2JELL

Jel42 fab/hpr complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
217
structure length
217
Chain Sequence
DVLMTQTPLSLPVSLGDQASISCRSSQSIVHGNGNTYLEWYLQKPGQSPKLLIYKISNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIGDGARQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSDSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (antibody/antigen)
molecule keywords JEL42 FAB FRAGMENT
publication title The 2.5 A resolution structure of the jel42 Fab fragment/HPr complex
pubmed doi rcsb
total genus 47
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 1998-02-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2jelL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2jelL01
3GSXB 2R29H 4OZFH 3DHJA 5E8DL 1LO5B 2SEBA 4ODHL 4JRXB 2NNAB 3OWEA 5T3XE 4FXKA 2WUBL 5IFAL 4FRWA 2D03L 1JWUA 1WT5A 5I9QC 1DQMH 4XXCC 2GCYA 3KPRD 3RWDB 1U8OB 2NXZC 3BZFA 3SO3B 5C8JA 4FFVD 5J0BA 1NQBA 2BNUB 1HZHH 1A3RL 3IU4H 2HJLA 3VA2C 5GHWH 5HDBF 4ZO9A 3PUCA 1VA9A 4DN3H 2FO4A 1AI1H 5DMKB 1LDPH 4KK6D 3HR6A 5L2JA 2B8OT 4O5LL 2FYYA 3CFIC 4GLRI 4RMQA 3V6BR 1FC2D 3MMEA 4P9HL 4JQIH 2PYFA 3HZVA 3LS4H 1KXQE 1CU4L 4K55A 5E2UL 3OJMB 1BVLA 2NX5D 5HDBE 4X6DB 5DD6A 5BS0E 1RHFA 3MUY1 4P3WA 1YEFH 4XPBL 3QCTH 5A2JH 3JSSA 5HHNA 3VWKB 1UENA 1EGJL 1T1WA 1WFUA 2JK5A 4K8RH 3SO3C 4OZFB 1OGAA 1NGYA 4HIIA 3VG0L 4P4KA 3RVVD 4OLWL 1MCBA 1EUUA 4Y5XB 3L3DB 4JZJB 3BGAA 4OAWB 3G6JF 1C16A 3ZMRA 3WNKA 4YEEA 2ZWLT 3AY4A 3KHQA 4KI5F 1KFAL 2MMXA 4CBPA 3I6LD 1L6ZA 2FB4L 4JHWH 1RULL 4KHXH 3MJGX 2B5IB 1RUKH 3DUSB 3DXAB 3N1PC 4WFGD 2Y6SD 2VDNL 5EOCL 1ITCA 1YPZE 3ES6A 3MUHL 1F6AB 5D71L 3GO1H 5ACMA 4OZHA 3TYGL 3MFGB 4K7PH 3M8OH 1X7QA 4UIKH 4LLVB 4YHOL 5KG9B 5LBSH 4LVHB 3VWKC 1DBBL 3WLWC 2O5ZH 4Q74A 3IT8D 4JFFB 3B8SA 2RGSA 1YEJL 4L5FH 4PGCB 4GRWH 4FQIH 3VFPB 3KS0H 3B5GA 2VH5H 3K0WA 4RMSA 4Y5XC 2HT3D 4JZJC 1NDMB 4RCAA 4NNYA 1T7VA 4XNQB 5FA4A 4IEFB 1KLGA 2J5LB 4YDVB 1OCWH 3UTTD 4G8IA 4LKXA 2XNAA 2B5IC 2VLMD 5J06A 3TJHD 3L5IA 3TPKA 4CVUA 1ZLVK 1Q72L 5IB2B 4GXVL 5EBWB 3SKMB 3GUTA 3PG2A 3I02B 3BH8B 2W0LA 2EDJA 5D7IF 4WIQA 4DOHB 5L8LB 3IF1B 1L4IA 3DVNB 2N7AA 5JMOC 2J6EA 4LVHC 2FBOJ 4DVBA 3H8NA 3SGDI 1FL5A 1MJUH 4RRPA 1S3KH 4OFIA 1RY7B 4ZS6D 2VLKD 5FEBA 4EVNA 4JEGB 5M7QA 5J6GA 1CF8H 5IHLB 1U8QB 5D2LB 4K8RC 4D9RE 1AP2B 2J5LC 4JPWL 5D7IE 5FYJL 5I74B 1WK0A 3PHSA 4X9BA 2QV2A 3TO4B 3KLDA 4HFWB 3B5HA 4GRWB 3ARED 3J7HA 5AG9A 1K9TA 2EIDA 3HE7D 4RGMB 1UKTA 2BVUA 3P30L 5LGHH 2YS4A 3FB7A 3GBLA 5ESVB 2J8HA 2D7TH 1WCBA 4U1NB 1QG3A 1RIHL 3W0WB 1DEEA 1X4ZA 5ANMA 3SEPA 1JFQL 3ILPA 1P4IL 1LO2H 1CDBA 4XBEH 4AM0B 4MVBD 4CVZA 3RVXC 4Y2DD 1OPGL 4OB5H 43C9B 5ADPH 5ILTH 2I5YL 7FABH 5D9SB 5I74C 2P8LB 2FLRT 3H42L 1WC7A 3TO4C 4LLQB 3QUZA 1NL0L 4HWNA 2R2EA 5JXED 4RGMC 3EYFB 1EK3A 3QH3A 5E1AB 4KPHH 1EMTH 5C0ND 4HUUB 4FTVB 4WI3A 4JM2F 4G43B 3HE6A 3OKNA 4GW5A 4CJ0A 2BXYA 43CAB 4HSQA 4MQXC 1MPAH 4WFHD 3WJJC 2COQA 2VDPL 2HH0L 4FQLH 4M6NL 1R3HB 4XNUH 1G9NL 2BNQB 4M7LT 2NY4B 3BGMA 2IAMA 1AC6A 4LNVA 3WUWG 1U2HA 4G9FA 4PP1C 5DRWA 3VG9C 1ZT1A 5SWZA 1ZK9A 3OKMB 1CGSL 1Q9OB 4ODBD 4MSWB 3BXNA 4HCRL 5KBNC 2AABH 4UAOB 2JB6B 4PJHB 3MLRL 3UJJH 5GGTH 2DOCA 2XWBA 4G6KH 3H0TA 3R1GH 2ENYA 3S37L 4A6YH 3QB7C 1A9EA 1KTDB 1BD2E 4WW2B 4GH7B 2NY4C 4PV9A 3KLHC 4S1QH 5I1CL 3EHBC 4ZUSA 5IESL 1I9JL 3U1SH 1MAMH 1P7QA 2Z8SA 1XR8A 3KXFE 1KCKA 4NQDD 3ZSTA 5F9WB 1KXVC 3PWJA 3KNBA 1LO0H 1U3YA 1CFVH 1RJZB 1UKSA 2YPVL 1S9VA 3ET9F 4UAOC 4IS6A 5BMFH 5I1LB 3NPSB 5F6HJ 4P99A 1CXLA 2JIXA 4ZTOH 1N6UA 5CFHA 1OD7A 1BFSA 2K9UA 1G7JB 2O93L 1QQDA 1N64L 2NZ9D 3HPJB 4GBXB 5IG7B 5LKNA 3VD9A 3KGRA 1IKNA 2XN9D 5JHDB 3IETB 4OUUA 3QISA 4QEGA 4NQSB 5ERWB 4K94C 1RU9L 5DO2C 2X1WL 4A6YB 4Z76B 2QQKL 3H3KA 2CUHA 1JPTL 1YEHL 4K7FB 2C4FU 2AV1A 2FGZA 2Z91B 4R7NB 5F9WC 3E3QC 1YY8A 3GMMA 2FO1A 1KLUA 2IPTL 4G6MH 2HG5A 4HV8A 3VJ6A 2Y25A 3GMQA 4MJIA 4QHUB 1U58B 3BEVA 3ETBF 4TULH 3NPSC 4L4VB 1UG9A 1CWVA 1GH7A 4LEOA 1JHKL 1KPUB 1X5GA 1ZA6A 4GBXC 1KCVL 4CN4A 1EH9A 3ULUE 4NGHL 2R0ZH 3W9EB 5F7EL 3MJ7B 5EZJA 1PZUB 2AQ2A 4P46D 1GGTA 4UNUA 4TTDD 5CJ8A 2EDLA 5L7XL 4XXCA 2MCPH 3VH8B 3HUJE 4X4MA 2ICES 1MI5D 3LH2H 1DL7L 3T8XA 2R23B 1KUMA 4YHPA 4LPXA 1DZBA 5CZVL 1AHWB 5C0BB 3WFHA 2R4SH 1RUAH 4S1DC 4Z7WA 2VAAB 2ESVB 3N0PB 1NH6A 4W81A 1H15A 3V5HB 2W0KA 1BM3H 4OCWL 4DW2L 5IOPB 4UTBH 3BN9C 3WXVH 2EEDA 2CDEB 1V05A 3ARBD 3DECA 1KIQB 5I76A 5I8OL 4JM4H 5SX5H 2NY1B 1VSCA 4R8WH 5F88A 1T83A 5ID1B 4RAVB 3VXUE 3O6KH 3RWDA 1U8OA 1WBYB 3GIZH 3D9AH 4FFWD 4ZQKB 4KKNA 1BFVH 3FO0L 4I2XE 4R97B 5AZEH 2OZ4L 5SWSE 4OZIF 5DMKA 2ZNWA 3QZWA 1AHWC 1KT2A 4N5UA 1OT2A 1Y0LA 1PZ5A 2HFEB 4YNYB 1T0MB 4U1MA 5HHVH 1PKQA 1DEDA 1X4XA 2VMFA 1RQ5A 2G5BB 4MNQB 1OP9A 3P0VH 1Z9LA 3WL9A 1CLZH 4OZIE 4HJGB 1T20A 4B0MM 1JNLH 4OCXH 3IS1X 3GSUB 1O0VA 2BVOA 1OWWA 4CADB 4X4YB 4JZJA 4TUKH 4FFYL 4OAWA 1P6AB 5HDQL 3O4LB 3O2VH 4WHYG 3EFDH 3WIHA 5E08L 3BSZL 1NCCL 4KRPB 1FG2B 3MRPA 4LSQL 5DJYB 3R8BB 1P4BL 4V1DB 4OLUL 3DUSA 2NY3B 1NGWA 2F58H 4OKVB 1WIOA 3BP6B 3BX7C 1F6AA 3MJ9L 4AG4H 4LEXL 4UUJB 3S96B 2WNGA 2AJ3A 4WI2A 5FHAL 1T3FB 3SY0B 4UTAH 3PDOB 5I2IB 3LHPH 3HNTL 5JQ6L 