2JELL

Jel42 fab/hpr complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
217
structure length
217
Chain Sequence
DVLMTQTPLSLPVSLGDQASISCRSSQSIVHGNGNTYLEWYLQKPGQSPKLLIYKISNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIGDGARQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSDSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords JEL42 FAB FRAGMENT
publication title The 2.5 A resolution structure of the jel42 Fab fragment/HPr complex
pubmed doi rcsb
molecule tags Complex (antibody/antigen)
total genus 47
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 1998-02-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2jelL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2jelL01
4HJ0C 4LHUG 5C71A 3V95A 2QSTA 5J11C 2MNUA 4ZG1A 4P4KC 3RNQB 4GXUM 4O4YL 1F97A 2A1WH 2Y36L 4YHYB 5HPOA 3I2CL 3N1PC 1CBVL 3RY6C 2OJEA 5T1LA 1IT9H 2VL5B 3GSNA 3BGMA 3BQUA 1MJUH 1YEKH 4TSBH 4EN3A 2GSIB 2PUQT 4RQQB 5C0JA 2BMKB 5E8NB 3DETD 2QBWA 1XGQB 1F4WH 1HE7A 3BH9B 1D5IL 3AY4C 4BZ2H 4HKZA 4LRNL 3S37L 2H8PB 1YPZF 4PLJC 1MLCB 4GAYB 2YUZA 3MV7D 3OQ3B 4XBGA 4CVXB 2IQ9H 3O0RL 3WIHA 1HSBB 2OZ4A 4FA8A 2PO6D 3RWDA 3D39A 1K3IA 4XP4H 4E42B 1KTDA 3MODH 4DVRH 1U8LA 2HJLB 1AE6H 3VCLA 1JYXA 2ZUYA 2C3XA 3WHXA 4L8DB 5CCKH 2HTKC 3KPQA 4PG9B 2QADC 4NKIL 4PG2A 5HY9B 3OKMB 4LCCA 5SX5H 1REIA 3KPPB 3SJVD 2HMID 1JTOA 5FYKU 4LRIA 5K9KA 3QUZB 3P4NA 3PQYE 3TIEA 5EC2A 2DBLH 4NQCD 1RUAH 4NQDA 5I1DA 5I71C 3VA2C 5K59F 1QHOA 5D5MF 3W82A 2Y72A 2P24A 1D9KB 4BQCA 3HI5H 3BVNA 2AEWA 3GRWA 3TN0C 4UBDD 2P5EE 2EDDA 5FO8A 5IB2A 4BK4A 3MR9A 2WBWB 1NCDL 2V2XA 1Q9WB 3G6JE 4NQVA 1Q38A 4OCXL 3F58H 4DTGH 5DMGC 1XF3A 4ZFOL 5ANMB 5EUOA 3S4SA 2R4SL 4F9LA 4QHKI 5ESVA 3ARDA 2I9TB 2DYPA 2DQUL 1X5LA 1KJ2L 3H7BB 3H9HA 4PY7B 3EO9L 4X6DF 4DEPC 3F8UB 1T1WA 5CFHA 3ROOB 4NQED 3G6DL 4EQ3A 2J4WH 2CRYA 5HVWA 3L5HA 3P0VL 5IBLD 4FTVD 2FO1A 2H32H 4GG6A 1CDUA 1A7RH 1KIQB 4N8VB 3HC3L 3IDYC 4Y4KC 3BPLC 4KROB 4IIQA 4JGUA 1SY6H 1XCTB 1Q9OA 2D7PA 2FCBA 5J8OA 1RUPL 4LCWB 1FBIL 3T3PF 4Z77A 5ACZB 3BJ91 3X17A 1XGTB 3M8OL 2PF6A 4YFDB 2A83B 4JB9H 3GI9L 3O6FA 3QUXB 2NW2B 1V3JA 1GAFH 5HHOA 4O58L 3NTCH 2FD6H 3P2TA 1RIHL 2JB5H 4IOIB 1YEJL 3QUMB 4K3HA 3WLWD 4RFOL 2ADFL 4LNRA 4NSKB 1T3FB 1MWAH 3DUUA 1MI5E 4R2GC 4GSDL 2JJUA 4ZFFA 4MAUH 3T2PA 1CE6A 1ZT4B 4KDTA 5FFLA 1NDGB 4FN0A 3FO2A 1BJMA 1NEZG 3S34L 3KS0H 5EFIA 1YEIL 5IVXB 1AC6A 2IMMA 3SDYL 4ALAH 3WIIH 2BNQD 3ULUL 4OLWL 5C0FA 1DBAH 3GM0A 1U92B 1W0WB 3NPSB 4KU1A 4NO5A 3Q1SL 3P4MB 2Q3AA 2CKBB 4HCRA 3FQXB 3K4DA 1A02N 1AO7E 4KK5D 1AP2B 5D1XD 3PGFH 4XVJH 3CCHA 4HC1A 4Z8FL 3B9AA 1JZ8A 4G6MH 2IJ0C 5F9OL 1LMKA 1KTLA 3OG6B 4JRXB 1L7IL 4NM8H 2AEIT 3VXPA 4TVPE 4MNGA 3OJDB 3DHJA 2A9ML 5D6DC 4JPVL 3QQ3B 1LDPL 3QEQD 5D1ZA 3L5XH 3TBYA 2AJYL 1E28A 3MOBL 2W65A 5B8CA 5CUSL 1Q9KB 2ZCKL 1CQYA 1KCSL 3SKUD 3QRGL 4FZ8H 4FNLL 1U41A 4OQ1A 4YUEH 5ETUA 3W9DB 2KUTA 5DK0A 3MRKB 3O3BA 3ROLB 2AI0H 2DI8A 3QO1B 1T66C 1AHWC 2HFEB 4LSPL 1ZLVK 1ZGLA 4OD3L 2DQCL 7FABH 4NQXA 4FMFA 4OZIB 3KLHD 3SCMC 1BLNB 2FRGP 3X11A 4OAWA 3ZE1E 3OB8A 2BOCA 4PRAA 5IR1B 4OFYA 3I02B 5LBSH 2ZUXA 3DBXB 1LEKA 4P23C 3EJZC 4WW2C 2K1MA 5EU3A 5FUCE 2DLEA 3C6LC 2LV4A 3TYFB 2W9LA 4QXGH 3QG6B 1XIWA 3KNBB 1OQXA 3UTTA 1A3RL 1A2YA 2J8UB 1YY9D 5L6YL 1QFOA 3DRTB 3OXRA 5GRZA 5T3ZL 4Y16A 4OBRA 1EAJA 3B2VL 5J1SC 1HQRB 1QA9B 3HE7C 4OTXH 1IT9L 5DQDH 3TIDA 4EVNB 2YPVL 1MJUL 4JFDB 1YEKL 2R29L 3CX5K 4TSBL 5E5MA 5DDHA 5ICYB 4ORGB 1C1EH 4CADB 1NAKL 3I85A 2VDRH 5JDSA 4W6YB 1F4WL 3LEXA 3BGFC 5FK9A 4H26A 3VI4E 4WY7H 4F15C 4BZ2L 3B43A 5F9WB 4QF1B 3RHWF 3GGWA 4AH2B 1EGJA 2IQ9L 4BSWB 2N4IA 4N90E 1YMME 2FYYA 4RFNC 3AGVA 1CFTA 3RWHB 1QRND 5MEPB 1NAMB 4L3ED 5EG6C 2OP4H 3AS0A 4X4ZA 3C60C 4XP4L 2NXZC 2YN5A 4GAGH 5J11B 4EXPX 3F6IA 3MO1B 4DVRL 1OLLA 3EYOA 2B2XH 3O8XD 4J3TA 2RCSH 3T4AA 1ZE3C 2A6JA 5CCKL 3D9AH 1HXMA 4JKLA 1SVCP 5HDLA 3RGHA 1NCBH 3RWIB 3UJJL 4IDJH 4YDLC 3TT3H 3QI9C 7CGTA 2P5WD 5T1MA 3WFHA 5BOPA 4RAUA 4ZPTA 2CIIB 1I7TB 4M62H 4MNHB 2DBLL 2A73A 1WZLA 1RUAL 4QRRA 3LPFA 4FFWD 1JE6A 1ZK9A 3QDJE 2VL4A 3LZFH 1VFBB 3I6LE 3IYLW 4GBXC 4L3AA 3NCBB 2DLTA 1KYOK 4YDVA 3NIGE 2H3NA 3D2UD 2R0LH 1UM5H 4CVUA 2N1KA 3MMEB 1D5MA 4W70A 2V2TB 1MAJA 4JZJA 5C09A 2G2RB 2ZSVB 4F8TA 3OXSB 3HAEA 4EUPA 1QZ1A 2X1QA 1AXIB 4WUUD 1MHHB 4NKDB 5C0CE 2C3VA 1TZGH 4JANA 3MRLA 1X5AA 4KK6C 4ZS7H 3QIBB 3HN3A 1ZLWK 3AMKA 4K23H 1N8ZB 3HZKA 1IFHL 4RWHA 5I71B 2OTWB 5DXWA 2J4WL 3QIWD 4ZSOE 3BP5B 3TJHC 4D0BB 1WZKA 1MHPH 5I0ZA 5EZJB 1D6VH 4B0MM 5HVHC 1A7RL 2VZ3A 3BN9C 1HXYA 2XICA 1P4BH 4OD2A 4N0YL 2D7QA 3WFZA 4U1IB 3P4OB 1A6ZA 4LKCB 3MACH 1JNNL 1MFEH 4P59L 4DAGH 2CDFB 4N0UE 5DFVD 4A6YH 3MCLL 3T08A 4JFQB 1WCBB 2ZKHL 2C3WA 1FNFA 3NTCL 2FATH 5CD3A 3E1F1 1NLDH 4LCUA 1A1OB 3VXRB 5I9QC 1R3KB 1PG7H 1W72B 3DIFA 1MWAL 4KTDL 2ICWA 1FZMA 4XPAH 2NW3B 5FYLH 5HGHB 4MAUL 1EO5A 4JDTL 5CSBA 1II4E 2G9HB 3CDGB 4Y4KB 2VLKD 2ZOKB 4K8RD 4PJBE 3UX9B 4YHOH 1S9XA 1U36A 4YBQC 4JFXA 4PJHB 3N1QC 2BSSA 2WZPD 3WIIL 1JF5A 4PRIB 3WJLA 3JV6A 4LVEA 1GPOH 3X13A 1XF4A 2VXTH 2DKSA 3OKDA 3MBXH 4EI5D 3SGEH 3FRPA 3MRGB 5KVGL 1MSPA 5BQ7A 1Q9LB 2DLGA 1U3YA 