1HZKA

Solution structures of c-1027 apoprotein and its complex with the aromatized chromophore
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
110
structure length
110
Chain Sequence
b'APAFSVSPASGLSDGQSVSVSVSGAAAGETYYIAQCAPVGGQDACNPATATSFTTDASGAASFSFVVRKSYTGSTPEGTPVGSVDCATAACNLGAGNSGLDLGHVALTFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-1027 APOPROTEIN
publication title Solution structures of C-1027 apoprotein and its complex with the aromatized chromophore.
pubmed doi rcsb
molecule tags Antibiotic
total genus 9
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2001-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00960 Neocarzinostat Neocarzinostatin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.230 Mainly Beta Sandwich Immunoglobulin-like Neocarzinostatin-like 1hzkA00
1J48A 1O5PA 2CBOA 2CBMA 4JW3A 1NOAA 1J5HA 1ACXA 1AKPA 2G0LA 1HZLA 1HZKA 2MCMA 2G0KA 2CBTA 1NCOA 2CBQA 1J5IA
chains in the Genus database with same CATH superfamily
4X7SL 4N9OB 4XCNB 2B0SL 1TNMA 2E59A 3NJMA 3NZHH 3SCMD 2JKJA 1S6NA 4Y4FD 4DWHA 4R3SA 3FSWA 3GTVA 4OT1H 4X8XA 3LKPB 3Q1SL 2NY3D 5CR8A 3KDPB 5EBMB 3B9EA 2XWJA 4L3EE 3EH4B 4PW3A 4WW1A 4XN8A 3OMAB 4PJCA 2UVEA 3QEGH 4BGLA 3PL6D 4HVBA 3GJFK 4H0LC 1IGFL 2EABA 3T3PE 1LD9A 3FULA 4NNYA 3RJDA 3CFJB 4UNUA 5EN2B 2GFBB 1FCCA 2FNBA 2QSCH 4KDTC 4JFOA 1QUNA 1E7UA 2JCCE 3MJ9H 4WHYG 4KFMA 4ZMZA 1FFNB 4XN9A 5CFHA 4NYLA 5ECJE 2LABA 1U91B 4BXSV 3DJ9A 1TVDA 4HPOH 4QAMB 5AOKA 2NT1A 1SRDA 2PWEA 4WTXA 3SO3C 3QIWD 4W9IC 2V5RA 2K3TA 2IAMD 2CK0L 2QQLH 4ESKA 2CBOA 5CAYB 1CXHA 3PNWA 3GMRA 1U3HB 4ELKB 2WLKA 5AWNL 3KXFB 1UM5H 3BKCH 2WN2A 2UZYB 5EFIB 1DN2A 2NSQA 1CDGA 3UOAB 4Y5XB 5JMRA 1R4XA 1TSRA 3LZOA 4UCFA 4FLSA 3NN8B 3NQKA 4AWJC 3EKCA 1G9NC 4RBPK 5ANMB 3EYOA 5EZOL 5CCGE 4PD4K 3F5WB 4PREB 4YK4B 1G87A 4MVBC 4WI8A 2PPDA 3UDWC 3MROB 2E7MA 3ZTEA 3HG0A 2HT2D 4XNYH 1CLVA 1JV2B 4PJXA 1OCRB 4XMPH 5JYLA 1INQA 2J7LA 2OULB 3VM5A 1GYWA 3ZT6A 1I1AA 3OLEA 2HJFA 4AL8H 2EKSA 5HYFA 2VLME 5LBSH 4MJID 1AGCB 1QVOA 1CLZL 3H7BB 2CWRA 2R2EB 3OR7A 4I3SH 4L4VE 2C1PA 2L7UA 1W8OA 4MBOA 1HHIA 3WN6A 3TM6A 1QHQA 4RAVA 1RUQL 2H0FA 1KPVA 2HB0A 2VKXA 1NKOA 4CBZA 1PG7W 2B8OT 1IKFL 1LNUB 4GNKB 1I1AC 2CRIA 2VE6B 1MFBL 1HQRB 1MXGA 5JW4N 4XPBL 4JDEB 4UU9A 4PJGA 2VW4A 3IFLL 3QORD 2GB2A 1X9QA 1BREA 3FQUB 1E9QB 1NMCC 2X4SA 1YQVH 4Z7VA 2J25A 3WHE1 3FQTB 1P1ZB 2D7PA 4AK1A 