 2I24N 1UJ3B 2I25N 1XGYH 5MHSE 4L4TA 3BKCL 5I1CL 1UXWA 4PS4L 1AJ7H 3O3BA 5GHWH 1Z5LB 5ANME 1IQDB 5FXCH 3BDYH 3QCTH 1KJ2B 4LKXB 3V5HB 5E2TL 1MJJA 4X83A 3TIDB 2IANA 3EDEA 4WUUA 4L1DA 2WINB 1AXTH 4P46D 2WWKO 2G60H 4TUOB 2OYPA 3UTZA 3B9KD 1QP1A 3C6SA 5CIPH 5JXAH 2P42B 2H45A 1NL0H 3SE8H 3BGFB 3HN3A 5IM7A 4JFED 5E99L 1P7QA 5DQ9B 1RULL 4FFVC 3L5XL 5I2IB 4FNLL 1Q9KB 5J6GB 5IMMA 1BJMA 1G9EA 3K46A 4YHIB 5BJTA 1VFAB 3T0VA 3X13A 1A7NL 1H3WM 5AUMA 2D7TH 2DKMA 3H0TB 2MHAA 1RUMH 1LK3L 4K2UH 5DRNB 1VEOA 5BS0E 3KJ4C 4X6DB 3G04A 2B1AL 1O0VA 1MNUL 4NC1C 4YZFF 3I6KA 3OR6A 1QRNB 1YDPB 3FO1A 2B4CH 4PJ7F 1KNOB 1T6VN 3D39E 5MP6L 1OTUD 5KSAB 5EBMB 5GSVA 3QUYB 4J8RB 4PG2A 3DI3B 4LCCA 2ZJSH 1EDQA 1JGVH 1TJIL 4P5TB 4S1DD 4BFBD 2DBLL 5CIPB 1UM6H 1NCBL 4YZFE 2BVQB 2GSIA 1RK1A 3TZVC 4OGAD 3T0EB 2FWOA 2GTWB 1N26A 4YUEH 3QIWD 4GRMA 1W8NA 4XNXL 4PJ7E 3FRUB 5IB3B 3GUTB 3S88H 1ZHKB 1ACZA 2ZUVA 4AJ0A 3GMMB 2CJUL 3T77B 4JO1L 1I85C 3SDCD 3PHSA 1EH9A 5FCUL 4U1MB 3VXNA 4XMPL 5BW7C 1PLGL 4DOHE 5HHMD 3X11B 1QLFA 4PY7A 1S8DA 4CMHB 1U8LB 3NFNB 4KJQC 2OSLA 4FXKA 4G8IA 1VACB 3N9GL 3HZYA 3OB0K 1XGUA 2CLVB 4UDUB 4Y2DC 4PG9B 2ZUSA 1MAML 1IKNA 1UB5A 3X3GH 3X3FH 1A4JA 3MRDB 3RY4A 1I8KB 4RISL 2QQKL 3LHPL 1S7SA 5DA0B 3P0VL 2CLRB 3O4LB 5D7LD 3BKJL 4GKZB 3BIKB 4I13B 3WIHL 4WGWB 3QNYB 5DUML 3UTTD 2XTJD 2W0PA 4M61B 5AYUL 3CUPB 1X7QB 1AR2A 4KROB 4XP4H 3BP7A 2VDKH 2O26U 3RBSA 4JG1L 4FS0A 3KPQB 4JPWH 3GRWA 4OLVL 4JFDB 4KZDH 3MYJB 4L4TB 4JFQA 1SJHA 1T1ZB 4HLZG 2EE2A 4JRXB 4JLRA 2QSTA 5T3XH 8FABA 3ZSSA 5K9QI 3OXRA 4HWUA 5HPOA 3MLVH 1NCCH 4IRJB 2EIZB 5D2LA 1QBLL 2NY1B 5JQ6L 1CE1L 3UTZB 2BJMH 1KCUL 1LQSR 4RAUA 4TVPD 