3WEXA

Crystal structure of hla-dp5 in complex with cry j 1-derived peptide (residues 214-222)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
181
structure length
181
Chain Sequence
IKADHVSTYAMFVQTHRPTGEFMFEFDEDEQFYVDLDKKETVWHLEEFGRAFSFEAQGGLANIAILNNNLNTLIQRSNHTQAANDPPEVTVFPKEPVELGQPNTLICHIDRFFPPVLNVTWLCNGEPVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDVYDCRVEHWGLDQPLLKHWEAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MHC class II antigen
publication title Structural basis for the specific recognition of the major antigenic peptide from the Japanese cedar pollen allergen Cry j 1 by HLA-DP5
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 181
sequence length 181
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2013-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wexA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 3wexA01
2CJUL 4Z0BL 4OCXH 1D9KB 3KPSD 3QUMH 3VFNA 4OLYL 1RUAH 1F2QA 1QSZA 2VDPL 4NNXA 2R69H 2UWEF 5B22A 1ZHNB 5F21B 4N8CL 1U3HC 1U8LB 1MEXL 3TT3L 1FO0H 4J3OC 1VPOH 3VU2A 1PKQA 3VDCA 1T7XA 4FFWC 2IF7A 3FCTA 4WW2F 3OKLB 1LO0L 4F3FB 4E0RA 4F7PB 3CFJB 1DVFA 1PAMA 4P3CH 1P7QB 4LCYB 5DO2C 3RWDA 4GG8B 3ILQC 4Y5VB 4KKBD 1S7UA 1CR9L 3E3QC 5DGRA 5IMLA 1CFBA 1J8HD 2FR4A 2AJ3B 5DYOA 3MJ6A 4BFBD 1YEEH 3CH8A 3CVHH 3WKNA 5DD1L 2ED7A 3FO1B 1F97A 5I2IB 5K9KA 3VG9C 3VDAA 4L4TB 3OKMB 1A3LL 2R23A 4X7EC 4ONHB 1MJ7L 4NHCH 43CAA 5EC2B 4EIGB 4HC1A 3AFLA 2GFBA 2R1YB 4QRRB 5DUBB 1I8MB 2XT1B 3L3GA 3ARFC 3LDBB 2DLFH 5SWSB 2QSQA 1MCCA 4EUPA 1I1FB 1KJ2B 5KSAD 2VLRD 1F3JA 1I8LC 1HKLL 1E6JL 3QO0B 1IKNC 2C7UB 4HK3J 5ALBH 4PJAA 3WO4B 1RIVH 3CDGA 2W9DL 2WUCL 3S35X 4GS7C 3H42H 3T1FA 4BELD 2X40A 1PZ5B 5E94B 5CUSH 4PJHB 5EBLB 4PJGF 5SX4H 3MLVL 5C0JB 3PWLA 5C0BE 1CGSL 2NW2A 2KKQA 5EA0H 4HGKC 5E6IC 3VCLB 4BKLB 5DWUH 1N6QL 3AB0B 3X13A 1XMWA 1N2RA 3SHSA 5DZLA 3O2DL 1TDQA 2HWZH 5KN5A 3B9KD 1Z5LB 2NY3D 5J57B 3HG1D 1VA9A 2H26B 5KJRL 4KQ4L 5L2KE 5LG1A 2GTWA 2V2TB 4P2OD 1IT9L 1HXMB 1NBZA 2FZ3A 4MNHB 3KPSE 2V9RA 1J1OL 4JY5H 1FZOA 3X3GH 2EH8L 1Z9SA 2BSRB 4K94L 2W0KA 4KTDL 4P2RA 5C0GA 4U1NA 5HHQB 4RMRA 1KCRL 2KH2B 3ARBB 3BSZH 1XF1A 2L7JA 5GZOD 1HKFA 1I1YA 3GBNH 1AI1H 5JNYA 2DM4A 4ONGH 5MENB 3JTSA 3K80A 2IPKA 3MRHA 4CU7A 3DRQB 1XF5A 4CADA 2X1OA 3DX8B 4OQTL 4BA8A 5EULV 3G6JA 3DVFA 5IG7A 2H3NB 2C3VB 2KL6A 2M8XA 1J8HE 2CDFA 4GKNA 5ID0A 5J4MA 3GNML 4LRIC 5H94A 2XZZA 3GDBA 3OKDB 3A67L 2J8UE 5DJ2B 3EYOA 3SGDI 3PXHA 4LLYB 4YWGH 4MNQE 2EYSA 3KPNB 1AO7D 3RL1A 2OTWB 4NJ9H 3RHWF 3EJZD 3GJFK 1VFBA 4K8RC 2GEEA 1CICA 3BPLB 2AW2A 3UAJD 5SWZB 3RWJA 5J1AB 1MHHA 1NUGA 2VLRE 1AGBA 4OB5H 1G6RL 2DYPA 5EOTA 1JIBA 2AJSH 1RHHB 1LE9B 2WNGA 2XKNB 3EGSA 2DQHL 3L5IA 4DQOL 5C70A 3H3BC 3T2NH 2Y5TA 5GRUH 1YDPA 3LPWA 4JHWL 3UYPA 1MRCH 3LKNA 4PRPB 4M6OH 4QWWD 3ULUL 5I8KH 4X6BB 5JR1L 1S3KL 1MJUL 2A6JB 4K3GA 1L0XA 4LP4A 3AMLA 5DJXB 4HDIA 1LEKA 5KAQF 3UZQA 4DN4H 4P59L 4PJDE 3EW3B 3HC4L 5IMOA 5SWQB 1RIHL 3AXLB 1EEZB 3HG1E 3TN0D 3BEWA 1S7RB 1FL5A 3OTTA 2P7TA 4PTUB 4ZDHA 4U1MB 5GSVB 5MI0B 4B53A 1I9EA 4OIBA 5GRVL 5DT1L 3GMRB 5FUZH 2AI0H 1BEYH 4QRTB 4UT9L 4YEEA 4IBLT 3E8UH 5EU7C 2W65B 2YHGA 4FP8H 2YRPA 3U1SL 4DKEH 1RJZB 1T1WA 4UAOB 3MSPA 3CLEH 3AMKA 3GO1H 4H0GA 4OCRH 1PKOA 1ITBB 4JFHD 5I16A 3DX6A 4TRPH 4PYGA 4KROB 5HDBF 3FFDB 4HF5L 1MCHA 5FYJD 4OQ1A 5J11B 3T3ME 2X9WA 3D9AL 2F53D 1IFHH 1OP9A 4DWHA 1HHGA 3LEXA 5GJTL 3KDMB 3MLUH 3BN3B 5HVHC 1XIWB 4AY0A 1G7JB 1HWGB 3KS0H 2RGSA 3LEVH 1MQKH 5C6TH 1P9MC 1R3IH 4RFNC 2IH1A 4YFDB 4QRPE 3NTCL 3P4OB 1D5XA 3SE8L 1Z3GL 3GSNB 2MQ0A 2NY7L 3TGXA 5GS0D 1FLRL 3RNQB 1DQML 3LQZB 4JR9L 1AO7E 3G5XB 2XZCL 1A7RL 3GBML 1F11A 5F7EL 5ISZB 4OCNC 1EPFA 3F7YA 4N8PA 1REIA 4KFZC 2OXHA 5E2WH 4K3EH 1GGBH 2CXGA 2X70B 1WFUA 1YUHA 4GKOA 4Q9RH 2GJZA 4PV9A 3VJ6B 4OGXH 1MCNA 4LVOC 3MRNA 3F62A 5IBTL 2DQTH 2B8OT 4ZSOA 5AUMA 5EPMB 12E8H 1FIEA 4F7TA 4BH7A 4UBDD 3W9EB 5IQ9B 5D6CA 5JHLH 1OD7A 4NQVB 3HC3L 4PJXA 1WISA 4F58H 5F7FA 4R7DA 3JWOC 4JO1H 3QG7H 4XZUB 2XN9B 4N68A 4CDHA 3K1KC 5HDQH 5JHDB 1M71B 1BMGA 3QXTA 5CMAA 4R0LA 5CZXC 5DTFB 1OQXA 4EVNB 4U3CA 5IVOA 2DBJA 3H9YA 1A14H 1H0DB 4KZEH 4EZMA 2OP4L 5A40E 5CEZE 1G0DA 3DHMA 5GIRB 1FN4B 4L9LA 1KTKE 1ZHBB 3B5GA 1MIEH 1N4XL 4U6VL 1MCKA 3O9WB 3S4SG 4GXVL 3O3UN 4HSQA 3OX8A 1Q1JH 3V4VH 2IAMA 5E2VH 3S96A 1I9JH 4JFHE 4P5KA 3QWOA 2EDFA 5D5MB 3SOBH 2Z31B 4OZFG 4G3YH 2ZJSH 5FCSH 2RCSH 5J3HD 4OZHE 4PJ5A 2QQNH 1NDGA 5FYJE 3L95B 1QYGH 3BESR 4UILH 3AS0A 2F53E 4DVBB 3TIEA 4F33B 3KYOA 3LD8C 4PJFE 1W0VA 2E7BA 2B39A 4BUHA 4FG6D 2B1AL 4UT7L 1GCFA 2F5BL 3NFNA 3HMXH 4WFFD 5B38B 2PKDA 5T3ZH 3D1MC 5A2JH 1XH3B 3MRBB 3QJFA 4ZAKA 4PJCE 4ZD3H 5BS0A 3QSKB 2MHAB 5HHPB 1BBJA 2XTJB 4KHXL 1UCBH 2MMXA 3O2WH 4LLUA 5DHYB 1UEYA 4ONFL 2GTZA 3LH2L 4F7EA 1HOCA 5ITBH 4KV5F 1BIIA 4JRXA 3KPRB 1GIGH 1AKJD 4HJGA 2J6EL 3IETA 3HCVA 4NQDA 4U1SA 2X4SB 4Y4FD 5FIEA 5E08H 4AMKH 1U95A 3BQUB 3QUYA 2X09A 3CSYB 1U3JA 5I30H 1UQSA 4YO0B 3I2CH 4FTVA 4LCCB 3ZKQD 3DGGA 3QHTC 3L6FA 4YBQC 1ES0B 2LABA 1HCVA 5HHNB 3ALWA 5JTWA 5JMRA 5KVGL 4X8JB 3RUGF 1GC1L 2QQKL 5EU4B 3GI9H 1T0MB 4BZ1H 4V1DD 2DQFA 4ZTPL 2M1KA 