4JJ5B 5FR3A 3GBNH 2EXWD 2IOIA 3CAFA 2GJ6B 1K8IB 5B3JF 4NB7A 4WCYH 3H9SB 4RNRB 1VKXB 3BVDB 1RK1A 5C97A 3ULUE 2QKIB 1M71B 1X5AA 2ENSA 2W88A 3GK8L 2CHNA 1D5BA 4GO6B 5DHYA 1S8DB 3DX9A 3S5YA 4V2BA 2BMKA 1IARB 1JTOA 1ZK5A 4BUHA 3APNA 3W39B 5GZOD 5HYJD 4GFTB 3ILDA 3QUZB 4CU7A 3HJ0A 3FAXA 5D70H 1TZIA 1MIEH 3L3DA 4KRNA 3GUTA 1M7DA 1EHLH 1JIBA 4DKFL 4NQXB 3MOBH 1JD9A 2NY1B 5TE6H 1JZ7A 2D7QA 2YRLA 3BPCA 3TC9A 4LAJH 4M4RB 4QRTB 1VCAA 5KBDA 5E1AA 5HYSB 2VR4A 3KYNB 1AHMA 4U3SB 2EDWA 3G04B 3GKWL 4PGCA 4U1LB 4JL2A 4YDLC 1LE9B 1MJ8H 4Z77A 5IJVB 5IQOA 1YN7B 2BVUA 3Q3GB 1ZXQA 4JRYE 1LO3H 4XB7A 1IFGA 2NXYB 3MRFA 2F15A 5I0DA 1CVSC 4L3AA 3WKMH 1QFWH 4A63A 3DI2B 4JS7A 3MRHB 3ABZA 2NW2B 5J13C 4OCRL 4OLWH 1LO4L 5DVKA 5FUZH 5BJTA 1G1KA 1PEWA 2ZUWA 5LDSA 5LNEA 4ODBD 3QO1B 1MWAB 1WJ3A 2VR8A 4J28A 1YEGH 1C1EH 1FH5H 4GI6A 4EI5A 4JUTA 1ZLUK 1BXAA 2F54D 4HLZH 2X44D 2CBQA 2WOBA 5MERB 1FO0H 3ZYOA 2E76C 2B2XH 1IFHH 4YHPA 4ZFZA 2ITCA 5DJ6A 4JDTL 4QHKI 1E4HA 4R7NA 3RX9A 3LRSB 4QY8B 1Z6JT 3GQFA 3VFRB 3QEQA 1UURA 4JLRA 4URKA 5C86A 1WAAE 3L3IA 3CLEL 5FA4A 5LXGL 1CYXA 4PBVC 3X12B 3T8MA 2YGOA 1QRNA 4DP6X 4EI5C 1JZGA 3E1ZA 5FF6B 2JLLA 3HAEH 4M1CD 5G4OA 3OTTA 3ECVA 1OT1A 3W0WE 4TN9A 3KPRA 4MS6A 1CGYA 3ERXA 1AD9A 2F7RA 1ORSB 4DK6A 1IB5A 4P5RA 4JZJB 1NFAA 1RZKC 5EZLB 1MI5A 4M8VA 2VMEA 1PY0A 1MWOA 2NY0B 3KPSA 4K9EL 2N7SA 1OCWL 2WSPA 1A3RH 3CN3A 3LZLA 5TE4H 5LKNA 1D2PA 5D1ZC 4DP7X 3I6LE 3BEWA 4JRXD 3T2LA 4MDIB 2I24N 3DIFA 4OD1H 4ZX6A 1F4XH 1YEKH 3C75A 4HX1A 1UD5A 2Z92B 3O41A 4X6CA 3EJZD 3TZVD 3II3A 3UTQB 2R15A 2NY2C 1HEJC 2DMHA 3CDGA 3WI9A 4LSUL 2PYEE 3TTYA 1AKPA 4JFDE 2ISDA 3FOMA 4I0CC 4WTZA 1DQKA 4EZLA 4X6DE 2XN9D 5CMAA 2PYFB 3FQWB 4X8JB 4DN4L 4HGKC 3EH3B 3NDYE 4OKVA 2ZF8A 5DJAA 4AYDC 1QHPA 3BKMH 4KXZH 4UTBL 1EEZB 5E5MA 2R56H 2W81C 4HS3B 3VXRE 5J12B 4G7VH 1R3HA 2WWMC 1IKNA 4YHKL 2KQMA 1S3KL 3K72B 3DRTB 2Q3AA 4M3JA 2QSVA 4Q2ZA 2APTA 3HC0A 5DJCB 5IHBA 4ZPVA 5EBLA 1BD2B 4YWGH 3V5DB 4ERSH 1B6DA 1SXAA 5IW6A 3UYRL 3U4EB 3IXTA 4Y9CA 4EIBA 1CWVA 1LTXA 4YHNA 1QI3A 2M1KA 5HGBA 3MV8B 5K9JL 2CPCA 5DT1L 3B2VH 1W0WB 4M6ML 2C9QA 1XCXA 2UWEF 4PRHB 4NNPL 1BZEA 1CL7L 1BEYH 2R1XB 5T1KD 4F58L 1JK8B 4V1DD 2J8UE 3L9EA 2IGLA 5ENWA 2J21A 5EOTB 4IDLA 1FZOB 5CN1A 4DGUA 3X11B 4ZW7A 2PP8A 5L8KB 1BAFH 3DX0A 3UTSE 4BEIA 3MRCA 4AI7A 3VVWA 2OMWB 3IJYA 1DBKH 4X99B 4LLUA 3THMH 4PWJA 1RUMH 4JR9L 1WFIA 4HWBH 1G94A 3GZQA 1E7VA 5JXED 2M2DA 