4KUZL 4OIAA 5TGBB 3LKOB 3GSVB 2HKFH 2EEAA 3TCXA 5HYQB 2KPNA 1P53A 4PGBA 3PGFL 4WDIA 3T4YA 4XVJL 4L8SA 1EBAA 2C5DC 3D25A 4N68A 1KB5H 5KW9L 3KWWA 4G6ML 1IM9D 1HI6B 3TYGL 5TFSL 1YN7B 4Y4FA 5BRZB 2F5BH 2IBBA 2GUOB 4Z7WB 4PS4L 1CFQB 4X9HA 3MRBB 3KYOB 4NM8L 4BZ1L 3B3IB 5B38A 4HK0A 2XIDA 1DLHB 1F4YH 1U58B 5TE6H 1IAOB 1NFDB 3DVFA 1OGTB 1GRWA 1A47A 1EAPA 5FUOL 1T7YA 3QCTH 1NMCC 4ZAKA 3VFMA 4ODBD 2BY1A 3NABH 1UB6A 1GZPA 2XTLA 4NCC1 1ZV5A 3AS3A 3N06B 4YUEL 3DROA 1X4YA 2AI0L 1PW3A 4NQUA 4XNZC 5DD3H 2AEPL 5IMOB 1BBJA 5I75C 2R2EA 5CSZB 7FABL 1GYAA 1AGCB 4X7TA 2ADGA 3JV4A 1ZWIB 5TPWH 1G9ML 1RK1B 3IKCA 3MLSH 1OTUC 2XOTA 3P77A 4LNVA 4HS3A 4FXGB 5EO0B 3QO0B 4EDWL 1AGFB 4HH9A 2EYRB 3T2NH 3EGSB 2O5XH 4V1DD 5IVXF 1U9KA 1YPZA 3GJFK 1JUFA 4PJFE 4H88H 2PW1B 3C8HA 3O2WL 1BOGB 1I3RA 1H3UA 1T4KA 1JFQL 4FRWA 5EOTB 3QDAA 4FZEL 4P2RE 4RISH 4IHOA 4PJ9C 3ESUF 1S78C 2J6EL 4LLYA 4L4JA 4L9LB 4U1HA 1AQDA 3GBNH 4J8RB 5CJQH 1QNZH 1PJ9A 4JO4H 3EKCA 4OTXL 4OZHB 4Q0XL 5DQDL 5E08H 1DBML 3TJEH 3LPWA 2AQ3A 4Z7UB 2VDRL 1OTSC 1KV3A 4UU9B 3VXUE 2KBGA 4KK9D 4WY7L 5GIRA 3MRQA 3MRDB 3PIQA 1S7SB 1KACB 1WBXB 5FA3B 4WUKH 5DJAA 2PNDA 4X4YB 5F3BA 5IG7A 4ONHA 4Y5VC 5D5MA 4GS7C 3PG2A 2XACC 1A7NH 2OP4L 2HJFA 3P9LA 2CJUH 1LD9B 4U4BA 1HH9B 2PCPA 5CP3A 3SDXB 3FHQA 4OZIF 2B2XL 2RCSL 5I16A 3UTQB 3NIFE 1K8DB 3D9AL 4JKMA 5DEGA 3OAUH 4MJ6A 4IBLT 1IGYB 3CJJA 3LRSA 1NCBL 4L8BB 1C5DB 2C1PA 3TT3L 5E56A 3GMQA 2I07B 4GRWF 1UM6H 1ONQB 1RZ8A 3BGFB 1UZ6F 3TH3T 4M00A 1E27B 4M62L 1AXSA 1VA9A 4TSAL 4X6DA 4POYA 4MS8C 4NNPL 4NQSB 4RFNB 1F02I 3OAYK 4WFFD 2VSCA 5C07A 2J8UF 2R0LL 1UM5L 1MVUB 3LQMA 5DRNA 3AUVA 1T89C 2D0FA 4DZBB 3MUGA 4WFGE 3FO9B 2HVJB 3TBWA 3JWOL 4L4TB 1I8MA 3HE6C 5T1LD 3BQUD 3BUYB 4EN3D 3MLUH 4P9MH 3I75A 4S1DC 1F3DH 3I50H 1TZGL 1I9IH 4UNVA 4UTBH 1BPVA 5E8EA 2YD8A 4ZS7L 3S35H 1OLZA 4QXTB 5EO1B 1OAXL 2VIRB 2X9XA 3LN5B 3BP6A 1F6AA 2BRRH 2B1AH 4PJXB 4D9QE 1QQDA 5F88A 4GBXB 2NXYC 4TUJA 5DK2B 4ZUVB 2OI9C 2VZ1A 3D39D 5FGCB 1MHPL 3QXUA 2QQKH 3S36H 1MCEA 4XRCA 1U3HA 1DN0B 5GRYA 1P7KB 1AKJA 4MA3B 1QSZA 3SO3C 4U3CA 1P4BL 5CWSA 3V6ZA 1FVDA 1IC5L 3SY0B 2X9WA 3MACL 4X5XA 3RWEA 4DAGL 2UWEB 5E4IA 1FNLA 5AD0A 5IF0A 4UIKH 4X6FA 4A6YL 2VISB 4RFEB 5B3JE 1GC1H 2LFGA 4F7MA 4QTHB 1HDMB 1M05A 2JELL 5SWZE 3MZGB 1I1CA 1NGPH 4HUWB 2FATL 2HA1A 3AMLA 4NQDD 5HPMA 1A8JH 1OSZA 2MQCA 2R1WB 4N5ED 2MQ0A 1PG7L 5L8LB 2HWZH 1I7RB 3V2AR 1LGVA 5FYLL 3OZ9H 3O3AB 1NGZA 5DSCA 4WFED 1A6TA 4P5TA 5DC0A 4HUVA 5E2UL 2JF1A 5EU5B 5JOPE 2AVGA 4YHOL 4YDJB 5DT1H 5IFHL 1I8LC 1NMBH 3ARDD 4P2QA 3GMRB 2DYPD 1GPOL 1HCVA 1YY8A 4HX1B 4M02A 5BCAA 4F7EA 2VXTL 3OKOB 4ZFGH 3KHQA 2HT2C 3MBXL 3TWCL 3DVNB 1OOAA 3JUZA 4NDMB 4PGCA 1FFPA 2AEQH 1J05B 1JRHL 3SGJC 1KB5L 1G6VK 1K4CB 2EYTB 2FJHA 1UEMA 1H5BC 2F5BL 2X42A 3LY6A 4BK5A 1HILB 5LXGH 1A9BA 2A77H 4XGZB 1F4YL 2W0KA 3BD5A 4HPYH 4E41B 4CN4A 3VFTB 3QCTL 2PN5A 1BWWA 5C8JB 5I76B 3FAXA 3DURB 3NABL 4WNQA 2NTSP 1JK8A 4MA1C 3MJGX 3JV0A 3O4LB 1AI1L 3O6FD 5F6IC 5J6HA 5IUSA 4JHWL 5HHOD 4P4RB 4QRPA 3OR6A 3IXAA 2AABH 5AAMA 1D5ZB 5EUKA 3DYOA 4UV7H 5TPWL 3EHBC 3MLSL 5DD6A 3T04D 4M7JL 3ULVD 1NC2A 1F4XH 5CD5D 3WDIA 2AV7B 3T2NL 1J5OH 4BFIA 1VADB 2D03H 4PJHF 4F7TB 1C16A 1BWMA 1L0QA 4H88L 3M1BA 1H8SA 2D7TH 5DHYA 1T7ZA 4HD9A 2DQFA 4XNZB 1OAYH 4P2OA 2HG5A 1ZLSL 1R0AH 2OK0H 3X14B 4RISL 3SQOH 2ITDA 1PKOA 3LSOB 3M17A 4FQHA 3P40A 3V7MA 3BZDA 2F15A 4MA8H 1UKSA 3BO8B 3L7EA 5CJQL 1QNZL 4JO4L 2FBJH 3MRFB 5E08L 5HXMA 1S7TB 4GLRH 3TJEL 1I4FB 4HIEB 1G84A 5ANME 4BFBD 4PGJA 1NLBL 3MSPA 3DUHA 1XF2B 2JJTC 5GGSA 1C08A 4PJIA 5D1ZD 4WUKL 1XH3A 5F7LB 4PJCE 3BD3A 4P3DA 5KS9B 1UACH 4XCFH 3S88H 3PGCA 1A7NL 1LNUB 3KR3L 2CJUL 1MFCH 6CGTA 2Q87A 3B9KA 1NH6A 4XMKL 4PJ9B 5BVPH 2E9IA 2NY2D 5JHDB 1YECH 5CGYD 3RNQA 4WEUD 4XVUD 2WQRA 1RZJH 2C3GA 3O2VH 1INQA 5ENWA 5CZXC 4U1MB 4OFYD 2VL5A 3IJYB 3MJ9A 2GSIA 2VLJA 3O4OC 3QPQC 4H1LG 1Y6KR 3P0YL 4RQQA 4LCWE 1S7RB 2JCCB 1UZ8B 1Q0XH 1VFAA 1KSRA 3BH9A 3FQTB 1N5AB 4GXUN 3CD4A 3RVXC 3QJHA 4NC0B 3LVEA 3WNMA 4GAYA 4CVXA 1XIWD 2F19H 2EXWD 3WDJA 1UH3A 1HSBA 3PDOB 4GS7B 4PV9A 4KV5E 4EI6A 3UTTD 4HS6A 4E0RB 1Q0YH 2OQJB 1V3KA 3Q5OA 3UZVB 2X4TB 4YHZH 5JPNB 1MCKA 4P5KB 4Y16D 3BWAB 3P73B 4XCCL 4OZHF 4PG9A 4NRXA 5HY9A 4P9ML 1DQMH 3I50L 5IMMA 1UWEH 4WW2F 3H9SB 4RGNC 1IBGH 1W8NA 2B1AL 2BRRL 3THML 4HMEA 3BAEH 2IAMB 3BP7B 4HIXH 5CJBA 2H1PL 5C3TA 2BOBB 1S7QA 5FECB 2QQKL 5ALBL 3S36L 5C0AA 3SDXF 2ESVB 5J13C 1DDHB 1Q9WA 1T83C 2LABA 1KXTB 4NZDA 3TESA 1JWUB 1K3ZA 1FL6A 3GJFB 3HE6B 1NCCH 2IALB 43C9B 1JPGA 3QDMB 5I19H 5JIHA 3MRRB 3B4NA 4UIKL 3IDUA 3UJTL 2IH3B 4M3KB 1UXSB 2NY4C 1J0JA 4PY7A 1NCAH 1NGPL 2DM2A 4QRRD 4NHCH 4YIQA 2NTFB 4ACPA 2XWJA 2FZ3B 1YDPA 2DQIH 2ZUTA 3TO2B 5IW6B 3EFDL 3T1FB 4GW4B 3FT2A 2QQLH 2RR3A 1CDHA 4R97B 3OZ9L 2ATPB 2Z8RA 4Q6YA 4MB3A 3KGRA 1IAIL 3ULUC 3EDKA 4Z5RB 5T1KB 5C09D 3U0WL 4JAMB 3ZTJH 1S9WA 5GS1B 2JJSC 2ZSWA 5DT1L 4NO3A 1NMBL 5EU7C 5GRUH 3Q3GB 3PXJA 4I9WE 2G5RA 4ZFGL 3DOSA 4UT9H 4KGJA 4PD4J 5HGDB 3VXSE 3QUXA 1K4DB 2I27N 2ITCA 5F1IB 4BYHA 2AEQL 4Z95H 4L5FL 3CDCA 3QXWA 5JXEA 4OGXH 3MLXL 4IOIA 3QUMA 3TPUA 3PL6C 3GIZH 4NJ9L 1AY1H 4X7EC 1CD9B 