4QNPF

Crystal structure of the 2009 pandemic h1n1 influenza virus neuraminidase with a neutralizing antibody
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
212
structure length
212
Chain Sequence
b'QIVLSQSPAILSASPGEKVTMTCRTSSSVSYMHWYQQKPGSSPKPWIYATSNLASGVPFRFSGSGSGTSYSLTISRVEAEDAATYYCQQWNSNPPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neuraminidase
publication title Structural characterization of a protective epitope spanning A(H1N1)pdm09 influenza virus neuraminidase monomers.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Hydrolase/immune system
total genus 51
structure length 212
sequence length 212
chains with identical sequence L
ec nomenclature
pdb deposition date 2014-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qnpF02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qnpF01
5C07A 2OS7A 5DRXA 2XNAA 3S35X 2DOCA 2R69L 2ENYA 2FR4A 4R2GB 3QXVA 4HV8B 4HK0B 5HHOA 4FQQB 1T1WA 3MBXH 2WINA 3U9PL 2IC2A 5T1LD 2WUCH 4OTXL 4O2EB 1UWGH 3HUJE 1NLBH 4LLDB 4KQ3H 1BJ1H 5E4EC 1HHIA 4XP4L 1I9RH 1LO4H 4BM7A 2FJFA 3N1QC 2RQ8A 4PJAA 1HCVA 1I1CA 4KI5E 1HI6B 2E7LA 5DJ8A 3SY0A 3S36X 3V6FB 5ICYA 3WIIH 1HQ4B 2YRZA 2R8SH 1QP1A 5D5MA 4Z7OE 5GGRB 3KPPA 2C3HA 3W9EA 3S5LB 1IGFL 1LO5B 3VFVB 2WLZA 4OTXH 1ZLUH 4NUGL 3OAYH 2XWTB 3CD4A 3C2SA 4M6AA 1YPZA 1FL6A 4F9LC 4ZS7L 4YUEH 2Q20A 4M43L 5DGQA 1UJ3A 4HC1H 4H20H 1JMZA 1HH9A 3RVWC 3NH7H 5KSAD 1OB1A 1VEMA 5DJ2B 1Q38A 4JY4A 5T3ZE 4KK6C 1CFTB 4RMWA 3RJDA 4Q9BA 4YEEA 4P2QD 3V95A 1JWMA 2VN4A 3E2HB 5F93C 5IP4A 1E4XH 4RNRA 1T5WA 4PJ9D 1R3JA 1QO3B 4NRZB 5EIIB 2F53B 4D94A 1YJDC 3BMVA 5HGDB 2G75A 1MAML 4A2LA 5L2JB 2VLRE 3OL2A 4ORGB 1KCSL 3RTQB 3MGOA 1MRFL 4QF1A 1D6VL 2CIKB 4BFBD 1NGQL 3NACL 3U83A 3LH2L 4KKAC 3UTPE 4L8DB 4EDXA 3V52L 4P2RD 2VZUA 4LCIL 3JWNC 3VFSB 2LAGB 2EDFA 3KPQB 4HFUL 4Z7VB 4JRYA 3KLSA 5A2JH 5C9JA 5AAMA 2AK1H 3RDTB 5SX5K 1BAFH 3SDDC 4EI6A 2X2YA 5DC4B 4MQTB 2CKBH 2CIIA 4MNGE 3RWFB 5IMMA 5M7QA 3RQ3A 4NBYB 4ODHH 4AM0B 1MSPA 1C1EH 4I5BA 3V4PH 1CD1B 1R5WB 2HJFA 3CK0L 4R2GC 5FK9B 2VQUA 2P5EA 3K3QA 4KJPC 2VAAB 1AH1A 3RHWF 3FO2B 4P49A 2Z8VC 3CVIL 2WANA 4GAGL 1MH5A 1T04B 4MDJA 4P59H 5IGXH 4LPVA 5BXFB 3DGGA 4QWWD 2XN9E 1N7ML 1GJIA 3UTQB 4LPXA 5TGBA 5BO1L 2HFGL 3RL1A 1T03H 4KGJA 5EOCH 2FGWH 2V2TB 2VQ1A 3GHEL 4U2ZA 3BQUD 5TE4H 1ZWIA 5FDWB 1VESA 2J7LA 3CVIH 4W4OA 4S2SA 4P5MB 1W0WB 2GSGB 4GAGH 1WITA 4Y5YA 4QRUA 2Y23A 3L3IA 4Y4HD 5DD3L 4UB0H 4P9ML 3MRCB 2BVTA 2ZUSA 3X12B 3RHWK 3BKJH 2FX8L 3SKUD 1OLZA 4X80L 1KIPA 3W2DL 2FH8A 2CUMA 3MOAL 3UC0H 2ARJQ 4UQ3B 3RU8L 1VCAA 1NMAH 4QT5B 2UY6A 5E2VL 3O6LH 4XPHL 4N1CA 1X5GA 5DQDL 4LFHD 2W07A 5JTWA 4U1IA 3TBSB 4FQPA 5DO2D 3QUZA 4Y19B 4M93B 5KW9H 4LASH 2MCG1 4P9MH 5SWZD 2XY2A 5HHMD 1CGTA 1TCRB 2QADC 1G0XA 1DQTA 2EZ0D 1A6AA 4OJFH 4Q0XL 1U8KA 5T1DL 4R97C 2V7NB 3RU8H 3RBSA 3T2NH 2HP4A 3GGWA 4OD3L 1FL3A 3LQAC 1VGKA 2HLAA 1NGXA 5EUKA 1I3UA 1QBBA 1CFQB 4OCSH 4OIBA 4ZOAA 4FFYL 5DWUL 4LCCC 3P0YH 5KS9E 2F15A 4OUOA 1UZ8B 3I3BA 4YPJA 1OCWL 4LARH 3ESUF 4UZGA 1KB5A 3QDMD 4OF8A 1D5ZB 3TO4D 1IM9A 4F2MA 1F2QA 4OLYL 3QI9C 5CJQH 5EA0H 2BSTA 3C8HA 4OD3H 1MJ8L 2HVKA 3FT3A 4LHJB 4LGPB 1XAUA 4YLQT 4P23A 1QFWL 1BEYL 1NCWL 3O8XA 1BP3B 2DJSA 4DGYH 4IOFD 1PG7X 4XBGA 5ENWB 2KL6A 3TCLA 1VFOA 2Z35B 3T77B 1NJ9A 2AXGB 3UTSA 1AHWA 2Z9TA 4RFEB 4DK6A 5ANMB 5IFAL 4IBLT 5FOBA 5JIPA 2GHWB 5KANI 3MUJA 3FO1A 2NY4B 3CLEL 3KJ6L 1TLKA 5I74C 1J5OL 4M1CD 3I9GL 2XKNB 4LEXL 4Q6YA 1H15B 4Y2OA 1CZ8L 5GRUH 1NGZA 1Q0YL 5C0EB 5HI4D 5ESQB 1NCWH 4KI5D 3ZL4L 4L3AA 4MS8D 5DR5H 3PL6C 1JK8A 4GSDL 2C7UB 2ARJB 2V17H 3BSZL 4P2YA 2VXSL 4PRAB 3S96A 4QHUA 5C7XH 1MCKA 5AZ2L 3EO0B 1OP9A 4XMLL 5TE6L 5K59F 3N85L 1X4YA 3GKWH 4X4ME 1HSAA 1K8DA 3WDHA 5I1DA 5EN2B 2LTQC 2O5ZL 2FNBA 3QB7C 4AMKL 4NO3A 5CP7B 4Z7UF 3O3EB 4M7LL 1QQDA 3ES6A 1Y0LB 5T3ZD 3BSZH 3U0TB 1NLDL 4ZFGH 2X4QB 3BP5A 2PTTB 4B0MM 3KJ4C 1FRGH 4WI2A 1MFBL 4H0HB 4UOW1 5F1KC 1RZJL 5F89A 3EO1A 5KAQG 4PRHB 3VXMA 2IPKA 1FNAA 2O5ZH 2VLRD 4RIRA 2EH7L 3WXVL 3EYQC 5HYSA 3LRHA 1QLRB 3FQUB 1KIRA 3LHPL 3BGFC 4ZQKB 5L7XH 3CLFH 3AS0A 3MRIB 3UTPD 2PTVA 4JZNB 5J4MA 3BGMA 1DSFH 1FGVH 4PV9A 3FB8B 4QRTB 3E3QE 2VISA 1ZT7A 4PR5B 4U6YA 1ZMYA 3H3PL 4LKCA 5DI8A 3DROB 1FIGH 1IEAB 4ZXBA 1KN4H 4IHOA 1KT2B 5K9KA 5JR1L 3HPJB 3OKLA 2GTWA 4IRSC 4OKVA 4FQ2L 1BFVH 2XICA 3E6HA 4LLMA 1MFDH 4YIQA 4ELMF 4EDWL 1N4XL 32C2A 2CSPA 3LHPH 4MQXD 3T4AB 3MFFA 1I4FA 2APWA 4UILL 3ZSTA 3B8SA 3UYOD 5D96B 2NY4C 1F42A 1U8IA 1XCTA 3LS5H 4NN7C 2EDHA 2WQ8A 2OYPA 4J4PC 1ZLUK 3MROA 3OAYK 1XR9A 1W2KT 5H37H 3PIQB 2XN9D 3ARFA 5DJDA 2BC4A 3RRQA 4WCYH 2VABA 2V2WB 2E8ZA 3B5GA 2OZ4A 4X4ZA 3D85D 1TJHH 1F6FB 3G5VB 1S7VA 4XCYA 4F33B 3QIUA 4OM1L 3NZ8A 3PWNA 1N6QH 4JM4L 1HNFA 4OD2A 3V6OA 3RJQB 4K2UL 4PBWD 1I3VA 5HBBA 4FZEL 3QDJB 4XC1H 4EKXA 5KVDH 1DR9A 1RUPH 1HXYB 3DETC 4M8VA 5A43C 4N8VA 2EYSA 3DNKA 2CLVB 1DQLL 3DGCR 3DVFA 2HTKD 2BJML 5TDOB 4GW1A 3QUXC 4PJEE 4JM2B 3F7YA 3UJTL 4OGZA 4GW5A 5EU7E 1QNZL 1IRAY 5DQ9A 2C3XA 3H3KA 4GRLC 3VWJB 2PYEE 4OLVL 2UUDH 3OKOA 2OTPA 4OF3A 5DUPH 1OOAA 1MCPH 1NMCB 4PG2C 1ZLWH 3C6LA 3OSKA 1NKOA 1AXIB 3DV4A 4P57B 4UU9A 1LHZA 