2WJ7A 4MDRA 3N1FC 5AW2B 4MRBA 4HJJL 2JVUA 3PQYE 4OF5A 5DRWA 4OQTA 4G1MA 4L4VD 4MJ2A 3SCMA 1U93A 4XB8A 2QR0B 3HNSH 2PPCA 4ZX3A 4ZT1A 1YY8A 1M6OA 3IDNA 4M93B 3QZWG 4PTUB 5IROA 3WFZA 4ENEC 2UYLB 5I30H 4JO3L 5ESQA 5KBNC 1EWHA 4HGWB 3ZE1B 3WEXB 3C9NB 4JPIB 3BRFA 1QW8A 1EGJH 4HH9B 2XRAL 4KQ0A 4PJ5A 3QCUH 3DK0A 5CGTA 2A4CA 1KGWA 1AP2A 3ROLA 3K6IA 4XAWH 2SEBA 2VNCA 3ME0A 1X7TA 5E5LA 2IALA 2YA2A 4U6XA 4AH2B 3SCMC 4GOSA 1OARL 1CLOL 2G75A 4W9GC 4HUMB 4LB8A 5IROC 4QHMB 2OJZL 4ZSOE 4D2NA 1AR1C 2CKBB 4HUVA 5HVFB 2Z31B 2KERA 3UCQA 3VXOB 2XYBA 3GIVA 2X1XR 2XETA 3FT4B 5IB2A 5ALBH 2XZCL 4UQBA 1QSEB 3OHMB 2B7DT 3HI1A 2YQ2A 3PWNA 2UUDH 3HVDA 1CFSB 4EOWL 3X3FL 2DQFB 2XBTA 4HF5H 3GSNL 5GGTH 4ELMF 3MBXL 4GG8A 2VIRB 1PF3A 3ULVF 2WXQA 3CH1A 4D8PB 4P5KA 5L4FA 3IF1B 1ES0B 3JYCA 2N56A 1DL7H 4JFHE 1MFDL 4JL1A 4P04A 4IM8A 4XP6H 4XR8C 3FCTA 4JX0A 1EZLA 4KKPA 1HCYA 5HGGS 1JPST 5AVTB 1KXTA 4KO9A 1E5YA 1IVTA 2FGWL 2IPTL 8CGTA 3K3QA 2AV7B 2AJZB 4Z76B 2ESVB 1J8HA 3PHQB 1FE8L 2OMVB 2BSED 3B3BA 2NX5E 5FCUH 1TDQA 4FQXD 3LZFH 5C07E 4OV5A 3ESMA 1ZHKA 1AGEA 1KTRL 4HLEA 3ECQA 5E8PA 5INDB 3TH4T 3ZMRA 1A14L 2VLJB 4ILDA 4KKRA 2I60L 5DQJB 1S7XB 2OZ4H 4Y1AB 1T1WA 3BFQG 1IJ9A 4N6RA 1IC4H 1KCRL 3RWFB 2IPKB 4WK0B 3CE1A 2GCYA 1ZY9A 2QSTA 2XKNB 2C9PA 3C6LD 4R4BA 1UZ8B 2XJLA 5BO0D 1U0QA 1S5HB 4FP8L 1KGCE 1ICTA 3LD8C 1WSST 1A7NL 1MJ7L 1VDGA 4N6QA 3QPXL 1AHWB 5B7MA 4FNPA 4C83B 4TUOA 3A47A 4NERA 5JHMA 3P2BA 3TF4A 4D9LH 4G5AA 2DF3A 2XPYA 4CSTA 4N8VB 2O6PA 4PJDA 2P24A 4Z7UA 3TV3L 4JN2A 4OD2B 4D0BA 3KEDA 4Y1TA 4PHXA 1SDDA 4PJ9A 4KO6A 5K39B 3BIKB 3OLIA 1NGQH 1WT5A 1R0AL 4EN2A 3BWAA 3NJHA 1TO5A 1U8IA 3D69A 3FBKA 1PKQA 1F11A 5L2KB 4Q6YA 4ODVL 3QZMA 4JN1H 5DMYA 1P6AB 3LSOA 5FFOA 3I2CH 3ULAB 3SHSA 1HIMH 1UACH 5E08H 3P9MB 3H6JA 5E9DE 1HAUA 2XVBA 1MW2A 5KUKA 3SQBB 5I6PA 4PJ9C 1FG2A 2NQ3A 2YARA 3IMBA 4AXWB 2GJ6D 3DSNA 3P0VL 2Z0BA 1WT5C 3H9SD 4AEEA 5J9PB 1TYRA 3IGAB 1PSKL 4W4OA 2VDMB 4KQ4H 2HFGH 2I7SA 2PR4L 3SKOB 1KTLA 3ESNA 4QYOA 5FO2A 4HIXL 2HKHL 4OIBA 2EE6A 2W80C 1PCXA 1KN4H 1X5JA 2BSBA 3DX3A 4XHQA 3SGJA 3RKDD 1I7RB 1A0QH 3Q0HA 3S3DB 2QZQA 5KOVC 3QAQA 4MS8C 4N2BA 4PQXA 3UADA 1F6AB 3LEVH 1U8LA 3LNHA 4QXTB 5DJDA 3QUZD 4K8RH 5DZJA 5I17B 4D0CB 3ZRFC 3JBG7 4J6RL 5KSVB 1SJEA 4W4OC 4YQXL 4LLDB 3HMXH 4GQRA 2NY1D 1AZBA 1LLAA 3WFEL 4PRPB 4BA8A 4DK3A 5B39G 5I1KH 1WGVA 2HA1A 3HBZA 1RJCA 1RHHA 2DMBA 3CFEB 3MNZB 4KRMB 5F72S 9CGTA 