4G7YH 2GTZA 2VN4A 4LSPL 4JFFA 5KZCD 2X6MA 4PGCA 4WHCA 1I1AD 2R2BB 4Z5RB 4YHML 2ZUUA 3UZVB 1OTSC 3BVNA 4XNQA 3B6SB 3TIDA 4NRXA 2CLRB 1DQLL 2CLVB 3WN5C 4KRPC 1HXMB 2H3NB 3CJJA 4JFED 1AD0B 3BAEL 2OJEB 4P48A 4DQOL 1ZS8A 1CL7I 1U6AH 2NY3C 5IB2A 1OL0A 3FHQA 5EBWA 4PJBA 1OTUC 4NZUL 3TH3T 3BH8A 3DUUB 3ZE2E 5C0DA 4QTHB 2PR4H 3IF1A 4PJAF 1BBDH 4D9QE 3T0AA 5T33H 3QJHB 2PF6A 4YO0B 1ZSDB 5D1XB 5DQDL 4M7KL 2EH7H 1IFHH 3KPTA 4JCLA 1FO0A 3QUXB 15C8H 2IANA 2XA8H 4YHLL 5C0CD 3HFML 4NC0B 1CLCA 1U8QA 2JE8A 3T4AB 4LSUL 1QBAA 5CEYA 3UTPE 2IF7A 4G3YL 1T1XB 5DQJA 5F3BB 3TO4A 1T4KB 2YSSB 1NJ9B 1FVCB 1YZZA 2YHGA 5ICYA 3FB6B 3O6ML 1AR2A 1MJ8L 5DYOB 2D2OA 5D7LE 4U1NA 5GS0L 3N9GH 3W0WA 2PXYA 3TVMA 4QRPD 4CGTA 3BEWB 4UOW0 1M05B 5HDLA 4CVXB 2QSCL 2QKIB 3HKFA 1EZVX 5DHXB 2BVQB 2W0PA 4AM0A 3MLVL 1KJ2L 1B3JA 3CC5A 1RMFH 3QUXC 4P2QD 5I8KL 3TNMB 5DZLA 4YFDB 1FFNB 1S5HB 1KYOK 2DYPD 3GHEH 5T1DL 3PWVB 4IMKC 5DLMH 5C0FB 1AKJD 5D9SA 4L3EE 5EU5B 3ZL4L 2P8LA 4QXWA 2DLGA 4L3AA 5CINL 3C8KA 5EUOF 3WO4B 3N1QC 4LLQA 4XBPB 1BWWA 4KQ3H 1MCSA 4J4PA 2HRPL 4X7TB 2AEPL 5HTSA 5ADOH 5FO8A 1NBZB 3LDBB 5FXCH 4FTVA 1CR9L 4NM4H 4G43A 5GISH 4ZNEE 1JHLH 3S9DB 3WXWL 43CAA 2NYYC 1IZJA 3K81A 1WZLA 2CIKB 4PLJD 1JNNL 4JHZA 1MH5B 1QRND 3QWOB 2HVJB 3E8UH 1FGNH 3FAWA 2DQGH 2NY7L 1IMHC 5ISZE 2W9DH 5T1LB 2A9NL 5GRJH 5DR5H 4P23D 3PHQA 3EJZD 3MBED 3DVIA 5IW6B 1EVTC 3WO4C 4LHUB 4JDZA 1J0IA 4M02A 3OKMA 4AEFA 5JW4Q 1Q9OA 3S5LG 3UYOD 4MSWA 3PABB 3LDBC 2VDKL 2R56L 2HLFD 1TVDA 5ECJE 1J8HE 4U1GB 3TT3L 3VI3F 4ZPVA 1PLGH 3ZLQC 1J0KA 3DVGA 4MLIA 3BP5B 4YLQT 5EO9A 5DJ8A 1IT9H 3K8MA 3MOQA 5DUPL 1KTDA 4ZTPH 4WW2A 5MEPA 3JTTA 5I75B 1WV7T 4ZUWB 3U0TA 4JFPA 4LSTH 3L3OB 1PX4A 3FKUS 3QO1B 2BNRD 4ELME 4IRSB 1LMKA 1C1EL 4G5ZH 1N6QH 3BOVA 1J1OL 1YMMB 3LKOB 2X41A 1RJZA 5CS7A 4L4TD 5D7SH 4OGXH 4PJ8B 5I1LA 5F96L 2VDOH 3HPLA 5EO0A 2MKWA 2XZZA 3OPZH 4Q0XL 2A0LD 4KAQH 5T3ZE 1HWHB 1G7JA 3IS0X 4PJ5D 3UEZA 3MLXL 3PWUB 4U1GC 3ZYZA 4BSWB 5IG7A 1EEZB 4MS8D 3C9NB 3EYUH 3LSOA 2HKHH 5JZ7D 2W07A 5K9KB 5C0AE 4NQSA 4HS3B 5ERWA 3DSFL 5DJ2A 2IJ0C 5I75C 5C71A 5DJ6A 3VGEA 5HHQB 4A6YA 4Z76A 2HA1A 4IRSC 3BW9B 4LP4A 2C3GA 4ZS7H 4K7FA 1D9KD 2P45B 2Z91A 1F4WH 2IGFH 4NQEB 4O58L 5KSAB 1A0QL 2XXMB 4MD0A 2WIIB 2WINA 3NFNB 3TV3H 3T0BA 3EJYC 4ODSH 5DRXA 3VFTB 1TVBB 3LKRA 4QHUA 1U58A 5E9DB 4EDWL 4L4VA 2A1WL 1A6TA 1ZWIA 1CTNA 3PNWB 4JKMA 4FZ8H 1ED3B 3EO9L 3PQYB 5DURB 3IFLH 4V2BA 1FYTA 3O6FD 3MRCB 2G2RA 4U1LB 5BZDB 1K8DB 2EEBA 1PJ9A 1WIPA 1YN7A 4GOSA 4WDIB 3LEXB 1TXKA 5DUML 3VH8A 5CGMA 3FFCB 1P7HL 2DWDB 3HR5B 1K3IA 2VLJB 1NDGA 2VIRB 4KJQD 5KSAC 3QBTB 4UILL 2YK1H 2W91A 3CH8A 5B3NA 1DVFB 4KQ4L 1AHWA 5C0BA 4F8QA 5IMMB 5CIPA 1E4XH 4RX4A 2VAAA 2ESVA 3WEXA 1VFOA 1MOEA 3BFOA 5IOPA 3UTSB 3CAFA 1S9XA 4XT1C 5E4IA 2CDEA 3VMPA 1JGEB 3RAJH 4EBQL 1MCKA 3GM8A 5I8EB 1KIQA 1MHHA 2L0DA 4FABL 5IGXH 2Y36L 3RTQB 1QSEB 4X0KB 3WDHA 4B5EA 5K9QI 3T0EA 1RUMH 4UT9L 2UY6A 5ID1A 2ADIA 5KVDH 4APQD 4RAVA 1WTGT 4PG2A 3F5WA 2YUXA 3FRPG 1WBYA 3ARWA 1EXUB 1BBJB 2LE9A 4HK3J 3JV6B 4ZQKA 4ZNCD 1MCFA 4PB0L 1S9WB 4KJWD 1AIFA 4S10A 3X13A 2XRAH 3HNVH 2AJVH 1RZFH 3BDYH 5E8NA 2HFEA 4PJ7A 4F58L 4U6VL 1OY3B 3Q0HA 1T0MA 2J88L 4YNYA 3EYSH 1OW0C 1HE7A 1VGEH 4LLMB 5CSGA 4RNRB 4XBGA 5IMKB 3KPRB 4NIKB 2YRLA 1FFQA 4B53A 3ZTJH 2G5BA 5ALCH 4U33A 4MNQA 3VFVA 1MWAH 1ZHKB 4U6XA 4XWOD 3QXDB 3RTQC 4I3SL 5F9JB 1NUDA 5BVPH 4HJGA 2B1HL 1ZVHA 4HWEL 5T1MB 2IH3B 3BN3B 3R06B 3GJFH 2BFVL 5EBMA 4XMKH 1C7SA 4ZODA 3NA9H 3L3JB 1LNUA 4U1HB 1V3JA 2P47B 2RHEA 4X4YA 1AGFA 4K7PX 3S3PA 3BD4A 3O4LA 4NUJA 2X4OB 2NX5B 1P1ZB 1FG2A 1RK0B 4JFQB 2X4UA 4V1DA 1H3PL 5E24E 2ARWA 4LAQH 5K9QG 4YHIB 1ZGLB 4QLRA 4OKVA 1IEHA 4P57A 5CKGA 4Y4KC 4UUJA 3N1FC 5DHYB 1FORL 3SY0A 3NACL 4OFPA 4KK6C 1UWGH 3PDOA 3SGJC 4X5XB 3HI1B 3DLQR 3BKJH 1EV2E 1MWAB 1X3DA 4ODTL 2HYMA 2R2BA 2GITA 3IVKA 1CBVL 4JY6A 5FUCC 2DQEL 4NUGH 1HHKB 2AEQL 1X5XA 3WFCL 3GJFB 3B6SA 5JIKA 3DTXB 4OCSH 1U2CA 4MYWB 1HXMA 3TF7C 2H3NA 3S4SG 4XPTH 3NN8B 2OJEA 4LNRB 2HFFB 5KW9H 5B38G 3RVVC 2WMPA 3SKOB 2WW8A 4CN6A 3DUUA 1F13A 2G9HA 2KQMA 4PPTA 3BYYA 3RZCB 1KB5L 1JN6B 4U2YA 4H20L 4NP4L 3T2NH 4M93B 2R0WH 5BW7C 5F21B 4YO0A 4PRIE 3F12B 3GIVA 1ZSDA 5D1XA 3UTTB 1NLBH 5DJZB 3QEGH 4PRPE 1QBMH 4EI5D 5HYSG 4NBZB 2Y6SC 5BJTB 4TRPH 5I1IH 3FJTA 3C6SB 1JZ6A 4IMKA 1BJ1J 3MCLL 1T1XA 4QRQB 4QY8B 4WNQB 4BK4A 2QSVA 4N90E 4NNXB 3K4DA 1NJ9A 3HG1D 5FF6A 1KV3A 3NAAH 1NFDB 1BQLL 5IKCB 12E8H 5DYOA 4HIXL 1B4RA 3WIIL 4NJ9L 1JWMB 3QUMH 3K4ZA 3RZCC 5HYJE 4G6JH 3BRGC 3RGHA 4WI6A 4E0RA 1C08B 1RFDH 4M93C 3SKNB 3NH7L 4M48H 4CVXA 2QKIA 3CVHH 5JPMB 3LRSB 2DIJA 1K6QL 4LBEB 2FWOB 1QTYT 3AREB 4I0PC 4KTEL 2E8YA 1T04A 1DQDH 3HE7B 3TJHC 3TNMA 3U9UB 1FFNA 1B0GB 3GMOA 1LVEA 3L1OH 4HKZA 4ZDHB 5C0FA 5EU5A 2GUOB 1XR9B 5KSBB 2ZUXA 4IRZL 2EZ0D 4XBPA 5C6PB 2GJ6B 1PEZA 3C08L 3MLTA 1ZAGA 3NCBB 1M7XA 4X7TA 4Y5YB 3RNQB 1GCFA 4F7CB 3LKNB 1NBZA 5IHUL 5FGRA 5DZOA 3TT1L 4UDUA 4ZS6C 2H32H 4MXQD 1K5NB 4JO2L 4Y2DB 3OJ2C 1IAIH 4EI6B 3CDFA 4JO3L 1I3RB 2CIKA 1XF5B 3EYQD 3IGAB 3QWOA 3FQNB 4NQCB 4WO4A 5C08E 2BHYA 3AREC 3WSQL 2OR9L 3QUMB 1DDHB 3C8DA 5IVXF 3RIAK 3HE7C 5T1LA 5FECA 