5D2NB 4N5UA 4L8SA 3QR2A 4LCWD 1RUQL 5DT1H 4YDKL 3TJHD 1IC7H 1EERB 5J8OA 4CRPA 3OPZL 2QADD 5TF0A 3E2HC 3P73A 2CIIB 1AQDA 4LGPB 1WEJH 4MCZB 4QO1A 2B0SH 5DMGD 3ARED 1CDGA 4I3RL 5AUMB 5EZLA 4X0KB 5BOZG 2HH0H 1RZJH 3QFJD 3RNQB 3MRHB 4MD4A 4F37K 1SMAA 3SN6N 3TBTA 3S4SB 3CPLA 4JY5H 2Q1EA 2CGRH 3CLFH 1M71A 1MEXH 2C3VA 1HKLL 4RX4D 1HQRB 1KCLA 3DYOA 5IB1A 1GZQA 3M8OH 1E28B 2WUBL 1GZPA 1G6VK 4NPYB 4LSSH 5FK9A 3UZEA 4LCCB 4PJCF 5T5NF 2YPLD 3TNNA 2A2QT 4J3TA 5IVXF 1S9YA 3AROA 3VG0H 3MNVA 2AEIT 3KYKH 3I9GH 2IPUG 3IDNB 1BLNA 4JY6A 3FHQA 5CINH 3GRWH 1KJ3L 5IR1A 4RAVA 2Z8VC 3O3EA 4C4KT 1NMCC 2VDPH 1YY9C 3BKYL 4ZFOB 5CCKH 3C60B 5CAYB 1FORH 3FQTB 5GGRB 3IXAA 2Q7NA 4L3EE 2GJ6A 4ZO8A 3VXNB 3AY4C 1ZSDA 2NY6D 4PJCE 4IM8A 4QWWD 4XVUD 3LS5H 3SCMD 5E8DH 3L7FA 2BRRL 2FR4A 1K8DA 4G8IB 1FP5A 4Y89A 2UYLB 1CXIA 2UWEF 5IESL 3EJYD 3QA3A 2HT4D 1ZLWK 4R4FH 2HFGL 2P4AB 1H3PL 1CFTB 4MNGE 3WKML 1CR9L 4NT6A 1DBAH 3AXLA 3OKDB 3EYOA 3CFKA 2P1YA 3RU8L 1U93A 1JI1A 2J5LB 5EUOF 2EZ0D 2CRMA 4F9PC 5GRZA 5IBLD 2OCFD 4M6OL 5DFVD 4POYA 2CIKB 4Z7UA 2ZCKH 4XNUH 2UZIL 4M3KB 1G7QB 1IAMA 5J1AA 1ZLUH 2H26A 2UWEE 4OFPA 3WO4B 1GJIA 3BE1H 2XWTA 5INCA 1SJHB 1J5OH 5IEHA 2AJUH 4IMLB 2YSSA 4I1NB 3SQOH 5A3ID 2BNRD 3RVWD 1Q0YL 2A77L 1KCVL 1HXMB 5FGSA 1J87A 5SWZD 4EN3A 1I1AC 1DFBH 5KN5B 5HPMA 2P45B 3QISA 4OLUL 4XAWL 4U1NA 4GQPH 4HG4J 3VCLB 4Y5VA 5K93A 3QCVL 2AEWA 4I48A 3S37L 4PJXB 4C56D 5FAAA 1T1WB 1A7OH 3WL9A 5EZLB 1NMBH 4DGIH 3U0TB 1BQSA 5TGBB 1MPAH 3CPLB 1A9BA 1FZKB 5H37H 3DO7A 4M9OA 1UM4L 2C3VB 4Z77A 4I77L 2DN7A 2AI0H 2OK0L 3MJ6A 4XMLL 5EPMB 5C0FB 1JTPA 3VWKC 3WN5A 3VXPA 2ERJC 3K81A 3P4OA 5JOPD 4KUZL 4JO3H 3T2PA 