3SGJC 1RAMA 2G60L 3D4ZA 3NFSH 4HS6B 3K2MC 5B22A 1A4BA 3I75B 1F3JA 4IIQA 4O2FB 3RIFF 4F80A 5AQ0A 1O7SA 4HA1A 3D39B 3FT1A 1KYFA 5A2KH 1ECZA 4Y7OC 1XGYH 3RVUC 4UYQA 3KDMA 2AEQH 1QNZL 1E5UI 5JOFB 5KVDE 1BM7A 2NYYD 4XCFL 3A22A 4KOCA 2O5NA 3IMVA 4OUUA 4R3SB 4JHBA 3ARGA 5HD8D 3W2DH 1VF5C 3KR3L 4PJ7F 1QR1A 1H19A 3ZKSD 2RFXA 4WW1B 2WXPA 3A67H 3CXHJ 4PJCB 4X6EB 5I1AA 4IIQC 2HVJB 4PLKD 3MCLL 4FERA 3P0YL 3S37H 1A6PA 2E8ZA 1LD9B 4NNYB 1LILA 3ASOB 4Z8FL 1JUFA 1T04A 1SBSH 2NYZA 2Z93B 4TVSa 4JFOB 1QUNB 4H8WC 4XXCC 1Y18A 4RGMC 4YIQB 4NYLB 4FA7B 4KVNL 2PW1A 4UIMA 3ARGC 1JN6B 4PP1D 3DVNA 4OJEH 2OBGA 3FU8A 1GSKA 2NNFA 3RZCA 4M6NL 3KWWA 3SYQA 1DEEA 4OFKA 4CVUA 4AQ8A 2JB5H 5KS9E 2FEDC 1T1XB 3S36X 3GMRB 5GISL 4ECNA 4E9WA 1RZQA 3N1MC 1L9NA 2CU9A 2APBA 3N1GC 4R2GD 3RBGA 3J27A 1N0XL 3O8XA 4PCKA 2VSCA 4L3EA 4PJIF 4BFIA 1PJ9A 2IGTA 5I8EA 3WS6A 2VUOA 1ZHLB 3BVTA 5G4NA 1WD9A 1MCIA 1A2YA 3GRBA 4KKAD 3RZCC 3EYOB 3TCTA 2NY6B 1SBBA 1NBYA 3F7LA 4LLMA 4K71C 4AQ8C 3E6HA 5EHFA 4XI5C 1MFEH 2JCCA 1FVDA 5HYIA 1HCZA 4MCZA 4QGYA 5CLWA 1LK2B 2VLKE 4PJXB 2FL5A 1FLRH 2EDLA 3O8XC 2Z9TA 1A4KB 3PYCA 4FFVD 3BZFA 2HJFB 3VD2A 2EKSB 5E9AA 3WS6C 1AQ8A 5DWUL 4E9QA 1I9IL 1CIUA 1X9UA 1QVOB 2C4FU 3O6ML 2Z7UA 2VXVL 4EMZA 1UH3A 3OR7B 2C1PB 3CFDA 2YQ3A 5F7LB 1VIWA 1NMCB 1HHIB 3IS0X 5C3IA 4DN3L 1G9MC 4F57H 3SDYH 1KPVB 2X1WL 5B1AB 3LVEA 1DJHA 4G3YL 4IJTA 5F6HJ 1PX4A 3F58H 1NFIB 3VRLF 1ZS2A 5EDSA 2C9UA 2IH1A 4KTEH 1YUHA 2IVFC 3AQXA 1GC1L 3RGVA 32C2A 2B4CL 1ZLWK 1UOWA 4UU9B 1U41A 4PJGB 4XPGL 1BG1A 5D5ME 2BS71 3A3YB 5JXAH 2BY3A 1RERA 4OGYH 2X4SB 4Z7VB 2F2HA 3ZKMC 2ADFL 4PRHD 4DGIH 3GS0A 2BVEA 1EZSA 3U1QA 2I27N 4GAYA 3QUGA 2PCPA 2XKUA 1RK1B 43CAB 5GRVK 3QUYB 5ABAA 4D9RE 5IQ7H 2B1AH 4N25A 3RGVC 4P2RE 2AS5M 1XL4A 3G5YB 4LPYA 4HJGA 1MCSA 1D5BB 2VXTH 5C09D 3U7YH 3G3LA 1OVZA 2IDTA 2EDJA 2V7HA 2BRRL 2YIHA 3CJJA 3SIKA 3VYOA 4A7QA 3PXJA 2BMKB 1E2VA 1SUJA 1T80A 1HEHC 3UZVA 4GUQA 1DQIA 4NZTL 4H44C 1MN4A 4NC2B 1BF8A 2YHGA 2NRDA 5JXEC 3BQVA 3EYFA 1I1FA 4YDIH 1TZIB 3L3DB 3NH7L 3GUTB 1M7DB 4L5FE 1M3JA 1EBPA 4HPHA 4YUEH 1A4CA 2A9BA 1JDAA 4GRWE 4LL9A 2OS7A 3R7RA 5F7UA 1XIWB 4H0IA 5L88L 2H2PD 3PWPB 4PBWD 5J13B 4A55A 1XH0A 3CLWA 4GI9A 3OC5A 5DEZA 4L4JA 1V54B 1ETZB 1M1XA 5E1AB 5ACMA 4PEEA 4PGCB 2DJSA 1C8PA 4ZODA 5LBSA 5KSBF 5AOJA 5C0ND 2D03H 4CSSA 2A7BA 2DWYA 1G5AA 4U1GC 4XMKL 4ZJ9A 4TVPD 3GSXA 1FNGA 1MJJA 4DIXA 1QTSA 3WJMA 1KEML 2CK2A 3K1DA 