4O4YH 2UWEF 3B2VL 1DBAH 3QIWD 3FQWB 3CVHB 4N8CH 4MA3B 4GRLA 4XMLH 2EIBA 4KZEL 4HG4J 4RAUB 5D5MF 3EGSA 4NO5A 1CIUA 5E70A 3CMOL 4CKVX 4Y5YC 3PABA 1SQ2N 5CMAB 3AM8C 4LK4A 3JWOH 2UWEE 5LCVH 4YUEL 3KAAA 1WEJL 4MVBC 3P73A 1X5HA 4Y2DC 5EC1B 1VEOA 4G7VL 1YQVH 4GKZB 3C5JB 4FQ1H 5EU6D 1RUQH 5B39B 3LN4B 1QO3B 5DTFB 5FYKD 2ZCLH 4BK5A 3BDXA 1LEIA 3V6OE 2H32B 2YD4A 2OBGA 2AEWA 3O6LL 3L3OA 3I6GB 3QO1A 2QR0B 5C0NC 1KENL 3V9FA 2VLLB 1T7YA 4IIQA 1VHPA 3HMXA 3PWPD 1ROWA 1YMMA 2PN5A 5D1QD 3LKOA 3T77A 4Y1AD 3SDXB 4OCYH 2I07B 2DRUA 4R3SA 3KWWB 1MCRA 2GY7B 4PJ8A 4UV7H 1GOHA 4RRPG 5C07E 3ZDZE 3T3ME 4JR9L 1FRGL 1VEMA 4BSWA 2VERN 1BLNB 3PWUA 1M7DB 4MDJA 2YMXL 1EEZA 1JI1A 1IGTB 3C9NA 1RZ8B 4Y19A 1F4HA 5EFIB 4NQDB 5K9KA 4XPHH 5HPMB 4H88H 5E99H 2CIIA 1KC5H 3FT2A 2R4RL 3RPKA 5HHQA 2FEEL 3ULVF 1FP5A 3D85D 5GRVL 1EHLL 2KQNA 4M8QA 1MHPL 1M1SA 5KSAA 2YEZA 4NQEA 4FP8L 1CT8B 2WSKA 2YD7A 4UMGA 3EO0B 4HEME 1WSST 3NFNA 4MQ7B 1IGJA 2FEDC 1OLZA 4M1GH 3VFTA 1TVBA 2MKLC 5IMLA 5E9DA 5TE4H 4EUPH 1OAXL 4PRHA 3OQ3B 4NC1E 1KPVB 4HX1B 4M6AA 5CKAA 5HHXH 1EO5A 3VWJA 3PQYA 3BPCB 2Z8WC 4PJ9D 2OCFD 2G75B 5H37H 1SYVB 1AQKL 3MODL 3FZUC 3S36H 2IFFL 4RWYH 3MRCA 2B1AL 5DT1L 3QEQD 3JWOC 1A4KA 4NKDB 3WKML 4X80L 4EOWH 3VXMD 4FOMA 2FATL 5ITFB 5JR1L 5D93B 4GKSB 4PREB 5TDPB 4KUCD 3FFCA 3OXSA 3X3GH 4WI5A 4GMSH 1TTGA 2DWDA 3MV8E 5HI4D 2VIRA 2NZ9C 2JJWA 1BX2B 3G5VA 1E6OH 5FYJU 1J1PH 1TCRB 1MEXH 1KB9K 4FMFA 1DVFA 4PJGF 2NXYD 1PKOA 1UJTA 3U4EA 3CDYA 4NFDA 4GAGL 4QRRE 2V2XA 4P5MA 5LAXB 4ZFGH 4U0RB 4XCNB 2YA1A 4LCWB 1GC1L 3V0AC 5D8JL 3HS0B 1MI5B 3SDAD 3DMMD 3LKQB 2E9BA 4FZEH 1P6FA 4LSSL 1NC4A 5FAAA 1HKLL 5J6HB 4EUPB 1WZ1L 2VABA 4FQXA 1QSEA 4X0KA 2DQIH 3NCJL 4X9IA 5D93C 3CUPA 1EXUA 3T09A 2DJSA 4M7JH 5KVFH 4NZRH 2VISA 1N0XL 4WUKH 4XVSH 1RK1A 1T2JA 3C60D 3S35H 1U93B 4ONHB 4F9PC 2J8UE 2P8MA 3TBWA 4ZFOA 4NJAH 1IC5L 1K8IB 4HULB 1HSBA 4EIGB 1N59B 4YIQB 3FB8A 1L7IH 1OAYL 1Q0YL 3SPVB 4C56D 4RNRA 2KZ1B 3KPRA 4U0RC 4ODWB 1MFDL 4TUJA 1I8LC 3QXDA 4IHOB 2DKUA 4KI5D 1FVDB 4BJLA 1YEEL 2AK4E 3K74B 1CQYA 5C9JA 2IH3A 1KOAA 1I7UA 3SGJA 3FO1B 5EBLB 5CCKL 1GAFH 5DMGC 3L3JA 5DUBB 1QSFE 4PP2A 4H25B 5ACLA 1YEIH 3H3PL 4HUKB 4U1HA 1MFCL 3OTTA 4PYHA 2X4OA 2NX5A 1G7QB 1GGCH 1ZGLM 1I1FB 1P1ZA 2ICWJ 4HZLB 3F58L 1DANT 1RK0A 4JFQA 4LVOB 1JL8A 5IQ9B 4OF6A 1AQDA 4QHNB 4X6CB 4IJ3B 4OCLC 4Y4HD 1ZGLA 1P84K 2XQBL 4FFWC 1J0HA 4RFEB 2I60L 1DLFH 3MOBH 1SMOA 1IQWL 1GRWA 1IBGL 2APTA 4YDKL 4LLYA 3MRRA 1I8KA 4XNXL 2F54D 1WWWX 4LARH 3QFJA 5EN2B 2CMRL 2XKSA 3CGTA 1MWAA 4OZGB 3H9SE 5F3HB 2EC9T 4BKLB 1F58L 2BOBA 4ZXBA 5T1KB 3B9KD 4HXBL 4X98B 3GJFA 3V0WL 3RBSA 3EO1A 2GKIA 1I8IB 1HNFA 4P5KA 1U8MA 4JO1H 4LVOC 4X9GA 3L5XH 1RZ7H 5FO7B 5E2TL 3NN8A 1OGTB 4IJ3C 1OAUH 1I7RA 4Q58C 4DK6A 3C2AH 3LQMA 5KVGL 1I1AB 4MXWH 5IT2H 1QSVA 4ETQB 4MJ2A 2VB5A 3QDJD 1JN6A 2PKDA 3WNNA 5IHBA 3ZDYE 4KY1L 2LU3A 5ETUB 1TDQA 1J86A 3GI9H 1Z0NA 3F12A 2CSPA 3UTTA 4MJ6B 5DJZA 3OX8B 1AY1H 3ZYIA 3V52H 4M5ZH 3QDME 3P0GB 1YECL 5CP7B 3C6SA 2VXVL 5I8CB 5HYQB 3RKDD 1XGPB 1T21B 4WNQA 4PJFF 4QY8A 4TVSa 5IBTH 4NNXA 2EDBA 1A6VH 4P9ML 4KK8C 2X4TB 3UPRB 1J0ZA 3O9WB 3LMJL 3O3BA 3P3YA 4GKNA 1AC0A 3H7LA 2OXGA 4O9HL 3O2WL 4N0RA 1DUZA 1I1AC 3ARFD 2HRLA 4U31A 3WCYA 2VLKA 5E8DH 5AWNL 1IAKB 4ODHH 2FL5B 4PY8J 1C08A 3RJQB 2WUBH 5E7FA 4PJFE 4DK3A 5IFAH 2VLRE 2D03H 2APBA 2N1KA 2NY0D 3QZWG 3P4MB 5D96B 4KMTL 1D5BA 2FWOA 2YPLD 3BWAA 5GS2D 2IEPA 5L9DL 5JXAL 1MCPL 2E7HA 1BFTA 4FA8A 3U9UA 3RWFB 1A3RH 1B0GA 4UT6L 3L3HA 4M00A 4X99A 4HC1L 1H3XA 2ZSWA 3B3IB 1XR9A 5FV2A 1SJVA 1FNSL 3IDGB 3C09B 4J1UB 4PJDA 1OTTD 3IDNB 3O9WC 4WU7A 1OM3L 3GB7A 4G8GD 1UCTA 4L4JA 3RNQA 4Y5YA 4F7CA 3LKNA 1RHHB 2FJGB 2BX5A 1T0NB 3AM8A 1JMZA 1CU4H 4P2QB 3G6DL 4FXGB 1K5NA 5SX5K 4Y2DA 1B0RB 2Q86B 2Y5TB 1WAAA 1LEKA 5KN5B 4E41E 3C6LD 1XF5A 1W8OA 1AKJB 4XPBH 3FQNA 5D96C 2E5EA 5F1IB 1BD2D 4LFHG 1EGJH 1JUFB 3QUMA 3QDGD 1S7RA 5JXEA 3VG0H 1NCWL 1JYXA 4FFZL 5B21A 3FQWA 1D5ZB 4X7FC 4NN5B 1CZ8L 3C09C 4POYA 2FB4H 1A1MB 2EDNA 3KPNB 5ESAB 4QOKB 2EO9A 1QRNB 1RULH 4LPTA 3H6JA 4DTGL 1T2XA 3GJEB 4NDMB 1MCJA 3IU3A 3ROOA 2VDNH 2WLZA 3GSVB 3QULA 5EOCH 3THML 5D71H 1A7BA 2XTLA 4OJFL 1FBIL 4HBQA 1IAIM 1MCNA 2RB8A 4BZ2L 3TYGH 3BP4A 3C5JA 4GKZA 3MBEB 4HMCA 4YHOH 3LN4A 1KELH 5LWYL 1DBBH 4QO1A 2XPGB 1YEJH 3FMGL 4K3JL 4WFED 2VLLA 5KS9B 1T7WA 4GW4B 4U0QB 3G6AA 3LRGA 4U7KA 3P9MA 3MV11 1QPXA 3Q6GL 3NGBB 4PLJC 2PO6D 5DDHB 3SDXA 1BZ7B 3VGHA 1UXWB 5C3LD 2I07A 3KWWA 4WJ5A 5C09A 1OSZB 1I8MB 3S7GA 1Q72H 3Q5OA 2AKRB 4GXVH 4NKIL 5CZXD 3WD5L 4UT7L 2P5EE 4GAYB 2UZYB 4LGPB 2OTUB 3EJZC 3BH9B 5EFIA 1I85C 4P9HC 5L2KD 4OTXL 2C7UB 3X11A 4YXKL 4I0CC 1NCUA 1ZHBB 3RI5K 2EYSA 4YJZL 3KPOA 4JDTL 5AG8A 3HLAB 4DUWA 3BHBB 4L4TB 1I3UA 1MFNA 1QKZL 2HLFC 3OGOE 4PJ5B 5I1GL 1G7MB 3ZDXF 2C1PB 5FYJH 2XN9A 3EO0A 2IH1B 1EAPB 2NY5L 3NGBC 2FX8L 4JO4L 1I9RL 1MFBL 5MERB 1UEYA 2WAHA 3O11B 1NGXB 1S7WA 4BFIA 5I30L 1BOGA 5GGQL 3ME0A 3P30H 2F53D 1KPVA 4HX1A 1HKFA 3WHE1 4FQHB 5E00B 2B2XL 3RVUD 2YKLL 1CDUA 4QHKJ 1RIHH 3BPCA 4OLEA 4UI2A 1EEUA 2D0HA 4GAJL 1D9KB 1SYVA 3BRFA 5DD1L 3ZDXE 1JFQH 3KDMA 1P4IH 1O7SA 1ONQB 4NKDA 2APFA 4RISL 5I16B 5IFJB 