2VZ3A 3TLRA 4WENB 1QSVA 1G6RA 3FCTA 2IAMB 1JFQL 3BKCH 4RAHA 3IETA 5IKCB 2R9HC 3OKMA 3T0VA 3BT2L 2OQJB 5J0BA 1A6TB 2R2CA 4GAYB 3VRJB 2O5YH 3MRHB 1ZXQA 4CVUA 4F7CB 3JWDH 4LP5A 3Q48A 1AY1L 1QVOA 4RZCA 3QEQA 1E4WL 3QHZH 1AC0A 2ZSWB 5B21A 4Y0GA 3W82A 2VXUH 1NC4D 1KBGL 4OLEA 3VG9C 3S34H 2CK2A 4MQ7A 5FO8A 2NXZB 2OSLA 1K4CA 3UEZA 3O3AB 4S1QL 4H8WH 4UINL 2RGSA 2W59A 4ZPTA 4AYFA 2I07B 4XNQB 1B0WA 4PJIA 4W4NA 4Y5VA 5B3NA 3AY4A 5TE7H 1JNLL 3MYJB 4YDLC 2Z92B 3SDXE 4S1SL 1ORSA 2COQA 3MRRB 4OLZH 1CF8L 3QZWA 5EO9A 4EQ3A 2JIXA 2APFA 2R1YA 2DL2A 3A6OA 1MCNA 3VFWB 3QJHB 1RMFL 4NCC1 5L2KB 3QULA 4TVPH 2NW2B 2XWBB 2PXYB 2VLKA 1P2CB 4OLUL 3BKML 5AG8A 2E6QA 3GSXA 4RWYL 1KTDA 4OZGB 3PHSA 1TNMA 3AS3A 5IG7B 3T8XB 2WBJB 1XGQA 4MJIB 3WLWD 2MKLC 3BKYH 2FZ3B 1N5YH 4KHXL 1BZ9B 5GS1B 4JM2C 4LL9A 2IALA 4W81A 4NO0B 5D2LE 3FKUS 4HS3A 1RUKH 2RCSH 1QKZL 2VLJB 2F8OA 1GZQA 2FEDD 2Y06L 3LAFA 4I0PB 4NKIL 1Q94B 1QFHA 1CDJA 1JGDA 3VWJC 5GS0C 5ACLA 3BZ4A 1Z9MA 3DV6A 3BW9A 1C7TA 1K5NB 1FLRL 1K2DA 3O3UN 3G6AA 1KFAL 4Y16A 2Z93A 1EEUA 2PNDA 1R0AL 4EN3D 4L3EE 3K2MC 4WEBH 4CN4A 3C6SB 1FZMB 1YEJH 3WNLA 1OF2B 1X5KA 4DEPC 2B7DT 2BVOA 4PJ8D 3GK8H 3RAJL 3LQZB 1MHCA 4NPYB 3D69B 1X3DA 1INDH 3MODL 4HUVA 2EE6A 1U8OA 1SVZA 2QQQA 3CC5B 2EYTA 4IMLA 1FLRH 1W0VA 1MCIA 5SV4A 2V5TA 4YHIB 3O41A 1CD0A 1UH2A 3BP4A 2L7UA 1CE1L 3ULVL 3HG1A 2HRPL 3UO1H 2JF1A 2ZUUA 1S7WA 4HGKC 4X8JB 5CP3A 4EQ2A 4FQCH 2FECL 3V8OA 4Y4FC 5B3JE 1CQKA 5FGBA 3BUYB 4X9FA 5E8DH 4LDEB 5F71A 3L5XH 4G9DB 1QSZA 4X98A 1V7NL 4NJ9L 2X4OB 1OPGH 1YN7B 1ZKAA 3T09A 2BSRB 4JJHA 4G7YL 4WHDA 5GSVB 1WIUA 3NPSB 2VC2L 1W72B 3QQ9D 5FGCB 3TH3T 1MFNA 1QPPA 4BJLA 1JF6A 1S8DA 4G6AD 5D7IE 1ADQL 2VIRB 5CHNB 3FO0H 1Z6JT 5FA3A 2PXYC 3VH8A 5TQ2L 1UENA 4XGZA 1CXEA 4JPIB 3TZVC 4MJ6B 2W9EL 1CFBA 4MNHB 2VAJA 2OI9B 1T7ZA 5I1AB 4H88H 3FT2B 1SEBA 2E27L 5ICZB 4H25A 1T66C 2A6DB 4YXKL 5GS1C 5CCKL 3CAFA 4JFDA 4S1DD 1YEFL 3PG2A 4FTVB 1MREH 3QUYB 3C9NA 3S8WA 4PYHA 1YEEL 2DQUL 5ISZE 2AKRB 4JN2B 1HKLL 4J7RA 3B9KB 3DHMA 2J8HA 1I8KB 1YDPB 4D9QE 4KKLD 1QBML 1WAAF 1XGPA 1JI2A 3QQ3B 4RA0C 5HDQH 3QFJB 4J8RB 1KCKA 3EYVA 4HD9A 2BOBA 2NXYD 5F7DA 4HCRA 1X7QA 1FO0B 2D7OA 5MEOA 5HHVH 4YXKH 3D25A 1U3ZA 4P4KA 4R3SB 1IL1B 3KNBA 3FB5A 5FYJH 3CVHA 3I50L 2RIKA 2H8PA 2PYED 3O6FA 4JVUA 4OIIH 3MRFB 2EIDA 5GJTH 4E41E 5IVXB 3IJSB 5HD8D 4NQEB 4X6CE 2C4XA 2J8OA 2OLDA 4QRSB 2H1PL 2NX5B 5DZNA 3MJ7A 3BWUC 1CLCA 1RHHA 1F02I 2YBRA 4YAQB 3OQ3B 1Q1JL 1U6AL 4M7ZB 1QBLH 1F58H 3VI4F 3MNVB 3GRWL 4HIEB 5D70H 1A6ZB 5DFTA 4UT7H 5SX4I 4FQXC 2JB5H 5B4MD 4KAQH 4LCWA 1R5VB 5IQ9B 2O5XL 3QG7L 4J3WA 4JFZL 2GSIA 3M8OL 3WDIA 2BK8A 5DRZB 3WUZA 4Z9KB 3HAEA 3NCJH 4PJCE 3U0PB 3NPSC 3SE4A 3O11B 3IRPX 5H2BB 1ZGLP 3PV6B 3GIZH 2P8LA 1HHHB 5DJZA 4DVRL 1PGRB 3OJDB 4FQJH 1IGMH 1JHLL 1TTFA 3CMOL 5IHUL 1J0IA 5I9QC 1CICD 4M7LT 5GZND 4HWZA 3IDNB 3RGVD 1NCAL 4FZ8L 5FUCE 5SWSE 1IGTA 1BF8A 4G43B 3IB4A 4ENED 4X4YB 5EC2B 4JG1L 4YDKL 5B38A 2YPKA 1A3RL 1LK2B 4QXUL 3VRLF 1U8JA 5E8OA 2FJHA 5ILTL 4APQA 4KHTL 9CGTA 4G6JH 3RWJA 2HVJA 4DVRH 4MA8L 3QUYC 4HKXA 4NFBA 3FOMB 3KHQA 4K94C 4QXTA 4KRNA 2F53E 3WFDH 1GXEA 4HWNA 2HTLC 3DRTA 4YX2H 3MRLA 1UQSA 2V2XB 4HJGA 5GISH 5E2WL 3AMKA 5ALCL 1AXSB 3B9KC 4HIJA 3VFNA 4R4FL 1JNNH 3MOBL 2QR0A 3SKOB 3PGDB 2W0KA 4XP6L 4JG1H 4YDKH 4YHYC 5E24E 1A3RH 1KLFA 3GSWB 1HDMB 5J9PA 4YHZH 4NZJA 1U8MA 2X89D 4PJXB 4DGIL 4OT1H 5FUOL 4HS6A 4ZODA 1DDHB 1S9YA 1YZZA 3GMLB 1EBAA 1W72H 1U92A 3DURA 1KIQA 2LU3A 3EIFA 4F7EB 4WW2A 1UM4H 5FOJA 4Y7MA 5E2WH 1A47A 1DQDH 3PDOA 4JPVL 4W6YB 3EYUL 1OLLA 3I84A 4YHLL 4L3ED 3QHFL 3ROLB 1O7VA 4M62L 3RUGA 3JTTB 3OPZL 1MCFA 2BVQB 4WFHE 4ODBD 3HNTH 3C8KB 4P3CH 4GKZB 4OUUB 5ERWA 2IPUK 3BPLB 3PHQB 1FBIL 4YK4C 4DGVH 3NPZB 3WSQL 3PGCA 1XGTA 4HIXL 4L29B 4QRRB 1V8HA 4M7KH 3CMGA 1X5JA 1UACL 2E9JA 4K94H 2BVPB 1D5MA 2DBLL 1YNTA 3HRPA 5HGAB 1N5AA 3QHFH 3R1GL 3OPZH 4HJJL 4U1SB 1BQSA 3R8QA 4K3EL 4UQ2B 2DTMH 3DTXA 2ARWA 3DI3B 4HH9B 1FO0H 4XXDA 4ETQB 4P9HC 1DFBH 3LKSA 4R8WH 1GOFA 4W6XB 3TC9A 2AJVH 1OTSD 4LBEB 2DBLH 3BH8A 5C0JA 4OIAA 4AL8H 3DRQB 1YEIH 4QY8A 2FGZA 5T1KA 4XVJL 4UDUB 5HYSG 1TZHB 4JG0L 3BEVA 2OTUB 5ID0B 3G5XB 2YEZA 3F7QA 3U0WH 2GQHA 4HW6A 1AE6L 2C3VB 1CE6A 5T1LA 1VA9A 1A64A 2LABA 5CILL 1AIFB 3S9DB 2O61A 3JWOH 2PYFB 4BH7B 4JM2F 4PGCA 2OTWB 2EDNA 5D1XB 5CMAB 1I1AC 2ZZUT 4NHCH 1ORQB 5C07B 3RX8A 5DRXB 2XNAB 2FR4B 5ISZD 5JQHC 1M4KA 3UBXA 5HHOB 4OQTA 1NAMA 1T3FA 1E6JH 2IFFH 1FNEA 2WINB 4D9QD 5EH1A 1T0MA 3WJJA 4GKOA 3MUHL 5C9KA 4RMUA 3WEXA 3VXRE 2DLFL 1HHIB 4NCC2 2FJFB 4G80B 3SO5A 4CVXA 4PJAB 5CBAA 2NW3A 5HPMA 4WFEE 5KSAA 1OAUL 1NEUA 5BVJA 5DJ8B 5DA0B 5IVNA 3HC0A 3SY0B 3O45A 4OCLC 5ICYB 3IS1X 4E41D 4WO4D 3VD5A 2PN5A 5D5MB 1MLCA 3KPPB 3W9EB 4GXVH 3VI3F 3SQBA 3ULUL 3RVXD 4EIGB 1JL8A 2BOCA 1YPZB 1FL6B 3TJEH 4UTAH 5F9OH 4WUUA 1IGJA 1UJ3B 3MR9B 5C2BL 1CLZL 1XH3A 1HH9B 5JPMA 1OB1B 5FYJU 1FFOA 4N8VG 3L5IA 3PDGA 1T6WA 4JY4B 2EXYD 2V6HA 1CN4A 4WGWB 1JWMB 4N0CC 2AXFA 4P2RA 3LEVL 4RNRB 1T5WB 3LIZH 1QACA 2Z8WC 1R3JB 1UVQA 4BQCA 4WUKL 4OCRH 5EOTA 4YBQC 1A3LH 2G75B 4F8QA 2VL5A 4XT1C 2WLYA 3MGOB 4ETYA 3A6CH 4QF1B 4TQEL 1MCOH 4WFGE 3W11D 1RIHH 