2HJKB 4PJGB 5FO9A 1GH7A 1OW0A 5LXGL 5SX5K 2A77L 5CKGA 1A3LL 1LP9F 4HPYL 4E5XA 1ZA3B 3QH3A 4Y2DC 4HJGB 3A6BH 2UWEF 2FEDD 1DQDH 2A74A 3SDCB 5IVXA 2YWYA 5DMIL 1CE1H 3NBNA 2ZOLA 3LQAH 4EIGB 1KPUB 3GSWB 2WBJB 3GSOA 4DOHB 2CUMA 3O81A 4DK3A 2GCYB 3FQXA 3RBGA 3MCG1 4Q9CA 3CXDL 5B4MC 1AP2A 2AABL 5GS2H 3ARFB 1H5BB 4XI5C 3MREA 2XFXB 4KZDH 5BW7A 4JRXA 5IEHB 3E3QC 1QLRB 3VMOA 3CLEH 3V6OE 4O51A 4R7DB 3OJDA 1FC2D 4ETYA 1OQOA 3WCYA 5E95B 3REVB 2D03L 3P3YA 2RB8A 3QQ3A 2VDOH 4PRNB 4PJ5D 1X5YA 3BXNB 1YEEH 3ARUA 4MA1B 4OCWH 4KK8C 4RBPK 4OGAC 3W9DA 4CU8A 1OAYL 3MRKA 3ROLA 9CGTA 2OK0L 2YRPA 4OZIA 2I25N 2WLYA 4MA8L 1XMWA 3S37X 3IAPA 3UPRB 5MERB 1BLNA 2WMPA 2FBJL 1MLBB 1WBZB 2ED9A 2VXSH 4Y4FD 2VDNL 3GSUB 4J4PA 1T7WA 1ERNA 4G80B 1WFOA 1WCQA 3VXMB 3HS0B 3FFDB 5GHWH 3PDGA 4MMXC 5HYFA 1WWCA 4G7VH 2HN7B 4NKMA 4ZAKD 1AJ7L 1MCQA 4RGOH 2RIKA 3TYFA 4K55A 1UACL 4XCFL 5CKAA 3S88L 4XPTH 5F89B 3TH2T 1WAAE 2I24N 2IH1A 3VFPB 1RJLA 4TTDD 3C6SA 2HTLC 5E2TH 4YNYB 3V0WL 5F9JB 4HIIB 1YECL 3QFJB 4XAKD 1RZJL 1RJCA 3O2VL 4LP5A 5GZND 4WW1A 1QA9A 4LAJH 2M1KA 3H3PL 4EVNA 3U1SH 3ARPA 4JFDA 4BQ6A 4D0DB 1O5DT 1RK0A 3RRQA 2M26A 2NX5E 2UVEA 1CFBA 5L8KB 1CVRA 3TVMA 1FNEB 2FX7L 4NNXA 3QEUB 2O5ZH 3TBVB 5IT2H 5KVMC 2D0HA 4PGEB 4AH2A 2F19L 3FFCE 2XKUA 4I4WB 2OTUA 3WNPA 4D8PB 3BUTA 4FS0A 4ELMF 1Q0YL 3VGEA 4ERSH 5HI3C 3LEVL 5TJWK 5IQ7H 4YC2B 2DQGH 4P99A 3TNNA 3RUGB 4P4KA 1XR8A 1FZKA 2WK2A 4LMQI 3JVGC 3RY6A 3MV7B 3B6SA 4E9LA 5EH1A 3RVTC 4LIQL 1L7TH 3RWIA 1DQML 3O4OB 2AJUL 2BZDA 3QYCA 1UWEL 2PO6B 3GMOB 5DZLA 4NFCA 2D9QB 4Y4HC 1NGXB 3AY4A 1I7TA 1UH4A 4MNHA 4PRIE 1UJ3C 4GQPH 2V5RA 5CINL 4XTRD 4EJ1C 2CXGA 4PTTA 2EXYC 4QHNB 5KS9F 5J89A 2R1XB 5SX4H 2DLFH 2VLMD 4HIXL 4WI9A 5I17A 4N5UA 1AGEA 1TJHL 3BDBA 1J0ZA 1HKLH 4YHPB 5IVNA 3RDTC 4GKNB 5HHMD 4LDLB 3SJVB 4OI9A 43CAB 2VXQL 3PQYA 3MOAH 4P5MB 5BRZE 2V2TA 4KHTL 2G2RA 2ZSVA 4NQCB 3EBAA 4HV8B 4Z7WE 1NCCL 2FO4A 3OXSA 5EOQH 3ZT6A 1SJHB 4NKDA 5I19L 4N8VG 5E0QA 2QHLA 3QIWC 1NFDE 3OKNB 2JCCF 3KYNB 1IQDB 4CJ0A 3W11C 3BKML 1YJDH 4NHCL 3V5DB 1N8ZA 2DMCA 3ULSB 3ZSSA 2PTTB 3WE6A 4QRUB 3EYSH 1UM4H 1BFOB 2WV3A 2QQLL 1NJ9B 4M7LT 3L6FB 3BP5A 2J8HA 3L3KB 5DJ6B 3TN0A 2IBZX 1GGIH 5MEQB 3K1KC 4K8RH 4TRPH 2EEDA 5J13B 4RNRB 5EZJA 4N0CD 3KS0J 4O2FB 5TF0A 2AJSL 1MNUH 5CEYA 2GK0B 1HQ4A 2CDFA 1WZMA 3MRMB 5ALCL 1C12B 4MJ2A 2NY4B 2DI9A 4UT9L 5E6IC 4PP1D 4JFQA 4BKLB 3QXAA 2UY7A 4FTVB 3CU1A 1J8HA 4C54A 3ARBC 1QSEE 4Z95L 5D2LE 3O9WC 4OGXL 3QHFL 3K4ZA 3L7FB 3VXRA 3RWFA 1M71B 1W72A 3GIZL 5CZVL 1AY1L 4GRLD 3N1FC 2FIKB 4NZUH 4S1SH 2B8OT 2NW3A 1LK2A 3BX7C 4OFVA 1U3HD 1AKJD 2G9HA 3KDMB 4Y4KA 4NM4H 3TBTA 2CUIA 5KSVA 1UB5B 2ZOKA 4XXCC 3GKZA 4EI5C 5GQBA 3BYTA 1T03H 4AT6A 2MOVA 1DQDL 4Z7UE 4PJHA 1AIFB 2FECL 1CE1L 4JCLA 1OD9A 1A6WH 4MCZB 4KMQA 3LQAL 5CS7A 1A1NB 2CDGB 4RMRA 2B20A 4ZNCD 1JNLH 5HDBE 5JTWA 3LB6C 1G9MC 3MJ8B 4M6AA 3V6BR 4KUCF 3T8XB 2NY0D 1MEXH 1BJ1H 1Q9LA 1B3JA 1XGUA 2ID5A 2EDLA 1AD9B 4RX4A 3R8QA 3SKMA 5TGBA 5I30H 2WINA 3LKOA 3X3GH 4D9RD 2EDJA 5HYQA 3S3PA 4PRBB 2QHRH 5FM5M 5KSAC 1HI6A 1OAQH 4D94A 3BP4B 4JCMA 1YN7A 4NN5C 4P5TD 2BNQB 1RUQL 2GUOA 4U33A 1BZ7A 1CFQA 1NGWA 2Y23A 3MRBA 3KYOA 2AXJA 2EIZA 1ORQB 1U8MA 1BZ9B 1P5UA 1YNLH 1IAOA 4C58B 5EC1B 2VDOL 3K80A 1GGBL 4GOSA 1YQVL 3A67H 4HKXA 4P2QD 5LCVH 5FDWB 2W38A 4MJIE 2KZWA 4K3DH 1VDGA 4OCWL 5EBWB 3QDHA 1NCTA 4MXQD 5CEXB 3D0VA 2IEPA 3DTXA 5CBAB 2GYSA 3A0OA 4X99B 1F2XK 5EZOH 2C1OB 3W0WA 1AGCA 2UVFA 1U8OA 5TF1H 3QNXA 1MRDH 4OCSH 1ZWIA 3R06A 2VAJA 1R3IH 4JZNB 3VDBA 3HPLB 3C8KB 3MA7B 4L4TE 3TM6A 2DRUA 2Y07H 1KTKE 1UQSA 4FXGA 5EO0A 3QO0A 5GHWL 2EYRA 5K9OB 5KN5B 5D6DA 4G7VL 4G8GD 4MD0B 1MJ8H 2VZSA 3ZKNC 4JQVC 3LHPH 5CJXC 4OQTH 1BECA 4RGOL 4XPTL 5C08A 4PJEE 1IGCH 2BVUA 4PJXE 1L0XA 4X5WB 1AHWA 1CFNB 4QRPD 5FA4A 3UCRA 5E2TL 3WNKA 2EZ0D 2GJ6E 5FGCE 2J7LA 3SCMA 1DUYB 5JORA 4Z18A 1A14L 1TCRB 3KPMB 5I73B 2VZTA 4G6AC 3H3KA 1NC2D 3T0WA 3U1SL 4XH2A 4EEEA 3BMWA 4PJDB 3SQBA 1RJYA 2O5ZL 3CXHJ 2NY7H 4NO0A 4P23A 4TNWK 4WW2A 5IT2L 2YXFA 3MRDA 4G5ZH 1S7SA 3UO1L 3C6LA 5FA3A 4JRYE 4AYFA 4X4YA 1DANT 4TN9A 5AZEL 4CAGA 1F58H 3JWOC 4XZUA 2UZXB 4GW1A 3WKNA 4DVBB 4ERSL 1CN4A 4P2OD 4JQXC 2BX5A 4O5LL 1HH9A 4K9EC 5CILH 5IQ7L 2DQGL 3SDXA 1QBAA 3GSNH 2F8VA 5DJ0B 2G75A 4FQPA 2OXGA 3UTQA 3NMEA 3SE4C 1ODAA 2HVKB 1FO0A 5GSVA 1EUUA 2BK8A 3HE7A 5A2KH 4ISVB 3BJLA 3MV11 4L8BA 1L7TL 3PHOB 1C5DA 4UOW0 5IM7B 4L4VA 4OLZH 1ONQA 1ZHNB 5M95B 1J0YA 3WIHH 4OZFA 3CFBB 4MQ7A 1T2QL 2WWKT 1S7XB 3B2UD 4MMZC 1SJEB 2NMSA 1OCWH 2OLDA 2C4FU 4M5YH 5GGRB 3WV0A 4QWWD 3EJYD 2BNRE 3C60A 3B9KD 3A6CL 4EN3C 5KAQF 5BZWA 5T3XD 2XTJC 3OGCB 4DZBA 3MOAL 3FO9A 1DL7H 1WBYB 4JDZA 2HVJA 4JHBA 3MRJA 4CKVX 5JLZB 2KL6A 2X4OB 4I5BB 5SWQA 2OX5A 3BUYA 3QI9A 2VLJD 4E41E 5KSBE 4JKWA 3LEYH 3QZWA 1KC5H 3H8NA 2PR4H 4J1UB 1E4WH 3D2UB 2X05A 5EU4B 3U9UA 1M7IB 1YJDL 4QXTA 4RRPA 3T77A 2VUOA 3LN5A 4W68A 3O4LE 2R2HB 2CRZA 4JFEA 4LK4A 1UM4L 3OMZA 4GBXA 1BJ8A 5IIEB 4ZUVA 5DK2A 3RDTB 5FYLE 1BQHB 1GGIL 2J5LB 4K8RL 4TRPL 3DVGA 5BMFL 2WIMA 1I7UA 2EDTA 5E9DB 2XG5A 4MA3A 2VDPH 5I8KL 4NZJA 4QRSB 2GK2A 4ONOA 1LP9A 3RIFF 3PXHA 2CO6B 5C0BE 3MUY1 4LP4A 5ITFB 1CVSC 