5DUPH 1FIGH 3BKML 2H41A 4OTXL 3OR6B 2AJYL 4ZPTB 1GHFH 2P5WE 4ZUVA 2GCYB 1M4KA 1ZEAL 4KHTH 1T5WB 4WFEE 5JPNA 5J6GB 3MFFA 4XPGL 2XWJA 3EDEA 4MA1B 4NZJA 5EZIL 3O2VL 3PABA 3TT1L 2P46B 4Y4KD 1TITA 5CKGA 3RWHB 4F80A 4LLAA 1FNFA 4NRYB 5I0DA 5C71A 1BZ7A 4I2XA 5TGBB 1KNOB 4EI6A 1WQVT 4JPWL 2CLZB 3JVGA 1NANH 2R9HC 1WZ1L 2NW3B 1XR8A 4U7SA 1H3GA 4HMCA 4RNRB 1R6VA 3PQYA 4HV8A 4QHMA 1MCSA 4Z7UE 2Z4QA 3TBSA 4P23A 2I60L 3SCMC 5I1CL 4I4WA 2ADJA 1BOGB 4I3RL 4O2EA 5HGDA 1R3HB 4OV6F 3FT4A 1MFNA 5GPRA 4Y2DD 5JW3L 3KYNA 2MKWA 1V8HA 3I3EA 3OPZL 4C54A 1C7SA 1EX0A 1WCQA 5E00B 1RZFL 4XXCC 4HIJA 1AQDB 5JLZA 4WFFE 4N5UA 2HT4D 1Y0LA 4W4OA 2PXYD 3QDGA 5D7JB 3PDOA 3GRWA 3QCVH 5LXGH 4CN1A 1ZLUK 2BNQA 5FFLA 4YE4H 2DQCL 2ESVE 3QUZA 4KKBC 4NCC2 4IJ3C 1CFTA 3N9GH 3QUMA 2YR3A 3F58L 4NBYB 3WDJA 4XMKL 2NYYD 2AJXL 4UUJB 2XWTA 3EOAB 2HVJB 4PG2A 2QQLH 3I85A 4W81A 3A6OA 4OF3A 2Y4SA 4PV8A 1FO0A 3VXMB 3NIDE 3WDHA 1CK0L 2BZDA 3JV6A 1CL7I 2OLDA 3MBED 2EDXA 3RY6C 4HXAH 2J5LB 1D7FA 4V1DE 2VLKB 3LB6D 3IAGC 1TQBB 1RJLA 3CVHA 3H3PH 3M1BA 2EIEA 1QPPA 4W6WB 3TNNA 1UA6H 4X6EA 2UUDH 5EU5A 5DFTA 4K9EC 2OJZH 4ZS6D 3OHXB 4NNYA 3GSWA 4EBQL 1G7MA 1YN7B 1QQDA 2OTUA 2HLFD 4GT7A 2VISB 1CD8A 4OKVA 4KUZL 4J12A 5ALCL 3B9KC 2IGFH 3AU1B 2NY3C 4LIQE 5IB2B 2O5XL 5FHAH 2NXYD 2YA1A 4P2OC 5T1KB 4CMHB 2YS4A 4FNLH 4YZFF 1R5IB 3W9DA 4Z8FL 3BT2L 3GSUA 3MUY1 5HHOA 1MIML 5FOBB 3NN8A 4J1UA 1DUZA 3WXWH 5CEYA 2JELL 2CLRA 3L3HB 3C09C 1MUJA 2FHBA 2GHWB 3GIZH 3SO3C 5IW6B 2ZCLL 3F7VB 3Q6GL 2W0LA 2DWDB 1N8ZB 3H3KA 2NTFA 3CFCL 4M1CD 5GZOC 5DJ6B 4MCYA 2DLHA 5FGBC 3G6DL 3WN5B 4Z78A 5B4MD 3VWJA 3GSNH 1EK3A 5JXAL 2J4WL 5I1JH 2JJSA 3ZYOA 4YUEH 4ZUUB 2F74B 2Y06H 1YEJH 4H5SB 4AQ1B 1IC5L 1YQVL 5CJ8A 5DVNA 3KWWA 2BNUB 5CEXA 2QR0A 2J12B 4PJIF 4U3XA 3TV3L 3LMJH 3EYSL 3MR9A 4TVPD 1BVKA 4PJBB 3KYKH 1MY7A 3UXFA 2AEWA 1PG7L 1U8IA 2EECA 2Q1EA 1NUFA 1MFDL 1DP0A 4LRNL 4WW1A 1OAQH 3CH1B 3PDGA 1WCBB 2EO1A 3EJZC 3CAFA 5E8DH 1VFUA 2FGWL 5E5MA 2W1NA 1JI2A 2Q8BL 1BM3L 5DJCA 4LPTA 4UIKH 4PY8J 2AEQH 2BFVL 4XP9L 3H9SA 4XCFH 3C08L 3HZMA 4PREB 1J12A 3DV4A 5DURD 3TJHC 5CD5D 2EXYD 1QHOA 3NVQA 3MRFB 3L9RB 4HEME 1LNUA 1ROWA 4G9FD 4L4VD 4WO4B 1NUDA 3TBWA 2X1QA 5EORH 4HJJL 4B50A 5CGYD 3NPSC 1P2CA 1LO3H 4BZ2H 2WBJB 4YZFE 3LKPA 4I0PA 4Z0XB 4Y1AA 3WJJA 2VZSA 2R2HB 1FVCB 3C87A 2RIKA 2DQJL 3DTXB 4YBHA 4X6DF 2H8PB 1V7NL 4NPYB 4ESKA 3A6BL 3TN0C 5J06A 1KIQA 2BVPA 4CAGA 5I9QC 1JCKA 3OZ9L 2P42B 3B8YA 3SDCB 3IJYB 4QRQB 4I0KA 3C6LB 1A2YA 4P5TC 1H8SA 3EYFA 4CU8A 3CFEB 3UTSB 5IM7B 3VFGL 2ZUWA 3U4BH 5FGCE 3FRUA 1CF8L 1KJMA 5BJTA 5IVZA 3VXRD 3RWEA 4LU5H 4N9GB 3W81A 2AV1B 4HIXH 1B3JA 3PIQA 2ICEA 1HZHH 5IK3A 4HXBH 2GJ6A 3RZCB 3OB0H 3ZKXC 1DQDH 4UTAH 4XPBL 4FQ1H 2BHUA 5GGSA 4R2GC 4TULH 1E28B 1M6OA 5IFHH 5F71A 4Y16A 2JIXA 1PG7W 1A1NB 4ELKB 1E4WL 2NY2D 1GOHA 5AZ2L 2A6IA 3TYFA 2VUYA 3AY4A 5IQ7H 1INEH 1JPSH 3FN3A 2R1XA 5IP4A 4Z0BH 1CLCA 5EUOA 1IC7L 4GW1A 4TVPE 1AGEB 5ANME 1INQB 3VD4A 4PJGB 4OLYH 5GS0C 2Y72A 2VDPH 1H8NA 1H3XA 1B0RA 1A6VL 1HI6A 1FVDA 4OF6A 2ADIA 1N64H 1OTTC 2MQ3A 2YSSB 4N8CH 5I6XB 3TT3H 1MEXH 3WLWD 1NFIA 2PCPB 4LCWD 1VFOA 2AP2A 1PBYA 1CT8B 3V4UH 2YPKB 4B7LA 3U7AA 2P49B 4ENED 1LO0H 3K46A 5FKAA 1UEMA 4WU5A 3V6OA 4L4VE 1TVBB 1D6VL 4RAVA 4G9FE 1CR9H 1WZKA 2RBLA 5HD8C 3BZEB 3MV7A 1QLFA 3EHBD 4UBDC 5DD1H 1OT2A 2WIIB 4LK4A 1L7IL 4JFYA 3CVIH 2IQAB 5MEOA 4XAKD 3SE9H 1A3LH 1J05B 3GMLA 5IHUL 4NOFA 5I1DB 3K0WA 4QEGA 1JWUB 5F7DA 4PGJA 2E7LC 4TUOB 5FV2A 1UKSA 4OZIA 3RL2B 3S3PA 3PV7A 5KANI 1MRDH 2Q7YA 4LEXH 4J3SA 5AZEH 5F89A 3ZDZF 1CFSA 4KK5C 4Z5RA 3KLSA 2EEAA 2QJDA 4GLRH 4PY8I 4ZG1A 1JHTB 4FQXC 5D2LB 4BUGA 3MRKA 2DQUL 1G0YR 2W07A 1AHWC 4NM8L 4OD2B 1RZIB 4ZFZB 2D7OA 1HKLH 1E6JH 5GSRA 4IOIB 3VXRE 4P9HC 3BRGC 2HP4A 3SDDA 4QXUL 2BC4B 4JJ5B 3MLVH 1IGJB 1EDQA 5J3HC 1CGSH 3D39D 4I5BA 1PEZA 1XCTA 4P46D 5I8OH 5MERA 1XZ0A 2NZIA 4DGVL 1N6QH 3BWAA 2HG5B 3NFSL 5DJZA 1U8OA 2A9NL 3O2DH 4YH6A 1F3DH 4PRHD 1S7QB 1HNFA 2IANB 3G5VB 3H7LA 1D9KA 5TPWL 3RY5A 1IT9H 5CJOL 1KCSL 2B0SL 4N8VG 5D1XB 3ARZA 1J1OH 4RAUB 5T33L 3MV9A 1I7UB 1I9RL 4AL8H 3VMNA 4DTGL 1IAII 1U8LA 1CN4A 1BLNB 2FJHB 4X7TA 5FA3B 1KCRH 3EOBB 4WHYG 1UXWB 4LCWE 3TVMB 4Y4FC 3T3PF 2HKHL 4JFEB 3MJ8B 2CRZA 3ZE2E 3UPCA 4F7PA 3QXUA 4TNWK 1P7QA 2HTLD 4LCYA 5DA0B 4F9PC 1H5BB 4GG8A 1SY6H 4Y5VA 2YMXL 2OCFD 4HIHB 4OQTH 1KB5B 2XOTA 4UOW0 1NCBH 3HMXA 5M95B 1AIFB 3GMNB 1MVFA 3ZDZE 1SEQL 5CCKL 5I2IA 1KIUA 1XGUB 3GNMH 3L3OB 3UYOD 3OKMA 4MHHG 1X4XA 2MSPA 5E8EB 4ONHA 4XAKE 3NOIA 5EC2A 4JRYA 3O41B 4NZUL 2R1YA 4QRRA 4TVPL 1YC7A 3BGMA 1I8MA 2YD1A 1BPVA 3VFMA 4JN2B 5BOZG 1QVOA 3CX2A 2FH8A 4F15C 4RQQB 1OP3K 2GT9A 1DQQB 1I3RB 3D0VB 3BO8B 4LLDB 4P99A 1XGTB 4X9FA 1I1FA 3BAEL 3VXTB 2UVFA 2WSKA 2UYLB 5IVXB 5HHVH 3QO0A 2ITDB 1MCEA 5KW9H 1XGPB 5EBMA 2HT2D 3ZL4L 3BRDA 1PZ5A 2DQHH 5E94A 2Y9RT 4DQOH 1FCCA 4PJHA 5EBLA 3AROA 1L7TH 2EH7H 2OQJB 3HAEB 3IDGB 5C0JA 2IMNA 3UYRL 3VCLA 4JHWH 3ULUH 3D39E 1EXUA 2EDOA 4KXZH 2OX5A 1P69B 1S3KH 3IS1X 4DUXA 4M93C 3VRLE 4NN7B 1NBVL 1Z5LA 3HMWL 3SN6N 2IQ9L 4P59H 3HC4H 3VH8G 3FHQA 1FGVL 1RIHH 2V2TA 1U92B 4PRHE 2FEEL 15C8H 1HXMA 1JZ4A 2Z91B 3QO1B 2HT4C 1NGYB 3BISA 