2P1YA 4RDQG 3X3FH 1P5UA 5SWSD 4EDXB 5JORA 4XHJC 4X7DC 1MCQA 4JR9L 4KK5D 4C83A 4JRYB 5HI3D 5BQ7A 5C9JB 2YPLE 5DVLA 3CXHK 3PE9A 5E9DE 4EI6B 1YEKH 2HT2C 4WVRA 1S9VA 2CIIB 5IMMB 1CGSH 2HN7A 3EOTH 4PRBA 5D7LA 3P9WB 2F53D 4I5BB 5C0AE 1CLOL 2HJFB 5IFHH 4TSCL 2ESVE 2P5EB 1NL0L 4G8GE 3RTQD 4DTGL 1U3HC 1JI1A 4MXVE 4IDJH 1BHGA 3PWVA 2Y6SD 1MH5B 4MDJB 1J86A 1DP0A 4TVPE 5HXMA 2AVGA 4Y4HA 4Z7WF 3GSVA 1ED3A 3DGGB 3OX8A 3RDTD 1U42A 4UAOB 5HHXL 5TGBB 3T1FA 3RL1B 5E6IC 4DKFH 2VQ1B 5F8RC 5A2KH 4F9PC 1I7TA 4PY7B 1QZ1A 3QZWG 1ZWIB 3BJ91 4N0RA 2G5BA 3MLVL 3I85A 3Q6GL 4S2SB 5F9AC 3U82B 5MI0B 4Y5YB 2AEIT 4QRUB 3L3IB 4WFHD 3QCUH 1D5XA 2PR4L 1P7QD 3H3BC 3WKNA 3GB7A 2VWEC 1KIPB 3P9MA 3L7FA 1T83C 1WWBX 2WIIA 5HHXH 3N9GL 2YA2A 5CJOH 1I8LC 2EEAA 4R26H 1AGBA 1BZ7A 4DJMA 3WJLA 3U7YL 3NCEB 1TVDA 5C71A 1GHFH 1II4E 3ZKXC 3MRQA 1KV3A 3VJ6A 2DQFA 4U1IB 1MRDL 2XPGA 1R5IA 3EJYC 4C54A 4O51A 4FFVC 4P4RA 1VERA 1U8KB 1RPQA 3LB6C 1A7RL 1I8MA 2NY3B 3QDMA 1EXUA 4OLXL 3VGAB 3TO4A 5J56B 4F37F 2NY6B 3GGWB 1FL3B 2BNQE 5T5FL 5EUKB 1VGKB 2HLAB 1NGXB 5K9JL 3HE6D 1TZGL 2NLJA 2GT9A 1IC4H 1LWRA 4K7FA 3O2DA 3L5JA 4KJWD 4MWFA 3VWKA 1HINH 1F3RB 3LKQA 5DMYA 1ZLVH 4XXCC 2EH8L 3O4OB 4L4TE 1KB5B 5DZLA 5KVEH 1IM9B 4HPOL 4F2MB 4ESKA 1DN2A 4JREB 1F8TL 2BSTB 4IIQA 1DBBL 2HVKB 3ULVE 4DOHB 4LNRA 1U91A 5JW5A 1M7XA 1T7VA 1VHPA 4I13B 3AXLB 1ZGLM 4P23B 2AK4E 3EJJX 2APBA 4YO0A 4DK3A 4XBGB 2Z31D 5I6XB 4F37K 1FZOA 3TCLB 1NJ9B 3UTSB 3V7MA 1AHWB 4QHNA 2HJLA 3L1OL 3MLRH 5IVXF 2LQRA 2Z8SA 4NN5B 5FOBB 2FO1A 3K7UA 1NGYA 3FO1B 1GOHA 3VXRD 5EPMA 3VI3E 1ZEAL 5GSRA 5MI0C 4LPWA 3ZE1E 5CINL 4MJ2A 2F19H 4OSUL 1NGZB 4PJHF 4WFED 5F70A 3VH8G 5DT1L 2WWMC 1GIGH 3NIGF 1L7IL 1JK8B 1OD7A 4KJYA 1YJDL 4WY7H 3VCLA 3S96B 4Q6IC 4QHUB 1IQWH 1A14H 1KB9J 1HSAB 1K8DB 5I1DB 3T08A 1TETH 2E9BA 1CU4L 3STLA 3OR7A 1JWUA 2E9IA 4NO3B 2VLRA 3OBAA 5JXED 1B90A 2VZ1A 3BPNB 3PQYA 1S7UA 1YC7A 5DSCA 4Y5XA 1QQDB 3ES6B 4BYHA 5L2KE 1WTLA 2WNGA 3ZE2F 2NY3C 4KC3B 3HB3C 5C0NC 3BP5B 2NY6C 3GMPA 2OK0L 5DHXB 4XVTL 4TNWF 5HYEA 1CXFA 5F89B 3EO1B 3PWLA 1PBYA 3VXMB 2IPKB 3FMGH 4RIRB 1VEPA 4ELKA 5SWQA 5HYSB 3MLWH 1F4YL 5LCVL 1KIRB 5HYQA 4WFGD 5LJYH 1JGVH 1EO8L 3O4OC 1KNOA 4EXKA 3FN0H 3BGMB 1NAKH 3O2WL 3BDBA 1L9NA 4PV9B 5INCA 4U6TA 2R29H 3FHQA 3ABZA 4ONOA 2YPLD 4UV4H 5FO7A 1DEEA 2VISB 1ZT7B 4K3JL 4U6YB 5E9DD 2OK0H 4LKCB 1TXKA 2YUXA 4ZXBB 2CUHA 4IHOB 4P23C 5K9KB 3SCMC 2FIKA 3OKLB 4PJXF 2GTWB 4Z7WE 5HYIA 5JZ7D 4OKVB 4OB5H 1LEIA 4LRNH 3E6HB 4LLMB 5C0AD 4TNWK 4YIQB 4U1KA 3ARGC 32C2B 3DYPA 2DQTL 2ESVD 4MJ4A 3WHE1 4G8GD 4KVCL 4M6NH 4O02L 3GSNL 1I4FB 1OTTC 4CMHB 3EYSL 3O2WH 2H2SC 1U8IB 1XCTB 5TFSH 1NQBA 5JMRA 1F3DH 1HNGA 1JIBA 3MLZL 3V6BR 4LSQH 3V5DA 3H7BA 4TVPD 3MROB 1XR9B 1IILE 4AIOA 3WCYA 1TJGH 3TIEB 3ARFB 5DJDB 4U4BA 2BC4B 3RY6A 4KK8D 2DJ4A 4YC2C 5L6YL 3BH9A 3HI5L 4OLWL 2R2HA 3O6ML 5B38G 3HZKA 1KCUL 5A16A 4JDVA 1OAXL 1S7VB 4XCYB 3FT4A 3QIUB 2C4FU 3NZ8B 5DUMH 2FD6L 3JTSA 3PWNB 2W38A 4OD2B 1DLFL 2RR3A 1KB5H 1W0YT 1YNLH 1MNUL 3EDFA 3NABH 4N8VB 4YFLI 1BLNA 3LQAL 2EYSB 3BPNC 1OQOA 2KBGA 4MGXA 4G6FD 4GS7C 1G7MA 2H2PC 3GI9L 1A5FH 5L6YH 2A77H 3TJHC 3TWCH 4I3SH 1DZBA 2NY1D 1L7TH 1WBXA 4GW1B 1SEQH 4OF0A 3IFNL 2H3NA 3F7YB 3ARZA 4ZD3L 1DVFA 1IZJA 3P4NA 4P5KA 3BN9D 5GRJH 4GW5B 4LSPL 4YHML 5DQ9B 3NCBB 4JO2L 5JA8B 3K81A 3EDKA 2DMCA 5GGSA 5KS9A 3OKOB 3IDXL 1R3HA 1MWAL 2VXTH 3C6LB 4MXQC 3DV4B 1XF2B 4UU9B 1S5IH 4XNUH 1NC4A 2BNQD 1G6RB 1A6WH 35C8H 3FCTB 3SDCA 4DKDC 3IETB 2R0WH 3OKMB 2GITA 1AR1D 3V0VA 25C8L 4KXZI 5KVGH 1FDLH 4Q9CA 3BIBX 1FYHB 4KTEH 1QVOB 4FQIH 4RZCB 1UEMA 4DQOH 2BVYA 4L4TD 2J88L 1GC1H 5JMOC 2YHGA 2N7BA 5IVXE 3M17A 4NWUH 4CKVX 5FO8B 4MQ7B 2OSLB 1D7FA 1JZ6A 4TPRH 3ULVD 1K4CB 5FHAL 2P24A 1G0YR 5J89A 5ADOL 1L0YA 1XR8A 2AK4D 3BPOB 1RUAL 4ZPTB 2DDQH 4G8IA 4PJAF 4PJIB 4Y5VB 3VFTA 4XPAH 4PJHE 5DJYA 2R0ZL 1NFKA 1K3IA 2W92A 1ORSB 4IJ3C 4WW1A 4MZ3A 4PP2A 3QZWB 5D5MF 2J88H 2XQBH 1BM3L 1T6VN 3AREC 5EO9B 4ZSOE 2JIXB 5J13C 3OXSA 3QCTH 2R1YB 4M00A 3C5JA 4H0IA 3S97C 2DI9A 2EDRA 1YPZF 1KG0A 4NHUA 2AJXL 4RFOL 2CJUL 2VLKB 3LPFA 2R0LH 3FRUA 4HWBA 1OHQA 1SM3L 3V0WL 1FJ1A 1OD9A 2H45A 3GSXB 5JW3H 4FG6C 1KTDB 4RQQA 3U48A 3TA3A 5IFJA 1XGQB 5FM5M 2J6EL 1Q0XH 2QL1A 1AC6A 5BS0E 5GS2H 3ZE2E 3TIDA 3QIWC 1BM3H 2IALB 4HS3B 3NFSL 1KELL 4QTIL 4PJ8A 3UPAA 1QG3A 4Q9QL 5IT2L 4U6XA 1JGDB 4GXUM 4TRPH 1IGIH 3UBXG 3BZ4B 5F7KC 3DV6B 4AEHH 3BW9B 5F7FA 4ERSH 4LSVH 5L2KD 1JNHA 1GGCH 3C6LC 1OAQL 1K2DB 5EUOE 1ZLVK 1FE8H 3G6AB 4Y16B 2Z93B 2W9DH 3O2VH 4I9WE 2VUOA 3E8UH 2NY5H 4G6ML 4HXBH 4N5UA 1XT5A 4MVBC 2HWZH 4DUWA 1NEZA 2I25N 3QA3A 5AYUL 5EOCJ 1UJTA 5I1KL 2BVOB 2DKUA 3NFSH 5ITBH 2CK0L 5EZOH 1MHCB 3SGKA 4M5ZL 4Q9QH 4LHUD 4QYOA 1HHKA 1T21A 4NO0D 5TH2A 4HUVB 4G8FA 2XTJE 1U8OB 2ZUTA 5LGHL 1M05A 4LU5L 1NCNA 2EYTB 4I0PD 1MCWM 4IMLB 3ULUE 1Q9OA 1W0VB 2DN7A 3TGXA 3UJJL 3H9YA 2OCFD 2YPVH 2YSSA 3O41B 3BZFA 5I8OL 3BP4B 3CU7A 2YD5A 1I9EA 2B4CC 4JFFA 1X6NA 3I3EA 5L8KB 3WFBL 1S7WB 3H42H 2XA8H 4KPHH 4J2XA 2Q87A 2KZWA 2IG2H 1CLYL 3H6JA 4UV7L 4X98B 1KCLA 4XP1L 3QR2A 1X9QA 1EGJL 3VXSA 3QIBD 5C0FA 3WFCL 4EXPX 1OSPL 1S8DB 2Q8AL 5IJKC 3MQIA 5DZOA 1K9TA 3P3YA 3HMWL 