3BT2H 1YMME 5KVGH 2FGZA 1KN4H 1ZT1A 3QUML 3TNNB 3BRGC 1N0XH 5J89A 1QR1A 4KXZI 4FFWD 1EO5A 1AHWB 1J05B 2VE6A 3ULSB 3VE0B 4LLVA 2NY0D 5T1KA 3Q6GH 2DLFL 4JY6B 3ARSA 1RIUL 4JM2F 3ARBC 4TUKH 4G80A 3EBAA 3ULUF 5I76B 5BZWB 1T2QL 5HGAA 3D0VA 4U1JA 2CK0L 1HSBA 4TNVK 2GJ6B 3WLWC 1IGJA 4FQXC 5FUCC 3EDFA 5KANG 3GJEB 1K8DB 2DQJH 3O6ML 2X4UB 1J0IA 4XNQA 5SX4I 3BQUD 2HKFL 4G8FB 1KB5A 2NY3B 2APVA 3H9SD 4NN5B 4YDIL 4O4YH 5C1MB 4X98A 3FFCE 3ULUE 3BPOC 3HKFA 3WFZA 3WEXB 4YQXL 4ZFZB 2HN7B 1FCCA 2ADFH 1BZ9B 5F44A 2EXWC 2R29L 2F53A 5EZOL 4EUPH 4I0KA 2BVTA 2B5IB 2X1OA 1TJHL 4NSKA 3BH9B 4NZTL 4UINL 1UACL 5DS8B 5DRWB 4RGOH 1CFNA 2VSCA 3WDHA 1YJDH 2QKIA 3RX8A 1WQVT 3GKWH 3STLB 1T89C 4PRHD 3WUWB 2J6EL 4PRAA 4LLUA 3WDJA 3C8KA 2PF6A 4NO3A 5HI5C 1VFOA 3LPFA 3A6CL 3U36A 5HGHB 4OF7A 3HZMB 3P0YH 2ICWA 5J0BA 1ZK9A 1J12A 3MA7A 4LSDA 4EN3B 1LO5A 3IU4H 1ZWIA 2CUMA 3FQWA 5D7JC 1FGNH 1NFIA 4XWOC 4U1NB 3D3VB 1KN2L 1MI5D 4R90L 5I1KL 4E41E 3SKMA 4XC1H 1BFVL 4WW2A 3U83A 3W9EA 4YHML 3GMRB 2C26A 2NTSP 1DBBH 1A7RL 1QHPA 1TVBB 1ZA6B 2NY4C 3GK8H 2IPTL 2WBJD 4ZS7L 2YK1H 3S3JA 2CKBA 2OI9C 4EUPB 4YXLH 1REIA 5B22A 3BEVA 3VXUB 4JFOA 3ILPA 3HE7D 4EVNA 1AD0A 3IDGA 1BQLL 2BMKB 2F54A 4QRSA 3OG6B 3OJMB 1J7VR 2OX5A 3EUUA 2HG5A 4XP1L 1GHFH 1P9MC 4N0UA 1Y6MR 1KB5H 3RWIA 5KAQG 1YEIL 3WDIA 4MNHA 3VXPB 1F6LL 4JZJB 1IFHH 2PTTA 3WS6A 1G7PA 5C0IB 4F8TA 4QHUA 5CD3A 1YEHL 1ZA3B 2Y7QA 2HJKB 2KZ1B 1ZT1B 1JHLH 5IUSA 3HG1D 1TZIA 2ZSWA 3RPKA 2IJ0C 4BZ2L 3MRGB 2VZTA 1QFHA 4P2RA 1R3JA 3N06B 1WBYA 4FZ8H 2MOVA 1GC1C 3EO1B 4JQIL 2ED7A 3MV7A 1SM3H 1A02N 1G9NH 3QG6A 4G80B 4YFLF 3RGHA 4ELMA 4NJ9H 5C6TH 5EU6E 3TF7C 3SE3A 3P77A 5GRUL 