2FL5B 5E70A 2R2CA 4PPTA 3QIWB 3I3BA 3MUJA 4QNPF 5HSFA 1VFOA 2VISA 4WTZG 5IQ9B 3MGTA 3FJTA 1KJMB 4HUWA 3SE9L 5I66B 3QNZA 3V4UH 2R1WA 2JJVA 1IGTA 3QAZB 5FM4A 1PKQA 1RZKH 4KJPD 1HHKB 3MBED 2YKLH 4S1SL 3RQ3A 2PETA 2DL2A 2I60H 3CSPA 2I5YH 3F12B 4RDQF 5IFJB 5C0AD 3TO4C 3CDFA 1YYLH 2QEJA 4NM4L 4B53A 1ZGLP 3PWUB 1A9EB 1QFWH 5L2JB 1OARH 2FHCA 3BZFB 12E8L 3ECBB 1FL5B 5L88H 3GMRA 5KOMC 4HX1A 3UTSA 3P4LA 1FNHA 2WWKO 4JGJA 1FZJA 1MEXL 3DVNA 4AIXA 1AGBB 2BVOA 3RZWA 35C8L 4DZ8B 1FIGH 2VLKB 3X3GL 3O9WB 2H9GB 1EFQA 1RULL 1J05A 2E6QA 3ULVH 2QHRL 3UBXG 4JPWL 2EYTA 5JMRA 1OAQL 3K8LA 4YR6B 2DOCA 1OP5H 5FUZH 1OGAD 3MV9E 5BXFA 2VYRE 4EI5B 4KROD 4XGZA 1XGYH 1NL0H 4X8JB 3VFTA 2HLAB 2AJZB 4RMTA 4JGMA 2EH7L 3DURA 4K3DL 4HCRH 4JY4B 4NN6C 2YZ8A 3QUXD 1HYSC 1OP9A 3PP3H 5DI8A 3MROB 2DM3A 4HC1H 1EO8H 5EZOL 3T09A 3GM8A 5JXED 2DWEB 1HHIA 5T1DH 1FSKC 5TF1L 1J8KA 4G7YH 1D5ZA 1MRDL 5KSAB 4OV6F 1BQUA 1R3IL 4EOWL 4NN5B 2HT4D 3FQRA 4YWGH 3ULUF 3F5WB 3ZLQC 4Q9RH 4JHZA 4KQ3H 1JPSH 4NBYB 3GKWH 1MOEA 4XXDB 2Y07L 1KFAL 4KI1A 1RZFH 2AV7A 4BH8B 2GQHA 5EORH 4GMSL 4S10A 1MJ8L 1VADA 4F7TA 5I15H 4A2LA 3LHPL 4OQTL 1P2CA 2XQBH 4K7PY 3MRNA 1U3ZA 4XBPA 5C7XL 3G9AB 3P0GB 1FVEB 5JO5B 4ELMA 4OFKA 5F7EH 2VDLH 5I8CB 3N9GL 3LSOA 4S2SB 4ZTOL 1RUKH 1ZT7B 2ED8A 4V1DB 2VTFA 1I1RA 2AK1H 4LLQB 4OM0H 4XNMA 3F7YA 2FB4H 3L1OL 1S7TA 1GL4B 3GMPB 4FQ2H 4HIEA 5DJ8B 4F57H 2O61A 2X41A 3QSKB 2Y6SC 1PLGH 5EDXA 2NY7L 1ZT1B 1RQ5A 1XF2A 2YEZB 2ATKB 4OCLC 3GBLA 4P2RA 1HHJA 3HC0B 4YHMH 3AAZB 2R8SH 4UI2A 2XRAH 1F58L 5KS9A 1I8IB 2ENSA 4OLUH 3T0EC 1KCKA 2ENYA 1LNUA 5HVGB 3PJSB 1UXWB 3O11B 2PYEA 3UEZA 2X4QA 4PJ9A 3K8MA 2K7QA 2X1PA 4NWTH 4LQFH 2XN9A 1PEWA 2BVYA 5JHDA 1OY3B 2EDXA 1F3DJ 1ROWA 4J4PD 2OL3A 3FN0H 1JV5B 1QFUH 3IJYA 1UWGL 1D5XB 4OLZL 1S7RA 1YC7A 1EGJH 3BPNC 1TMCB 3U82B 2AGJH 3SHSA 5KSUB 4KGLA 3L3IB 1E6JL 4IS6A 3O3DA 2L7UA 2E7LC 2DQHH 4Y5VA 1OCWL 4M5YL 3PDOA 4UDTA 1MCHA 1MH5B 4OB5H 4LFHD 4UV4H 2OQJA 5T5NG 4NOFA 1V8HA 1YEHH 4KJWD 2X4TA 1AGDB 5EZLB 2Y1VA 3BWAA 2XV6B 4HJJH 1WFNA 4PJGE 1JRHI 1JGUL 3CH1B 3KLDA 3CGTA 1PG7X 4JFDD 2VABB 1IGJB 4PJDF 4V2BA 5JW5B 3CVHB 3LEYL 2R0WH 2PR4L 3TVMD 1E4WL 5CHNB 3KPNB 3H9SA 1UYWH 3JTSB 1B0GB 4LSVH 4P49A 3QDGE 4XNUH 4DOHE 3NFNA 4NYLB 3TLRA 3BP7A 4PRHB 3EO1B 1VESA 2F8XC 4KRPC 4ZDHA 4XBEH 5FOJA 5T1LB 5DTFB 3GSNB 3D48R 5C92A 3BGMB 4HJ0D 5FECA 4EN3B 4AEHH 2LU4A 1UCBH 1YYMH 2IPUG 2ESVA 3HAEH 2ZJSL 4EUPH 4RZCA 2VDPL 2XTJB 1T89A 3RKPA 4P4KD 4HKZB 1U8PA 3GJFA 5C2BH 4MDJB 2VR5A 3HE6A 3TZVD 1HEZB 4XBGB 2IALA 3QDMA 1A0QH 3MRRA 4D0CB 1JHLH 3RWDB 5D8JH 3D39B 4LVNC 1AR1C 2W07A 1H3TA 2VWEC 1KTDB 4PLJD 4H20H 5TQ0H 2NTFA 3LPGA 3V4UL 3MLRH 3TO2A 3WHE1 5IW6A 3VCLB 1RZKL 3T1FA 1IJ9A 2YKLL 3BZ4B 4HW6A 3KPQB 3QQNA 4XHJC 3DMMD 2I60L 2I5YL 1TIUA 4QKXB 2ATPA 3BKCH 1FQ9C 1YYLL 4NGHL 4CDHA 4QYOB 5K9KB 1RUML 4P57B 3PQYD 3P4NB 4Z5RA 4NUGH 2AK4A 2HTKD 4R7NB 2QADD 2OXHA 1YEGH 5JDJA 4APQC 3SGDH 2P24B 5J12C 1G7LB 5J1TC 2UUDK 2Q7YB 3SN6N 2R0ZH 1K4DA 4WGVB 5F1IA 4G8IA 4L3CA 2APFA 1FIGL 4YDIH 1CK0L 1MRFL 3EYVB 2VC2H 1P4IL 4Z0BH 2ORBH 4NP4H 1PD6A 5E94B 3TN0D 2GSGB 5B22A 3ARDB 4LCIH 5FUZL 4YEEA 5IV2B 1P6FA 3H9HB 2Z91B 3SPVB 1XGYL 5D7IE 5GRVL 1ZA3A 4FQ1H 4NJAL 5AZ2L 5DO2D 1T1WB 5EU6A 1I8LA 3DX6B 3KYAA 5KTEL 2CLRB 4XCEA 5HDQH 3BESR 1A7QH 5CGMA 1KPUA 3GSWA 1J8HD 2F74B 1EO8L 3VMPA 2MQ3A 3VXRD 4AIOA 5T1DL 1FC1A 4G7YL 4X9GA 1T1ZA 3SGJA 1U6AH 4PREA 3WL9B 4YWGL 1HYRC 4LQ1A 4OCMC 2XFXA 4TPRH 4F37K 3RUGE 1YEFL 3CMOH 5DUMH 1JPSL 2HRPL 2L0DA 3MXVH 3OPZL 4OM1L 5IEHA 4NHUA 4Y4KD 2EC8A 3MA9L 4M03A 3MV7E 1K8IA 4OIBA 3D3VA 4R7DA 5EORL 1T7XA 3MC0A 4UZGA 3REVA 3U7WH 4R90H 5I15L 4PRNA 1TDQA 1Z3GH 2EDKA 2XQBL 4RCAA 2FGWH 3BXNA 1MI5D 1JHKH 4U3HA 5HYIA 2CLZB 1WZ1H 4FP8L 4ZFFB 1CE6B 4RX4D 4OUOA 1GIGH 5JW3H 1KB9K 1FSKB 1QD0A 3LIZH 1SJXA 1RUKL 2OJZH 5DA4A 3FO2B 4S1QH 1MCOL 3WS3B 4R2GD 2AK1L 4S1RH 5EFIB 3UPRA 4OM0L 1FDLH 5GGVY 1NCWH 1MLBA 3SJVE 4ODXB 2FB4L 3GSUA 3LS4H 2I9LB 2YN3A 4G80A 4F57L 1B6UA 4NO5B 4NQCE 1BVLA 3VXMA 5GGTA 3P11L 3HS0A 2FJFB 4ZNEA 1JI2A 3FFDA 4K3EH 4M6NH 2HN7A 4YHML 4F7CA 3JWDH 2XRAL 2VZOA 3CCHB 1JGLH 2C3HA 4OLUL 5F89A 2IPKA 4MXVE 3MGAA 4M1DL 1KTLB 5IWLC 5ICZB 2F54E 1A7BA 1ZVHA 4GAJH 5AWNH 5GS0L 3BPOC 2ARJQ 3MNWA 4TVPD 4NWTL 2BP3A 4LQFL 3VXPB 1FH5H 3QCVH 3W0WD 3IDMA 4Z7VB 5HI4D 4HIIA 3IFLH 1NMAL 1WFTA 3QFJA 3O2DA 1R5VB 1VFUA 1M6OB 2MPAH 1E28B 3RAJH 3QBTB 3FN0L 5B8CB 2VN4A 5JHLH 2NY5C 1IAII 1EGJL 2WIIB 1TCMA 5DK0B 1FNEA 2BSRA 2JJTA 3O3BB 4NQEE 2WUBH 3QEUA 3S36X 4D9LH 2Z9TA 1ZGLB 1IC4L 3F62A 4PGEA 4L1HA 4ENEC 4ONGH 4FTVE 5C08D 2B1HL 3T0EB 3X11B 5CP3H 4X7DC 4OB5L 2VLLA 4UB0L 4CN1A 1SMOA 2BOCB 3MQIA 3IDJA 5ISZA 1T66D 4LLWB 3MV8E 3QQ9C 4HUMB 4TUKH 4K94C 3SCMD 1MELA 3VH8B 4HJJL 1RMFL 4ODSL 1CGXA 5FIEA 4CNIB 1NBZA 4LBEA 3ZKMC 4NC1E 5KANG 2R0WL 4PB9L 3K74B 1SM3H 3BPNB 4P23D 3EJZD 3GMOA 4NO0D 4TYUA 4ZYKA 1NGXA 1A6VH 3C6LD 4LSVL 2XNAA 1QFHA 3MLVL 3S5LA 1LO3H 5J4MA 3D18A 4ZFOA 2YRZA 1KCVL 3T65A 3KYKH 2HKHH 3DHMA 5E5MB 5ADOH 3VG0H 1RVFH 1CG9A 5HHPA 3V7AE 3CK0L 5JDSB 1KJ2A 3LEXB 1UC6A 3NCEB 5MI0B 43CAA 4DKDC 4H26B 3IVKB 4OZGF 5JR1L 5C2BL 1Y18B 2BNQE 