3WEXA

Crystal structure of hla-dp5 in complex with cry j 1-derived peptide (residues 214-222)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
181
structure length
181
Chain Sequence
IKADHVSTYAMFVQTHRPTGEFMFEFDEDEQFYVDLDKKETVWHLEEFGRAFSFEAQGGLANIAILNNNLNTLIQRSNHTQAANDPPEVTVFPKEPVELGQPNTLICHIDRFFPPVLNVTWLCNGEPVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDVYDCRVEHWGLDQPLLKHWEAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the specific recognition of the major antigenic peptide from the Japanese cedar pollen allergen Cry j 1 by HLA-DP5
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords MHC class II antigen
total genus 32
structure length 181
sequence length 181
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2013-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wexA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 3wexA01
2K7QA 5EIQA 5I0ZA 5JW3L 2G60L 3G6DH 4P23D 2GK0A 5FYKH 3NGBC 4Z5RA 4C4KT 2R1XB 3I84A 3H9SD 1FORH 5MENA 2CXKA 3BMVA 5IROC 1BP3B 4PJBB 3ZKNC 4HHAB 1U3HD 3ZE2F 1S8DA 4PJGF 3E8UH 4XVUD 5E03A 1KJVA 4NNYB 3PE9A 1CDCA 5IB5A 4J6RL 3SGKA 3G6JB 4FFZL 3QUZA 5TDPA 5A2LH 5C0IA 3GSRA 5IFAH 2D4FA 1DLFH 1C1EL 1FYTB 5JXAL 1ORSA 1IGFH 2IJ0C 4JQVA 4R90L 4HCRA 3HZVB 4FZ8L 1A0QL 1OT1A 2P8LA 1FV1B 4WU7A 4WDIB 3SQOH 3TVMA 5GS1A 1EVTC 3A0OA 1N5AA 1B4JH 1JNJA 2FB4H 1CDGA 2LTQC 5CEZL 4AM0B 3QFDB 3M8OL 3TBYB 1YEJH 1DE4B 3ESVF 3IDUA 1I7UB 2AEIT 3BO8A 2Y6SC 3QQ9C 2UVFA 1T7ZA 1VADA 6FABL 3TO2B 2LVEA 4IRZL 3STLB 2VWEC 3MLUH 3L6FA 4GQPH 1QBLL 1IGFL 3DGGA 4ETYA 3ECBB 1OGAA 2FSEB 1V8HA 4H25A 3QIWA 4P2QB 4M02A 2IPKB 1GAFH 2DQEH 2X4NA 3KXFD 3OWEA 4YFEA 2YSSB 3FT4B 4MHHG 5C9KA 3T65A 4N5EC 5I9QB 1SBBA 3U7YL 1RUQL 2GFBB 5DT1H 3HB3D 3ILPB 4GAJH 4ZFGH 1WBYB 4L4TD 3LQZB 5I1CH 2E6JA 3PDGA 1KJ2A 5C08B 4Y5XC 3TJEL 1XGRB 3GJEA 3OKOA 1OAKL 4WRLA 1TNNA 2QKIA 5HHOA 3BZDA 2ESVD 2QQKH 1XGPA 4OZ4B 2X9YA 3D3VA 1A4JB 4MJIA 3F58H 4Z76A 3MRFA 3QJFB 5F9DC 3PDOA 2UZIH 4UB0L 4GS7C 1G9NH 1BX2A 2W38A 4JHAL 3P0YH 4LHUG 4F8TA 3QA3A 2R9HC 1J7VR 4HGMA 1OP9A 1RUMH 3MA7B 4Z18A 4L29B 3MO1B 1ADQA 4YIQB 4PV8A 3TYFB 3GKWH 1DQQA 1JI2A 3X13A 2NY3C 5I18L 4X8JB 5C0BA 4M7KL 5CZVL 4OZHF 4PP1D 4X0KA 1MFBL 3K2UH 1YEFL 2P24A 3HNVH 4X0KB 5HYJB 1H3TA 2F53B 4LHUD 3BKMH 3FOMA 3RHWF 2EYTA 3BDYH 4TUJA 3QEGH 4EI6A 3UZVB 1I1FB 4RGMB 3O0RH 5DGRA 2WNGA 4QY8A 4JHAH 2BSTB 3CJJA 2OZ4A 1A9EB 5HI4D 1YMHA 1MY5A 4ZUWA 3IKCA 3PDOB 4RGNB 1VEMA 1N8ZB 4WUKL 4UILL 1KIPB 4NN7C 4XC3L 4JHWL 3LKOB 1YUHA 2HTLD 4H8WL 1JHTA 4Z0XA 2NY3D 1ND0B 2APBA 3VXRE 5BS0A 4V1DE 2OXHA 4DWHA 3OXSB 2X4PA 5GGRB 4HIEA 5EBMA 5MEOB 1NGYB 4CRPA 5GRJL 3SDCC 3ULUL 3DSFL 5DEGA 2EDQA 1FSKC 4YDJB 4OSUL 1QEWA 2O61B 2WUBL 2F19L 4OGXL 5EOCJ 4FOMA 1JUFA 3X17A 4ZUSA 4H25B 1G9ML 3FN0H 1N7MH 1NGXB 3MOBL 4IRSC 3GI8H 3LEYH 3QIWC 2EH7H 3GSWB 3FRPA 3B3IA 3QUZD 3MNZB 1QNZL 3C5ZA 3K80A 3KLSA 4PGZA 4DZ8A 1FNLA 3VA2C 1QZ1A 4LLQA 2XIDA 5I66B 4W4OA 1HK6A 2PTTB 4NO2B 1Z9OA 1E28B 1LD9B 1U3HB 1HNFA 1FG2A 3D39E 1UB5B 2JJSA 5J0BA 2DQDL 3IDIB 2P8MA 3QG6B 4P3CH 3RZCD 5F44A 3THML 4F2MA 5JDJA 3T77B 3VMNA 3IETA 5EG6C 2VB5A 4GAYA 2MTPA 4U0RC 3LD8C 2XYCA 3RUGE 1EX0A 2ZUWA 3LEYL 3QXUA 3CVHH 2ATKB 2LAAA 4BZ2L 3T0XA 4AQ1B 3O6FD 5HPOA 5ANME 2FCBA 1R0AL 3OPZL 3ZKSD 5H94B 3MV11 2J8UB 4HK0B 1VPOH 4C83A 3FB7A 4RWYH 3LS5H 3L5WA 3MRKA 2DWDB 4P46B 4JR9L 1F2QA 3DV4B 3QQ4A 1W8NA 3H6JA 1DJSA 1CF8H 3U1SL 4UT6L 2CSPA 1PYWB 3IFNL 2YPKA 4LHUB 2DN7A 4HZAA 1YEDB 3WFZA 4LDOB 2K9UA 3CFKA 1YEDA 4R7DB 3LKQA 4F7MA 1AE6H 4UOW0 1OPGH 2D2OA 4P4RB 3UMTA 5LBSH 1U93A 4ZTPH 1RUQH 5EUOE 2C7UB 2AGJH 4GS7B 3VG9C 3WFBL 1BX2B 4RFEA 4HIHA 1NMBH 3E2HC 4GQ9L 2CQVA 4JO2H 4XPGL 3D6GA 4KMQA 3JUYA 1BJ8A 1XGRA 3BAEL 4XH2A 4UV4L 5CP7B 3ZDZF 3RVTC 3OX8B 5HHOB 5E9DA 4XCFH 4CVUA 2VUOA 2Y23A 4TQEL 4PJDA 3S36X 4F58H 1DLHB 4PRNA 2CDGB 5J57B 4HH8A 4XBPA 3MJ7B 1KG0B 1JPST 1FAIH 4U6HB 1NUFA 4D8PB 4OIIL 3WFBH 4YR6A 4X6DA 2AKRB 4HUNB 4O00A 1JK8A 4HFUL 4HUVA 3N85L 3A6CH 5IQ9A 2WUCH 4S2SA 4AYFA 4NO3A 4KKNA 3HR6A 4NZRH 1CQYA 4XVSL 2ORBL 2NXZC 2KH2B 4P57A 3O6KH 2X5PA 3FO1B 2ILLA 3MBXL 1QBML 4YFLF 4LSQL 1P4IL 5KBNC 5T33L 1I1AC 4GBXB 5CGYC 3BD5A 3ARDC 2DLGA 5HDQH 5ISZE 3T2QA 2X1OA 1OQOA 1FV1A 4KTEL 4WU7B 5LVEA 3I6GA 5MEPA 4HG4J 5K59E 2GSIB 1KTLB 4LASH 2EYSA 1UQSB 2DKMA 4HS8L 1HQRB 3GSOB 4OCYL 1GPOH 4LPCA 4R97C 4G3YL 4UILH 1HKLL 1N64H 2WBJC 3ME0A 5CHNA 4NJAH 1EHLL 2VISB 3P77A 5DSCA 2BHZA 2F5AH 4PUBL 3QUYB 3EFFA 2XTJE 1RUPL 5SWSA 5DTFB 1BOYA 2KUTA 4X9HA 4Q6YA 4ONHA 3B9KA 5I19L 3MRGA 1RZJC 5CWSB 5DMIH 1YMME 5LGHL 3VG9B 4XNXL 1DQJA 4YHNB 1YEHH 5IB2B 4YBLB 3GEWB 1MFCL 1INEL 1OT2A 2I07B 5DD0L 1RZIA 4WTWA 3QA3B 1IJ9A 1BF2A 3GMMA 2VN7A 1C08A 4CW1A 1U6AH 3TZVB 1BHGA 2VZ1A 3QCUH 4X6CB 2I60H 3FFCD 5IBTH 3PWUB 2XTLA 1ZT7A 2EDEA 4Y5XB 4N0YL 1AO7A 4OF8A 1NCDH 1QSEA 3T0EC 5EBWB 2X6MA 1X5IA 3VGEA 3DI3B 2GFBA 3MFFB 3N9GH 1L7TH 3ETBF 1BBJB 4KHXH 1CF8L 2BCKB 5CP7A 3FOLA 3U0PA 1TVHB 4HKBB 4NKDB 2DQIL 4P49A 3SJVB 3VI3E 1UACH 2IGFH 1W72A 1E6JH 1FIGH 1GAFL 3HMXA 3MNVA 1CWVA 1IGTA 2R2EB 3QEQB 1MJJB 5EU6D 1T20B 2YD1A 1JNHA 3PGCB 4PJ7E 1QSEE 3U7WL 1U3ZA 