3WEXA

Crystal structure of hla-dp5 in complex with cry j 1-derived peptide (residues 214-222)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
181
structure length
181
Chain Sequence
IKADHVSTYAMFVQTHRPTGEFMFEFDEDEQFYVDLDKKETVWHLEEFGRAFSFEAQGGLANIAILNNNLNTLIQRSNHTQAANDPPEVTVFPKEPVELGQPNTLICHIDRFFPPVLNVTWLCNGEPVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDVYDCRVEHWGLDQPLLKHWEAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC class II antigen
publication title Structural basis for the specific recognition of the major antigenic peptide from the Japanese cedar pollen allergen Cry j 1 by HLA-DP5
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 32
structure length 181
sequence length 181
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2013-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wexA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 3wexA01
4P4KB 2NY5C 5JW4Q 5KSAC 2ZPKH 5F9JB 1RZJL 1KEML 4YDVA 2GUOB 4HJ0C 4K3JH 5CZVH 1MQKH 2VRAA 4JHZA 4UTBL 3AB0C 1J8HD 2YUWA 2YD9A 2XV6B 2KPNA 5DEGB 2VKWA 2I9LB 4F37K 3MV7D 3T8XB 4WEMB 3VXQB 1J1PL 1EGJH 1P7QA 4NJ9H 5D8JH 3QIBD 5F3BA 4HMEA 4ZAKC 4BZYA 4X6CB 1C5BH 4GAJH 2P8MA 4MNGB 3MRPB 4IRJB 1HINH 2DBLH 2AEQL 4XCYB 4F3FB 3QQ9D 5HDQL 4ALAL 4JFDE 1UWGH 5JIHA 5KSBE 5A16A 3T0ED 3MCKA 1A6UL 4RISL 3H7BB 5GISL 1JCKA 3W9EB 4AEIL 3FT4B 4XBPA 4WHYG 3L3JA 3S8WA 5B8CC 2CIIB 1FIGH 4QRPA 5D7LD 3WD5L 1L9MA 5FECA 3MRMA 5EO0B 3L6FA 2Z35B 1CDHA 4KGJA 5GS2D 1CGVA 3ULUL 5I8EA 4Z7NF 2VLKA 4WCYH 5I8CB 1MCQA 1TDQA 4ONOA 1NGQL 4XZUB 1MF2L 3C08H 2Z31D 4OJFL 4JO2L 4JQIL 3CXDL 4XB7A 1AXTH 1GPOH 1MNUL 4NRZA 4MS8C 1JPGA 1ZXQA 2ZWLT 1MH5A 4GRMA 4KAQL 5I9QB 3MYJB 3B3IA 3V0VB 1PY9A 4WU5A 4YDLB 3MOBH 4ZOBA 3GZKA 5GGTH 1LE5A 3S37H 1GIGL 4G8IA 3NOIA 4UUJA 3O9WA 3JV6A 1A7PL 1KYOJ 2UWEE 5DMIH 4JY4B 1IAIH 5F9OL 2GW5A 1TJIH 3K1DA 1EGJA 4J4PC 4PP1D 4PJDE 5C2BH 5J12C 4LP4A 1GJIA 3QA3A 1EFQA 4L3ED 1GZQB 4FQHA 1P7HL 3C60A 5I8KH 4TQEL 3FO0H 4QRQB 2NNAB 1CGWA 4MLIA 4PGDB 1I1AD 5EFIB 2XKNA 2ZG2A 3D39E 3LIZH 4X5XB 1I3RB 1I9JH 3LN4A 1S5IH 4G8FA 3Q5YA 5I8OH 4RFOL 5DVLA 5F89A 1JWSA 1AP2B 3DARA 1WAAA 1RIVL 4IHOA 3TVMA 3PUCA 1S7VA 4QRSB 1RK1A 3LN5B 1WUNT 5F3HB 5I1LA 3FFCE 2VZTA 1T2XA 4QOKB 3X12B 1MVUB 4JM2C 2V17H 2YPLD 4IOFD 1J05A 3GI8H 3VD3A 5HHME 5GS1C 3DV4B 4NT6B 5L2JB 5MEQB 3CFBA 5EU3A 1ONQB 1ZHKA 1VCAA 1UM5L 5DFTA 1NCCL 1IFHH 1E4KA 3F7QA 2WLYA 4LLYA 4EDXB 1CDJA 1CS6A 3S4SA 1UM4L 1EA9C 2ESVB 4ZPTB 3MV9A 1JYVA 1AXSB 4M43H 2R56H 1OY3B 5GGTA 2W9EL 2VDOL 3FKUS 3QUXB 4FFWC 3W82A 4NWTH 1PZ5A 3HNTL 2AABL 2PKDA 5D7JA 3TJEL 2YD1A 2VQ1B 4MQ7B 2AV1B 3EO0A 3KPRB 4EIGB 2Z4QB 5DD6A 4UB0L 3L95B 3E0GA 4PTUB 5JPNB 2JE8A 2QSQA 3MRNB 4I2XB 4RDQG 2E3VA 1F4XH 3QXDA 3WNMA 4JHBA 1A7NL 2MMXA 5LGJB 2NY1B 4UIMB 5EU4A 4F7EA 3IDUA 4L4TB 4XNXH 2FHBA 4JLRA 1RHHB 4OF6A 4PJ7B 5FO8B 5EBMA 2GY5A 1BD2E 3X11B 1JI2A 1U8JA 3E3QE 4G6FB 5KSAD 2NYYC 5DUBA 3MV8B 2GTZA 1J0KA 2E7HA 1P4IL 2UZIH 5GRVK 5E2TL 4FQQB 4HJ0D 2D31A 3QG7L 2VN7A 5F6HJ 4WWKC 5E94B 5KZCD 4TPRL 5E99H 5DD1L 4UOJA 4OCRH 4WDIA 2OSLA 3DHJA 4HBCL 3DURA 1JPSH 4IOSD 1UYWH 3H9SA 4ODTH 5T3ZD 5KSVB 4ZAKD 1ETZA 4NZTH 4XCFL 2CPCA 5D2NB 4JRYE 3HG1D 2P45B 1FZKA 1KJ2H 5C0RL 4BELD 2QR0A 5C8JA 5FB8A 4X6EB 5ELIA 2FJFA 3OGCA 1QBML 3MR9A 5H35B 3CDGB 2YPKB 1OAYL 2GJ6B 4P46C 5EN2B 3JTTA 1C16A 4D8PA 3O3EA 4BQ6A 1EJOL 5EZIH 3ZTNL 4X9IA 1ZVYA 3B5GA 4NQTA 3VE0B 1U3JA 3AY4A 3MRCA 5AWNL 5FYLH 3MREA 1CICC 3VD9A 4K3HA 2DLEA 3VWJC 4RX4D 2W65A 3V8CA 4M00A 4OBRA 4UINH 3WKNA 4PJGA 1JPTL 2IADA 1VEMA 5EOTA 1WV7T 4N8CL 4N0UE 5DC9B 4RZCB 4LSVL 2PYFA 3C8KA 4L3CB 4X5LA 4MS8D 3V6BR 4HJJH 3WUWG 2N7AA 2GY7B 2QQKL 2ZZUT 5EIVA 3FQUB 5EBGA 3BGAA 3MRRB 2A2QT 3C5JB 1EVUA 4C54A 1R3IH 1YYMH 4Z7VE 1J5OH 2EIEA 2OJEB 1B9ZA 5T1KA 4LLQB 3AAZB 4J4PD 1OP3H 4NFDA 5C0AA 2EYSB 4XNZC 5A1AA 4HXAH 2AKRB 4PD4J 3ULUE 2M26A 5DHVH 3BISA 4RMRA 1CBVH 2AAVA 4JFOB 4HS6A 1X6NA 1NBYA 5J56B 1E4XI 3ZDYF 4PJXA 4PV8B 3BDBA 1PGRB 4KI5F 1YEGH 3OV6A 1A5FH 1BQHB 4HGKC 1EFXA 1C12A 2JK5A 2PXYC 2ZNWA 1FGNH 2Q7NA 4OZFB 5I2IA 3HZVB 3UJJH 4GMTL 1T1YB 4M61B 3K8MA 3UCRA 4OLVL 3ZHKA 5AAWA 4I3RL 1QSED 1R3KB 4BUHA 5HGBA 3PGCA 1OP9A 4LCUA 2J8OA 5KJRH 2ATPB 2F54B 4JM2D 5DRXB 4O58H 4DVRH 4P2OB 1MCFA 1G0YR 3F8UB 3ALPA 3T65A 1J10A 5ICZB 4QTIH 4CMMA 1CD9B 1J1XL 5KVDL 1HQRA 4HHAB 4FOMA 5SWQA 1HIMH 2E9IA 5D71H 4QLRA 5DMYA 5GS0C 1KPRB 4FFWD 2L0DA 2WBJB 2C3GA 1RURH 3VFWA 2VAAA 1GGCL 4CADA 1LO4L 1R5WB 2AJUH 4M5ZH 4M7JL 4F9LC 3LSOA 1EO8L 4JFDA 5KSBA 1KN4L 1TZGH 4CVWA 5DHVA 2P8LA 5C6WH 4LOUC 3MLVH 1KTLB 2HVKA 2IANE 2DQGH 3ROLB 1YC7A 2X41A 4NO0B 2NYYD 3JVGA 3WIHH 3RPKA 1JFQL 2HJKA 4YFEA 4GG6A 3QG6B 2DYPA 4FQ2H 1GAFH 1G84A 5T5NF 1MWAB 2EYRB 3QEUA 4LVOC 1MFBL 1BEYL 2V5RA 4WWKD 1NGWB 3DRQA 3PHOB 5J11C 1TJGL 1LO2H 4YX2L 2PTVA 3I50H 5ID1A 2YC1B 4FQXC 1SEBB 3KWWA 3ULVH 1FO0H 2W0FA 4NQVB 5JMRA 1MCEA 1RJZA 5E8EB 3CMOL 3P4OB 3LMJH 4ZYKB 1E4KC 1LQSR 1TZHA 1I8IB 4LSQL 3IJHA 3BJ91 3UTQB 2FCBA 3TH4T 5I1KL 4KVCH 5FGSA 2D9QB 1RULL 1BECA 3QP3A 4OFDA 4H1LH 2V5TA 3TYGL 2D7PA 4HV8A 5AZ2L 3QO1B 4BQCA 4P46D 3BPCB 2E7LC 3U36B 5E8DH 4MJ6B 