1FG2B 4GJTB 4HV8A 3HE7D 4ESKA 3EFFB 4G9DB 3ET9F 4N90D 1SJHA 4G43A 3VFRA 2FYYB 2X7LA 4X7SL 1KIPA 4G6JH 1CFTB 1JHLL 4L4VD 3EO0A 3QISA 1IQDA 3PWPE 4JN1H 4H20L 5TQ0L 5IMLA 4N0CC 3EYOB 3MLRL 4JKKA 3T4AB 2PTTA 3VI3E 3CLFH 4QRUA 3H0TA 1INDH 4CMHB 1JZ5A 1HXMB 5FGSA 4KRPB 3L6FA 1XZ0A 3C60D 1DANU 2NXZD 5MEQA 4R8WL 2P49B 5IP4A 3BKCL 1P4LB 2WWMC 4RNRA 1T83A 3B5TA 3QEQE 4RAUB 5DFTA 4NUGL 4LPVA 2GK0A 2HH0H 1YEGL 3UPCA 5IEKA 1UENA 1HWGB 3PDDA 3QI9D 3MRMA 4YDVB 4GRLC 3VFUB 4HEME 2XA3A 4TUOA 1IEAA 4JFFB 2YK1H 5L7XH 1S5IH 1U8NB 4JFED 3FAWA 1H9VA 4JZJB 4GBXD 4Z0BL 1IM3A 2E6JA 3WNLA 3LKQA 2ORBL 3NIDF 1JZ6A 2LE9A 1E4XL 4LCIL 4U6TA 5F6HJ 2MFNA 3QEHA 4NFDA 4AMKH 3MRLB 3KDMA 3VXSA 1FFNA 1UB5A 2ZCHH 2LU3A 4PJ8C 4FQ1L 3HZKB 2W0LA 5MHSD 3B8YA 2JJSA 3UZQA 2YC1B 4JG1H 3QWOB 4LARH 3PWNB 3U36A 1QBLH 4ZD3H 1X4XA 3WDHA 4HG4J 4ZQKA 1S7WA 4MCZA 5HDQL 1A1NA 1BF2A 2CDGA 1A7QL 4KK6D 3MJ8A 1OAUH 4X98B 3T8XA 2VMFA 1NFIB 1AD9A 4OD2B 3RL2B 1JNHA 1FAIL 3PL6A 2XT1B 3TJHD 1J0KA 3G5YB 2GW5A 3BP4A 4TPRL 4TNWF 5FGBC 3GZKA 3BN9D 1OTTC 3P30H 2EDQA 3LRGA 5I1HH 4Y2DA 1A6AA 2IC2A 3U7WL 4O2CB 4R90L 2EEBA 1CF8L 1QRNE 2V6HA 3W5MA 1Z3GL 4L3EE 3K2MC 2FGWL 5FDWA 2NZ9C 1EV2E 3UTSD 4GW5A 1F5WA 4BSJA 2ICWB 1FZMB 3L3JA 5EBWA 1IAKA 2A2QT 3O3UN 4KDVA 4X9IA 1ES0A 1CIUA 5I6XC 4Q6IC 2BY0A 1M7XA 3BSZH 3SKOA 1GIGL 4ONFL 5JW3L 1KULA 2A0LC 3LIZL 2OJZL 4S1QL 3I9GH 3L3GB 1NCWL 1Z0MA 2P5WE 4PJ5B 3NCJH 4JZNA 2CGRH 1OP3H 1KPVA 4Q58C 1FAKT 1XF4B 3C8KA 3MA7A 4F58H 4ZMAT 1JGVL 3DGCR 1DBJL 1F90H 1JBJA 4K3EL 1ZTXL 4M6NL 4YBQD 5KN5A 2WAHA 2EE3A 1JWMA 2YUWA 3MLWH 1Y0LA 4PGBB 3JWDL 4K3GA 2X4NA 1JGLL 3KPTA 3D25B 5ESAA 4KKAC 3RVVC 3TV3H 1GOHA 1WITA 4ZS6D 4XNYH 3RBSA 4GAJL 3V5KB 4XMPL 5AWNL 1LEGB 3DXAE 4X5WA 5JQHC 4UAOC 1CFNA 2FJGA 1FH5L 5D7SH 4WUUE 3IFLL 3FT3A 4PJAE 3VFMB 1GGYA 3MJ6A 5JHLL 1UB6B 1NCUA 4XPBH 4OLVH 1GZPB 3T3MF 4PJDA 5DVMA 1E6OH 3VFOB 2V5YA 3HRZA 1OWRM 4D9LL 4TOYH 1TZHA 2R2EB 4HK3N 3JV4B 4U7KA 4WFHD 4C4KO 5T3XH 5J9PB 4DVBA 1MIEL 4YBLC 1X5ZA 5ADPL 5GRJL 1TXKA 4WWKC 4HS3B 1QOKA 4TUKL 2CH8A 5IW1A 2W1NA 3DX8A 3MJ9H 3X12A 1ZKAA 2J12B 4YGVB 2IWGA 5T33H 4ISVA 1OTUD 1P5VA 3PHOA 1H3PL 1URLA 4YHNA 8FABA 1T4KB 1SM3L 4YJZL 4YEFA 1ZHNA 4HXBH 3V9FA 1WGOA 4P2RD 4IHOB 1A6VL 3CFBA 4XVSL 5D2NE 3U46A 4QOKA 1G6RL 4JFHD 4LLYB 3LDBC 1LO3L 1S7XA 3WUWG 5IHUH 3ARVA 4C56A 1KGCD 2FECI 5GGVH 5GGRA 5FDYA 4KKBC 3KYKL 2Y06L 2VLKE 1I9JH 2HKHL 3PF2A 1DLFL 2B4CH 1RVFL 2PYED 4PY8I 1F4AA 5GXBB 2BC4A 5ACLA 1S78D 2XN9D 4Z7VF 3H42H 4M93C 3OGCA 1R24B 5F1SA 5JHDD 5GIRB 1WBYA 4K3JH 4DN3L 3LD8C 4HZAA 1BFSA 3JVGA 2VJXA 2X4OA 4HMCA 2DM4A 1N6QL 3EYQC 1L0YA 5IG7B 4G6JL 4G8FA 1X5XA 5AUMB 5C86A 1I9EA 1OTSD 4I8DA 4Z7OE 1X4ZA 3G04B 4Y4HA 2PCPB 3K81A 1UJ3A 1I1AC 1OD7A 4R4FH 5E6ZA 2YHGA 3CLFL 4JPIA 4HDIB 1INDL 2P4AB 5DEGB 4MJ6B 4WTWA 5IIEA 5LGKA 3JTTA 1J1OH 3RDTA 3WYRA 1IE5A 2C1PB 1G9NL 2P8LA 3ZE2F 3GMQB 4YHLH 3VD4A 1FCCA 3W39B 4QXUL 1M7DB 3TP4A 5E9DA 1ORSB 4QRSA 5KVEH 5I1JH 3UTZA 4KKNA 3WFDH 2FDBP 3W5NA 1ZANH 1Z9SA 2HH0L 1TPXC 5ITFA 2FL5A 3FQUA 3MBEC 1BJ1J 1FYTB 1QYGH 3H9SD 5F1NB 2E8YA 2RGSA 4Z6AT 4MS8D 5L7XL 1S5IL 1KJMA 5I66A 3C09C 3NA9H 1O0VA 4HT1L 3TBWB 1JWSB 1WIOA 1HHKA 1I8MB 1HSAB 5DURB 2APXA 2Z31C 5IFJA 2CKNA 2HFFA 4AENB 3SE8H 4V1DE 5ELIA 2OMNA 2N7AA 3V7AG 3WN5C 1P7QA 1T0MA 1A9EA 3ZTJG 1F6AB 3HE6D 1MCJA 5L2JA 3GO1H 3HNSH 3MLYH 3QIUC 4LARL 3BZFA 3HB3D 5HHVL 3QDMD 4D9QD 1QQDB 5F88B 3ZMRA 2FH6A 3LH2H 4S1DD 4OLXH 4TUJB 1FFOB 4GRLB 5E6IA 1B4RA 2P8PB 1NUNB 3QUMH 2C26A 2F5AH 1IMHC 3ARBA 1AGBA 4UT6L 4DZ8A 3IDXL 5CWSB 5T5FH 3O9WA 3V6ZB 3HG1B 4XWGH 1J86A 2NXYD 4XP6H 3RVWC 1MRCH 2O5YH 1KN4H 1X5KA 3KPRB 3BH8B 5AD0B 2OR9H 4YR6A 5I8OH 5IF0B 2VXUH 3P30L 4F7MB 4XXCA 5DK3A 3VXQB 1MCWW 2NY0B 4PJ8B 1EH9A 2AK4D 5HDOA 4X8JA 5HPMB 2HLAA 1U91A 2IG2H 4XVTH 4LLVA 4OSUH 2CKBH 1H3XA 1V5JA 1I7ZA 1QFPA 3P9MB 2DJUA 4NZTH 1IL1B 1I3VA 1A6TB 4P5TB 4NN7C 5EULV 2ZG3A 3BSZL 3MROA 3U9PH 5JOPD 1LK3H 3KLAB 3NOIA 4OGYH 1AD0A 3BI9X 5K9JH 1CT8B 4R3SB 5KSAA 3EDEA 4Z7QF 3VG9B 3NCJL 2CGRL 3GMLB 1BIHA 4F58L 1CDYA 4XXDA 3PWJA 1MPAH 1F90L 4KKCC 1MFBL 1FFPB 4Y19B 1UCTA 3OG4B 4WFFE 5EU6D 1G1CA 3UP1A 4ODVH 3IFNL 4JJ5B 2J6EA 3L5WB 2VZUA 5IFAL 3BMVA 3JBG7 3N1GC 1NKRA 3TV3L 2HT2D 4XNYL 1FV1A 1QUNA 3CPLB 3S98A 5I6XB 4Q6IB 1FVEA 4FQXC 5JO5A 4K07A 3RPIA 4IOSD 4PR5A 1DQTA 3O41A 4MNQB 1A9BB 4LU5H 4ODUA 5I8CA 2COQA 4OF5A 4WEBH 3IDIA 4NCC2 5L2KB 1ZT7A 4LVHC 3BRDA 4LLUA 4G8GB 5I18H 4JREC 4LSQH 3TCLA 4LLQA 2IANA 4XPBL 1I9RH 4OLVL 4WNQB 1JK8B 4WI7A 3GMPA 5DJ8A 5IB4B 4IRZL 5J6HB 3NFPA 3RNKA 3D3VD 1P1ZB 1ZT1A 4TOYL 2ATKA 4QRPB 4JQVA 3OR6B 3L3OB 5CJXA 3D39E 5I1CL 4PFEA 5EUKB 3AC0A 1I8IA 1MIMH 4QTIL 2GKIA 1DZBA 1RAMA 1T0PB 1NC2B 5KJRL 1OM3H 3O11A 5IESH 4LHUB 4U1NB 3SBWC 4KI5C 1OP5K 1MCNA 3U4BL 3MJ9L 1RIVL 1ND0A 3C5ZC 5D96B 1C16B 4OZGA 3EHBD 4EXKA 4Z76B 2B0SH 4JRYA 5T33L 4H5SB 5GRVK 4PLNC 5AYUH 1EA9C 1SBSL 3M1BB 2WP3T 4HS8H 3DJ9A 4NQDE 3VXMD 4UIMA 3SGKC 4BZYA 4P2OB 4LL9A 1RFDL 4RA3A 5KSUA 2FEEL 4KJWC 4FQHB 5FYJD 3WIFA 1T5XA 4H8WL 5IHUL 3QFDA 1B90A 4WFEE 4X6CE 3BE1H 2F53E 5IOPB 1MH5A 1I9JL 2B4CL 4JQXA 3HMWL 5JZ7C 1ED3A 5EUOE 3LS5H 1CR9H 