3OG4B 1AIFA 1CR9H 3GMMB 5E6IA 3NH7H 2LV4A 4H0HB 3RVVD 3SE4A 3L3KA 3T2PA 3FT3B 2DYPD 1MCCA 3RGHA 4JRXD 1C5DB 5T3ZL 4I18A 1NDMA 1A6VH 1V3MA 3V0WL 4XP6L 1FH5L 2NY5H 2V7NA 4ZFOB 5FFLA 3O8XA 2F19H 1KCSH 4CUCA 4PJ9B 3NIDE 4L3CB 1DUYA 4KVNH 5J56B 1B4JL 5I2IB 5C0CE 2VISA 4FQLL 4EVNA 1KIQB 2V5TA 2NY1D 3CGTA 1JWMA 1Z9LA 2VNCA 2O5ZH 3I02B 3PJSA 3L3IB 3SOBL 3PQYD 4G8EB 2JJWA 3ARQA 1R5VB 1J0HA 2AEPL 3O6ML 4O9HL 3QWOA 1UH2A 4OFPA 3WUWA 1H5BC 4KK5C 5DJ2A 3DSNA 4XPBH 1JJUA 2EYRA 3BFOA 4Z7VF 2QSCH 3KPNA 1MCPL 3U2SA 1LP9F 1KCSL 5F9JA 1LMKA 5SX5K 4HEME 1UZ8A 4P59H 4KVNL 4EIZC 1QLEL 3LEVL 2HKHH 3CVHL 1OD9A 1ZT1B 3S35X 3KPQA 2PTTA 4KKBD 5ID0A 4GSDL 2F74A 3PHOA 4WFGD 5D70H 1A7QH 1AHWA 1XIWD 4ZOEA 5IG7A 1IEBA 2XTJC 1CFVH 3U0WH 3MUGA 4QKXB 4P46D 1IEHA 4UQ3B 3UJTL 2ICCA 2Z31D 2DJ4A 4TVPH 1NC4A 1NCTA 3QDGB 4NKDA 4R2GC 4I2XB 1AXTH 4IDLA 1T2XA 3T0EA 4DGVH 3CZJA 2VZOA 1IM3A 1I1RA 4ZUVB 1Z6JT 4F7CB 3KLHC 3HPJA 4XPTL 2E8ZA 4LGSB 3RWJA 2GTWB 3U7AA 3NAAH 1KENL 5ACZA 5DJAA 5T1LB 4PJDB 2L7UA 1CDJA 3K8LA 1XF4B 2PYFB 3WO3B 4MA7L 4RDQG 1U91A 4JKLA 2YRLA 1WIOA 4U3HA 5C0CD 5E6IC 5EU6E 5A43C 4AENA 5T3XE 1MI5D 4PJDE 4F37F 3RNKA 2GUOB 5KAQF 1G7MB 1II4E 1U93B 5EPMB 3VXUE 4XNQB 3GI9L 3RBSA 3N1FC 4XBGB 1BIIB 5DUBA 3V4PH 4ZODA 1YEFH 2UWEE 5DJ8B 4ZUUB 1OSPH 1X5XA 3U48A 4XCYA 1NEZG 1T21B 3LKQB 5C0BE 2EEAA 5IBTL 1F5WA 1RZFH 4E5XA 1S7RB 2FH8A 1J18A 3A6OA 2PTUA 1H15A 3FMGH 3I6LD 3FQUB 1ZE3C 5BRZB 4KJPC 5D2LB 3HS0A 1YC7A 3UTZB 5B3JF 1SEBA 2O26U 1L7TL 3MX0A 2HVKB 2X89A 2BY3A 2EC8A 3MJGX 3VFTB 1AGEB 1G7IB 1XGYL 4UBDC 4X5LA 4MQTB 5JPNB 3CSYA 4UT7L 2EIZB 5J11C 1UQSA 1QRNE 1A47A 5EO1B 3JV0A 3RX5A 3GI8L 4PBVC 5F72S 1YPZB 2AI0H 3EGSB 4QXUH 1X5HA 4U0QB 1BZ7A 2V6HA 1JYWA 3UTPD 1ORQB 4MXVF 5L8KB 1JHLL 2VDRH 4PYGA 3FONA 4JG0L 4OD3H 4ZNEE 3SJVD 2FBOJ 3L5JA 1ITCA 3FRUA 2BXYA 5DFVD 1XT5A 4XHQA 3I2CH 2R69L 3C5ZB 4OB5L 5AZEH 4PJ7F 2VLME 4OLYL 3VXNB 4JZNA 2OJEB 3BYYA 2ZP0T 2OJEA 1NDGB 3JTTA 4HKXA 4KRPC 2ZG3A 5I1KH 4Z7OF 3TO2A 4NWUL 3G6DL 5D8JH 1G1YA 3GHBH 3MJ8B 1E6OL 5DK0B 3WXVH 1I7UA 5D7LA 2DKSA 4LLDA 4HIEB 4OIIH 5EBMB 4PJEB 2Q1EA 2Y06L 4JKWA 1NGPL 4X9GA 2VO5A 3I50H 1FNEB 2DL9A 2ZNXA 3T0AA 5EN2B 2HYMA 5D7IE 1INEH 4DTGL 1D5IL 4YFDB 1KENH 1LNUA 2PUQT 4JFEB 5I1DA 3AREC 1OAUL 3QUKA 5K59F 2G2RA 4PJEE 4ENEC 3R06B 2OP4L 4LEOA 3T4AB 3GIVB 3V8CA 1IM3B 4EN3C 4J12A 3FFCB 1F4YH 1DUZB 5C6TH 3WLWD 1M7DB 4RX4D 2X44D 1SJEA 4R26L 2BSTA 4AMKL 4AG4H 5ICXB 2YRZA 4QCIA 5IMLB 1CICA 2WIIA 2HJKB 4WEBL 4GKZB 2CK0H 2C9AA 5F7YC 5FEBA 5FV2A 1T0MB 5EC2B 3QRGH 5BRZD 2DDQH 3X13B 5C0JA 3EIFA 1K6QH 1O7SA 1HXYA 3DX8B 4R2GD 3QIUC 3MJ9L 4XNQA 1J1OL 3BJ91 5J8OA 3HAEG 3NH7L 2J88L 4YIQA 5J12B 2GJZA 2Z31B 1SEQL 2IF7A 1HHKB 2H2SC 5ESQA 1CLCA 4L8CA 2QSQA 4HX1A 3S5LB 4X99A 2G75B 1WICA 2CK0L 3HRZB 4QRQA 4FXGB 2NMSA 1TJIH 5AEAA 3MOQA 3CVIH 2VKXA 1SEBB 5MEND 1U8IB 3ULUE 3RI5F 4FQLH 4PRHD 4HBCL 4XMKL 2HH0L 5DMKA 3MACH 4I1NB 3B8SA 1PSKH 5D2NC 3VXSA 5D2LA 3IDJA 5IV2B 3ZYOA 2XA8L 2Y5EA 3O3AA 1AO7E 3DTXB 4PGBB 1A7PH 4RAVB 4GG8A 5IMKB 4GMSH 3QCUL 3S96B 2BSRA 3RP1A 4JE4B 2V17L 4HLZG 4XCYB 1MCOH 4JN2A 3BXNB 4CDHA 5B39B 3DV6A 4MCZB 5T1MB 1S3KH 1TCRB 1UWEL 4C54A 2XZAH 5JXEA 4K23L 4XMPL 2Z92A 4ZNCD 1N6QH 4R4BA 1DE4A 1IL1B 4P2QE 4APQA 1AIFB 1MCWW 1WZ1L 4YHOH 1ZHKA 4LSQH 2PCPA 3HPLB 1RFDL 1RZKC 1LVEA 5L6YL 2KQNA 3GRWL 3AREA 1W72L 2NCMA 1ND0A 4GKOA 4MB3A 2A74B 4PJ5E 5FIEA 1Q9WB 1IGIH 2J1KA 2IH1B 4S1DC 1T1XB 3LY6A 4B7LA 4BZ1H 4LLYB 4PGCA 4I2XE 4OQ1A 1RI8A 3BP5A 4WI7A 4NRYB 5J89A 3O3DB 4GRLB 4WHTB 5GSRB 4M48L 1T1WA 2AXHA 1QLFA 1VFOA 5JPMB 5FYKE 1B0GA 2JELL 2OR7A 4YHYB 4AG4L 1DEEB 1S9KC 3P30H 3Q3GB 4YK4B 1W0WB 5DUPL 1U8MB 2YPLD 1S8DB 1KPVB 3G5YB 5BJTB 5HVHC 4NN5C 5J11B 3OKKA 3RDTD 1KYOJ 2ITCB 4HFWA 1KLGA 4LRIC 4ODUB 1TQBB 5DJXB 3G08A 5EZIH 5EOCL 4JRXE 2R4SH 1CZ8H 3SKUD 4ELMF 3I3EA 4RMUA 3N1MC 4ELMA 3EO0B 4CL7A 3P4OA 2R0ZL 1YDPB 3OKDA 2P44B 3QUMA 3GIZH 2CD0A 3D39D 4PJ5A 4OM0H 1AFVL 5I1HL 3S7GA 1CL7H 4QWWC 2JELH 1YNTA 4IRSB 1GPOL 4YDKL 4RX4A 5GRUL 5D72H 2VLKB 3LOWA 4JFFD 1UYWH 5CIPA 1QYGH 3AUVA 4JPWL 3PP4H 1HILA 5AUMB 2NY2B 3QEUA 3MRDB 3WN5B 1OARH 1Q1JH 3IGAA 4H0GA 1VACB 1LP9E 4CADB 2QEJA 5A2FA 5F1NB 1I9IL 1PSKL 2Z93B 5BRZA 4QTIH 4YWGL 3KR3H 3QAZB 3QJHB 2EDFA 5F7FA 3L1OL 3BH8A 1FL3A 3QCTL 4LAJH 1ZHKB 1FPTL 3QNXB 3MRIB 1A6WL 4R4BB 3QO1A 3KHOA 5GISH 1BWMA 2AI0L 3MJ9H 5DUBB 5ERWA 1X4ZA 5F7LB 1MELA 1T83A 4NSKA 5F6HJ 5HHMD 5KN5A 3BXNA 5B39A 2DM3A 4QOKE 4AEEA 3ARGA 5DR5H 3VRJB 1H0DA 1AKJA 3QDMB 4X6DB 1PD6A 3MYZA 2ADJA 2CLZA 5I74C 3MGOA 4Q6IB 4P2RA 1TVHA 4RAVA 4AH2B 3EFFB 1MRFL 4NHUB 3TM6A 4ODXA 5IK3A 5DVKA 3OB0H 5CEZE 1NGZB 1BD2E 2WQRA 4JB9L 4Q9RH 4PRPE 1VENA 3D25A 3O4LD 1S78C 2AGJL 1A7OL 1MIEH 3VH8B 3W81A 2A0LD 4WFGE 4XC1H 1AGCB 3WXWH 2IALA 2OTPA 4AEIH 3QUZB 4GOSA 2E6PA 1A7PL 4U6XB 2GJ6E 1L0XA 3MBED 3UAJC 3U7WH 5IBLD 2DAVA 4ZPVB 1S9XA 4ETQA 3D18B 3IT8D 3PWNB 4QRPD 4WGVB 1OD7A 1NKRA 4PTTB 5KG9B 4APQD 4P5TD 1MRFH 4KROB 3E6HB 1LO4L 3UPRB 4ZD3L 4HUXB 4LEXH 3LMJL 4A6YH 2CKBA 4KMTL 3LCYA 4NKIL 5IVZB 5DJCA 1NCBL 3NAAL 3TA3B 4CU8A 4CVXA 3B8YA 3QUYA 3JV4A 2XOTA 1T03H 2WWMD 3QBTB 4EEEA 1WCQA 2FX8H 2HTLC 