1NCAL 2PXYC 1P4LA 25C8L 5DT1H 1J5OH 4UT9H 5A16B 1EO8L 3U46B 3G5ZB 4HMDA 1S9XB 5HHQA 1ZT4B 2CUMA 4OLZL 3U1SH 4L3EB 2C3GA 1U2CA 5J0BA 3ARBA 2ZUVA 1T7ZA 4KMTL 2J2ZA 3W2DL 2FCBA 3LS4H 5MENA 3U2SB 3PWPD 2NYYC 3HUJE 2BDNL 3C5ZB 3DRQA 3E2HB 3ARGB 3D9AH 3DX8A 3SGEI 3STBA 4Z6AT 4R4ND 1TNMA 5CINL 4HIEA 1UENA 1G7HA 2BSSB 5CSGA 5BV7L 5I73C 1II4E 4WI3A 3MBEC 3OKDA 2EEBA 3SE8H 5IEHB 5DJ2A 5A43C 1WZMA 5I1KH 1K4DB 1N6UA 2BRQA 5EU6D 1FLTX 1Y6NR 5EZLA 2NY7H 3LB6C 3QR2A 5TF1H 2Q8AH 1BAFL 1QR4A 3KPNA 1FLRH 1QA9B 3H2WA 1DQMH 2OTWA 4I3SH 4S2SB 2Q20A 4JR9H 4P2QB 1OAYL 2NY1B 4JGJA 2XZCH 4JFFB 3GBMH 4KUCD 4ZS6C 5SWZA 5F7EH 5J1AA 5DVOA 4NN5C 3V6BR 1HQ4B 1LE9A 1RHHA 2FECI 2LU3A 2XKNA 5JW5B 5FYJU 4Z7VE 5LGJB 2YZ1A 2IALB 2ZKHH 1OGAB 2NXYC 3IRPX 2K7PA 1I1AD 3PP4L 4ZUTA 5DHXB 4UNVA 4X9HA 4X6CB 1U8QA 4JDVB 4X6BA 4MXVF 2X10A 3PJSB 5DRNB 3RGVC 2EXWD 3OXSB 5DJXA 3QRFM 4ZYKB 1K8IA 5SWQA 2ATPA 3AXLA 1EEZA 4H20L 4WHTB 1CGUA 3Q5YA 1WWAX 3QXAB 1F8TL 4MJID 5DJAA 4ZS7H 4U1MA 5GSVA 4QOKD 4R3SA 3QDHA 3BFOA 3VXQB 2ICWB 3D85A 4BFIB 4QRTA 3DMMD 2FX9L 3OJ2C 1R5WA 4PGBB 1N4XH 2ADGB 2YUVA 1RJZA 4OZGE 1XF2A 1UJ3B 3VD3A 1MFAH 1UWEL 3P30H 3FQRB 4NKIH 2NY6D 2FWOB 1U91A 4G42B 1CFVL 2ZOKB 4M6ML 3FFDA 3PWPE 4U7KA 4N9OB 3FO0L 3HC0A 5C8JB 3PL6B 1RZ8B 5D1ZB 1EHNA 3IDYC 2AQ3A 4WWKB 1QNZL 2EE6A 2OR9H 3RA7L 2E9IA 3CD4A 1XIWA 1G7JA 2YXFA 1DQLL 4AK1A 5J9PB 1FC1A 3SJVD 3SDAA 3KLHC 1FG9C 2CK0L 4AH2B 3RPIB 3B2UD 2B1AH 1D5BB 2DL9A 3P4OA 5EOCH 4EIZC 4UT7H 3QNXB 2F5BH 3MX0A 3FFCD 3BMVA 3GSNA 1ZOXA 1ZLSL 3TO4D 2VN7A 4P4KD 3DOSA 3Q5OA 3ZZ1A 5EU6E 4Q97A 3RNQA 4M3KB 3LQZA 4Y4HB 4PRNB 1ORQA 5CD5C 4GQ9L 3G5XA 3NGBB 2EXYC 5HYSB 3MV8D 3LH2H 5ISZA 2YRZA 4KI5D 4TSAL 3LN5B 2AK4A 2V5SA 4IRJB 5F6IB 4UMGA 2IPUG 2FL5B 5CGYC 3GSOB 2J6EH 4XGZB 3BD5A 1S7TB 3UTTB 2P5ED 5DMJB 3IS0X 2X70A 2Q76B 4MD5B 3VJ6A 4XHJD 5JDSB 5DD3H 5K59E 1LP9F 1KT2B 4KI5F 5FGRA 3HE7D 4BZYA 5EPMA 3P0VL 2XZQH 5IQ9A 1DBKL 1PDKA 2P44B 1V5JA 3ISWA 1JNLL 5T1DH 3RAJL 3EYVB 3EFDL 4EDXB 1GC1H 2M26A 1WICA 4XZUA 2XN9A 1RZKL 4GUPB 3CSBA 4JPVL 3LOWA 5JHDA 3BKMH 1M71A 2DMBA 3KNBB 4GRLD 4OTXH 1CIDA 3S35L 1ONQB 4BSJA 2JCCF 3CZFB 4QGTA 4K07A 5EZOL 1H0DA 4MJIE 3TZVB 4DCQB 1ZEAH 1Z6JT 2AXGA 4QOKE 1CYGA 5GIRA 3GMOB 1ZHBA 3IFLH 5EZIH 3TT1H 2X2YA 4F9LA 3LHPH 3O9WA 3HNSL 3WJLC 5F9WC 5FDYA 3TA3D 1DBML 2VJXA 3DYOA 2F54B 3MUHL 4JPWH 2GW5A 2NY2C 5D5MA 2Z31A 3MGOB 5I15L 4CKVX 3QDMB 2LFGA 3OAUH 4ODWB 5I1CH 3NCYS 4CVZB 4PJEE 2NY4B 4F8QA 3IJHA 4YGVB 4HCRL 4F33A 3ZDYF 1XEDA 3O45B 4MB5A 5JW3H 5BQ7B 3SJVE 2YOCA 3SKJH 1KB5H 5CHNB 1M7XA 4BM7A 4JRWA 3WLWC 4U6HB 5B38A 1R3KA 1RZ7L 1JPFB 1XH3A 3FFCE 3KS0J 5CZVH 4XPTL 2MHAA 5HHPA 4G6FB 3QDJB 3X3FL 2L7UA 1BECA 1YMMB 1H9VA 4A6YB 5TFSL 2JK5B 5E4EC 4M8QB 1DVFD 5DRXB 3MROB 2DQCH 3MV8E 4CDGC 3KPRA 4AJ0A 1I3GH 4M62L 4MWFA 3I6KB 3EHBC 3F58H 2D9CA 1QRKA 5E7BA 3BQUA 4R97C 3CSYA 2P5EE 4YO0A 1TZHB 2N7BA 5BRZA 4LCCA 2O5YL 3REWB 2NY5L 3VXPA 5HHNA 4MLIA 1HHKB 5IMKB 4X8JA 5I76B 1T22B 3HAEH 4JFZL 5EU4A 2EDKA 4NRZB 1T0MA 1AXTL 1T66D 1KN4L 5LWYH 2EYRA 4G43B 4XVUD 4J6RL 4P49A 3M8OH 4ZPTA 5IB3B 1A7QL 4PY7A 5GZND 3K4ZA 2GCYA 3DSFH 2Y36L 2DM2A 1Z0NA 3ZE0F 5J6GA 1NQBA 5IB4B 4EBQH 1NFDF 5GHWL 1U3HB 4S1SH 3RWHA 4P46C 1SVCP 4JANB 2G2RB 4FQHB 4EQ2A 4HW6A 4KUZH 3ZDYE 2XG4A 2CLZA 3X17A 4NZDA 3FAWA 4QCIB 2F8OA 1JHLL 4RGMB 3MUGB 3MZTA 3KPPA 4Q9BA 5DD5L 1BOGA 1MIMH 1EBAA 2CK2A 5GS2D 2JELH 4LPUA 3CDYA 4QXTB 4KRNA 2KQMA 5I17B 2OL3B 5E00A 1DEDA 4P2RD 2PETA 2ZCLH 3Q6GH 4H25B 4MAUL 1AQDA 1PKQE 3WUZA 3CFCH 3GBLA 4OLVH 4X6DB 1NGWB 5D7JA 3ARFB 1WT5A 3O2DA 1J8KA 4GKSB 2HTLC 4HLZG 3T08A 4PUBL 5DHVH 4ZXBC 4YIQB 1A5FL 1H3PL 1IVLA 1YQVH 4GS7B 4W6XB 3TV3H 2N4IA 2DD8L 2HVJA 1GGUA 2KPNA 3EYSH 5IOPA 5E8PB 4K55A 1PG7H 2HFFB 4KC3B 4KMLB 5E6IB 2E7CA 1KXTB 2P43B 4LRNH 1ZANH 2BK8A 4PRIA 1CICD 3B2VL 3AREC 4ZFOL 4OLUH 2C1OA 1DCLA 3C5SA 3BKJL 3ULVH 4LF3B 2EC9T 1LE5A 2FGWH 3T1WA 1SY6A 2VLKA 4OQTA 4RDQF 2Q8BH 2DYPD 5IJVB 1YY9D 4PJAE 5HGAB 2HT2C 4ZO8A 4LSQL 1MI5B 4JO4L 4PD4K 5TE7H 2CSPA 3VXUA 3OHXA 3FB8B 4TUJB 3NZHL 2DJ4A 1X44A 2WM0A 4MNGA 4HJJH 1A1MB 4GW4B 1YN7A 1HDMA 1YJDH 2JJVA 5DMKB 4X9BA 1F4HA 2VISA 5CSZB 5KVDH 5FCUL 2KZ1B 2Q7NA 1OAXL 3V0VB 2ZUQC 3SGKA 3AU1A 1TPXC 4U0RC 2DQJH 5IB2A 3QT2A 2VERN 4TOYL 1V7NH 3A6BH 5T1KA 1HH6B 5KOMC 2YD4A 5DZOA 1IQWL 4R90L 1F2XK 4CRPA 3QXVA 5FOBA 3I3DA 3U79A 1WBXB 1MLCA 1QTYT 3P40A 3ARVA 3L3HA 4J4PA 1F58L 4UOW1 3QIWB 3VFGH 3WSQL 5IW6A 1PZUB 4P4RB 3W82A 1WAAA 2ED8A 4P2RE 1CF8H 4HMEA 4V2BA 2DWDA 1N8ZA 3BH9B 1I8IA 3DX9B 3WN5A 1E4KA 1TCMA 3DXAA 3B5TA 3WS3B 1A1OB 3PWVA 4AG4L 2XWBB 2AS5M 3T65A 4XPBH 2ZUYA 2G75B 1OF2B 3QG6A 4R4NC 3RWCB 3JV5A 4ZUUA 4YHIB 1TJGL 2AXHA 3G6JE 2F74A 2KBGA 4H5SA 2ZSWB 1B2WL 1BQHB 1Q9WA 2VTFA 1E4WH 3E0GA 2LVEA 5SV4A 3LRHA 5AZ2H 3DPBA 3KPMB 4X80L 4PJBA 1IC7H 3HPLA 3LN9A 5F9JA 4ZFFB 3HNTL 3CH1A 2DQGL 2DDQL 1F02I 1PLGH 1IGYB 1A6VH 1U8NA 4OI9A 3V0WL 1RUKL 5K9QI 5C09B 5H37H 4KKAC 1TTUA 3VGFA 4KVCL 3MLRL 4N1HB 3EYUH 2HVKB 5INDB 1DQJA 2WW8A 3BX7C 2HMIC 5GRXG 2IFGA 1D6VH 3V9FA 4ZNEA 5JXEC 4P5MB 1TJHL 4RA3A 1XF4B 3F65A 4QNPF 1B0WA 2EXWC 5IFJB 1MLBB 4XNXH 5IHUH 3DTXA 3T77B 4WW2A 2IG2H 