2E7LC 2XG5A 4HC1L 4Z5RB 3BIAX 4PJIF 1IGJB 1BX2A 4NYLB 5FYJL 3WUZA 3LIZH 4APQB 5DD3L 2VL4A 1CU4L 1UCTA 2WWKT 4ONOA 1BBJB 3CK0L 1IEBB 2AJYH 3QCUL 2AJ3A 5AZ2H 4Y16D 5I8OL 1RAMA 3FMGH 4AH2B 4HV8B 1ZOXA 4U1IB 4NN6C 3UAJC 3GBNL 1NC2D 2WQ8A 1ZTXH 4MCYA 5CEZD 1D5IL 3DTXB 5E2VL 2LV4A 1C1EH 1SBSL 4HJ0D 1Q0XH 3MUY1 1CL7H 3NCFB 1XFPA 4PRBA 5H37G 1MCOH 2CKBH 2R0WH 4PJIE 4BK4A 4ZAKC 1PJ9A 1IZJA 4JJHA 3VFUB 4OIIH 1R5IA 2OTPA 1HINL 1JGLL 2EH7H 4P57A 1N59A 1NBYB 3U0PA 1FFNA 4JO4H 3FTGA 2QKIB 5CILH 2V2XA 3RWHA 3MLRL 4KI1A 2J8UF 1FG2B 2R8SH 2APTA 4OD2B 2DM2A 1DDHA 1GYAA 1ZS8A 3P40A 4IRSA 4NO3B 2VMFA 1XR8B 1S5IL 3FOLA 1CK0L 2ZCLH 3MQIA 4JDZA 3OHXA 4JCMA 3BEWB 3G6AA 4KK8D 4R97C 3WFCH 3QNXA 1MRCL 1LO5B 2DF3A 4KC3B 4UAOB 1KIPA 5JMOC 1HILA 1GSMA 3QSKB 15C8H 3CGTA 3RY6A 1I1CA 1NFIB 3ARTA 3PDGA 5DLML 4P4KA 4K8RC 4WW2B 5F6IC 5DJ2B 4AQOA 4KK5C 2IAMB 2J8UE 4Z95H 1UYWL 3BZFB 1DLFH 1E6OL 5L8KB 2XTJE 2CKBB 2Y25A 2VXSL 4MX7B 3A6BH 4OCSH 5DVOA 4M6NL 4MQXC 1AY1H 3V2AR 3ILPB 2PETA 2F9BT 3MCG1 2FL5A 3VXMB 1NGWA 1AD0B 1QRND 3H8NA 2F54B 4AMKL 3M07A 3BN3B 5I8CB 3MUGA 4M93C 2YC1A 2VOTA 3GIZL 4JHAL 2IH3A 3RHWF 4N0UB 5KSAD 3S35L 4UDTA 3WFDH 3WSQH 3QUYD 5IMOA 2PTTB 4OCWH 5JUEL 2FHFA 3EHBD 3RVUC 4EUPG 4Z0XB 3PGDB 5CD3B 2VDNH 4P5TD 3SY0B 5GIRB 4Z9KB 3WFBL 5E5MB 1PSKL 3WJJC 5I1EL 4TVPE 1H3PH 5CEXA 1A0QL 1X6LA 1TZIB 3TT3H 3EFFA 2VH5H 4LCWE 4TULH 5MERA 4TQEH 3GMOA 2D9CA 1H3XA 3RU8H 4FQIL 3K4ZA 1I3GL 1W0VA 1DP0A 1R3JB 5D72H 3RIAF 3TPUA 4WI9A 2VN7A 4LRNH 5D1ZA 1E0OB 1EA9C 4ELMB 3WJLC 4JHWL 3V6ZA 5FGBA 2C1OA 3OAUL 3MRQA 2AXHA 2IADA 1JNLH 1BX2B 5KVDH 3K2UL 1WISA 1KTKE 1T22B 4NDMA 4JQVA 1RZKC 3BSZH 4FQJL 