1BXUA 4HSCX 1ZRUA 4N8PA 3IDGB 4IKNA 4O5LH 5KBKA 4Q6IB 4EVNA 5CWSA 5BJTB 2GY5A 1XF2A 2ITDB 3U7AA 3EYUL 1P6FA 1QSED 3T8XA 3BVWA 4X7TA 4I77L 1INDH 3IPFA 4M1DL 4EI5B 3ULUC 2X38A 4DO6A 4NZ8A 1N68A 1GS6X 3VGAC 1K5NA 4MLSA 4I8DA 2R2CA 4IBYA 3ZLQC 2MH4A 4NIKB 3WYRA 4ZK8A 4HUWB 1ET8A 5BO1L 1M53A 4ZFZB 3S5LA 5ADOL 4S2SA 1HFUA 4MNGE 5DJ6B 5F8RC 3MLRL 1OAYH 1DSYA 1HZHL 5DGQA 5TH2A 2BWQA 3WY4A 4JRYA 5DZAA 5C0JB 1MG3C 2Z8VC 4LSTH 3QEQB 2W0KA 4JLRB 5ID1A 3L3IB 4Z7OF 4AYFA 5FECA 3CZFA 3HNVH 3ORJA 5DQ9A 3QNFA 5GHWH 2AXJA 1BYNA 3BT2H 3SY0A 4GH7B 5DUBA 1UWEH 1ZHNA 2LVCA 1W72H 3SOBL 43C9B 2GJJA 2G3ZA 2ICWJ 3KPRB 3CH8A 5DS2A 2NY2B 1FIEA 4A66A 4DOHE 1AD9B 3QZNA 4FQXC 3RBSA 5KYWA 1WUNT 2WWKO 1OGTA 1ZGLP 4LRIA 3ZR6A 2VITA 1MCHA 2O6FA 3UTPD 5K1NA 1MI5B 4FGMA 5DK2A 5EUOF 2BK8A 4BUGA 3OR6A 1PAMA 3KPSB 3C2AH 3PJSA 5L0QB 4TXVB 5ITFA 1DR9A 2AEPH 2NY7L 5SWSE 3KYAA 3DIFB 4ABQA 4PWGA 3WLWD 2B20A 1S9VA 1Z7JA 3O41B 4X6CB 4IGBA 3V6OE 1O7VA 3V4PH 3CDGB 3D4YA 4IDJL 1WAAA 5BMFH 2VXUL 4LRIC 4LHUD 3B43A 2F53D 1M05A 1BVNT 2COVD 2VDNL 3CZJA 2VKWA 4KI5D 3FOMB 4YS4A 4PGJA 2NT0A 4KVPA 5KVFH 1BVOA 4JZOA 1SF5A 1YJDC 3KMDA 4Z95H 1WZLA 4RDQG 1F5WA 3W0WA 4OKVB 1OSPL 3KEHA 4Y4KB 3PS6A 1RIVL 5KZCB 5E5MB 1WZAA 1DO5A 1NGXA 4AJYV 4IGBC 3B9DA 4PJBB 2J3SA 4HFWA 1A6UL 5L2KD 1IBGL 3LIUA 1YC8A 3HC0B 4Q2ZB 2O4EA 3Q43A 4X2UA 4XP1H 5H8DA 4ZPVB 2DQGH 5EBLB 3C2SA 2IV8A 2MPVA 1V7MH 5IW6B 1GTNA 3QXAA 4LFHG 4B53A 4RBPH 1URZA 3IXTB 2YA0A 4YHNB 1PY4A 1S5IL 4W9HC 1YEHL 5HGBB 4MZRA 5LAXA 5I66B 3Q6FA 1WHPA 4HJ0D 2IOOA 1UGKA 4FZEH 2JXMB 1NWOA 1EO5A 4LGPB 1XDTT 2PYEA 4OCLC 4CSPA 2OR8A 4JFDA 4LOUD 3UZEA 1NCHA 4FN0A 3AUWB 2BDNL 5KVFE 4NO0B 3B56A 4X6DA 4IJ3C 1NZRA 4YDJA 1ZTMA 1CE1L 1CDYA 1FFPB 1XCQA 3BUYA 4FFWD 3CCHB 1WVZA 4M8QA 4JFQA 4POYA 1XF1A 3B9AA 3MRCB 5LG1A 3VXRA 3IJYB 5JPMA 5BOJA 1G7MA 2IQAB 2VXQL 1CR9H 1Q9OA 1VLXA 4NCDA 5IB4A 5KW9L 2M83A 1ONQA 3KE0A 3W3BA 2VSDA 2EYTA 3TO4B 3UZEC 3NCBB 5DRWB 1QPKA 3Q06A 2E7DA 3NAAL 5JA8B 2KS0A 2R0ZH 1U93B 3S3CB 1I75A 2XZZA 3B1UA 1YY8B 1M6OB 1J0YA 2LLNA 4M1GH 1S7VB 3CVHL 5B3JE 3ARVA 2YXFA 2A9AA 4F8QA 1OAUL 5GPRA 5E99H 1L6XA 4YHLH 2J8UA 5ETUA 3NSJA 4PJ5B 4F8NA 1N3NA 1MAML 1RMFL 2DWSA 1CCZA 2EVFA 1AP2B 3ROLB 3TBYB 3HZYA 2AEOA 2SEBB 3CHOA 4MMXA 4P2QE 3RGHA 2WCGA 3ME0B 3UTSA 1NEZG 2IALB 4U6XB 2F1AA 1CO1A 3RVTC 5I0YA 2G75B 4OFYD 4OLYH 3O6LH 1M6UA 2E74C 2FT8A 3N42F 4QRSA 1G7QA 4RA0C 1XTLA 4EBQL 