2H8PA 2R29L 4NPYA 1EO5A 4YDKH 2CDEB 5HGHB 3S37X 1CBVL 4JY4B 5BVPL 1J18A 1TIUA 4HC1L 1MVUB 1S5IH 5HVHB 3DMMC 4PJXF 2DQUH 5I8CB 4NM8H 2EDJA 1PD6A 3CFEA 4RFNB 2GSIB 3NCJL 4AEHL 1AFVH 3MOBH 2CO6B 3ULSA 3EO9H 3HI5L 5ID1B 4N9GA 2AV1A 3NCFB 2NY6C 2IAMD 5F96L 1T89C 2F9BT 1L6ZA 1VENA 3RZCA 5C07B 4LSPH 2NXZD 4PJ5D 1M7IB 2VXQL 1DN2A 1E28A 4POYA 4M4PA 4A6YH 1NAML 3NFSH 4M48L 4U31A 2UUDK 1KPVA 2R0LH 3EZ8A 4WI6A 3BHBB 4YDLC 1I75A 4XT1C 4LVOB 5TPWH 1UVQB 1HEZB 5CJOH 1KCSH 4ZAKD 3TO4C 4PJGA 5BS0D 2B0SH 3LAFA 1MCDA 4NQUA 4POZC 2A2QT 4LSVL 1YA5A 2VLMD 3S6CA 3NFPB 5DJDB 5GRZA 3DUUA 2YSSA 1J10A 3WNMA 3D48R 4MCZB 3QRGH 4JRXD 5CLTA 4K2UL 4RIRA 1MHCA 4MDIB 3MV11 4X83A 1CT8A 4Y7MA 1UGNA 5SV3A 5E2TL 1S9VA 2HKHH 3MLSL 2CR6A 3QUYD 4C56B 2VDOH 2WBKA 2EDBA 1FFOA 1RULH 1BD2B 4UTBL 3S7GA 4FTVD 1X9QA 5KS9F 4KPHL 1TVBA 3W11C 5C7XL 3SGJC 2K9UA 3FZUD 3HE7C 2XIDA 4M5ZH 3UTZA 3BZEA 1U93B 4ZSOE 2WIIA 2XNAA 3CX5J 5C3TA 4NUGL 3MRPB 3VI4F 2JJTC 2IQAA 1J05A 4XTRD 4FXGB 5I1DA 4OSUL 1JWUA 2CUHA 2E6PA 3V4PL 3DO3A 4KKLD 4GRLC 3QI9A 4JHAL 4NZUH 1DSFL 5AG9A 1UH2A 3EYQD 2R0WL 3PHQB 2J6EA 2YZ8A 4UNUA 3LD8B 4MJ6A 1RZIA 4PGCA 4ZFZA 5L88H 4GSDH 4I77H 1DJSA 3ZHKA 5TH2B 4FXLA 4YHZL 4XP6L 2DM7A 3LKRB 1JWMB 2VSDA 2B4CL 1ACZA 3ZL4H 2HKFL 1TVDA 2OL3H 2VDLH 3ZDXE 3SQOL 2BC4A 4JJ5A 5JIHA 5LGKA 1IGJA 4KY1L 3H0TA 2JB6B 3RDTA 4P23D 1SJVA 4EJ1C 3F6LA 1MFBL 1HYSC 2DQIL 1J0HA 1CD0A 1UYWL 5GS1B 1V05A 4JB9L 5T3XD 1YEGH 1NBVH 3HMWH 1QR1B 3QIUB 4LPXA 1FNAA 1NEZG 2FATH 2VXSL 1S7QA 1QBBA 4OF0A 1FGVH 2IANA 1HINL 3SBWC 3M45A 4JM2F 1HN1A 5D1XA 3SY0B 3QQ4B 1BWMA 4RAUA 3QHZH 3QDGD 4FHBD 1NCAH 2A77H 3PP3K 1I7UA 2BNQD 3RKDC 2H2SD 4HIIB 5D1QB 1EO8H 4G6AD 1J86A 1J1XL 1OB1B 3EBAA 2AQ2A 3QUZD 1BLNA 4OLZH 5IMMB 4CW1A 5FA3A 5GXBB 2BP3A 1UXWA 3BIKB 4HWEL 3VXSE 2D4DA 2P8PA 4JRXE 3RTQC 4KMTH 3Q3GB 4JFEA 1BJ1J 3MJ8A 3P4MB 1KENH 3DNKA 5DS8B 1H5BA 3VGAB 3F8UB 2VL5B 1Z9OA 4NN6C 4HIHA 4FTVE 1KB5A 4O5LH 3QEQA 3KJ4B 1FYTA 1TTGA 4OFIA 1AIFA 3GMNA 3IGAA 2E8ZA 4OFKA 3FB6A 3OB0K 1XGUA 4ORGA 5BV7H 3L3OA 4HWZB 4M43H 5E8EA 3L5XL 2YD5A 5L2KB 3NCMA 4OZ4B 1UC6A 1T66C 1R24B 3RGHA 3FT2A 1P4BL 1JF1B 2ZCKH 3LQAL 3O41A 1JHKH 4JKPL 3KPSB 4CGTA 3SCMB 1BAFH 1FNEB 4NQCA 3T0EC 1OSZB 3MA7A 4JN2A 4MA8H 5GZNC 4Z7OF 3V5KB 1S5HB 1RIUL 1OL0A 4FXKB 4RQQA 3CC5B 1I3RA 3D0VA 1OAYH 3L3IB 1XGTA 4LDLB 4HZAA 5T5NF 3VXTA 4U1KB 2UYLA 5IVXA 1HQRA 5DLML 5C0IB 3JSSA 1A8JH 5ILTL 5M7QA 4W4NA 3MGTB 1C1EL 4I2XE 5L7XH 4O9HH 1J0YA 1N26A 3SGDH 5JA9A 3SE3A 2OQJA 3HAEA 4HS8L 4ZFOB 3PP4H 2FJGB 1T2JA 5HHOD 5I75B 1JF5A 1J8HB 3VFTB 4IJ3B 1IGIH 1JYNA 4OGYH 4LSSL 3P4NA 4YHOL 1QBML 3FQUB 1N5AB 3P0YL 5T3XE 4H8WC 1VADB 2J8UB 1I1RA 2W60B 1A4KB 3W5MA 4H20H 1U92A 2HAZA 4AEIH 1F8TH 4LLWA 2AGJL 4OD1H 4X4ZA 4MNQB 1MJ8L 2PF6A 1NGYA 1LP9B 3RVVD 5B3JF 4HX1B 3C60D 2GY7B 3DX7B 1K85A 3QDGE 3VWJD 5A16A 3U46A 1YPZF 3G5ZA 4NRXB 1KSRA 2BNQE 1S9XA 1VEMA 1ZT4A 4E41E 4L3EA 5F1KC 2VLRB 4Z95L 3FOMB 4UQ2B 1AJ7L 1FFRA 1RURL 1PY4A 3BMWA 4ETYA 3U2SA 5IVNA 2GIYA 4M6MH 2JCCB 3C5ZA 5DD6A 1D6EB 1JPST 4WTXA 4L4JA 3FO0H 1QNZH 3VGGA 3RA7H 1DQLH 4LCIL 5J12C 5MEPB 3ZTNH 2FX7L 1CICC 1DBAL 1I8KB 1MAKA 5LJYH 3V6FB 5IEHA 3U82B 4ZTOH 4PB0H 1A3QA 3UPRB 2OK0H 1K4DA 2BJMH 4C4KT 4PG9A 3QUXB 2VO5A 1LD9B 3HFML 4F57L 1KELL 5DHVA 1QA9A 1YY9C 1NCUA 3H9SD 4S2SA 2Q86B 1E4XL 1AY1L 1J0ZA 3C09B 3DRTA 4JFFA 4S1QH 2OYPA 3O4OC 1U8PB 3SO3B 4W70A 4QHLB 4I0PD 3QQNA 5F3HA 1A4JB 1HQ4A 3GJFH 4Y1AD 5EBWB 5JW5A 4N90D 2ARJQ 3RJQB 1OW0A 1GXEA 1AP2B 2MJWA 2IALA 3S34H 1IKFH 1OGAA 1IAOB 1DBBH 1U9KA 3P0VH 3OBAA 1GZQB 1DBKH 4X6CA 1BQLL 1SYVB 4JDVA 3PJSA 4JVWA 5HHOE 5ENWB 4HQQL 1Q9KB 1FQ9C 3EFDH 1KPUA 4QRPB 4ZYKA 4FS0A 4G80A 1RZKH 4WHTA 3TO2B 1IZKA 3S35H 2FECL 2Z8SA 1JI1A 5EZOH 3B9VA 3VXQA 2V5TA 2ADFL 2ICWA 4GRMB 4M02A 3TIDA 5C0ND 3MACL 3VI3F 4J2XA 5DQ9B 2GJ6D 4XI5D 3PV6B 4D0CB 2JJWA 2APFA 1NL0H 2ADGA 4JG0L 3LIZL 3CFBB 3BVNB 3RUGA 2QLVB 4XNUL 1UJ3A 1V3MA 3FQRA 3E6HB 3LSOB 4Y16D 2JIXD 1DBMH 3MLZH 2FWOA 4G42A 4DZBB 2ZOKA 3WS6A 3MV01 4OGAD 1P53A 3MLYL 4BYHA 3RVTC 2V9TA 3P9WB 4MGXA 1FORH 1RZ8A 5D1ZA 5F7WC 4WWKA 1YNLH 4HCRH 3NPSB 4OLXH 3U0PB 1AD0B 5J9PA 1EMTL 4NZRL 3GUTB 2FH6A 5LQBL 1D5BA 3QNXA 2WK2A 5I0ZA 1W0YT 5GJSL 3U6RB 1MCOL 5HHMD 5EUOF 2QADC 5I9QB 1MF2H 4NT6B 1MREL 1MSPA 3X3FH 4X0KB 4PRDB 3QHFL 5GRJH 4PRNA 5L8JB 3OAYK 3H9SE 5HYSA 1QLEL 3EJJX 4P5TB 3REVB 1H3WM 1K4CB 4FQIH 4IRJA 5GRWA 1T20B 3O4LB 4RA0C 3WD5H 2FL5A 4DOHE 3MV7D 1KEGL 3GSOA 4XGZA 2AKRA 3UTTA 4C57C 4MS8D 5MEQA 4HZLB 4Q9QL 1DUYB 2Q76A 4MD5A 4Y1AE 3HPJB 4XWOD 4HKXB 1RUAL 5JDSA 4N90E 5DVLA 2W59A 4OZHB 2R69L 3ZKXB 1KT2A 2NQCA 2XQYG 1AQKL 3WDIA 4R2GB 3SPVB 1FO0L 4G8EA 1VACB 1WWCA 3EYVA 1VPOL 3ECBA 5F7LB 4EDXA 4MZ3A 4JFZH 1ZAGA 1AXTH 4FQLH 4GUPA 2DRUA 1KN4H 1RJCA 3KNBA 1IEHA 1ONQA 4PJCB 1HYRC 3CZFA 1A7QH 1GAFL 1Q38A 4P3CL 4M1DL 1C5DA 2Y36H 3O6ML 4X5XB 2K1MA 2IAMC 3M17B 4HJ0D 1XGRB 3SDDD 1YEEL 4RGNB 2GJ6E 2NXZC 3QWRA 5D7SL 5GHWH 1RFDH 4ZPVB 1WGOA 1UB6B 1YMHB 5D6DC 2F54A 3DECA 1NBQA 1AC0A 1FJ1A 4Y5YB 1J7VR 2GAZA 3MGOA 4ALAL 1A3RL 1R3LB 1OSPL 2EKJA 3IFPB 2DLFL 1D9KD 2BNRB 3MRGB 4QXGL 4ODWA 5DEGA 5DZNA 2DMKA 4OFYA 5JIPA 4CVZA 