1SYSA 2EEDA 5DD5H 2KUTA 4NC0B 2F8XC 4ZPVA 1MF2H 4MS8C 3JWDL 4HKBA 2C3XA 1Z9OA 3O4LD 1N4XL 2CMRH 5E6IA 2IGFH 3QPQC 3MRIA 5GGSY 1JGDA 2YPLE 4OKVB 4NNXB 1VB9A 1YEJH 4NGHH 1TCRB 5K9JH 3BVNB 4Y4HA 2X4OA 4KROD 3QAZC 2P5EE 3DSFL 4WJ5A 1NAML 1U58A 2VISA 3QUZA 5ID1A 4M5ZH 4N0FA 3TIEA 4JFDD 3G6JB 4L4TD 4J3SA 4G8GE 1FFNB 3FTGB 4JRXD 1BOYA 2E7CA 1ORQA 4F7CB 2DD8H 1Q8MA 4TTDC 4DJMA 4IRJD 1S7UB 1WICA 2I9TA 5F3HA 5HDBF 1SMOA 3C5ZC 2NY1D 1A8JH 5ADPL 3B5TA 3OGCA 3ZKNC 4X9FA 3V6OE 2M26A 1MQKL 4NQDE 3DXAB 5IB5A 1KFAH 2VXQH 5IK3A 5ESVA 4P3DB 3HI1A 2YD7A 4WVRA 4IOFC 5I74C 5FEBA 4P9MH 3TN0A 3X17A 1CE6A 2GEEA 5JZ7C 4Q9RL 5H35A 4O2FA 2AGJL 4GKOA 1MWAL 1U91A 3WLBA 2YZ1A 4P49A 3BFOA 4OBRA 3KLSA 5HY9A 1ERNA 4OI8A 3PQYB 5HDBE 2ZUUA 2YUZA 5FO8A 1ND0A 3MGOB 1NGWB 2PO6A 3ARXA 3H6JA 3OJVC 4Z7QF 5DEFB 1RUAH 1CLYH 4NCC1 1MAJA 3L3JB 3AS3A 1U6AH 2NY5L 4PJDB 1C5BL 4GBXA 2EXYC 1CFSB 5FO9B 1T0MA 1JHKH 1JNJA 2FLRT 5E95B 4HX1B 3FJTA 4IHOA 3CFEA 4X6EB 3QWQB 5GGUB 1CT8B 3CFJA 1UM5L 5FOJA 1EUTA 4KDTA 1FFPB 4BZ1L 5JHDA 4S0TD 1W72A 5MERB 5TQ2L 2P24A 3AVEA 4Z7QE 4N90D 1W0VB 1CFVL 5CHNB 3S34H 1FL5A 3TPUB 1MCQA 2EEBA 2XACC 3QUMB 5D1ZB 3C60D 4J12A 1FRGH 3UPRA 4GMTH 2R2HA 4R7NB 4KJPD 1JPFA 3DYPA 2GITB 5F1KC 4ODWB 3OZ9L 3RL2A 5CEYA 4WEMB 2XQBH 2VLJB 3QXUA 3IFLL 2IADB 4ODVL 1WSST 3CSPA 3RVXD 2DQEH 5IW1B 3QJFA 1U0QA 3WCYA 3W0WA 5KG9B 5BO1H 5C09A 3G5YA 4U6VH 2OP4H 3LD8B 4OZIB 2BY0A 1X5FA 1HI6B 1FVCA 1LDSA 1QLEL 3SOBH 1JGUH 1S78C 1WF5A 2HWZH 5E6IB 1IKFH 1JFQH 1MFEH 2Q8BH 2ICWJ 2OJEB 1CD9B 4ZNCD 4BQ9A 2X4OB 2XA8H 4QXUH 3PXJA 1EBAA 1MH5A 4DN4L 5I19H 1S3KL 1QRKA 3EOBB 2YD6A 2PUQT 3QI9A 2BVEA 1YNLL 1S7QA 2BOBA 