4DCQA 1R3IL 3OAUL 4MD0A 5FA3B 4Z77A 2YD9A 1KJ3L 2EYRA 3VH8B 1G6RH 1MHHA 4XGZB 3HR6A 3FQTA 5D6CA 1MFAH 2A1WH 2DIAA 4H26A 4NKMA 4NQDE 3SEPA 4QKXB 1SEBB 1TQBB 3LOWA 3AB0C 4H25B 4DN4H 5IHZA 4KKBC 4PJEA 2AGJH 1DQQA 4BSVA 4GJTB 4JFDB 1VGEH 1OSPH 5EU5A 5CZXD 2A9MH 1LMKA 3KS0J 1Q8MA 4NSKA 2I60H 3C9NB 2DQDL 3IDYB 5I1HL 4M9PA 2YC1A 5TDNA 2EXWC 5K33A 5C0BE 1LO0H 1TVBA 5D2NA 5EU3B 4W70A 3LZFH 3UTZA 1UGNA 15C8L 3NVQA 1XGPB 1KXQE 4R6UA 4Y16C 1QLEL 4PJ5E 4ALAH 3EYVB 3HC3L 2BOBB 4DVBA 1X7QB 5MEOB 3D25B 4P4KB 1L4IA 5EOQH 1KJ2L 1T22A 4NDMA 3KNBB 3FB5B 3CVHB 3V8CA 4KDTC 3TBTA 4NZUL 1QFPA 2H8PB 2R4SH 3O6FB 5BW7C 4ZTOH 4FFZH 1K4DA 1TJIH 1WFOA 2Q7NA 3K4ZA 3CDCA 1J18A 15C8H 4AG4L 3CUPA 5CD3A 1RHHB 2YBRB 4JFPA 2D7TH 2IANE 4LFHG 2KH2B 4PFEA 1UWEH 1WSST 2IBGA 5CEZH 1S7SA 2ZKHH 3U1SH 3MLUH 1MCDA 2HFEA 5I76B 3G9AB 4U7KA 1IKFL 3RGVA 4LCWB 4PJAE 4DKAA 4O4YL 2BSED 4Y4KD 2GSIB 1FFNA 2GYSA 3SDXA 3KHOA 5EU6A 5D5ME 1RULL 5ICXA 3F7VA 5I1LA 2NYYC 2P8LB 1RVFH 1AKJD 5DJZB 2VKWA 3LN5A 1JGEA 1URLA 1YPZE 1A7NH 1CGWA 3HI1A 3K46A 4JZOB 3DX6B 4HWZB 5CGTA 3FQRA 1M7IA 3PGFL 3IU4H 4UIMA 2OL3L 1IGTB 5D72L 3AU1A 4URTB 5B38B 2YPKB 1MPAL 4XBPA 3MRGA 1B2WL 1TQBC 2NZ9C 1U8JB 2AQ2A 5E8OB 5EWIH 2FJHB 5GS0L 4APQB 1JZ7A 4X5XA 1QR1A 2CDFA 5EBLA 2X89A 3RWJB 5D2LA 1RURL 2HVJB 5GGVL 4E5XA 4HKXB 1KCVH 4QXTB 3O0RL 3DRTB 1UQSB 3LD8B 3MRLB 4MAUL 1N64L 4HJGB 3TP4A 1SBBA 1FP5A 3VFOA 4HBCL 4HIJB 1V05A 3DMMC 3VFNB 2YD4A 2QR0B 1G9EA 1EHLH 2B1HL 3EHBD 5CP3H 4PRNA 5BS0D 4KKNA 4L3EA 5E5MA 3REVA 4AEFA 2BRQA 2X4NA 5J9PB 2FX7H 1U8MB 3P4OA 4HS6B 4R4BA 5I1GL 1DJSA 3JZ7A 4HGMA 2HT3D 2XWJA 2L4OA 3ET9F 1U92B 4I0KA 3VXUA 1KIQB 5E2TH 3O0RH 3OZ9H 4WW2B 2BFVH 1RZFH 4NQTA 2IPTL 3GO1H 4NC2B 3PDOB 3CH1A 3RPIA 3W5NA 1UM5H 4KROB 5DD0L 4I9WD 1H5BA 5HYJE 1HXMA 2ZSVA 5I1CL 3HE7D 5HPOA 2OR9L 4R90H 1J1XL 1NCCL 3MLYL 4QOKE 2Y5EA 1AQKH 3CXDH 4WV1A 4YDIH 2P5WE 1C8PA 1PX4A 5ERWB 4XAWL 4YQXH 3V9FA 3EO9L 3HA0A 3PGCB 1XGTB 1P4IL 2XZQH 2XTJD 3NTCH 2DLEA 5J12B 3BWAA 4NZRL 1KEGH 1EX0A 1CR9L 3LY6A 3ULUD 1D5MB 4KDWA 3SE4C 1N5AB 4RMRA 2ICES 1XGUA 2CRZA 3OKEA 4K71C 1A02N 2CKBA 2J4WH 1NCTA 3I6GA 5HSFA 5D7IA 4JHAL 1QYGL 1MCHA 1B0RA 5GJSH 3DTXB 4MAYA 2Q7YA 3Q3GA 3ZKND 4HQQL 4XXDB 3G6JA 4POZD 3LKSB 1PSKL 2YRLA 3CVHH 5H35A 4XTRC 3BAEL 2J5LB 1NUNB 3BH8B 4BZ1H 4ZS6C 5C0JB 3D1MC 1OGTA 1KTLA 4OCMC 4F57H 2A0LC 3MRDA 4QY8B 3U4BL 4KQ4L 1OW0A 3DUHA 3IFPA 3BEVB 4FFWD 5IQ7H 2YEZB 3DLQR 4HWEL 5F9JA 5ISZA 3VA6A 2KQNA 2N1KA 5JIKA 5ADPH 1CE6B 1NMBH 5CD5C 5T1LB 4NQDD 3AM8A 2O61B 3BAEH 4RFNB 1UB6B 5IMOA 1ZVYA 4PGCB 2VUYA 3RZCC 1Y6NR 5F1SA 43C9A 3HAEH 4KQ4H 4Z7QF 2BY3A 1J8HA 3CSGA 4X7SH 5T1MA 3UBXB 5C0BD 1PEWA 3FAWA 3ELAT 1NAMB 4PTTA 1T3FB 4X6CA 1FNEB 4D9RE 1T0MB 4JPWL 2JELL 3WEXB 5AWNH 4PJ5D 3QYCA 4HIIA 3SGDI 4KMTL 5EORL 3T3PE 2VH5L 4CVXB 5F7UA 3SBWC 5ESVA 4Z18A 4QHMA 2NW3B 4K7PY 5HPMB 5KSAB 1OTUD 5MENE 5CUSH 4PGBA 5BVJB 3HC0B 2OJEA 3CFDA 3KR3H 5F1IA 1MLCB 4ODTH 4U1HA 4LGSB 3GMQA 4JHWL 4YZFF 4PJCA 4PJ9B 2BOCB 2JELH 2IAND 4XMPL 4TTDC 1CXKA 3BP7A 2CGRL 1JNJA 2I9TA 4WUUB 4KZDH 1IGJB 2PKDA 2OX5A 3C87A 3TVMD 1E6OH 1XH3B 4P5TD 5JPMB 4M5YL 1FFOB 1BQLH 2ED7A 4PJIF 1MVFA 2R0KH 4MX7A 4GBXD 5SWSA 2VE6A 2AXFB 4P2RB 3QPXL 5GRWA 2X1OA 1CTNA 2E7HA 3SOBH 2VDML 1OM3L 3LN9A 1UVQB 1ZLSH 5E5RB 1IAII 1N59A 2UZIH 5EOTB 4MA1C 1BF2A 1X4XA 5JQ6L 1ZT4A 2VL5B 1C5CL 1J1OL 4PJ7F 5E2UL 4KRLB 4M6MH 1FPTH 1EMTH 4PJFE 3RWGA 2YD7A 1LE5A 5FGRA 3QO1A 4MNQA 4TSBL 5JORB 5EZIH 4MCYA 4BZ2H 2HH0H 3HLAB 2UZXB 4F7PA 2VL4A 1MF2H 4C83B 5I66A 4BH8A 5BQ7B 2AJYL 2MMXA 2LAAA 5EIVA 1S9VB 4KXZH 1RHFA 2HN7B 3WS3A 4PRBB 4ZDHA 2WZPD 2EE3A 3W9DA 1HOCA 3GNMH 5I73C 3VXME 4TOYL 4BFGA 1TQCC 4LVHB 1UKTA 5CGMA 3K4AA 3WJJC 4PB0H 3PWVB 4P2OC 2ITDA 1XGRB 2AJSL 1XIWD 1NSNL 4Y4HB 5TF0A 3GSVB 4TUKL 4K3GA 4LSTH 1ED3B 5LGKA 1YC8A 1P7QA 3OX8B 5KSAC 5C0GA 3IAPA 3T1FB 4M9OA 2F5AL 5DLML 5LXGH 3RWIA 5I75B 1VPOL 4DZ8A 1C16A 4UNVA 1I7TB 5FO9A 3UPRB 1F3JA 2XXCB 2G5BB 4PJ9C 3U36A 5HYJD 1JPTL 1Z0NA 1I85C 1D5XB 4QOKD 1NCBH 3G5YA 3B2VH 2P5WD 4P9HL 4XNXL 4ODVH 4I2XA 5HHMB 1F5WA 3GB7B 3P9MB 1YQVL 3L7FB 3VDBA 2WIIB 2RB8A 3I2CL 1AGBB 1BZ7B 3U30B 4HLJA 1SYVA 4JO1L 2MKWA 4E42A 1SJVA 2F5BL 3R0NA 5I8KL 4D0CA 1MIEH 1UKQA 3MRQB 1FVDA 3VJ6B 2DQFB 2QSCL 4KKAD 2BY1A 3DVGA 2VLME 5MP6L 2XPGB 3HE6A 4MB3A 4OQTH 1R5IB 1J1PL 4O51B 2FBJL 1Z2KA 3N1GC 3V6OE 4P4RB 1RZ7H 2BNUB 1ZHBA 3QUML 4D3CL 1I8MB 3QDMB 1AJ7H 1EXUB 3BE1L 3TO4B 3UJIL 1G1CA 4JO1H 5KSBE 5JW4Q 4PIRF 5CEXA 5DEGA 5I8KH 3X11A 1NEZG 2NLJB 3MCG1 1T5XA 5LBSL 1JPSL 3EKCA 4K7FB 1I7ZA 3ULSA 2Z31A 4MWFB 3VWKB 5D7JC 4CBPA 3LKQB 4Z7QE 1MRCH 3QUZD 2OJZL 3B43A 4NM4L 2ICWI 5KG9A 3BQUC 1A8JH 2LV4A 1NH6A 4YHKH 2EEBA 4IRJA 2QQLL 4IIQB 1WFUA 3T0XA 3MBEC 3MSPA 3VXRA 4LNRB 1U91B 5FYKH 4ZYKA 5JW5B 3FZUC 2QHRH 1SVCP 1BD2D 5D8JL 4LVOB 4YO0B 4ONFH 5LBSH 4WJ5A 1FZOB 4NRYA 4X9HA 4XPFH 4B7LA 4ZNCD 5BV7C 4QHNB 3B3IA 2YA1A 3EFDH 2HJLB 4WRLA 4UTBL 3MACH 2QHLA 4D9RD 1A7OH 1C12A 5C92A 1NGYB 3QEQE 5EPMB 4MDIA 1UCBL 3K8LA 2DS4A 5GSRB 3INUL 5DO2C 1LNUA 2E7MA 2YOCA 3MZGB 2DQCL 2EC9U 4JN1L 4MMZC 5JXEA 3BHBA 3ZMRA 3WFEL 1G7JA 1F45A 3CU1A 3C60A 5MEND 3THMH 