1XF4A 4ODHL 3ECBB 1NLBL 2DQJH 2JB6A 4UNTA 3GSXB 1IKFH 1CICD 2ERJC 4ZO8A 4PP2B 3VWJD 3MJ8A 4OLEA 5I19L 1YMME 2D3VA 3WUZA 3BIKB 3GKWL 3EOTH 5A2LH 2OZ4L 3D39A 3VFNA 2HJFA 3VDBA 4Q74A 3RKDC 4JCMA 4ELMF 3F65A 5IMMB 4XVJL 1X5LA 3WIHA 1P9MA 3UJTL 5F7YC 4HUWB 1A1NB 2EH7L 3CVHH 3MTRA 3VRJA 5C0JB 1RUAH 3CGTA 4PG9B 3BZ4A 3FFCA 4XP1L 3MPCA 2VR5A 5BJTB 2XN9B 5GRZA 5CILH 5E6IC 1OQXA 4F7CA 3VXOB 1G7IA 1B88A 3TBTB 1EPFA 5C09A 1ZANH 2YSSB 4QHKI 4R7DB 2E6PA 1LO3L 3FB6B 4PGCA 3KJ6H 3OXRB 1IL1A 3K74B 1RZJH 1KEMH 3Q6GH 1JTOA 3DUUA 3L3KA 1MAML 2F53B 4YDVB 3CFCL 4R3SA 4WENB 1G7MB 2DLGA 3O3DB 5I1JL 3IFNL 4UTBH 5KW9L 5B38G 3RUGE 3CXHJ 2H32H 4QRPD 4H1LA 5D5ME 4NNPH 3IKKA 3AY4C 1H5BA 2PXYD 4E42B 1J1PH 4TUOA 4NKIL 5BVPL 1AHWC 3BFOA 1P7QB 3J8F7 3MZTA 4LRIA 3WL9A 2JIXA 5TF0A 4JAMA 5E6YA 1BBDL 2AEQH 1J9CT 4ZO7A 1N5YL 4NZUL 1BD2A 2Q76B 1C8PA 5HDQH 4ALAH 1XFPA 3MZGB 3D2UA 3O45A 3MRBA 1X5KA 1A6UH 4RISH 1MRCL 1FV1B 2AW2A 5GISH 2C3WA 2DQIL 4AEIH 5DDHA 4NQED 3PE9A 2ZCHL 4XBPB 3JXAA 1OGAB 3CVHA 3RWCA 4LDOB 5DRWA 1T1ZA 3BO8A 4WI5A 4JN1L 3ZE1F 3WD5H 4Z95L 5GS0D 2FYYB 3MRMB 4YWGL 1IKNC 4XGZA 5F71A 3CPLA 2Y25A 3ULUH 4JRYA 1FL5A 1S78C 2JB5L 1NGQH 1MF2H 2VLKB 4DWHA 5J1TC 1CDUA 2FJGB 1WJ3A 3GSVB 4JO2H 5TDOB 4JQIH 3CXDH 4JJHA 4ONGH 5K9OB 1E6JL 4XPFL 1YEFL 1MNUH 4F15C 1OM3H 4LOUD 1WWCA 3AM8C 4KQ3L 4KAQH 1JPGB 4HG4K 2JCCB 3OSKA 4XNQA 5IVXA 4CN6A 5F96H 2H32A 5FF6B 3DSNA 4HUUB 1GIGH 4XT1C 4HPYL 3GIZL 4ZODA 5I74B 5JW3L 1A7PH 4JRXA 4G8IB 1XF3A 1QSZA 5F9OH 3O9WB 4GXVL 1C5CH 3NCFB 4Z18A 2BZDA 4ETQB 5GJTL 4PJGF 3QA3B 1NH6A 4IDLA 5CHNA 3VG9B 1XF2A 1BPVA 4LAJH 4FQXD 3ETBF 2W60A 4FQHB 3QQNA 4U6YB 3OKLA 1NEZA 4TVPE 2X9XA 4GKSB 5DFWH 3QFDA 1R3HA 4DCQB 1IT9L 3VXMD 1A2YB 4L4JA 4U1IA 4MX7B 2X4TB 4UI2A 1QP1A 3S88L 2P5WE 4MA3B 4UILL 1BQUA 4NBYB 5F89B 5T3XD 4H25A 1RIVH 3T0DA 1JWSB 5DK0B 1B90A 5T1MB 5SX4H 4Z76A 1JYXA 1TQBC 3UBXI 4IHOB 3TVMB 4GBXA 5GGRY 3B8SA 3FQWB 1S7VB 2FO1A 1AR1C 1LHZA 1S9VA 2E7CA 4N1CA 2PCPA 4F7MB 1WC7B 2YD4A 1WFUA 3CX5K 2A6JB 2BFVL 4JVPA 5FCSH 5JUEH 4J3SA 4PJXF 1CK0L 3AREB 1ITBB 2ADFL 1UM5H 3CLFH 3VXNA 5I16B 3C5ZA 3RKDD 3V2AR 5E70A 1UM4H 4U1MB 4ZTPL 5FM8A 5HYSB 4R8WL 4M9PA 4KRNA 2W9EH 2VDOH 3WJJC 3OG4B 4WEBL 3HNTH 3EFFA 2AABH 35C8H 3SGEI 4J6RL 3H9SD 1M1SA 1SEQL 1WWWX 4HUKB 1JNHA 4UB0H 3EO0B 2APVA 4WHTA 4Y8DC 3I2CL 5E6ID 5DD6B 4LLMB 2DLFL 3MNZA 1FG2B 1P7KA 4DKFL 1AGEB 3QH3B 3S35X 4OM1L 5E03A 1A6ZA 1V3KA 4F7EB 1CGUA 4I18A 4EN3C 4MCYB 2OLDA 5J6GA 3FN3A 1MCNA 5EBMB 3DIFA 3SOBL 4KUZH 5E1HB 3UYOD 1P4IH 2R2BB 1CGYA 2GTZB 4KXZI 4YNYA 2I5YL 1XGYL 3SKJL 3WLBA 1FNEB 4CU8A 4NFBA 3V0AC 2I60L 3T2NL 3RWFA 5D70L 3BKYL 4HBCH 5J06A 2OSLB 3UTSD 3DURB 3EDKA 4M4PA 1AH1A 5I75C 3ZHLA 4XCFH 4LPUA 4HJGA 2IANA 5CMAA 3T0AA 5C0RH 2N1KA 2RHEA 4YE4L 4G7VL 3U4BH 1RZKH 4OZIE 2QR0B 5C8JB 1CFSA 5FB8B 2JELL 1QBMH 1QYGL 3LCYA 2I27N 4GG6F 2V2WB 1N7ML 3MR9B 1KG0A 2DJ4A 5AD0A 1D9KA 3OB0H 4JFPB 3ZTNH 3O3BA 4P9HC 4D8PB 2GHWB 4WU7A 5EO9B 1AO7B 2X4QA 4H8WC 1S9YA 3MO1A 5F44A 5AWNH 4PJEE 3ULVC 2XXMB 4CN4A 2YN3A 4JFQA 3MREB 1G7LA 2HLAB 3NPSB 4X7TB 2XIDA 3J7HA 4QGYA 5DR5L 1BZ9B 3PQYD 1S78D 4TRPL 1JPTH 2FEEL 4NDMA 2EIZB 2XY2A 4P57A 4HUVA 5EOTB 2BNQB 3O11A 3KYNB 2MKLC 3FB8A 4FA8A 5A40E 1EFXD 1ES0B 5BV7B 5IHUL 1KB5H 1T0MA 2XKUA 1K3IA 4IDJL 4LRIC 2DLTA 1FP5A 4PJHF 5FYLD 2EIDA 2ZKHL 1A9BB 2NW2A 1FFOB 3ZYJA 5KVEL 5T1KB 3G6JF 4Y0GA 4JZJA 1SBBA 4P4KC 1NANH 1YY9C 2G2RA 2W0PA 1O0VA 5C0AB 3DROA 1XF1A 2YD7A 1AGCB 3TC9A 1CE6B 5DTFB 5CEYA 2IFFL 4G80B 1I8LC 2VXSL 4HS6B 2ZG1A 4JREB 1KJ2B 4XAKE 1NBYB 3V9FA 3NFPA 5FOBB 1QRNB 1J86A 1RPQA 4J3UA 1NKOA 2C7UA 3U9UB 2PR4L 2CR3A 4XC3L 3T0VA 1C12B 3QSKB 1OARL 3HUJF 1ZT4A 3HNSL 4IRJC 2EE3A 1TVHA 2FIRT 4I3RH 4AEEA 4QT5B 4YHZL 1X5GA 3ULVF 3SQOL 5HGBB 1AR1D 4X6BA 1I7UA 3LS4L 5ESVA 1DL7L 1MHHB 5FHAL 2FO4B 5FKPA 3UYRL 1CQYA 1JE6A 5IW6A 5DQJB 2XPGB 4ZG1A 5D5MA 3T65B 1D6EA 1W0VA 4MB5A 5KVDH 3QDME 2OBGA 1OAZL 3B43A 5SWQB 2HFGL 2G9HB 3H3KA 5F97E 5JNYB 3S3SA 4S0TD 1JWMB 1I7TB 2F19L 1I8MA 1LO4H 2DQUL 4M3JA 1PAMA 2VAAB 4CADB 4M7JH 3S37X 2BSSA 3VA2C 3BKJL 4TVPH 3D0VB 4MXQC 4PJCE 1KN4H 3I02A 1G9ML 1WK0A 3ARWA 5I9QC 4JFDB 1CL7I 5KSBB 4M9OA 1RFDL 5DS8A 2KQMA 4YDLC 5DHVB 5KN5A 3RWIB 2HVKB 3VH8B 3ILPA 4GSDH 4EN3D 1XGRA 3GJEA 4B7LA 1JFQH 4YHML 3LQAL 3BEWB 4L8DB 5FDWA 4LHQB 1VSCA 2IF7A 2DYPB 1MFBH 1J12A 1WBYA 4XAWH 1BEYH 3K80A 4PUBL 4HZAA 5MHSD 1WEJH 1M4KA 2OI9C 1TJGH 3DRQB 5CIPH 4XP4L 4YX2H 4XP6L 3PGFL 4ZMAT 3KWWB 3CMOH 1NCAL 4BK4A 1P2CA 3INUL 4LSQH 4JJ5B 5HYIA 4QF1A 4KPHL 4NQDD 1TZHB 4E0RA 5DJ8A 1J88A 5I1KH 1JMZA 5IVXF 4N0RA 4HS3B 1FPTH 1RULH 2MOVA 3HMWL 2C3XA 3WFCL 4QKXB 4MYWB 3TYGH 1JRHL 4FNLL 5AZ2H 5ACZA 1IC4L 5JIKA 4HV8B 2UWEB 1VGEL 1W72B 1E6OH 4ODHH 5C0CB 1MOEA 2VABA 2AK4E 3CH1A 1XF4B 4PJDB 1HSBB 5FYKL 3HA0A 3PV6A 5C09D 1ZSDA 1HZHL 4GKOA 3ULVD 5LGKA 3U83A 4YR6A 4OF8A 5ALCL 5I19H 1VFAA 1IGJA 1UWXK 5F7LB 3MJ8B 3UYPA 3GKWH 5D6DC 5HDOA 3CLEL 4WI7A 2OZ4H 4CKVX 3GMMB 5B3JF 4Y88A 1FL6B 3PWPE 2IFGA 2P5WA 1HILA 3F7RA 4UZGA 4FQJL 3RZCA 3QUXC 2M8XA 1YY8A 4XVJH 3RFZC 1SJXA 4Z0BH 5C07E 3UJTH 5I1DB 4KK5C 1CLZL 5GGUA 2DIBA 4LGSB 1TZIB 2IBZX 1IZKA 1RZ8A 