1FFOB 3HMXL 2AEQH 3SDYL 4F58H 4PREB 4MA3A 4TNWF 1XF2A 1MRDH 3NFPA 1IAIM 1XT5A 3JV4A 4GXVL 1Z3GL 4F15B 2LVEA 3I85A 3S96B 2VKWA 2DQCL 5K9KA 3BPCB 3H9SE 5IB4B 1LMKA 1LK2A 1IAKA 1YY8A 5DJAA 4X4YB 3TN0B 4XNYH 3P11L 4U6YA 3KR3L 4I18C 1JPGA 1J1XH 5D70H 4WW1A 5H35B 3GBLA 4JPVH 4LFHD 5J1SC 1WZLA 5HVFB 5HY9B 3LEYH 4I2XB 4AL8H 5DSCA 5I18L 1B4JH 1HSAA 4Y7MA 1KCRL 1ND0B 1OT1A 1YPZA 3WFHA 4ORGA 5SWSA 2NNAB 3B6SA 1F58H 1C5CH 3RGVC 1KG0B 2QR0A 4OF0A 1HHJB 4KVCL 3PIQA 3W5MA 3ZT7A 3MRMA 2EC9U 1BIIA 4R26L 3SE9L 1FL6A 4KV5E 1HQ4B 4HKZA 3CFJB 4JFZL 3WFEL 5FB8A 5EA0L 3RDTC 1NGZB 5FM4A 5FOBA 2EO9A 3L7EA 1TQCC 5EN2A 1NPUA 4H8WH 4YEEA 5C7XH 3VJ6B 3CFBB 4PJBB 4OIAA 2XXCB 3E3QE 4ZXBC 4NUGH 4M5YH 1KJMB 3QG7L 5E2VH 4A6YA 5HYIA 2OL3A 1X3DA 1BVKA 1JK8A 3UPRB 1Z9MA 1MHEB 2Y06H 2R2HB 3TZVA 2GJ6D 5B39A 4CJ1A 4MJ6A 5HGBA 1WAAF 3M1BB 4CDHA 4JFHD 4JM2C 3RL2B 3D6GA 1JGLH 3THMH 3NIDE 5AAMA 3ULUC 4OSUH 2Z35B 2E9WA 2GY7B 2AEPL 4XTRD 2YA2A 4LARH 5BW7A 1KELL 5DMYA 3QJFB 1A3LH 2NY3D 3W0WB 1JL8A 3G5YB 1BEYL 4K3GA 1S7TB 1NANI 4HJGA 3VDCA 1CFQA 4S1QL 3P4NB 3VGAC 5IBTH 1MRCH 4IS6B 4PLKD 3RL1B 3NACL 2EDBA 4JPKH 1WAAE 1ZVSA 5C86A 2VC2H 4KAQH 1JZ4A 2Q6WB 1GGYA 2L4OA 4OJFH 4MXQD 3VXOA 2KQNA 1F02I 4OFYD 1F90L 4QYOB 1FSKB 5FM5O 2GAZA 3B8YA 2L7JA 3GHBH 4I9WD 3I02A 5TDPA 2P8MB 2XKSA 1Z0MA 4QXGL 1I1FA 1ZGLB 5HHPB 3CAFA 1EFXA 4X9IA 5I17A 2O5ZH 3QI9B 1S7QB 3K8MA 4RIRA 3ES6A 1Z0NA 4MDIA 4P2QB 1SEQL 3TO4B 5IHUL 1D6VL 3REVA 1HZHL 5FM8A 2ATPA 5GGVY 2W60A 5KOVC 1CXLA 2AK4A 5DQDL 2XKNA 3D3VD 5C0CE 1R3LA 4XH2A 2XN9E 1LK2B 1N2RB 1HHHA 1IAKB 4YHPA 5DJAB 3B2VH 1WC7B 1EGJA 1F4WH 2OL3H 3ISWA 1FGVL 1AC0A 3VFGH 1JHTA 1Q38A 