3WEXA

Crystal structure of hla-dp5 in complex with cry j 1-derived peptide (residues 214-222)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
181
structure length
181
Chain Sequence
b'IKADHVSTYAMFVQTHRPTGEFMFEFDEDEQFYVDLDKKETVWHLEEFGRAFSFEAQGGLANIAILNNNLNTLIQRSNHTQAANDPPEVTVFPKEPVELGQPNTLICHIDRFFPPVLNVTWLCNGEPVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDVYDCRVEHWGLDQPLLKHWEAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC class II antigen
publication title Structural basis for the specific recognition of the major antigenic peptide from the Japanese cedar pollen allergen Cry j 1 by HLA-DP5
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 32
structure length 181
sequence length 181
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2013-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wexA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 3wexA01
2VL4A 1RZFL 2B2XH 3IDNA 3EYVB 4IRSC 3VFGL 1T6WA 1FLTX 2O93L 1GH7A 1BWWA 4OLZL 5CJ8A 4WFGD 2D7OA 3D39B 5ADPH 4TYUA 3VFOA 5IW1B 1FL6B 5F7EL 3CVIH 5E99L 3V0AC 5D7KE 3Q6FA 1K5NB 3MRPA 4JM2B 2AXGA 1RD6A 4J12A 4ZOAA 1MCFA 5F7HA 1JFQH 3REWA 5TDNB 2VKXA 3VXNA 1CLZH 2DQEL 1S7UB 5DVLA 4DZBA 3QXAB 3TO4C 2AV7A 4L8SA 2D9CA 5CFHA 1LNUA 4PJIB 4U05A 4NBXB 1AGFA 2IAMC 3N9GL 3UBXB 1I8KB 5EG6C 1NBVH 1WT5A 1ZTXL 1C5CL 2EH7L 2BFVH 3QUXD 5HI5D 5GS0H 3C2SA 3QUYD 5C0IA 3RL2A 1MLCB 1FJ1A 2R0WH 3HS0B 3QUKA 2BNUB 4F15B 4QRUB 2AK4A 2DQFA 4QF1A 4DW2H 1C12A 3CLEH 5CJXA 1JNLL 4JGMA 2EKJA 1FZJA 4P3DB 3QPXH 3U0WL 3WE6A 5EBMA 3EDFA 2D7PA 1LO4H 4X9IA 3F7YA 4JKPL 3KYNA 4XC3L 1MFBH 3T3ME 3SCMC 4PD4K 3V8CA 4YDIH 3VH8B 4J3SA 2AS5M 1BLNB 4LSTL 5FUOH 4MS8D 3S97C 1VACA 3DX7A 3LEXB 1FVCA 2VN7A 1J9CT 5FYJL 1F4AA 2HH0L 1XCTA 4PGZA 5HVGB 3DIFB 4F8QA 1S7WA 3REVB 5D6CA 3LOWA 4GXUM 1OD9A 3KYKL 4LVHC 3SKMA 2P5ED 3H3KA 4E5XA 2V7HB 1X5XA 4HH9B 4P5KA 4O2CB 3TBSB 5K9KA 4U1IA 4GRWB 5IVZA 2VLRE 3QNZA 3UZEA 3MLXH 4Y5VB 2LTQB 2A6IA 2R56H 4L29A 3H42H 4F8TA 1B6DA 5T33H 3MJ8A 5I76A 1IGJB 4YXLH 1H9VA 3MOQA 4OSUL 4EZMA 3EYVA 4MB3A 1RZJL 4B5EA 1CGTA 1YQVH 1T83A 3D39A 4Q74A 5SV3A 5IW1A 1DZBA 1FL6A 3UJJH 5IT2H 3WIIL 1FYHB 1R0AL 1K5NA 3HZYB 5I1IH 1WGOA 3HRPA 4JM2A 4XP9H 3ME0A 1SJEB 1A0QH 4JHAH 2NY1D 4XBGB 5TDNA 3MCLH 4GAFB 3GKZA 3UAJC 3JVGA 1S7UA 3QXAA 1UJ3B 3VFUA 3L3IB 4PJIA 1P7KB 1G9MH 3UBXA 4Q0XH 1I8KA 4UINL 3P9LB 2QV2A 3QCUH 1KPRB 4OCSH 4PBWD 2NY7L 4OFKA 3NTCH 1TNMA 1MLCA 5CMAB 4JFEB 5KW9H 4PJHE 1RY7B 3HS0A 2AERT 2BNUA 3M8OH 1F3RB 1JJUA 3BDXA 4QRUA 5GZOD 4PJ9D 4UBDC 3GRWA 2AK4E 3D0VB 3EYOB 1BFVH 1ZA6B 2CPCA 3PGFL 2J4WH 4YHKH 4XBEL 1O5DT 4P3DA 3QCTH 2DQHH 2AJVH 3I2CL 3RFZC 1INQB 3MO1B 1T03L 1UFUA 5IHUL 3UYPA 4K71C 1FNHA 1MAKA 3ZHLA 3VH8A 5E2UL 5B8CB 1BLNA 5FEBA 1I3GH 3KHOA 3C9NB 3FMGL 3LEXA 2GHWB 3H9SD 1T1WB 2DD8H 4M6ML 4EKXA 1IJ9A 3DIFA 3B9VA 1AO7B 3REVA 3RVWD 3L5XH 2EEBA 1PJ9A 2AJYL 2V7HA 4HH9A 1NGPL 1RQ5A 3G6AB 3TBSA 1IGIH 1FFPB 1JTTA 2J8UB 1QA9B 1OARH 1IAMA 4CVUA 3NAAL 4Y5VA 3EHBD 4GXUN 1XGUB 4L4VB 1YEHH 3S9DB 1IGJA 2X41A 4UDTA 2ICEB 4XB8A 4Y0GA 5IEHB 1OT1A 1JP5A 4ZUSB 3H9YA 5I17B 5T3ZL 1CGSL 4FQXD 4HK3J 3D39E 3TVMC 3HZYA 1IGFL 3I6LE 3KPSE 4AEIH 4NHUA 1SJEA 3BJ91 3VD9A 3AS3A 1DLFL 4XBGA 1T6VN 3WNKA 4UDUB 3T04D 1EEZB 4XCCL 3RVUC 1UJ3A 5EA0L 2WZPD 5BS0B 3L3IA 3MXWH 4YHIA 1P7KA 4PJIE 4G6AD 4YQXL 1JIBA 5E6ID 3P9LA 3MV9B 4KTDH 5GHWH 1YDPB 4HKJA 5GRYA 5CMAA 4JFEA 4RFEB 3SE8L 2WUCL 3HB3C 4OCXH 2FR4B 5I18L 2XTJB 3M1BB 3SQOL 3UROR 3QZWB 3LEYL 3D0VA 3EYOA 4PJ8B 5D8JH 3NIFF 1ZA6A 2C3WA 4NZUL 4OBSA 4PP1C 2OTWB 2WSKA 3NCBB 4MA8H 5DT1L 5F9OL 3BPNC 3FAWA 4V1DD 2VDMH 5FK9B 5DI8B 1K9TA 3S7GA 2DJ4A 1INQA 3MO1A 4JHZA 1RMFH 4M4RA 5BV7C 4KRNA 3BT2H 5JIPA 3PL6B 4WI6A 4LFHG 3HE7C 2W9EH 3OKMB 5B8CA 1U95B 2FLRT 1RUQL 4K9EH 2F58H 3C9NA 4YBQD 4HGKC 1OSPL 1GGCH 1I8IA 5D9SB 1T1WA 1JVKA 4EVNB 2LAAA 1FCCA 4MQTB 4PRHD 4N8VB 3BD5A 1AO7A 5CBEB 5HSFA 3MOBL 2NX5B 3MA9L 1CE1H 5GJTL 3G6AA 1FFPA 2J8UA 1CDGA 3W0WB 1QA9A 2K9UA 2LU7A 5DGRA 3VD7A 1XGUA 4MJ2A 4L4VA 1GGBL 2VDNL 2XIDA 2IPTL 2ICEA 5IEHA 1OSZB 5LAXB 3MV8D 3OF6A 3E8UH 3O2VL 4ZUSA 5IROC 5HYJB 5I17A 1RU9L 2DQDH 1R3IL 1XF4B 2ZUSA 4NYLB 5TE7H 3ZT5A 3IS1X 3QRFM 4X6EB 1QRNB 4I9WE 4JQVC 4JPKL 3WKML 3HRZB 4P9MH 5J1AB 5J1SC 4QHNB 1C1EL 2YA0A 5IMKB 5SWQB 1FC2D 3GBNL 4UDUA 4XAWL 5JHDE 1EEZA 1U0QA 1UACH 1AGEB 2C3XA 1UYWH 3DROB 4G9FD 5BS0A 3C6LD 5C71A 5TF1L 4DN3H 1Y18B 1VGEL 2OS7A 2H2SC 3STBA 1A5FH 1V7MH 3BQUC 3TYFB 1YEKH 5ALCL 4J2XA 3MV9A 4HIHB 2WM0A 5DEGB 1T89A 2GQHA 2R4RH 3LZFH 4RFEA 3OKKB 3S36L 4XTRD 1S8DB 1X5IA 3BN9D 3JXAA 2FR4A 4JFEE 3NCCB 3M1BA 2IBGA 4OM0L 4MZ3A 2CIKB 3QZWA 5FYKD 4PJ8A 4DOHB 4F37F 3QWQB 4NKDB 1TLKA 4MNQE 4R26H 3HTLX 3D6GA 2OTWA 3ARPA 2B1HL 2VXQL 5AZ2H 4MZ2A 2JIXD 5DI8A 1F4WH 5HI3D 2VH5H 2E7BA 4JRYB 3TIDB 3VH8G 4ODTL 4NC2B 3PL6A 3OKMA 4EXKA 1EGJA 5INCB 1U95A 2EXYD 5JOEA 1PY4A 1TVHB 2WP3T 1T21B 3G5ZB 3SHSA 5CINL 5D9SA 4EVNA 4N8VA 2VLKB 3AC0A 5CBEA 3MXVH 2NY4D 4FZEL 2NX5A 1WAAA 1AO7E 2AJUL 1GVIA 1RVFH 2GTZB 3PQYD 2E9JA 2FZ3B 3W0WA 3HMXH 4GOSA 2X1QA 4PREB 35C8H 5K9JL 4I3RH 1X44A 2J8UE 3PUCA 3GSRB 4HK0A 1XF1A 2J8HA 