2XWTA 3D0LB 1F3DJ 4XP1H 2BVEA 2CO7B 3P0GB 3BZ4B 1HQ4A 3OAYK 2NY1C 2ED8A 3FQTA 5CIPA 2DICA 1BWMA 1LO3H 2CLZA 4P4KD 4NNYB 4PJ8A 5HHMB 1YY9D 3AVEA 1FO0B 2QQLL 5D1ZB 2HJLB 3AGVA 4HFUL 1IEHA 4KJPC 2ZSVA 1MAMH 2GITB 3GBML 5I1JH 3IFNH 5KW9H 3TCLA 4R3SB 4DN4H 3ZTJG 4NCC2 5H2BA 1T6VN 2YZ1A 5DA4A 1CN4A 4V1DE 3D69A 4NQSB 4NKIH 2W0LA 1SM3L 4XPGL 4HIIA 3MLWL 3O2VL 1GH7A 1ZTXL 4IRJD 3B5TA 5IWLA 2EO1A 3AXLB 2ICWA 5DGRA 1U3HB 2JIXB 2DKSA 4M02A 4UQ2B 1BBDH 2XG4A 4JAMB 1N5YH 1MFAL 1WSST 4WFFE 4UQ3A 5FYJE 1BD2B 5GZNC 4U6HA 2AERT 2OZ4A 3A67H 5K9KB 1FN4A 4U1JA 1RZIB 1MRCH 4EXPX 1G7QA 1D5BB 2VN4A 3T2PA 2DQIH 3LKNA 1MELA 2ZCHH 3V4UH 1D5ZA 4G9DB 3AU1A 4OZGB 4JRXD 4YDJA 1C1EL 2CLVB 3CVHB 3IDYC 4JN1H 4WJ5A 3O4OC 4Z95H 1MRFL 5F6IB 1T1ZB 3BO8B 4G8GA 1BHGA 3MRJB 4XH2A 2QQNL 5C08A 4GAYA 4YWGH 4HQQH 5IF0A 2I25N 3KJ4C 4U0RB 4ELKB 4KZEL 4NRXA 4OZIA 4OLYL 1G9NL 4HK0B 4MXQD 1O7VA 1E6JH 4XPFH 1YEFH 4QY8B 4NFCA 3L3DA 4HMDA 1T20B 4KQ3H 3SGJA 5D2LB 1A9EB 4K7PX 3RTQB 5C9JA 2SEBA 3O6FC 4NO2A 4HW6A 4LU5L 4NQCA 1PEZA 3QHTC 5ABDE 4OLWL 2R15A 5JW3H 2NXYB 5TGBA 3OB8A 5BQ7A 2HG5B 1XF3B 5E8PA 4WTXA 5SWZE 4LPVA 3VCLA 5HY9A 5JOPE 4I5BB 4BSJA 2YEZA 5GJTH 5CJOL 5GQBA 2DI9A 3DYMA 2DIAA 4LSUH 2Q87A 5DLML 3QIUB 1JUFB 3VFUA 3ELAT 1QHOA 1Z9LA 4N0UB 4PV9B 1F97A 3PDGA 1ZLWH 3OKLB 1TQCC 2D7TL 1BREA 2RAMA 1AC0A 3QFJE 1IT9H 1MCOH 1YJDC 1R3HB 4HPOL 4LARL 3ZSSA 4BYHA 3S88H 2R23A 4U1IB 2B2XH 1C7TA 4UILH 2RFXA 2A83A 2XFXA 5DJYB 1MJUL 2GI7A 3QIWB 3CU1A 4EUPH 4Z7VB 4H25B 1MFCL 2VDNH 3FFDB 3RWJA 4QOKD 3SE8H 3HTLX 4Z78B 1DBML 1JN6A 1YNTA 2Z8SA 1FNGB 4J3WA 3B6SA 1U8OA 2BFVH 2W0KA 1R24A 5F1IB 4PRIE 1CK0H 1LE9A 2ADFH 1EJ6A 2VDRL 5EWIL 5IMKA 3KLSA 5FM5O 2C4FU 2ESVD 3EDDA 1AD9B 2J88L 3CZJA 4MQXC 5E5MB 3QUXD 4ZTPH 1LEIB 4R8WH 3WXWL 4KK5D 3SGEH 1BVLA 1YEIL 3KPRD 4WEBH 3S97C 5EUOB 2IQAB 2HKHH 4J6RH 1SEQH 4L8SA 3K46A 3FN0L 3I2CH 4JY6B 3BHBA 2VLRE 2NY1D 4MXVE 4NM4L 5FYKE 4DKFH 4DZ8B 4LASH 2XTJC 3ZE2E 1MCPL 4L4TD 1BFTA 3QAZB 1P7KB 3L5HA 3P4LA 4I0KA 1NLDL 1IGTA 1R5VB 3FQNA 3LH2H 3P73B 1B4RA 1PSKL 4P4RB 4S10A 1SYSA 1UZ6E 4IEFB 3PABA 4PJAB 3RBGA 1UEMA 3SOBH 3QDMA 5J6GB 4KJPD 2BHZA 1HWHB 3KPLA 2BY3A 2I5YH 3SKJH 3IETB 5C0GA 1ZS8B 1HH6B 3FZUC 3DMMA 3NGBC 4WUUB 5IW3A 3T2NH 3D85A 5JR1L 1XEDA 5D70H 3BKYH 3IXTB 1T0PB 2WSKA 3UTTA 4PRHB 2VXTL 5EG6C 4PJCA 4OZ4A 3SJVE 2X4OB 3ARYA 4OF5A 2V5SA 1UJTA 1QUNA 1T03L 3GHBL 1WVZA 1SMAA 1E0OB 3ARVA 4BH7B 1P5VA 2GSGB 4HJGB 5JIIA 3O4LE 4YE4H 4G7VH 4ZUVA 1J0HA 3RZCC 1CXLA 5CMAB 2AJZB 5GZND 1CFTA 2PYEE 3BD3A 3GRWH 2Q7YB 3BYYA 2OR8A 4KC3B 2LQRA 4BSVB 1N7MH 3RX8A 4EDWL 5AD0B 1WFOA 3GJFA 3TYFA 5EBLA 1GSMA 5DI8A 4WU7B 2MQCA 1HYSC 2IC2A 4JFXA 3BI9X 5FIEA 7CGTA 1L7TH 1RU9L 1CD1A 1G7JA 2Z91A 1SBSH 3MYZA 3EYUH 4Z9KB 1NSNL 4N0YL 3QT2A 5GGVY 5FHBL 4ZFZA 4GH7B 2ZOKA 1X5XA 3P9MA 4JZNA 5E7BA 2ZUSA 5L2KE 5AG8A 12E8H 1U8PA 2LU3A 3FB8B 3TA3A 1J11A 5IHUH 3R06A 3FT2A 2WLZA 2IAMA 4ODVL 4BFEA 3VFRB 4O5LL 3QDAA 4G9FE 3O6FD 4H26B 3PNWB 4IDJH 1T0MB 2P49B 5DJZB 1FBIL 2ZKHH 4RFNC 3VJ6A 5L88L 2H26A 1U8NB 5DJXA 5FGBA 3ZT7A 5KVEH 3FO9B 5TQ0L 5CCKL 3V4PH 4X80L 3OX8A 4HD9A 4K8RL 1KOAA 1YMMB 4FG6C 5K59F 3EYFB 3GSUB 1KJMB 2A0LC 5CJ8A 3AMLA 3T3ME 1XR8A 1U3YA 2IFFH 3GSWB 2JJWA 4MXWL 1CG9B 2VXSH 3MRLB 3HN3A 4I1NB 3BP7A 3ZO0A 3LKSA 5C07A 1F13A 3RPIA 3BJLA 3RVWC 5HYJD 3SE3C 3SO3C 1BBJB 2X1WL 5EZOL 2PR4H 3FT3A 5DK3A 1AJ7L 5K33A 5AYQA 5GGSA 3SDCA 4YHYC 5EU5A 2YA2A 1IRAY 3HNSH 3K4DA 4Y16A 5HYSG 1KPUA 4N1HB 1TVHB 4YHZH 1S8DA 3CFEB 4LIQL 3SQOH 5HVHB 3QEHB 3LS4H 2XA3A 4R4FL 1K3ZA 1DL7H 3GMOA 1I7UB 5FHAH 5MEND 1HEZB 3RAJL 3TN0C 3UYRH 1PY4A 2BRQA 4LDEB 2BSTA 3STLA 3TT1L 3F12A 1X4ZA 3RUGB 4HIJB 4MQXD 5D5MB 1AFVL 1OAZH 4V1DA 3HRZB 4HT1L 2HFGH 1KB5B 4L8BA 1UVQB 3BH8B 2IBBA 2F19H 2PTTA 2DQUH 1T0NB 1S5HB 1LNUA 4EBQL 1CL7H 3BKJH 3BP6B 2XTJD 1CZ8L 3T77A 1RFDH 3QCTL 4LDLB 4TNWK 4WO4A 2DQFB 4WI6A 5CSZA 2NX5B 2EDRA 4F2MA 5JPMB 5E1AA 4MQTB 3VXSE 1ACYH 4LQ1A 3EOBB 3MRIB 3B9EA 3A6CL 5HHOE 1EDQA 5I74C 4U31A 3GJEB 2D03L 1VEPA 1UH2A 1WTLA 3BXNA 4DTGL 3KPQA 1ZLSL 2APXA 5DQDL 4P5TA 4PUBH 3FZUD 4NKOA 4BK5A 2AP2A 1PG7L 4R0LA 3WS6A 1I1RA 4XP4H 4XP6H 3PGFH 3MX0A 5D1XC 1E28A 4KJYA 4RWYL 4YO0B 3GMNB 5IG7B 4OZIF 4W6XB 4CU7A 3C2AL 5J1AA 3INUH 3QDJD 4OLXH 5FK9B 4YXKL 4KPHH 3B9AA 5DJ2B 5CP3H 3DVIA 3GMQB 2BP3A 3RZCD 3VXPB 4JM4L 5CJQH 3QHFL 1AGBA 1M7XA 3MBEA 2C4XA 5LWYH 2Z93A 4MQSB 3WFCH 5F7WC 5F7EL 4FNLH 3WS3A 1XZ0A 4YPGA 4O2EA 1VGEH 5ACZB 1AIFA 5C6TL 2DM3A 1H3VA 4J12A 3S5LA 4XCCL 5FYKH 3VFOB 1HYSD 2VABB 2D2OA 3FO2A 4M62L 1HZHH 3CX5J 1FJ1A 3PV6B 4U05A 2CLRB 5DMKB 1VGKA 3AREC 4ZS6C 1KCUH 4A2LA 2R1XA 5HI3C 1FVEB 4KRPB 2CQVA 3QFJA 4RAUA 3CLEH 4OUUA 5FYJU 2GTWA 1RVFL 2CJUL 2K7QA 1HH9A 5GJSH 4KDVA 2P5WB 4CJ1A 5ALBL 3WO4C 2ZOLB 2AXGB 3RY4A 5IM7A 2DTMH 5IJKC 1CLZH 1A6AB 2HYMA 1DVFB 1SY6L 2EC9T 5B21A 2Z8RA 4Q2ZB 4HCRL 2YZ8A 3CVIL 2XN9D 3GIVB 3IDJB 5JMOC 4LFHD 1RZ8B 2XWTB 2FATL 3LDBB 5F6HI 2DLHA 3HI5L 2A74B 1HQ4B 5IR1A 5CIPB 5CJBA 5EOQH 3WKML 3TWCL 4XWGL 1CXKA 3WDJA 5E9DE 1I4FA 1T4KB 4FG6D 4PJ8B 4OZHB 3UROR 2QQLH 2A0LD 3CMGA 1Y6MR 2H9GA 3RWGA 3DGGB 2WQ8A 4HKXB 3G9AB 4U3XA 5J6HB 4Z8FL 4JFFB 2K9UA 4ZNEE 