5JA9A 4EBQL 5HJ3B 3QFJD 4K3JL 5F96H 1BQHG 4NKOB 4PJIB 1XH3B 5E8PA 5FGRA 1GZQA 4G9FA 4P3DB 3AM8C 1RZKC 3CC5B 2VABA 1IGJA 2HLFC 3PGCB 3OJ2C 1T2XA 3GMMA 3B9KB 3KPNA 3RI5K 2VR4A 3ZDYE 3JTSA 1B0GA 3TGXA 5K9QG 3HFMH 5IHZA 3LDBB 4LVOC 1WIUA 4HGMA 4NYLA 2OSLB 4PRHA 3EO1A 4GG6E 1INQB 5ENWB 1UA6H 2VLRB 3TZVC 5DTFA 1IKNC 5ISZD 4M61A 5JQ6H 2LTQB 2JB6A 2VLJB 1XGPB 1KLFA 3ESVF 5F3HB 5EB9A 4M93B 1VFAB 5KVEL 5I1JL 4QLRA 3VFGH 3ZHDA 3QJHB 2AKRB 1ZANL 3IFOA 4MDJA 2AJ3B 5CZXD 1HEZA 2DM7A 2DJSA 5HHOE 3QPQD 4PV9B 4D0CA 4EI6B 1EDQA 1UG9A 2Y9RT 5FKAB 4HS6B 4Z78A 1QYGL 4TSCH 3D1MC 3DMMC 3DSFH 4KZEH 5HGBA 4X6BA 3RVXD 5IGXH 3DUSA 5SWSB 3NA9L 1DQLH 1QLEH 4F37F 3ULVE 2R56H 2Z8SA 3BZ4A 2BDNH 4NRXB 2CPCA 3OKLB 5JW4M 1YNTB 5IMMB 4DCQA 2D7MA 1QSFA 2BSED 4QYOA 5C0DA 1WWBX 4P57A 1CL7L 2WP3O 4MLSA 1CLYH 1LO0L 4U1GC 2K3TA 1WC7B 4R7NA 1F13A 3GO1L 3HNSL 3MLYL 1TPXB 4O9HH 3HPJB 3LH2L 4OLXL 2OR7A 1A7OH 3MBEB 1G7LA 4ZUWA 1FN4A 1S7QB 2DIJA 2Q7YA 3QUML 4RGND 2X5PA 2BNUB 1JGEA 4C59B 4R26H 5C0AB 1W72H 4F2MA 4JR9H 5A43C 2DL9A 2DTMH 3C09B 5DR5H 1L6ZA 4MA7H 1CGSH 4G8EB 4PUBL 1FL6B 3I84A 1ETZA 3EYVA 4XP6L 5DO2C 1KN4L 4MD5B 2ZNXA 2FX8H 1JPGB 5E94A 2GSGA 3HZVB 4MNGE 3V4VH 1CGUA 2OR9L 2Z31B 1A5FH 5DZOA 1MJ7H 2BY2A 3TO4A 4YQXL 2YRLA 5IV2A 3WN5B 2WANA 2Z91A 3HUJE 3SPVA 5A2FA 4I2XA 4YIQB 5FOBB 2XWJB 1YDPB 2VAAA 2IG2L 1NEZB 4OSUL 2KQNA 2CKBL 3DX6A 5DVOA 3CFCH 3FT2B 5MEOB 2CLRA 3GSRB 2NY4D 2DLHA 4NZTL 4LPTA 4X80H 2JJWA 3U9PL 2F74A 1OAKH 1LK3L 1OGAB 4JKPH 4JVWA 1L6XA 4KQ4H 2D7OA 4PRPE 1KG0B 1S9WB 2ZPKH 2MCPL 2PKDA 2X1WL 2ZSWB 3SKJL 4ZUSA 3K46A 2BFVH 5LWYH 4NO3B 3QR2A 3EOAA 3WL9A 3ULUD 5DLML 3VXSD 3BFOA 4CL7A 1MPAL 5HHXL 3WFBH 3PV7A 3WLBA 2ITCB 1MCIA 3IRZA 5GS0C 1HINH 4ZOCA 3UTTE 3TPUB 3IDNA 5E1AB 3E0GA 3IS0X 3T2QA 1N2RA 1XEDA 1UWXK 1FNSH 2CLZA 5E99L 1IILE 3VWKC 5C0EB 5I2IB 4NN7B 3VXNA 2R4RH 5LGJA 4DGIL 5FO9B 4FQQB 3LKPB 3ZDZE 5H37H 4F80A 3ZDXF 3C8DA 1DBBH 4E5XB 3PL6D 3B9VA 3QH3B 3KPSA 4IMLB 3WS3A 5I18L 4LSQL 2A74B 3BT2H 1OF2A 4ODXA 3OGOE 2Y25A 3CFEA 2I9LA 2ZOLB 3DPBA 3Q48A 3GSOB 2IGFH 4YZFE 4Y2DD 3RA7H 2FJFA 1ZGLM 5H8DA 1TVBA 4MQSB 2R0KH 4LEXH 3VGBA 1TQCC 1TQBC 5HI4C 3IS1X 2GIYA 1B4JL 1MIML 1ZVSB 2KQMA 3MREB 1MAMH 4XAWH 4FQXB 5DD1H 5ICZA 5IESL 1D5BB 2V7HB 3QHZH 3R0NA 3LKRA 2EYSA 1CI5A 1RURH 4O51B 5B4MD 1N4XH 2I26N 5D7LB 4Z7VA 4LVHB 5KVDH 4XI5D 4JREB 3RX7A 1R5VA 2B0SL 1M6OA 3KJ6L 4JPKH 5H35A 1BD2B 2P1YA 1RHHB 5JXAH 4QRRE 2JLLA 1WF5A 2R9HC 3VGGA 4HIJA 2WIIA 4ODHH 5I1EH 1UKTA 1NAML 4MQXC 3D85B 4GRMA 5D6CB 5D7JC 5I74C 1N0XH 3ZT7A 3BE1L 5T3ZD 1J1PH 4KK8D 3HZMB 4FHBD 5FUCC 3ILQC 3T0EA 2DMBA 2QTEA 4OGAD 5IHLB 4HUNB 4ZO8A 2RFXB 2GTZA 5C09E 4OLYH 4WHDA 4B41A 2V2WA 3LS5L 1FO0H 1CR9L 4OIIL 1QPXA 1KCLA 1M1SA 3UAJC 4GRWB 1T04B 2EDRA 4LLWA 1FE8L 1EHAA 2QJDA 1OB1B 5F96L 3VH8A 2ZCLL 4NKMB 5ILTH 4U3XA 4KMTH 1DQQA 2P43B 4CNIA 1C5BH 1JPST 4DKAA 3DX7A 1NUGA 1N59B 1JF1A 4M7LL 2YA2A 4YHKL 3U7YH 1FP5A 3WNNA 4FFVC 1XFPA 2IH1B 1RJLB 1WLHA 3C6SB 3HC4H 4NUJB 3HFML 4XWOC 5E00B 5HGGS 1UVQA 2E7LA 3TFKC 2A1WL 1EEQA 4WW1B 4HWBA 1UA6L 5GJTH 4FG6C 5E8OB 1FG9C 1CICC 2K9UA 5JQ6L 1V3MA 1RK0B 2HTLD 4HULB 3TVMB 4NNXB 2FBOJ 5KZCB 1L9NA 3VFGL 3IVKA 4U2YA 4C83B 1Y18A 1FG2A 3H3BC 1OAZH 2YD6A 2XY1A 4LPXA 3RGVC 1ZLVH 3EFFA 3FFCD 4G9DA 5MENA 5TQ2H 3OBAA 2PXYC 2OTUB 1CCZA 5J3HC 1SYVB 5DF0A 1JZ2A 1LO4H 2ICWJ 4KZEL 5INDB 2Z92A 2NR6C 5DS8B 4HEPG 4QOKD 1H15B 4LVOB 4ZXBC 1MFNA 3MODL 3TNNB 4P4KB 1T0NB 1QLEL 3RX8A 1AE6L 1XR8B 4CVWA 2E5EA 1FZKB 4C56D 1HHHB 4M1CC 2BDNL 3TZVB 3B6SB 1HK6A 5HI3D 1PDKA 3Q6FB 4RAVA 1P4LA 3S4SG 1MQ8A 5ICXA 1AR2A 5E5UB 1N7MH 4PJIF 1CLYL 4HLJA 3LKSB 2D7NA 4I48A 4PTTB 4MAYC 4O9HL 5DEFB 3RVTD 4TQEH 5TDPA 4EQ2A 1EEYA 1KCUH 5I17B 2ZNWA 1A7OL 3OTTA 1AGEB 2Y5TB 2VKWA 3HI5L 5TDOB 2V9RA 1H8NA 3DMMB 3VFUA 4Y4HD 3BHBA 4R26L 1W72L 4YPGB 4JR9L 4JFFA 1NDMB 3PNWA 2DTML 3K0WA 2EXYD 3F58L 5DR5L 3QT2A 4DTGL 1U8NA 3VFSB 3PQYB 2B7DT 5DD0H 3MFFA 2FO4B 2QADB 2FX8L 4JDVA 3RDTD 3V4VL 2R1YB 4WI4A 5CP7A 5E9DD 3RTQC 1MHEB 2P47B 3STBA 4U1GB 3G6JB 2O26U 1FPTH 1A6PA 5M94B 2YC1A 2DKUA 3QWOA 3WE6B 1F42A 4APQA 3PWNA 3CFCL 2A6IA 2L7JA 3QPXH 3FT4B 3AREC 2EECA 3TN0B 4CDGC 4DUVA 4YAQA 3W11D 4X98A 4WV1C 3OB0K 1OAKL 4OBSA 3W2DH 5I1KH 5A16A 4FXLA 1NFIA 3ZKSD 4KQ4L 1TETH 3N85H 5A1AA 3RL2A 5FHBH 1SY6L 4QHMA 2ZPKL 2J88H 3FZUC 4IRJC 5CEYB 3JZ7A 4Q2ZA 2CUHA 1HQ4B 2BFVL 3G5YA 1X5IA 3FO1A 5D72H 4JB9L 1P9MC 1RJZB 2Q3ZA 3QXAB 1YPZE 1GAFL 4DEPB 1J8HB 1P7QD 1B0WA 1QSED 2FD6L 1HINL 4O2CA 3KXFE 2JB5L 3OAZK 3TT1H 3RWFB 3C2AH 3C87A 3OHXB 4U6XB 4J2XA 1FNSL 3F7PC 2R2BA 5E6ID 1CGVA 5LVEA 1LWRA 1YNKH 2R4RL 3ORJA 3ARBD 4XB7A 4XPGH 1KN2H 1LK2B 4UMGA 3NFSH 1ITBB 2VDQH 3IDYB 3I6KA 3TBTB 1H8OA 3O9WD 5KSVB 3BPLB 1DBBL 1BVKA 3RWCB 1I85C 4XP9H 3BYYA 4DGVH 4AT6B 1NBVH 4R96A 1ZLWH 1QKZH 3ZTNH 3L3GA 4ALAL 4PJ5A 3VRLF 4NT6A 2V7NB 1DBAL 1MI5B 5IK3B 4HKJB 4WHCA 4JE4B 3L9RB 4RAHA 4ZS6C 2YPKA 4PJ7F 1WVZA 5K59E 1G0YR 1WV7T 1XGUB 4NPYB 4WI3A 4BUHA 5D5ME 3SKMB 2WINB 2R0KL 4LEXL 3HNVH 4YO0B 1D6EA 3CVIH 4R2GB 5HHME 3LB6D 4ELKA 3VWKB 4PTUB 4XAWL 1QO3B 5HYSA 5DD1L 4OF6A 3V5KA 1BZ7B 5CEZD 1NGWB 1LEGA 5H2BB 1INEH 