4G7YL 4ZAKC 5FYKU 1BFTA 3MJGX 4YGVA 5I71C 3QULB 3BXNB 4GRWE 3U4AA 3F7QA 3MV9D 3GK8L 1YEKH 5FYLE 4XAWL 3BZFB 1O7VA 5BQ7A 1JNHB 1MRFH 8FABB 4K23H 1AXSB 5J6HB 4U6HA 1N6VA 5D96C 4D9QD 5ICZA 1JPFA 2WINB 4MAUH 4O4YL 5FHBL 1OLLA 2P5WB 5CGTA 3OB8A 5HHME 4U7MA 5IGXH 5EOCJ 1YMMA 3T04D 2FIKA 3R4DA 2JK5A 4XP1L 4M8QA 3WFZA 4CVUA 4MX7B 1P7QD 4FQXB 5C1MB 3TESA 1EAJA 5DRXA 4OZFB 3MROA 4PUBH 1AHWB 5IW3A 2HWZL 1IMHC 3MUJA 4XPFH 4L29B 2DAVA 5T3ZD 2HJFB 3I6KA 4RRPG 1H3PH 1UG9A 4R7NB 3MRMA 1LK3H 2DD8H 4XTRC 3UEZA 1KOAA 1TZHA 4JY5L 3MNZB 4XC3H 4KKLC 4ETQB 4JRYD 3WNOA 4QRRD 4OZIE 1JTTA 3LV3B 4XC1H 4Q2ZB 5IMKA 1Q0XH 2OBGA 1ED3A 1T22A 3AM8A 5I76A 4NRZA 3B2VH 3BSZL 3VFRA 4NNPH 1BF2A 1DTUA 3BKJH 1AR1D 2NZ9D 2PW2A 1PEWA 3IDIB 3MXWH 1JYVA 4G43A 4PJIA 1KCUH 1T1XB 1JPTL 3MCKB 1Z0MA 2R2BB 5IUSA 2X4QB 3T09A 3UBXI 4P3WA 1CG9B 2JB5L 3QIBC 4N5ED 3MRJA 4JO4H 5IB4A 4HBCL 5HYJB 1EFXA 2FSEB 2ESVB 2HTKD 3NZHH 3IJSB 4P23C 1XGYH 2VSCA 4E42A 1G9NL 4NO3A 4JVUA 4JG1H 1EO7A 3CPLB 1ZT1A 1CL7H 4JANA 1YEIL 1ODAA 4LVEA 3SE4A 2G2RA 4FQHA 1AKJB 4NSKB 1S8DB 1OAXH 4Y4FB 5JUEH 4X4YB 4QCIA 2HT3D 3ZSSA 4PJHF 2VH5H 1T3FB 3MLTA 4F8TA 1G9EA 3BEVA 1J0IA 3U0WL 2A6DB 3MUGA 4NJ9L 4Q7DA 4P3DA 4DUWA 1KXVC 2VE6B 3GM8A 3OWEA 1I9IL 3STLA 2F8XC 4W4OC 1QSEB 2VQ1A 1NAKH 4CNIB 4OB5L 3MV9E 4QXTA 5I17A 2OL3A 3ROLA 5IKCB 4HS3A 3QUZC 4H25A 4V1DB 3UP1A 3KLAA 5ERWB 5GGVL 4X6DA 5D72L 4U6TA 2Z8VC 5MEND 3P9LA 5DD0H 3ARFA 3G6AB 4R6UA 4GKSA 1HSAA 2DQEL 4PG2C 5I8KL 2FEDD 1TJIH 2NMSA 4HPYL 4R26H 2J8HA 1QRND 4R8WH 4JHBA 3UJJL 1I8LA 3RY4A 3UC0L 4DN4L 1Y18B 4YIQA 1ZLUH 5T3ZE 3B6SB 1QZ1A 1T2QH 1FV1B 4X7FC 4EN3B 2LQRA 2Q6WB 5EO9B 5FUZL 4I13B 2AI0L 2HFFA 3E8UL 3J7HA 1HK6A 4JRYE 2P1YA 3BE1L 2DQGH 3QFJB 3O3AB 1FFNA 9CGTA 4JFPB 3CLEL 5KSUB 3GO1L 1NCCH 4M93B 4OCRL 3V0WH 1EJ6A 2DS4A 1RUKH 5SWZD 4EEEA 1JZ6A 4LF3A 3C8KB 4TRPL 2D7TH 2H9GA 4KVCH 5IJVA 5EO1A 5HGAA 3MLRH 2AAVA 4MQSB 1IFHL 1MI5A 5DMIH 2IADA 5JQHC 5C0CB 3MLUL 1S9YB 4QHKJ 3FB8A 4TUJA 3TYGH 3MFGB 2P48B 3LEVL 1MQKL 4RFEB 4ZODA 1TJHH 1A1MA 1R3IL 4GW4A 5C6TL 5DMKA 2FB4L 3AUVA 4TSCL 3HB3D 3CCHB 5CSZA 1X7QA 3FN9A 2QKIA 3KJ6H 3V0VA 4H88L 3MLWL 5T1LB 4HS6B 5ESAA 1GOGA 4OIIH 5E9DB 2R29H 2NX5A 5E99H 1LEGB 1HH6A 1CBVH 5BVPH 4GKZA 3D85D 2FO4B 3RVVC 4ZOAA 3C60C 4JQXA 4HK0B 4LRIA 3VWJC 5I73B 3WLBB 2MKLC 3QIWA 3MBEB 4K3EL 3S88L 2YUXA 4P4RA 1GGBL 4J23A 5FA4B 3HI5H 3BH9A 1HHHB 4OGXL 1IEBB 2Z8RA 3WEXB 1T2XA 5F96H 3FQXB 1MCPL 2DQTL 3CFIC 4KROD 3WS3A 1A1OA 4YHNB 2XWBA 5JHLL 2RFXB 2G75A 3RWCA 1GZPB 1UXSA 2VXQH 4F58L 4BQBA 4YHIA 1QRNE 4S1DC 1XIWD 3QG7L 1UJTA 3H9HB 2ZSWA 1NAMH 1BQHA 3E6FA 1FVEA 3SDXB 5CEZH 5HDQL 3SDAD 1NFKA 2LTQC 3KPQB 3GJEB 3OSKA 3KPMA 1GGTA 2VIRB 1A14L 2BVTA 4KZEL 1DEEB 1EAPB 5HJ3A 3L3KB 4YFEA 4ZFFA 1TXKA 1MIEL 1L0QA 1JTOA 4LSVH 4Q6IB 1RUPL 3O6FA 1IGYA 3O6KL 3RGVB 1EHXA 5ISZD 3TCXA 2YD8A 5C09A 2AK4D 2YA2A 4WJ5A 3V4VL 2W0FB 3HRZA 5E2VL 5FGCB 4K2UH 1I9JL 2V6HA 5C0RH 3SOBL 3C8HA 4HH9B 1CDJA 2ZJSL 4I0PC 4RMSA 4NZTH 2B20A 2QQNL 2X4OB 5E2TH 3MLSH 2NNAB 1QYGL 3UROR 4UTBH 2N56A 1SYSA 3BP4A 4KK9C 4KPHH 4KJQD 2FDBP 5C7XH 4WTWA 5JA8B 1XF4A 4TTGA 4XPHH 5GGRY 4OFPA 5F8QC 5ACZA 4GAFB 4OCLC 5IFJA 1MLBA 3X11B 1OWRM 3T77A 2XN9D 5F7UA 2J3SA 5JHDD 3V4PH 2CDEA 5HGHA 1UCBL 5ANMB 5IJKC 2X05A 1G0XA 1ZA3B 3L3JB 4JY4A 4NKMB 4U49A 4UDUB 3IDYB 3RX7A 3A0OA 5ITBL 2R0WH 3MZGB 3GJFA 1DQTA 3PUCA 4OCSH 1CDBA 3T0BA 4XI5C 1P9MA 5BZDA 1QLRA 2GSIA 4QGYA 3O11A 3WV0A 1KJ2L 1ORSB 4YHZH 4XP6H 3O9WD 3AS3A 5I30L 4FZ8H 4I18A 4O2FB 4N0YH 5CJBA 5D7IE 2HKFH 1ZVHA 2LU7A 1OAUL 1NGQL 1Q8MA 2Z31D 1L9NA 5C07A 2XZAH 3SQOH 1IAMA 4KQ3H 1WLHA 3AY4C 4OGAC 1F6LL 4KY1H 1M7IA 5DA4A 4PP1D 1K5NB 1C16B 3P77B 2WWMD 1MFBH 2CKBL 2DQIH 1FIGL 1UYWH 1JZ3A 4JB9H 1YN6A 4OZFH 3IDNB 4UI2A 5D5MF 5ESQB 2VXSH 4YC2C 5K9JL 4KHTL 4UB0L 4XBPB 5GGVY 2WP3O 1UVQA 1HEZA 1LWRA 4TTDD 1DL7H 3B4NA 2X89A 4P9HH 2XTJD 4KJPD 3P11L 5DJDA 4FQCH 1J1XH 4XVJH 3VGHA 3DIFB 5B38G 5IBLD 2OI9B 3KPRD 2G5BB 5ISZE 2AK4E 4HWEH 4GAYB 3HRPA 2IWGA 3VXRB 4MS8C 4LKCB 2FLRT 3BQUD 4HCRA 4C56A 1U58B 2A83B 5BRZD 1BD2A 2ZPKH 4NKQB 4KJYB 3ZYZA 4R96B 4WI8A 3S98A 1MJJB 3MQIA 1U93A 3CSPA 1FZJA 3VXNB 3QCUL 5F9WB 1GPOH 2AERT 3BH8A 2CUIA 3MRPA 1DLHB 4PBXA 5D9SB 1IAIH 3KPOA 4HUUB 4O51B 4FXGA 4WI9A 3L5XH 5LXGL 2D03L 2X6MA 1P4BH 2XN9E 4N1EA 3P4LA 5JHDE 4X6FB 3D2UA 4YE4L 3UZEA 2VLLB 5C6WH 4HJ0C 3SDDC 4Z7QE 3DETD 3N9GL 5DGQA 1I85C 4JDZB 3B9DA 5TH2A 5DLMH 2BOBB 3LKRA 1JWMA 4LCWB 5I74C 3R06B 2QQLL 4LVHB 5KSBE 4TPRL 1P7HL 5KTEL 5E4EB 5GS3A 2APBA 4HS8H 1UWGH 2JB6A 4LDOB 4OIAA 5TDOB 3I75B 4TN9A 3NBNA 1EEYA 4UINL 5CLWA 3WFEL 2QSTA 4PPTA 5GS1A 4LSSH 4YHOH 2PO6C 3I50L 1XCQB 1QBMH 3P0YH 1QR1A 3QIUA 2XQBH 4R97B 5F6HJ 1AC6A 4XH2B 3PF2A 3MBXL 2AGJH 2DKSA 1MJ8H 3SY0A 2R15A 1A9BB 2OJZL 5D7JD 5B3NA 4XNZB 2Y07L 4HIIA 2QQQA 2XTJE 5D1QA 3O3BB 5IHZB 1OB1A 4Y5VC 3HNVH 5HTSA 5IMMA 3BIKA 2H2PD 4OV5B 1AJ7H 1RURH 5FHAL 3Q3GA 4UDTB 2H6PA 2DBLH 5GGTL 4PBVC 3N1QC 2O61B 3P4MA 4YXLH 2KDGA 5BRZE 3WXWL 3OKOB 1IAKB 1NCWL 2IPTL 4NP4L 3GSVB 3MYJA 2NCMA 1U2HA 3LDBC 4N8VB 5C08B 1CD9B 4JJHA 4HWZA 4PRID 4LCIH 1FBIL 1LHZA 2FX7H 1WIUA 1DBAH 4EOWH 2CDGB 2X1WL 4OZ4A 