4RBPH 2ZCLH 4D94A 1QBLH 4HAFA 4XP5L 5HDQL 1OSZA 1FNFA 5LAXA 3QRGL 2P8PB 1XF4A 1OCWL 2ZKHL 1UH2A 4UAOB 4NYLA 4I18B 1J0YA 4X6EA 1QRNA 1BZ7B 5LXGL 3RPIB 4QGYA 4WW1B 2R0ZL 3HRZA 5T3XE 3S34H 4QNPE 5J1AA 1FVDB 4QHNA 1ZT4B 5D2LA 1DQTA 5IMKA 5SWQA 1LO3L 4KROC 3BRFA 2O26U 5SV4A 1H3TA 3I84A 3DROA 3ARFA 4F3FB 3K3QA 1BQUA 3WIHH 1Y18A 1I75A 4M6NL 3U7WL 3I50H 5BS0E 3TYFA 4DK3A 4HIHA 4LAQH 3O2DH 5DEGA 3RKPA 2L4OA 3MV9E 3C5JB 1RIUH 4PYHA 1C16B 3OKKA 4HULB 1AQDB 1S8DA 4O02H 2X44D 3MV7A 1ZLVK 2ZSWB 3W5NA 3RDTD 5GRWA 4P23B 2CIKA 2XTJE 4J6RH 4KRMB 4NKDA 4XAKD 1KJVB 2A2QT 2NTFB 1FIGH 1G6VK 3ZTNH 1YEFL 3VU2A 5H35B 2GW5A 3SDDD 1UM6L 2YSSB 2FATH 4JRYA 3TIDA 1UWGH 4PJ7F 1Q0YH 3GI8L 2GJ6D 4G8GB 4ONHA 5F44A 1CI5A 4GSDL 1EDQA 5CEXB 1GC1H 1H3PL 1QLFB 1A6WL 4JQXA 2NNAB 3MLWL 1TVHA 4LCYB 2ZOKB 5FA3B 4LNVA 1T21A 3G5ZA 1SBBA 2HT2C 4NWTH 3LB6C 4I13B 2JELH 4DKAA 4L3EB 4IRZH 4P4KC 5GS0C 4OGYL 1PEWA 3S88H 3EO9H 4IM8A 1EA9C 2GTZA 3RWDB 1JGVL 4BZ2H 5L2KB 3MROB 2FZ3A 1Z2KA 1HHHB 4D2NA 4PREA 1A2YB 2BY1A 2A0LD 1IAIL 2E6QA 3GSRA 4TTGA 4ZTOL 2H9GB 4JN1L 2CLRB 2BVOB 4LSDA 4Y5YC 1F4YL 5GQBA 3KHQA 4F7EB 3MJ9H 2UUDH 3RHWF 1MCEA 2P8PA 5HYJE 3C60D 2PXYB 4IRJA 1JZ8A 4I18A 4NZDA 4CJ1A 3HKFA 1P4BL 5HYIA 1BZ7A 3RPIA 1CK0H 4WW1A 1QRNE 1OT2A 1N3NB 1FVDA 1D5XB 1ZT4A 1F2XK 1ZOXA 4LSPH 5C0RH 3WFDL 4CMMB 3BH9B 5MP6H 2QADD 3MACL 2H1PH 5E2VL 1AI1H 4F3FA 4B50A 2IFGA 2F5BL 4LRIC 4ORGB 5J3HC 2DBLL 5F1NB 3HMWL 2V17L 3VMPA 3RWHB 1UCTA 1A3LL 4LIQH 4R9HA 3G5YB 3C5JA 4X6FB 4HHAB 4K2UL 1C16A 1ONQB 5CJOL 5IMLB 1T2JA 3FO0H 5CCKL 1Y6NR 1AQDA 5K9QG 5LQBH 5IOPB 1MJ7H 1UEMA 3QZWG 2NY2B 1YA5A 4JO1L 2ZSWA 3V5HB 1S9WB 4OGXL 4IOFD 4Y5XC 1NMCB 4P23A 3VWKC 1ACZA 1KN4L 1NGXB 3QHFL 7CGTA 3P4OB 3T0WA 3O8XB 4DOHE 1KJVA 2NTFA 5GGVH 2Y36H 3KXFD 4OGAD 5H35A 1EFXB 4XP1L 2FO1A 1R6VA 2YSSA 3ETBF 5F89B 3QEGL 1RZ7L 5AZEL 3TBTB 2QBWA 5IQ7L 4G8GA 4HCRH 3P73B 2Y07L 5F97E 5CEXA 1NCTA 3K1DA 1QLFA 2Y25A 2RGSA 2NNAA 1ZHLB 1DFBH 3EGSB 4LCYA 4KKAD 2ZOKA 3E0GA 5FA3A 3QFJB 4XNMB 5ICXB 4HW6A 4HEME 5SWSB 4N8VG 1MSPA 3CK0L 4X9BA 1BMGA 4L3EA 15C8L 4HH8A 1ZK9A 2YMXH 2VLKE 3P9MB 1MCOH 3GKWL 4M93B 3RWDA 5L2KA 4O58L 4D9LL 3G9AB 5D93C 1A2YA 3O3AB 3Q48A 2Y7QB 2BZDA 4OV5B 3U2SB 1DQJB 1IC4H 3T2PA 1TJHL 5ALBL 5L0QB 3S3SA 2CLRA 2BVOA 1EBPA 1S5IL 5FYJE 5JIHA 1ZT1B 4F7EA 2DKUA 3J7HA 3P40A 1F4HA 3OX8B 3S3JA 2BRRH 2PXYA 4C56E 1BPVA 3QQ9C 4QLRA 5JXAH 3CFBB 4WWKA 1X5HA 3BRGC 4HWZB 1N3NA 4LAJH 3F6LA 1D5XA 1FG2A 1FORH 1N59B 4CMMA 3BH9A 2OI9C 4Y8DC 4LCCB 1PVHA 5E7FA 2E7CA 2LVCA 3EDJA 4UUJB 3VG0L 3ZHKA 4ORGA 3QDAA 1VADB 1T66C 5F1NA 2FB4L 1IAIM 3RWHA 3JTTB 1MIEH 4OI9A 1HCFX 2V9RA 4X6FA 1I85A 4HHAA 1ONQA 2BNQE 5IMLA 4GMTH 2LE9A 4P46D 1NKOA 1T2QH 5IOPA 1E0OB 3V5HA 2VDRL 1MFNA 1S9WA 3OPZL 5GRUL 1NGXA 4PRIE 3P4OA 1JGUL 3O8XA 4XPHL 2VZ3A 5EBWA 3F5WB 5L7XL 4KVNH 1MFDH 1EFXA 4K3EH 2Q8AH 1JF1B 4Y16C 2YPVL 4JQIL 4UILL 5F89A 1P5UA 4NSKB 3TBTA 2JF1A 4WI4A 3BOVA 5LBSL 3BN3B 3NFPB 3P73A 2QQNH 4NJ9L 4WFHE 4G8GE 1ZHLA 1JHLH 3EGSA 3WFEL 4WV1C 1Q72H 3DWTA 4XNMA 5ICXA 3LCYA 5HHOB 1AHWB 5SWSA 1NCNA 1HINH 1DDHB 4YBLC 3CCHB 4KMLB 3RTQB 2APFA 2E7HA 4XCYB 3IXTB 4L3EE 3P9MA 1I1CA 2ERJB 4NBZB 3ESUF 1AC0A 3C8KA 1QYGL 1JRHH 3ARQA 1A7BA 2X4SB 5L2KE 3O3AA 4GH7B 2Y7QA 4OV5A 2VLLB 1GPOL 3U2SA 1DQJA 2PO6C 4HIIB 4QTHB 1AR1C 2R15A 4U2ZA 3PP4L 2VITB 4MHHI 3RAJH 1ZT1A 4IS6B 4KFZC 1UENA 1RJLB 3OX8A 3MBEC 5DD1H 2JLLA 4TSCH 4K55A 4ZQKB 2WMPA 3QDGD 1KENH 3CFBA 4K9EC 3S35L 2NZ9C 3RY5A 1LEGB 4HWZA 1FLRL 4MJ5B 3DUSB 1L6ZA 5DA4A 5F7WC 4XMKL 1EVTC 1J8HD 2UZYB 1IM9D 4DTGH 4ESKA 1N59A 2NYYC 2DQTL 3K74B 4LCCA 1E6JL 5TQ2L 4IOIB 3MREB 3OGCB 3IDMB 5EU7C 4A2MA 3Q5TA 1CICB 4S2SB 4YUEL 2B5IC 2CJUH 5JUEL 5T3ZE 3G08B 1KELH 3JV5A 3OKLA 3OKDB 4NRYB 4X6CF 1KBGH 3RVVC 4ZAKB 3VXRB 1IC5L 4DJMA 2V2XB 1H15B 4NFBA 1UXWA 4MB4A 3HE6D 4K94H 3MLVL 1ZLSH 5INDB 2D0HA 2MMXA 4XNXH 2YPLD 3F5WA 3TBYB 1S5HB 2IANB 1WWWX 2Y6SC 1XR8B 1T0NB 1JF1A 2EC9U 2A9ML 4AH2B 2IQAB 4NSKA 5D7IF 4GRLC 1CD9B 5E9DB 5L8LB 3NFPA 4YHPB 3GSQB 1CD0A 4R4NC 5GIRB 3ZKXB 3I02B 4K8RH 4MXVF 5BCAA 5HHOA 1RUKL 4JR9H 3QFJE 4Y4HD 1DDHA 3AM8C 4OIBA 1PZ5B 1Z9OA 1OW0C 1GGIH 2VC2H 1FGVL 3IF1B 5SWSE 5I1CH 1WWCA 3CCHA 3RTQA 3P77B 5D1XC 4XCYA 4V2CB 3GHEL 3IXTA 4R0LB 4JVWA 3L5JA 3GUTB 1X7QB 1FH5L 2AEPH 4I0PD 5I1JH 2X4SA 2AQ1A 3LN4B 1C5BH 2IGFL 2VLLA 3HI5L 1JGLL 1FQ9C 4HIIA 3SDYH 4QTHA 4KDTA 3HHRB 2VITA 2ESVD 3IFLL 5C2BL 2NY3D 4L9LC 4XPTH 1JPGB 4IS6A 3MRNB 4HJGB 1LP9F 1RJLA 2HFFB 3SE4A 5KZCB 2Y72A 4ZQKA 2CUHA 2A6DA 2HJKB 4NRZB 1XT5A 1MNUH 1LHZA 5LJYH 1JTPA 3VFTB 4MD0B 3G04A 1XCQB 4QKXB 3DUSA 3SDAB 1M71B 3ZT7A 1NLDH 3NH7H 5J06A 4XNUL 3BUTA 1U91B 4HXAH 1CFVH 5KN5B 4QRRD 4IOIA 3MREA 3OGCA 3IDMA 5D6DA 5MHSD 1CICA 4S2SA 2N56A 2Q3AA 2Q6WB 1MJJB 4OCRH 3G08A 4M8QB 4URTB 4ZUUB 4R96B 4NRYA 3OKDA 4YPJA 3FFCD 5DJ2B 2QR0B 2AEQL 3DMMD 1I3UA 4PV8B 4ZAKA 3VXRA 2X9WA 5CLTA 4JG1H 2IPKB 1TDQA 2V2XA 1H15A 2R0KL 1A4JB 5DMIL 2EC8A 5DVKA 3MUHL 1C8PA 3IJHA 5INDA 4KHTL 5GRJL 1YNLH 1ZANL 1UH4A 3TBYA 1YC8A 4P9HH 1S5HA 4YE4L 2IANA 4Q9QL 4WO4C 4E42B 1INEL 1T0NA 4LOUC 4AH2A 2IQAA 1G1YA 4S10A 5E9DA 3BP7B 4EIGB 3VE0B 3DVFA 4KHXH 4YHPA 1J7VR 