2EIZB 3G5XB 1U8MB 4H0HB 1N4XL 1T7VA 1WUNT 2NY6D 5KVDL 4KTYA 5KSAD 3S96A 3OKKA 3L5XL 1AO7B 1EX0A 4HKXB 4JPKL 3ZYOA 4P3WA 2GAZB 3UDWC 3ARGC 4LASH 2A6DA 2VZVA 4X6DE 5JXAL 4FZ8L 3D0VB 3DTXB 4ODHL 5I1EL 3MOQA 3VFOA 2F54A 1J0HA 4Z0XA 4HGWA 2X6MA 1TQCB 4LSRH 5C07E 1TQBB 3W0WB 1N0XL 1U8OB 1G7HB 2R39A 3QNXB 1WK0A 4M7ZC 4Q97A 3CZJA 3R06B 3ARZA 2A9NH 5GGQH 5J9PA 5IWLA 2V5MA 4OLYL 1QPPA 5LBSL 4LOUC 1UQSB 3QCUH 4PBVC 2OL3H 3U0TB 3T3PE 5JA8B 1RPQA 4IM8A 5ILTL 3WXWH 1QEWB 3GSXA 4KMTL 3VDAA 2IAND 4L9DA 1GGCH 1C5BL 4YGVA 4QXGL 3WEXB 1MF2H 5B21A 5C08B 4HBCH 1E4XI 1CU4H 2W9DH 3H7LA 3U7YL 3IB4A 4AEEA 3HC4L 1G9NC 3ZKND 1AHWB 4LSSH 5FA4B 1OSPH 1HIMH 5B39G 5D7JB 4DJMA 3SCMB 2EC9T 5JORB 5BV7C 4G6KH 5FAAA 4ZUUB 1MFDH 4XH2B 4UINH 4XCYB 5BZDA 4QY8A 2BVEA 1C1EL 3HI6H 3C5SB 1RJYB 4P23B 4NO0B 4WW2B 1R24A 4AZ8A 1S7VA 2IBZY 2EKSA 4WHTB 3C6LB 4G6AD 4JRYD 1OAZL 3O6KH 3PABB 1BMGA 5A2JH 5TQ2L 4XZUB 1KEMH 4GW1B 2CRIA 5AUMA 5FKPB 1WSST 3PV6A 1LO4L 3MLTB 1A6UH 4M9OA 3G04A 4I3RH 4GAGL 5D70H 5HD8C 2G75B 4OCYH 5D1QC 4X83A 4HDIA 5GZOC 1FO0B 3G5VB 5GSVB 1C5CH 4X4XB 3HE7B 4XP1H 3FO0H 2EDWA 1CQKA 1F45A 4IDJL 3AXLB 3ZE0F 3GJFH 4CVZA 5HYEA 3OX8A 4KI5F 4L4VB 3W39A 5ID1B 5EZIH 1M7DA 3HAEG 4EUPG 1ORSA 1N7ML 4F15B 4P2QE 4OZFB 4MQ7B 3AU1A 4WCYH 3RGVB 1GOFA 4G9FD 2YPLE 4TQEL 1KCUL 3LZFL 3F7VA 1VACA 3I6GB 2W59A 1XR9B 1A3QA 3C60B 2W60B 1FYTA 3TA3C 2NXZB 1CLZH 5F1NA 4NRYA 5BZWB 3GB7A 4YHIA 1G7MB 5DD0L 1MQKH 4JDZB 4PRHD 1JWSA 3MNVB 3MRJB 4X8XA 2H6PA 5IHBA 4Z7NF 1HSAA 5SWQB 1ZA6A 5HYJA 5C0GB 1MY5A 3HB3C 4YDLB 1RIUH 5F7KC 3QI9B 4AENA 4OJFH 3QZWB 2XTJD 4DQOH 3IJHA 4N9GB 5DJDA 3U9UB 4K23L 1DFBH 3T77B 2UZIH 1FPTL 4MAYB 4OZ4A 5DJ2A 2YMXH 3IDGB 4JFEB 2XQYG 1SEBA 1T1XA 2J1KA 3QPXL 4F9PC 3FN9A 1IZKA 1FFOA 4QRPE 4GRLA 4GFTB 4FQCH 2P8PA 1RZGB 3DVGB 1NKOA 1D6VL 1I7UB 3EDFA 3W2DL 4GQ9H 4ORZC 1TETL 3N85L 1WIPA 4J12A 4L29A 5FHBL 3HG1A 1LP9B 1XT5A 3KVQA 2ED7A 4FABH 1MFEL 1PYWA 4KKLC 3KPRA 3BH8A 4YXHH 4OF7A 4ZSOB 1SHMA 5D72L 2FLRT 3GJEA 3RTQB 1QSFD 1JYVA 3OAYH 3ZL4H 3PHQA 3VXQA 3MGTB 4PJ8A 2FHFA 4NOBA 2XY2A 1LE5B 1NLDL 3QNZB 4KDWA 4LGSB 4NRZA 3VFWB 1IGTB 3TT1L 1PKQB 3C2AL 4Q9BA 4IRSC 5LGHH 3FRPG 3UC0H 1JNJA 4XPAL 1A4KA 3P9MA 4N0UB 1YNKL 4I18C 1IL1A 1U8JA 4XPGL 4BSVA 1KN2L 1YMHA 5E2WH 5HVHB 2VDQL 4WO4C 3KLAA 1X3DA 3E2HC 1I1YB 4XP9L 2X10A 4IRJB 4DGVL 1NBVL 3T0AA 1CT8A 4R3SA 1QKZL 4HWZA 5DHXB 4R9HA 5FGBA 2OTPA 3TO4D 5B38G 3GMLA 2QLVB 1QR1B 3UTSB 4R6UA 4X4MA 1ZS8A 1FZJB 5JOFA 3G6JF 4Y19A 3OSKA 2BVOB 4LPYA 4WU5A 3W9EA 4YHYC 3X3FH 3HNVL 2HKFL 5I9QB 3V4PH 2X70B 4JJ5A 4PJBB 5GISH 3L5WA 3CVIL 2GTWB 1ZHLA 2ZG1A 1CD8A 2M2DA 5CLWA 5T3XE 2VUYA 3CPLA 5DJCB 1XCQA 3STLB 1V7NH 4I0PD 4Q6IA 3EIFA 4MNQA 1INEL 2X89A 5BXFB 5GGRY 4G42A 3WXVH 5A2LH 5TE6L 5L2KA 1LDSA 1KNOA 2VLJE 2VRAA 2YSSB 4G8GA 4QCIA 3WBDA 3KYMB 5GGTH 4H8WC 2QSQA 3RI5F 3BW9B 2WW8A 5IB4A 5FYJH 3S9DB 3BN3B 5DD3L 5DI8B 1P1ZA 3KAAA 1T2JA 3DXAA 2Y36H 1Y6NR 3HHRB 1B88A 4LSRL 3L3OA 3GUTA 3TF7C 1HHIB 3NA4A 2R15A 3VJ6B 4PLOB 1SQ2N 4G6FB 1MCPH 5I8EB 4HUXB 4PJAA 2V5SA 5GGQL 2VQ1B 1HYSD 1IQWH 3FQRB 5DZNA 3QUZC 3O2DH 3S37H 3IT8D 4OCRH 3QCUL 4LHUA 4U1NA 4U49A 1PZ5A 2EDEA 2DQTH 2O5XL 3KPSD 3U79A 1CTNA 3WXWL 1D9KC 1NMCB 1GGCL 5DUBA 1P2CB 4Z76A 4H5SA 1MF2L 4OT1H 5TH2B 2ICEA 1NBQA 4HBCL 3HMXA 3MRNB 4XBPB 1CU4L 5F8QC 1CXIA 4ELMB 2FGZA 4LSSL 5I75B 1HIML 5LG1A 2XA8H 5GSRA 5C6TH 4KFZC 3KPOB 4M7ZB 3GBNL 2F8OA 4DFHA 5IOPA 4G6KL 3F7YB 4XNMB 4LGPB 1MFDL 4PJFB 2BY3A 2O61B 4WWKA 3HI6L 2P48B 3RU8H 4IOFC 1S7UA 5HJ3A 4P2RB 1HHJB 4NKOA 4WJ5B 1LHZA 3O6KL 3N0PB 4LSUH 4JFYB 4N9OB 2NLJA 2P7TB 1NCDH 3CC5A 4HKBA 1ACZA 2Y6SD 1RI8A 5E2JA 2RJMA 1A6UL 4I3RL 1LO5B 2PYEB 2X4QB 5D70L 3VRIA 4HFWB 1KENH 2XN9B 3V52H 3VXUB 1FLRH 4OCYL 5BV7B 5EOCH 1P84J 2OSLA 1YUHA 1U3JA 1C5CL 3OAUL 3T0ED 2XG4A 1H3WM 2DLIA 3CX2A 4XP1L 3FO0L 2DQUH 1KJ2H 2OL3B 2VLRA 3O3EB 3EO9H 4ZFZB 4G3YH 4H25B 1XGPA 5EZIL 1UM6L 4GAFB 4JRWA 5F3HA 3I3EA 5CZKA 1BFVH 2ADJA 4IS6B 1PZUB 2AKRA 3O3DB 2AJ3A 4NBZB 4NNYA 3P0VH 4PD4K 3S3SA 4Y5VB 3ZE1F 4UDTB 5HGAA 3HC3H 3QXDA 2AQ1A 5FKAA 4O02H 2NYYD 5J1AA 2CO7B 1I1AA 1RUPH 5SWSA 1FBIH 5D1QB 3M8OH 3FB7B 2YUXA 4WI5A 3SDAC 3VWJC 1VPOH 1HH6B 4U31A 2AXGA 1Q94B 4MZ3A 3BKJH 3NPSC 1RY7B 3GI9H 4PRDA 1LE9A 5A3IC 3MLUL 4O58H 3OKLA 1I9IL 1YNTA 4OJFL 4UTBL 5HHNB 4DQOL 4KRNA 3S35L 2XXMB 5IVXE 1QRKA 4BH7B 4RFOH 1DFBL 3D6GA 2UZIL 1WC7A 2YD4A 5DRWA 2YMXL 4UQ2A 3VGHA 3TPKA 3C5JA 5MEND 3NFNB 2Z8WC 3HPJA 1BIIB 5JW4N 3MBEA 4ZDHB 4FQCL 2X2YA 2BNUA 4GQ9L 4RZCB 1YEIH 4KH2A 1DE4A 3VI4F 2IADB 4G8EA 2EIEA 1U8PB 4FABL 4OLWH 3ULUH 4KRPD 1K5NB 1WWAX 4JRXE 1CDJA 4MD5A 5H94B 4AM0A 4YXHL 3HZVA 2Z31A 1T1YA 1ULVA 3NPZB 4XPFH 2VXVH 2NQCA 1X7QB 5DUPH 1GC1L 2AJVH 3WN5A 3IXTB 1CDCA 5DD5H 4XPHH 4PJ7A 5FOBA 4N1EA 1A64A 3QIUA 1NEZA 2HWZL 2NXYB 5MEOA 5LGHL 3UC0L 2OI9B 1S5HB 1L7IH 3GSRA 1CXHA 1CDBA 1AR1D 3FTGA 4JHAH 4OZIE 5E2WL 4JFFD 3SO3B 1LDPH 1BVZA 1OGAA 4MD4B 2GITA 3MYJB 1MREH 3MOBH 2AK4B 4I0CC 4U6YB 1KG0A 3IETA 4XHJD 1KCSH 4OF3A 4GRWE 4HHAB 4AIZB 1MCCA 1UZ6E 3NIGF 5AEAA 1NC4B 3FOLA 4HAGA 5DVLA 5FYKD 1U8HB 3VU2A 5EN2B 4G8IB 4L3CB 4I13B 2XI9A 4R4NC 3X3FL 2N56A 