2EYRB 3G9AB 3IFOA 1M71A 1S9VA 4XP9H 5ISZB 3TN0B 3KJ4B 4AIZA 5H35B 2ADFL 2VE6A 4F9PC 5CKAA 4XVJH 3MV7D 4UNVA 1G7HA 3BZ4B 3V6ZB 5GRYA 1BVKB 1IE5A 1OGAD 2AQ3A 3KNBA 4RQQA 1VGKB 5FDYA 5DEZA 3P0VH 4R2GB 1KNOB 4K2UH 5HYQA 3WJLA 1KTDA 2D7QA 3DVGB 2AXGB 3AS2A 3HHRB 3G5VB 4XMLH 3PWVA 4OZIA 3R0MA 4MYWB 1IM9B 3KWWA 2ZUTA 2VXSL 5IT2L 4G8GD 3GHBL 4KGLA 1H0DB 4YFLI 4Y4FC 5BZDA 5J7CC 2ZKHL 3BRGC 3U0WL 2YK1L 3K3QA 4EDWL 1JNLH 1ZT4A 3NCYS 1QUNA 2VDML 2VITB 3LVEA 4QWWD 5HHOD 3L3KB 1QHOA 1HCVA 5FYJD 4JDTH 2EDXA 4UUJA 2EC9U 3FB5A 2B0SH 2FBJH 5EU6B 4UIMB 2R23B 3RAJH 5L88H 1H8SA 2KKQA 3MNVB 5CZKA 1HXMA 3PV6A 4FP8H 4PJHA 5KVGL 1KTRL 5DEFB 3GMRB 2VDRL 1KEMH 3AB0C 2Q7YB 4PS4L 3WUWG 2HT2D 2V2XB 3QIUD 2IAND 2X2YA 3BUTA 3BRFA 1FGNL 1U3HC 4JKMA 3JSSA 5DJ0A 2RHEA 4PV9B 1CDBA 2VDMH 3OGOE 4XI5D 43C9B 4G80B 3MRQA 4J4PA 4WGWB 3PWJB 4HX1B 3MRQB 2FD6H 3WDJA 2UWEA 4R96A 3TCLA 4QRQB 3CMOL 1QYGL 4KFZC 3EFDH 4YDIL 1HZHL 4U1IB 3K4AA 3PP3K 4WFFD 5DT1L 3RX7A 3TIEB 1KLUB 4PRHA 3M1BB 4KRPD 5AWNH 4X5WB 3QP3A 4JM4H 1VFAB 4GBXD 3VFUA 3SDCA 1AKJD 1QO3B 3LKRA 2NYYD 4OGYL 4WU5B 1YECH 1P7KB 5IFJA 1U0QA 1RZKL 2BNRA 1AP2B 5GRVL 1D5IH 5DLML 4RGOL 3GMNB 2JIXA 5AD0A 3G6AA 3C6LD 2FX8L 4PJFE 2R1YB 4FQJL 5EUOF 1Z9MA 3T0EE 2LQRA 3TO4A 1JFQH 5JIIA 5GGTH 3CFEB 2QR0A 3HC3L 3WLBB 4NRYA 3HTLX 1ZKAA 1HWGB 3SKMA 2NY7L 2VDQL 4FQPA 4JREB 2H41A 1P5UA 1GCFA 1C7SA 2AXGA 4NZUH 5AAWA 3LHPL 1ZGLB 2A74A 3IETB 2XRAL 5K33A 1WFOA 1RK1B 1BVKA 3MRRB 5EOTA 3WFDH 4TSCL 3QG6A 1E28A 1UEYA 2YD2A 3JUZA 3PG2A 3C6SB 3VWJB 2IPKA 3W0WA 2C3XA 5FAAA 4YGVB 5K9JH 1OARL 1Q1JL 4J2XA 3FB5B 1JZ5A 2VLJA 4QTHB 1FZJB 1JMZA 3MFGB 3RDTA 1QSZA 5HYJA 4NZDA 2GEEA 2XZCH 1H9VA 2YN5A 1VFUA 5CILL 5E1AA 4YXHL 5BS0E 2GAZA 4EZMA 4OLVH 3VFWA 2AV7A 3DMMB 1AQDB 2AP2A 5FUOL 2EE2A 2E7HA 1OAZL 3F7YB 4X6DE 2NNAB 1NGQH 2FX7H 2VXTH 3ARZA 3IFPA 4CMMA 4YHIA 1P2CB 5B22A 1SQ2N 4PRHB 4E41A 4JZJC 1KBGL 3MLWH 3Q48A 4LF3B 1U41A 1N2RB 1A0QH 4BSVB 1D5MA 1HYRC 1IC5H 4PJBF 3T4YA 4X6FA 3ET9F 3BI9X 5E4EC 4KI1A 3LKOA 1ZEAH 4JRXB 3CSYB 3HI1A 1PDKA 4OIBA 2EIZA 4PRHE 1JGEB 2Z31C 3ARTA 3KPMB 4L9LA 1MJ8H 3C5JB 4PB0H 4HIHB 4HPYL 2EXWC 4JO4H 1X5FA 4EIGB 5C0RH 4ONFL 3WE6B 1JPFB 3UJIL 5IK3B 4JGJA 4JY5H 2NQCA 2VDNL 4G8GB 2EYTB 1I1FA 2EC9T 4JDTL 3IU3B 4N0FB 2ARJA 4RMSA 4EI6B 4OF3A 5IT2H 3NN8A 4LCYA 4H26B 4YX2H 1K6QL 3VRJA 4E5XB 1OM3L 1T1YB 2CGRH 1MCLA 5HHXH 3MRHB 5LAXA 43CAA 5E95B 1P7KA 1Q9KA 4QRPB 3HFML 4NNXA 4DKFH 2BNQB 1TFHA 4UQ2A 3EJZD 4PRDA 3ZYZA 5IVXE 1M7DA 4PTTA 1YN6B 5E8DL 3ARGD 1UB6B 1OL0A 3B2VL 5L6YH 1KT2A 1Y6MR 5C2BL 5TDOB 1J5OH 1EPFA 4PJXF 2E7LC 1D6EB 5D4QA 5LBSL 2VLRA 3U9UB 1QSFD 5HHXL 2BVQB 3RJQB 4U1MB 5CINH 3IDYC 4PJCE 4GQ9H 2VABB 1L9NA 5I73C 3T0EB 5GGSY 4JVUA 4NQDB 4OZIE 1XGYH 4HIJB 3TJHC 1O7VA 1A6PA 3P30L 2JIXD 4YPGA 4NRXB 4LLQB 4UU9B 3C09C 3WFHA 1G7JB 3OKNA 4XPHH 3P9MA 3T0VA 2CIIA 1DSFL 3Q5TA 4LAQL 2C3WA 3HNTL 1YDPA 3T3PF 4AIOA 5F3BB 4Y5VC 3ISWA 4U1KA 5CD5D 4XC1L 1ZT1A 1EZVX 2AJZA 3VWJA 3EYOA 3KLAA 4JRYB 5FO8B 4HUXA 1ZTXL 2E7BA 3R8QA 3RWIA 1N5AB 5KSBA 1LO3H 1KPVA 3ARSA 1IM9A 3OKLA 4FXKA 4F7TB 1T3FB 2AV1A 3BQUD 1WBXA 1NGWB 3GMQA 4F33B 5DDHB 3RL2B 3EYVB 3O6FA 2RCSL 2F8VA 4X4YB 1SVZA 5MEQA 2IPTH 3MV7A 1CIUA 1DVFB 4FTVE 1D5ZA 4HUWA 4BH7B 2D0FA 3U4BL 3GBNH 1KJ2H 1TTUA 2IH1A 3UTZA 2ADIA 4K8RD 4NRZB 2YXFA 4P48A 2XY1A 2BERA 3L3OA 5E8EB 3PWPE 3FQUA 3BEVA 3LH2H 3UZQA 1S7XA 3FFDB 1W0YT 4OCYH 3H7BA 2YEZB 2DICA 4YXHH 4OTXH 1FBIL 3BH9A 1A8JH 1G0XA 4YO0A 4S1SL 5HHPA 1U8KB 5CLWA 3K8MA 3EFDL 4YDIH 5E2VH 5DRWB 2R1WA 1BIIA 2XWJB 2DTMH 1K4DB 3PF2A 4I0PD 1BQLH 4Y16D 3RVUD 5TQ0L 3BPNC 1W8OA 3QYCA 3LQAC 5JHDE 3LAFA 1DQML 3W9DA 1NCAH 4YDVA 4HCRL 4KV5F 4JANB 3G5ZB 1CE1L 3ARFB 1UA6H 5FXCH 4Q0XH 1MY7A 4PJCA 5IHUH 4C56D 1NEUA 4D8PA 2WINB 2DDQL 4OZFH 1ZA6B 3F6LA 1KB5B 2HA1A 3QWRA 5DD0H 2NW2A 4Q9BA 5E2VL 2HLAB 5I1JH 1KELH 2DTML 1KCUH 2NW2B 3U46A 4O5LL 1AY1L 5ICYA 4L8BA 3U9UA 2NY4D 4YH6A 2IAMD 5BRZE 2BVOB 3UO1L 4WWKA 5IMOA 3CSBA 4KK6C 1NFKA 1TETL 4Z78B 1ONQB 4TUOB 3P9LA 5EWIH 1EEZA 5FA3A 2OS7A 2YRPA 3GNML 3NTCH 4DW2H 1OPGL 1ADQH 5E7BA 3UZEA 2PXYB 2F54B 3SDCD 4D0DA 4DK6A 2VAAB 5FKPA 1JTTA 1NUDA 4GSDH 2FLBT 4M9PA 4H1LB 2Q6WB 3KPPB 3WYRA 5MERA 2VDKL 4HV8A 2V17H 4CNIB 1CICB 2WIIB 3KPNB 3RPIB 5EBLB 4C56E 5CHNB 3QEQE 4ONGH 4BZYA 1F42A 4RMWA 4PIRF 4BUGA 1ZLUK 4MNHB 3O3UN 4QHUA 3U0TB 2QBWA 4GRLA 3ULUC 3V6BR 1B0RB 2HKFH 4FMKA 1ORSB 5HHQB 3U30B 4OCRL 1NGWA 3GMQB 3P4NA 3QR2A 4E41E 5E08H 3O6FB 4JFDB 5F9WB 3I6KB 5MEQB 2ICES 3GO1H 3NCYP 3UPAA 3GRWA 3G6JE 2Q8BL 3T0ED 3WV0A 1IGML 3OKLB 4FXKB 5EO9A 5HYFA 1IQWH 4LSPH 4NFBA 4M03A 5KSAB 3AMKA 5GQBA 2W60B 3GSQB 3ES6A 4DAGL 5D5MF 2MPAL 2H9GA 1N6UA 1T0NA 1LO5A 3HC0B 1QFWM 3VFSB 1HINL 2ICWB 5DQJB 3MLRL 1VSCA 1ZSDA 4OV6F 3EOYG 1YC8A 3INUL 1ZA3B 1NL0H 5GS0C 5GGQH 5LGKA 4MDIA 3IAQA 4WCYH 1MSPA 4AL8L 4D9RD 1FZOB 5BVJB 5GZND 1RIHL 3O3AB 4M4PA 5IR1A 4LCWB 4YHLL 2X4PB 3SE8H 1TITA 3CLFH 4X98B 4P46C 1GGCL 1QVOB 5LCVL 1WZKA 4OZGA 3IDYB 4Y5YA 4LSSH 4DCQB 4U1SA 2BJMH 2OTUA 5FM5M 4K8RC 5DJDA 3T2OA 4E9LA 4OLWH 4RWHA 4YDKH 1RUAH 1G1CA 4W70A 1T2QH 1L7IL 1DN2A 5T1KB 4RMQA 4HWZA 1YMHB 4EOWH 5M94B 4F7PB 4XAKD 