1SHMA 3GSQA 1D5ZB 4QXTB 4KK5D 3V0WH 3WN5C 3I02A 3Q2CA 3W11C 1EHLL 3OL2A 4KZEH 1D6EB 2FLBT 3VA2C 2BC4B 2AK1H 1PZ5A 5JIKA 3D85D 4OCYH 3IF1A 4WEUD 5KVDH 5IWLA 3P77A 3TF7C 5FYLD 4JHWL 1EO5A 2D0GA 3X3FH 4R0LA 4OCWH 3V95A 3SJVB 1PZUB 3GUTA 1Q94B 1X7QA 2VSDA 4PG9B 1N5YH 2YD4A 4HWBH 1ZEAH 1VPOL 2X7LB 3LN4A 3MLSH 1DBMH 2BDNH 3QNXB 2CDGB 1YEIL 4XPAH 5I30L 5LWYH 1JPGA 3BKMH 3B9KB 4NN7B 4OUOA 3IVKB 1CVRA 3MRNA 4HJGA 3U1SH 1FG9C 4DGVL 4YXHL 4YBHA 4OJFH 2HJKA 3ARED 4K07A 2DKMA 3SDCC 1GC1C 4NRZA 2E3VA 4N9GB 4Q9RH 4X8JB 1KCRL 3VFTA 3LIZH 4MD0A 1IEHA 4QXGH 4WDIB 1E27B 2X4UB 1XCQA 2EICA 5DFTA 3CIQA 3SDAA 1M71A 2HKHL 4HXBL 5EC1B 3WXWH 1U91A 4R90H 5KN5A 1WZKA 1FVEB 1Q0XH 2EDKA 4AG4H 4H20L 4PJBF 2Q6WA 3V7MA 1NAML 1MJJA 4F37K 1RJYB 3FKUS 4APQB 3FB8B 4M8QA 2RR3A 4NQCD 4ZUUA 4R96A 1S3KH 1LDSA 5DJ2A 2QR0A 4KUCF 3NIFE 1BWMA 4Q6IC 4PV8A 1F5WA 3O6FC 1FGNL 4JY6B 1PG7X 1TETH 4WU5B 2ZZUT 4PJ7B 1MQKH 5ILTH 3O11B 1LO0H 1LD9B 2MJWA 3IDJB 3AMKA 2OJZH 4PLKC 1NFDF 5CEZH 5GS3A 4O00A 4E42A 2W07A 2FBJH 3VRIB 4RWHA 1MF2L 1P4IL 5GRXG 3U9PL 2FX8L 4N5ED 5IK3B 1F6AB 2DQGL 2GI7A 4OD1H 3BP7A 5TE6L 3VE0A 2R2CA 1BBDH 5I8CB 3BSZL 5SX4H 4HFUH 3RWJB 1J87A 5E9DE 1G1CA 1D5ZA 4QXTA 3M17B 2FBOJ 3O81A 4BSJA 2O5YH 4K3DH 3NCFB 1D6EA 2BJMH 1FCGA 3MRMA 2VL5B 3SY0B 5H37H 2FEEI 1IRAY 4JKWA 2FO4B 4I3SH 3RZCD 4Y88A 2W9DH 3MV01 4M7ZC 1Q94A 4PG9A 3OAZK 4I77H 3MJ6A 1W8NA 3PE9A 5BW7C 2RCSH 5IVXF 2N7AA 3FONB 2X7LA 4UQ3B 5GSRB 3TZVD 1MCKA 2VSCA 1MUJB 3O6LH 1IL1B 5LCVH 2ARJQ 1J0ZA 3QNXA 2CDGA 1P9MC 1NC2D 4LVOB 1HSBB 3QUZD 3ZKND 3B9KA 1CE6B 4XNYL 3IVKA 4TN9A 1LEIB 4M61B 3GSXA 3IDIB 3HNVL 5I16B 4P4RB 2VR4A 4Y19B 4FA8A 3QUXC 3VD5A 5GGSY 3L7FB 1G6RH 2RAMA 3QUYC 4N9GA 5C0NC 4X8JA 4U3XA 5ENWB 2R0LL 5A43C 4WDIA 2X4UA 2QQKH 3QBTB 2YRZA 4GFTB 4J3TA 5EC1A 5IB3B 3GJFB 4IRSB 4MAUL 4RGMB 3N50A 4RQQB 1FVEA 3QCVL 4TSAH 3CZJA 5MEQB 4UNVA 4PB0H 5TH2B 1PX3A 2Q7YB 3RWEB 5MENB 5D7KD 2J2ZA 1RJYA 4APQA 3FB8A 4DEPC 4PJGF 2ED7A 3ZTJG 1DVFC 1FRGH 1TNNA 4HPOL 3DGCR 2EDXA 4JY6A 3VG9C 4MS8C 3TO4B 1WEJL 4WU5A 1ROWA 2WQRA 3BPLC 4HUUB 4PJ7A 3O11A 1BF2A 3TA3B 2EIZB 3VXUB 1LD9A 3IDJA 4LLVB 3NFSL 4G8IB 1AY1H 5EUOF 4KY1L 4LLWB 1IEAB 3VRLE 2YN3A 3VRIA 3LAFA 4HGMA 5IK3A 1F6AA 3C87A 4MQXD 5I8CA 4YPGB 4OCNC 3IGAB 2NY5H 3MGOB 4RMVA 2DJSA 5HPOA 3TYGL 4Q6YA 3M17A 2XNAB 4HKZB 4TNWK 1MCIA 4P59L 4Y4KC 5HHME 1U2CA 3NPZB 2I60H 4DGYH 4F57H 2WAHA 1QNZH 2P5WD 2VL5A 3SY0A 3BE1L 1N4XH 3SCMB 4EDWL 4JDZB 4XNZB 2PYEB 4X4ZA 3SJVE 1DP0A 1OGTB 5FM4A 3THML 4PJFB 4UQ3A 4MA7H 5GSRA 5JMRA 4FQJH 4NFCA 3K46A 1MRDH 2P47B 1MUJA 2YOCA 5IR1B 1IL1A 5IGXH 2J1KA 4YX2H 1HSBA 1PG7L 1CE6A 1TJGH 5TQ0H 4FQ1L 1J86A 1T7YA 2HLAB 2B4CH 4LK4A 4M61A 1LEIA 1MI5D 1ZHBB 5GJSH 3IDIA 5T1DH 1CR9L 1LEKB 5I16A 4KJPC 4P4RA 4Y19A 2VLRD 1S9KC 4JG0L 3L7FA 1NBQA 5ESVB 5ENWA 4H1LB 4F7PB 3PABB 1X9QA 3GJFK 4PJ9C 3NBNA 5EU5B 4IDJH 1I1RA 3MJ7B 3GJFA 4IRSA 5IB3A 5DZNA 1J5OH 4EEEA 4RQQA 5MEQA 1DN0B 4ODWB 2Q7YA 4M43H 3RWEA 5MENA 4EN3B 1CLOH 1CCZA 4NRXB 1WVZA 3I9GH 3BDYL 1JRHI 1D6VH 5HHVL 2E6JA 2B2XL 3MRKB 4U33A 1QG3A 3VDAA 3TO4A 4BFBD 5KVFH 3WJJA 4HUUA 3AS2A 4NT6B 2CK2A 2JJTC 4JREC 1FBIH 5ADPL 3TA3A 3VXUA 2EIZA 1K4CA 4PJ7E 1UXSB 3H0TA 3T3PF 3V5KB 4LLVA 4G8IA 4LLWA 3KR3L 1JGEB 1IEAA 4TULH 1QSFB 3RVWC 1CFNA 2J3SA 5KSBB 5CZXD 1JFQL 3NZHH 1UWXH 4UT6H 1CLZL 1OTSC 4YPGA 4AQ1B 1CXHA 1B0RA 3MGOA 3CVHH 3EHBC 2A74B 2ID5A 2AK4D 4HKZA 2XNAA 1FAIH 3RBGA 4MSWB 3MTRA 4UQ2B 5KSAC 5DVNA 3ULUF 1NBVL 3NN8B 2BFVL 4EXPX 1BF8A 3MFGB 1ZGLA 3BZFB 1OTUD 2E5EA 3PIQB 4JDZA 2R0WL 5F96H 5E5RB 2PYEA 3E2HC 1A6AB 5EZOH 5C09B 1OGTA 3U0PB 1I1AB 5SX5K 5C3TA 4DW2L 4CMHC 4K94C 4PJFA 4JO3H 4LFHD 5GGTH 4WFEE 5IHBA 4DWHA 1O7SA 1NBZB 2FEDD 3QPXL 4U0RC 5IR1A 1BP3B 12E8H 1LO4L 3HUJE 3WXVL 2HLAA 1E4XH 1ZHBA 4G6AC 4HC1H 1LEKA 1MFBL 4ODHH 2OSLB 4Y19E 5FUOL 5ESVA 1A7QH 2ICWJ 4H1LA 4LARH 4F7PA 5HBBA 3PABA 3TGXA 2V2TB 2CO7B 3WS3B 2Y5TB 4ALAH 5EU5A 1F6LL 2OJEA 4HIXH 1P5VA 4X6CB 2XG4A 4RSVA 5HHXH 5CHNB 1DN0A 2DQJH 4ODWA 2EE9A 1H0DB 3D39D 1FYTE 4EN3A 3NZ8B 4NRXA 3I6LD 1J0JA 1V05A 5MENE 3D3VB 1HHJB 1IKNC 2R56L 4JM2D 2F5AH 3H42L 3C6SB 1KB9K 5T33L 3IU4H 1XH3B 1WWAX 4YXLL 3DI2B 3MRKA 4YBQC 3RIFF 3QAZC 4NT6A 5D7IB 3B5HA 5I8OL 1MFAH 1MCHA 1VERA 3OKNB 3CMGA 5KVEH 2VDKL 4OM1H 2X5PA 3UJJL 5IT2L 1NAMB 3V5KA 3VXUE 5I1IL 1SEQH 4XP9L 1JGEA 3UDWC 3SKOB 1QSFA 1GCFA 2E7LA 5AG9A 5KSBA 1A0QL 4JHAL 4ZO8A 1FNAA 1BQLH 4Z0BH 4HBCH 2EC9T 3ORJA 2IBBA 5JZ7D 2A74A 1IFHH 4MSWA 1A22B 5FGCB 4UQ2A 2HN7B 4OAWB 1G9ML 4ELMF 1U42A 3BPNB 3NN8A 3QCUL 2EYTB 4OCSL 1NCAH 1X5GA 4YXKH 3VFWB 2YWZA 4KVCH 4YHYC 3NTCL 4K7FB 2XWBB 4JGUA 3BZFA 1NLBH 3B5GA 1W72H 3PIQA 5KW9L 1KIQA 1A8JH 1OTTD 4P2CG 3M8OL 1A6AA 5C09A 4ONFH 1UM4H 1WICA 3U0PA 1I1AA 4YFLI 2PYEE 5F6IB 3UJTH 1MCBA 5F9WC 4YDKH 4K7PH 2J4WL 4PJFE 4YHKL 5JMOC 1NBZA 3QCTL 3K1KC 5DYOB 2DQHL 2AJVL 4PY8J 5F1SA 4Y2DD 3C6LC 5MEOB 2C1OB 4S11A 5IHLB 2VDOH 5IB5B 2OSLA 3OWEA 2UZXB 1I3GL 5E2TH 4MJ6B 2V2TA 3OSKA 4XTRC 3BN9C 3WS3A 3FRUB 2Y5TA 5IESL 2DD8L 3QIWB 4X6CA 3L5XL 3GBML 4UOW0 1H0DA 1IGIL 2FIKB 3NZ8A 4I9WD 3HC0B 1VFOA 3D3VA 5HI3C 1HHJA 5CAYB 4JFZH 4HZLB 3C6SA 4HF5H 3ULUL 1YEHL 