1UXWA 3GBMH 4P3WA 3RVWD 5JA8B 2P1YA 4MSWA 5EORL 1KLGA 3OKMA 3T0XA 4OTXL 1JHKL 2A1WL 3TCLB 1WZ1L 2WUCL 1EEUA 1NAKL 3IRPX 4RMQA 5MP6L 4NYLA 4G8GD 1RZGA 3H3PL 3HFML 5D1QB 5C08D 4BKLA 4Q6IB 1SM3H 3MV01 4N8VA 4KZDH 3D69B 3MLTA 1EMTL 2UV3A 3O2VH 3MLWH 3X13B 1ZTXH 4Y7MA 4OV6F 1BVZA 5J1SC 3BE1L 2VLJA 3EO1A 2ICWB 5MI0B 5HPOA 1MFAH 5I73B 3ARQA 2C26A 5TE6L 1XCTA 4P23A 2CR6A 4YC2C 1KIPA 5FV2A 5ETUA 3TN0D 5IFHL 3ARTA 5EZLB 1RJYA 4U6HB 3TA3C 5IMOA 4FXGA 1FN4B 4PBWD 4Y4HA 1G7QB 1UG9A 4MD5B 3LKNB 2UYLB 4EI6B 4X7FC 3THML 1C1EH 3T4YA 1D5ZB 3VH8G 1JMXA 3BZFB 3PJSA 1Y6KR 1MRFH 1B6DA 2F15A 2DM7A 4XMLL 4CMHB 2QQNH 4NBXB 5TPWL 3SJVA 3T2OA 4RBPK 3EBAA 5IQ9B 3MNWB 1DBAL 4N5EC 1SJHA 4YK4B 5GRJL 3FRUB 3NN8B 4QNPE 4LIQE 4OLYH 1G9NH 5HHQA 4NRXB 1NGZB 2AQ1A 2PYEA 4PJFE 2X4NA 4GUPA 3EJZC 2PW2B 4EJ1C 3EJJX 4KRMB 2BHUA 5BV7C 4WFEE 5JLZA 2B0SL 1F5WA 1FIEA 1W0WB 2HH0H 5HBBA 3LY6A 4RNRA 5LCVL 2VH5L 1HNGA 1NDGA 2SEBB 4OLWH 4Z7OE 4TOYH 4PJEB 3C09B 5TGBB 1NCUA 3NA4A 5BQ7B 2B7DT 5CJOH 3VCLB 5DA0B 1A47A 3LD8C 3H9HA 4OI8A 5D1XD 5KVGL 1SJVA 2DI8A 2D4DA 2YA1A 3MCLL 3VGHA 1T7XA 2KUTA 3H0TA 5L2KA 2Q8BL 2D7TH 2ED7A 4LSPL 2FGWL 4AYFA 3C6SA 1IBGL 4HPOH 4LARH 4ISVB 5AG9A 4G9FA 3V0WL 4MA1B 1XGQB 2R23B 2ZUWA 4G5ZL 4LSDA 4PJ5D 5CZXC 4HZLA 1UA6H 2RFXB 2XFXB 1IGYA 4HGWB 4ZFFB 5BOPA 4R97C 1MFCH 3MBXL 3MLRL 3JTSB 4NC1C 2BNUA 3K2MC 2BY1A 43C9A 1FVCB 4F7PA 1U8KA 1KIRA 1Q9OB 1JV5B 1KT2A 1JPFB 4UIKL 1U8OB 3ARED 2KKQA 4X5WB 4ZS6D 1ZLUK 3DYOA 4HKZB 5E2UL 1A6PA 5HI3D 1SVZA 2IPKB 2VDLH 3TO4B 2VDRH 5EWIH 4YHPA 5JQHC 3HCVA 3BD5A 3CUPB 1LP9E 4UT7L 1KENL 2FX9L 1QFWL 4P5TC 3TFKC 3JSSA 4EOWL 4XBEL 1KEGL 2OCFD 5HSFA 1VFMA 1YEIH 3FTGA 4MCZB 4JKKA 4RMUA 1YEDA 1QR1A 3UTTD 4JO3L 4ZDHA 4YFLI 5DJCA 4LSTL 2IH3B 2DL9A 2DDQL 3QDGE 5KS9B 4KDWA 1FL3A 4NM4H 4FQLL 3BHBB 1H0DA 1KV3A 1MCPH 5DT1L 4MWFA 3W5MA 1KCVL 3MRKB 1NLDH 3CFDA 3NCMA 1PSKH 1VKXA 1IGFL 4R26L 4P5MA 1MRDL 1FNSL 3NABL 4PJ9B 1JHLL 2X4RA 4JQXC 5CBAB 2EEAA 1V05A 4HH9A 1WBZA 2YD3A 4JGJA 3JZ7A 5D7SL 3QDMB 5DJ6A 2HFFB 3OJMB 2HFEB 2CRZA 3FL7A 4EUPB 1YEJL 1RK0A 2FLRT 3DMMB 4EZMA 1HHKA 5LAXB 3V4VL 1MLBA 4JHAH 1V7NL 2VXTH 3W11C 1AGDA 3OKEA 1G9MC 3S36L 4PJCB 1T03H 4MJIE 3GHBH 5C0FB 4OV5B 5D93B 1A0QL 3QCVH 1Z5LA 3QUKB 1H9VA 2AEWA 1F4WL 4W81A 3ULSA 5IKCB 4ZUVB 1DCLA 1JGEA 5DHYA 2F8XC 3LQAC 4XVUC 3L9RA 1QLRB 3TA3D 4WWID 2IBZY 2ADGB 2ENYA 5IT2L 3GSOB 4EDWH 4K9EC 3ME0A 5EA0L 2B20A 2IH1A 1U2HA 3PHSA 3TYFB 5DQ9B 1CFVL 5JW4R 5DI8B 1ERNA 4JPVH 4AT6A 3QO0A 1NFDE 3K8KA 4JFXB 1SJEA 3ES6B 2D4FA 3E6HA 1NSNH 3KXFE 4N0YH 2NY3C 4N5ED 5IV2A 4JFYB 1YDPA 4O51A 3Q0HA 3H6JA 2OTPA 4LMQE 3GBNL 4JPWL 1U8HB 3EJZD 3BZEA 1MCHA 2AGJL 4ZFGH 4AY0A 3DUSA 4D9QE 2P47B 4I3SL 1OGTB 5J0BA 4W4OA 4ODVH 4MDJA 4O5LH 4ZXBB 3FT2B 2QBWA 1QPXA 4JANA 1KUMA 2BX5A 3ZKMC 3I6KB 2AK4B 1XIWA 4XVTL 4RWHA 3VFMA 1FBIH 5BRZD 3V6FA 5L88H 1L7IL 5TQ0H 5CCKH 2H26B 4X80H 5D1ZC 4K8RH 5JA9A 3MRFA 2BRRL 5ERWB 5I76A 4AMKL 5BVJB 2GFBA 3OX8B 1IAMA 3AMKA 5I71B 3EJYC 5DVNA 2X42A 1ED3A 1GL4B 4MXWH 4Y4HC 3VXTA 3PWPB 4LBEA 4XX1E 4D9LL 2FR4A 5CS7A 2FECI 1MCWM 4WNQA 2HMIC 3HI6H 5I17A 3CZFA 2BC4A 3RPIB 2OXHA 1U8MA 1VERA 1Q72L 1Z6JT 1N2RA 1KPVA 3SGDH 1AJ7H 4MJ5B 2VUYA 5B4MC 2IMNA 4P49A 5CZXD 2V7NA 4LPTA 2Q86A 2GK2A 4GKZA 5F1OB 3SDCB 3UTPE 5ISZE 2FWOA 3I3EA 4Y16B 1MCLA 2BNRB 2XG5A 4XCNA 1U6AL 4LIQH 2PW1B 3WO3B 3VFSB 1S8DB 4UT9L 1V3JA 4R4FH 5JDJA 5IB5B 3C6LB 3D3VA 2CDFB 2DTSA 3RAJH 4NWUH 3QPXL 3MUGA 5BOZG 3O81A 3PWLB 4YBLC 4ZNEA 5IEHA 2FBOJ 4M6ML 4XCEB 1QLFB 1ZLVK 4MD4A 1OQOA 5I15L 4QHUA 4ZUTA 1SYVA 5T1LA 4U1NB 1J8HE 2DKUA 3RY6A 5F6IC 1AFVH 5IFAL 2YMXL 4P5TD 2P5ED 3VD7A 3TFKD 1OWRM 3MV7E 1OAXL 4V1DB 1EXUB 4HT1H 3VGGA 3OKKA 4PJIA 5E24E 2EXYC 2VISB 4MXVF 1M71A 3ZE2F 2ZSWB 4CN1A 5KVFH 3UEZA 3DI2B 1K2DB 4LLDA 4EBQH 4XBGA 2PTTB 5IW1B 5ITFA 1NGXB 1FFNA 1CLOL 1LNUB 1XGPA 2EDQA 1BP3B 5BZDB 3QCTH 2G60H 4MNQD 32C2A 5FKAA 5TDNA 3T0EE 3IDIA 5C0BA 4WO4B 1IVLA 5CSZB 1I3UA 3A6CH 4EQ2A 1KBGL 4BH8A 3WHXB 4QRTA 4HLJA 4DTGH 15C8H 1ZLSH 2P7TA 5D7LE 5DQDH 2ZG3A 3NIFF 4OCXH 4W6WB 1KCLA 4FFZL 1PG7H 4NKOB 3KS0J 3QIUC 3KPNA 3DHMA 3EIFA 1DQQB 1BX2B 1A02N 4NUJA 4MNHA 5EO1A 1V7ML 1E28B 3W11D 4Y2OA 1DLFL 1BF8A 4PJFA 5B39A 4TUKL 2Y23A 3C2AH 4H0IA 5EC2A 1BFOA 4YXKH 5J1AB 2VMFA 1ZT1B 1N5AB 3VGFA 5CEZL 4MD0A 4JM4H 3ILQC 3QIWC 3QHFH 3QXAA 4XVUD 5IB4B 1NUFA 2B1AL 4OZGF 5BCAA 5D96C 4OSUL 1AGBB 3MBEB 5F7EH 2Z93B 5C0CD 1AKJA 4KWUA 4DN3L 1VA9A 5C6TH 3TGXA 3WS3B 1JWUB 4YPGB 1AIFB 3GSRA 4I0PA 4XCCH 5SWZB 1J87A 1FCCA 4QHNA 1C5DB 5DRNA 4L3EE 3ZKXC 4DEPB 4KROB 4M62H 3UC0L 3FO2B 5J4MA 2DI7A 2Q1EA 5HDBE 5JOFB 2NY3D 4Q6YA 1UCBL 3G08B 4AM0A 1K4DA 3D25A 1H3PL 3P40A 1OB1A 3RIAK 1RVFH 2CJUH 3OR6A 1HXYB 2GTWB 4KK9C 1QNZL 2QL1A 4Z7QF 5L0QB 2ITDA 3Q5TA 5ALBH 4JCLA 1KCRL 3SKNB 5HHXL 2ZUTA 4WI3A 3RGVA 5HGHA 4X0KB 1SY6H 4HKBA 1GVIA 1S9KC 5IM7B 4HCRH 4C83A 3CVIH 3VD5A 3PP3K 3VU2A 5BMFL 5GXBB 2FATH 2MQ3A 3ZKMD 3DSFL 1J18A 2IPUK 3HI5H 3SDDC 4P2RB 4Y5XA 2VLJD 1DN0B 2FRGP 3SBWA 4NRYB 1I9RL 2YPLE 4RGNC 3WKMH 4PRAA 3KPSD 1TIUA 4XWGH 5IR1B 1P5UA 5D1ZD 4PRIB 4KUCF 3EJYD 3U7YL 2R0KH 2LV4A 1LP9A 2XRAH 4Y4HD 2O61A 4Z8FH 3DETC 4AH2B 