5K9OB 2ZOKB 4UQ2B 1V3JA 4NIKB 4KRMB 4QRPA 4N1CA 4OD3L 4ENED 2YPLE 2EXWD 3MLXH 4HAFA 4FA8A 4YBQD 5CINL 3RAJL 3D3VE 4MJIE 4P5TA 3QPQC 3QT2A 5EA0H 5F89A 1AXSA 3GSXA 5FM4A 3QIBC 5F89B 2FJFB 4OKDA 4YAQB 5DJ8A 4ODHH 4HUMB 5GPRA 4NQDD 5DTFA 4MCYB 3SGDH 4JKKA 2HWZH 4KRNA 1MQKH 1OTUD 2EDBA 2VRAA 2CR6A 4MD4B 2NY1C 4MQXD 4L9LC 1Z3GL 3VXQB 2VXUH 4M4RA 4XPFH 1PZUB 4JG1H 3ARFD 3ZE0F 1KLUA 1K8IA 3CAFA 4PTUB 3WIHL 4M5ZL 4PJAA 1AY1H 2FJGB 4JPVH 4HJ0D 3ZTNL 5B8CC 3CMOH 2QADC 4DKEL 3N0PB 1YMMA 3C8HA 3IJHA 5DHXB 4MB5A 3IAPA 5SX4I 1Y18A 5DQ9B 1QFWI 1QSFA 4R3SA 1L0YA 5HD8C 5D6DA 1V3KA 1XCQA 5EUKA 2DQFB 1BBDL 4P23C 4Z7NE 2Q7YA 4D3CH 4PJEA 2E3VA 3GJFK 5EOQL 4YHMH 5E56A 4OCWH 5DLMH 4IS6B 3VD3A 1MRCH 1S7QA 5GJTL 2CPCA 4M6OH 1S5HA 3RQ3A 2FZ3A 5MP6H 2B5IC 3VW3L 1S5HB 2HJKA 1SM3L 2ZCHH 3QI9C 4NRXA 1CBVH 3TBVA 1R3KB 4QRTB 3SDAB 1CGUA 3K0WA 2VXTL 1DANT 4WHTA 1E0OB 5AYQA 1KPUB 1HQ4B 3PWVB 1IEAB 4ZOBA 4OZIB 5DJ2B 2HT2C 1OTSC 1EGJL 1B6UA 4C58B 2DL2A 4XH2B 2H2PD 4X80H 5GJSL 1XCTB 4GAFB 4UOJA 5DD1L 1O0VA 2ADFH 2B2XL 3KS0J 3C08H 2GTZB 3I50L 1HKFA 1ZVSB 5CEYA 3MLPA 4MD0A 1QBBA 5BMFH 5B39G 5JDSA 3L3JB 4P2OB 3HG1A 4Z7UF 2FRGP 4PLKD 2C3HA 4Y2OA 1BAFH 1TMCB 3S37H 4PJGA 2Q8BH 1OQXA 3EZ8A 4U1NB 5F1IB 5KSAD 2ZPKH 3VXNA 5JORA 3IJSA 5EO0B 3VA6A 4BKLB 1I4FB 1AGDB 4FQQA 2IAMB 1MCHA 2BNRB 3BSZH 1A21A 4NDMA 2CH8A 3V6OE 5E2JA 3BGMB 5D71L 4X8JA 5C0BB 3NIDF 2JCCF 4OFYD 3JV5A 3MLZH 1JPFA 3O2WL 2Z91B 3PWPB 4Z95H 2AXFA 5IEHA 1YY8A 1ORQA 1EERB 3U2SB 2GHWB 1I85A 1YPZA 3QRGL 2Q8AH 4KROD 3L7EA 5DD6B 4R96B 2XTJD 4KK8C 2HJFA 2XPGA 3TWCL 2BVOA 4PB0L 3VE0A 2G9HB 5F9AC 5KSVB 1JGVL 4F15C 3QDJB 1UXWA 2FJGA 2XG4A 4LGRB 4UMGA 3LQZA 4FQXD 3NOIA 4UIKL 4GJTB 4M43H 3X14A 5T3XL 1B2WH 3ARWA 1T04B 2CO6B 3MNWB 1INQA 1QFHA 1R3KA 3FQNA 5AZ2H 4KK5D 3BUYA 3QDMA 5JUEL 5F7HA 5BOZG 1F00I 4XTRD 4RFOH 4N68A 1G9NC 5MP6L 1AD9B 3RUGA 2ARWA 3VW3H 4K7PH 4OLEA 3STLA 1CFBA 3QQ3A 2ZCKL 4ERSH 1KELL 1G7MA 1MFEH 3QWQB 5EZIL 3GGWB 1FVDB 4NHCH 4BQCA 2KDGA 2QADD 4PR5B 3BIBX 5I18H 3QUMH 5B4MD 1LO3L 1JHKH 3C9NB 4S0TD 3QEHB 4OCLC 3O6LH 3LQMA 4M1DH 4HKJB 3IDNB 4Q6IC 5E4IA 1DBJH 5DGQA 3RY5A 5HVGB 2A9NL 1KNOA 3CVHA 3O3BA 4JPKH 4XCEA 5F9WC 3C6LC 2D7TH 1FL6B 4PY8I 4F7CA 4P2OD 3KJ4C 5EBWA 1IGJB 4DZBB 2IPUK 3P9WB 4M8VA 5F1KC 4DKEH 2O5YL 2VE6B 2MJWA 4V1DD 3Q5OA 3GJFH 1UKTA 3CFCL 5E1HB 1CXEA 2BOBB 5TDNA 5DQDL 5D2LF 4PY7A 3CLFL 2NY0C 4UQ3A 2I26N 2OI9C 1T3FA 1F6AB 4MXQC 1NAKH 2W9EH 5KSBB 2X42A 3FOMB 1FG9C 3R1GH 4FNLL 1WWWX 3M17A 3L3DA 2IANB 1HI6B 3VJ6A 4XNMB 1BQHA 3MCKA 3O4LE 1DLFL 1OW0A 5IJKA 1HNGA 3NZHH 5DJXA 3V4UL 2CDFA 2R56H 3KGRA 3B5GA 4LVEA 5E24E 1IC4L 2R0WL 1FFNB 1JWSB 1T5WB 5SWQB 4MZ3A 4PB9H 3FO0H 2APTA 1FJ1B 4LLWA 1FLTX 4NC2B 3CD4A 1CZ8L 2CLVB 3D69B 1WFTA 2UWEF 4N90D 5TDNB 3PXHA 4ZSOA 2DQHH 3PQYA 3VGBA 1FDLL 2BNQD 1OAYL 4DAGH 3WD5L 1MPAH 2W65A 1RJLA 2MCG1 2YD9A 1YPZF 3BOVA 4YBHA 4PJFA 4XX1G 2E7MA 3QXDA 4X5XB 4LFHG 5IHLB 4NHUA 1DUYB 1JPTH 4JR9H 2Z35A 1UM6L 4MAYC 4M7ZC 4AH2A 3GBLA 3GKZA 25C8L 3K8KA 4GRWE 4FQHB 4PJHE 3FRPG 4BZ2H 5D1ZA 1XIWA 3CK0L 4H1LA 3QSKB 3SDDC 3MR9A 3NFNB 3PL6D 3UYOD 4P5TB 3BP4B 5KVFL 1JGLL 3VWKB 2ZCKH 4JLRB 1OWRM 2V5YA 1FLRH 5F1SA 1OOAA 5IQ9B 1PLGH 4JPIA 2HP4A 4GG6E 3QPXH 2UZXB 1U8KA 1WTGT 3V5DB 2BC4A 3MUJA 4LPYA 3U9PH 5JO5A 1MOEA 1NC2A 4WWKB 3JWDC 4KPHH 4LPUA 3H9YA 4LVHB 1A64A 1TNMA 4DUVA 3QXDB 4X5XA 2NXZD 2VXVH 2W59A 4JO1L 5CIPH 2C4FT 3SE4C 4GG6B 3UTTB 5K9QG 1CFQB 3W0WD 4C83B 2RAMA 1XR8B 3V6OA 1FRGH 3ROLB 3TN0D 1BJ1J 3MRDA 2VLKA 3BWAA 3MV7B 2CUIA 1ZGLP 3EZJB 2EXYC 5EWIL 3EYVA 5EC1A 3QDGA 2HN7A 3GMPA 3NFSH 4DN3L 1GGBH 4LF3A 1ZGLM 3X3GL 1MCQA 1SYVB 5SWQA 1CDHA 4CNIA 2P8PB 1PVHA 3HZYB 3QIWD 4CMMB 1A6UL 3EDDA 2Y5TA 1QSED 5IIEA 4XMPH 4PRIE 5GHWL 3MV01 5J1TC 2BY0A 4YZFF 4NPYA 4JRYA 4NZRL 3S4SA 3MCLL 4TVSa 5FYJE 4ZQKB 5I71C 4WUKH 2NY6D 1BEYL 1I4FA 2ZUQB 3WFEL 3OKYA 4G9FD 1KGCD 4L4TA 1A3RH 5JQ6H 3BDBA 3C60C 4FTVA 4ZFGL 2A83B 1S7XB 3JVGC 4IIQB 1KIRA 3FO0L 1BFOA 4AL8H 4PJ8A 1F6AA 1RIHH 5EU4B 4S1QL 4P3DB 3Q1SH 4F3FA 3CXHJ 5D7KE 1JGDB 2COQA 4Y16B 4G8IA 3WNPA 4BH7A 3T09A 1A14L 3HE6C 2NX5E 5JXAH 2DTSA 1JRHL 2OQJB 3CX5K 1QKZH 4QHLB 4JQVC 1ZHBA 4LKCA 12E8L 1FNFA 1BEYH 1LDPH 4MJ5B 3MCG1 5C0BD 1K2DB 1IAIL 2AS5M 4HZLB 5FM5O 1EHAA 3BN3B 5DC9B 3BYTA 5GRVK 1VGEL 1SMOA 1BD2A 4UTAH 4J3SA 1YEJL 3ARGB 3TIDB 2PCPB 1MI5E 3V8OA 4M5YL 2B4CH 3U4BH 3LV3B 1JL8A 2B4CC 5BV7C 1LEIA 4WI4A 3G6AB 4XMLL 1JZ6A 5MHSD 4HSQA 2PXYA 4OI9A 4YC2C 2ESVE 4FN0A 3BP6B 1NGXA 4HH9B 5IEKA 3FCTB 4MAYB 4MQ7B 2XA3A 2L0DA 2AJUL 4TPRH 5F7KC 4XNYL 3ZSSA 3VXSB 3KJ6L 4ODVH 3MV9B 1YEHL 3OXSA 4X9IA 4Y4FB 3OF6A 5TFSH 1MFEL 3ARUA 1T2QL 1OTTC 2E9IA 2G9HA 5KSVA 1HHIA 5AAMA 1OCWH 5IW6B 1AO7B 1R3HB 4R8WL 2DQHL 3BWUC 2NXYD 5IVXB 4ZTOL 5C70A 1I8MA 3VFOA 3GSVA 2AEQL 1GGYA 2FECL 5DD6A 1RIVL 2YN3A 4MJ2A 4QRPE 4YE4L 1MHCA 2AK4D 2WV3A 2C7UA 3MXWL 4RGNC 5FO8A 4M00A 1FZMA 4LQFL 1V7NH 4U1GC 3EO0A 3PABB 2R1WB 4TN9A 1JN6A 3MUHL 4O2CA 4PRAB 5K9JL 5BO1H 1RV6X 1I9JL 3CK0H 4JO3H 3VCLA 5DURD 4M6NH 1MI5A 1LP9A 5IB1A 3QQNA 4URTB 3RGVC 3ZHKA 1J1PL 5HD8D 4L29A 2GJ6B 3LKNB 3MRMA 1B0GB 2BVEA 1KFAL 2FGZA 5DK2B 2ZOKA 1IKNC 2BNUB 3EDJA 