1XH3A 4R97B 2JKXA 5E2WH 5JHDD 4YH6A 1YNKH 3CSGA 2FGWH 4AEFA 3KS0J 1FO0H 5D7IA 3OKNA 1CLCA 5HGBB 4H8WC 1SMOA 4EI5B 4ZSOB 1NAMA 3W9EB 5I1HH 1ZA3B 4HJJH 3FQNB 3SQBA 3UPCA 4LGSB 3SKOA 2NY4C 3DUHA 2HJFB 2BY0A 3IKCB 5DEFB 2G5BB 1YMMB 1QSFE 4KK8C 5JQHC 3K8MA 4PPTA 5DJZB 4JFED 5KSBE 1DN2A 4XNQB 1I9JH 4BSWB 4MNQD 4YDJB 1DUYB 3PWUB 4OAWA 3PWPB 3DETD 4KTDL 2VXTH 4FRWA 2EYTA 5C9JB 4J23A 3IJYB 3VFWA 5IFAH 1DJSA 1DQMH 1J1XL 4K7FA 4RA3A 2XWBA 3SKNB 1G9NH 5EOTB 3KS0H 3A6BH 1N0LA 5GGVY 1BFTA 3SN6N 4OCXL 2WANA 4KV5F 2ZJSH 3LSOA 4KKNA 5E4IA 2EIEA 4ZOBA 1ZT7B 4ZFOL 1LP9A 3AROA 1CTOA 2B39A 5C09E 1MRFH 5D8JL 4MJIE 2N4IA 4FQXA 2Q1EA 2HT4C 2V5YA 2ZG3A 4G7VH 1MQ8A 5DYOA 4G3YH 3JWOL 1B2WL 4MA8L 4QEGA 2FSEB 2VDML 5GGRY 2BNRE 5C6TH 4ZUTB 1EMTH 4EQ3A 4KJWD 1AO7D 5MEOA 4JZNB 2JJVA 4QXWA 2C1OA 5KOVC 3BT2L 5IB5A 2W9EL 3EW3B 2IC2A 3DRQB 4H1LG 1X3DA 4K9EL 2F58L 3DLQR 5SX4I 3PF2A 2X6MA 5JXEC 4MJ6A 3BIKB 4CVWA 1MOEA 2J5LB 1GGCL 4N1EA 5B39B 3FRUA 3QIWA 3KPLB 4ISVB 5KSUB 5EZLB 5IROA 3SGEH 3OF6D 4X6CE 3ULVH 1DQLH 3U4BH 3S37X 2OP4H 5ITFA 3HC0A 4HLZH 4X8XA 4BSVB 3EYFB 2K3TA 3P0VH 3D3VE 4HZLA 1A3QA 1CLYH 1NFDB 1TQCB 4FQPA 2V5SA 2KPNA 4AIZB 3VGBA 3SDXF 3MGAA 3MODH 3E8UL 1NCDH 4LBEB 3OJVC 5KG9B 1MCRA 1XR9B 3UYOD 5FO9B 1BBJB 4WHYH 5BS0D 3BP5B 2DQDL 5HGBA 4EI5A 5C8JA 5D7IE 1NAKH 2H41A 4ZSOA 5TE7L 3W9EA 3AVEA 5C0BE 3FQNA 4EQ2A 4QOKE 3MV9D 4YGAB 3CLFH 3K0WA 3KJ4B 2HJFA 3IKCA 5DEFA 2G5BA 1YMMA 4DFIA 1XF2B 1CQYA 2VQ1B 3RU8L 4MXVE 3V9FA 2DM2A 5DJZA 3QDJE 4IMKA 3QQNA 1UACL 4Y1AE 3OG6B 1DR9A 2A0LC 3DHJA 1T0MB 5J12C 2CLVB 2XTJD 4XNQA 4BSWA 1H3UA 4DN3L 4YDJA 1DUYA 3PWUA 4PJ8D 1A5FL 5DK0B 5IVXB 1YEKL 3PWPA 5FGCE 1CXIA 3QIBC 5C9JA 3UC0H 3IJYA 5TE4H 4OZIF 1JF6A 5LGJB 3SKNA 1CU4H 5EOTA 4YLQT 3C60C 2R4RL 5MI0C 3LZFL 2BOBA 4A6YH 2YWYA 3PL6D 4Z6AT 1ZT7A 3NGBC 3PP3K 1GL4B 4R26L 3WFCH 4PJCF 4NM4H 3S4SB 2FSEA 2XICA 3D9AH 1F4WL 2YD9A 3GMOB 4ZUTA 1MEXH 2VH5L 2CKNA 4LSUH 4JZNA 3WBDA 1V7NH 3MSPA 2NX5D 3VXQB 2NY5C 2MOVA 4R2GC 3DRQA 2CKBH 1L0QA 4S1RH 3BIKA 2IMNA 1IT9H 3P4MB 1IVLA 5B39A 1ZLWH 4PJGB 3KPLA 4ISVA 4AZ8A 4X83A 5KSUA 4IOFC 5EZLA 3WDIA 3MXVL 1U9KA 1MJUL 4X6BB 1RVFL 5HYJD 3NFNB 1U8NB 4YAQB 4HPYL 4OGAC 5B22A 3HMXL 3RDTB 5DJCB 3IT8D 35C8L 4XHQA 3RY6A 3EYFA 4I3RL 1QRND 1OWRM 2ZCLL 1KYOK 4OT1H 3RJDA 5GS1B 1NFDA 5EUOB 4Z95L 3CFJB 4YZFF 4NCC2 5CILH 2HG5B 4F9PC 4FFVD 4TVPH 3WO4C 3SDDB 4AIZA 4LBEA 2NY0B 1XGRB 1BJ1H 3ZDYF 5KG9A 1XR9A 2B4CC 5FO9A 1BBJA 5EOCJ 3BP5A 5DS8B 3SGJA 5IBLD 1CXFA 1YEEH 4XMPH 3S3PA 4HV8B 2DRUA 2O5ZH 1C7TA 5CKGA 3VI4F 2IFFH 3S34L 4PYGA 4BYHA 1BD2B 3BP6B 1XF2A 4G6MH 1HKLH 2VQ1A 4N90D 3H6JA 1EEQA 4GG6F 1IBGH 4OTXL 4HS3B 1T0MA 2CLVA 5HYQB 1QBBA 4RGNC 5FGBA 2Y06H 3WIHL 3IAPA 3PQYA 3I50L 2FL5B 2BVPB 4ODXB 5DK0A 4D8PB 5JLZB 5IVXA 4LAQL 3O2DL 3MUJA 4WI5A 5LGJA 2WUBH 1HNGA 1RIUL 3KPQB 3NABH 4LPYA 4JRYD 4O02L 4FMKA 4YDLC 5EOCH 3DV6B 3S37L 4Z7QE 4QT5B 4KKBC 4U1LB 4J6RL 1AGBB 2QHRH 2MQCA 1KB5L 1MCWW 1ZLUH 4WU7B 4TQEH 2FD6L 3S4SA 4OV6F 3ZTNL 4NKQB 3GMOA 1CZ8H 1UQSB 2VLKD 5IMOB 2FATL 3BAEH 1MRCH 2W65B 4GKZB 1Q0YL 3VXQA 4LSRH 1GC1L 3VGHA 4P46C 4N0CC 4NWTL 3P4MA 1IGCH 2JELL 4PJGA 2XI9A 2EECA 5FYJD 4PB9H 2QQLH 5TFSL 4IRZL 3S88L 4L5FH 4QHUA 4X6BA 3NFNA 1U8NA 1CGVA 4YAQA 1BQSA 1WTLA 3HN3A 3RDTA 5DJCA 1EJOH 5GRVL 4MQ7B 4CU6A 2UY6A 4HK3N 5HYSG 5GS1A 3QNYB 5EUOA 5J0BA 3CFJA 1PD6A 3QEQB 1R3KB 2HG5A 1NFDE 3SDDA 2IBZY 5HPMB 5L9DH 3MJ9L 1IEBB 3TT1H 3KAAA 4MX7B 5I1KL 4LRIA 5DS8A 1E4XI 4PJ5B 4E0RB 1TVDA 5EU3B 5DRWB 4HV8A 1CK0L 5DO2D 4LCUB 5DJDB 2BNQD 5EN2B 1BD2A 4LPUA 4JZJB 2ATKB 3NOIA 2ENSA 1U8KB 4GAYB 1DBJH 3PWJB 4LSPL 4M03A 3ZKQD 5C0RL 4XPFL 5MP6L 2EDDA 4HS3A 5CZKA 5HYQA 2E9WA 2VE6B 4PRID 4OFPA 4WEMB 4NIKB 4P23D 2FL5A 4ONGH 2BVPA 4ODXA 4D8PA 5ACZB 5JLZA 4KK9C 3F7VB 3TN0B 2FEEL 5IVXE 1KEML 4LIQL 4Y16B 4JFXB 4QGTA 4WY7L 1A4KB 5DHVH 2PYFB 3TJEH 3EJJX 3KPQA 3QXDB 3T3MF 2GKIA 3FO0L 3LS5H 4JRWA 4B0MM 1GGTA 3DV6A 1MJ7L 2R2HB 4WFHD 4G8GD 1RURH 1U3ZA 4U1LA 4XX1E 4OZFB 3AB0C 1AGBA 3CDGB 4WV1B 5DXWA 2COQA 1UZ8B 2OR7A 4WU7A 5GGVL 4GKOA 5D96B 4G6JH 2ICWI 5HI4D 2NR6D 2Y36L 1JWSB 3UTSB 1YYMH 1UQSA 4L3ED 5IMOA 5C0AB 2I25N 2W65A 4GKZA 4X5LA 1HXMB 4HCRL 4WCYL 3K8KA 5L2KD 1NANH 3KPPB 1I3RB 4ZFOB 1G7JB 1NUNB 2OXGA 1MY5A 5CD5D 1O0VA 2VXSH 1A3RH 1RFDL 2JB5H 3IJSB 2BMKB 4UIKL 1FZOB 4UTAH 4RCAA 2YC1B 4WGVB 3HE6C 1I8LA 5H94B 4PJGE 4NO0B 2YMXL 5D1ZC 1MCOL 2UZIH 4WRLA 4PLJC 1NCWH 2PXYD 5C0CB 1ZE3C 5E1HB 1N6UA 4MQ7A 4QHLA 2A1WH 1IC4L 1AGDA 1UA6H 5DJ8B 3QNYA 3PHOB 5HGGS 3GSOB 1OQXA 3R8QA 3QEQA 1R3KA 2RIKA 3MRDB 1L7IL 5EUOE 2C5DC 2YK1H 5HPMA 4OB5H 1HSAB 1IEBA 4MX7A 3QXWA 2B5IB 5E95B 1NQBA 5I19H 4Y4HC 1FL3B 2BRRL 2UY7A 4X4MA 5FA4B 5T3ZD 4PJ5A 1A02N 4E0RA 5EU3A 4ERSH 5HVHB 5DRWA 4GBXB 5JXAL 2HWZH 4OF5A 3FZUD 4LCUA 5DJDA 3E6HB 5EN2A 2I27N 4ELMB 4JZJA 2ATKA 4PJHF 1CXLA 1U8KA 4GAYA 4I0PC 1FORL 1BD2E 2EDRA 3PWJA 4YFDB 1T7WA 2NY2D 1K8IB 2VE6A 3FQUB 4JM4L 25C8L 1F45A 4JEGB 5ACZA 2Z4QB 4PTTB 3F7VA 3O8XD 3TN0A 5J11C 3W5MA 4QXUH 1TQBB 5KS9F 4Y16A 4JFXA 1A4KA 1JPFB 2EDNA 2PYFA 4PY8I 3QXDA 4GMTL 4XVSL 1EV2E 3GM0A 4JVPA 1XAUA 2R2HA 2RQ8A 1Q9WB 4FP8L 5J57B 3KLHD 4JDTH 4OZFA 3CDGA 