1FN4A 3QH3A 4HF5H 1T0PB 4KJYB 4LPCA 3UDWA 3VCLB 3O8XD 3U30C 3UYRH 2B1AL 1MCCA 4XVSL 5ECJE 5FM5O 4GG6E 2QADD 3ZDYE 5LAXA 1ZHNA 5BVPH 1CD8A 1UA6H 4NC1C 5F1NA 2P8MA 3VD9A 1J88A 3INUH 3OR7B 1JWUB 1YEGL 2VLRB 5LWYH 2X05A 1G9NC 4PJ7E 4F3FA 3I02A 3TT1L 1O5DT 5I19L 1S7UB 1J8KA 5DSCB 3ARQA 4Y5XB 3V4VL 4DKEH 3CFBA 4CMMA 3DUSB 1GGTA 2VLKE 4N8PA 1F4WL 1TTUA 3GMPB 3FAXA 3P2TA 4PS4H 2A38A 2YPLA 4I18A 1CFVL 5GZOC 4AEIH 4FXKA 5E9DA 3NFPA 3PWLB 4LGRB 4MHHI 1H3VA 4ELKB 5DHYA 3QI9D 5SWQB 1IAMA 2HKFL 5HYQB 5C0AA 3CCHA 5ALBH 2R1WA 1KLUA 1RJZA 2PCPA 1KNOB 2ESVA 4KZEH 5IMLA 4G8GA 4ZFFA 1MAJA 1F4AA 5INCB 3Q6FA 1GAFH 2DWDA 2X4UA 1N2RA 2LU4A 3KPSE 3RNKA 5FO7B 1DEEB 2G60H 1RIVL 4M1CC 4OGXL 4XPGL 4LVOC 3FRPA 1C5BH 2FIKB 1PZUB 4XRCA 5HI4C 5M94B 1IT9H 1LEIB 5D1ZD 1X5YA 5K9QG 4U1KB 4L4VE 4RMTA 3VXMD 5CJBA 4WW2F 4LSRL 3H8NA 4XWGH 3SDAC 3GSOA 1S9XA 3EUUA 3WFHA 3PL6D 3V5DB 3H7BB 1KCRL 3RUGF 1IFHH 1JF1A 1G7QA 5FM8A 2V5SA 4G6KL 4P3DA 3S35H 3HG1E 3SN6N 1NCDH 2OXGA 3KLHC 3BH9B 5GS2D 2R2HB 1AI1L 5MHSE 3VW3L 3HZKB 5A16B 3C09C 4JDVB 3O2DH 3FT4B 3HC4L 3JTSB 5F72S 1JMXA 4U31A 2D9QB 2A73A 4H0GA 3BRFA 5JXAL 1BLNB 3QXDA 5E7BA 4NZTH 2XRAL 4EOWL 2CQVA 4Y5XC 1MQKH 3AFLA 3O4LA 3S3JA 1R3KA 3ARFD 3L5WA 1FZJA 3AS2A 1FYTE 3EYQD 3VW3H 1WBXB 3MRBA 2BNQA 1UWXH 1WWCA 1UB5A 1PYWA 2H3NB 1DVFB 1DBAH 2VLMD 3P4NB 4P5KB 4ZFZA 1TCMA 2DTSA 1X5LA 1YECL 5GGSB 5KS9B 3KYKH 3W39A 2EIZA 4NQCA 3MO1A 3UP1A 4MQXC 2VDKH 5D6DC 4L4TA 1GRWA 3LMJL 3MOQA 4GQPH 3WIHL 1NC4B 4IRSD 1G7LA 2BXZA 1UZ6F 4XI5D 1B0GA 4HEME 4HT1L 1YEHL 4GMSL 2GITB 3V0VB 2AK4A 1MJ7H 2GJZA 3TV3L 1ONQA 4O5LH 2ZPKH 5L0QB 3F6LA 2E8YA 1TMCB 4J4PD 5CAYB 3EW3B 4HKJA 1KJVA 4Z95H 4YNYA 4D2NA 3M17B 2ADFL 3D9AL 4XNMA 1AFVL 5TQ0L 1RZKC 4Z7NE 2P24B 1ADQA 4J12A 4V2CB 1XR8B 2IGFL 1XEDA 4GLRH 4EZMA 4G8IB 2DIJA 2HG5A 2B8OT 3VFTB 3QNZA 3L5HA 2WSKA 1LE9A 5DJYB 3RY6C 1I8IB 2PF6A 4DW2L 2DLGA 4WW1B 4NRXA 4PP2B 2RAMA 2HTKC 3TO2A 4HG4J 2HJKA 3OXSB 5I71B 3QEQD 1NDGA 3AROA 4GKNA 2ADFH 3C5JB 1DEDA 2GK0A 4TSAL 1KG0B 2B2XL 3BEWA 4NHUB 4KTDL 5FHBH 4NT6A 3FRUB 3OF6D 3B6SB 3QUXD 1FJ1B 4AJ0A 3K8MA 2MOVA 2A9NL 4RQQB 1I9JH 2ZCKH 1OAKL 4I77L 4ODWA 3TA3B 5IFJB 3MLXH 5EBMA 4GRLD 5IWLA 4K8RC 3TIDB 1G7PA 3R4DA 4KJQC 1OAZL 5KTEH 1KYOJ 3ARBC 5KZCD 1UADC 4PJ8B 1E4KA 1F97A 2JIXD 4OZHA 4U6XB 4Y2DD 5BZDA 4LHUA 3QAZB 1F6AB 4FXLA 1MUJA 2UY7A 3IT8D 1JNHB 3BYTA 3KVQA 3QQ4A 2ZNWA 2VLKD 4DUVA 1DBKL 4IRZH 5FCUL 2GIYA 5GPRA 2K1MA 5GGTL 3W0WE 4N68A 4N0YH 5CJ5A 4MLIA 3GRWA 1NEZB 1A7PH 3QA3B 1YYLL 5TJWK 1PLGH 1DCLA 5E08H 2ZG1A 4N5ED 4QYOB 1YMHA 5F7EL 1HHKB 1T21B 5TH2B 4G8FB 2EIEA 1M05B 3QDAA 3BOVA 2DI8A 2MPAL 1Q9OB 2VDQH 1IAIL 1KC5L 3QIBA 5IHBA 2X1WL 1BVZA 2YSSB 3KPSD 2VO5A 3V4UL 3BZFB 3VXOA 1ZGLB 4JFFB 3MV9A 1YYLH 1OAYH 4G7VH 3RUGE 1VFAA 3JV0A 1MI5E 5I15L 3G08A 4GT7A 1H0DA 4OCWH 3EZ8A 4L4VD 4NOFA 5J57B 3T0EA 1KYOK 4ZTPL 2G5RA 1LO2L 2MPAH 3DSFH 3VXSB 5C0FB 4CU8A 1IC5H 3P4LA 4AENA 4K7PL 4HS8L 2HFTA 3SE3A 4L8SC 1CG9B 4DCQB 4MD0B 4Z77B 4NWTH 2FEDC 5KBNC 3ALXA 2EYRB 5F9WB 2EC8A 1MHHB 3HG1D 3FQTB 5D6CB 4NO5A 4H26B 4FP8L 4NKMB 3WHXA 1XGYL 5MHSD 5FKPA 2J2ZA 4JCMA 4EN3C 4KI1A 4M1GH 5IHZB 3H9ZA 3WN5C 4IMKA 5GS0D 2NXYB 5IF0A 4PJEB 1MCBA 1DQQB 4BSVB 2EDXA 4M1DH 1EO7A 5EU5B 3EYFA 3BMWA 1F00I 4NSKB 2D03H 3C8DA 3NZHH 5F96L 5KVMC 2YC1B 2IMMA 5TDNB 3MCLL 4JB9H 1TVBB 4XCFL 4M6OH 1DBML 3UTZB 3L3OA 1Y18A 4WWKC 1MCLA 4KVNL 4OGAD 1FYTD 2PO6A 3NCFB 4DVBB 3BJLA 2IQAA 3HNVL 3E3QC 3ARSA 3UCRA 2DJUA 1T22B 4R4NC 4NDMB 5SX5H 4HXAH 3TBTB 1G6VK 3FFCE 3MRMA 3G6DH 5CZVH 3ARUA 3SGKC 4ZFOA 4I4WA 1K4DB 4LOUD 4Y4KA 3MREA 2ICCA 3KPNA 4Y1AE 3NGBC 3CUPB 5CD3B 4Y4FD 3QQ9C 4JFPB 2ZCLL 5J6GA 1FVCA 4LCUA 5C6TL 1S7SB 1AKJA 1CD9B 2FB4L 5GRXG 2HFEB 4GQ9H 5DYOA 5IBTH 4J6RH 3RGVB 3VFRA 5IHLB 1PDKA 4U6VH 5TF1H 2ZUYA 4KI5F 2VDNL 1EJOH 4ONGL 3L3DA 1EHNA 1FFNB 5TPWL 2K9UA 3QRGL 4WI4A 3SDXB 4ODXA 5EU6B 2AQ1A 4Z7OF 3X17A 4ZSOA 2EDBA 1A1MA 4Q2ZA 5I1JL 5ICXB 3F7VB 5I1LB 4S1DC 3WXWH 3LN5B 1JGEB 3HI1B 2D0GA 4GXUN 2DIBA 4OCNC 4BUGA 2W1NA 3FQRB 1M7IB 4GAJH 3QT2A 4UIMB 4WUUE 3FHAA 3SGJA 1PY4A 4DN3L 3AU1B 4ZO8A 3P77B 2VDNH 1V7MH 5FYKE 3J8F7 4XBPB 3MRGB 2XKSA 5BS0A 2FHBA 2NXYC 3P11L 4H5SA 4X5XB 1MFCL 1QR1B 5H37G 1UWXK 3ARDC 5EBLB 2QQKL 3BXNA 5D2LB 3CFJA 5FYLL 4E5XB 3RVTC 2D0HA 4BKLB 1G9MH 5FGSA 3OJVC 2WP3O 4XAKE 5CZKA 3CH8A 5EUOA 2IEPA 2Y72A 4FHBD 5J11B 3IVKA 4PRNB 3BD5A 4X7FC 4L3EB 3BGAA 5E5MB 3REVB 2VDPH 1YNKL 2X4NB 4Z0BL 3HE7A 5JDSA 5DUBA 3P4OB 4Q9RL 1JUFA 4R4BB 4LRIC 2XOTA 1P69B 2XWJB 1ZV5A 2JJVA 2EDEA 3VXUB 2ORBL 5B4MC 3R06A 3TYGH 4XP5L 1J0KA 3TBYA 4PD4K 1QTYT 5A40E 2B4CL 3WD5H 5D7LE 4FMFA 3CH1B 3RPIB 5BJTA 2HRLA 5GXBB 4FQXD 2QSQA 1H5BB 1J05A 1HXMB 2ZSVB 4NGHH 3W0WD 3RZWA 5KVFH 3ILQD 1S7TA 4WV1B 2CO6B 2E6PA 5GGQL 3BZEA 3DWTA 4X0KA 1CICC 4JQVC 1MFEH 3RGVC 2ORBH 3F58L 4TN9A 1X44A 4XP5H 1P9MA 2YD3A 3BWAB 1BX2A 4ENEC 5DK2A 1Z3GL 1T20A 3JBG7 4L1DA 2RJMA 4RGMB 1XGUB 3LKPA 2G2RA 2J3SA 3OKEB 2CKBB 4TULH 2I27N 1JPFA 3I6GB 2BRRL 5D7IB 1Z9SA 1RD6A 1B0RB 4HKBA 4KROD 1RI8A 4MAYB 3D0VA 3MNWA 1U93A 5F21B 4P0DA 1MI5D 5FUZL 3Q3GB 2Q7YB 3VXPA 3OB8A 3O6KH 1UH4A 4LSUL 4LSDA 3OV6A 5H35B 3D18A 4GUPA 