3RY6C 1JGEA 1IC1A 1X4YA 4F15B 3R06A 3KWWB 4KQ4L 5JHLH 2VLMD 1AI1H 4X4YA 4O4YL 3TBWA 4PRPD 2RR3A 3Q6FB 5FK9A 2YD3A 2GTWA 5J1AB 1UKSA 3IFNH 3IU4H 3HPJB 5DFVC 1FNSH 5DJZB 1E27B 4V1DA 3O3EA 2O5ZL 3T04D 4FQCL 5IR1B 3FO1A 4CJ1A 1D9KC 3QUML 4P3DA 4M5YH 5LG1A 3RWEA 1CFNA 1AGFA 1ULVA 3WJJC 3EKCA 1TQCC 1RY7B 3QIWB 5SX5H 5JQ6L 3ARBD 4ZAKD 4ZXBD 4AEFA 1H3PH 3CDFA 1A4KA 5HVHB 5JHLL 4B7IA 2CGRL 4W6WB 3F7QA 4LCYB 1KC5H 1T4KA 1MVUA 5E9DD 1H3GA 1HHGB 3MUY1 2NY4B 3GSUB 4RMVA 4X6EB 4XVJL 5GGTA 4EUPH 4JAMA 5KSAC 3KJ6H 5CEXA 3WBDA 2I5YH 1I3VA 1DLHA 3FONB 4G6KL 3TPUA 3NCCB 3KYKH 2EZ0C 3GSVB 1Y0LB 3TH4T 1VFBA 4NKQB 5IWLA 7CGTA 5JPNA 3SBWA 3IJHB 4KDWA 4Y4FA 4K7PL 4X7CC 4OKVA 3HMXH 3H42H 3U6RB 4Y0GA 4HFUH 5DC0A 3CX5J 4UDUB 1PX4A 2NY2C 2ZKHH 3O9WC 5BZWA 3FB6A 4ZG1A 3R4DA 4OAWB 3VFMA 4X7SH 1F4AA 1CT8B 5L2JA 1XMWA 3JV6A 1CDIA 4QRUA 1G7QB 2PO6A 4U2YA 2VR4A 5D2LE 5JZ7C 3DGCR 4NO0A 2OJZL 3HC4H 2VDPL 4XPAL 5DJYA 2XN9B 5E5MA 3MV8B 2GT9A 2QQQA 1MHHB 5D1ZB 3KXFB 1ZWIA 1IGYA 4ESKA 1OSZB 2AK4E 3PIQB 4M6ML 4V1DB 5JW4Q 2VR9A 3WFCL 2OXGA 4N90E 1GVIA 3MRRA 4P0DA 4ODHL 4PJXB 5J1AA 1VERA 1MREH 3VXTA 2HWZL 3FQTB 4IBLT 1FCCA 4TQEH 2PYFA 4I9WE 4X6FB 3EBAA 5ID1A 5EN2A 1EMTH 1ZHBB 2YD7A 3LIZL 3IAGC 5E70A 4RFNC 1J12A 3SDDA 5EBGA 2P47B 3QDAA 4JM4L 4KY1L 4F57H 2NX5B 4OFKA 1D5XB 5EU4A 1NC4B 5D7SL 1FH5H 4GLRI 3BQUA 4TSBH 1H3XA 2E9WA 4K3DL 1HIMH 4PB9L 1CTOA 1TZGL 1PQZA 1DANU 1J05B 1XF2B 4P4KD 1EK3A 5D6DC 4M6NL 3W9DB 5FYLH 5IOPA 3AY4C 3QUMB 5CP3A 4ZQKA 1EEYA 3SOBH 1FRGL 4QHNA 2NZ9D 2R1XA 4U6TA 5KSAA 1JFQL 2ZOLA 2WAHA 5JHDD 2PW1B 2Y5TB 5IIEB 1YYMH 1FVCA 5DD3L 5A16B 3ZHDA 4OCXH 5IP4A 4QOKD 3H7BB 4GUPA 1IAKA 3L95A 4DN3H 3TIEA 1JZ7A 4HZLA 1S7VA 1INDL 1RZ7H 5KVDH 2HN7B 2UWEB 5FHBL 1CBVL 1S9WB 4HS8H 1U95B 4LLVA 4G80A 4J23A 2OQJA 3WIFA 5D70L 5E00B 2C4FU 2V7HB 1JZ3A 2N56A 3WLBA 4JZOB 3N1GC 5JIPA 3MRPB 3QXAA 5LKNA 5CS7A 5F7DA 1R6VA 3UDWC 4TVPE 4CN4A 3J8F7 3QEHA 4MQ7A 1GC1L 1XF3A 4S1QH 3M07A 5DRXB 4BH8A 2B1AL 4I18B 2UZYB 5HDBF 3S35H 1AP2A 1UVQB 2MOVA 4HWBH 4TULH 4MB4A 3UJJH 5A40E 4NSKB 5AYUH 4M7LH 3LQAH 3FZUD 5EIIA 4G6KH 1HCFX 2X4TA 1ZAGA 1RZGA 3CSGA 5HGDA 4TUOA 2HMIC 5IB3B 4FQIH 3MGAA 5E6IB 5E4EB 1QA9A 1X5GA 4OFIA 1KJMA 5BXFB 3ZLQC 3IDMA 2VLRD 3U1SH 4UTAL 3JXAA 1NSNL 2X9XA 5HHVL 1CN4A 4XBPB 3HCVA 2ZNWA 3G5XA 4P2RE 4WY7H 1GOGA 3VH8A 2GSGA 4NGHH 1I1AD 3MA9H 2FATL 2OK0H 1DZBA 5FGSA 3QUXD 1DBKH 15C8L 4JCLA 2CK2A 4I0CC 4KJWD 2YC1A 1LE5B 1A7QL 2E27H 1NMAH 2E9JA 2JLLA 2IQ9L 4PJXE 4KKBC 4PJIB 2X4RA 5LQBL 4F80A 2ICWA 3CH8A 5DQJA 1GRWA 4O5LH 4Z7NF 3MROA 3TA3A 3MRBA 4GO6B 2I9TB 1NCWL 4UOW1 4DKFL 4K23H 4NGHL 3E1F1 1K4DA 1IC7L 3WFEH 4YO0B 3V0WH 4NC1E 3V0VB 4K3HA 4AZ8A 5IESL 4ODUA 3MRGB 5CCKH 1X6NA 5EU7E 2W9DH 4HD9A 3BE1L 2WSKA 3NIFF 4UAOC 1U8QA 1GSMA 3HG1B 3G5VA 2ZG1A 4JG0H 1L6ZA 3E3QC 3L3OB 3LIZH 1QP1A 4MLSA 4JGMA 3FZUC 4NRZA 4QNPF 1BZ9A 5GRJH 5AG8A 4PRBB 2ICWI 2IANE 1MWAB 2HT3D 3J7HA 1A9BB 4LSRL 1BJMA 5DFWH 1GGCH 2PW2B 1T6WA 4XC3H 5CSGA 5D7JD 5F3HA 3T4YB 5A2IH 1S9WA 3O6LL 5TE7L 2Y07L 3WUZA 3IDGA 2R29H 4K07A 4Y4KA 3D48R 1E4XL 5KANI 3BKYL 5I6XB 4E42A 1YEIH 2ADJB 3FO9B 5DRZA 2HJLB 4K94L 2FB4L 4NOFA 2GCYA 3JWOC 1Q72H 4X6EA 4MAYD 2QQKL 2O5YH 4QHNB 1IARB 2DQJL 1EHXA 4DZ8B 4HS6A 1GYAA 4ZAKA 1C12A 4LSRH 3WMSA 2B7DT 4XNUH 1CGXA 5ICZA 1EBAA 5EA0L 3X12B 3QAZC 4QYOB 1C7TA 3WFHB 4XNZC 2YS4A 4NQVB 2CIIB 4NKOA 3F7PC 3QH3B 1WITA 3DROA 2AKRA 3PWNA 3O6FC 1E4XH 1KJ3H 5IF0A 4TPRL 1J1XL 4GG8B 5IMKA 3OPZH 1NSNH 5HHVH 4Z7QE 1F11B 1XZ0B 5IJKC 4GW1B 3QFJE 1W0VA 5FO7B 2GW5A 2HRPL 3QZWA 1R3LA 2OJZH 2Y7QB 1QBLH 3H9ZA 2ED8A 5IW1A 5ACMA 3RZCC 3ZDYE 3F5WA 3SKJH 3IB4A 4P9MH 4KWUA 4OFVA 4PJAE 4WFHD 4UDTB 1YNTB 3PIQA 4O02L 1JGUL 3SGKC 4FFWD 5LQBH 4G6AD 4JFPB 3QUZC 4AQOA 3MV8A 1KSRA 1UB6A 2X4OB 1MHEA 3ALWA 3KXFA 1IT9L 3H0TB 2DMKA 4M61A 1DQMH 4MXVE 3RA7L 3B5HA 4GW5B 2APWA 4P5KB 4KK9C 3X3FH 3CFKB 1PYWA 5C8JB 5C09E 1FIGL 1QOKA 3T8XB 3RFZC 3NCMA 1DEEA 1JIBA 4WO4D 3L5WB 3QI9A 3MRKB 2B1HL 4KJQC 4Q7DA 4NC1C 4WUUA 4Z7UB 1D5BA 5I1JL 5JZ7D 5H94A 4GG6F 4Y2DA 4R4NC 1NANI 4O4YH 4LLVB 1A6VL 3TJHD 1DEDA 3ZT5A 4U49A 4BSVA 5DZNA 3HA0A 4F33A 2M1KA 5ACZB 1HEZA 4CN1A 3RWJB 4KZEH 4IRJB 4DEPB 4XTRC 3ZKXC 3BGAA 5ANMB 1WZ1H 3T65B 1YYLL 4U1GB 2AV7B 1ACYL 3UAJD 5IF0B 4PJHB 1R0AH 1XGUA 4MDIB 5BO1L 4WENB 1ZA3A 5IW3A 2KL6A 5DHVA 4B53A 4NKOB 2CRZA 2DYPB 1T4KB 2AEPH 3O6MH 2VLJB 3AAZA 4MA1C 1MJUH 2NR6C 3TBSA 3B6SB 2AAVA 1FFRA 2JK5B 3CDYA 3VG0H 1EMTL 3KYOA 3VGAB 1JN6B 3OAUH 3S96A 1GC1H 4PGJA 3PHSA 4KZDL 2P5WA 4Z8FH 1HHHA 5D7JA 2O5XH 4RMTA 4WIQA 1A1OA 2YWZA 2ZZUT 4PD4J 4FABH 4YDLB 1E27A 5J3HD 2R2CA 3KDMB 2UYLA 5FF6B 2VABA 1TJGH 3SQOL 5F96H 1BWWA 1ZMYA 2ZCHL 5TE7H 5GGVL 5E08L 2PTVA 3L7FA 3IU4L 1J11A 1MFBH 2RBLA 3K2UL 4X7SL 1IEAA 4JCMA 4TUKL 1KEGL 3VXUB 1YN7A 2XPGB 1I8IB 3LN4B 2PNDA 1MAKA 1PG7H 5TDPB 1MWAH 1VCAA 2JE8A 4N5UA 1CD0A 1JWMB 2XXCB 3EDKA 2BNUA 4JZJA 2R39A 4HK3N 5F97E 3T8XA 4R4FL 2CMRL 2MHAB 1BGXH 2XN9D 4GXVL 3EO9L 1VB9A 5ADOH 3W11C 1F4HA 2XWBA 4ZNEA 1OAXL 3O8XC 1CICC 4P5KA 2EDTA 4M7ZB 4HV8B 3RWHB 3QUXB 5E94B 4N9OB 5KTEH 1JZ8A 4PRAA 4XNXH 3UXFA 5C2UB 5ACLA 3H7LA 5I16B 3PABA 5J12C 5HI4C 5SV3A 