4WV1A 1CXEA 4X7FC 1UZ8A 3QFJD 3S4SG 2O5XL 1UG9A 4KVNL 5CZVH 1HZHH 5SWSD 3QDGB 3WFHB 1MFDL 1JWSA 3UTSA 3HC4H 5D1XB 4K3EL 2Q8AL 5FOJA 4KK6C 5C0AA 2CRZA 4OLWL 4FQLH 5IG7B 1HXMA 2JE8A 1JZ4A 3ZYJA 3RGVC 1I3RA 3KPPA 4ZFOA 1G7JA 1JHLL 3U46B 1P7HL 2BK8A 4GT7A 3IJSA 4MVBD 1KTDB 2R9HD 1FZOA 1HINL 2IQ9H 2QHLA 4F7MB 3TPKA 2X89A 5H94A 3IAQA 3I3DA 4NO0A 2YD7A 3DO7B 1WFUA 4KZDH 1G9NC 2VDLH 3RIFK 2AAVA 2RJMA 1JRHL 1SVZA 1JI2A 1P84J 3C5ZB 1J05B 3FRPG 5C0CA 1VEMA 3QWRD 2L0DA 1Z0MA 4Q9BA 3B2UD 4P3WA 5DJ8A 3PHOA 1JN6B 1FDLH 3GSOA 1KTLB 3M07A 2Q87A 4GRWH 1KCVH 1NPUA 2H26B 2VRAA 4KK5C 3MRDA 3RAJL 3TCLA 5DGQA 3MBXH 1A6UH 1HSAA 3QEQE 3FQXB 4UI2A 1NUFA 1DEDA 3DBXB 3PDGA 4TSCL 1FL3A 3I85A 5FA4A 1KSRA 1GAFH 4PJDF 4GBXA 1KENL 4PJ5E 2X2YA 5IW3A 5DR5H 3E6HA 5I71B 4FMFA 4ELMA 1H3VA 4UV4L 3BGFB 1M4KA 3QJHB 4HWNA 4GJTB 3EFFB 4DTGL 3ULUE 5FGRA 1RI8A 1K8IA 3FQUA 4Y8AA 1FSKB 4JFDB 4RGOH 4LP5A 3ULVC 5D72H 2Z4QA 3SGEI 4PTTA 4QO1A 1KELL 3T77B 2X40A 4WO4B 1MHEB 4U1GC 1JPFA 3DX6B 1PKOA 1G7MB 4NO2B 1KBGL 1J10A 5AYQA 5DEZA 5IBTH 1JUFB 5F3BB 1Q9WA 4K94L 1I4FB 1L9MA 1ZLSL 3BESR 1N5AB 5J7CC 1T1YA 5HHOD 5IV2A 2F54B 1PX4A 1AFVH 1OW0A 3QDGA 3WFHA 5E5UB 3MC0A 2WWKO 5D1XA 1PLGH 2W38A 4NO3B 5JW4M 3RTQD 3UTSE 4JO2H 3MRHB 1IM9A 5IG7A 1HDMB 5KOMC 5C0AE 1EZVX 2HRPH 1R5IB 3R0NA 3ZDZE 4M6OH 3U46A 5BZDB 4C4KO 2LFGA 2DTMH 5D71H 4RFOH 4S0TD 4K8RL 1KB5B 3HAEB 1KTDA 4I0CC 3GI9L 4JR9L 3FHAA 5B4MD 4F7MA 1I9RL 5CIPH 1BVZA 4XVUD 2VC2L 4OD3H 3V4UH 3T1WA 3DMMB 1J12A 2GIYA 5I1LB 1YJDH 3UZQA 4KRPC 1RJCA 5IMMA 2AEPL 3SDXB 3BXNB 3C5ZA 1J05A 5E1AB 5C1MB 4JY4B 4DUXA 1C5BL 4CUCA 5C0CE 3SDYL 3QULB 4LHJB 1JN6A 1KTLA 4G43B 1G7PB 2H26A 3CXHJ 5HHQB 4XPTL 4LCWB 1YEJH 5A3ID 3FQXA 5C08B 3CH1B 3DBXA 1D9KC 1V3JA 4JFPB 5EU7E 1F8TH 1CICD 3HMXA 3SGDH 1T1XB 4RBPK 1OLLA 1KPVB 3RZCC 5IP4A 1EEYB 3EOBB 1T04B 3O6FB 2QQQA 1NLDL 3QJHA 2YUXA 3EFFA 3NH7L 2MNUA 1Y6KR 5DJXB 5C0EB 5KVMC 4OZIB 4ZAKD 3VXRD 3CC5B 5L8KB 4LLYB 1NEZB 4HXAL 1CFVL 4P48A 2VR5A 1AXSB 4XXDA 4JFDA 4U3CA 4POYA 1KJMB 4OCRL 3QUZC 1CQKA 4WO4A 2CRMA 2BSRB 1FNGB 1MHEA 2AP2A 2EXWD 3DX6A 1UJTA 1G7MA 3BJLA 4NO2A 4PJCB 2DOCA 3ARDB 2ICCA 5BRZB 5F3BA 4JG1L 4Y4FC 5E9DD 4JVUA 3SOBH 4OZFG 1I4FA 2DYPB 3TCXA 2OCFD 2WP3O 3WIHA 1IAOB 5I1DB 1N5AA 3R0MA 4ZD3H 1YNLL 3P0GB 3O2DA 2F54A 2M26A 1X5ZA 4P9HL 3S6CA 1CGWA 1P4LB 4F2MB 4NO3A 1K3IA 2C1PB 2HJLB 3UPRB 2OTUB 3WJLA 4M7ZB 3MRHA 4KI5F 3PG2A 1HDMA 4POZC 1H5BB 3U7AA 5E4EC 1R5IA 1C5DB 4BUHA 2J8UF 5JW4N 4MHHG 1HQ4B 1BJMA 4M3JA 1KB5A 2DS4A 3HAEA 2MSPA 3T0DA 4KZEL 4KKLD 4L4TB 4W4OC 2AK1L 4P5TD 3OV6A 1EGJH 1ORSB 5KVDL 3A0OA 3CSYB 1TENA 1VFMA 3DMMA 4UU9B 5DUPL 5DZOA 3X3FL 4X99B 4OCWL 4U49A 3WO3B 4NCC1 5I1LA 1N5YL 5KZCD 3SDXA 3BXNA 3SO3B 2V5TA 4HWBL 2EKSB 1ZEAL 5E1AA 4NJAH 2DIBA 4JY4A 2XT1B 4XXCC 3MLSL 1OLZA 1DBML 2KZ1B 2X4RB 3C09B 4CDHA 2BDNL 4S1SH 3QULA 5CBAB 4MQXC 4PGJA 4LVNB 5F9JB 2HTKD 4G43A 1OAKH 2Q20A 1G7PA 3SDAD 4XPAL 3SGKC 5HHQA 3PGDB 4LCWA 5LWYL 3BKML 5EB9A 3U1SL 3IETB 5C08A 4NWUH 4GG6B 3CH1A 4G5ZH 4OJFL 4JFPA 2AXJA 5GGQH 5GRVK 1G7HB 2M2DA 4DEPB 1SJHB 1T1XA 2KZWA 1RIHH 4Q9RL 1KPVA 4MA1C 2HLFC 1DVFB 4GAGL 2GY5A 1EEYA 5FF6B 3EOBA 1T04A 5IQ9B 3EBAA 1RIVH 5DJXA 5C0EA 4OZIA 3WXWL 3CC5A 2UUDK 4LLYA 1NEZA 4R90L 3MJ9A 3LHPL 1AXSA 1B9ZA 1Q0XL 3GSNH 7FABH 3PDDA 2CO6B 2EDYA 4AG4L 4J1UB 2N1KA 1KJMA 4JFDE 1RZFH 3VFGH 1EHNA 2BSRA 3H9ZA 1FNGA 3LS4H 4U3HA 2W0FB 1RPQA 4OLZH 5KAQF 5HGAB 4PJCA 3ARDA 5F7EH 4MGXA 2EE2A 5BRZA 3QEHA 1WJ3A 4U6VL 3QB7C 2KBGA 1TETL 2DYPA 4Q2ZB 4Y4KB 1IAOA 5I1DA 1MQKL 1LO2H 5ILTL 3LKSB 1LO0L 1G7IB 2FDBP 2DQEH 1FC1A 2R1YB 3L5HA 4LF3B 5CEZL 4XI5C 5C07E 4OFVA 1HWGB 1II4E 2F54E 2FBJL 3RX8A 1ZLVH 3O45B 4F2MA 2C1PA 2HJLA 3UPRA 2OTUA 3S5LB 4OD1L 3LEVL 1H5BA 1BBDL 1SY6A 2HT3C 4P2RB 3SJVD 4H0IA 4HFUL 1J1OH 3CX2A 3IDYC 1C5DA 4X7DC 2KH2B 3B2VH 2EH7H 5E2JA 4ENEC 4EUPH 3GB7B 1HQ4A 2GTWB 4P3CH 1H3GA 2O5YL 1G0YR 3OHXB 4XVTL 4BQBA 1T5XB 3D69B 5DD0L 4WEBH 4L4TA 4NQCA 1WCQA 1NGWB 5IJKA 1ORSA 2R29H 5ID1B 3CSYA 4L8SC 1RZKH 4UU9A 3B9KD 3TO2B 4CW1B 4I3SL 4X99A 2W9DL 5EORL 1N26A 4I77L 2P44B 3DPBA 2FGZA 4LSSH 2EKSA 2OZ4L 2RCSL 1WT5C 1FZKB 4OFYA 5CZXC 4ZFFB 1CIDA 1KGCE 2X4RA 1IILE 2Z31B 4XC3H 5CBAA 4IDLA 1DQQB 3O6LL 4PIRF 5LCVL 3RUGB 3GIZL 1T5WB 1JK8B 2VUOA 3MOAH 3PGDA 5CSGA 3EOAB 1AQKL 1JPSH 5DVOA 3IFNH 3IETA 4LCWE 4GG6A 4M7LH 3P0YL 4I0KA 1RZGA 2HFEB 5C08E 1G7HA 1SJHA 4QTIH 1G6RL 4P5MB 3D18B 1OTUC 3BWAB 1NANI 1EX0A 2KQMA 5FF6A 3OKOB 2QQKL 4TTDD 5IQ9A 1HH9B 5C7XH 1RUPH 5F1OB 2NXYB 2ZG1A 2OMNA 4OZIE 1DBBH 2BVUA 5DHXB 4PB0L 4BJLA 2FEDC 4LGRB 2DM7A 2OQJB 4J1UA 3FTGB 4HLJA 4UOW1 1F3JB 9CGTA 2W0FA 5C92A 5HGAA 1FRGL 3CPLB 1HYRC 3VJ6B 2I24N 4PJCE 4NQDE 5BRZE 5BQ7B 4Q2ZA 2QL1A 4J3XA 4Y4KA 2W0KA 3LKSA 1G7IA 3N1GC 1AJ7H 1L9NA 2R1YA 1HILB 2EDJA 4LF3A 3QHZH 4ZUVB 1VESA 3B8SA 1LGVA 3O45A 4KKCD 4LIQE 1T83C 4QRTB 4P2RA 4UINH 2NY5L 5C0FB 1NMAH 4JM2C 5SWZB 3HAEG 3GB7A 4WFED 2GTWA 4XGZB 3OHXA 3WNMA 4U0RB 1PDKA 1T5XA 1JNJA 3D69A 1I7RB 2I60L 4O2FB 2YEZB 3JVGC 4DGYL 4F57L 1NGWA 2XKUA 1NMBH 1RULH 5ID1A 1JBJA 4L4TE 4PTUB 2DLTA 4CW1A 3TO2A 1RZ8B 1KT2A 2WBKA 2F9BT 4DAGH 3O6KH 4H5SB 3TH2T 4JFQB 2FJFB 