3KLAB 3VXUD 4GKSA 4PREA 2R9HC 5L88H 1ND0B 4HK0A 5TDPA 5IW3A 2F19H 3ZT6A 3TCXA 4U1SA 1OPGH 1DP0A 4F80A 4NRYB 2I5YH 4F9PA 5HHOB 5JHLL 1BX2A 1GGUA 1AO7A 4MS8C 3H42H 3O6FB 3A6CL 3RL1B 1NL0H 4U05A 1ZEAL 3I50L 3WV0A 2B0SL 2FJFB 4P46A 4Q6IB 1OGAE 4LPVA 1EEQA 4XCNA 1WITA 4EQ2A 3SQOL 1MI5A 3GSOB 3LKQA 1D9KC 1MELA 2HH0H 2VDPH 5J6HA 4M6NH 2OSLA 5GGRB 1G9NH 1CG9B 2YWZA 4HLZG 3IFNH 4PBVC 1AGCB 4XCYB 5DVOA 5IJKC 2V2WA 3BISA 4LDOB 1CVRA 1OP5K 4HZAA 1UM5L 2FX7L 1QZ1A 3ARBA 5TFSL 1I3VA 4MX7A 2OTPA 3O6FC 4OZHE 1MRDL 5CWSB 4WRLA 1CGSH 1T7XA 4I48B 3MRQB 5IBUG 5D2NA 1V8HA 2CRZA 4HCRH 4Q6IC 1QLRB 1CGTA 2HVKA 4APQB 3QQ4B 3OHXA 3MLRH 4DZ8A 4H1LH 4HDIB 2P24A 4ODWA 3DX6B 1AD9B 1IEBA 3DO7B 5HHPB 3S37H 4KJQC 1FVDA 2DBJA 1V7NH 1HOCB 3H9HB 1N6VA 4K94L 3FO1A 4M6OL 4MAYD 5LJYH 4FQPA 3L3IB 5IESH 1I9JH 1E4WL 4QRUB 1HQ4B 1CDIA 5EB9A 4JFYB 5DK2B 3DYPA 4XNZB 2LAAA 4HZLA 5DK0A 1A64A 2YPVH 5IQ9A 4APQC 3SKUD 4WUUD 3U83A 1S9YB 1WZMA 4X6CA 1V7ML 4J3UA 2LFGA 3B43A 4AQOA 1N64H 1U92B 5F8QC 1C8PA 4RFEA 4NWUL 4J2XA 4M5YL 4KJWC 4D9QD 5D1ZB 4X5WB 3A67L 4H1LB 2ZSVB 3ULVL 4HBCL 1JGVL 1FFOB 1RU9H 4F7TA 3D25B 3LS5H 4NO0D 5F3HA 1JPTH 4BKLA 4I9WE 4S11A 1YEHH 4GQ9L 2AK1L 4IMLA 1G9NC 2N4IA 3DGGA 3GMNB 4X98A 2IPTH 1S78D 3QUYD 1HCVA 3PGDB 3QIUD 4XNZC 1I8IA 1FNEB 1N0LA 5FO7A 1NEZB 4OQ1A 5FFLA 3O45A 1CL7L 1JHKH 1XF1A 1JYWA 4WI7A 3TO2A 4HUWA 4PJXA 1KCVH 1I1AA 1G6RL 4NGHH 4HUXB 4PTUA 5F7EH 3X12B 1WWCA 4D3CL 1MCWM 5D1ZC 1KCRL 3OKOA 1HH9A 2AS5M 2C9AA 3LZFL 4MD5B 1KNOB 4MJ6A 3RU8H 5L7XH 1J87A 3OX8A 4LLUB 1DBML 4JFEA 1DL7H 3LB6C 2BJML 3AMLA 3MV01 5I8CA 1Z9OA 3GSNL 5J8OA 1XGPA 4DVRL 1T21A 2R69L 3VFUB 5CZVH 5TQ2L 3CIQA 3VA6A 1DBJL 4F57L 5ITBH 2X4TA 3EZJB 3JWNC 2WK2A 4PGDB 3UPRA 2YD2A 5KVEL 5CGTA 4QKXB 4OCWH 1H9VA 3QCUL 1NCAL 3F62A 4DW2H 4ZUTA 3N85H 2PW1A 5TJWK 3SDCD 1NFDF 4Z7UA 5TGBA 5FUOL 3CVIL 3GBML 5I8OH 1IAKA 3GGWB 3MFFB 2FL5A 5I1HL 4FQJH 5C0CA 1JE6A 4JFOB 1HHGB 4NC2B 1SBBA 5SWZE 2GT9A 3P4MA 3RWHB 1PG7W 1V5JA 5ISZD 3TP4A 2B7DT 3VXSB 3ARYA 4JGJA 4X5LA 1EFQA 3HG1B 1E27B 5I1KH 2Q3ZA 2IC2A 4Y16B 3RWFA 5I18H 1IL1B 3FO0H 4JRYD 3PP4H 2OZ4H 3IDGA 4QRPA 3IAPA 5CEZE 4Q9RL 4J1UA 3RWIA 1XZ0A 2X10A 4N9OB 3MBXL 3QO0A 1IGFL 3FHAA 5GSVB 2CGRL 1XF2A 5GJSL 2FJGA 2EE6A 1EJOL 4FXGA 1FFPA 4ZSOB 1J8HD 2DYPA 4TSBL 3MV7D 2Q86A 2Y5TA 2YBRB 5KN5A 3IXTB 1AKJA 4NBXB 3OKEB 1DFBH 1XF4B 3M1BB 4GRMB 4KTDL 4HIEB 4Y16C 1K3ZA 1KF9B 4FFYH 3LY6A 1D5ZA 5HDQH 3SOBL 1P7KA 5DQ9B 4AENB 5E08H 2N56A 5LGKA 4H0HB 5F6HI 3BSZH 4GG6F 1NCCH 4M7LL 3F7VB 5ESAA 1QRNA 3U0PB 1P4BH 4OLUH 3IKKA 4KGLA 5EH1A 4IM8A 5JIPA 1JIBA 4JGUA 4KKBC 2Y23A 5I15L 5CUSL 2IBGA 3MJ9H 4P23A 4KMQA 2A38A 3T3PF 2LVEA 2FX9L 1GYAA 1TETL 2WIMA 5FHAH 3U4AA 2FHBA 3MBEA 1I85A 1NANI 3GJFK 4Z7OF 3ALWA 3CLEL 3HNTH 4GG6E 2GK0B 1OAZH 5JQ6H 4LSPH 2EO1A 2XTJE 4MJIE 2XPGA 3WIFA 3HHRB 3CX5J 4YHMH 4AQ1B 3DX8B 5E1HB 3ZKMD 4MXQC 3T3PE 4NM8H 1EGJA 1DN0A 1NAML 5TDNB 1I3GL 5DDHA 4N0UA 2VO5A 3EYQC 1X5FA 5EU6B 4Z7OE 1UXWA 1P69B 2E7LC 4K2UL 3TNNA 4WFFE 4TNVF 1OSZA 1F8TL 5KTEL 1FNLA 1I8MA 5IP4A 2OK0L 3TH4T 3VXRD 2W60A 4X4ME 4NZUH 4BYHA 2BNRA 3Q1SL 4GAYA 4PRNB 2X4NA 1F2XK 2OTUA 3JTSA 2DM2A 3BH9A 3PWPB 1KCUL 1P53A 2C7UA 4QF1B 1FJ1B 1ZHBA 5D1QB 2XOTA 4PRAA 3LKPA 2DI9A 3MLSH 4Y1AB 5DQDH 1XGUB 4M7KH 4CJ1A 3MRJB 2LABA 4Z7WE 3HLAA 1KCSL 3VFGL 4L4TA 3T0XA 5J7CC 3BPOB 4HPYL 4YHLH 3OR6A 2P5WD 3HFMH 4ZAKD 1LEGA 4PJ5A 4LSUH 4DAGH 4KVNL 1G7MA 4G3YH 1LD9B 3MRNB 2IH1A 4JREB 5BOZG 5MERA 1FL3A 3O11A 4JFDD 3NCYP 1YDPB 2GTWA 4MMXC 3O6MH 1MJ8H 2VXTL 4FQHA 3B4NA 5E00A 5GS0H 5F9DC 5MHSE 2BY0A 1D9KA 1H8OA 2AJXL 3V0VB 5IEHB 3AVEA 2QSCH 5D1QC 3PGFL 4WWID 3MLVH 5JO5B 1KJ2H 3QNYA 5I8KH 1ND0A 1PKQE 3BPOC 5CAYB 1F3DH 5T1DH 3WS6C 4XXDB 2D7OA 3ZL4H 3QCVL 3U4BL 4PJ9B 4JREC 5GIRB 5CINH 1I7TB 3D39D 4KGJA 1S7UB 2BDNL 3QEQB 2FJFA 4JRXD 2HRPH 2AEPH 4H8WL 3RUGA 1NBQA 4Q6IA 1I7ZB 2FIRT 5HD8C 5DSCB 5H35A 3MJ6A 1CR9H 2A6JA 4HGWA 4NN7B 4TTGA 5EZIL 1OQOA 5JIHA 3DX9A 3WXWH 3GSOA 4XX1E 3O8XD 3DPBA 1JNNH 1CFQB 2EDFA 3JUZA 4WEUD 1AGEB 3RWCA 2NXYB 2NY7H 3VFSB 5FCUL 1AGCA 4XCYA 2R8SL 4NO2B 2VDRL 2A9NH 1D5MA 4GFTB 3JWDL 1GOGA 1DN2A 3BKML 2AJUL 3I2CL 1A2YA 4G6FD 2BHUA 5DC0A 5IWLC 4PJ9C 4RGOL 2HAZA 3SDAB 1KJ2B 2DIAA 3F7PC 4KK9C 1U8NB 5BS0B 1U8HB 5CWSA 1FSKC 3MRQA 3AU1B 1S7QB 4TPRL 4XGZB 1W0YT 1JPST 1NFIB 4APQA 2VDKH 2R56H 3T1FB 4JFFE 4X4ZA 2RR3A 4NN7C 1ZVSB 3VWKD 3D69A 3DRQB 1AD9A 3DO7A 3TT3H 4PJBF 3RY5A 2BVPB 1X5KA 3C60B 4M9PA 3TWCL 2EICA 3LQAH 1RZJL 5DUPH 1BIHA 1NGPL 2NXYC 1HOCA 4QYOB 4LVNB 5GS0C 4MNHB 4Y5VB 3FOMB 5JA9A 3LKSA 3L3IA 2LV4A 4C56B 1WLHA 5CP3H 3KR3L 3TCLB 4RDQG 1C1EH 3DXAD 1HQ4A 3QHFL 4FG6D 4PJBE 3SDAC 4ZG1A 3G6JB 4KZDL 4DOHE 4BH7A 3TBVB 2J12B 1PFCA 5F96H 1S9YA 3DOSA 3MO1B 4Q0XH 1UACL 1U92A 1A1OA 3L7FB 3MLXH 3AC0A 2IANE 3C60C 1I75A 4MAUL 4X5WA 5A1AA 4H1LA 2ZSVA 4ONFL 2HT4D 5D72H 1R3KB 4LVNC 4W4NA 3OXRA 4KJPD 5CD5C 1IGYA 1FFOA 4K8RD 4Y5VC 3D25A 1MSPA 3GNML 3FQXA 1XCTA 4BQ8A 1DQQB 4N8PA 5A43C 3VD3A 3UTOA 4Y4HB 4UB0L 4PGJA 5I17B 1UQSB 4UNVA 4HGKC 1A0QH 1XIWA 4IOFC 3W0WE 4YHKL 4ZYKA 2Q87A 3D0VB 4KI5C 4X8XA 5DA4A 2V5MA 1PYWB 4XAWL 3MUZ1 4XTRC 2F54B 3CFCL 