4YNYB 3VXOB 3MLSL 1HSAA 1TTGA 1DBBL 5DS8A 3QDGD 4M6MH 5CFHA 4GXUM 2APVA 4K7PY 3UTOA 3OJDA 4OT1L 4WHDA 3MV9E 4LKXB 5C0EB 2FYYA 3HMXL 3MOAH 3NA9H 3ULVF 3VFGL 2Q76A 3C5ZC 5L88L 4PGDA 1GIGL 3BWAB 1BBJA 1YPZE 1LEGB 3OKMB 1H5BB 5DJ0B 3VD4A 4NOBA 3L5XH 2VL4A 4P2QD 4PPTA 4PBWD 5D2NA 5TFSL 4R0LA 1AHWC 1FZOA 4H5SA 1N3NB 1Q0YL 4Y19B 4YHZH 4CKVX 1AQDA 4KI5E 4YEFA 4OD1L 1BFTA 4UIMA 1F02I 2FD6L 3GSXB 1G6RH 2IADB 4RZCA 4ZTOH 2DM7A 3B9EA 5EU6A 3HC0A 4OQTL 3GMLB 2RGSA 1JP5A 1K8DA 2VITA 1PW3A 1C12B 5HHNB 3ARBA 3TNNB 4MJ6B 3ALPA 4UT9L 3U36B 4LSUH 4ONHB 4NPYB 3NIGE 2NY5C 2VH5H 3WNNA 1MF2L 5ANMA 2N4IA 1VHPA 2B39A 3L3HA 2P5WE 1QBMH 5JNYB 4JEGB 1MFCH 2F53E 4XP4H 2P46B 3Q5YA 4GLRH 5F88A 3DXAA 3E8UL 4N8CL 3IDGB 2ID5A 1P9MA 4HBQA 2EIBA 1F6LL 1MCKA 4OQTH 4ZFFA 5C07D 3SKNB 3GSRB 3TA3C 1ZLWK 2D9QB 1IKNA 4G8EA 1FYTA 5JLZB 3MLTA 2XQBH 4ZUWB 4EI5D 4YBQC 1AQKL 2A77H 5L8JB 1NFIB 1I9RH 5MI0B 3BPOC 1BVLA 3V7MA 5F70A 4AK1A 5I2IA 4RBPK 5HI3C 3VG0L 1P4BL 5I1AB 4KJYA 5LXGL 2BVUA 3RWGA 2A6DA 2R9HD 2DI7A 4RAHA 4J7RA 4B41A 4Z7QF 2RFXA 4XCFL 5EOCH 4JKPH 1FCGA 2R4SL 4WNQA 3U79A 3EUUA 4GW4A 5I1LA 5C0ND 1TDQA 4N9GB 1WQVT 1FE8H 4GW4B 5JMRA 4MVBD 1CR9L 2JCCE 4JJ5B 4KQ3L 2W9EL 2NXYB 3NFNA 3VWKD 4L8SA 4P99A 5C71A 3M1BA 3VXRA 4PUBH 5J6HB 1TVBB 1S9XB 4ETQB 2KBGA 3MLVL 1U6AL 1K3IA 3IS1X 2AK4A 1HSBA 2MQCA 4JDVB 3LPGA 5CMAA 3O2DH 4XWGL 4ZFOL 3BP7B 2NTFB 1IAIM 1NUNB 3EOAA 4M1GL 2Q7NA 2W0KA 3UTTD 4Y19D 3U7YH 4LIQH 3K4ZA 4GAJL 1ZANL 1BLNB 4GXVH 3EO9H 1BAFL 1NGZA 3FT4A 5I8EA 3W5MA 4Y5XA 2VDNH 5ALBL 1G6RB 4OBSA 1J0KA 2VSCA 1R5IB 3QCTH 3NFSL 1HXMB 3PV6B 9CGTA 4OD1H 2EO1A 5BXFA 3MBEC 3RVXD 4K3JL 4ZS7L 1IL1A 4L8DA 4X7TA 4BSJA 1FVEB 3CIQA 3NCJL 2YUZA 4Y4HA 4G6ML 4K9EL 5GGRY 2CJUH 2WBJA 1EJOH 4Z7OE 3GKWL 4Y88A 3BP4A 4RA0C 4XWOC 3RU8H 4BH8B 2EEBA 2IQAB 3KPQB 1OP3K 3MCKB 1T1YA 1GOHA 3ARDD 3C2SA 1HH6A 5J4MA 4GMSL 3MXVH 2R29L 1WFNA 4KKAC 4CMHC 3QI9D 5EZOH 1EVUA 3EO1B 1LDSA 4KH2A 1YEIL 3Q6GL 3SE3C 1MH5B 3WN5C 3EW3B 3P4NB 2CLRA 4L3EB 3QPXL 2PW2A 3DO3A 3SO5A 1S7SB 2AVGA 5JA8B 4X4MA 2EE3A 3MLTB 5GRXG 1C5BH 5L2KD 1RJLB 2H1PH 3VFGH 2FWOA 3I9GH 1DCLA 5D1XA 1UJ3B 3W2DL 5DDHA 1PEZA 4YHOL 5JW4N 1P7QA 4KUZH 5HYSB 4NN7B 1BFOB 2VUYA 1I75A 3ZSTA 2UUDH 3FAWA 3C60B 2VIRB 4Z7VB 1P2CA 4YDVB 2I60L 3WL9B 1FNAA 1RZIB 5CEXB 2F53D 2DIAA 3MV7E 4S1RH 4LCIH 1IZJA 1MCSA 3D0LB 2P5WB 5I8CA 4N9GA 4KY1H 3P11L 4F57L 5HYJE 3FT2B 4FFWC 1WGOA 1PG7L 2IAMA 3S4SB 5E0QA 3SDYL 3RWGB 3L9RA 2YEZA 5T3ZE 2VC2L 4HF5H 4M7LT 3AAZB 1UZ8B 4H20L 4UU9A 1N26A 3OKNB 1YEGL 4N0CD 4HWUA 5DYOB 1XGQB 3G9VA 4N8VB 1E6JL 2OMNA 4XP9L 2WANA 4NZTH 1UJ3A 1VEOA 3LDBB 4TVPL 3RIAK 3P2TA 3CZFA 3QB7C 3ROLA 1P5VA 1ZLVH 1GL4B 3L3IA 1X7QA 1CFVL 4EXKA 4EQ3A 1AH1A 1P6AB 4LRNL 1ZA6A 2WP3O 3SKMB 3C9NA 3MBEA 4PJXA 1JGUH 2AK1H 5E8NA 4M8QB 2VLLA 2P5ED 3S34L 2O5XL 2QLVB 3GHEH 3OF6D 1VPOL 2IQAA 4JDZA 4P2OC 2H32H 3TO4D 4QRUB 5CKGA 3QQ3B 4ZS6D 5TQ0H 4J3XA 4O9HH 3UTTE 1FGVH 1KEGH 2DM2A 1L6XA 3BPOB 3D39B 4U1HA 1XAUA 3FFDA 4OB5H 5AZEL 5IFJB 4Y19A 2V2WA 1MWAL 2HT3C 3SY0A 2H2PC 4HKBA 5SWZD 5EZOL 4OGZA 4XHJD 4KQ3H 2XN9E 2JJTC 3BN9D 4MNGB 4YXKL 2VLKD 4JFFB 1IAII 1C5BL 2DKUA 1XGPB 1JYNA 1EO5A 3UBXI 4Z9KB 1OM3H 4U6VL 3ZYIA 2ZUXA 1NAMA 3A6BL 4UT7H 1S7TB 3UTSA 2P45B 4J4PC 3HNVL 3CFIC 1ZV5A 4ODVL 4YHPA 5IW1B 1CVRA 4HWNA 4G42B 4XP4L 1FJ1A 5JOEA 4J8RB 4R7NB 1QFUH 5JHDA 1SBSH 3RVXC 4RFNB 1FVCB 3D2UB 4BUHA 4DGVL 4KTDL 3TN0C 4WI3A 3SDAA 3B4NA 1HHGA 1HXYB 3DLQR 4G9FA 1DBAL 4PRIB 3I2CL 2RFXB 5F1IA 2ENSA 3TFKC 2VC2H 3M17B 4KKAD 4J3TA 2HT4D 2WMPA 2LU7A 4YGAB 4ZS7H 4KK8D 4ZAKB 4ZXBB 1JYXA 4OCNC 5FKAB 5AG9A 5I8OL 5FYKL 3HE7A 3LEXB 3S4SG 1F3RB 4ONGL 4CN6A 3T2NL 4H88L 5D1XD 5C0AB 3RWEB 3QEQD 5EZJB 3MRNB 5CJBA 1P7QD 4JRWA 4LVNB 4G8FA 4I48B 2GTZA 5IESH 1XCTA 2UY7A 4JO4L 4JRXA 4PGCB 1LK2A 1RVFL 2DMCA 1Q9WA 3BPCA 2Q3AA 5KSBE 3STBA 4F2MB 3M8OH 2BFVH 5C7XL 3QZWB 4H1LH 1UKQA 4TOYH 4XVTH 3MLVH 1N0XL 3WNLA 2QQNH 2X4QB 3H9HA 2XV6B 3TO4B 2X4SA 3NGBB 3IKCB 3CFEA 1ERNA 4LLUB 5E2TL 4PRDB 4APQB 1D5BB 5SWZE 3F6IA 5I76A 2HRLA 3HE7B 3U36A 2OTWA 1EHLH 4NO0B 3OGCA 3QFJD 3MNZA 3MMEB 5BW7C 1WWCA 3IF1A 4GT7A 4WWKC 3P3YA 3T0BA 3MACL 4BFBD 3CH1B 3D85D 1OAUH 2FJHB 1NJ9B 3GO1L 3MOAL 2OL3A 5FUCC 4TTDC 4AJ0A 2D7NA 2WK2A 5CP3H 3P11H 4KDVA 5FA4A 1IQWL 4N0FA 1UWXH 4FG6C 1INQB 5ETUA 3UPRA 2Q86B 2A1WL 2J12B 3BPLB 3DX6A 1I9RL 1LO2H 5GGRA 5MEOA 4F8QA 4OT1H 1I7RA 2J8UA 1GH7A 4HK0A 1I8MB 4L5FH 5DO2D 1VA9A 3JBG7 3NVQA 1TQCB 4NFDA 1E4KA 2B0SL 2FBJL 4S1SH 3ZKMC 4MXWL 3UYPA 1RULL 1DDHA 5GSVB 5GIRA 43C9A 4JFFA 4PJAB 4R4FH 3U82B 5C9JA 2Z31A 4NCC1 2B4CL 3G5XB 3IDIA 1U8NA 2HTKD 5TGBA 1RJYB 2QV2A 4YHZL 3LSOA 1ETZB 3PP3H 3OZ9L 4L8SC 4ODSH 3EAKA 4V2CB 4U7SA 3BT2H 1AJ7L 1T0MA 4HH9A 5EORL 4BQBA 3GSWA 1I7ZB 3QEGL 2Q87A 4W4OC 4WFED 4QRRA 4XBGA 3K1KC 4WTXA 5CZVH 5DMGD 3DV4A 3DRTB 4IHOB 1FL5A 3FB7B 5M95B 5C6WH 4PJIF 5I9QC 4OCXL 3H9HB 5ECJE 1JE6A 4OZ4A 3ZYJA 4LK4A 5FUZL 2QKIB 1K2DA 2OMBA 4NM8L 5SX4H 2H3NB 3BPCB 3CDGA 2X7LA 4YHYC 3FAXA 1XH3A 2QHRL 4JM2A 5ESVB 2HLAA 2VDLH 5BV7B 2A6KA 2CKBL 4DQOH 1CTNA 3AU1B 5E2WH 3IS0X 1PKOA 1PKQB 4KU1A 2NYYC 1NCUA 35C8L 1EFXB 3OTTA 5EFIA 2X89D 4WI6A 2DS4A 