4APQD 1MAKA 3ALWA 2DB8A 5E1AA 2J8UE 4QGYA 1S9YA 4I18B 5C0EA 5I2IA 3NCMA 4Z9KB 2D4FA 4FQQA 3LKPA 3DNKA 4F7PA 3EOYG 3IGAB 2Q76B 4WO4B 4LLDB 5D4QA 4C57C 5CIPB 3WXVL 3L95A 1B6DA 3LN4B 1UH2A 4JFDE 2FR4B 4IMLA 3CNKA 1R3LB 5EU6B 2Y4SA 5GGTL 1T20A 1A3RH 5DRXA 4M8VA 3MRCA 4XCEB 3EYUH 4U1LA 1G7QB 5FYJL 5L6YH 3E6HB 4MVBD 5T3ZH 3B2VH 2D2OA 1BX2A 3C08H 1TTFA 2XKNB 3V6OC 5DMYA 5F1OB 3TNMA 2YPVH 2OS7A 2QSVA 1MCPL 2R29H 1T1ZB 4UV7L 1ZVSA 3V6FB 4EDXB 4PREB 1NAKH 15C8H 4GXVH 1IQWL 1F4XL 1T6VN 4FQXA 3O2DL 2GT9A 3I3DA 1D5BA 2V7HA 4NHUB 3PP4H 4OCRL 1K8IB 1J5OL 2DQTL 3D3VB 4PLKC 1QBMH 5D7LA 1QTYT 1MUJB 4AG4H 2YD2A 4S0SD 4OT1L 3PHSA 3WO3B 1DUZA 4ZODA 1BD2A 2X09A 3AS2A 1RHHA 5F6IB 2D7TL 2XWTB 4MSWA 1R0AL 4M6OH 3SQOL 1CL7I 2XA8L 2M8XA 3B83A 5C6TL 4PJBF 1CIDA 4JFPA 3D85A 5D6CA 3JV5A 3UJJH 2ILLA 3HZMA 1EBPA 4P2CG 1TNMA 3NGBC 5DHVA 4WHYH 1J11A 3GEWB 3QIBC 1FGNH 2RFXA 3D69A 3RU8L 1BVLB 3VFVA 3SBWA 1T04A 3MRPA 1OB1A 1IGMH 3E6FB 1CZ8H 3C5ZA 5BS0A 2NNAB 5DJZB 3U48A 2X4PB 1V3LA 3EOBB 5F44A 4F7CB 4LSUL 3RP1A 4X6CA 2F53A 3IFPB 1N59A 1NEUA 2IPKB 3SGKA 2ZUVA 1U95B 1QVOA 1FL3B 1MFCL 2F54D 1R5IB 3MPCA 5JMOC 5BVPL 5F7NC 3MNWB 4NUJA 2CK2A 1KENL 1QP1A 5J0BA 5FHAH 1OL0A 1DR9A 5E8DH 3V52L 4OI8A 2D31A 3IDMB 1FLRL 5E00A 4D2NA 1RV6X 5EOCL 2AJXH 5DGRA 3QUYC 4PJCB 1PFCA 2QR0A 2CDEB 2XZZA 5E8OA 4G3YL 2NPLX 1IFHH 4XNXH 1Q0XL 4Y1AA 2BSRB 3CDYA 1EFXB 4RBPH 3WSQH 1BFVL 3ZKQD 3HA0A 4C83A 5D93C 4RMSA 1YEDA 2YZ1A 3SE3C 3AM8A 3U2SA 1J8HE 2VLLB 2DQJH 4OI7A 1SYVA 3IDJB 2APWA 4O02L 4N0YH 3VXRE 5IMKA 5ISZB 5INDA 4QXWA 5CSGA 5DS8A 1IEHA 3MV8D 4YHZL 1JNNH 1H15A 4P59H 2J2ZA 3IRPX 4ENED 1T0NA 1IRAY 1VPOL 2XZAH 1X6NA 3BKJL 1HHHA 1NBZB 4PJFF 4LBEB 3MCLH 3TZVA 4PBXA 1IKNA 2ZKHH 3DX9B 4XMLH 1P69B 3SKNA 3Q6FA 4UOJA 2XPGB 3QQ9D 4PJHE 4ZYKB 1IBGL 5D7KD 3BIKA 2XNAB 3LKSA 4KTDH 1HOCA 3ZKMD 3S5LB 3RX5A 5DEFA 3BAEL 3D18B 1FHGA 4ZFOB 3VDCA 4JDTH 5TDOA 2Y5TA 5HHQA 1VGKB 4Y7MA 3T65B 3DMMA 4JM4H 4WU7B 1CG9B 5HHPB 4YPGA 1CFVH 2IFGA 2FWOA 1NDMA 1KJ2B 1RSFA 3VFSA 5E03A 3VWJB 3SDAB 3LV3A 3DARA 3BOVA 3VW3H 3WKMH 4G43B 3VFRB 2X7LB 2Z8VC 3IF1A 5KVGH 1KIPB 3U7AA 2R1YA 2EC9U 4XPFL 2VXVL 4KUZH 3EO0B 1DSFH 5IKCB 5DUPL 3HR6A 2AJVL 3PWPD 2P5EA 1NANI 1MHEA 4RGNB 1NCAL 2EE2A 1O7SA 5DD5L 4XPHL 5C9JA 3G6JA 3HR5B 2C9AA 5KW9H 5IMLB 2DQIL 4YXKH 3TYGH 3C9NB 3NIFF 5TFSH 3VMNA 3H0TB 1WT5C 4PS4H 1HN1A 1XZ0B 3FT4A 5IB3B 4BZ1H 1FYTD 1VEMA 4ODTH 4JHAL 4W4OC 3W0WE 1KT2A 2NY3C 5GS3A 3AVEA 5EIVA 5FUOH 3SO5A 5IJVB 1XGRA 3HUJA 1MREL 3BGAA 3CZFA 5DURD 5I1IH 3QULA 4I77H 1WICA 4JN2B 5HYJD 5IEKB 5GRUL 2WWMD 2AEPH 3RJQB 1JL8A 3BZEB 1XF1A 1RJZA 4MWFA 1FVCB 4QO1A 2A6KA 4TUOB 1IEAB 4L9LC 1UKQA 5C08E 4BFEA 4PYHA 1G9MH 4PRPA 4LDEB 1IM3B 5GS2D 3OHXA 3LKQB 4U6XA 5CEZH 4BQ9A 2H26A 2XXCB 5DYOA 4EDWH 3QJFA 1IAMA 3QEHB 1VERA 3CMGA 3VXSB 1RD6A 2V17H 1FFNB 3HG1D 4OZHE 4RA0C 3RWCA 3O2WH 3A6BL 5CHNA 2BJMH 2BCKA 3KPRD 3U36B 1JI1A 5CBEA 3FQWA 1JFQH 3T0DA 4DFIA 4ZQKB 1S7WB 3CXHK 2V7NA 3EYUL 4FZEH 5F7DB 1MI5A 5IK3A 4HKJA 2J3SA 2J6EH 1KOAA 3L9RA 4PJ8D 4WI8A 32C2B 3RWJB 3V0AC 3SDDC 3C08L 4NPYA 2IPUK 3VFNB 4XX1E 4YO0A 1JNHB 3MGOB 4Q0XH 2NY6C 3PL6B 1DBMH 5IROC 1WTGT 3A6OA 15C8L 4GXVL 4Y2OA 3SDXE 3NZ8A 5GGUB 3VWKA 1EXUA 4PTUA 2YWZA 4FFYH 1QO3A 4KZDL 4XNQA 5B3JF 3PP4L 5JUEH 5H2BA 2BERA 3G5XA 3CLEL 5IBUB 4OFDA 4LEOB 4Y2DB 1QBML 1A6AB 2AXFA 5B39A 4PGDA 3T0BA 4AG4L 5DRZA 1ZOXA 5D9SB 1AO7A 4L4VE 5CJ5A 1S3KH 2BSTB 2CRMA 2GAZA 1YEEL 1OTTD 1I3UA 4GW5B 2HRLA 1H3GA 2WBKA 3L3JB 4KXZH 1IAKB 4LF3A 3K3QA 1ES0B 2CR6A 4YFLI 1Q72H 4Y19D 5C9KA 3VE0A 4M6OL 2DIAA 2EIBA 3SKOB 5IJKC 3VRJA 4B7LA 2NZ9D 4DN4H 1G7HA 5L9DH 4LFHG 1DVFC 3VA6A 3QB7C 2VXSL 3O6MH 1FGNL 4U6VH 1KPVB 4TSAH 4MNQD 1KIRB 2X89D 5I1AA 2YA1A 2A0LD 4NNPH 4DGYH 1HCFX 2OM5A 1IGML 4WVRA 3U0TA 5L2KD 1CZ8L 1HWHB 3CFJB 1JWMB 1QEWA 3R4DA 1JHTA 1Y6MR 1Y0LB 3FCTB 4L8CA 5IB5A 2JTDA 2X4NB 3WEXA 5ESAB 4P9HH 3Q0HA 4JFEE 3U83A 3DXAD 3FB8A 3JWOH 4MHHI 3Q2CA 2FJGB 1EHXA 5FHAL 5E8DL 5D7JA 2AJXL 3PWLB 4KKAD 4K9EH 4UTAH 3FT3B 3RVVD 3NGBB 4ZUUA 4ETQB 4XCYA 1LP9E 1OAXH 1Z9MA 5C2UB 4LHUD 5MHSE 4XNXL 3C5SA 3WJJC 2UWEE 4Y5XC 1XF5B 3HRZB 1TZHB 4MJ4A 3WSQL 2X4RB 1U8QB 5F71A 3CVHH 4WHTA 3PABA 4GG8A 4YH6A 2DQJL 5FKPA 3CUPA 3CX5J 4LHQB 3MLTA 3F7QA 1PKQE 2NX5B 2N7BA 1IC5H 3FONA 1F6LL 2W9EH 5IW1B 3DX8B 3X12B 2XZAL 3UBXI 3G5VA 3QUYB 1CD1B 4X4XA 4JZOB 4YXLH 3FFCB 1CICA 4XMLL 1YMMA 2JELH 1JMZA 4WWKD 3AXLA 8FABB 4IDLA 4YHNB 2D0GA 4JFOB 4U2ZA 5ID1A 1QG3A 3L3HB 1FNGA 2OZ4H 5BJTA 3AS1A 1ADQA 1W0VB 3U46B 5D93B 1R3HA 4PYGA 4QOKB 3DO3A 3UTSE 3RGVA 5C6PB 2DLFL 4C56B 4MDIA 2PXYA 5CAYB 4QRQA 1HKLL 1A21A 5E2UH 3I6GA 4KVCH 3N50A 3RKDC 1XR9A 4JM4L 2W60A 4CJ1A 1CFVL 3VXTB 2BC4B 1G7MA 4KJQC 4ZXBA 5IFHH 1F11B 2VH5H 3GK8H 1AC0A 1RU9H 3U0PB 2GJZA 3MNVA 4KKBD 4PJCF 5EOQL 2NY1C 3NN8A 3VW3L 3WKML 2VLRD 3TWCH 3QDJA 5C0GA 3F6LA 4G8FB 1KYOJ 4QHUB 1T6WA 3K1DA 1DSFL 5CMAA 3RZCD 4N9GA 4Y4HB 2H32B 1JRHH 1UJ3B 2YBRA 1RZIA 4YXKL 4MAYA 2QSCH 3GRWH 3IDGA 3EYQD 1BAFH 3EYSL 3MUHL 4JPIB 4AQOA 4TTGA 5IVZB 3JTTB 4ODTL 2G5BA 1RZGA 2QV2A 2P8LB 5C0CA 1I1AD 1EK3A 1IC7H 5SWSD 4DW2H 5TDNA 1SEQH 3UTZB 2CLVA 1MNUL 5FM5O 3G6AB