3I2CH 3MLRH 3FCTB 5F9DC 4Y19D 2PTVA 2QEJA 1FZKA 4UTBH 1BFOB 3STZB 4ZFFA 4MA7L 2D3VA 3KJ6L 4FQJL 4KU1A 2Z31A 2VDPL 1DQQA 4PBVC 3H2WA 3RUGA 5IGXL 1T5WA 4PBXA 4F15C 1JK8A 5E2UH 1P6FA 4M9OA 4YX2L 4BQ9A 3EOAA 1TJGL 5TQ0L 3VFSB 4IRSD 4X4XB 2B4CL 4PJHB 5T1DL 2YPKB 5GJSL 3VI4E 2HFEA 43CAA 4GG6E 5MEND 5AAMA 3G6DH 4P5MA 1DQDL 3BWAA 3WUZA 1OTTC 3HC3L 3L3OB 3OKOA 1HHKB 1NEZG 1HH9A 5KS9B 5TPWH 1J5OL 2Z92B 3TO4D 3VWJB 3RWFB 3GSUB 4XMLH 2OQJA 4FFZH 1E4KA 3TA3D 3VXUD 1CLOL 3ZL4L 1J0HA 3I9GL 3W9DB 5J9PB 1F3JA 2XWJB 3LKNB 4K7PX 1D6VL 1KACB 3CPLA 2P5EE 4QHKJ 1QKZH 1WTGT 5DQ9B 3VJ6A 1OAYH 5BQ7A 4Y5VC 2ZPKH 3OB8A 1AKJB 1FBIL 3ZDXF 1ND0B 2GY7B 1S7RB 2VERN 4N0UB 3V4PH 1HILA 1RK1A 4ZUVA 4TULL 3ISWA 2BX5A 1GGYA 1A7OH 3NZHL 4UT6L 2WNGA 1Z3GH 4QRTA 1BVKB 3SCMD 1GZPB 4K3GA 5C0FA 1MHPH 3CVHL 2PYED 1MPAH 5CJ5A 4P2RE 1B90A 2VNCA 5BXFB 4XGZA 3NIDF 4NC1E 1I7RA 3L1OH 4O2FA 3LRGA 1UT9A 3OBAA 1UJ3C 3KPSB 2DLFL 4IIQB 4PTUA 1WIUA 3ZKSD 1RZ8A 4H5SA 3EFDL 3BEVB 5F96L 1JZ7A 4JFQA 2FJFA 5J89A 5F9OH 4HUNB 5EZOL 3FCTA 3V7AE 2CDFB 4M1CD 1BFOA 4JO3L 4ETYA 3P3YA 4KTEL 3W2DL 5GGTL 1CVSC 5CWSB 4PJDB 5JORB 4I8DA 2D7QA 1XGYH 4Z77B 12E8L 5I1EL 3RUGE 1ZVYA 4QRPB 3VFSA 1FNSL 2PR4H 4X4XA 1E4XL 1OSPH 4PJHA 2YPKA 4HC1L 1CFBA 1B4JH 4ODHL 4OQTA 3U7YH 4MYWB 1A47A 4FS0A 2DTSA 2D7TH 3AY4A 4EN3D 3QH3B 1HE7A 5GXBB 1A7QL 4KDVA 4LARL 1J11A 4U31A 5DC4B 1QBAA 4DUVA 3L3OA 2CSPA 3I6GB 1HHKA 2HRLA 1NH6A 4ALAL 1FHGA 5KS9A 4HIXL 4PR5B 3TT3H 2Z92A 4OQ1A 5HHXL 2DQJL 2X4NB 2BCKB 1IC1A 3VWJA 3RWFA 3GSUA 2VWEC 4AEHH 1YJDC 4U1NB 5GSVB 3EYUL 4KJWC 3W9DA 5J9PA 5EIVA 4BM7A 1GGUA 2F5AL 2XWJA 3LKNA 5I0ZA 1QSFD 3IU4L 5DQ9A 2D03L 1T1ZA 1JHKH 2YUVA 4Y2DB 1VENA 2H6PB 5BOPA 1AKJA 4UBDD 3F8UB 4OM1L 1C1EH 5GGUB 2NMSA 1S7RA 3U4AA 4N0UA 2R2EB 1SEQL 3SGDI 1KCSL 3HG1B 1T80A 1BQLL 4Z0BL 1BVKA 1GZPA 4HBCL 5ALCH 3QIUB 1AH1A 5C09D 4WTWA 1IFHL 1I1AD 4DQOH 3QI9C 5BXFA 3DGGB 1CGXA 5SWZE 3EOTH 1PGRB 4NN6B 2BSED 2D4FA 4UB0L 2IG2L 2BNRD 1NCAL 3KPSA 3I6KB 4XWOD 4YXKL 3V7AG 4IIQA 4KVCL 4NQSB 1M05B 3J8F7 4CBPA 4Z7WE 1NLBL 5HDOA 5J8OA 5JHDB 1W72L 5I74C 4ZXBC 4MQSB 5HVFB 4ONFL 2CDFA 1UM4L 4XWGH 5JQ6H 3UJTL 1T89C 1Z5LB 5CWSA 1MWAH 4K7PL 4PJDA 5JORA 1RAMA 4PJEF 3DNKA 4O5LH 3WLBB 4Z77A 2XTJC 4QRPA 4PJ8C 2VDOL 32C2B 2APWA 3SKJH 4HWBA 3F58L 3TVMD 3L5WB 3HI6H 4LHUB 2YR3A 5E2TL 4MNQB 3D3VD 3VD3A 5M7QA 1J18A 2WW8A 3NCMA 2ZCHH 4NCDA 4AEEA 2D7NA 3I6GA 3PL6C 3H7LA 4BK5A 1H8SA 4H26B 5HJ3B 5KS9E 3ARBB 2X4NA 1GHFH 2BCKA 3N1FC 1JZ5A 3LDBB 4XP5H 5JW4Q 1RUMH 4OLVH 4U1NA 3RX7A 4PRHE 1G6RB 5E6YA 5GSVA 1DL7H 3EO0B 4MD4B 4JFZL 3F6IA 3MCG1 4HF5L 2AGJH 2ZKHH 3QDJD 5E2WL 3U83A 4Y1AD 1YNKL 5DA0B 4Y2DA 3HB3D 2FGWL 4M1DH 1A7PL 2E6PA 5DC9B 2H6PA 2R0ZH 1CFSB 1NGYB 4LHQB 3S36X 5GGUA 1MREH 4EBQH 4O2CA 5I1GH 3ZTJH 3QIBB 5I1HL 4HJJL 2R2EA 3VMOA 3QXUA 4KMTH 4N0UE 4RMTA 3HG1A 3FB7B 2AEWA 2L7JA 5D4QA 4PV9B 3QIUA 1UB6B 3NGBB 1TZHB 2PN5A 1D5IH 2ZUWA 1WZMA 3DGGA 4BELD 5CUSH 4HG4J 2FHCA 5D7LB 4FFVC 2VXTL 4AY0A 1TFHA 3JTSB 1LK2B 3I6KA 2PF6A 1ITBB 4NQSA 1M05A 3ARFC 4C57C 3N85H 4JJHA 5IB2B 5IBLC 3A6BL 5JHDA 5DD3H 3ROOB 1OGAB 2ZJSL 4JKLA 4R2GB 3WNPA 3BW9B 4JB9H 2MKLC 1MRFL 1TVBB 5JW3H 1Z5LA 5JXEA 1ZV5A 4G7VL 3WLBA 2XRAH 1WUNT 4G3YL 4PJDE 4R4FH 3T8XB 1KPRA 3QIWD 3WD5H 5C6TL 4NQXB 1BFSA 1EMTL 1XF5B 4QRPE 4WNQB 4WHCA 32C2A 4OIIH 1BZQK 2J6EH 3DX9B 2OZ4A 1BAFH 3L5WA 3OAYH 4BQ6A 4MNQA 5F71A 3HZMB 5FXCH 3TFKD 1QFHA 1H8OA 3RP1A 4DN4L 5HJ3A 4JQXC 4N8CH 1RZKC 2G5RA 3ARBA 3ULVL 1JYNA 4U7SA 4CN1A 3IB4A 3U4BL 2LV4A 2OP4L 3I3BA 4EI5D 4U1JB 1JL8A 2G2RB 4MD4A 3P0VL 4M6AA 1RJZB 1CLYL 1YMMD 5DLMH 3DSFH 1P4BH 3EKCA 2DL9A 2MQ3A 1E4WH 1U3YA 1NCDL 4L8BB 3GMRB 3UTTB 1CFSA 1NGYA 4P99A 5DTFB 3ARGB 3QIBA 1WFNA 4M8VA 3PWPD 2CR3A 2GFBB 3CLFL 4S1DD 1CWVA 3E3QC 3X14B 3FB7A 1MY7A 4RAVB 3WDJA 2R69H 5FUCE 2B20A 4PV9A 3HG1E 2DBLH 1H3WM 2NW3B 3CMOH 3HMWH 1UB6A 4IRJC 4UAOC 3ZKMC 4I18C 6CGTA 1MFEH 1TZHA 1WF5A 5CGMA 4HT1H 5D7LA 4KJQD 3JTSA 1LK2A 3UC0L 5TE4L 4X5WB 5CEZE 1PEZA 3FN0H 1CU4L 5IB2A 4A6YL 4JANB 3ROOA 1OGAA 3CVHB 5DO2C 1ZHNB 3BW9A 4XP1H 1ITCA 1TVBA 3Q3GB 2CGRH 3UBXG 1E4JA 3OR7B 2J8OA 2Z91B 3VW3H 4NM4L 4ZODA 2A6JB 4XCFL 3T8XA 3D9AL 1YDPA 4WI7A 2P7TB 4NQXA 1MEXL 3P4LA 2EH8H 4N9OB 1XF5A 1JF5A 4LSUL 4KUCD 3ILQC 2VMFA 4WNQA 3DX9A 4GW1B 3PGCB 2CKBL 3KPNB 4S1RL 2M8XA 3QHTC 2NTSP 3GKWH 3HZMA 3HFMH 1IT9L 4RISH 1HN1A 4UMGA 3GNML 4HX1B 5EU6B 4KROD 5FK9A 4WFFE 4RFNB 5M95B 3WIFB 3U36B 2ZOLB 1TJHH 4OZHF 2NR6C 2KDGA 3VRLF 2G2RA 4ZPTB 5FOBB 4U4BA 1RJZA 4OT1L 4UT7H 5DQDL 1EXUB 5CILL 1FL5B 1VCAA 4TVPL 3WS6A 3KYMB 1HWHB 3LRHA 3GMRA 4L8BA 3UTTA 3QO1B 2H2PC 5DD5H 4N0YH 2ADGB 5DTFA 4KI5E 3ARGA 4XMPL 1IM3B 4AQOA 1KC5H 4M7KH 3IRPX 2O5ZL 1PG7W 3L3JB 1F58H 3JZ7A 4WTXA 1KLFA 4J3OC 2YXMA 2DAVA 3X14A 4G6ML 4HS8H 3VG0H 1HKLL 4RAVA 5D7JB 1W0WB 3MLZH 2NW3A 3VFPB 1IBGL 1QFOA 1A7NH 1VFBB 4WWKC 5HYJA 3A6OA 4C56B 1G0DA 1T0PB 2PNDA 4F58H 3ESVF 1BIHA 1AIFB 3FL7A 3LB6D 4OCMC 5D7LE 4X5WA 3OPZH 1UWXK 4NNYB 4P4KD 2WUBL 3ZHDA 4HWEH 4L8CB 5K93A 3FQWB 3NABL 4JANA 5I6XC 1ES0B 5EOCL 4JAMB 3CD4A 3DJ9A 3CVHA 1PKQE 1AGEA 1ZHNA 2BY3A 4ZTPH 4RWYH 1OGAE 1I9EA 3Q3GA 2QHRL 4ZNEA 3LD8C 1I85C 3OR7A 