2N7BA 3RL1A 2HMID 1NDMA 3KNBB 3QRFM 2VITA 4WTZG 5ANME 4OTXH 4X98A 1RUML 2A1WH 2C1OB 2WUCH 2NQCA 3OKMB 2D7NA 5MP6H 4V2BA 3F7VB 1NMAL 3H3PH 4JKPL 5B4MD 2PO6B 3QDGA 4NYLB 5HVWA 1QKZH 1EMTH 3IFOA 2VLRB 5AAMA 4BUGA 5C6PB 1AD0A 3BE1H 3IFPB 2E9WA 2W9DL 4JPKL 1I8KA 5FO7A 2RB8A 1F4YL 5EOCJ 1FZJB 3VD4A 1A4KA 2GAZB 3BWAA 1OWWA 1AQDB 9CGTA 5IFHH 2DQTL 3B9KB 4DVBB 5ETUB 4W4OC 3BP4A 4K3DH 5C9KA 3ARBA 3SN6N 3E1F1 4GRLB 4L8CB 2BY2A 1XIWC 3D18B 4QYOA 2DQHL 1SY6A 3UTOA 4HCRA 4APQB 2X4SB 2VZUA 4XMLH 4UDTA 4F9PC 2EXYD 5TPWH 3BPNB 5CGMA 2YA0A 3MROB 1JZ8A 5T3ZE 4MJIA 3SJVB 4G43A 1LEKA 1DBAH 3MCG1 3SKUD 1N59A 2ARJB 5DXWA 1KCSL 3HG1E 1R5IA 3IAQA 5GRJH 3U7WL 2VLLA 1SJHB 4ZUUB 3O4LB 3ESVF 4PJAF 1TNNA 2PYEB 1FLRL 2B0SH 2X4NB 5SX5K 4JO4L 3TIDA 1B0WA 1UENA 2BVYA 2XT1B 4MVBC 1S7UB 2AJYL 2NY7L 3I75A 5J7CC 2VH5H 3DRTA 4FRWA 4LF3A 5EBWA 3EOAA 3TH3T 1QG3A 1X9QA 4EQ3A 4I4WA 1NDGB 2VDKL 1NFDA 2BMKA 3ARDB 5TF1L 3QIUD 1HHGA 3KXFA 4FZ8L 3TZVA 4PLJC 1VACA 5KVGH 2R8SL 5EPMA 3H9HB 1DANT 2CUMA 3MCLH 4KUCD 4X8JA 4QEGA 3DV6B 2Q8BH 5DGQA 3L3HA 3HC0A 3T0BA 4LSPH 2FGWH 3RDTC 1IBGH 4M8QA 3NZ8A 2DQDH 5IVZA 1G7HA 4P2QB 3C6SB 3ILQD 3QIWD 2LE9A 2WZPD 3V0WH 3GB7A 3PL6A 4G5ZH 4G9FB 4M1GL 4PS4L 5C0DA 2MCG1 3UP1A 43CAA 1IM9A 1CT8B 2O5YL 3IS0X 1DDHA 3Q6FA 4TUJB 3MBXH 3MLRH 4NHCL 1HN1A 1A6VH 1UT9A 2J5LC 3BEVB 2KL6A 3VFGL 1I9IL 1RJLB 3GSQA 3KYKH 1NC4A 2J3SA 3QR2A 3WFHB 4G42B 1I1FA 3MRHB 1DLHB 4UIKH 4B5EA 3STZB 5E2UH 1W0YT 1ACZA 2Q8AL 2FIKB 2DD8L 3O8XA 4L1HA 4U2YA 3WNOA 1FG9C 3MA7B 3O2WL 1UACL 3N9GL 3EFDL 3HE6A 1ZWIA 3QUZC 3IXAA 2XWBA 5E00A 5CD3A 4YHPB 1Q38A 4ZFOL 4KK9D 4PG2C 2FX9H 1QFWH 1M7DB 3DBXA 2X7LB 4EOWH 3P77B 4XBEH 5F7DA 3GUTB 2KZWA 3BN9C 1KEGH 4PR5A 5IESL 4GKNA 1BMGA 4DKAA 5ISZA 5I1CL 1QR1B 1P4LA 1YEDB 1QSEE 4K55A 3QNZA 1JGDA 4LSTH 1D5MA 1MCRA 2DDQH 4ZDHB 1KIUA 3SDDD 3RBSA 4FQLH 5DT1H 4RGND 4TSCL 4U0QB 1H0DB 3LKQB 3DVNB 5A2IH 4NNXA 3HZMA 2F5BL 4FZEH 1IGFH 1MRDH 1FNSH 3NABH 4JFZL 1VKXB 1JHLH 1J8HA 3U0TA 5C86A 2Z8WC 2X4RB 4YHKH 5IOPA 5D7SH 1EEYA 4LKXB 3DETD 3MV7A 1F4AA 1RZ7L 4WUUD 4P59L 4W6YB 3P4MB 4I0PC 3QIBA 4PJIF 1XCQA 3A6OA 3VW3L 2RJMA 2AJ3A 3SDAB 2H8PB 1YEJH 3TBWA 4JDTL 1FZOB 1NCDL 1HI6B 3VWKB 3HPJB 4PRHD 3V4VH 4AQ1B 2BVTA 4D9RD 4U4BA 2APFA 4GAFB 1HHKB 1V7NH 1G1CA 4KJWC 4QTHB 1WBXA 1TMCB 1YPZA 4ODSL 5E8NB 3S36H 2R2EA 3T0EA 2R2CA 3C5SA 5SWSA 1A0QH 3ARXA 1GZPA 5IB1A 8FABA 3IU4L 3AC0A 2DS4A 3VXSB 3GSNH 3ARSA 2DF3A 5HHOB 1JGEB 5DHYB 1ZHBA 1ZGLP 3AROA 5D7LA 1QO3A 5IT2H 1IAII 1MHCA 3IGAA 1XIWD 3LEXA 3QJHA 4IIQA 2DMKA 3G6AA 4XMKL 4Y5XC 1BAFL 3UBXA 4S1SL 1CFVH 3U1SL 4RAHA 3ARFB 2Z31A 3N0PB 3W9DA 1IGMH 1FLTX 2ADJA 4PJFF 2R1YB 2GK0A 1T04A 2FHFA 4Y4FB 4LLUA 3HLAA 1QQDA 3EGSA 1KIQA 4ONFL 1UKSA 3ZDYE 5IV2B 2CXKA 4RAVA 3GBNH 3DX8A 4XMPL 5D9SB 1DVFC 4PTTA 4XI5C 3IF1B 4OFYA 4JN2B 3SGKA 1VFBA 3MLXL 5GRVL 3TBYA 1S7RA 1MJ7L 1KLUB 2R69H 3HE7A 2HFTA 4MVBD 5FAAA 4WFHD 4MDJB 1HXMA 2H3NB 3V5KB 4L3EA 4XVTH 4YGVB 4XHQA 3BGFB 4CJ0A 2X5PA 2JF1A 1L7IH 2I9TA 3V6FB 3KVQA 3MA9L 3PGDB 3D3VD 2BRRH 4HUMB 3W81A 2NY5H 5ADOL 5IROA 3S3PA 4PLJD 4NN6B 1HHIA 1KC5L 3V95A 5T1LD 2AV7A 4OQTL 4UAOB 4UU9A 4F33A 1M6OA 3OF6D 5GGRB 1L6XA 3RDTD 3WIFA 4HXBL 5I17B 2AJVL 1Q72H 3CZFB 2BC4B 1S9WA 3RIAF 1S7QA 2VE6B 1N2RB 2R29H 1KPVB 2YBRA 5CBEB 1DEEB 5T3ZH 4L3AA 2V7NB 2X9YA 3D87B 4HWZB 2LAGB 1NPUA 3VMOA 4UT6L 4XWOC 2FWOB 1MCCA 4HDIA 5E9DB 4FQIL 2GIYA 1P69B 4UT9H 3U2SA 4UDUA 3MRDA 4MB4A 1OLLA 4PGZA 4Z77B 3R0MA 3HZYB 5C0BD 5DWUL 3UDWC 1S7TA 4M6MH 5DURB 3L7EA 4ETYA 5I15H 3QUZD 1F11A 3BQUB 4QXTA 3RA7H 5DZNA 3WIIL 4QHUB 4QRPE 4ZUTB 2ZUVA 4Y4KB 5DMJB 5IFAH 2YMXH 4CMHC 3MLYL 4AG4H 1OAXH 3BN9D 3SKMB 4OFPA 4FQPA 5HYQA 3CFJA 3LZFL 3OKKB 3TZVC 2GSIA 1M71B 4YK4C 5ILTL 4ERSL 4U1SA 1U8IB 4EUPG 4ZS7H 4L9LB 2LAAA 1CFQB 3UBXG 4HAGA 4NO5B 4N9GB 2NX5D 4IRSB 1V8HA 3FB5A 1U93B 3K81A 4U1GB 1IEAB 5FKAB 4B41A 32C2B 1ORQB 2WM0A 3R4DA 1R3JB 4GW1A 2CK0L 3BW9A 3IDIB 4PRBB 1TJHL 3RU8L 4YHNA 3SY0A 4NQEE 5L8KB 3BESR 3MOQA 1KBGH 1CDBA 3IDMA 1XGTA 4BH8B 4OLZL 1P53A 2GYSA 4CNIB 4QRTB 1XGUB 4GAGH 4I0PD 5IB2A 3NIGF 3IDXL 5CJXC 1GRWA 1JF1A 2QHRL 5DD3H 3LHPL 4WW2A 4ZAKA 1A6TA 1FAIL 3QWOB 2J8UA 2R2HB 4CVUA 4KJWD 1QEWA 4UTAL 1V7MH 4LHJB 2ADIA 1DLFH 3O8XC 4QHMB 4NUJB 2NLJB 2XQYK 4TUKH 5I1GL 3K4AA 3ESUF 3F7YB 1RIHL 2QKIA 5F93C 1HOCB 4HWUA 5GZOC 3P9WB 2ICEA 3L5JA 5JXAL 5CEZH 5DD5H 4LL9A 4ELME 3SPVB 1YEHL 2B1AH 5B8CA 4YIQB 2IGFH 3QXAB 1CR9L 4NPYB 4D0DB 4OSUH 3P3YA 3QNYA 5DF0A 2WBWB 3JV4B 3UTZB 1AKJB 3T4AA 4HUXA 1IMHC 1T7VA 5FO9A 5CGYC 2VWEC 3FQRA 1PLGL 3TNNB 5E2JA 2VXVL 1UCBH 1FFPB 3LQZA 4GW4A 2CKBL 1H3PH 3MJ9L 4ACPA 3QYCA 3D25B 3VXME 1QNZH 1SQ2N 1DVFD 3NFNA 4XI5D 4TVSa 1Z2KA 4X8XA 5HHXH 1FORL 3L3OA 5T3XE 1DQDL 4G8EA 5LGHL 3VXRA 4OF0A 1CDYA 4U33A 1EHLL 1XR9A 4LVEA 4QRUA 4J4PA 5BMFH 1P1ZB 3F5WA 4HWEL 4WHYH 1DUYA 3DSFH 2ZUXA 1KXTB 5LJYH 4LLVA 5GSVB 1WZMA 5D6CB 3BMWA 1F00I 5BXFB 4PJ9C 3ZZ1A 3DOSA 2VOTA 3U7YH 4A6YL 4JFFD 3VGDA 2VQTA 1MIML 3QZWB 2LVCA 1T7WA 1LP9B 3QNXA 3RHWK 3ZSTA 5I66B 1MLCA 1MY7A 1BLNB 1KN2H 1CGTA 2J7LA 1HHHB 1I9EA 4IIQC 4E5XA 3V52L 4ODUA 5I0ZA 1RUMH 1B4JL 2GT9B 3ZE1E 4X98B 1QSEA 4B53A 1NMAH 4YUEH 