2VDRB 2W0FA 2Z64C 2C8NA 4CADA 3WJJA 4FNSA 3MJ8A 4HUVB 4M8RA 3MRMA 1DVSA 3GIVB 3HRZA 3QXVA 3MXVL 5EU3A 3PQYA 2GEEA 1ASPA 1CF8H 4FQHA 3L3HB 4TQHA 5GSRA 1QATA 1M7XA 3F04A 2E7BA 4QRRA 5CLXA 3OXRA 3PWNB 5F7AA 5HPOA 2JJSA 4P5MB 5IEHA 4MMXC 3GMMA 2DDQH 4FABL 2GTWA 2Q20A 4IW4C 4XN7A 1DBJH 1QQDA 4I18A 3CH1B 3U1SH 4P5KB 1IMHC 3HS0A 2WN3A 4P59H 3FU6A 5GRJH 3VFPB 3FCTB 4BSVA 3WJJC 5IHHA 1A7RL 2HT4C 3OWEA 4DP1X 4JEGB 1K2DA 5DJ2B 1K9TA 4J3TA 5E0FA 1JGEA 3K2UH 1W6LA 3V4VA 3QO0A 1E8YA 5EDXA 5AB2A 2JJSC 1J8HB 5GS3A 3STZA 1R24A 5I1CH 5IWLA 4HWBA 4W9ZA 4ZSOA 4OV5B 3ARFB 4LEXL 4A04A 1ZHKB 4I18C 1AGEB 5CZXC 3BH8A 2H2SC 2WB7A 3ET9F 3HS0C 1IJNA 5E8PB 1MRCH 4UQ2B 2NY6D 5E95B 2HT3C 4YDMA 1T1WB 4ZZFA 4M6OL 3W38A 4QOKD 1H0DA 3NMEA 3LPGA 4NKDB 3BWUF 4R4BB 3HG2A 1ZLUH 2UZIH 5CLYA 5FO8B 1FL6B 4S1RL 3NP3A 2VN5A 1EGJA 5CP3H 1RPKA 4GMTL 2P43B 3T8VA 4U2ZA 1E6JH 5JHDB 4TUOB 4OGZA 2GVYA 1T66C 1HNFA 2ZXBA 3KPTA 3ZSSA 4PJDB 2P24B 4JN2B 2J5WA 3ZPDA 3HHSB 1Z9PA 3Q8CA 4JKNA 2AXWA 2GC4C 2H5UA 5AALA 3T65A 1SDDB 2MNJB 4L0YA 2NX5A 4YBQD 4HMEA 1CICB 4B7IA 3S36L 5C07A 2HVBA 1UQSB 3TYGH 3D87B 5BW7A 1D3CA 3QZBA 2F58H 2MQ3A 2OL3H 3VW3H 1H5BA 1OPGL 1PKQB 4H2AA 1F11B 4QTIL 3T2NH 5IVNA 1MCPL 1VAHA 3NYKA 1UCTA 3LSOB 1X44A 3W82A 5GGTA 2CZNA 1AZZC 4HG4J 3OJMB 2Y36L 4ONGH 4KUCD 2GSMB 1U4EA 1R47A 4N0CC 2OMBA 4N2OA 3DSNB 1UWGL 4DTGH 4YDKH 1FUNA 3F7VB 4KJWD 1Q9LB 4JGJA 4WWOA 5BW7C 2G5RA 2A74A 2RCSH 3QUYD 4HIQA 2OMNA 4KNQA 5I1LA 2GI0A 1KTLB 4QYOB 2J4WH 4LCWA 3FSVA 1BQHA 2NTSP 3P3RA 2CALA 3FUKA 4I87A 3V2AR 1BQKA 4JREC 4M7ZC 2DJMA 2CM6A 1AACA 2AI0L 1KZQA 5DMGD 1MY7A 4TPRH 4AOFA 2VH5L 1VJSA 5DJDB 3WKQA 1H6UA 2EDXA 4TQPA 3KYMB 1KDJA 4UMGA 1UTDA 1SJEB 2A74C 5PCYA 1QFUH 4M7JH 1VFAA 1CS6A 1XIWD 4ACPA 3PWPD 1S7WA 5E9DA 4A6YL 1GPOL 2G3MA 4J39A 3ZT5A 5CHNA 2UXVA 4ZO8A 2B15A 4R26L 4P5TD 2UWEE 2ZONA 3RL2A 2HG0A 3AT9A 3CN2A 1LEIA 5IVXF 1EO7A 3UGXA 3QCTH 3WTSA 1F3JB 4IIQB 4IMKA 4AIXA 2XWZA 3I74A 4UOW1 3ZUCA 3AFLA 4HKBA 4GEIA 4DVRH 4CMMA 3IFNL 4IKIA 3DTXA 1R33A 2WQUA 5M94B 1W8EA 2AERT 1XGRA 4KU1A 2BIPA 4KITB 3GHBH 3ZE2B 1JNHA 3TIEA 4BSWA 4OUUB 3ARGB 1U33A 1BX2A 1QR1B 3AADB 2P46B 2FAUA 3IU3A 4Y2NA 5AKSA 2EZ0D 5JHLA 1UG9A 5I1AB 4Z7WB 1SEQH 2VDOL 3BJLA 2DLFH 1BBDL 4IMKC 5B1JA 3QDJE 4NO3A 2D3NA 5CJ5A 3S3PA 3CZGA 1NIAA 3EHBC 2A9NL 5EORH 4F37K 3H9HB 1JUFB 1T04B 2BVYA 4ICWA 4JM0A 1L0XA 5DI8A 2OMTA 2A1WH 4PG2A 3LDBB 4YHIA 2ZPKL 1Y18B 3NACH 