1NSNL 4EDWH 1NEZA 1UM6L 2DQJL 2A1WH 3L9RA 4YX2L 1AJ7L 4IOIB 3EO9H 4W4OC 1S7VB 2A77L 3B9KB 4HUXA 1QVOB 5CILL 3RVXD 4LCIL 5D7IB 4AIZB 4BZYA 2ORBL 3GSRB 5CLTA 4MD5A 1B90A 1RV6X 4LLUA 3NIDF 1GL4B 1EEYA 1HN1A 5ACZA 3HCVA 1BECA 1LP9F 4NHCL 4Y4HC 3FB5B 4OLYL 1PY9A 3K4AA 3K2UL 3FCTA 1UWEL 5GS2H 4UILH 3VFUA 1ACYL 1UB6A 2XZQL 3P9WB 1Q94A 4PG9B 3VFNB 4KQ4H 3QDJB 4XI5D 4F9LA 5MEND 5GGRY 4MQXD 1T80A 4PGDA 3CFDA 4QRTA 2EKJA 1P4LB 2RFXA 2LAGB 2X09A 2FRGP 3QIBA 4XVJL 3TBYB 4EI5A 1AGBB 1CXIA 4WW1A 5E5UB 4EBQH 5E94A 4FABH 3B9KC 4I18B 2Y36H 4EIZC 2DB8A 5DEGA 1UCBL 4JFOA 1HHGA 4UQ3B 1KYOJ 1IM9A 2D9QB 4OI7A 3RWHA 5ID0B 4OLXL 1JRHH 3OV6A 2AXFA 3HG1A 2OQJB 1E27A 5BO1L 1KULA 5M95B 1YC8A 4J3TA 1H3WM 1RZKL 3UAJD 4PB0H 3MCKB 3KYMA 1CCZA 3OJVC 4IBLT 1E28B 1LGVA 3ARDD 5MEOB 5INCA 3NZHL 4KRLB 1SHMA 4F58H 4Z6AT 2J88H 2NY0B 1CGXA 4R4BB 3IJYA 5F7UA 1GOFA 1IC7L 2BNQD 2VTFA 4ZSOA 2QQLL 3ZZ1A 4I18C 4JM2B 3EOTL 4JHAL 4Y0GA 3EHBD 3RKDC 4I3SH 3X14A 3UZQA 2XKUA 5CHNA 3IXTA 2B1HH 4HWEH 1MAKA 1X6LA 3OKEA 3OAYH 2Q6WA 3UBXI 4LLDB 1XF4A 4G8GB 2AAVA 3DO3A 5EORL 4DZBA 5D4QA 2EKSA 4MCZB 5DQ9A 4AENA 1QFHA 4LRNL 1L9NA 4RMUA 5DEFB 1T2QL 3C6LB 3L3GA 3PP3H 4POUB 2NY0C 1H3PH 1UB5B 4KKCC 1BD2B 4JFHE 3RA7L 3QDGB 2OZ4A 4WCYL 2Y07L 2XY2A 4X6BB 4JM2C 5DO2D 3QIWA 1SYSA 1FORH 1MJJB 4NCDA 3V4UL 3NACH 1OVZA 1ITBB 2DL9A 4AL8L 4RQQA 3HC4H 2RAMA 1HINH 1CFNA 1OTTC 1DTUA 4ODTH 3K80A 4NYLB 1ES0B 3PV6B 4HH9B 4BFBD 1RI8A 1CBVH 4L4VE 4I13B 2DQEH 4XP5L 2DLIA 4PYGA 3WFCH 1FZOB 5M94B 1FYTE 2HMID 4KRMB 3MREB 1BOYA 3F8UB 4GBXD 5TDNA 3C6LC 3MGAA 1ZOXA 1F6LL 1FZKB 5JHDD 1VEPA 3I3EA 1GZPB 3LRHA 3SQBA 4LPUA 1HXYB 2D9CA 1QD0A 4L8SA 4ZOAA 4LLWA 4UQ2B 3ULVD 4BELD 3KJ4C 3UBXG 5EUKB 3ARGD 2VR9A 1RD6A 1X5YA 3HI5H 5GSRA 4H20H 4NP4H 4FQQB 5C92A 5J89A 5LGJB 1RAMA 4OQTA 2EH8L 5D1QA 5DJCB 5IMOA 2PO6B 4Y1AA 4YGAB 3MJ9A 3MRJA 1U8JA 1BHGA 5LQBL 2ESVE 3CH1B 1XGQA 1G7HB 4HWBA 3U2SB 1TJIL 3FAXA 3ZYOA 1A02N 1REIA 3GRWH 1G7LA 4XWGL 3WS6A 3ALXA 2AJSH 3BN9D 5TF0A 4LQFL 1LD9A 3MCLH 1TPXB 5L2KB 1BVKB 4AJ0A 4YDLB 1NBVL 3T0EE 4PJ7F 1YDPA 2A83A 3E6FB 4JRWA 4QXUL 4HIXH 3VMNA 3U79A 3HUJB 3WIIH 5CEZL 1RJYB 2NMSA 3FO2B 4NJ9H 3FQRB 4J3WA 4MNGA 4P2YA 3D85A 4O51B 4QXGL 2E27L 2Z8VC 5B22A 1N5YL 3JZ7A 5IEHA 3RIFK 2Z93B 5JW3L 1K6QH 4R96B 5JO5A 4KTEH 4PJ7E 1KB5B 5IHZB 3VDAA 3ULUC 5J13B 5BZWB 3KYKL 4PJ9A 1NC2A 1TPXC 1I7TA 4JDVB 4IRZH 2XWTB 3N06B 4N9GA 5FOJA 3C08H 3QEQA 4YDLC 4PY7B 3KYAA 1I7ZA 3VXMA 5KSVB 1K85A 3VXUB 5IHUH 1HHJA 4R6UA 3TT1H 3EYVB 2ITDB 3SE3C 4JO2H 2BRQA 2K7PA 1PEWA 4MCYB 4JO3H 4XP4L 3U0WL 3O4LE 1CFQA 4I2XB 1FNGB 1FN4A 1FCCA 2AK4D 3RBGA 1K4CB 1FLTX 2OR9H 3HZYA 4NO2A 4V1DE 1HHHB 3B2VH 4OD1L 3S37X 4P5TB 3FTGB 2FBJL 5AZ2L 4U7MA 4D2NA 5J13C 4MDIB 3HRPA 3SDAA 3DMMA 3G5XA 4KZEH 3V6ZA 2ADJB 1U8NA 3CD4A 1U8HA 3OKDB 2JCCA 4OZIB 1HEZA 3CMOH 3MNWA 1EIBA 3A0OA 4JPIB 4XGZA 5J1TC 4RBPH 1LK2A 1ZANL 3FOLA 1ZVSA 4YUEH 4NSKB 1WEJH 1XH3A 1VFAB 1J10A 3DRQA 1VFMA 4G7VH 2BVPA 4OF5A 1AFVL 3C60A 3EYOB 5IR1B 3I75B 4JG1L 4Z77A 1CXFA 4QYOA 4EXPX 1V3LA 3VFMB 3O6LH 3FOMA 1YEGL 3H9SD 3MGTA 4C56A 2IG2L 2CO7B 1KENH 4P5TC 5FYLD 3EZ8A 2DD8L 3TCLA 3VRLE 3V7AE 3RWJB 1TJGL 1RZIA 1Q9KA 3G6JA 3RI5F 4R90L 3QFDB 2P43B 1CIDA 1X5ZA 4HUVB 5KOVC 2Q1EA 4MAYB 4X6EB 4JR9H 3L7FA 2YMXH 4W4OA 3RHWK 3P11L 3MRIB 3IAGC 5DJ0B 4F7MB 3MACL 3Q3GB 4KKLD 4GKOA 4L8DB 2WWMC 3HC3L 4YPGB 32C2A 4U1JA 2AXHA 4YZFE 2R1YB 4U6TA 1MCOH 2R4RH 2O26U 4HIHB 6FABL 1CTOA 3QDMD 4WUUB 3UYPA 1EHLH 1DQQA 3WBDA 1MHPH 4Y4HA 5FM5O 5CEXB 1UQSA 5CBEB 2ZUSA 4FP8H 3RX5A 5IB3B 3D0VA 3UDWC 1AXTL 5SWQB 1PYWA 4PV8B 1ZHNB 2F54A 1J11A 2WBKA 5CBAB 4MAYC 5F93C 4YBHA 4N1CA 1KXTB 4NO0B 4PJIF 5CJOL 3MZTA 5DFTA 3QUXD 5CLWA 5DGRA 2I9TB 1AQKH 3MODH 3SGKC 2IFFH 4CNIB 1QVOA 4Z0BL 2B1AH 5DT1H 2X89D 1R3JB 4AIZA 3WKMH 4X80H 3QUYB 2RCSL 3GSRA 3QIUB 4PJAB 4WHTB 5JR1H 3NFPA 5JOPE 4RZCB 3T2PA 1IGML 2H26A 1DQML 3WIHL 4ESKA 5D7LB 5KVMC 1OP3H 1RVFL 2YA2A 2CRMA 1PSKL 3RJDA 5T5FL 1HZHL 3VFNA 5GHWL 3QDJA 2NYYD 4GAGH 3IFOB 2DF3A 4NFCA 1UGNA 3KPSD 3PGCB 4G9DB 1P4LA 1WCQA 5EPMB 3BWUC 4KXZI 2VE6B 1A4JB 5GPRA 4PLNC 1GC1H 4S1SL 5D8JH 1AGBA 3O3EA 4JQIL 3LS4L 4LSSH 1HKLH 1CK0L 4EN3B 3S97C 1WZ1H 5D7KD 4UQ3A 1S78C 3QUYC 4P2OD 5E8OA 3NCJH 3QIUC 4JKLA 1J8KA 1UM4L 4IRJD 4PGEB 2P1YA 1CXEA 2EXYD 5I1EL 1FV1B 1RUPL 1N0XH 1MLCB 3VE0B 3SDCB 3MNVB 1E28A 2EE2A 3ARFA 1FC1A 3S34L 1TZIB 4LIQE 4HGMA 5A2FA 1IC5H 5MEOA 3O2DL 2Y06L 5EUOB 3RWGA 4GLRH 1OAYH 2BK8A 3NPZB 5IB4B 2YPLA 4OLZL 5ISZB 4R4BA 4RDQF 2FD6L 1MFDH 1IQDA 5HI3D 5D70L 4EN3C 1HILB 3FO9B 3IRPX 4NKOB 2W65B 1VPOH 1YEEH 3CU1A 3AS3A 1YMME 1FO0L 1WFTA 2JJVA 4U1KB 2PTTB 4HLJA 4G8GA 3VGDA 1A6UL 3H3PH 3QHTC 1MFCH 3SDCC 5DMJB 1QACA 1UT9A 1YNKL 4NZTL 3UJIH 4D0DA 1MFEL 2NW2B 3D6GA 1J8HB 5I1DB 4MCZA 2VH5L 4XNMB 3MV7B 1XGTB 3RNKB 3FRUA 3TFKC 4Y19E 5TQ0L 5DEFA 4S0SD 3F58H 3C6LA 1JNJA 4HHAA 1EBAA 2Z4QA 1F11B 4GS7B 1GSMA 1BD2A 3QDGA 1U3JA 5JW4M 2A73A 3SKJL 4FS0A 2XQBH 1JPFB 2E6PA 4X6BA 2GIYA 1BVZA 2I60H 4ELMB 4MQTB 1IQWH 1IBGH 4XB7A 3QJFB 4NQEE 1W8NA 2O61B 3CX2A 4O2EB 4XNXH 3F7RA 2CMRH 1GC1C 4HT1H 4E5XB 2HLAB 1ZHLB 4NZJA 2FGWH 1WF5A 3DYMA 5E9DE 