2IPUG 1WZ1H 3RI5F 2ITCA 1OGTB 2UWEE 1UM6H 1KTLB 1IAOA 1IC7H 5JPNA 3S37L 3MRDB 3TPKA 4V1DA 5DK0A 4RGNE 4D9LH 2VSDA 4KTYA 3WUWA 4F58H 1JGLL 4MXWH 5F9JB 1RFDH 3Q5OA 5E6ZA 2ZJSH 1F4XL 3FFDA 5ISZB 5CJXA 5C0BA 4A6YL 3UAJD 3ARWA 3OMZA 1A3QA 1NANI 4HJ0C 5J11C 1I7RA 3TN0C 3VGGA 1HYRC 4PJ5A 3IDGA 2APTA 3WIFA 1NGPL 1DN0A 3SE9L 5IMOB 4OBSA 5EIQA 3UTTA 1L6ZA 2FWOA 4WEUD 3DHJA 3FRPG 4JRXE 43C9B 3GBML 5DD6A 1S3KL 4XMKL 5F7LB 3LEYL 4PLOB 1J8HB 4QRPE 4CVWA 4LSSH 5T1MB 3NCCB 2FO4A 1AGCB 5KS9F 3MV7E 4RISH 5T1KD 4PTTB 4X6CB 3MMEA 5CFHA 1OP3K 4PLJD 2AI0H 1N6VA 3P0VL 1H5BC 1FORH 1GGIL 4HIIB 2IANA 2WWKT 1NGPH 1D5BA 4M48H 2K7PA 3D39E 4YXLH 1U8PA 5ESVB 5I18L 5DFVC 3TVMA 4QHMB 4P5TA 3GBMH 1A9BA 3FFCD 4PGBB 1GGBL 2OJEB 4N8CL 4QXGH 3CFEA 1LP9A 4UT9L 3CFDB 5LKNA 4GBXA 2MFNA 5F1IB 2NY2C 3MC0A 4U1HB 3GMQB 4RMVA 4Y1AD 4PJCB 3IFLL 2R69H 1OTSC 3JVGA 4Z6AT 3BP7B 3H7LA 2I9TB 4G5ZL 3U9PH 5CGYD 5GRVL 1H3WM 4XP4H 4F7MA 5I1IL 4MX7B 5SWSB 2VE6B 5IBLD 1CBVL 3KPTA 3L3GA 1WT5A 3GUTA 4CVZA 1MIML 3MXWL 5E4IA 5CKGA 4MJ5A 1Z9OA 3AC0A 1FGNL 1N59B 4BELD 1YQ2A 5IUSA 1EHAA 5IB4A 4RGOL 4AIXA 1ZT4B 3TYFB 2IH3A 3S3PA 5D71L 2MQCA 4XZUA 3SKMA 1IGFH 1SYSA 4NUGH 5EZJA 3RWGB 4ZS7H 4WUUD 4WWID 1LE5B 1HEZA 3MLSL 3QO1B 4MNQB 3DYOA 4M43H 2DQHL 4MCYB 5I1IH 1I1AD 1Q9KA 3ORJA 4F7PB 2DQEL 3PQYE 2FECI 5FYKD 5I66B 2EO1A 3P30L 4BH8B 4F8TA 3QNXB 2H6PA 4ZUVA 3LPWA 4R7NA 1XIWA 2OR8A 3S4SA 1KF9B 2D0FA 4RGOH 5ESAA 1E4JA 3WS3B 4CUCA 4ZDHB 3HNSL 3W9DB 1HOCB 4RX4D 4P2CG 4F9LA 1RZ8A 1Y6KR 1MAMH 5EO0A 4WO4C 4I0CC 4XAKD 1RUML 2UVFA 4BFEA 2CMRL 1KCSH 1MRFH 3KPRE 1D6VH 5DEFA 3RVXC 1NGQH 3NACH 3WBDA 5JHLL 2ITDB 3LH2H 4HBQA 5HYJA 1BBDL 3V52H 2ICWJ 1OY3B 1WWAX 4JJ5A 3P40A 4LCIH 4LVNB 4QOKA 3TPUA 2P5WA 4HFUH 1AD0A 1P7QB 1J12A 5C0GB 4UBDC 3LSOA 1BFOA 1PKQE 3HNSH 4NP4L 1G0DA 3ZKMC 2EXYC 4C4KO 4LLVB 2D3VA 3RWIB 1UC6A 4DZ8B 1C16B 4U49A 4N0FA 5D7LD 5FO9B 1A0QL 1F3JB 1FSKB 4ZAKD 1YUHA 3T0BA 2DYPD 3U36B 2NMSA 3CK0H 4V2BA 4N0CD 3G5YB 5GGSY 4I2XB 2X7LA 3Q2CA 3U4EA 3WS6C 4LF3A 1LGVA 4YBQD 3QWQB 3W11C 3SDDA 2VDLL 4WFFE 5CLTA 2QQNL 1JYVA 1SYVB 4E42B 1AGEA 3WMSA 4KK5C 1N7MH 1GPOL 2YXMA 4D0CB 5HI3C 1FVDB 5BO1H 4WI7A 2HFGH 3RVUC 1V3JA 1KPVA 3DVGB 4ODUA 5JUEL 3E2HC 3HE6B 4HK0A 4JO3L 3GHEH 2YWYA 3NA9L 4XHJD 5C0CE 4R7DA 5B8CA 4LHUG 4Z0XA 1CVRA 1G7HA 1ZHBB 4DAGL 2UYLB 5DD3H 1XCQA 4UI2A 2BDNL 5BZWA 3RTQC 4OF5A 1EFXA 1BIHA 1S78C 2FX8H 2IBZY 1RZIA 4X80H 5CEXB 1E27A 5DEGB 3W2DH 3X11B 1RJYB 3MOAH 1MEXL 1BD2A 1T5XB 3O81A 4PJEF 4HK3N 4JO3H 2D7NA 1T89C 1I7ZB 1U3HD 1R3LA 2H26A 4RGND 2Z31B 3ULSB 3VXQA 4XVUD 5E2VH 1L9MA 4RAUA 4XPHH 3IJYA 3RDTC 5DQDH 3T1WA 3TFKC 2XWTA 3N1PC 1JGUL 3SQOL 5KG9B 2ZP0T 5JOFA 1DANT 2FHCA 1HIML 3GSNA 1U8HA 3VG0L 5E70A 4IRJB 1WCBA 1E28A 1I3GL 3GHBL 2R4RL 1A9EA 2DAVA 3VXRB 4ZYKB 2UZYB 4Q0XH 5T1DH 1CFTA 4I48A 3KXFE 4QRQA 1VENA 4RA3A 5KSVA 4OGYL 4JRXD 4XC3L 4WJ5B 4PY8I 4NRYB 4AH2A 4WHCA 4LCYA 5MENA 4QRPD 4NRZA 3B3IB 3ZDXF 8FABA 1EJ6A 3MV7D 4FFYH 5DWUH 4W6WB 1RZGA 3VWKD 4S1RL 1C12B 1FSKC 1NFDF 2EDTA 4O9HL 2C9AA 4CNIA 4MDIB 1OCWH 3FN9A 3MGTA 2XYCA 4XNYL 3D39D 5IESL 1LNUB 4NQXA 1Q72L 3MJ8A 4I3RL 3KPQA 4OLYH 3BHBB 5AUMA 4PP1D 1G7JB 1MJ8H 3C60B 1FG2A 1FN4B 3T04D 3QH3B 3BDYL 5KANG 4ZO7A 4R0LA 4LCCA 1QFWH 1FCCA 1BEYH 3C5ZD 3GI8L 4K3DL 1WFTA 4X99A 3RWDA 4PGEA 3SDXF 5LAXB 3ZKSD 1ZHNB 5KSUA 2DM3A 3SE8L 5F1NB 2P8MB 5IFAH 2NTSP 2Q8BL 5IESH 3IJHA 3QI9A 4KJWC 4F3FB 3KJ6H 3CLEH 3I02B 1Z5LA 1MWAA 1J5OH 1T04A 3I9GH 4PJFA 3CFBB 4M93C 4LEXH 4CMMB 4I1NB 5IK3A 5F44A 3RNQA 2MWCA 1CZ8H 1Q0YH 2VRAA 1WZMA 4Y89A 3GI8H 2P48B 1LDSA 4K3DH 3ZL4H 12E8L 2YPLB 4I18B 4FXKB 5E9DB 4GSDH 3NFPB 3CIQA 2WUBL 2VXSH 1IEHA 1G7IA 5D2LF 1KJMB 1CDHA 5DHYB 5AZ2H 4XMLH 5TE6H 3N85H 3VGEA 3HMXL 5D1ZA 4G9FE 5C0AB 3BD4A 3QDGE 3CCHB 4P5MA 2R1WB 1RJZB 4L4JA 5F97E 2PCPB 2ESVB 5IMLB 5F7NC 4G8GB 4AMKH 4ZO9A 4ZFFB 5I1EL 2AXJA 4JDTL 1BWWA 3Q6FB 3PQYD 2DWDB 2X4UB 1N2RB 2M8XA 4DZBA 1HE7A 4M7LH 1LEKA 3PL6A 4CGTA 1NCUA 4X4XA 1NLDH 4OZFA 1ETZA 4XRCB 1HH6A 3OKYA 3HHRB 1BQUA 4JHBA 3STZB 1KACB 1MFBH 4C59B 3BIAX 3HMXH 3N0PB 4OCYL 1RZJH 5DVKA 1U3YA 2EH7H 3O3DB 3WXVH 1JRHI 1B6UA 3CNKA 3GSOB 1S9XB 2WWMD 3KPRD 1TCRA 3KPMA 3QQNA 3WFHB 3WNNA 5F88B 4GO6B 4KRPB 1JF1B 1G7QB 5JXEC 1DQML 4P3DB 4JFFE 5F6HJ 3H3PH 4HZLA 4G6FB 5BMFL 3KG5A 4AQ1B 4WU5A 3UDWC 5B3JF 2F54A 3MJGX 2IF7A 5JR1H 2J6EA 4UNTA 4WNQA 2NY1B 4FQ2H 4YDVA 2NQCA 3SDYL 1CFSA 4PTUA 4EDWH 1N4XH 4LQFL 2MCPL 5FYLE 4GMTL 5HVHB 2AJZA 2A73B 2V7HA 4HUWA 3VXSE 4EBQL 5AYQA 3HB3D 4UILH 4JO4L 4XH2A 3JWDC 5D7IF 1A1NB 4OFIA 1CIDA 3EOAA 4XCCL 3CFKA 4HWUA 5GRVK 2HAZA 3O4LB 4WFFD 3EJZC 2P49B 2CDGA 1R3KB 3DUUA 3L5WB 3G6JF 5IOPA 3W5MA 4IRSA 1I1RA 5KSBA 3MRBB 1JHTA 2BNQB 1UB5B 1PYWB 4LIQL 3PABA 4H8WC 4EUPA 1SBSL 4ZFZB 4TNVK 1U41A 5J1AA 2YKLL 1NGWA 5C0CD 1IGCL 1K6QL 3HZMA 5JZ7C 4BUHA 4OM1H 3W39B 2F8XC 2DQGL 4JM4H 4HDIA 3MO1B 4PB9L 4J4PA 4U1NA 4K2UH 4L4TB 1QHPA 3SCMD 4GRMA 4FZEH 3L7EA 1LDPL 1G7LB 5D2NE 1FFQA 2QSTA 3FO9A 2EEDA 3ARGD 5BV7L 3SO3B 1JZ3A 1B0GB 4JKWA 1DQLH 4M4RA 5FAAA 2AK4B 2GJZB 2BJMH 2YKLH 2AW2A 2H2SD 1ONQB 3ZTNL 1DVFD 4HULB 1HHGA 5DJCB 3VRIA 1CGXA 1IBGL 3UJTH 5T33L 1UH3A 