2Z91A 2CUIA 3O9WC 3X11B 4TQEL 4ZPVB 3QG7H 1WBZB 2A6JA 2AVGA 3AXLB 3RA7H 3DUUB 1CZ8L 2P7TA 2BNQB 3BVNB 4MDJB 1NMCC 5D1ZB 4J4PA 1F42A 3L9RB 1W72B 1MRCL 3BAEL 4M48H 4DKFH 1TPXC 1CS6A 3O8XC 4LSRL 2LU3A 3UTPD 3BUYB 4GW1A 2VUYA 3PGCA 4ZDHB 2FJHB 3L3DB 3KPNA 2P49B 4PRIB 3LQZB 2ZUUA 4BFIB 4YC2B 5GGTA 2ZUQB 1R3HB 4FABH 1IGCL 3FAXA 4NHCH 1QYGH 4HX1A 5EU6A 4PB9L 2QQLL 3KLHC 2IJ0C 4QHKI 4L5FL 3WIFA 4HC1A 1ZAGA 2NY0D 3U36A 5C0GB 2ZOLA 1EHAA 3TV3H 3JWDL 5IKCB 1EJOL 5INCA 4ZPTA 5FOBA 3L6FB 5GISH 1EXUA 4M93C 4YIQB 5ID0B 1BD2D 1NCUA 1X6NA 3BMVA 1FPTH 4H88H 1QUNA 3ARXA 1FL5A 4KQ3H 2XWTB 2VLKA 3KYMA 5LG1A 5L9DL 4MVBC 3TT1L 1YNTB 3QO1A 4KGJA 1FLRH 4RGNE 2GSGB 1NDGB 2ADGA 4D3CH 3UTTE 3NPSC 1OP5K 1IM3A 4TNWF 4XP6H 2DQTH 5L0QC 3L3JA 3C8HA 4AIXA 4AMKL 1UCBH 3HA0A 4YUEH 5D7JA 1W0WA 1DBJL 3HZVB 6FABH 3NCJH 4G8FB 3T4AB 1VFBA 3B5TA 4DKEH 4RMWA 5IBUB 4C56A 4ONGL 1AIFA 1IC5H 4F33B 2GYSA 3TBWB 4LCCC 3HUJF 4NNYA 4JPVH 3WKNA 3L95B 5FECB 3TJEL 4L8CA 4M62H 3FQWA 1KIPB 3LS5L 3MNWB 1ES0A 4JAMA 1CF8H 1RURL 1F97A 1U8PB 2PCPB 3BD3A 5ERWB 4NP4H 4R6UA 3O4OB 5GS2H 5ACLA 4ZPVA 4ZNEE 4UV7H 1WBZA 4G6JL 3AXLA 1YYML 3DUUA 2BNQA 3BVNA 4MDJA 3FT4B 2HMID 3L9RA 1W72A 2A83B 3V5DB 4XHJD 5FHAH 1ZMYA 1CDCA 3D25B 3BUYA 5DRZB 4ZDHA 2FJHA 1QP1A 1FGVH 3L3DA 4PRIA 3LQZA 3FO2B 3T0BA 1ADQH 4BFIA 5JTWA 4X9HA 2ADFH 3EJYC 1A3RL 5HD8D 4FQIH 1QFWH 1QBMH 1R3HA 3ZE0F 4UTAL 5KAQG 4JY5H 1VDGA 4R8WH 3S35X 4TOYH 3QEQD 2ZUTA 5EU6E 5H2BB 4H1LH 3JWNC 1JGLH 5C0GA 1Z0NA 2KKQA 4HUXB 1T66D 1OWWA 1NCWL 5IKCA 3IFLH 4M4PA 4PJ5D 2CUMA 1BGXH 5E8DL 1BEYH 2A1WL 3L6FA 4XCNB 4ZO7A 1UA6L 2PKDA 4BFGA 5ID0A 4I2XB 3ULUD 3U30C 3UTQB 1FV1B 2YRLA 4MCYB 2XWTA 2YK1L 4Y7MA 4OB5L 1HIML 3A6CH 1YNTA 4XPGH 2GSGA 1NDGA 5FKAB 3MROA 4XVUC 4ERSL 1HHHA 1DANU 2HWZL 4U1GB 3TN0D 1WISA 3CSBA 5ISZB 1OD7A 4Y16D 3O41B 4MAYB 5D70H 2UWEB 2H9GA 3SE4C 5IB4B 4BK4A 1GRWA 3HZVA 3WFZA 2DIJA 1M7DB 4G8FA 3T4AA 1CDUA 4JFFB 4YHMH 3SE9H 2AEQH 4PJFF 1EUUA 4U7KA 4N8PA 2ARJB 4WI3A 3TH3T 5L6YL 3TBWA 4D9QE 1KJ3H 5DMIH 1KEGH 4ODVH 3UTSD 3CGTA 3JV6B 3L95A 1NJ9B 4PJEB 2V5RA 4O4YH 1OAUH 4GMSH 1KIPA 5C0AD 1CICC 1V5JA 5I75B 3KDMB 2I07B 2RHEA 4GQ9H 1BHGA 1T20B 4RMRA 4JDTL 1U8PA 2PCPA 5ERWA 2XOTA 1AR1D 2Z8RA 4ZAKC 5CZVL 1HZHL 3MUZ1 1JCKA 3HC4L 2X89D 3FT4A 3G5YA 4OCLC 4NO0D 3DURB 2FX7H 4FQLL 1UB5B 4PUBL 2A83A 4HS6B 4P2OB 4KRPB 5CP3A 3V5DA 3VD4A 1U93B 2CXGA 3D25A 5DRZA 1IQWH 3Q6GH 3SBWA 5DSCB 2EXWC 3LY6A 3FO2A 2DMCA 5C0CD 5I73B 4B7LA 5JHLH 2NY6B 3DYOA 1BM3H 2IQ9L 5DZLA 4FQ2L 4QCIB 4FQQB 1QFUH 4FQHB 3TH4T 4MXQD 3SE3A 3STLB 4NGHH 3ZKXC 2DQCH 2NXZC 1D9KB 3CDCA 5EBGA 2WBJB 4HUXA 4E41E 1YEIH 2NLJB 2CKBB 1QR4A 2YD1A 4FQCL 2GJZB 5IWLC 4GBXD 2VR9A 3QFJA 4XCNA 4YXHH 3ZDXE 4I2XA 5KSBF 4CN6A 1FDLL 2ADJB 1FV1A 1KCVL 2P24B 3GM8A 4R7DB 4MCYA 3BWUC 4JPIB 1L7TH 3MBXL 2EDEA 3WUWB 1K3ZA 1A6UL 2VJXA 1CTNA 4MCZB 1I9IL 1SJXA 1JI1A 2Y1VA 2HTLC 4KKLC 3ARUA 1GAFL 5FKAA 1BZ9B 2QSVA 3VGGA 2EYSB 3VXTB 2Y6SD 5ISZA 5DR5L 3AMLA 3O41A 4MAYA 1RZIB 4KH2A 3TP4A 3WEXB 1QO3B 5IB4A 3NIDE 4GRLD 1NAMH 1M7DA 2OR9H 5FUZL 2H32B 5HTSA 3HCVB 4JFFA 3CSPA 4GKSB 5D72L 5AEAA 2AV1B 2DQUH 2ARJA 1AXTH 4MNGB 1U6AH 5C70A 3QWRA 3WNNA 3X12B 1JNNL 3JV6A 1NJ9A 4PJEA 5D1XD 3RKDD 3LN9A 5IBTL 3RL1B 2DBJA 1XIWB 3KDMA 5DK2B 2F8OA 2I07A 4NZTH 1T20A 4NQTA 3BPCB 3VFNB 1P4IH 3U9PH 2FX8H 5KTEL 4G6KL 5ICZB 4UUJA 4GXVH 4NN5B 1VADA 3UYRL 3BSZH 1AFVL 3DRTB 2Z35B 4ZOCA 3JTTA 4G9DB 4CU7A 2VYRE 1ED3B 4JO2L 5D7SH 3DURA 1UB5A 4HS6A 4P2OA 3BDBA 3D87B 2HRPL 1U93A 1GXEA 5KJRH 5DSCA 4IJ3B 5FM8A 5ACMA 3C5ZD 2DTML 5D71L 1N0XH 2GK0B 3L3KB 2VXVH 1OAXH 3QFDB 1F4XH 2EO1A 5LGHH 1D3CA 4QCIA 4FQQA 4GUPB 5E00B 4FQHA 4OD3L 3STLA 4KPHL 1NFIB 3BZEB 1P53A 1YJDL 2WBJA 4O51B 4HWUA 2NLJA 2CKBA 1N6QH 5FDWB 2P42B 2GJZA 1U58B 5F9AC 2MFNA 2J12B 1ZLWK 3KLAB 1IGMH 1GOHA 4ZS6D 1VKXB 5IVOA 1TXKA 1AHWA 2ADJA 2P24A 4R7DA 4JPIA 4I2XE 1I7UB 5FAAA 1YEJL 1T4KB 2XQYK 1KCUH 3WUWA 3HNTH 4MCZA 1XMWA 4HDIB 1MCCA 1J1PH 2NZIA 3EDDA 4RX4A 3TWCH 4JFDD 4LLAA 3ULVE 1BZ9A 2PTTB 4JDVB 3CFKB 5DJAB 2XTLA 1SEBB 3QPQD 2D4DA 2EYSA 3B9KC 4NN7C 3QCVH 4WO4D 3VXTA 1KULA 1RZIA 4LOUD 3WEXA 2VXUH 1QO3A 4PS4L 5ISZE 4PG2A 4P5TB 2UWEE 4HEPG 1DLHB 2H32A 5IBUG 5AD0B 3QXVA 1MCLA 1JPST 2V9TA 4TPRH 5DFWH 2UV3A 4GKSA 2YA2A 4M7LT 4HPOH 4FTVE 2AV1A 4JFFE 2HVKB 5LGKA 1T7VA 4MNGA 3HPJB 3C5SB 1NL0H 1U3HB 2F54D 1QPPA 3X12A 4LDOB 1LEGA 5BO1L 3WSQH 3L7EB 4MJ5A 5DWUH 1I3VA 3P11H 3RL1A 4PJEE 1GOFA 1XIWA 5DK2A 3SOBL 4BZ1L 4APQC 4XVJL 4BKLB 1XGTB 3BPCA 1WCBB 3VFNA 1IQDB 4F9LC 4ZD3L 4TTDC 3X3GH 3UJIH 5BOZG 5ICZA 5EO0B 1Q9KB 3DRTA 2Z35A 1N64H 1A7RL 1NUDA 4G9DA 5DHVB 5T5NF 1ED3A 2X1OA 4PY7B 1XFPA 2ZUVA 1PAMA 4WI8A 4RMQA 5BMFH 2ENYA 4N5UA 1YPZE 5DMGD 1KGCD 3GJEB 4JPWH 4Q58C 3G9VA 1ZLUK 4OZHB 2GK0A 3L3KA 3BE1H 3EYSL 1IGTB 1ZKAA 3OB0K 4G6FB 1SM3H 1A9BB 4GAJL 5F7DB 1EGJL 4GUPA 5E00A 2LAGB 1OOAA 1XR8A 4LCWD 3O3EB 5DF0A 1NFIA 3BZEA 5C08D 4W6XB 4O51A 1X6LA 2R4SH 2BHYA 5FDWA 1PG7H 4EI6B 5HHMB 2I9TB 4Z7VF 1U58A 5GIRA 1X5AA 4FG6C 5K59E 3D2UB 4S1SL 3KLAA 1VKXA 1OVZA 1KXVC 1OAKL 3O6FD 1I7UA 5FYKH 2OXHA 1T4KA 3F7QA 1HYSC 4JCMA 4YHNB 4NWUL 4HDIA 4JKMA 4G5ZL 4KRLB 3IYLW 