3ULVH 2ITFA 3QXWA 4ZMAT 2F08A 4UIMB 1WFJA 5FW8A 3DVNB 4EZMA 3R0MA 1KCVL 2VJ0A 5T3ZD 1BZ9B 1QSFD 3KWWB 5JOPD 1KWKA 4YGVB 5B1JC 1DEEB 1A6VH 2J6EL 3EIFA 2XPZA 1E2WA 3TCXA 5F9JA 5E6YA 5DZPA 3DV6A 4UQ3A 1JXFA 1ID5I 1SHMA 2GHWB 2V3DA 4PWFA 5I2IB 1AGBA 3K46A 4X6BB 4WIQA 4G7RB 1NM9A 5F1OB 5BZXA 1J5CA 4BFIB 3HKFA 4R7XA 3P73A 3FO1A 2EVHA 1A2YB 3KLLA 3SGKA 3VD4A 1AXTH 2EDFA 1A47A 4LVEA 1E4KA 4DQOL 1TEYA 3CX2A 3Q8AA 4KRPD 4ELME 4P2QD 2FDBP 4K73A 3ULVE 1FVDB 5IHUL 1AO7B 2Y9RT 4F92B 4N24A 2XWTA 4XNAA 5F7KC 2CHWA 4LZKA 1NCDL 5B3SB 3GHPA 1USQA 1PG7H 4G9DB 2CJUH 1UB6B 4HJTA 3RKPA 4Z7NB 1J1XH 5KS9A 2DQEL 3H9YA 3SGKC 3H3PL 3AY4A 1N4XL 3CFDB 4Y4KD 1E4KC 1ZTXE 5KZCD 4KKBD 3P3TA 2JELH 5FA3A 3DDGA 1I8UA 3FH8A 4WI5A 3VB8A 1YEDB 1SDAB 3R4DA 4FG0A 1PGRB 2EE9A 5TPWL 3V0DA 3RGVB 2AEIT 32C2B 3MACL 4GRMB 1J9QA 4ODWA 1MF2H 3WDJA 3AY4C 5IESL 4EIUA 3RY6A 5HHVH 1F58L 4MNQB 1K3IA 2VLKA 3GMNB 1I7TA 3GYRA 4ZMWA 2NSXA 5HDQH 4MD5B 4LLWA 2GBTA 1UCBL 2PXYA 4GAYB 5I16A 5CGBA 2B0SH 4NO0D 4LIQL 2VO8A 1H6TA 1OM9A 4W81A 3Q1SH 2BP3A 3D1MC 1LEKA 1AGFA 3GINA 2OFQA 5E0QA 2RTTA 3IETA 3RY6C 3M1BA 3OL2A 2BSRB 4XVJH 1IGFH 3BP4A 1CXFA 3F7PC 1BWMA 3C12A 3TO4D 4J3OH 4U1GB 2PXYC 2YD1A 4OJYA 4G6MH 4JKPL 5CINH 1N18A 3EYFB 1I1FB 2B5IB 4OZGB 2QVFB 1H3PH 4ES8A 1RQ5A 5D5MA 1HYSD 4WDIA 2BHUA 4H88H 3MV9D 1U95B 2JMRA 5ISZE 4XNBA 1PBYA 1OQOA 1HHKA 6CGTA 2YGPA 1M1XB 4I1NB 5C0BE 1ACYL 3PWVA 1WK0A 3PUCA 3N1PC 3UIZA 3O0RH 5AOMA 3T6QC 3II1A 1OTTC 3VGAB 4P2RA 1FNGB 2WQ8A 1U8NA 1ULVA 1MJJB 2ZOLA 3WJMB 5SV4A 3GXIA 5F89A 1NICA 3NABL 4WUUE 1EFXA 3PFQA 4JO8A 1KLGA 2VAAA 4W6WB 1AQHA 4GSUA 5CWSB 4C4UA 3Q2CA 4KHTL 2HKFH 1XF2B 3KBEA 4ZBJA 2P45B 3T8XB 1G6RH 4UV4L 4UTCA 4X7TB 2WO3B 5FYJH 4UV7L 4WK2B 4UBDD 2YRPA 1N70A 1BF2A 1VGEH 1K5NB 5AOLA 3GNML 1MRDH 3WL9A 5ABZA 2WXRA 1PL3A 1A8ZA 1OHQA 5IHLB 1DSFL 5FYJU 3FQ4A 3S5LB 4NDMA 3U7WL 2B16A 3VQMA 2OSLB 1RJZA 3CUPA 4UDTA 3MBEB 1CLZH 1Q1JH 4JMXA 4JRYB 4YSOA 3TA3B 5I18L 3GZPA 4E41E 1RUQH 4AYFB 5FECB 3CZFB 3NCYP 3NBNA 2LU3A 4KQ3H 4L18A 4K4KA 1Q9WA 4F7CA 1CGTA 3B1TA 3VH8A 2PUQT 1PJWA 1ZHNB 2OI9C 3DHPA 3QFJE 1IKFH 2KT6A 3T2OA 4PJ7E 4XBEL 2EEDA 3ARFD 4HS8L 4NAMA 2D4FA 4P4RB 5KYWB 1JPGA 1I3RB 4GINA 5JW4M 4WLCA 3VSVA 2NNAA 5CEZL 2VITB 4M3HA 1NIFA 3NCCB 3BUBA 2IH8A 4YEEA 5GS1A 5DK2B 2EADA 3VGDA 1ZT4B 1CTNA 2ROYA 3AGWA 3KJ6L 2DQTL 1YUKB 3OR6B 4IHOA 4LVOC 4OGAC 3PJSB 2AJUL 2XXFA 5ITFB 2PPEA 5D96B 5GGSB 5JO5A 