3WFBL 3VGAC 4JKPH 3U46A 3AS3A 3H9SE 4HH8A 3KPPB 5D93C 1G0XA 3O0RL 1R0AL 4JM2A 1U8QA 2B5IC 4XWOD 1JNLH 2W9DH 4JPKH 5EZJA 2XZZA 1I1CA 3W39A 4OIAA 1F4YH 5EULV 3REVA 1FYTB 1BIHA 2Y9RT 3SGKC 4AENA 5BS0A 1WITA 4D0BA 4WFGD 3PWUB 1A4KB 3BWAB 3RNKA 2HRLA 2GQHA 3HE7C 5E8OA 3BP4B 4P9HL 1ZHNB 5J8OA 4JO1L 3HAEA 3OKDA 2Y5EA 2NY2C 3BYTA 4H5SA 2IALB 5C0EA 3I85A 2P46B 1CDGA 3NMEA 4H8WL 4QYOB 3T1FA 4HS8L 4LVNC 2OQJA 3ZMRA 2XQYG 4OCYL 3UTSE 5IBUB 1YPZF 5IROC 3GMLA 3TZVD 2NZIA 3M17B 1T7YA 4MJIB 1MJJA 4GT7A 1CVSC 1KCSH 2A6DB 3M1BA 2Z92A 1N59B 3U7WH 2OMBA 2X2YA 5F7FA 3PWNA 5J13C 2O93L 5ECJE 4NC0B 3FMGL 5ICYB 1FLRH 1A7QL 4U49A 4M4RA 2Z9TA 4JO4H 3TBSA 4ZXBC 3NIDF 3QEGL 3MODL 4G6JL 5D7IF 4XPHH 2NY7H 1T21A 3I75B 3JV0A 1GC1C 4RGOH 1MUJB 3LRGA 3DRTB 4OCWL 1N6QL 3BP5A 2VDKH 4GRWH 4RSVA 1P6AB 2L7UA 3VXUB 5HPMA 1NFDB 3VFPA 3ZKSD 4FTVB 5TF1H 3OKOB 3PQYE 3FAXA 2O5XL 2R8SH 1T1WA 1FQ9C 5EPMB 4PJXE 3O8XD 4JQVC 3TJHC 1T3FB 2VO5A 4X8JB 1YMHA 4NN7B 4HIXH 5GZOD 3HC0B 3G04A 3JWOC 4P46A 2H1PL 1OSZB 4NUGL 3NZ8B 5MEPB 2ID5A 2VL5A 1G7HB 5IVZB 2EDBA 3I6GA 4M1GH 3MJ7A 2F74B 3GB7B 3PL6B 2RBLA 4KKCC 3PWJA 4RA3A 5FYLE 3FCTB 2CRYA 3Q6FB 4NHCH 3EYOA 3VWJA 3WDIA 4RMVA 1I9IH 4Z6AT 5HDBF 1CIDA 5CWSA 1NC4B 1Q9WA 2R0WL 3TNMB 5CGYD 4MHHI 1NGYB 2Q8AH 3MGOB 1U95A 5EIQA 4ZO9A 1XF5B 3TO2B 2BSED 3O2WH 3EFDH 3N9GH 1Y18A 2WIIA 2VDQL 4FQCH 2O5ZL 3HE6B 2VNCA 1IAKA 1ZWIB 3IXAB 1NC2B 1ZVHA 2EC9U 1RMFH 1ZGLM 5GS0H 3EYVA 2D7OA 5LBSH 4WW2C 2OJZH 5IESH 3KPMA 5INCB 2FJHA 1KJ3L 5I1CH 2CK2A 5ISZB 4PY7B 4WW1A 3HAEG 2HKFL 3ARGB 2NY4B 1E4WL 1JGDB 3UMTA 1D5MB 5SWSD 4ORGA 3BUYA 2EDHA 4K07A 4PGEA 2VXUH 4XPTL 4RFEB 1EZVX 1YA5A 4PJ9D 3CX2A 1PG7X 2FBJL 5TE7L 2F5BH 2BCKA 3HZMB 4NOBA 5A2JH 5J9PB 4GG6E 2VZ3A 4RIRB 1INEH 2PTUA 2EH8L 1J8HB 2WIMA 3DX9B 4XPAL 4JZOA 4S0SD 3OPZL 3PDOB 2PXYA 4JDZA 7FABH 2NXZB 1KNOB 4I48B 3HI1B 3MV7B 4OKVA 4P59H 4U1KA 5IQ7L 3WFEL 3VW3H 1TFHA 1XCQB 3TPUB 4JDTH 1NCDH 4M1CC 2BOBB 2AQ2A 2EDOA 4F80A 1QSFB 1UZ8B 1U8LA 2YPVH 2A6KA 1WBXB 2FSEA 2W59A 3GM8A 4X7DC 2V2XA 3VDCA 2WP3O 2R2EB 3T0EB 4DUVA 1GZPB 1NL0L 4NQEA 1DE4B 4NO3A 1HCVA 4OFYD 2X44D 1I1YB 3CC5A 4KTDL 5T3XH 3DGCR 4HK3N 2FB4L 3HE7D 2A6IA 4ZFOA 1ZHBB 1JHTA 1U91A 4ODWA 5HI4C 1RUQL 5D7LB 4JFEA 1TPXB 2NY2D 1MHCB 5MHSE 4XMKH 3NCYS 3HNVL 3OAUL 4PJHE 4WW2F 4S1SH 1F3DH 2J8UF 3G6AB 4R9HA 3U1SH 4GW5B 3GMPA 4OD2A 3G6JE 4R90H 3UPRA 5FUZL 1I75A 1E27A 4F9LA 5C7XH 2EDTA 1UH4A 1KULA 2GK0B 3DI3B 4NKDA 4Y19B 5HGAB 3X14B 1PFCA 4LLUB 3HLAB 4ONFH 3MJ6A 4NQDE 4CBPA 4ELMA 2YHGA 3IAPA 5IHZA 2G5BB 4WV1A 4O2CA 4XMPH 3GDBA 1ORSB 1N3NB 3MLXH 3IVKA 3R0NA 4ZXBD 5CAYB 1NCTA 5SX4I 4JG0H 1QD0A 5L6YL 4GS7B 3HUJE 1FZMB 1NMBL 3V6ZA 1OP5K 2XKSA 3DVFA 5C09E 4L3EB 3WUWA 4FQXA 3ULVE 4P5KA 4OCSL 3MA9H 2I9TB 4GQPH 1A4JA 2OTWB 5ADOH 1B0RA 4U6VL 4GMSL 4WVRA 5EC1B 2BXYA 1I1AB 1EUTA 3VXMA 1KC5H 5CINL 3TJHD 5I18L 5E2VH 2XWJA 4OKDA 1FNLA 1H3WM 3DLQR 3O2DL 4OAWB 3GSNB 4HXBH 2AJVH 5ESAA 2E7LA 2PO6C 3MGTB 5E4EC 4OI9A 3HC3L 3TESA 1S9WB 3R8QA 1ZT7A 1UM6L 5DEFA 1H15A 3RGHA 4KKCD 3GGWB 2BNRD 2NPLX 1OAKL 4JHWH 2ATKA 2HN7A 1A7OL 4X99A 3WN5B 5EIIA 3CIQA 2YPLB 5K9QI 4O2FA 2DM4A 2CDEA 1FFQA 3F58L 4FQIH 4HDIB 4ONHA 3B83A 5T5FL 3FOMA 1C08A 3B9KC 4OGAC 2C1PA 4UDUB 3DX6B 2JJVA 4WI2A 5DWUH 3H8NA 3S96A 4Y2DC 4JPIA 4JKMA 4GRLC 1D5XA 1TXKA 3D1MC 4Q58C 3QEQD 4LCCB 1G6VK 3KYOB 1FSKC 4APQC 3WIIH 4CVZA 1K4CA 5ANMB 3U0WL 1HSAB 3RHWF 2BVUA 1T2QL 2C3VB 3L7FA 2DJSA 4X4XA 4BFIA 4DW2L 3V79C 3BPNC 4R6UA 2CH8A 5E6IA 4Z5RA 3LZFH 1MI5A 4JM2F 5ILTH 2NTFB 3EDFA 4ERSH 3TIEB 4OFKA 4L5FL 4HX1B 5FYJD 2KH2B 4MAYA 4NHUB 1IQWH 3ALXA 4TSAL 1T66C 4WY7L 1A21A 5KSAB 3L3IA 1LD9A 3EZJB 3FB5B 1FGVL 1DP0A 1TVBB 1EAPA 3DO7B 1K85A 1PQZB 1YN7A 4FP8L 5IVXE 2CK0H 3C2SA 4OQTA 3QQ3B 3RU8H 3TEUA 1GCFA 3ZKQD 1BZQK 4IMLB 4X9GA 3VFTA 5ICXB 4YHNB 3AB0B 4N90D 3DVGA 3MOAL 4JRXE 4PJBA 5GHWL 3RWHA 4OLZH 1CFNB 1JZ6A 1JZ5A 3SDXB 5IIEB 1XGTB 5JQ6L 3ARDC 3UTSA 1AE6H 1JZ4A 1AHWA 3IDXH 3LHPH 4K7FA 5IB2B 1U0QA 4R4BB 3QUYC 2V2TB 1DSFL 2YD5A 1Q9LA 5MEOB 4ZAKB 4M1CD 1CLCA 5HHNB 3L5IA 3HG1B 5BZWB 4H20L 1A7RL 2BOCA 2HVJB 5I1GH 1WCBA 1RIHH 3VGEA 1BQLL 2NZ9C 1YJDL 5B3JE 1FDLH 2QKIB 1RD6A 3KDMA 5IEKA 4POZC 3ZLQC 1YEHH 2EICA 3QRGH 4OIIH 1FNAA 1CR9H 1X7QA 2J4WL 3VXRD 5B8CB 4F58L 1TLKA 1IQDA 5HI4D 3K7UA 1LEGB 1NGPH 3A0OA 4AEFA 4BSWA 1IKNA 3I3DA 4YEFA 1NANI 4K7PH 4HUXB 5HVFB 3PQYA 2IMMA 1RUPL 3EYSL 1FC2D 3LS5H 4EI5B 3QJFB 4IS6A 3SCMB 1NMCC 4W68A 1TCRB 1PLGH 4C56A 1YNKH 4RCAA 2VXVH 4BM7A 1ZA6A 4KY1L 3AM8A 4ZUWB 4G6KL 3L5WA 2CKBH 2GJZA 5CEZD 2ITCA 3MJ9H 2XZQH 1N64L 3QCUL 1S7WB 1HDMA 1FORH 3NFNB 5ID0A 1DQDH 3T0WA 1UB6A 1DQML 5GIRB 3NPZB 1ZEAL 5LGHH 4HLZG 5T1DL 3EDJA 1EHLH 1N4XL 4P2RD 4X9HA 5IJVA 2GCYB 3AFLA 1YN6B 4HWEH 4QRUB 4QOKE 2Y7QA 4ZUSA 3F5WB 4XXDA 4LHUB 5J12B 1YEKL 2BERA 2CRIA 4U6XA 2A9ML 1T5WB 3SE9L 1LO0L 2D0GA 1BVKB 4X7EC 1A1MB 3KYMB 1DZBA 3DXAA 3RVUC 4L4VA 4PRDB 4LCYB 5BS0D 3QQ4B 5AUMA 1EVTC 2YXMA 4A6YH 1MWAL 1KCKA 1MIMH 1F3RB 2ESVE 3IU3A 2EZ0C 4QRRA 3SKOA 3S36X 3QHZH 3SDAC 1CXIA 4U2ZA 4Y5VA 1B4JH 4ZPVA 5DUPH 4F37F 1VPOL 2PO6D 3KPRE 4KKNA 1BWWA 4GRWF 1PZUB 3WFBH 4LCIL 4P9ML 1QSEB 1K6QL 2YUVA 