5GGQL 2PTTA 4JDVA 3CFKA 5DJAA 1SEBA 2RB8A 3RWCB 1NGQH 4PLKD 3ZE1F 1S7WB 1RIHL 4NNPH 3AFLA 3P30H 4PP2B 3RWIB 3TJHD 4E5XB 5E03A 4FOMA 1DCLA 1KJ2H 1U92B 4DUWA 5T1MB 4P5TA 3ARDD 1RIVL 4NQDD 5BRZD 3T0EC 4Z7QF 4GS7B 1DLHA 4WHYG 5B38B 1MAJA 2V6HA 5AD0A 3GSNL 7FABL 4TVPE 2DYPD 2HFFA 3EUUA 4H8WH 1E6OL 1U2HA 2HVKA 5KANG 4IHOB 3HPJA 4JRXB 3C5SA 1U3HA 1U8LB 1AXIB 1KIUA 3LS4L 4RGMC 4MNGE 1YQ2A 3L7EA 1AC6A 2CDEB 3KR3H 1BVLB 4BKLA 3C2AH 1XGTA 1GSMA 4KQ4L 1WCBA 5TDPB 2YBRB 1IQDA 1LO2L 1LE5B 5EO0A 1Q9KA 2V9QA 1DBKH 4Z7OF 1CDIA 1F02I 4L4TD 3VFUB 5TGBB 3WJJC 5DHVA 5AAWA 1KUMA 3H7BB 4PY7A 4NUGH 3TA3C 1U8IB 2A73B 3NA9H 5F7FA 5T1KB 1TITA 4KAQL 2IPKA 3HNSH 4G8EB 1J1OL 1ZVSB 3B2VL 1OL0A 1A4JA 3GJEA 3TEUA 5C0ND 4OZHA 4OFYD 5ESAB 1IGTA 1MCDA 4P3CL 4NZJA 3MCKB 3FT2B 2XQBL 4WEBL 1A9BA 5D2NB 3OG4B 3GMMB 1VHPA 3BPOB 5F7DA 4I1NB 2R29L 3EJZD 2MPAH 4CVXB 4D0BB 4U6TA 1RZKL 5D1QB 1EUTA 3O3EA 3GSVB 4KJYB 4LRNH 2ED9A 5BV7L 1MCPH 3ALWA 2OYPA 4LSSL 3ROLB 3KNBB 5AWNL 1QTYT 4EI6A 1NCBH 2P5WE 2I9TA 3WXVH 4L1DA 1MCJA 3D2UA 1L0YA 3LKQB 3OXRB 3V6BR 1DVFD 4XNZC 1IC7H 2BC4A 2BXYA 3WUWG 3MOAL 2D0FA 4PJXB 1JPSL 2XQYG 3IFNL 4OF3A 4YHNA 3RWGB 1NC4B 4M7LL 5JR1H 5EZJB 1YN7B 4ZO9A 3RGHA 3SJVA 4FNLH 3RWCA 4QTIL 5F8RC 3QQ3B 3LQMA 4PP2A 3RWIA 3B8YA 3IS0X 1MI5E 1KCKA 1U92A 3V0VB 5T1MA 2IF7A 4M1CC 5C7XL 1RUPL 1QFWI 3HUJB 4QRSB 4X80H 2AQ2A 3A67H 5B38A 3PWLB 2X9YA 4OZ4B 5F7KC 1DBBL 4N0RA 4Y4KD 4LNRB 4UDTB 4IHOA 2X4OB 2ITCB 4JRXA 4P2YA 3ZYOA 1U8LA 5HI5C 1RHFA 5I8OH 1URLA 2FNBA 3QSKB 4WUUB 2VDKH 5J13B 1HNFA 1E27A 2OR8A 1OB1B 2Q8BH 4EN3C 2CDEA 4P2RD 1BVLA 2CK0H 5TDPA 4NHUB 2YBRA 3R1GH 1FYTB 1LE5A 2WBWB 5E94B 1DBAH 2FIRT 2B8OT 1AJ7L 1FP5A 1XF3B 4P2QB 4NQVB 3QHZL 5CKAA 4OKDA 2ATPB 2EYRB 5TGBA 4YHIB 3H7BA 4YGVB 1U8IA 2A73A 4KJPD 5T1KA 3CU1A 1CIUA 2X9XA 4G8EA 1ZVSA 2XV6B 1NMAL 1MCWM 4HKJB 2Q3ZA 1OPGL 4U7MA 2E7LC 2IAMB 3N1PC 5ESAA 4WI9A 2DI8A 3MCKA 2Z31D 3FT2A 4OZHE 1ZSDB 3O4LB 1J0IA 5D2NA 3GMMA 4WW2C 1NMBL 1YZZA 5E08H 2FX9H 1RULL 1OQOA 2VIRB 4CVXA 1F90H 5B3NA 4D0BA 5D1QA 2DDQH 3GSVA 4KJYA 4DAGL 3EZ8A 3O6KL 5L2JB 1QHPA 5DUBB 3OKEB 2OL3L 3MLRL 2AJSH 3MA7B 3ROLA 3KNBA 3RWJA 4UTBL 1X5JA 4GW4B 3NIGE 3LKQA 3OXRA 2IALB 1JGDB 4YWGH 1P7QB 5CIPB 1ULVA 4LDEB 2CXKA 1AR2A 5HDBE 4AT6B 4PJXA 1I1AC 2NXYD 1NC4A 4HUWB 3RWGA 1F2QA 2FO4A 5EZJA 4H0HB 1YN7A 2VZUA 1I8IB 4YHZH 3PWNB 5IESH 4XWOC 1UM5H 3BYYA 3FONA 3QQ3A 1OAZH 3G6DL 4PLNC 5L88H 2NY1C 3GBMH 5EC2B 1DANT 3V0VA 1S78D 1MFCH 1OF2B 1YY9D 1OTSD 3HUJA 4QRSA 1KLUB 2YD6A 5TPWL 5IFHH 3PWLA 4YO0B 4OZ4A 2NPLX 4JCLA 4LVHB 5C6WH 3ULUH 1XZ0B 2DB8A 3W81A 4XMLL 1QACA 4FFZL 4LNRA 5CJBA 1JV5B 5KSAD 3V6OA 5IF0B 2X4OA 2ITCA 5I1AB 1T7XA 4YNYB 5A2IH 4JRXE 5E5MB 1WV7T 4WUUA 4U2YA 1YECH 1KN2H 1QKZL 4MXWH 4ZS7L 3VFRB 1OB1A 3KWWB 4NOFA 4NQEB 2WIMA 2VZTA 5TF0A 5GZOC 2DN7A 1CD8A 1OAYL 3QUMH 1P84K 5E56A 3KPOB 2AKRB 1P2CB 2ZPKL 1Z9SA 3QI9B 2OMBA 5IVNA 1FYTA 5SWZD 5E94A 5TH2A 2VLJB 2VLME 1PYWB 4NKIH 5JOPE 3U0TB 1XF3A 3V4PL 1JPTH 4P2QA 4NQVA 2ATPA 3HI1B 1U8QB 3MV11 2EYRA 2VDQH 3QR2A 1QSEB 4ODBD 2Z8SA 3MMEB 4OZFH 1UWEH 1A7OL 2EDLA 5I74B 4ZXBB 4YGVA 3KYOB 1Z3GL 4Y89A 5CSBA 2EEDA 4GRMB 1MHPL 4EJ1C 1R3LB 1MPAL 3OQ3B 1J1XH 2IAMA 2DL2A 1MIMH 3CVIL 4K8RD 1FFRA 3L1OL 1ZSDA 3O4LA 3U4EB 2ZCKH 2VIRA 5D2NE 3T2OA 5L2JA 5DUBA 3OKEA 3JWOH 1B2WH 3IGAA 3MA7A 4MWFB 3IRZA 1IKFH 4GW4A 5IUSA 5HYFA 4ZYKB 2IALA 1K6QH 1JGDA 3BEWB 1P7QA 5CIPA 1XGYL 4AT6A 5JIIA 3DARA 3T2NH 1TZGH 2PR4L 5F6IC 2JJUA 5GS0L 4HUWA 4PJXE 4FQXC 1G9EA 3SCMA 3G6JF 1B4JL 4K71B 3PWNA 3VWJD 3U7YL 3F7PC 4BUGA 1INDH 1S7TB 1RHHB 2D7TL 2WWKT 4MJIB 5IM7B 2WV3A 4ZFZB 3BIAX 1X5LA 4JFOB 3CLEL 4LCIH 4PJAF 5EC2A 2YD8A 5B38G 2BNRB 1OF2A 1KLUA 3TT3L 2VOTA 2AJZB 4GRWE 3W82A 4YO0A 4C4KT 4HK0B 3S8WA 1HXYB 1XZ0A 1AKJD 5E6IC 4AEHL 1QEWB 1JV5A 3RQ3A 4YDIL 3QIWC 3BISA 3O3UN 5IF0A 2F8XC 5F70A 5I1AA 2FH8A 3GIVB 4YNYA 3V6OE 5AYUH 1UZ6E 4YEEA 5E5MA 3FT3B 3VFRA 2V7NB 4NQEA 3KWWA 1JHKL 4WUUE 1FE8H 3ZDZF 1CL7H 3MJ7A 3KPOA 2AKRA 1P2CA 5AUMB 3QI9A 3GSNB 5FGSA 3QEUB 2VLJA 3TFKC 1PYWA 3RU8H 5D2LB 1EFQA 5DFVD 4R97C 3WHXB 3U0TA 5A2JH 3TVMB 1A6VH 4DVBB 3BKYH 3CXHK 3HI1A 1YYLH 1U8QA 4CAGA 3GK8H 3MLXL 4PRAB 3ARFB 3KPSD 4P2QE 1QSEA 3MMEA 1MCNA 2DI7A 1PY9A 3ET9F 4ZXBA 3KYOA 2B7DT 3DX8B 4EI5C 3CU7A 3ZE0E 3O0RH 4GRMA 2H3NB 1R3LA 4X98B 4NZRH 3TM6A 1RUAH 4PRPB 4DQOL 1NGZB 1YQVL 5C0BB 3EOTL 3GMNB 4E9LA 4NBYB 3WL9B 3C08H 4QOKB 1UXSA 1B3JA 3P2TA 4TUOB 3MV7B 3U4EA 4IMKC 3FJTA 2RBLA 1NUGA 4S1QH 2YKLH 5FCSH 3O4LE 5BVPH 4BZYA 4QRPD 3QDJB 1AGCB 4Y1AB 4JO4H 4L8DB 3MCLL 3L3HB 5FCUH 5C9KA 4MWFA 4XWGL 4EUPB 5JQ6L 3LKRB 4S1DC 2X4PB 4L3AA 2C3HA 2AW2A 4CVZB 1MWAL 3LVEA 4ZYKA 1ZHKB 4ODSH 2D7MA 4O5LL 4ONHB 4Q0XL 2VABB 3BEWA 1IMHC 4NM8H 4O9HH 2CMRH 1KG0B 4LEXH 4ZNCD 5BV7B 4X6DF 2J88H 4KJQC 3HE7B 3SKJL 2DQIH 4LQFH 2VWEE 3GFUA 1S7TA 3JUYA 1RHHA 4RNRB 3HI6L 4MJIA 5IM7A 4ZFZA 1MJUH 4JFOA 5CJQH 1P6AB 1BFVL 3FO1B 4KTYA 2ZCHL 3MLPA 1CGUA 2Y23A 4KK8D 2BNRA 4HPYH 3K2MC 1S9XB 2IH3B 1OAQH 5I8KH 2AJZA 3LMJH 3FOMB 2EE6A 1HXYA 1GHFL 1Z6JT 2E8YA 4L4VE 4ZOEA 2J5LC 1E28B 4TRPH 1MVFA 1QEWA 1RUML 3ARYA 4OLVL 4Z95H 3T08A 4WGWB 1KNOB 1DL7L 3GIVA 1P1ZB 4FFWD