4POUB 4HKJB 1KJVB 4PJDE 4YHPA 3ZDXE 1QNZH 4LLWA 1EGJA 4YNYB 4X6CF 2EECA 3MXVL 4OLVH 4M3JA 1RJCA 4XNMB 4CJ1A 3EDEA 1FNFA 1NFDE 1Q9LA 2IFGA 3FQWA 5CSZA 3KXFD 3BIKA 5I30L 1T2XA 5D96C 2HG5B 3OF6A 4GFTB 3SDCD 1RJLA 3QNZB 3QUXA 1LE9B 4K55A 1JFQH 2AJ3A 1XF4A 5DTFA 1WUNT 4YBLB 3BT2H 2GFBA 4OKDA 4JE4B 1BZQK 3DIFA 4L8CA 3GMNA 8CGTA 4NRXB 1CXLA 4IDLA 4GRLA 2NY1C 3P0GB 4MD5A 3TO2B 4GG6A 1G9NL 1NDGB 4GKNB 4PJCF 1AY1H 5JLZA 3EGSA 4PG2A 2GK0B 1FNSL 1E4WH 4M02A 3ROOA 5HVHC 5EU6E 1GZPA 3TJHD 3BN9C 5H8DA 4NT6B 1P5VA 3WUWG 1KBGH 2YK1L 1BOGA 5I30H 4Y2DA 2DQJL 3BDXA 4PJ7A 3IAQA 1RUQL 1ZANL 2ADJA 3S37X 4ODWB 4S1QH 1U8QA 2V9TA 4UINH 5EBMB 3L95A 3DX9A 4X6DE 1NANH 1LILA 1RIUL 4JKPL 1G7PB 4WHYG 1JNLH 1CT8A 2RFXA 3FQNA 1KJ2A 1SQ2N 1YMME 4S1SH 2C1PA 1AR1C 4OD1L 3HI6L 1CF8H 4OZHB 5IJVA 5BZDB 3CPLA 4LHUB 1CK0L 2DQJH 1MUJB 1SJHA 1LVEA 3QQ4B 1RMFH 3M1BA 4OLUH 3BKMH 4K9EL 3KPSA 3OTTA 4RWYH 1IAKA 1NMCC 3TA3D 4M7JL 3SO3C 1WEJL 3OHXA 43CAA 2AQ3A 2EDWA 1I9IL 3PP3H 3BISA 4CL7A 4OD1H 4Z7WB 2IAMC 1YMHB 4KHXH 4PUBL 4WTZA 4HPYL 4G9FD 2MNUA 3QDGD 4YHNB 4L4VA 1QKZH 4JFOA 3VXUE 1GL4B 2Y06H 4NKIH 3QDJA 3QIBB 4JY5L 1T2QL 4FN0A 4RMSA 1U36A 4K9EH 3VXOB 3IYLW 3U7WL 3MV9B 5T3ZL 1E4XI 1KFAH 4XB7A 1R0AH 3A6BL 1VFAB 2NXZC 2OL3A 1WICA 4LAQL 2DWEA 1H0DB 2A6JA 1FV1A 5L8LB 3T0EB 5E03A 4PRPE 4R96A 3GM8A 3RAJH 3CFCL 3VWJA 2WM0A 4J3SA 3MODH 4I8DA 4AENB 2AABL 4HZAA 3B5HA 2DM2A 2VITA 4UT6L 1TENA 3TEUA 1BREA 5H94B 4ODSL 4ORZC 1WBZA 4LLQA 4JFFD 1I1YA 1CE1H 4NO5B 3ULVH 5IKCA 2FSEA 2HRPH 2I5YL 4BK4A 2VSCA 2HA1A 5DURD 4KUZL 3WHXB 4WEMB 4JGUA 3V6ZA 5FKPB 1WQVT 3QCVL 1FYTA 5IWLC 5C6WH 5IF0B 1BGXL 4F7CA 3G6JE 2WBJC 4X9BA 3S4SG 1UYWL 5FYLD 1V7NH 3EYFB 4NJ9H 4ZUWA 4NM8L 4KFZC 5JOEA 3VXSD 4G7YH 1E4KC 1EZVX 2VC2H 1PG7W 1VEOA 2DF3A 3B5TA 1ADQH 3L3OB 4CW1A 1Y18B 4I0PC 1KENL 2KDGA 3VGHA 4Y4FA 2PO6B 5TQ2H 3X3GL 5GGRY 5IB2A 1BGXH 3KPOA 1ZVSA 1GOGA 2R2BA 5K93A 2W9EH 2GAZA 4RWHA 4KY1L 2H9GA 2QBWA 1LD9A 2E27H 3MRMB 4ZFOB 4JEGB 3VGBA 3MTRA 4I4WB 5CCKH 3WNOA 1RZKL 1YEFH 3LKOA 4Y4KB 3MREB 2HKHL 2K7QA 4NQVA 3KPNB 1J8HE 1FCGA 1YEEH 2Y36L 2DQUH 4S0SD 1DUYA 5J6GB 1HKLH 4LCUB 1HYSC 1AKJB 1U2CA 4H1LH 3TZVA 1QBMH 2GW5A 2BY0A 5DYOB 5CSGA 1FAKT 1OARL 3VFRB 3IU3B 4PJHB 1MVUA 2AXHA 1N3NA 3L3DB 5DDHA 4ODXB 3I50H 4KMQA 4OM0L 4ZSOB 4Q2ZB 1REIA 2EDYA 2P8PA 1RAMA 3SE3C 2H1PH 5CZXC 1Q1JH 4K8RL 3QXAA 1U6AH 1MLBA 3PDDA 5GHWL 3GRWH 4POYA 4U1LA 5GIRA 2FLRT 5DD1L 4U33A 1FAIL 2P47B 5BS0B 3GJFK 4H5SB 2O5XH 3QG7H 1RQ5A 4GH7B 3WKML 4JFZH 3M8OH 3BXNB 1B3JA 2OI9C 3CFJB 4TTGA 1NC2D 5EU6D 3CX2A 1GYAA 2JE8A 4R9HA 5E95B 3NOIA 2ZWLT 3S7GA 3KDMA 3QHTC 1ZTXL 1JHLH 1IKNC 5EUOB 4FABL 2AV7A 3CMOH 5IHUH 3IVKB 4FQXA 5FKAA 4MNQE 3MA7A 1NCAH 3HE7B 4FZ8H 1PVHA 5IW6A 5JDSB 3W0WA 3MPCA 2X09A 5DUBB 3UZEA 3VD3A 1I3RB 1JUFB 1YMMD 2X4OA 2XZAL 2YZ8A 1A6PA 2V5YA 1HK6A 3Q5TA 4QXUH 2VKXA 1U8LA 2JJTC 4MA7L 3R06B 3GFUA 4WI3A 3TBYB 5ILTH 3WNKA 3IRZA 2XTJB 4KHTH 2XI9A 1YYML 1XFPA 2VIRA 5KJRL 4MA8H 2VERN 5BJTB 2R23A 1NBVL 1J05B 4YWGL 3E6FA 1ACZA 5ALCH 5M95B 4MXVF 1P6FA 4Y8AA 1S7TB 5HGHA 4R4FH 4XX1E 1ACYL 2NY0D 3MOBH 3PV7A 3BZEB 4OF6A 4MNHA 4CAGA 4XP6H 1EEQA 4X0KB 4M7ZC 5E2JA 1KLGA 1MI5A 3MZTA 4DGIH 5FUOH 5C09E 1X5FA 3C2AL 4FTVA 4GKSA 2XZCL 1N26A 3VXUD 1A6VL 4JQIL 5DK2B 5IROC 4B50A 1EUTA 3JWOC 2AEQL 4XP9L 3LKPB 2G2RB 3DXAA 3U2SA 2VJXA 1JPFB 2JJSC 5DA4A 3E0GA 4JPVH 3EYUH 4HKBB 1P6AB 2ERJB 3VFGL 2VZTA 4YHLH 3D0VB 3MNWB 1U93B 2FX9L 4C56E 4WI8A 4M62H 4L9LA 5C0RL 3VXPB 4I2XE 1HHJA 1CXIA 1XF3B 1WIPA 4NQDB 3EHBC 3D18B 4GUPB 1FBIH 4PRPD 3QRFM 4OZIE 1QSFE 3WSQH 3MJ9L 1EEZA 4HIXH 2X42A 3ZYZA 3QEGL 3Q1SL 2ITCB 1IAOB 3DMMD 5IB1A 3U6RA 5JPNB 4ZOCA 4QNPE 1UACH 4V1DB 5DK0B 5JW4M 5MERA 3GDBA 4XPBL 3WUWB 1O7SA 1PZ5A 3FFDB 3R1GH 5C0BB 3BESR 4IOIA 4HJJH 4X7EC 1JHKL 1U9KA 1QPXA 1QSEE 4K3EH 2FEEI 4MAYD 1JRHL 2F58L 5EFIA 1I7RB 1LEGA 2Z4QA 5L88L 4PJ5B 3IDGB 3WIFB 1DN0B 3QXUA 3TT3L 1ZVHA 2ZCHL 2DBJA 3QEGH 3OKKA 4M4PA 3UTTB 1TNNA 2FWOB 4OZFG 3B9DA 5DD6B 3U9UA 5F7YC 3K80A 5C8JA 3FFCA 5B39A 3PP3K 4JGJA 4FS0A 3MA9L 1INEL 2FO4B 2X10A 2XTJC 1A7QL 3MMEB 4G3YL 4XVJH 3EOYG 4Y1AA 4TUOA 4JG0H 3MUY1 3VMPA 2IANB 1T1WB 2B0SL 1D5BB 2R56L 2Y25A 4L5FL 1AE6H 1U8PB 3WNPA 3F12A 3ULVF 3TVMB 4P5TB 2PTUA 5CILH 4L3CA 1HN1A 1OT1A 1AGFA 1KEML 1LP9B 3CFEB 3ZKNC 4GBXB 3QFDA 1EBPA 1P9MC 3BPLC 4POZC 1SY6L 4QO1A 1J8HD 1J11A 4E0RA 2C1OA 5JO5A 5DMJB 3DPBA 4RCAA 1B4JL 1JZ8A 2NZIA 4LLYA 2J8UA 3LV3A 5IVZA 3ZE1F 2DLFH 3QUMA 4FFWC 4F7MB 4YXHL 2A0LD 3L3GB 1OL0A 1I1AA 3GUTB 1P84J 4CVZB 1TZIA 1OAUH 3AUVA 4LIQE 4MJ5B 4FQ1L 4Z8FL 2Q1EA 4EUPG 5IB4B 1DL7L 1FNLA 2IH3B 4XZUB 5I16A 1AD9A 4PJBE 4JVWA 3SKMB 3ULUH 4P99A 1SYSB 4NBXB 1P53A 5D7KE 5EZJB 2GY7B 5E4EB 4RX4A 3NCMA 1HEZB 3SGEI 4EVNA 5CJXC 4PJGE 1KN2L 3OJMB 5C2BH 1CLZH 1Q9KB 3HPLA 1F90L 2ADIA 1QFUL 2HLFD 2OR7A 2H6PB 4ZUVB 4R7NB 1XIWB 4P3WA 1NFIA 3S4SB 1IEBA 5ESAB 3LEVH 3PP4L 1RK1A 1K3ZA 1UCTA 1VDGA 5D93B 5DMIL 4WUKH 4NFCA 2FCBA 1RZ8B 3HFML 4OZHF 3H0TA 5D1XC 5EO0B 2VXQL 2DQIL 1KN2H 2NNAA 4UQ2A 4ZAKA 1F6LL 2JB6A 2AJUL 4FNLL 4TQEH 5DEFB 3RIFK 2DYPA 4ONHA 1A22B 5HYJB 4MNQD 2R1XA 4JJ5B 1P4BL 2OMNA 4X5LA 1GH7A 4QOKB 