1WFTA 3QJHB 1R24A 1AR1C 5EN2B 2NZ9C 4MJ4A 4GW5A 2VLKD 1X5YA 1BIHA 4PR5B 3GIVB 2XFXB 4LPVA 1BZQK 3GSNL 3SCMA 4MQ7A 4F57H 3IXTB 1FNEA 2I9LB 5I1JL 4N5EC 1S5HA 4OUUB 4FXKA 4YUEL 3CC5A 3WFDL 2J1KA 3L3IA 2YXMA 3SGEH 3VXUD 5FM5O 3QNYA 3B9AA 3V95A 5C0IA 3D3VD 3LMJL 1OP3H 4Q58C 3MGTA 5FYKL 3MJ7B 3HUJB 1OOAA 5EU3B 1FDLL 3EUUA 3FHAA 3S37L 1OAQL 3U30C 2D3VA 5T1KD 4ZFOA 3NCCB 2FJGA 1BQLH 4ZXBB 4QTIL 5DDHB 4ODUA 2PYED 4K3DH 1YZZA 4HQQH 4J4PD 3N85L 3FQUA 1N5AA 3ARUA 1VADA 4UIKL 2W60A 2AEQL 1EBPA 4EDWL 2JKXA 4L3AA 1IL1B 2BOCB 4MNQA 3ULUD 1LP9A 4HX1A 2WWKO 2ADFH 2A9ML 2IH3B 3DX7A 3S36X 1A0QH 3DXAD 1FE8L 4XP5L 4YBLC 4GBXC 2QSCH 3AREB 5F1IB 4DW2L 1KTLB 4XNUH 3FOMA 2BX5A 1EZVY 1JV5B 4MQXD 1RZJL 2VR9A 3LS5L 5DRZB 2JCCA 3BOVA 1D6EA 1FZKB 1LO5B 5DJYB 1I1CA 3MLYH 1Q9OB 1VGEH 5F6HI 3VH8B 2XA8H 3RX8A 2VR5A 2V7NB 2P45B 2OR8A 5KG9A 5CJQL 3V5HB 4TVSa 5H2BB 3U4BL 1CXLA 5MEPA 1EMTH 4MD4B 3U7YH 3BPLC 5LQBH 2A0LD 4LU5L 4OF8A 2QL1A 3FB5B 4PRIE 4HIXL 4Y88A 1TPXB 4U0RB 3UPRA 4NYLA 4LLMB 5EG6C 3BN9D 3QUXA 1LD9A 5ESVA 4JO2L 2UZXB 3PXJA 4UTAL 1T6VN 3QHFH 5C0FB 1HH9B 2CLVB 3DVNB 2Q86A 3DYPA 4TULL 3ZHLA 3MRDB 4X7SL 3TBYA 3CXHK 3VXUE 1U8PA 2DIJA 4MNGE 4QHLA 1A4JA 3D3VE 5IQ7L 1INEL 2VZVA 4XCNB 5EBWA 4Q9QH 4PP2B 4MJ2A 3MMEB 1FSKC 3PWPB 1IAOA 3WKML 2EDTA 2E7MA 3GHBL 1GZQA 1N64L 1OTSD 1AQKH 5EZJB 4YNYB 2NR6D 1SYVA 2DI8A 4KRLB 3QUKA 3F6IA 5C6PB 5A2KH 2E9BA 2PYEE 4QRPA 5HY9B 3V4UL 4BSWB 2VZTA 1KGCD 2CH8A 2OJEB 4YPGB 3MRLB 3TO2A 1I7RB 1WAAE 3JWNC 1GAFH 4M61B 4GQPH 4M1DH 4GRMA 4QY8B 3LEYL 3O6MH 3ULUE 3GSRA 4MD0B 3PV6A 5ICYA 4RBPK 3DXAE 1BBDL 2I5YL 3CVIL 3CFBA 5D7SH 3SE9L 3S8WA 3DSNA 3E6HA 3LSOA 1OPGH 1MY5A 3BKCH 5EUKB 4EI5C 5IT2H 3V7MA 1G7PA 3SDAC 4AYFA 1MRDL 4LEXL 5AZEL 3VE0B 4ALAH 1A3RH 4IIQB 1BZ9B 4QYOB 3VWKA 4MJ5A 3LN4B 1OSPH 5B39A 4QXGH 1S7XB 5CJ5A 1MOEA 4PJBE 5BW7A 3P9MB 4J3WA 4HD9A 4QKXB 4G7YH 5DMGC 4PJ8B 2C1PB 5C0AB 1AD0A 1NFDA 3GK8H 4XAWH 4Z7WF 3GUTA 1T4KB 4NC2B 4OI8A 1TNNA 4TUKL 4M7LL 3K3QA 1PQZB 3OR7A 4WI4A 3U6RA 4D9RE 3DO7B 4NO2B 4O4YH 5T1MB 5FHBH 4KKCD 5J1SC 2HFEA 4NT6A 4XRCA 4YDJB 5ACLA 4X0KA 3GMMB 3I6GB 4QOKB 4G8FA 4XP1H 1NAMA 2CKBB 5I8OL 3VW3H 3NZ8A 3G5YB 4P5TA 3DMMB 3REVA 5FUCE 1K4CA 4Y5XB 2UWEE 1T20A 3O4LA 3QEHB 2EO9A 5KSVA 1ZGLP 2Y6SD 1DUYA 3MCG1 3NMEA 3HPJA 3UX9B 2YPLB 4HKXA 5E8NA 2JJUA 4XMLL 1YEFH 1NLDL 3U7WH 3ZE1F 3QI9D 4BQ6A 1CTNA 4JZJA 3HLAB 1TCRB 4PJEB 4AL8L 4IRZL 3MJ9L 3RWIB 1OT1A 4JLRB 1UZ6F 2WV3A 2BVQB 1JRHI 3SJVB 3ZYJA 1SM3L 2EDQA 4F9LC 1KGCE 1SHMA 3O9WC 1JPTH 2VQTA 1FNSH 1XT5A 1P84J 4JKWA 4FFVD 1DR9A 3THMH 3TO4B 5C2UB 1SY6L 2JB5H 4LVNC 2R1WB 4X5XA 1F45A 4RAHA 3M17A 1Z2KA 5D2LF 1XGRA 1NCBL 1RV6X 4J8RB 2Z31C 3IDXH 2ZOLB 1R3JA 1T0NB 4HHAB 4HBCH 3RDTD 5BVJA 5C0DB 3MV8B 4CL7A 1A9EB 3VRIB 1G9NH 1ZVSA 1UB6A 4PP1C 3KVQA 2WWMC 4BSVA 2DM3A 1YEIH 1AGFB 4Y5YA 3DJ9A 2P5EB 4FQPA 1Q9LB 4MDJB 1T03L 1JBJA 2WWKT 4Q74A 4ZUSA 3BGFC 3FQTA 1R3LA 2IAND 3IFPA 1JNNH 2BNRA 3MRGA 1BFSA 4ZO6A 3U0WH 1K2DB 2RHEA 4M9OA 5D1XD 1NBYB 1I9IH 2C3WA 4TTDC 1NUNB 3QULA 3BXNA 5EO0B 4PJGE 1M7DB 5HHVL 2XTJC 3D69B 1H15A 3WFBH 4KJPC 3C9NA 5DK2A 5KW9L 3BI9X 3BZFA 1FZMB 4I8DA 1F6AB 8FABA 1QFWI 5HYIA 3A6CL 1AXSA 5J6HA 3HZYB 4P9MH 2WINA 1WBYA 5F7KC 2E7LA 2X5PA 2P5WA 4GRLB 1RZGB 1L7TL 5GGVH 2EH7L 3S97C 1P84K 5D72H 2A73B 4JFED 5FV1L 1QACA 5CJXA 1JK8B 2R0KH 1DANU 2FO1A 3L5WB 4FQXA 4LCCC 2DQEH 2OXGA 4OZFA 1ZA6A 4HPYH 1AHWA 3O8XC 3QEQD 4IOSD 1VGKB 1FYTD 3UJJH 5KAQG 3UC0H 2HJFA 4PLNC 1IARB 1LQSR 15C8L 5B8CA 6FABL 1BREA 1CDHA 3ARDB 3MNZA 1P6FA 1J5OL 4ETQA 3FB7B 3LV3A 4NQCD 4HH8A 1GGCH 3BE1H 5C9JA 3VD9A 2VRAA 1G7LB 4D3CH 1URLA 5E5RB 2VZ3A 1LO4H 3LS4L 5IESH 5I1IH 1TMCB 3MCKA 2QV2A 2R2BA 2X4QA 1ZS8B 5CD3B 1CG9A 3ZTJH 3MC0A 5HYJA 2FSEA 4L1HA 2ESVA 5IVXF 3IJSA 3ZKND 1S7UB 1QSFB 4X5WB 2FB4H 1CWVA 3CPLA 4TSCH 2FR4B 5E8OB 5TE6H 3AVEA 2WANA 3RTQB 3DUSB 5I1KL 4Y4FA 4H88H 3C2AL 4X4YA 3MLWH 1CFNB 5TF1L 1GVIA 2Q8AL 2YPVH 3OKEB 1L0YA 1F3RB 4F9PA 3SDYH 4I3SL 4NN6B 2IANE 43CAB 2VE6A 3QAZC 4AIZB 5F88A 5DFVD 1QSEA 3L3GB 4FA8A 4JKLA 2BRRL 5KVEL 4MA7H 5CKAA 3S88H 4L3ED 1F3JB 1MHEA 1ZMYA 4TNVK 4LSRH 2ZKHL 4JN1L 4J3UA 4GFTB 3CUPA 3T0EB 1G9ML 5L9DH 1MCPH 2NLJB 3G6AA 5LVEA 3RRQA 3VRJA 3C5ZD 4PLKD 3S5LB 4GMTH 1XGQA 5JDJA 3S3JA 1ZHLB 5HBBA 4Y2OA 4WGVB 4K94C 4YXHH 3WIHL 4L8DB 3QEQE 3BP5B 5EIIB 1FYTE 1Y18A 5DF0A 4U1JA 3B6SA 1AD9B 1N2RB 1P4IH 2G5RA 4IRSB 3WUWA 4ZS7L 4EN3A 3RPKA 5I19H 4J3TA 2Q6WA 5E03A 5EO9A 2GTWB 2AK1L 2FZ3B 4DKFH 4WFGD 5HDBE 4WGWB 3QFJA 3O3AA 4NQCE 1RUPH 4LMQE 4GG6F 3O6KH 2NY1D 5KSUA 1MFAL 3P30L 4JFQA 4JFFD 4NKIL 3TCLB 4ZUWB 1RVFL 1V3LA 4P0DA 5C0GB 5I1GL 4D2NA 3MUZ1 1I1YB 3SGKC 2R4RH 2FBJL 2OR9L 5C0CA 1S9YA 3MRRB 3R0MA 1YNKL 3MRHB 3ZSTA 1WTGT 3MNWB 5IG7B 5EOCL 3QQ3A 4JZOB 3CCHA 4IMLA 4B41A 4Z7NF 2CDFB 4PBWD 2EICA 4NOBA 5T1LA 4YDVB 1OM3L 1FC2D 1UCTA 4HS6A 5H94B 4PJ7F 5E9DA 1LEGA 1BVLB 3ULVF 1IEAA 4X6CF 5KS9A 2FO4A 1F4XH 2MTPA 4MAYB 3WN5C 4HK0A 1E4KC 4H1LG 3RL1B 5AYQA 3WLBA 5J12B 5IB1B 1ZTXH 2ZSVA 1KJ2H 1MHHB 5FA4A 1F4WH 1AGBB 4MQXC 5DD3L 1IEBA 4XNQB 1N3NB 2FJFB 3FQXA 2VZ1A 1OAUH 1NGQH 1QUNA 2XZQL 1KPRB 2WZPD 4JFOB 2HH0L 5T1DL 5D1ZD 1GZPA 4WWKD 