1XGQA 4N8VA 1XEDA 4JO3L 1RHFA 4QT5A 2F53A 1N59B 4LMQI 1SBSL 2X4TB 3P0GB 4LSUL 5ENWB 3TP4A 4PJ9D 3O9WD 3RNQB 4KMTH 3GSNL 2QHRH 5DZLA 3TVMD 2Q6WA 2VZ3A 5I8KH 4TULL 1JF6A 2Y72A 4P23B 4L4VA 3THMH 5I1EH 5HDLA 3HB3C 1XF3B 5D7LE 5FUCE 1LK3L 5BVPH 4NJAL 5F9JB 3GZKA 4I3RH 3TVMC 3RY4A 5D1XB 5C0AD 1JF1B 4MVBC 2XKUA 4HGWA 4KUCF 1U3JA 5KS9A 5D1ZC 4X7DC 3KPRB 1XR8A 3I02A 3PJSB 5CGTA 5FYJH 3ROOB 5I8KL 3D85A 3TNMB 5ID1B 5GGSB 4WVRA 1TJGL 4LHJB 2EE9A 5C3LD 4GRWB 5DEFA 2ADGA 4DUXA 4WO4B 5BVPL 2DI9A 3KR3L 4P2QA 1I3GL 2WW8A 2R2BA 3RPIA 3VGGA 2P5EA 1IGYB 3V5KA 4FP8L 1BFVL 4TSAH 1ZEAL 4GW5A 1UCBL 5FO9B 4NO0D 3BSZL 3L6FB 4WI2A 4QXTA 3V7AE 2XKSA 4YPJA 1UZ6E 5FYJL 3MROB 4QXGL 1DR9A 2BJML 5H37G 1JYVA 1HHJA 3RIAF 5FA3B 3VXMD 4NQED 3LMJH 4A6YL 4Q2ZB 3S9DB 4PJIA 5FYKU 4LP4A 4RISH 1R5IA 3LD8B 3LKSA 3BE1H 4Z76B 4UDTA 3SHSA 4V2BA 3IDJB 1FAKT 1U91B 5C0DA 3EYSL 4IMLA 4JM2C 1D5XA 3FMGL 1KTDB 3DVGA 4PG2C 5INDB 4G5ZH 3C60D 3IJYB 1FGNH 3IJYA 1LE9A 3MFFA 1PZ5A 3RPKA 3T3ME 4M7KH 4UV4H 2W0FB 4L8CB 1R5WA 3NA9L 1U2CA 3BT2L 3PWUA 1OP5K 2FL5A 5IEHB 5J6HA 2YD5A 3DX7B 3ZTJH 2ITDB 4Y4KC 1C08B 4KJWC 4S1RL 5KOVC 2ESVB 2PO6C 5B21A 3EJJX 1IAKB 4K94H 2VSDA 4OM1H 5A1AA 1HYSD 3BESR 4I8DA 3V6OC 3MGTB 3VFSA 5TE6H 4L4VB 1DL7H 5E8PA 2VDPH 3KLDA 2DI8A 2ARJQ 2HFGL 1HI6A 3VJ6B 2IBBA 2GK0B 3UBXB 5HHPB 5FOJA 3B83A 3UYRL 3SE8L 3AM8A 3JZ7A 1WLHA 2DF3A 2BVPA 2ARJB 4EJ1C 1J8KA 5I1AA 3HE7D 4ODBD 2QSCL 4JZJB 3KPRD 2EEDA 1TVDA 2W1NA 4D0CA 4OLWL 3MRCB 3D85B 3TNMA 2HT4C 2VQ1B 4L4TE 3QISA 2BRRH 5HXMA 3EYUL 1AGCA 5A2JH 1K4CA 5DHVH 3AU1A 4GRLC 4PFEA 2P49B 4YJZL 5I17A 3ARGC 4ORZC 1I7TA 4FFVC 1KGCE 1VFBB 4JFEA 1U8HB 2ICWJ 2UUDK 4YK4C 1CLYH 1RUPH 3NZ8A 1ZHNB 1KN2L 4ZS6C 4HKJA 5ITFB 5TDOA 4YXLL 2P8MB 3TPKA 2VWEE 2AERT 3UJTH 1N64L 2DQUL 3EDFA 1HHHB 2NLJB 1OAZH 4OM0L 3EOBB 3RI5K 5IM7A 5C6TL 1Q9LA 5E1AB 2VAAA 5FKPB 3EDEA 4K2UL 2V9TA 4KKLC 3MLYH 3RA7H 1RJZB 4EUPG 5F7UA 1J05A 5L7XL 3HI6H 1XF2A 4I3RL 3JV6B 2JB5L 1A6AB 5LWYH 1PEWA 4O51A 2BHYA 3MV8D 4NZJA 4WHYH 4PG2A 1T66C 1R5WB 2WP3T 3S97C 2VLRE 2VZSA 5EZLB 4I4WA 3DJ9A 3K81A 4MD5A 5H2BA 1WEJH 1JTPA 1J1OH 4U31A 1KG0A 3MJ7A 4KHXL 5I1GL 4PRPA 3V5HA 1X5ZA 2LU4A 1SJHB 5F7MC 4OJFL 2DQCL 2X7LB 1K3ZA 1H5BA 1X9QA 1WAAF 2HFEA 1IC5L 2HMID 3FQTA 4X99B 4ZSOB 2H8PB 1T66D 4ISVA 3CFDB 1RSFA 4FXGA 4QRRE 1G7IA 5F9OL 1REIA 2UV3A 2B1AH 2ATPA 4NM8H 3NFPA 4OLXH 5F93C 4QY8B 3UJIH 5C09A 2I07A 5C6PB 5IGXH 4IRSD 4YBLC 3SCMD 2CKBH 2DQIH 1RZ8A 4TUJB 5ETUB 5KVFH 1YEKH 4U6YB 5K9QI 1KCUL 1Q9KB 5HHOE 4M9OA 4R7DA 3JWDH 3R8BB 5L0QB 3BEWB 3QIBA 1NBVL 1UWEH 4G5ZL 1P69B 4M6AA 3LKRB 4MGXA 4XCNA 5EPMA 4KHTL 4CU6A 4AEHL 2W07A 1VDGA 1BVLB 1KOAA 1DQDH 4AENB 4GKNB 3WE6A 4FABL 3FHAA 1BECA 4DVRH 1XF5B 3OZ9H 2XNAA 4PJBE 1R3IH 4RISL 4YQXH 5E7FA 2FATH 3O3EB 3VMOA 4U1IA 3TYGH 1IBGH 2PN5A 2H26A 3C5JA 3MODL 2NY7H 2VDQH 4LSVL 4O58H 3HZKA 4OF7A 1ZLSL 3S5LA 2AQ2A 3NMEA 4Y4KD 4LSDA 4X6DF 3UTQA 3DXAB 2EDNA 3TPUB 3PGFL 4NP4L 4WW2A 3LB6C 1KPUA 4JGUA 4W4NA 1PFCA 3SCMC 2UYLB 5FF6A 3LZFH 5GZOC 4NQCE 5IB4B 1A1OB 4D3CL 2JCCA 2OZ4H 2N1KA 5LJYH 5EOQH 5C1MB 1JRHI 2BK8A 1BVZA 1RU9H 1U3HA 5IBLC 4YDLC 4K3GA 5GXBB 5BV7H 1K9TA 3BVNA 4ZDHB 4UAOB 5CCKL 4DJMA 2W9DL 4S2SB 4DTGH 3MLYL 3ECBA 1D3CA 1N59A 2QQLH 5FECB 3TT3L 3ULVE 1R3JB 2CRMA 2LE9A 4D9LH 1NLDH 1F3DJ 4IDJL 3C6SA 4ZUSB 5HYEA 2H6PA 3EOBA 1QTYT 4KMLB 5IM7B 2A1WH 3VD5A 5FHAL 3BKCL 4U3CA 3TT1L 3GIVA 3B9KD 1HKLH 3LKPA 3S37X 1RK1A 4OGAD 5I1HH 4QXGH 5IHZA 4M43L 4U33A 4TOYL 5I1DB 5EO1A 3RKDC 2EDRA 1EZVY 2YPLB 1BOGA 1G9EA 3GSNH 2BRRL 1SMAA 1G7HB 3BZ4A 3JWOL 4XP1L 3VXPA 1PAMA 5C0CA 3TO4C 1A5FH 4G8IB 2FEEI 5GGVH 4MNGA 5IGXL 1FQ9C 2J88H 3FQWB 3Q0HA 4ERSL 2DIBA 1IFHL 1X4XA 4PYHA 1G7PB 2A83A 4X9BA 1X5JA 5D1QD 1U58A 2X70A 3V0VA 4DN4H 1VEPA 1O5DT 1RZ8B 1FC1A 5IMLA 1BGXL 3UBXG 4G8GA 2I9LA 2V5RA 1ZT4B 3WKML 2A9ML 4JFHE 4P2OA 3FQRA 3SJVE 1U8PA 1TENA 2WIMA 1N4XL 2ESVA 1T20A 3HZYA 1DUZA 4Z77A 1ONQA 5C0CB 3C2AL 1UH3A 3KPMA 3GSNB 4XB8A 4HWZB 3UO1H 1I85C 1LILA 2E9BA 2ATKA 3BKML 4HPOL 4QXUL 1WT5A 4Q9QH 2VXQL 2EKSB 5B4MC 1QLRA 3SCMA 4HUUA 4PJ8C 1D5MB 2IALB 2R8SL 3L7FB 5CILH 4EN3A 4OGYH 3O9WB 1C16B 1M7XA 3MRNA 4IRJC 1TQBC 1A3QA 3WKMH 5HVFB 2Q86A 4ODXB 4I77H 5DF0A 4A6YA 1VKXB 3U9PL 1MCBA 2KQMA 4EI5C 4X9FA 5JO5B 3LN9A 3FQXB 4OCSH 3BP6A 4U3XA 5DYOA 1R3JA 1NAML 1UM5L 2Y36L 3P73A 4IMKA 4NQVA 3ZE0E 5HJ3A 5HI5D 1I9JH 4YLQT 3GBML 4L3EE 1SY6A 1LO4H 5IVZA 4LPVA 4OTXL 4KTDH 4K7FB 1I9EA 5K9KB 1JHKL 1UH4A 4KUCD 3ULVC 3FO9A 1XCQB 5EUKB 1GOFA 5DSCB 5BS0B 1C8PA 1S9YA 4XXCC 1NFDF 5HYQB 3PGFH 3D18A 1HEZB 4NP4H 3MRJA 1X7QB 5IJVA 4NNPL 3KNBB 1T5XA 5ADPH 1NGPH 5JIKA 4D9QE 4NQTA 1MIML 1CGSH 3C6LA 4P9HL 5CJXC 1L0QA 2GQHA 3R0NA 3QPQD 3VDCA 2OM5A 3SE9L 3I6GB 4WUUB 4Z7UA 1ZHLB 1AFVH 1CL7L 5SWZB 5ALBH 3TA3D 4CVXB 1NC2B 3JV4B 5C7XH 1J8HD 1N0XH 2D7PA 3MPCA 2A77L 4P57B 1AHWB 4HDIB 5GJSH 3GB7B 3EYUH 4ELMB 4Z5RB 2CKBB 1QKZL 2DB8A 5HHNA 2J4WH 1I3RB 2C5DC 1LEKB 1K8DB 1G0DA 4HXAH 4JDZB 5ENWA 1IAOA 3VGDA 4D0DB 3MO1A 3QO1B 5E5UB 3DO7A 1XIWB 1MHCB 5D6CB 5BJTA 5CJ8A 1EAPA 1FO0A 3NIGF 4Q9CA 3GRWH 1W72B 4NC0B 4TVPD 5CD3B 1MCRA 2V2TA 2YA1A 3O2DA 1L7IH 3LRSB 4PP2A 1ACZA 3KPRE 