4HH9A 3BP7B 4PRHE 4HXBH 4LF3A 1CN4A 3V0WH 3PQYE 4L3CB 5HHME 3SJVD 3MREA 5KSUB 4U1IB 2ZOLB 2OXHA 4CVWA 1FZKA 3B8YA 1EERB 3RX8A 3QEHB 1W0VB 3K1KC 4GS7C 4AZ8A 1AE6L 5E2TH 2W9LA 3I9GL 4OT1L 2YZ1A 1A6WL 3O3DA 5KVGH 5F70A 3UX9B 3KS0J 3SGEI 3CXDL 2D7TL 4KDTC 4KY1H 5LGJA 3SGDH 2PO6A 4AH2B 1D6VL 2VUYA 4Z7VA 1CXKA 3HC0B 1LO2L 1YECH 3MZGB 5H2BB 4XBEL 2VWEC 2VXVH 3VXRB 3AXLB 1ZT7A 1RIVL 2A9ML 1MF2L 4UOW1 1A7QL 1U8IB 5ADPL 4P9MH 5ILTL 5L2KA 1JYNA 4JVUA 1QSEE 4JPKL 3LMJH 4BQ6A 4K3DH 3P77B 1NAKL 3D0LB 2XFXB 3O2WH 3FO2A 1JPGB 3FQRA 1IEAB 3BO8B 5AWNH 4CW1B 3ZKMC 2P5WB 1EDQA 3CFJB 4MD4B 2VLJD 3PHOB 4Z78A 2CDGA 4H26B 3HAEG 4KMTH 5C0EB 1OLLA 2HFGL 4JFDB 4JGMA 5L9DH 5JXAH 1KB9J 4WGVB 4OD3L 1MCPH 3QRGL 2F53A 3MA9L 4UT6H 3DSNA 3KPRE 1D6EB 1MREH 1M6OA 1N7ML 1OF2B 4HC1H 3UTSD 4JHBA 1CDCA 1FNSH 4C4KT 5DGQA 4DGIL 4TNWF 4PJCF 2XWTA 3MA7A 3GMLA 2ZPKL 5DK3A 1OM3H 4YDIL 4DKEH 3GRWA 4ZFFB 3GBNL 2M2DA 3BUYA 4N8VA 3WUWB 2WQ8A 2WUCL 3G6DH 4QHMB 1JZ5A 4MCYA 3UJJL 5HVWA 4MB5A 3DX7B 5E03A 4E42B 5C6TL 1FNGA 2NX5E 1ZA3B 3D39B 4MXVF 3LEVL 4XAKD 3QNZA 1HHHA 2XIDA 1T89A 4CMMA 5J9PB 1JF5A 3TESA 3FTGA 3LEYL 2ICWI 2EYTA 2W0FB 1FDLL 5F97E 3N50A 4MDIA 3EIFA 1CZ8H 4PIRF 1VENA 2ADJA 3O8XB 3HTLX 3OKDA 3G5YB 4OZIA 3V5KB 3ARPA 4Y4KD 5D6DC 5CSZB 3OKKA 4DTGH 4JPIA 1FGVL 4MXVE 3QFJE 3I6LE 1R0AL 5F71A 3BIKB 4ZO7A 5EC2A 1Q1JL 2W38A 2C3WA 4KK5D 4PR5B 3THMH 1VFAA 2OS7A 2PW2A 3VFOB 4OJFH 2MQ3A 2O5YL 1FBIH 4WFGE 3RFZC 1CDJA 5IW1B 1FL6B 4GMTL 4BZ2H 3EYOA 4G6FB 1CD0A 3PXJA 5IR1A 3I75A 4Y2OA 3QPXL 3GZKA 5LWYH 4KHTH 5EWIL 4M4RA 5F72S 5J11B 1IAOB 1T5WA 3FMGH 4JKWA 4K3JH 5IB1A 1KN2L 1SEQL 5AYUL 1W72L 3RWJA 3QQ9D 5TE6L 5J57B 5K9JH 1OHQA 2WV3A 2ZUQB 1GGBL 3O8XC 5F7FA 1IRAY 2GEEA 1P84J 4GW1B 3Q6GH 3QFDA 5FGBA 3TN0D 4CRPA 1YPZF 5F6IB 2AW2A 4MWFB 4HUVA 4G80A 4LP5A 3UTTE 1G7IB 4MAYA 1W0WA 3E2HB 2VLME 3VXTB 4UT7H 2XWJA 4G6AD 5DJ0A 4F7MA 1HI6B 4OTXH 4HH8A 1JWSB 4L8DA 5LVEA 4K07A 5JOFB 4F7EA 4JDTH 4Z7NE 4R4FL 1Z5LA 5BVJB 1VKXB 5J11C 1UVQB 4HIHA 3HN3A 1TJHL 5HSFA 1YC7A 4KC3B 4WUUA 4EZMA 1QKZH 5FKPA 5MP6H 3WMSA 4HXAL 4AIXA 5CEXA 5HGAB 1WBXA 3IRZA 2ZUQC 4YFEA 5IB3A 2VLKE 2NY5H 2FX8H 1I9RH 1MFBH 5F6IC 1BQHA 2YXFA 4PV8A 3RZCD 4PJDF 5I30H 5GGQH 4PRIB 5F1NB 5CBAA 3OG6B 3MNZA 4PJEA 2P46B 3E2HC 4PY8I 1BGXL 4UDTB 2EYRA 4PRPB 5FKAB 1QLFB 2B2XH 4YFLI 3UTQA 2YKLH 4NO0A 2OR7A 4I0PD 5BRZD 4G8FB 4GAJH 1TLKA 3CCHB 2I9TA 1QYGL 4FG6C 2WBWB 4X6FB 5F7DB 1D5XB 3AS0A 4NKMB 1R3JA 3QUYA 4JM4L 4RISH 3QIUA 4PJAA 2BCKA 4WHTA 4PJDE 5GRUH 3TIEA 2RQ8A 2ARJA 3KPLB 2DQCL 4N1EA 1VADA 1KIPA 1ETZB 1MCEA 5JHLH 5IJVA 3BPLB 2UZIL 3A6CH 1WAAE 3T04D 3I50H 1IC1A 3BZEB 2B0SH 3KYNB 5DJDB 4U6HB 2HT4C 5JNYB 4KJPC 4BSVB 5EPMA 4WHYH 1WTLA 1WBZB 1F5WA 3OMZA 2VE6A 3RP1A 4A2LA 2G5RA 3IJSB 2GY5A 5JDSA 3SQOH 1TZHB 3RY6C 5KJRL 1AXSB 4I3RL 1IGCL 4TSCL 1NCNA 1LE5B 1Z9SA 4WFHE 4QWWD 3DVFA 5IF0B 4OGZA 3WFBL 5MENB 4MGXA 5GS3A 3NA4A 3FT3B 2IADA 1JNLL 5I1AB 3VD7A 2GJ6D 4ISVA 2J4WL 1MLCA 3SDCA 3MNVA 1OQXA 3BPLC 2FX7H 2XYCA 5TFSH 1TZIA 2X44D 5IV2A 1G1CA 1R5IA 2B20A 4OZ4B 1MRDH 5BV7L 1OWRM 5E4EB 3O2VL 3QXAA 5EUOA 3T65A 1YNTA 4J3XA 5C08B 1P2CB 5IB4A 2C1OB 3BRDA 5DMIL 4NQCD 3VG9B 3CFKB 1R5WB 2NY5C 1YYMH 3CDCA 4HMDA 5HGHB 2DBLL 3AFLA 1HILA 3FO9A 4NKOA 1P5UA 4X9HA 1ZT4B 4JRYA 2Q7NA 3ARDB 4XI5C 4M6OH 4K94H 1QNZL 3SDXE 2CXKA 2PTTA 4JZNA 4TSAL 5C09E 1F4AA 5FOBB 2YUWA 5IVXB 4AYFA 1UJ3B 2UWEB 5D7JB 2NW2A 3U6RB 4QCIB 5DD3L 5I1DA 4XNMA 5F7LB 1O7VA 2ADGA 3MV7A 3RNKA 2AVGA 5E4EC 2JJTA 2VITA 4JJ5B 3UROR 5D5MB 5GGVL 1NUGA 4KUZL 1FE8L 3MXWL 1V7MH 3UAJC 1U6AL 4M5YH 3DI3B 1MUJA 4B50A 2O61A 3TPUA 3ARDC 3A67H 2XN9E 4GSDL 3ULVH 1MHEA 4E5XA 4HBCH 1JGVH 4MLSA 1QEWB 5CJQL 1VGKB 2FZ3B 5T33L 3BD5A 2FEDD 2Z9TA 3BP7A 1UJ3C 3GMRA 3CSBA 3EDFA 4GQ9H 5C07B 2YA0A 5D7JC 1TNMA 4NOFA 5KSUA 2DM7A 2X1PA 4R0LA 4XVTH 3VFWB 4ORGB 3MC0A 4MA8L 4QHKI 3FZUD 3V6OC 2CJUL 1CL7H 4LASL 2IPKB 2GK2A 5EG6C 2YPKA 1WZKA 4JPVL 3CX5K 1ORQA 2ZOKB 1G6RH 1AXIB 2ED7A 1MJ7L 2VXQH 1OT1A 4D3CH 5IB5B 3U48A 1Q9WA 1KCRH 1AO7E 3MV9D 3L5HA 4AH2A 2XZAL 4XPGL 3V4PL 4X4XA 1Z2KA 5FCSH 4NQXB 4ZPTB 1YY9D 3TJEL 2BJMH 5E6IC 3VXRA 1CICC 3RQ3A 1U8PB 4DVRH 3AXLA 2JJSC 3ARGB 1MI5E 3DIFB 5TQ2H 4F57H 1DBJH 1U8IA 1EO7A 5BQ7B 1KJMB 3KJ6L 3ULUF 3D18B 4X7SL 1CLOL 5KVEH 1C5BL 3P77A 3QCUH 1NCAH 4L9DA 3D0LA 4LIQL 2XFXA 3QA3A 3OGCB 3IJHB 1DQTA 5FUOH 1QSZA 3CVIH 1IEAA 3BO8A 1RURL 4CW1A 1YEDA 3HUJF 3MV8B 2P5WA 5I1HH 4ZAKA 1A9BB 3VXPB 2HMIC 3RL2A 3PHOA 4LFHD 5C0EA 1G6RB 4JFDA 3RDTB 5D2NE 2BY2A 3OAUL 3HMXL 4NC1C 2FCBA 1D7FA 4JAMB 5BXFB 3H9ZA 3H7BB 2W9DL 3ULVC 2NTFB 1OF2A 3W9DA 3ARGC 5HGBA 4NRZA 4LCWD 4Q9RH 2MQCA 3QT2A 4NQVB 4TVPL 3DV4A 3MRHB 3MBXH 1IGFH 3QWRD 1L7TL 4PJGB 5TPWL 3GSNB 2CGRH 3OZ9L 5GJSH 4ZFFA 1M71B 4LSRL 3WUWA 2DQTL 5GRWA 4QHMA 1MFAL 5DMGD 5J12B 4TSBH 1E6JL 1BJMA 3DX7A 4WHDA 1PG7L 1GIGL 3BESR 1ZA3A 3D39A 1G9EA 3GSXA 3MLUL 5GGUB 1LO5A 1HYRC 3RDTC 4IDJL 4JRXA 1IT9L 2NNAA 2NPLX 3S5LB 4KTDH 4V2CB 3BJ91 1BEYL 1F45A 1MY7A 4X6CE 4LSTL 2XT1B 4KJYB 3O8XA 4NWTL 2Y7QB 4M7LH 4G5ZL 3WNPA 2BNUA 5FYLH 3V5KA 2AK4B 4NKQB 5FDWB 1XFPA 5EO1B 3BIKA 2B4CC 4PR5A 2GJZB 1QSFB 5CUSH 2OX5A 