1YDPB 1UKQA 3HZKA 3L3DA 4DK3A 3H9HA 2VLJB 2CKBH 3SDXA 3KPQA 3GJEA 2PYFB 1OHQA 2BHZA 2A0LC 4G6MH 2VIRA 3ME0A 5K9JH 1EAPA 4BK5A 2I07B 4HWBH 4UB0H 3RBSA 5IMOB 3BN9C 1FL5B 4J3XA 1UM5L 3IFLL 2E7HA 2MFNA 3SKMB 3MYZA 4Q6IA 2I9TB 1JGDA 4WFGE 4JY6B 2ICCA 3P11H 5FUCC 3RGVA 3LHPL 35C8H 3PWNA 3WNPA 3FMGL 4I48B 2W0FA 4IRJD 4JFFE 2GJJA 2ORBL 4PRAB 4HH9A 2VAAB 3UTTD 1CFQA 3H6JA 2X4OA 2NNAA 5I16B 3OAUL 4HEPG 5ADOL 3FRPA 4JM2A 5HYSG 2GKIA 1VEPA 4NWTH 4WW2C 4L9DA 1LMKA 4DKAA 3C5JB 3BYTA 4IM8A 1OTSC 3TPUB 1T04B 3SKJL 1KB5L 2NR6C 3QCUH 4KV5E 4UOJA 4LSUH 5CZVL 4HFWA 4M7JH 3QH3A 3X11A 4U33A 3DURB 4C59B 4M5YH 1WZLA 3NAAH 2D03H 4QRSB 2ERJC 4NBXB 5ANMA 5DJ0B 1QFOA 3L3JA 2R0ZL 4NKMA 1NC2B 5C9KA 1RK0B 1WTLA 3K4DA 1I3GL 3K81A 3QWRD 2CMRH 2YC1B 1Q72L 2LE9A 3QFDB 4XB8A 1ORSA 5JZ7D 2SEBB 1P6AB 3ILPB 3RUGE 2QADB 2F54D 4CBPA 2V5YA 3QEGL 4O00A 2VZOA 1UM4H 5DK3A 4Y19A 2OM5A 2ZG3A 4TPRH 5KTEH 1ULVA 1KULA 1NCDH 3OJDB 3VD5A 4LCUB 4OFYD 1K5NA 1C16A 1UACH 3P77A 2NY4D 4UINH 5AUMB 4ZSOB 3WFEH 5KSAC 4UT6L 5LWYL 5D6CB 5FKPA 4OT1H 3I50H 2ARWA 1JMZA 3M8OL 4KTYA 3IDNA 5F7MC 5ESQA 3DSFL 4XBPA 5BZWA 1MCLA 1TETH 3MBXH 4KK6D 2VABB 4G6FD 3RWGA 3UMTA 1YMMD 4S1SL 2BY3A 1VFAB 2Y07H 4XMPL 1C08B 3VFSB 5CAYB 1U8JB 3AC0A 3DIFA 2G5BA 2MCPL 4GAYA 3G04A 3UO1L 5GGTH 2Y6SC 4AZ8A 3UTTE 2A83A 1B4JH 4P5KB 4PIRF 3QWOB 5FO9B 5GGQL 3BPCB 4R96A 1MJJA 2NXZB 5FM4A 1NCWH 2IPTH 3HE6B 3QI9C 4NP4H 1QFUL 4L8SC 1YPZA 4XCEB 1R0AL 3VXNA 3WIFB 1VB9A 3EO0B 1FBIH 4HUUA 1T0PB 4O51A 2DOCA 2B5IC 4OLVL 1FG2B 3ARQA 1QFPA 1QHPA 2AV7B 3ARWA 3WHE0 4JE4B 4XVSH 3TF7C 2XPGB 4X6FA 3VXOB 3LZFL 3QJFB 4YR6B 3BWUC 5I71B 2V5RA 5CILL 4ODXA 1EGJL 3WFDH 1QP1A 2YUWA 1GC1C 4APQA 4JDZA 1EFXD 5D2NA 1L9MA 3RDTC 4NQSA 1HOCB 1PYWB 4CMMB 2BOBA 4M7KH 3VXSB 1BIIB 4NC1E 3R06A 4KDTA 4HJGB 3IETB 3HCVB 5FYKH 2BXYA 4WUUB 3IAQA 2F54E 5GGRA 1FDLH 4AIXA 3S37H 1LDPH 1ZANL 5TDOA 3I75A 5I1LB 3ILQD 3VGEA 3SO5A 2Y25A 2OSLB 4LHUB 5GRYA 4OLUL 5IR1B 3UAJC 4QTIH 3ULVL 1OTUD 4YHLL 3G9VA 1B90A 3N85H 1XCQA 5FM8A 1LVEA 2EKSB 5L6YH 1IGTB 1EH9A 3IFOB 4YHPB 4EDWH 4XH2A 1M05B 5TE7L 5H8DA 1A9BA 1A6PA 32C2B 2WQRA 2GK2A 5IB5B 2A9MH 2WLZA 2KQNA 1YJDL 4QWWC 1FE8H 2D7MA 4XP5H 5IWLA 5JPNB 1H5BC 5IHZA 4OJFL 5KVDL 2XWJB 4L3CB 5DXWA 4DW2H 3WFCH 4K71C 3W5NA 4LAQL 2C3HA 4OV5A 3PP3H 4JHZA 3UBXB 1RZJH 5D93B 5GS2H 3LS5H 3QIBB 2DQDH 3L5JA 2W91A 4H8WH 2E27L 3EKCA 5TE4L 4HLZH 3VFPB 4ELMF 2AEPL 2X4NB 4UV7H 1NEZB 5CGMA 5FO8A 4HV8B 3OKOA 4PRBB 1LEIB 3TBSB 2Z4QB 2C4FU 4P23B 5CJQH 4GH7B 4I4WB 1EHLL 4AENA 3GM0A 4LPWA 5C08A 2ADJB 4O2EB 2AJZB 2CQVA 4LMQI 4AEEA 3G08A 5FO7B 5KVMC 3FT4B 2CDGA 3NCYP 3KYNB 3QJHA 4NHUA 2PN5A 3D6GA 3WIIL 2BHYA 3GIVA 1ZGLB 2XFXA 4OCWL 3PWUB 4JO2H 3IXTA 4PJIE 2I9LA 5JLZB 4GOSA 3IDUA 4OUUA 3JZ7A 1MI5D 5ETUB 3R8BB 4X7SH 1EUTA 3BP7B 5FUOL 4E41B 5DQDL 3ZKNC 2I26N 4Z7WB 3QUZB 3V8OA 2UZIL 3RX5A 1N5YL 2E6JA 5D71L 5DFWH 5IHLB 4JDTH 1EHAA 3HUJA 4NN7C 1BOYA 5EU3A 1FFQA 2NX5D 1NDMB 2GUOB 3WKMH 1PLGL 3GHBH 1P5VA 3MTRA 2WUBL 3X14A 1BJ1H 4ZXBA 5DDHA 4G6JH 1KIRA 3OMZA 4EXKA 2P8MB 3QIWD 4PS4H 2VXTH 3Q1SL 3EYUL 1IL1A 2BOCA 5EBGA 4AIOA 5HSFA 3GKWL 3LEYH 2BCKB 5D4QA 2IH3A 4X6DE 1FPTH 2D2OA 3CVHB 5H35A 3M1BB 3C5ZC 2KUTA 3E2HC 4HPOL 3AREA 3CDFA 1BBDH 2I5YH 3R8QA 4DFHA 4NGHL 2CD0A 4XNXL 1JV5A 1CDUA 1NLBL 1RPQA 2IG2L 1NC4A 3QDAA 4YDKL 5DI8B 5DRZA 2H1PL 5HYEA 2LVCA 1FZKA 1LO5A 5DJYA 4HG4J 3TBTB 4FOMA 1S5IL 1VERA 1NMAH 2V7NA 4CN4A 4LHQB 4ISVB 1UADC 5H2BA 4LNRA 2YKLL 4R4FL 4X5LA 3WNLA 3O6FD 4M6NH 3WL9B 1AFVL 1LDSA 3MOBL 1KG0B 3ETBF 1DUZB 4MD4A 4ODSL 1FL6B 3EO9L 4WEBH 3UZVB 3FB5A 4TUKH 1MUJB 4M7LH 5C09D 4HUMB 4LLMA 3NACH 3GSQA 4NC0B 4LSPL 2D31B 4HT1H 2C5DC 2NTFB 5B21A 3TH4T 5C0FA 1HH9A 2CLVA 5DQJA 3C60B 1OW0C 1NEUA 2EDLA 3D87B 1BQUA 1MI5E 1WWWX 2ICES 4A6YL 3VWJB 4WY7L 1T83C 5D7LA 3MO1B 2K3TA 4MZ2A 4FG6C 2R0LL 3ES6B 1K3ZA 1N7MH 1KJVB 4PP2A 2X4TB 3NIGF 3KWWB 1CE6B 1KLUB 4XMLH 1NLDH 4BQ9A 4HG4K 2ZP0T 2NX5E 2W9LA 1N59B 1ZHNA 5EZJA 4IRZH 3MJ9H 3QRGL 5I1HL 2FLBT 5HVGB 4BSWA 1CGXA 1S78D 1YYML 2LAAA 2D0GA 3OKLA 2OJEA 2F5AL 3MRLA 4WRLA 4F3FA 2EDWA 1I7RA 1CXIA 1SM3H 1UJ3C 2F19L 2VDOL 3CFJA 2Z8WC 1RULL 4M61A 4QY8A 2XKSA 2EDNA 4M5ZL 2AJ3A 4D94A 3WS6C 5C07D 4WTZA 3FO1A 5IBUB 1H3VA 5D1ZC 4WFHD 4L4TA 5FF6B 4WWKC 4DOHB 4WENB 2NY0D 1X5AA 4I9WD 3GFUA 3LKPB 1CI5A 3HI1B 1KLFA 3VE0A 5DUBA 1T03H 4IIQA 1B6UA 1BZ9A 3ARTA 4QYOA 3LN4A 4G9DB 4RMVA 4H0IA 5SWSA 3DLQR 1V3JA 3P9MA 5JXEA 4C83B 4PJ8A 1KJ2A 5C0AA 2X89D 5L88L 4GSDL 4I77L 5AAWA 4Y4KC 3CMGA 4OD3H 3MOQA 4U4BA 2C7UA 3R1GL 1T4KA 1A2YB 4OLEA 2AVGA 3A6CH 4IRJC 3DO7A 1MAML 5T1MA 2OL3L 3V2AR 2VDLL 3FRUB 5CZXD 4YDJA 2XRAL 3RWEB 4GMSL 3GMMA 1YNTB 3I6GA 4BKLA 4C56D 2CKBA 1K8DB 3SKUD 5IK3B 1BD2D 1VHPA 3G5YA 3DMMA 2GJ6B 4KRPD 5DC4B 4Y5XA 1YEGL 4OI7A 4Y2DC 4HWBA 2H26A 2FATL 5CWSB 1M6OB 3OAYH 4BJLA 6FABH 2YPLA 4MNHA 4DN3L 3T2QA 3QHZL 1BGXL 3TYFB 3QNZB 2A77L 3T3PE 3BDYL 2EIDA 1P7KB 3HLAA 1TCRA 4PJEA 2BSRA 4GW1B 3NIFF 4GRWB 3RWIA 3D2UD 3CZJA 4KTEH 4TQEL 3RIAF 4JLRA 3GKZA 1F00I 4PJ9D 5E95B 2BVQA 1OD9A 1B0RB 1PX4A 3QZWG 1ADQH 4IDJL 5F7YC 4NC1C 4NJAL 1KENL 4NQED 5HHMB 3MA9L 1CIUA 3MODH 1X5FA 2R1WA 4O5LL 1PY9A 