3TPUB 2P5WB 4JR9H 4P5TC 1AD0B 1MCSA 4EEEA 4LBEA 5J3HC 3LSOB 4DFIA 1BFOB 3PJSA 4NC1E 3DRQA 4GBXC 3DOSA 2VXQH 4N0FB 3GMMA 4PGZA 2X4SA 2IWGA 2W0LA 2WP3T 1IM3A 1YUHB 4PY8J 3S3SA 2E7LC 1EK3A 3TBWA 5CIPH 1CLOH 5ACMA 4TSCH 3MBXL 3MJ6A 5CKAA 1NL0H 4DTGH 5FECA 2JJWA 5AD0A 1OGAE 2WUCL 1UWGL 2X7LB 1NLBL 3U4EB 4KQ3L 1AO7E 1I9RL 1LO4L 4WI6A 4LF3B 5GGUA 4WHYH 3O9WD 4OAWA 1UJ3C 5C09D 2BY2A 5DS8A 5LVEA 2YS4A 1J0HA 1IZKA 2OM5A 1QRKA 1FIEA 3BO8A 2R8SL 3WIIL 1KPVB 4ODUB 2ADGA 2UWEA 2CDEA 2R39A 4N1HB 4R7DB 5B8CB 1U3HA 3MLVH 2CRIA 4Z0XB 3Q6GH 1CTOA 1I1FA 1G7HB 4YUEL 4C56D 3QUZB 4NKOA 1S7QA 4Q74A 1XCQB 4G80A 3G5ZA 4HC1L 4H20L 5BZWB 5I0DA 1EFXB 3NH7L 2FRGP 2PR4H 3GSRA 1RZIB 1A6AB 1E27B 4PGJA 3EFFA 1QSFD 3O4LE 1X5AA 3ISWA 3N9GH 5E6IA 1XIWC 3T0DA 1BD2B 5D1QD 1E4XL 3I75A 3U7YH 4U6HA 4F9PA 2H26B 1R3LB 4JRXA 4YGVA 3VXQB 1QUNA 4RAUB 4WTZG 5D93C 3IJYB 4P2OD 4QGTA 4QRPA 1MRDH 2D7QA 3HZYA 2N4IA 3MV7A 5JOFB 3GSNB 3H9SA 3U46A 3MR9A 1JTPA 1QSED 1U8HB 4NQCE 1WCBB 1E28B 1A9EB 1T83A 1A7RH 4I48B 1I8LA 4QRQB 3RL2A 1MCWW 4OLXH 3D39A 5DD5L 5KSVB 2WMPA 5T5FH 3FT3B 4AH2B 5K9JH 2AK1L 4LCYB 5E6YA 5MENB 1BAFL 2CLZA 8FABB 1TZGH 2CKBL 3O8XB 1RZGB 4X5WA 1CDCA 3C5ZA 4ODHL 1C1EL 3DBXA 3V4PL 1ZSDA 4UAOC 5IB5A 2DRUA 2QADB 2WW8A 4CNIB 1S7RA 2JLLA 4GOSA 2EH8H 3N1MC 3MGTB 5IBUG 4R97B 4NQXB 5C08E 4IRJD 3MJ8B 4HPOH 4OFPA 5DD5H 5AUMB 4W4OC 1F8TH 1DBBH 2H32H 1JN6A 1FG2B 4Y5YC 3LRGA 4P59L 3SKJL 5IGXL 4R0LB 4LCCB 4QGYA 3FJTA 4KU1A 4X99B 4PGEB 1WJ3A 3RWDB 4DWHA 1W8NA 1T03L 4HUXA 5EOCL 2FGWL 4XXCA 4U1MA 5KSUB 3R0MA 3L1OH 4NCDA 5TE4L 4KV5E 2DI7A 1T7XA 3IJHB 5B8CC 5DJ0A 3NFNA 3QI9B 2XQYK 1F11A 1Z5LB 3FB7A 1MWAB 1ZEAH 3QUZC 4PJFB 4UB0L 3SKJH 5IK3B 5CINH 3RNQB 4OSUH 3BKJL 3FN3A 3WIHA 4K23L 3C60D 5D7JD 4MB5A 5DT1H 3ARRA 1L7IH 1PKOA 3L9RA 3D0LA 4M61A 3D3VE 3UC0L 3PWPE 1YJDH 3F5WA 3VGAC 1NMAL 3ALPA 4RMQA 4S10A 2VOTA 4U3CA 3EDJA 1G7IB 1QR4A 4PY7A 3O6LL 3OB0H 2X4TA 3MBED 2P42B 5D1ZB 5D7KD 5DMKA 5I74B 3FZUD 2NPLX 1CU4H 4OZHE 5KW9L 4LASL 5GQBA 3GJEA 4HUKB 4EI5D 1JYXA 3ESVF 4IOSD 1KPRA 2PETA 4K23H 5EUOF 3KPRA 4OJFL 4DZBB 1LEKB 3PL6B 2A74A 1S9KC 1VFBA 5HHPA 2BNRE 4X4XB 4OZFB 1ETZB 4Q6IA 3T2NL 1CI5A 1HH6B 4JREC 4X83A 5DJAA 4XVTH 5DI8B 4QLRA 2JCCE 4OCSL 1PKQA 2DMKA 2LTQB 5J06A 3P0YL 3O8XC 2XKUA 4FA8A 5SX4H 5I6XC 1WF5A 3LDBB 1F4YH 5LCVH 1KIUA 1AHWC 3KPMB 3QDHA 3ULUF 1KB9K 4LARL 5GRYA 1EO8H 3BYYA 2Y1VA 3HAEG 4ZPVA 3MFFB 4NN5C 4BK5A 5CJQL 5EA0L 3KJ4B 4K3JH 1X6LA 3MV9E 4HZLB 2I24N 4WU5B 2F54B 4X7TA 4R0LC 1JTOA 2GY5A 3IDMA 4DGYL 4WNQB 4LPYA 2BVUA 5C1MB 1ULVA 4YDVB 2VABB 3T0EE 1CFSB 4PTUB 3BGFB 3MV01 1UEYA 2DQTH 2AJZB 2V7HB 3KS0H 4HUWB 5IW3A 3DX8A 4KVCH 4O02H 3GSNH 4CU7A 5HI5C 1OGAD 5DGRA 4XH2B 5C0CA 3I6LE 3EYSH 5E0QA 4KRPD 2DLTA 1AO7D 3EOAB 5GZOD 3MLZH 3CFKB 2BHUA 1GC1C 3AXLA 5JHDE 5GRUL 1U58A 3T2OA 2CDGB 3SCMA 3DUUB 2GJ6E 4C4KT 5IOPB 1EAPA 5I8CA 4IRSB 5GGTA 5KSBB 1JHTB 5DR5L 3TF7C 3PABB 2V17L 3ARGA 4EUPB 1QRNE 4N1EA 3HI5H 4OLWH 5J1AB 4P46D 5C7XL 3O6MH 1T1ZA 1KCUH 1NGWB 3U79A 2XIDA 1OAXH 3HZMB 3GKWL 2FD6H 5D1ZC 4NN7B 4HDIB 1DLFH 2GI7A 4U1NB 4HLZH 5DJ6A 4ZOBA 4GRMB 1MNUH 3L7EB 4JANA 4WI5A 4KMLB 3LQAH 2IBZX 1BJ1J 3FO9B 3HR5A 1X5HA 3O4LD 1LO3L 1BVLA 3GI9H 2AEWA 2C3GA 3KXFA 4TVSa 4ZFGL 4IM8A 3SDAD 1FRGL 1T80A 5DHVA 3JSSA 1HHGB 2XY1A 1C08A 3IFNH 3VRIB 4ZD3H 5FDYA 4ZXBC 1K8IA 5IEKA 3ZT7A 4LSPH 4YHPB 4YHMH 4LLWB 4JO2H 4BQ6A 1NUGA 3LDBC 4XB8A 4NQCD 3IDXH 3QEQB 3RP1A 5L7XL 2X6MA 3V5KA 1MWAH 3CLFL 3QWRA 3KLHD 1Q9LB 3FQWB 4PRIE 5CSZB 4CDGC 5I17A 1LO3H 3GIVA 3M07A 1DSFL 1FGVL 3BIKB 4CMHC 2LVCA 4Z5RA 3ZT6A 2X44D 1RJLB 5HTSA 3QUXB 4RAVA 5C6PB 2AJ3B 1XF4B 1FIGL 5DTFB 4OI7A 1EVUA 1J87A 1KN4L 2FEEL 25C8H 2GFBB 4L8CB 3B8YA 3DIFB 3GMNB 1LP9F 3T2PA 2NY5C 3ARFC 1WISA 1BFVL 4GRLB 4MD5B 4GG6B 1MFDL 3LKRA 4YDJA 4UIKL 5JLZB 3EGSB 3ROOB 2BHYA 1GZPB 5KZCB 2VLLA 5C08D 3QIUC 1BOGB 4Y2DB 3LS5L 4PJ7B 3V6OC 6FABL 2YN3A 3X14A 5FHAH 2ADJB 3HRZA 3QULB 4JDZA 1U8QB 5ADOH 2J1KA 3L95B 4OZFH 1RUAH 3DX9B 3KPLA 2Z0BA 5A2LH 4JAMA 4WCYL 2R0ZH 4U0QB 1CT8B 1M6OA 4XI5C 2P44B 2RFXB 4LLAA 4UIKH 3FQNB 4WHTA 4WTXA 1KJ2B 3ZKQD 2C1PB 1H9VA 5EB9A 1QEWA 4HMCA 1TJHL 3CSYA 5IJVB 4B41A 1D9KD 3CPLB 5B39G 3ETBF 3VG9B 1QD0A 1N6QL 4PBXA 4G9FA 6FABH 1I75A 1SJHB 3QDGA 1GZQB 1L6XA 2AJXH 4OI8A 4RFOH 1PQZA 3M1BB 4XC1L 2CJUH 4KUCF 1W8OA 5KVDL 1RUPL 1QHOA 5F1OB 2QLVB 3PHOA 5F9DC 1SM3H 3TIEA 3V0WH 4MCZA 4TUJA 3KPSB 1IAKB 3FONA 4HUNB 2HMIC 3D3VD 4NO2A 4XWOD 3MGAA 3PWPD 5T5NG 2CXGA 3OHXB 4YDLB 5IIEA 43CAB 2CH8A 4Q7DA 2J6EH 4QHLA 1WFNA 3AREA 1H3GA 2X1PA 2Z91A 4L4VB 3MLPA 1KELH 4QTIH 4JFOB 5IT2H 1VFMA 4M8QA 3WFZA 5DUPL 1MCPL 3U4AA 3CDGA 2WV3A 1OAQH 2BNRD 4U3HA 3ARXA 2DL9A 2R2EA 3QIWA 2OL3B 4G6MH 3BKCL 2ICWA 3HG1B 2DWEB 1N0LA 2A6JB 1FV1B 2ZOKA 4EUPH 5AYUH 5I1KH 4FOMA 3BPOC 2O5YL 2CK0H 4R96B 4Y5VC 3AY4C 4K07A 5I0ZA 4M5ZH 3JWDL 5J1TC 4HKZA 1MHEA 3DI2B 4PLNC 5LGHH 1X5ZA 3QHZL 5IBUB 2VITB 4LU5H 2EICA 2VXUL 1XF2A 5ACZA 3UJJH 4K8RD 1PJ9A 3S34L 4Y2DC 1WBZB 4LLQB 4KJQD 1I1YB 4L1HA 2E5EA 5I8OH 3MV9D 3ARBD 3OKDA 3SGEH 2AS5M 4H8WL 4DEPB 2FSEB 3RWHA 3TNNA 3WFBH 4HGWA 3V6ZB 4L8BA 4PLKD 5FV1L 3N06B 1FYTB 1SJEA 5TE7L 2QKIA 2FLBT