1FZKA 3G6JF 3VWKC 1C16A 2OTUB 4LAQH 3PNWA 3IGAB 4RSVA 5HYJD 2IWGA 4BZ1L 1DL7L 1QVOA 5LCVH 4QOKA 1KB9J 1XH3B 3CLEL 4WI9A 1F8TH 2ZUYA 1WWAX 2ENYA 4I77L 4BFGA 2HKFL 4N1EA 3KYKL 3WIIL 2IPUG 3TZVA 1QR4A 1NANH 4KUZL 3IFLL 4MAYA 2X1QA 4OCSL 4U1HB 3D9AL 2X4UB 2EDDA 5D6CA 2UZIL 2YBRB 2Z8VC 4HXBH 3STZA 2YOCA 4M62L 3OR6A 3L5IA 1WIPA 1WFUA 3WIHA 4JFFE 4C57C 1A1MB 1P4LA 4XT1C 2XWJA 4IOFD 5ID0B 2DJSA 4L9DA 1JNHB 3O4OB 3PGCA 5B38G 1MCOL 4H26A 2YPKB 4K3JH 4LHUA 2VL5B 5F9OH 4KPHL 4HC1L 4AT6B 5A2KH 1C5CH 3QJHA 3NACH 2P8LB 3BPNB 3IDXL 3QXWA 1JMXA 3TVMB 1OVZA 3HZVA 3T1WA 1NLBL 1NFIA 2QQLL 4MA3B 3QWOB 4QRSB 1QFWH 3EOAB 5SWSE 3MYJA 1T7VA 1HQRA 3GSOA 3IXAA 5CJQL 3VXME 2PETA 5K93A 2MMXA 1S7UB 4AIZB 2FX9H 4OSUH 3OR7A 4FXLA 4JFYA 4FFYH 4MA1B 2Y36H 1G6RL 4NQDE 3FFCE 4K3DH 3T77A 1J8HB 5J1SC 1TZGH 1JNNL 4O2FB 3CX2A 4ZOAA 2AK1L 2VJXA 5IHUL 4C59B 3V7AG 5C0AE 1F45A 1NEZA 4LLMB 4WV1B 1LO0L 2H6PB 3OSKA 4HKZA 4KRLB 5CWSA 5D7IB 4C55A 2JF1A 5F6HI 4N5ED 4R90H 4IM8A 4LSVH 4OZHA 1KB9K 4D9QD 2OL3B 1NAMH 1UM5H 2EZ0D 1MRDL 5DI8B 3P9MB 4H0IA 5DVNA 1G9MH 4P2CG 1FO0H 3C5ZD 1MFAH 3IF1B 1EGJH 5KS9F 3O45B 4ZO6A 3DRQB 4PBXA 2Z8RA 4NQCA 3LPWA 3O0RL 1D7FA 5FGBA 2YC1B 4FQCH 2D9CA 1LE5A 5I8EB 1MCIA 4ZMAT 5JOPE 2V5SA 3O3DA 1I8KB 3BP5B 1F4WL 3UPCA 4X6BA 3HE6A 3W5NA 4H20H 3RWDB 4IJ3B 3SDDB 4NYLA 1CD1A 3SCMB 3CLEH 3S6CA 1CFQA 3VWJD 1RK0B 3HAEH 4PGDB 3MQIA 2ZPKL 3HAEA 1EXUA 3L3HB 5ESQB 5FHBH 3BGFB 2C1OB 4GRWF 1WZLA 4TNVF 4IHOA 4KHTH 2VN4A 3C8KA 2BOCA 2Z92B 5I71B 1M6OB 4DOHB 2ZWLT 4Y7MA 4LRNH 4Q74A 1E4JA 2QSTA 4NNXB 4G9DA 4LSSL 4F7MB 3SDXB 2DQTL 5HJ3B 1AGBB 4QRRB 3SDAC 1AR1C 1DBAH 1Q94B 1EGJA 4UT6H 1EDQA 4YR6B 2EIEA 2BSED 4LCWD 5IV2A 4JB9H 2AJXH 1T04A 2NY3B 3U4EB 4MX7A 3ULUD 5C09B 1F90H 2VERN 3EJYD 5I30H 3FB6B 2NY6C 1SY6H 3TZVD 1JPGA 2HH0H 3QZWG 3KPRA 3RTQC 3SKNA 1J0ZA 4LCUB 4ODWB 4NT6A 1U95A 4R8WH 3AFLA 5T1KD 2KPNA 4HT1L 3BZFB 1WBZB 3EYSH 1RAMA 2E6QA 4YXKH 1AGEA 2Z8WC 4OZFA 5T3XD 2X10A 3PWPA 2VXUL 3QIUB 2IBGA 3HS0B 5T3XH 3MJ9A 1CXFA 1RU9L 1J10A 1F90L 4R97B 3OKDB 5ADPL 4X7EC 1OGAE 5FECA 3KYNA 1JF5A 1ZLUH 5GJTH 4UUJB 2HG5A 1W72H 3E0GA 3BDXA 1G6VK 3C09B 3GK8H 4FQ2L 3CH1A 1BQHG 3P4MB 2A9NH 1URLA 5I76B 2X40A 3IVKB 3ULUH 1BBDH 2YA0A 4GMTH 5F71A 2DOCA 5D7SH 2ORBH 3QCVL 4M8QA 4Z7VE 3HZMA 1GGIH 3UYRH 2X05A 1EXUB 1J88A 2FEDC 3RHWK 4FZ8H 5I8OH 2NY1B 4NBYB 1ZGLA 4EBQL 5I0DA 3OX8A 3VRLE 3CUPA 2ED9A 1VGKA 4IMKC 2EECA 4LU5H 3RWDA 1B88A 2DD8L 2MPAH 2OR9L 4PJAF 2DLHA 5FB8A 3RKDD 2A9MH 5HYSG 2IAMC 4P3CL 1IC4H 2R0WH 4PLJD 1UADC 4YNYA 4GRLD 4XPAH 1F13A 1FO0L 4HF5L 2BFVL 1QRND 2DQTH 1ZK9A 1F8TL 4QF1A 2FR4A 3A6CL 5E94A 3UBXA 1RD6A 4G9FB 5L0QC 5I75C 3HE6D 1IILE 5D5ME 4PRIA 2CIKB 1J0YA 2H32A 1DN0B 4HIXH 1GHFH 4OAWA 2BDNH 3SDXA 3D0LA 5I8CB 4M61B 5IUSA 4JFZH 4PG9A 3C5SA 3TV3L 5IB4A 3I6LE 3QG7H 1EO8L 1CLOL 4G42A 3HUJE 1NCAL 4YHPB 5DXWA 5LWYL 3UTSD 2VLKE 4F9LA 1RZFL 4L3ED 1T89A 1WISA 4S11A 3RIFK 2D03L 2BHUA 5ESAB 1BPVA 3H9SB 2QSVA 3OHXB 1PZ5B 4LNRA 3WD5H 3GBMH 4JVPA 1EA9C 1WBYA 3VGFA 4L5FL 5EUOA 3ARBC 5DVMA 1XGTA 4X98A 1H3WM 1W0VB 4ALAL 3U4EA 1JWUA 3V9FA 3ZE1F 5CBEB 2HFFA 3HUJA 5C0GA 3S3JA 1EHNA 2CLZB 5C08E 3G5ZA 2BNRD 2IGFL 3B3IB 4JPIB 1NDMB 4PLOB 2D03H 2XZCL 2DYPA 5HGGS 4OZHB 1YJDC 1DQQB 3OMZA 3VWKA 3OR6B 4HWBA 5TF0A 4ODSL 1MHEB 3QNYA 3PHOB 3M45A 1F3JA 1MLCA 2A6JB 2IFFH 1IT9H 1OTSD 2NLJA 1EEZB 1A2YB 2XWTB 2FDBP 3WIIH 5ISZD 5E8NB 3WFCH 2GCYB 4LQFH 1MJ7L 2YPVL 1P53A 5J13C 1ZHNA 2DLIA 3IFLH 1ZS8B 1A6ZA 3DX9A 5ITFA 3IXTB 4H8WC 3AC0A 4H8WH 4UV7H 4WDIA 5GS1B 2F8XC 2FO4A 3QDMD 2HFEB 1BZQK 1YUHB 5I17B 1LNUB 4MDJA 3ORJA 4JZOA 4NYLB 2Y7QA 4R6UA 4POYA 4Q97A 5E99H 1K4CB 5TH2B 5KS9E 4OCWL 2BSSB 1BQUA 2D7TL 4LEXL 3ALXA 4DVRL 3MYJB 3N1PC 5D1QC 2EICA 5EZLA 3TN0A 4YQXL 2Y06H 1JVKA 4FHBD 2NTFA 3RL2A 5BCAA 4TNVK 3TYGL 4U4BA 1KJVB 1JF1A 2AK4B 5FCUL 5HDQL 4M1DL 2YKLL 3DRQA 1U8QB 1GGTA 4DQOL 4FQ2H 2LAGB 1IEBB 2VKWA 3KLAB 2ERJB 1JGVH 2A73A 4L4TB 5JR1H 1Q9LB 2P43B 5B8CB 1QRKA 5CGMA 2FEEL 3SGJC 4JFXA 1GGUA 2YZ8A 5SWSB 2GJ6D 1WC7B 1DQTA 4JFPA 1G7JA 1SYVA 2XXMB 5D96B 2ATPB 2NW3A 2E7LA 3VXMB 3HKFA 1ZHLA 1JNNH 4NQCD 3I6KA 5DZOA 3RZWA 3QDME 1NLDL 2OR8A 1HOCB 3OAUL 1M7IB 1A9BA 4FS0A 4DZBA 1U8JA 3PHQB 4U1JB 3VGHA 1ES0B 5F7NC 3T3MF 3HUJF 4Y5YC 2Y6SD 3CNKA 3NCBB 3QQ9D 4K8RL 2A6IA 3VRIB 2V2WB 4ZXBC 1AKJB 4AIXA 1PJ9A 5CD3A 1ZVYA 3DROB 1X3DA 4Q6IA 4A2LA 1MJ8L 4JFOA 3VXSE 4HC1H 2EDLA 2J4WL 3O81A 4MLIA 4HPYH 2FJFA 5C07A 4YAQA 3F12A 3REWB 5IKCB 4EOWL 5GZOD 2OI9B 4ZUUA 3SE3A 4Y4HB 4HS6B 1IZKA 4S0SD 4PLKC 3N9GL 5HGAA 4RIRA 3MRHA 5LAXB 43CAB 3GI9H 3MRIA 3UC0L 4R4ND 2ITDA 5F6IB 5K9OA 3TBYA 3IKKA 4XAWL 3AM8C 3X11A 1S7WA 4QO1A 1TIUA 2BDNL 1AXTL 4GRMB 3RJDA 3EYFA 4LBEA 1U8HA 4WO4C 5DMKB 3U0PB 4BFIB 1MCWM 1T1ZA 1KF9B 1OTUC 1WAAE 3SDXE 4U1LA 3NCFB 1EFQA 5D5MA 4NBXB 2V7HA 4JPVL 1Q72L 1FZKB 2WINA 4PJ9C 3C2AH 1XZ0A 5FYKD 2ICEA 4OF0A 1IGCL 3BIKB 1OTTD 3KPOA 1KTKE 2AJXL 1GJIA 1T5WA 4XXDB 4G7VH 5H8DA 3RZCB 3D87B 3BPLC 5DJCB 1DQJB 4YHNA 5GRZA 4K7FA 1AR2A 3KS0H 4LCCA 5SWSD 3O11A 2DMBA 2J6EA 1EEYB 3QXTA 3RTQA 3IDXH 1NJ9A 1TZIA 3NACL 5FUZH 4OLYH 5SWZA 4UV7L 1W0WA 4XI5C 3UTPE 3G04B 2MHAA 4NN6B 5GGVY