1OQOA 1SEBB 2H3NA 2C3VA 4J8RA 4Y89A 2ZOLA 1ZLWH 4AM0B 1T0NA 4HHAA 4RFOL 3M07A 5FGSA 5C07E 5C0DA 1YYLH 1X6NA 4GG6B 3VRIA 4M43L 2NY4C 4X9GA 4XBEH 4ZO9A 4WFHE 1AGFA 1FFPB 1JN6B 4HUWB 1JRHL 5AG8A 3C2AH 2ZCKL 5MP6L 4LLYA 1JHKL 4TNVF 4Z9KB 1AH1A 1Q9LA 3QIUD 4UIMB 5MEOB 4MA8L 4K7PX 1K2DA 5F7DB 3CFDB 4HLJA 4KK6C 1TZGH 4XWGH 4BQ8A 3S36L 5F89B 1LO2L 5EO0A 3D69A 4M7ZB 1XFPA 2BRRH 1IJ9A 5D1QD 3X12B 5KVEH 4QTHB 2HLFC 1FZMA 1F6AA 2X4PB 4LSTH 2ATKB 3HZYA 3N50A 5L7XL 4O9HL 4PJ7B 1RZGA 4Q0XL 5GSRB 4JN1H 3KR3H 2A73A 3UTQB 3VFUB 4BH8B 1G9MH 2J88H 2A38A 4PRPA 3ARSA 3L5WA 5IW1B 4RX4A 3SQBA 1IGIL 1BD2E 1CE1H 2A6JA 4FQQB 4OGYL 1VGKA 1T1YB 4K8RL 3WIHH 4ZNCD 4OM0H 2R4SL 2YN5A 4G8GB 3BWAB 5I74B 3TLRA 3NIFE 3V52L 4AEIL 1MWAB 1S7RA 5DJZB 1QFWL 4PTUA 4OD1L 3ARDA 4LLQB 4M1CC 4M3JA 3OJMB 3MOAL 3V5DB 2F58L 3GMRA 4QHUB 4X9IA 1E27B 2AK1H 4X4MA 3SCMD 3FB7A 5B4MC 2W65A 3BZ4B 5HI3D 3QBTB 1JJUA 5GGTA 3MV9B 2PO6B 1G7LA 1RVFH 1MCBA 4TSBL 1IM9B 1WC7B 4RZCB 3IKCB 5D8JL 5I1GH 3SBWA 4X7TB 4NO5B 3G9AB 1ZS8A 3SE4C 5DC9B 3WNNA 5CD3A 4NQEE 3HS0B 3OGOE 4X98B 3P73B 2W38A 3PHOB 2FBJH 3KDMA 5F97E 1YNKH 5A3ID 3T0DA 4RGMC 1TENA 3ZTNL 1Z9MA 4X5WA 1QSFA 3BJ91 4KJWD 3OXRB 5E1AB 5E8OA 4ZTOL 4PB0L 3IB4A 3RTQA 3DUSA 1OTUC 2OK0L 2BJML 1MCWM 1OM3H 1CFNA 1W8NA 3OKEA 3MREB 2C4XA 2C9AA 1MELA 4UQ3B 3RIFK 1T21B 4MNQD 4JRYB 1G1YA 4AIZA 4FABH 3BGMB 3FAXA 4S1QL 5TQ2L 3VFMB 1QVOB 4HKBB 1A02N 2L4OA 1C5BH 1FAIL 2GT9B 1ZLVK 2J8UF 1MNUL 5LBSH 4MXVE 3WHXB 4LDEB 3S34L 1IKFL 3T0EA 2FEEI 2NLJA 3KYAA 4JREC 5EBMB 1DBBL 5C2BH 3S5LA 3W9EA 5DEZA 2HH0H 3WHE1 1ZHLA 2IC2A 2Q3ZA 4NQVA 1XAUA 4L8DA 3BP5A 5EIIA 1EXUB 1AD9A 5EIQA 3NH7H 4KDWA 4KGLA 4IRSA 5DTFA 3RI5F 2CKNA 1OCWL 4LNVA 4EVNA 2UVEA 3QWQB 3O3DB 3QUXD 4K7FB 3U30B 3D18B 1OARH 1FN4A 1UM5H 1NL0L 1G6VK 1A7NL 2XV6B 1JZ2A 5C92A 1P4LB 1JYWA 2ZNXA 5BV7C 3TCLA 4PJDF 3FMGH 3MLZL 4ZUWA 4JGUA 3ALXA 1B6DA 1C12B 1CU4L 3BGAA 3JWOL 2ORBH 3T0WA 2Z93B 2QHRL 1FORL 2CIIB 1MPAH 3L95A 3ZT7A 3EDFA 2A1WL 5ADOH 1YNLL 3MRRA 4DVBA 4OLXL 3OF6A 4YBLB 4GBXB 1X5JA 3MNWA 4JPKL 4WHCA 2EE3A 1QRNB 4HIEB 4JZOA 1IAIM 1IGFH 4JQXC 1G7HB 4YDVA 3MRBA 4QRPD 4NO0B 1NCTA 1YY8B 3SKNB 1MF2L 1MHPH 3QIWC 3T3MF 4ENEC 5GRJL 5DHYA 1BVLA 2R0ZH 2G9HB 5EZLB 5FDWB 4MAYA 4FQIL 1LP9E 5E4IA 3FT3B 4KI5E 3WD5L 2X4SA 4JFDB 5IB1A 1Q72H 2LAGB 1GJIA 1HILB 4JQVA 1JGLL 2DIAA 2HLAB 4XNQA 4NUJB 1N3NA 2FJFA 5L2JB 3K8LA 3QEGH 4IS6B 2YN3A 1ES0A 3TJHD 1KPRA 5DEFB 3VWKD 4JFOA 3RP1A 2JCCE 4HGMA 1QEWB 4ZUTB 3IVKB 4FQLL 4LSDA 1RJYB 2VXVL 1WFNA 2VLJA 4UT6H 5DRWB 1U8QB 3O6FC 3OR6A 1J1PL 4Z76B 2PYFA 4QRUB 1FSKB 5B39G 2Y7QB 1K8IB 2I07A 2PR4L 4YEFA 1T5WA 2ATPB 3V7AG 4EUPG 4M6AA 4P2YA 5DJAB 3W0WB 5EWIH 3SKMA 1RU9L 7FABL 4R3SB 2MPAH 1RFDL 5CEZD 2I9TA 5K9OB 3D85B 4JY6A 3T4AB 4P5TD 4XMPH 4NRYA 1MCQA 1GGIH 4I48A 5TGBA 1KNOA 2ZWLT 4FFZH 4NQXB 5SX5H 2DWEB 3O4LD 1R5WB 2BSED 4GRWH 2MCPH 4HAGA 2NW3A 4PRAA 5CBEB 3L7FB 3PE9A 1XF2B 2VAAA 4RNRA 5FYLH 2BERA 3UO1H 5D7IB 1EFQA 4X8XA 1JGUL 1U91B 3LVEA 4WNQB 1R3HA 5GGQH 4DGYL 1YEKL 4D0DB 2FD6L 3C5JA 3VD7A 1HIMH 1DE4B 1EZVX 2Y23A 3HC0B 3VG9B 1QFUH 1T04A 3TPUA 4R2GD 1MRFL 1R0AH 4K23L 2VXUL 4EI5B 5HPOA 4UNTA 3SDAB 3DURA 1KEMH 1S78C 4OZHF 5IGXL 2WIMA 4QRSA 3OG6B 4YK4C 5DJ0A 3LZFH 1NC2A 2O26U 4I18C 4MHHI 4ELMB 1RK0A 1JPGB 4PJFF 1KCVL 5CILH 1EGJH 4QO1A 4XPFL 4RGND 1ORQB 3PGCB 3RU8L 4I3GA 3PG2A 3GB7B 1OTTD 1DN0B 2YC1A 3LKSB 3QFDA 3JUYA 1RZKC 2AK4B 2SEBA 4ODBD 4YQXL 4UUJA 1LK3L 3ILPA 4PJCF 2NY0C 3EOAA 4XC3L 5HDOA 3MJ9A 5CIPB 1WV7T 3D5OF 3FO9B 4D9LH 5LAXB 3VXMA 5KBNC 4XC1L 2B1HL 2CIKB 2BNRD 3OJDA 1Q0XL 4LCUA 5J1TC 3V7AE 3ZE0E 5HD8D 4NNPL 4YHLH 3MXWL 1KB9J 2YK1H 1NFDE 1KCUL 4RDQG 4WV1C 5BXFB 5DMYA 5DC0A 2P5WD 1W0WB 2VABA 1MWAH 2VB5A 4KK5D 3T4YB 1CZ8H 1UZ8B 1XGYL 4WFED 4JFXB 4G6KH 4JG1L 1VFAA 2AXGB 4FQXD 5BOPA 1C08A 1CL7L 3VFSA 4KRPC 4O02L 1U8JA 4OJFH 4P48A 4W68A 1CLOH 4ZQKB 5JUEL 5KANG 1KTRL 4LAQH 2VH5L 3O4LE 1W2KT 3JUZA 1BFOB 1JTPA 2V9QA 5KSBB 1R5IA 4LVNB 2E27H 5TE4H 5FO9A 2AEPH 3BPCA 3HE6A 1NAKL 4XCEA 4K9EL 3NABL 1FP5A 1EHLH 3WIFA 1ERNA 3IJHB 3F7VA 1KB9K 3EO0A 5D6DA 4PJ9C 4N0UB 1U8HB 3KXFB 1FG2A 5DJ6A 2AV7A 4Z7UF 3BGFB 5DD0L 5I18L 3WIIH 2XPGA 1R3KB 3VXOA 4RISL 2NY5C 4OCWH 3IU4L 1TJIL 2QTEA 1ACYH 4YR6A 4R26L 4R8WL 1CLZL 3LY6A 1KLGB 3GZKA 1YEDB 4JQIL 5HYJD 2ESVD 4RGNE 5FUOH 2BNUA 3O6LL 1PYWA 5DQDH 4CMMA 4J3VA 3VXSA 1T2QL 1NPUA 2UZIH 1N5YH 5D71H 4MWFB 5TDNB 5GS1C 4WUUA 3F12B 3EDKA 4ZFGL 3QIUC 1FL3B 4LPCA 4FZEL 5KVFH 5BRZB 5I1LA 1WCBA 1INDH 1ADQA 3O8XB 2BNRE 1RK1B 3FL7A 1NCCL 2OSLA 4LHUA 2WUBH 5IR1A 1YC8A 2DLTA 3VXPB 3CSGA 1QSED 2YD3A 2D7TL 1S7VB 1CQKA 2EKSA 5D1QC 1IGTA 3IFOA 4YHPA 2IPUK 3WNKA 2BY2A 4HGWB 4MLSA 5LGHL 3Q1SH 3PGFH 4U1LB 4PREA 5IFAH 5DMIL 1HHIB 1M05A 2MQCA 3L9RA 3MRFA 3NIDF 2EYRB 4WO4A 3SKOB 2DLIA 5HHXL 32C2A 4OM1L 3GKWH 2Z35B 3TYGL 5IB5A 4PY7B 5BMFH 1I1AC 1J87A 2WBJA 3VGAC 4HPOH 4Z0XA 2YA0A 4L3CA 3KJ6L 4LKXB 3KJ4C 4W6YB 2R2HA 1FVCA 4NGHH 1OWWA 2ED9A 1NLBH 4OIIL 3UBXA 4AEFA 1FNLA 2Z0BA 4Q6YA 1YEHL 5E99L 4JGMA 3TJEL 3QIBA 3RWFB 3DBXB 2H1PH 1TVHB 4EN3D 1NGXB 3SDCA 3IJYA 3VFPA 2X4NA 4QRQA 1NEZA 4NIKB 3C6LA 3QPQD 4PRBA 1LEIA 3VG0H 2F15A