4I2XE 3PHQA 3PIQA 2MFNA 5B38A 3O0RH 1OD9A 5DVOA 2DWDB 1R0AH 2Q20A 5DJAA 4L4TE 1U8QB 2BXZA 5F88A 1A1OA 5GS1B 4WV1C 1WIPA 1S9XB 3W39B 3B9KD 4OGAD 4YAQB 1NFIB 4RDQF 5LXGL 2CKBA 3REVB 4Y2DD 3MJ9A 4GRLD 5EDXA 4LGPB 5FV1L 3TP4A 5GRYA 4P9HH 3HZKB 4D0CA 3WJJA 4APQD 3GHEL 2HLFC 4X9BA 3OKDB 2Q6WB 3ARFC 3OHXA 4H8WH 4YHIA 1UXSB 4HS8H 1I3GH 3GI9H 4E41B 3E8UL 4OCYH 1WFNA 1IEBA 1AC6A 5FOJA 1JZ2A 4P3DB 4HIEB 1RUKL 4XC1L 3GMLB 5IB3A 3RX7A 5MERA 2EDLA 4L29B 1GHFL 1Y0LA 3OL2A 3M1BB 3P9LB 5JDSA 4EN3A 1G9EA 5FCUL 1T66D 4A6YA 3FMGH 4H0GA 3SEPA 1A7QH 3NAAL 3NZHL 3FRPG 3QEGH 1FYHB 3MODH 4G6JH 4PRNB 4M1DL 3LKRA 1Q0YL 1JJUA 1BIIA 4LSRL 3TT3L 4PJHA 4LCWD 4WWKB 1DQLL 2VC2L 1T21B 1WTGT 4KJQC 4OCWH 3G6JA 1N6QH 5IK3B 5KG9A 5ESQA 3ARDD 5I1AB 2ICWI 4LEXL 3LKPB 4DJMA 4N0FB 2YXFA 5HPMB 4I0CC 2BHYA 1ZVSA 1IM3A 3QUYD 4LP5A 3VFVB 4H88L 5GGQL 1UJ3B 4S1QL 2O5XH 4NQDA 4XPBH 4HWNA 2F58L 3MRQA 5EUKB 2X09A 2D7QA 1DQJA 4QXGL 3WEXB 5FUOH 5DYOB 2NZ9D 3M07A 4P2QD 2J8HA 1KACB 1XH3B 2HA1A 3LRSA 2H1PH 4POZD 4NQUA 3P4NB 4PRPA 4NUGH 4P46B 5IVNA 4Y1AB 3HUJA 3BGMB 3OQ3B 4U7KA 5HGDA 1EERB 3DTXB 3IJSB 3MJ7B 3N1QC 4HF5L 1VADA 2CO6B 3V5HA 2CDGB 1CXHA 1CICB 4MAYC 3VWJB 1LWRA 3QI9C 5HHVL 5CWSB 5EU6A 2PNDA 3U6RA 2UUDK 3MRGA 3LKOA 4OGXL 4ZD3L 1ZMYA 3UJIL 3UPAA 3BQUC 3W0WA 5GRUL 4AL8L 2EDFA 4AIZA 2DWEA 5HYJE 2O5ZH 1P84K 3Q3GA 3QZWG 4MZ2A 5F3BB 3B4NA 3F62A 4RRPG 1KJ3H 4WIQA 2P8MB 1FRGL 4L9LC 4P4KA 2HKFH 3T09A 5F9JA 4IRSC 1E4WH 5HXMA 1MY5A 4U1GC 2GUOA 4X6DF 5F9DC 5A16B 5GRWA 5MENE 3MCKB 4ORGB 1I8LA 4U6TA 4XPTH 3BUYB 2FBJH 3RVUD 3CSPA 3L3JB 2I9LA 4JFHD 2BCKB 2EH8H 2DBJA 2EE9A 2EZ0D 4QRPB 4S2SA 4XPAH 3OPZH 4JFED 5FECB 5IQ7H 3B2VL 4JZOB 3SDAD 3L6FB 2PXYB 3OJ2C 4X6CA 1L6ZA 1EUUA 3MRPA 4IRJA 5I8EB 5IVOA 2DJUA 4F3FA 4OJFH 2J12B 4NGHL 1B3JA 1EEZA 1UWGL 3B9DA 4P2CG 2Y6SC 3H7BA 1U8LB 3S6CA 5FUCC 3W9EA 2A6KB 4NRZB 2XTJE 3FT4A 1MH5B 5KTEL 2H45A 2FSEB 4GRMB 1G1YA 5IBUG 1AR2A 3VXSD 3B3IB 4WU5B 2MQ0A 4KTDH 1LE5B 5EO0A 1J0IA 4UUJB 2FB4H 4PJBF 2Z35A 3V7MA 3JV6B 1ZAGA 2A6IB 2QV2A 5I8CA 1U91B 1WISA 2HLFD 3HNVH 4WCYL 3ARFD 5C71A 1ITCA 4TQEH 4MB3A 5FUZH 2QTEA 3HB3C 4ZNCD 3C60B 5CD5C 3G5YA 1AXTL 3UPRB 5K59E 3FOLA 2K1MA 2O26U 2VDPL 3V0VA 3QDJE 2XKNB 4RFOH 3LN4B 2E5EA 4G8FB 1URLA 4HSQA 5IHZB 4Y5VC 1F6FB 4JY4A 3PG2A 2WP3T 2G75A 5M95B 5JW4N 3IVKB 1RK1B 5FA4A 4LVOB 5L6YH 5C2BL 5I1LB 4KJQD 1MCJA 3V6ZB 4QRQA 4HUNB 1J05B 2NNAA 5I8KL 3FO0L 4OCSH 3WUWB 2A77L 3MSPA 2EXWC 3CFBB 5EFIA 5EU3B 1NCCH 4Q0XL 1ZHKB 4X5XA 4XRCA 1I3RA 4U6VH 3VRIA 1A4JB 4GMSH 4LLYB 5JHLL 1B0RB 3S4SB 5CINH 4KQ4L 1UB5A 3VXMB 5EOCL 2MCPL 3T08A 3MV9B 2XQBL 5DO2C 3O2DH 4Z7UF 4QRSA 1PZ5B 3TJEH 4XX1G 5F3HA 2BVPA 5D7JB 2XN9E 4KVNL 5DVKA 5ESAB 4QOKA 3X12A 4MJ4A 1UM6H 2J6EL 1MVUA 1MI5D 2CXGA 2W1NA 1A7NH 2F9BT 3DV4A 5DEFB 3QXDB 1DTUA 5L2JA 1A7OH 5MEQA 2CD0A 5EU4B 1ONQA 5F1NA 1FVDA 5LKNA 4X99B 2ATKB 2ERJB 4JLRB 3F58H 4MAYD 4EDXA 2WWKO 4DOHB 5D6DA 4O2FB 5A3IC 1U8JB 5T5FH 1YECL 3FHQA 3QI9D 3BX7C 5DUBB 5E2TH 2ESVA 3O3AA 1AXSA 3NCCB 3QG7H 3BQUD 3QUXA 2D31B 4TPRH 3BPOC 5DD1H 4LSSL 3BD4A 1C7SA 4KHXL 2AV1A 3KPRA 4WDIB 2Z4QA 3ZDXF 5JPNA 1T2QH 4DW2H 2YK1L 4G8GE 3MRNA 4I2XA 3BKCL 5C08E 3H9SB 1BF2A 4GLRI 3MUZ1 5LGJA 4UIMA 2H2PC 1RAMA 1HWGB 5E6IB 1ETZB 2ORBL 4L4TA 1RHHA 1ZK9A 2X6MA 4NKMA 5FO8A 4CDGC 3X11A 4L5FH 5KBNC 1FZKB 3W5NA 4IRSD 3FO1A 2EE6A 3MV8A 3JWDC 4ESKA 4OT1L 1CYGA 2FJFB 3OGCB 1EEQA 4GFTB 5BV7L 4WY7H 1OAYH 3G6DL 5E94A 3L3IB 1EJOH 4R2GC 4FP8H 3JTTB 1C16B 3O3EB 2HTLC 3CXHK 3O2DA 5E99L 4NQCE 3N85L 3CSBA 3MOAH 3S9DB 5GHWH 3AS2A 3MRCB 1CWVA 3DVGB 1JPSL 5KSVA 5JQ6H 2WAHA 5FXCH 3RWHB 3L1OL 1TTFA 5JZ7C 5D2NA 2W65B 3B2UC 1MCIA 4K7FB 3FQXA 4N8CH 2EEDA 2IADB 4PJGB 1QFHA 2FEEI 1KJ2L 4LVHB 4LSVH 4KRLB 4C56D 4OLUL 1A7RH 2PYFB 5H35A 1D6VL 2Y6SD 1PX3A 3CDGA 1EHAA 3C8KB 3QISA 2BOCB 2YPKA 5HGGS 1BQLH 5EN2A 1YJDH 1DR9A 2QQKH 1JK8A 4Y5YC 2DQEL 4W4NA 4QWWC 5EZIL 4X7SL 4FHBD 4HEPG 5JHDD 1WWAX 3P0YL 3G5VA 4DQOL 2J4WH 3MV11 4F58H 1X7QB 2XXCB 4Y8AA 1J5OL 3EOYG 2OP4L 4UINL 1JZ7A 3EYSH 5ACMA 3ZTJH 2MJWA 3PQYB 4XP5L 3HB3D 3V5DA 3WJLC 4F8QA 3DXAD 5CD5D 1EZVY 4L4VD 5F9WB 3WNPA 4WI8A 3K4ZA 4IS6B 4PJXB 3X17A 4KY1H 1GOHA 1YQVL 4F15B 4MJ2A 1ZA6B 3MRRA 4QRRD 3C5JA 1QBBA 2E7MA 3UZEA 4KV5F 1EFXB 5KOVC 2JK5B 1N64H 3MLZL 5F7KC 1PBYA 1R3IL 3O6FA 1DJSA 2K3TA 3QCUH 4GMTH 1Y6NR 3TCXA 4Z7WF 5I2IB 3PV7A 4OLVH 4PJ5E 4LLQA 2NY6B 4NP4L 1DQMH 1HDMB 2Z8VC 2EYSA 5T1DH 5ID0B 1N4XH 3PGCB 3ARGC 4LCUB 2WMPA 1X4YA 1MHEA 3BOVA 1WZLA 4JFOA 4P2YA 3LRHA 1YEKH 2PUQT 1F6LL 4YDKL 2A9MH 4PV8A 3SE9H 1LK3L 1X44A 2EXWD 5JO5A 2ED9A 6CGTA 1J1XH 4U7SA 2ZJSL 5HYJA 1WCQA 4CMMB 1AXIB 5AUMB 5L9DL 1HQRB 2NXZC 1V5JA 3HZVA 4C59B 2EYTA 5DO2D 1T1YA 4M61A 3SKOB 1R3KA 2YD8A 1GGCH 1VPOH 1F02I 2FD6L 3VFWB 1YC8A 3UTTE 2ATPA 2F54A 1TQBB 4P9MH 1EO8H 2HT4C 4FQ1L 5KJRL 2RGSA 3KG5A 2DLIA 3LSOB 5DRXA 5DD0L 5MENA 2VERN 4O58L 3S3JA 4DVRL 2P8LB 5B38B 3QXUA 4KKAC 5DJAB 1UWXH 1FYTD 5A3ID 1K8DA 1D5IL 4HHAA 4UNUA 5TFSL 2HJKB 5LXGH 4GG6B 2AJXL 3LEVL 1W72L 5FGCE 1HIML 1NCWL 3WLWC 2CKBB 1KPRA 1B6UA 3QEUB 1TPXC 4K9EL 5A2FA 4X6CF 3GHEH 3H42L 1R5WA 4D0CB 2X89A 4M5ZL 3OHXB 4MZ3A 1IC5L 3E8UH 5ID1B 