5J12C 4PJXF 5FB8B 4QGYA 4NNPL 5AAWA 2FX9H 1TETH 1C5CL 1F00I 3TZVD 4XCFL 3CLEH 1UADC 1JMXA 1JTOA 3JXAA 4DCQB 4UV4L 4X6DA 4P2RE 4Y89A 1YNLL 2VL4A 2C3XA 2CKBL 3RPIB 3VWKA 1INDL 4PJXE 4FXLA 4OZFA 3WFDH 3TVMD 3QQNA 4GW1A 1NAMH 1I3GH 3PP3K 4Y5XA 3L3DA 1X44A 2BRRL 4K2UH 1XGRB 5C2UB 3MLZL 1F8TH 3NOIA 3SDYL 5KTEH 3TV3L 5BCAA 4M43L 1G7IA 5DWUL 4GG8B 4F2MB 2OK0H 2CRYA 2JKXA 3WN5B 3H9SB 4JFEE 3VXTA 2VNCA 5E2WL 1Q0XL 1C5DB 4Z7UF 5A2IH 3Q1SH 3U30C 1MAJA 2D4DA 3WJLC 3DXAA 3GSWB 1HI6A 5T1KD 2Q8AL 1KCUH 1JWSA 5SX4I 4WWKD 5JOFA 3IFPB 1VKXA 4KROD 2EE3A 1KCSH 4J4PD 3EDKA 5DFVC 2E7CA 2LTQB 4K23L 3VFGH 3ZTNL 3B5TA 4MJ4A 3VD4A 4LLVA 4KK8D 4HPYH 2CR3A 5KG9A 1EUTA 4ZFOL 2D0GA 4Z7UE 4KVNH 4L9LB 4Q97A 3RIFF 4HS6B 1E4KC 3VFPA 5K33A 4J23A 5C0CE 1NDMA 5FUZL 3ZE2F 4C55A 4OF3A 5J56B 5F1NA 1A5FL 2VR4A 5B8CB 2VXTH 4OI9A 4UDTA 4YDVA 5AD0B 5FKAA 1DQJB 1NAMB 4XP9L 3QDMB 1WICA 3CCHA 2AJXH 3BE1L 3V6FB 1DUYB 1XAUA 3QHZL 1D5XA 1P9MC 3PGFH 4QRPE 3SKMA 3EFFB 3I02A 1UH3A 3IDXL 1MVFA 1YYLL 5IROC 3P40A 2LTQC 3ISWA 3KPLA 4KVCL 3DVNA 3KPMB 4M1CD 2X5PA 3O9WD 4GJTB 3ZKND 4ORZC 2EIEA 2JELL 4L9LC 2Q76B 5T3XL 2BDNH 4KKLC 4FMKA 3BZEA 4PJFB 2VUOA 3KYNA 2IQ9L 2CRIA 4H8WH 5D2LA 2DQFB 5B8CC 4BSVA 1UC6A 1AP2A 2XRAL 2R0KL 1WBZA 4U2ZA 5FA3B 2AJVL 4HFWA 1YMHB 3IJSA 5EZIH 2DICA 5ESQB 5ELIA 1TZHA 3STLB 3ZHKA 4X7DC 3NABL 2FH8A 5ESVA 1U95B 2D7PA 5IF0A 5E2JA 5FCUH 5MENA 3NVQA 1QRNE 2VDRH 3WJJA 2ADFH 3FT3A 3KPSB 4JFZL 3JWDH 3NTCL 5I1AA 3BKMH 2AJUH 3EKCA 3I2CH 1QA9B 1MHCB 4PRBB 4RGOH 3MYZA 4NHUB 4P3CL 4ZUUB 3DJ9A 4G8EB 1GZQB 1NCDL 4E41B 2WQRA 43C9A 4BA8A 4P2OB 4TPRH 5F7YC 1P2CA 2C1OA 4JFHD 4IRJB 2C5DC 1QR1B 3CFKA 2CPCA 4L1DA 2XY1A 5HGHA 1LK3H 4DWHA 3ARSA 2GFBB 3IDJB 3EYFA 2OJZL 5E1AA 3FONB 1RZJH 4HUUA 4XB8A 2X05A 5JQHC 1NGPH 3ARDA 3ZSSA 3G9VA 4N0UE 3SE4C 1EVUA 2Y4SA 3DHMA 3QNXB 4QOKD 3IDUA 5FOBA 5GRZA 2QQNL 4P4RB 2V2TB 3KR3H 4NFBA 5IVXA 3TBSB 3LOWA 1R3HA 2UWEA 3GKZA 4L29B 2BNQA 4LCYB 3U6RA 4QCIA 2YC1B 1FYTD 2BNRE 5JW4N 4KZDH 4JJ5A 4P2OC 3D87B 5D5MA 2APXA 2DM4A 1JGUL 4IRJC 1F6FB 3V6OA 2EXYC 1UACH 4L4TE 5FK9B 1B6UA 4D94A 4H8WC 2JB6A 4PJHA 2YXMA 2F8VA 4MAUH 4PJ5E 1QP1A 1YUHB 4ELMF 2EDWA 4JJHA 4ONFH 1QEWA 3MRGB 2AXGB 2L7UA 1VGKA 3S4SB 3GNMH 2FZ3A 2HJFB 3A6BL 2VKWA 2HN7B 4JLRB 5I19L 4ELKB 3BPNB 1U91B 2DLEA 4UB0H 5B38B 5HI3C 2F8XC 4BH8B 1VFBB 3V4VL 3T2OA 3JWDC 3CXHJ 4XAWH 3CFCH 3B9VA 3HZMB 3T0ED 1UM6H 2DQJH 2V7HB 1P5VA 2H1PH 4GUPB 5D6CB 2IPKA 1AJ7H 3NZ8B 2ATPB 2YUZA 1N5AB 1X5IA 5HYSB 3VI4F 5A3ID 1R5VB 12E8L 2A77H 1KTLB 2R9HD 1BF8A 2DS4A 4U6YB 5CILH 3G08B 4LCIH 1ZLSL 3SJVB 2ORBH 2SEBB 3WO3B 3HPJA 4GBXA 2QADD 5JHDA 1DJSA 3BQUD 3IETA 4LAJH 5TF1L 5GRVK 1JWUB 1RZJC 3RUGE 4LHQB 3BPNC 4LKCB 5KANI 2GCYB 5GGTA 4OLYH 1JRHI 3BZFB 3VI4E 3K2UH 1U8PA 1UWEH 1I9EA 3SE9L 3DIFA 2HJLB 3WFEL 1F90L 3L1OL 1KJMA 1F2QA 4L1HA 5BQ7A 4KH2A 4WGWB 2GAZB 2XICA 4YE4L 4R7NA 1QFWI 2R1WB 4XVJH 5T5NG 2FYYB 2ZCHL 3OGCA 3IJHA 5HVHB 3T0DA 4WTZG 3HZVB 1UCBH 4I77H 1IGIL 4YFLF 2GW5A 4GXUM 1B4JL 1IILE 1BVLB 1KPUA 3FN9A 5HHOD 5DD6B 5FDYA 1OOAA 4OLXH 3W9EA 5BO1H 3MJ7A 1WT5C 3I3BA 8FABB 1M7IB 4JAMA 1T1WB 1OP3K 1A3LL 1N2RB 3M07A 4P4KB 2VDMH 5FYJD 5A40E 2IBZY 3CFBB 4NQVA 3NZHH 2R23A 5DMYA 4PJGA 1SBSL 1IC7H 5HVHC 4YC2B 1T66C 4YXLL 2QQLH 3K2MC 5IVZB 3EOTH 4JHAH 3V5HA 3GI8L 5KANG 3I6KB 2KH2B 1YQVL 3MPCA 4FQ1L 1X7QB 1V3KA 5L8JB 3S5LA 4S2SB 4KMLB 1H5BB 5EORH 4Z8FL 5C0JB 4P4KC 1JGLL 5EOQL 5EULV 4LRNH 3H3BC 2Y7QA 2VSDA 4NNYB 1T2QH 1A8JH 3AY4C 4OI8A 5FA4B 2AK4A 4C54A 2WWKT 1KLGB 5FDWA 3V5DB 3RA7H 1RIUL 2BVEA 4G8IB 2FHCA 4WCYH 2XNAB 2Y07H 4YC2C 3OR7B 3MYJB 2CR6A 2LU7A 2VDLL 2X70B 3WJLA 1J1XL 3V4UH 4AL8H 4CU8A 1JPSL 3CMGA 4Z18A 4Y4KB 1BZ9B 3VMOA 3UZEA 1H5BC 2D0FA 3JVGC 2QSQA 4XP5H 2YRZA 5BOPA 3QQ3B 3GSUA 1E4KA 2P7TB 4EVNB 5J6GB 4CADA 1RZKC 2BZDA 1BAFL 1XGRA 2HTKD 5GXBB 5D1ZD 4M1GL 4F2MA 3WN5A 3H9SA 4P0DA 1BWMA 5E8EB 5F89B 1C5DA 4RMWA 5DJYA 3TA3D 1WWBX 3FN0L 5FO9B 1WCBB 4M4PA 1PVHA 3LB6D 4HJ0C 1DEEB 2EH8H 1P9MA 3BP6A 5DRNB 3TN0B 3S36L 3IFPA 3S96A 5JOPD 3ILPB 3OAZK 5LQBH 3HMWL 5IROA 4F37K 1T3FA 3QPQC 4KTYA 1A7OL 1TJIH 4EOWL 5I2IA 4KK5C 4AEIH 3ULUL 4XWGH 5MEQB 4LQFH 1II4E 2X1OA 3HNSL 4J12A 4GMSL 1QR4A 2PETA 4Z5RA 4Z9KB 4D8PB 4OM0L 1J9CT 4EDXB 1NBVH 3L5JA 1MEXL 4WO4D 1WC7B 4PS4L 3QUZB 5JA8B 4OF0A 2CLRA 4H5SB 3LIZL 2CLVA 3HG1E 4OFYD 3QH3B 3UPCA 4QXGH 2E27H 1AD0A 1N5YH 1YA5A 3SCMD 3QQ9C 2XQYK 3V6FA 1DUYA 3OKNB 4GW5B 1UA6L 3FL7A 4GRLD 1BREA 4HF5L 1JI2A 5DS8B 3TN0C 4JZOB 5JW3H 5EBGA 1S5IH 3BIBX 4QTHA 5F1OB 2DQIL 3VCLB 3KPMA 1A1NB 1L9MA 3QJHA 3BGMB 3IB4A 5CJXC 4N8VG 4UU9B 5B3JF 2BSSB 3OKLB 4E9LA 3KYKH 4I0PB 5BRZB 2Q76A 4G6AC 3QUXA 4WUKL 4Q9QH 1EFXD 3S35L 2X89A 5DRWB 4EXKA 5SWZB 1N8ZB 3QUZC 3T4AA 1XGYH 4LOUC 4KFZC 2VXSH 5FA3A 5F3BA 5I0ZA 1T4KA 1L7IL 3WNLA 3VXSD 2YSSA 3B2UD 5ESQA 1FVCA 2HTLC 5ICZB 3FB6A 4GQPH 5B3JE 1JYVA 2XWBB 4XP4H 1GGIL 1A6AB 3U0WH 4Y16D 1N4XL 1U36A 1TNNA 1S8DB 3SE4A 4DGYL 1A7PL 1A9EB 3BEWA 3KPSA 1M05A 2AI0L 1U42A 4OUOA 4TVPD 2IAMC 4PV9B 1GAFL 2FBJH 5AZ2H 2BVQA 3F7QA 4PRBA 4K3EL 3T0VA 4ZUSB 3D48R 4KKBD 2BVTA 3U7AA 4Y19D 5DJAB 1FIGL 1S5HA 2GSIB 3H9YA 3PWVA 4P2OA 3PWJB 3KNBB 