2BVPB 2AVGA 5HHVH 2PYEE 4E5XB 4DGVH 4LAJH 3VXUD 3I3BA 4L4VE 3V0WH 4RSVA 2HLAA 4Q2ZB 4P46C 4FABH 4OM1H 5DYOA 2R1XA 4XAKE 3V6FB 4ORGB 2ED9A 5SWSB 2BFVH 3LKQA 2DKSA 2H2PD 3B6SB 4K23L 5CBEB 3BDBA 3I2CL 1QG3A 3UC0H 5D7SL 5CD5C 3ARDB 4BSVB 4UU9B 4G6KH 2Y07H 3DMMB 5DD1H 2BXYA 5E7FA 5EBGA 1I1YA 1FC1A 2X4SB 1OWWA 4EQ3A 3KPPA 4DW2H 5EWIH 5FOBB 1T5WB 3W39B 5BV7C 4GG6A 5EN2B 4F57L 2ZP0T 4Y1AA 2YMXL 1YEFL 4NO2A 2B1HL 3RX7A 1T5XA 2EDNA 2OL3B 3PGCB 2R2EA 3Q6FA 4GJTB 5AWNL 2AJVL 5GS3A 1OTUC 3NPZB 2HRPL 5LCVH 5IF0A 4APQD 1FO0H 5D7KD 1P7HL 1D5XA 4A2LA 1FYTB 5A43C 4LNVA 4KHTH 3RVTC 1RMFL 4KRPC 4O58H 4DKEH 3AY4A 3QEQD 3NCCB 1T7WA 4PJ8B 3U7WH 3FB8A 4ZFFA 4M8VA 4OGAC 3ZKMD 4HS8L 1EGJH 2X4QA 4PB0H 3QIWC 5BQ7B 3BN9C 4Y2DB 1CS6A 3MLUL 3QH3A 1H3GA 1HH9A 2LU3A 3SDCC 4CADB 1FL3B 4LBEB 4M1GL 3G5ZB 5FHBL 1XF5A 3DX7B 4NJAH 2P49B 4OZFA 4F9PA 3F7VB 1A6UL 4YHLH 4DTGH 3OKEA 5C0ND 3I02B 5TDPB 4DCQA 4WFEE 5E9DA 3FB5A 1IRAY 1JWSB 1MCWW 4PJEB 1EFXB 5I17B 4Y8DC 1L6XA 4UTAH 4P5KB 3GKZA 1A6AB 1QHOA 1OSZA 1ADQL 4L8DA 5BXFB 5JW3H 1FO0B 2HA1A 1ORSA 2XWJB 4PRIA 5IFAH 3BUYA 1NDGB 2XTJC 1PKQE 1I8IB 3VXRA 4WWKA 4LU5L 1MLBA 1R3LB 4YDJA 2EKSA 2IAMD 1I1AA 4XXDA 1QTYT 3NCBB 4BSWA 5HYJE 2Y9RT 3PDDA 1F4AA 3UTPD 4CW1B 5DJYB 3E2HB 3AMLA 4HH8A 5DZLA 2YUWA 1HN1A 3VXMD 3EGSA 5FYLH 4HS3A 1SY6A 2F54D 1SJXA 1JMXA 4D0BA 4RMUA 4U1LB 1AGCA 1FPTH 1V7NH 4QRPD 1D5ZA 3W5NA 3H42L 5MENE 3LKQB 1VFUA 2V2WA 2VDRL 3RUGE 4Y19A 4AENA 3QDME 4DN3L 1TFHA 2EICA 3RY5A 4CVZB 2QADC 2BNQB 1P84K 35C8L 4GAGH 4HIJA 4K71C 3G5VA 4MD5A 2W07A 5BCAA 3TCXA 4FA8A 3O41B 1OAXH 3QPXL 3VWKA 1IZKA 5DMGC 3AREC 1P7KA 3BI9X 3MGTB 2V5RA 2J88L 2VIRA 4I5BA