4EKXA 3Q2CA 2W0FB 2M2DA 2H2PD 2IJ0C 1RJZB 4Q9QL 1TZGL 3OAYH 1KTLA 4XC1H 4CVXA 2E8ZA 3IJHB 2D0HA 3ROLA 5IB3B 2MNUA 1GHFH 2APTA 1JGUL 3ALWA 2X40A 3QG6A 5FCUH 2RCSL 4EN3B 1MWAA 2IEPA 2EYRA 1OTSC 2R9HC 2WNGA 4PRPD 4R2GD 1JRHI 3GMRA 3NAAH 1F58L 2HTLD 3PHOA 3OKYA 1Q0YH 4M1DH 5I6XB 1NLBH 4LSRH 3TT3H 4ZTOL 3EKCA 1DQLH 1BIIB 1MCWW 2VC2H 3OAZK 1A7BA 4LLWA 3VXUD 2JB6B 5H94A 4NQVA 4LEXH 3SDYL 4FTVD 1FO0L 5E8EA 5JZ7D 3LMJL 3B2UD 1ZVSB 3GKZA 5I75B 3QDJA 5D7KD 5GGQH 5EU6D 3D39B 5F1KC 3VFNB 2HJFB 2F58H 3W0WD 4NQDB 5ENWA 1ND0A 1DQJB 2EH7H 1PEWA 4GOSA 3BPCA 4MJ6A 4OQ1A 3ECBA 4QWWD 5E8DL 3VRJB 1PJ9A 1F8TL 1KTDA 1BQHG 3FFCB 3GSXA 3HUJB 4OZFG 5EU7C 4PP2A 1G7IB 3QWRD 4F7CB 4WHCA 5BRZE 5C09B 1CXEA 4DFHA 4PLKC 3BIKA 5F7NC 1VADB 4PGCB 3V5HB 1IL1B 5E0QA 4KMTL 5HHVH 3P0VL 4BZ2L 5IMMA 3CFCH 3DUUB 3L3KB 4LCCC 4ZD3H 4LHUG 2C4FT 3UJIH 3MRGB 4LK4A 5GRUH 1NJ9A 4AL8H 5SV3A 1NC2D 3MJGX 4H1LB 5C0JA 4UBDC 1H5BB 2XN9A 5BVPH 4TUOB 5D2NC 3VXOA 5IGXL 3TBTA 3WL9B 2Y1VA 4R7DA 3B8YA 3FB6A 3WCYA 1FRGH 3ARGD 4NC1E 1OT2A 4NZUH 1JNNL 3OXRA 3KJ6L 2B39A 3KS0H 4M7LL 3M8OL 4E9LA 5CFHA 3D2UB 3C87A 3C8DA 3MRBB 3O45B 3Q6GL 2F53A 1PG7W 5TE4L 1G7MA 3O3DA 5DDHB 3ZE0F 5L7XL 1CF8L 4ZOEA 2PF6A 4NNPL 3SE3A 1F3JA 3MUJA 1EIBA 3RWCB 4E42A 2NXZD 5DRWB 1WT5A 4I9WD 2BK8A 4J2XA 4S2SB 2P5EE 3Q48A 2YKLL 3TBVA 3B2VH 1CVRA 4XGZB 5IHBA 3CPLB 2JB5H 4JRYB 1FL5B 1QSFD 4PJ7F 2Q76A 4NGHH 2HT4D 1X3DA 1UKTA 1W2KT 2JJSA 3KHOA 5H37G 3V6OA 2XICA 1FV1A 1NUNB 1EEZB 3TN0A 5KTEH 1ZOXA 1KTRL 4MNQE 4TSBL 4KKAD 1DUZA 4PGJA 4V2CB 1OGAA 4XNQB 5IVXB 1B0GA 3PF2A 5DJ0A 2H32B 4K71B 4HPYH 5JW4M 3GIZH 1A3RL 2Q3ZA 3WLWD 2FYYA 3FAWA 4JRXB 4GXVH 3WE6A 1U58A 4NZJA 4EI5C 2FJGA 1QA9A 1NBZA 3GSVA 5TDOA 5CHNB 3SCMC 1XF2B 4KK8C 5K9OA 3RVXC 2W60B 1MJ8L 2EDWA 3ET9F 4ONGL 4Y19D 1NEZB 3G5YB 2PETA 3QFDB 1OM3L 2JCCA 2VDPH 3FOLB 1YNLL 1KXQE 5FF6A 4HUUA 2LABA 4YDIL 5F96L 5FM5M 3ARRA 1OTSD 2R9HD 1IAIM 4PBXA 3SDXF 2LU7A 4HKJA 4Z76B 2G75B 5C0CE 3RKPA 4ETQA 1C5CL 1KB9K 4GBXB 1CFBA 5FA4B 1S9VB 4P2OC 2PCPB 1JTPA 4U6YA 2OI9B 2V6HA 5D1XA 5DVMA 5DZOA 3MLSL 4GKSA 2A77H 4PB9L 5CSGA 1K8IA 4DCQA 4J1UA 4Q0XH 2N4IA 1A2YA 4MX7A 3VXNB 2X4TA 3C5ZB 4M6NL 4XRCB 2F8VA 5JHLH 1M7IA 4MA3A 3VRIB 2WBJC 4F57L 4KQ4H 4I77L 5EOCH 2MCPH 3GJFH 5DK0A 2XQBH 1UB5B 4NBZB 5T1MA 4PJ5A 4P0DA 2ZUUA 5AEAA 3GO1L 3RRQA 4B0MM 2R39A 3EFFB 3FQWA 4KVNH 2BVPB 4F7MA 1JNHB 1WC7A 4LPXA 1MREL 2DLFH 4QO1A 2A6JA 4WHTB 2J6EH 3MNZB 3UZVB 2VLJE 4FS0A 4G6FD 4PLKD 1RZFL 3AREA 4OM1H 5JUEL 2EDNA 3MV8D 3KPSE 4JB9L 5HHPA 5F1NB 5I16A 1A6ZB 1FVDB 3CLFL 1MAJA 4I18B 3ZYIA 2UVEA 1YECH 2NW3A 3DIFB 4U1MA 1EHXA 3STBA 4OIBA 1II4E 2R1WA 5HYSA 1XGYH 1L0QA 4YNYB 3O3AB 3WLBB 2BVOA 2Q3AA 2I60H 2XTLA 5IJKA 2YWZA 4LSSH 4KHXH 3LEYL 3LVEA 35C8L 3NACL 3RWFB 4UBDD 4PGBA 2W9LA 2X1QA 2YK1H 3I6LD 4GLRH 4LLMA 3NIFE 3BKCH 1FG2A 4FN0A 2X05A 5T5NG 1AGEA 1HKLL 4DGIL 3QH3A 3U30B 5B3NA 3LPGA 2ORBH 5IBTL 2IANB 4NZDA 4MCYA 1D3CA 2CGRL 4JE4B 4NKMB 2JELH 2GJ6D 1QYGH 4OT1H 3V7AE 3FO1B 2R2BA 1CFSB 1QZ1A 4KUZL 5JW5A 5BV7H 4MMZC 4Q7DA 2NCMA 1FNEA 1KG0B 3G6DH 2WWKT 1D9KB 1WFTA 3E2HB 2FX8L 3O3BB 4OZGE 1MFDL 5FA3A 3N85H 1LMKA 5JORA 3HPLA 2X4QB 1H3UA 1S9YB 3K2UL 3MO1B 2OMNA 4S11A 3L1OH 3UAJC 5DR5H 4JFQB 2J6EA 1G7LB 4TRPH 5FM4A 1UJ3C 1XAUA 4NDMB 4P57B 3FQXB 3U4BL 4PB0L 4HUVB 1RZKL 4OLUH 4KI5C 1OTTC 3O11B 1D6VH 4HEME 2DAVA 2V2WA 5D2LE 2DMBA 5F7MC 2DQEH 4JFPA 5C3TA 4J7RA 2QQQA 4HAFA 1JK8B 5EO9A 4Z7QE 4X7SH 4IM8A 1AO7A 3P0YH 2VKXA 4DQOH 5KANI 3OR7A 4YH6A 4ORZC 5HYFA 3G5VB 2YWYA 2NW2B 2FDBP 3IDYB 2HLAA 3IJYA 4X7TA 3O4OB 5IMLA 4JZJB 2QSVA 1YYLL 1BZ9A 5J3HC 4BJLA 1A8JH 2G2RB 2OP4H 4EI5D 3DROB 2EIZA 3SCMD 1AGFA 1QHPA 3KJ4B 3L3GA 3KLHC 4KK8D 2BNQA 5CEYB 2I24N 3KLAA 4XP5H 3RVXD 1J1OL 3V5DB 4AEHL 3KYNA 2MHAA 1ES0A 3NFPB 1EO5A 2VLMD 2UVFA 1YQVH 1WT5C 2P48B 1RQ5A 3MXWL 4XC3H 2C7UB 1KB5L 1P84J 3SGDI 5E08L 3MLZH 1OARH 3S4SG 1A9BA 3VI4E 4YGAB 1FFOA 3O6FB 4NP4H 1ZT4B 5BRZA 3VI3F 5I1IL 2F54D 1OPGL 1PYWA 3ZHDA 2VUOA 2OYPA 2JJSC 3ISWA 4LHUD 1VFOA 3V6OC 4X6BB 1AGCA 1CE6A 4P2OD 4M03A 5DTFA 2VZ1A 3ZYZA 4G80A 5ESVB 3G5XA 1E4XL 1MHEB 1T80A 5FKPB 4YDKH 1KJ2A 4KH2A 3H9YA 1LK3H 2APWA 1FFRA 1YUHA 5FOBA 1QRNA 3RVVC 4UV4L 2AQ3A 5IW6B 2DIJA 3U9UA 2ZJSH 4KTEL 3OTTA 2NMSA 1D6EB 1TQCB 4K94C 5JO5B 1W0VB 5L9DH 2WBJD 5HYJB 2FNBA 1JYWA 2EDEA 1LDSA 2B4CC 3H9ZA 3KGRA 3T3PE 5EUOE 2EYTB 4QT5A 1I8MB 2X89D 2FD6H 4KHTL 2OR9L 1X6LA 3MMEA 3L5XL 4FQ1H 1MHHA 2FO4A 2GKIA 2BSSB 1G9MH 2NTSP 3I02B 5DD0H 4HG4J 4NO0D 5MENB 5DS8B 3VRLF 4RGNE 5DQJA 5KN5B 5GPRA 2XPGA 4WI9A 5M7QA 4PJAE 3ILPB 1D5IH 1XGRB 4YHMH 3LQAH 5TFSH 1K8DB 3O9WC 4P3CL 2AJXH 3LEVH 1W72H 1NCWH 1OP3K 2JLLA 5FDWB 2G9HA 5JNYA 2P5EA 1WBYB 4K9EH 1JWMA 3HC4L 1I7TA 1I7ZA 1X5IA 4WUUE 3VG9C 1VHPA 3H42H 4WGWB 4E41D 5E95B 4TTGA 3C60C 5JOEA 4PRHE 1IC5H 4D9RE 3D0VA 2XNAA 1NCAH 4TVPL 4TNVK 4Q9QH 4HK3J 2X9WA 1S7SA 1P2CB 3RWIA 4QF1B 4MNQA 3WXVL 2XTJB 3GEWB 3VH8A 3ZL4L 2EDKA 4CVXB 3QUML 3JBG7 4E0RB 5DJ8B 4UOW0 4GSDL 1JGUH 2N56A 3BEWA 1T89A 3HMWH 4L8DA 4GXUN 2RCSH 4JQXA 1JRHH 3TVMC 5JXEA 1LILA 1IC4H 4XAWL 1F58H 2E6JA 3GMRB 1WEJL 5DC0A 4ZTOH 3CH1B 1L9NA 1F6AA 4PIRF 4N1EA 3C9NA 3NGBB 1ZSDB