1ZANH 2PYEE 4BFEA 2R2HB 3IDJA 2GFBA 4MA7L 2JIXB 1AFVH 3DV6B 3FONA 3NFSL 1T22B 4JG1H 5DVNA 3MOBL 4DN4L 1SM3L 4DKAA 2V7NB 1YEGH 1JTPA 4XNYL 5JDJA 5FYKE 2I25N 4OLVL 1F97A 1MH5A 2FDBP 2IG2H 2V2TA 4P4RA 2Q20A 2DD8H 1Z6JT 2HVJA 3TBSA 4J3VA 3C5SB 4L29A 2OYPA 3L7EB 1TJGH 5C0GB 4BUGA 2BC4B 2YC1A 5HHMD 4EKXA 4R90H 5E6YA 2AV1B 2VZVA 2DL2A 5F44A 1KLUB 4QWWC 3UPAA 4GG6B 1RJLB 1T5XB 5IFHL 2X9WA 5IW6A 3VJ6B 4Y1AE 2XTJB 4LHUA 2JJUA 1S7SB 4MJIB 4PB9L 2C26A 3BEVB 3P11H 4OFKA 3W11C 1ZA6B 3I85A 2VZ1A 3MACH 1YUHA 3EDJA 1IKNC 4PBWD 4I8DA 3HC3H 2NQCA 2X7LB 1BQHG 3MRGA 5AAMA 3BP5A 6FABH 4ELKA 5EA0L 1U91A 1QBLL 4ZUWA 1VFBA 2YD1A 4MNGE 25C8L 1G9ML 3ZDZF 3T3MF 2MPAL 2Z31D 4IRSA 4PUBL 1BZQK 4MJ5B 3V7MA 2BP3A 2V7HA 2XTJC 4OKDA 3WFHB 1IM3B 4CDHA 4GUPA 3NZ8A 2ATPA 1KJVB 2QL1A 1H15B 4ONGL 1N5AA 2P8PB 3GDBA 5CJOH 4KUCF 2YD9A 2FR4B 4U6YA 4Z0BH 1DANU 4YQXL 5I76B 3SJVA 2RCSH 1CDGA 4HIJB 3V8CA 5F88B 3QEQE 2I9LB 1IGMH 5C7XL 2F5BL 5H94B 3VXME 3Q48A 4LKCA 3WIHH 4HS3A 5HI5C 5C86A 4DGVL 1RVFH 2FH6A 5HD8D 3O3AB 4C4KO 5C2BL 2HT2D 1PSKH 5IQ7L 5T5FH 3EUUA 3BW9A 2VQUA 2GAZA 2JCCF 3MV9B 1JCKA 1ACZA 1A7NL 2EC9U 3QZWB 3OKYA 1KT2B 2R1WA 2WIIA 1Y0LB 1PZ5B 1OSPH 5DEZA 4S1SH 1JP5A 4U1MB 1PKQB 1I4FB 1JZ2A 2E9IA 1CK0H 3Q5TA 1IAMA 3PNWA 1ED3A 2HP4A 2VQTA 3WL9B 2Q8BL 2BY3A 2R0LL 1UM4H 3M45A 2JCCE 4KK9D 1T83C 1T20B 2FHFA 5T3XD 5F7WC 8FABA 5I1EH 1M7IA 1SY6H 4RMVA 1RUPH 4U1LA 5BZDA 1H3GA 1K8DA 3QEUB 1N2RA 2R2CA 3S34H 1CGVA 1LILA 2BVOB 4JY5L 4WDIA 1WGOA 3LEXA 2CDFB 1TZGL 4D0CB 3SDDD 3O2DH 3CFBA 2Y06H 2D7NA 3HR5A 4OCRH 2VLJA 1Y6NR 3QFJD 2OI9B 2GJJA 4OLZH 3MRPB 2FD6H 2P42B 3DARA 3VRJB 5IMMA 1YY9C 3D5OF 5D70H 4C56E 5GS0D 3KLSA 5IVZA 4ZXBD 3WLBB 3MOAL 2B39A 1NGWB 1OW0A 3UTSA 5GZNC 1AR1D 3I6KA 1JGEA 3G6JE 1FO0H 2AJ3B 4PBXA 5EU7E 5I8EA 2K1MA 4KI5E 1MCIA 5AEAA 2J8UF 3K8LA 4KKAC 1KELL 5BS0D 2H8PB 1A6UH 1QLEL 3RTQA 4S2SA 2GTZB 1H5BA 3JVGA 4NZTH 1YNKH 4LPYA 5C0JA 1JTTA 1MFEH 2DDQL 1JZ4A 1BBJA 4ERSL 1CFSB 3JV6A 5TQ0H 3BVNB 3TIDB 4AMKL 4HEPG 4NRXB 1S9WA 4XC1L 2OI9C 1FPTL 3V5DA 1GHFL 4CDGC 1ZMYA 4XP6L 3SKJH 4YH6A 5CD5D 1KEMH 2ZG3A 3OR7A 3MYJA 5HBBA 2JB5L 1ZS8B 4NCC1 5JUEL 3D3VE 4LLMA 4U3CA 2X70A 2R1XB 2KPNA 3ALPA 4D9LL 5IMKA 4PJBB 5C0DB 3GK8H 1ZHKA 4IOFD 4Y4KA 1BZ9A 2HKFL 4YXHL 2F54E 5F9JA 4HJJL 5T1MA 4XTRD 3R06A 5T3ZL 2E6QA 1FO0B 2VYRE 3FT4B 5EOCJ 3RVWD 2IANB 3QQ3A 2L4OA 2P7TA 2UYLB 1T6VN 5CEYB 3TZVB 1AE6H 4HQQL 4OCMC 5DQJB 3U7WL 2WM0A 2FNBA 3ARTA 1KTRL 2YZ8A 3I9GH 4GT7A 4OT1H 5ICYB 1A6WH 5E8EA 5F89A 4JANB 3CXDH 1PBYA 2V5YA 3QG7L 5EIQA 4UZGA 5FO9A 2WP3T 4YHIA 2H9GB 3QWQB 2PXYB 3TVMB 4W70A 3TC9A 3TN0A 5DRNA 3QDJE 1D6VH 1CFBA 5DD5L 5DHYA 2W9EH 3GMPB 1U41A 5T5NF 2VZSA 1SEBB 4QRSB 4R26L 5BW7A 3CC5B 1YEKL 5CJXA 4X5XA 5L88L 4HLZH 3HI1A 1WISA 1ORSB 5MEQA 1RIVH 2F19L 1FAIL 2A9MH 1MF2H 1A7QH 3DI2B 5CGYD 2A6DB 4XP1L 4Q9CA 5KAQG 2RBLA 3TZVC 4D8PA 4JPKH 4WWKB 4EDXA 1HHKA 3C8KB 3DTXA 1NAKH 4D9RD 4H5SA 3ZDYF 4KROB 4KV5F 4N0CD 5FO8B 2XQYG 3IDIB 4LNRA 4X8JB 2D3VA 2PXYC 2HFFA 3TVMC 5DS8A 4JZOA 4M3JA 4Y8AA 3SKOA 4BQCA 2HFGH 3CSPA 3MROB 3ARQA 4J8RB 3RZCA 1F3JB 1IC4L 4M3KB 4OD3H 1QHOA 3VCLA 3QRGH 1A1NA 1H0DB 2YPLE 3MA9H 3IFNL 2DIBA 4KV5E 3NIFF 4UINH 5EDXA 3UMTA 3ZE1F 1N7MH 4CN1A 4UU9A 3SO5A 2BSSA 3OKLA 1LP9B 4I0PA 5BRZA 3PHQB 4DGIH 5BJTA 2ZPKH 4WWKC 4YDIH 4JDZB 1N8ZA 5HJ3B 1Q38A 4KROC 4QRQA 3GBNH 3HA0A 4J4PC 3K3QA 4G8GE 5GRXG 2WUCH 3NIFE 3ZE1E 1NFDA 5K93A 5ICZA 4PTTB 1A6AA 4OBSA 5IKCA 5C6TH 3GHBL 4ZPVB 3DVGB 1JWMA 3O41B 3LEVH 5EO9B 1MIML 4LPCA 1S8DA 5DJ8B 5IBUB 4IOSD 5C09D 1V7NL 5E7BA 3SKNA 5MEPB 3JTTB 5JPMA 3QDGE 1FH5L 3LEYH 3LRSA 4JFPB 2N7BA 3U0TB 1FDLH 4LBEA 4KKCD 3AREA 4OIAA 3HE7A 3EDEA 5DJAA 4JM2D 3MRBB 2GSIA 2MCG1 3BT2L 4OFVA 2ICCA 1FGVH 1G0DA 4ZDHA 1RPQA 1R0AH 2X4RB 1JZ8A 2GUOA 2M8XA 5KSBA 1FHGA 1Q1JH 2CQVA 3WNOA 3BGFB 2R2HA 4M1CC 2GJ6A 2O5YH 4LVEA 4O5LH 3ZKNC 3HPLB 5EO0B 4GMTH 2EDKA 3DV6A 4NO3B 4P9HH 3LPWA 4OZFG 1T22A 1FZMB 3QPXH 5E2UH 3ZT7A 5EWIH 3LSOB 4XX1G 4EI6A 2CXGA 2V7NA 4Z7VF 1I3RA 5DJ2B 4WW2C 4MZ3A 3IGAA 5DJ6B 4NQCA 1KN2H 1SEQH 5AYUH 3C5SA 1W72H 2DMBA 1NKRA 3L7EA 3LS5L 4N1HB 5TE6H 1DDHA 5CIPH 5C0GA 2BC4A 1GGBH 4WFEE 4OLWH 3CVHA 4MD0B 4GG6A 3QR2A 1RJLA 1T5XA 3KXFD 2WINB 2XA3A 4MA3A 1KFAH 4Z7VE 1S7SA 1UZ8B 4RAUA 5DRXB 3BGFC 3LKRB 5FIEA 3N1GC 1A6TB 1ZWIB 1CGYA 5CMAA 1HHIB 5JW4R 3PXHA 4MZ2A 1SJHB 1AO7D 1FYTB 2HWZL 3NCMA 3K8KA 1V3MA 2YWYA 4R4FH 2X7LA 5EC1A 2YUVA 3VXOB 5L2KE 2G2RB 1NMBL 1TJHH 5B39A 1QO3A 3IDMB 1LO3L 4K3HA 1YN7B 5DTFA 3RU8L 4HXAH 1OAKL 2H32A 4HWZB 4HWUA 3I6GA 2QR0A 1EO8L 1NDGB 2ED9A 2BSED 2OMBA 4P2CG 4MJ5A 1VB9A 5A2KH 1W72B 2UV3A 1IM3A 5ITBL 5CIPB 1BGXH 2VOTA 4WY7L 5KOMC 1KJVA 5HYEA 4YHZL 3WEXB 2P8PA 4AT6B 2F53E 3N85L 1S9XB 2BHZA 1QYGH 2FR4A 3EBAA 4XVUC 5JOEA 2LQRA 1MHHB 3OJDB 4HIJA 3ULUD 1BLNA 3OBAA 1M7DA 4FQJL 1IGTA 2I9LA 1RZ8A 2R15A 1ZGLP 3T0EB 5EZOL 4K9EL 4NQDA 2ADIB 2DQCH 5H94A 5C0IB 3MLWL 3F5WB 3CLFL 2XACC 5HPMA 1OARL 4JY4B 2I27N 3O3AA 5I1KL 3O0RL 5I18L 2UZIH 5ICXB 1Y18B 4EQ3A 1QOKA 3I84A 3PP4L 3MV9A 1AIFB 1EZVY 2V9TA 5TE7L 3X13B 1TQCB 2K3TA 2QADB 1CT8A 4JPWH 4Y7MA 3BQUB 5E8NB 4GXUN 4PJ7B 4MQ7A 2NY6B 1CLYL