1T2QH 4J23A 4IU3A 1TZAA 5EUKA 1AE6L 1MFMA 4W1TA 4WGWB 3IWVA 4MNGA 3HG1E 3DVFA 4XNMB 3V6FB 2LT9A 3LV3A 1S9VB 2EDBA 4IGBB 3I3BA 2R1WB 1EEYB 3HS8A 5JHDD 4ALAH 5EEWA 2FX7L 3WJLC 2AJVL 3LQAL 4JFEE 4LDEB 5IT2L 2EXYD 3DJRA 5GS1C 1M05B 5MP6L 2WBJA 2C5DC 3RUGA 3Q44A 2XQYA 3VUAA 2K9UA 1GS8A 4FTVB 1XGTA 2G0LA 1CICD 3W0WB 3JYBA 3M8OH 4I89A 2N3JA 4W93A 4PJIE 3SPJA 3C8KB 4PRDA 3KL3A 1W80A 1HILB 1NGXB 4J8RA 2IG2L 2BWDA 1L6PA 2FB4L 2NY5H 3FT2B 4HFWB 4AQ1A 2Z1KA 1J11A 4P9MH 3QUML 4CU6A 2PWFA 1FO0B 4JFXA 5DA4A 3TBTA 1GGIL 4POUB 2WBJC 5GS0C 3QXAB 4I5BA 5SWSA 5T33L 2DD8H 3UERA 2PCFA 2F5BL 1S7UA 3NIFF 3LQZA 5D4QA 5HI4D 2ZKHL 3C6SA 5LAXB 1V55B 4Y16A 3V6OA 3F01A 3Q6FB 2B1OA 2XFXA 2JIXD 2X4QA 4R6UA 3LB6C 2PYEB 2ZKMX 2IFGA 3CHRA 3L7EA 2AQTA 3QHFL 2NUPA 4NZUL 4Y1SA 1DEDA 5SWQA 1MLCA 3GLDA 1KN2H 2WXGA 4OCRH 3B6SB 3WTVA 1OE1A 1W72A 3HAEB 3LMJL 4YDJB 3ZE0F 4J7RA 4WJKB 3T3MB 4FJYA 1ZLSL 1XCQB 3BUYB 5LBVA 5DUPH 1OP4A 4S1SL 1EEQA 1FIGL 1NC2D 4LHJB 1KJ3L 3VXRB 3VRLE 5JPMB 4Y16C 3FSZA 1BP3B 4IHBA 4MDJA 1GOGA 2H0JA 3V6OC 1IC1A 4QJ4B 1ONQB 3O9WA 1IZJA 1OSYA 3WEBA 4JCLA 2EYTB 4OVVA 1L3NA 4AJWA 2ED7A 3HCVA 1ZWIA 3V0VA 1DQTA 4J3XA 5FGSA 1X5XA 3WNLA 4JDTH 2MNUA 2O5XL 4AJ0A 2O6EA 4LVNC 3L48A 3WAJA 5HHMB 1BDYA 1R9FA 4B0MB 1ZLWH 3L1OL 3QCVL 3N44F 1GAFH 3B4NA 4FOMA 5I1GL 2YRZA 5LXGH 2XBZA 4KXDA 1SJMA 5CJQH 2AQ2A 2PNDA 4KKCD 4XMLL 1UD4A 3NQIA 4EN3A 3PUUA 5ETUB 1ZLEA 3O9WC 4NCC2 5E4IA 3TVMA 1N3NB 2E46A 2DM3A 4Q9BA 2ZAIA 4MMXB 5GGVY 4K7PX 2Y5EA 1KNOA 3SQOL 1OK0A 4YC2C 4CRPA 4QRSB 1G7QB 2FO4B 5ICUA 4M5ZH 4F3FB 4HUXA 2W0FB 1OCWH 2ZXDA 3T1FB 4PCSA 1NDTA 1BXVA 1OE2A 2FSDA 4W9FC 4XVTL 1MVYA 3MJ8B 3MRMB 3TF7C 1YC7A 4MAYA 4AM0A 3HRZB 4EN3C 3FYEB 1U92B 3BD5A 4FXTA 3ARBB 4TTGA 1I8MA 3BP5B 5GSRB 4NC0B 3SKJH 2ZXWB 4H8PA 4QRRB 3OXRB 4I0PA 3TVMC 2FIRT 2UX6A 3B83A 3II2A 4MA3B 3UBXG 3BISA 4ETQA 2AABH 2BCKA 2GTWB 2VR3A 3T0EA 4M48L 4X5LA 4HETA 2UXGA 5DURB 5KSBE 4NRZA 4HIHA 1ZDQA 3HS0B 2H1LM 4LEBA 3WAKA 2YEZA 1QLEL 4BSVB 4YSEA 1HZLA 3OKLB 4V33A 4MAYC 4NNXA 1K2DB 5HI3D 1JGEB 3V4VB 4I0PC 4NSKB 1R75A 2APFA 1U8PB 3MAWA 3L9YA 3QQ9C 2A77L 3STZB 1GYVA 1R24B 2DQCH 3RU8L 2TRYA 1HTYA 3L54A 1BECA 3DUSA 4OGXL 4UZSA 4DEPC 4ZFFA 7CGTA 2BJMH 3TO2A 1PZDA 4AGLA 2ADGB 3BH8B 1GHFL 5D6DA 3SE9L 1ASQA 5TK4A 5IQMA 1P4LA 1EQWA 1KEGL 3FRPA 4GXVH 4HDIB 1H0DB 2QADB 4FG2A 4NNPH 1AO7D 5I0XA 1CL7H 4KMQA 3V52L 1RH8A 3WGVB 4JY6B 4PYHA 2WXKA 2N7AA 2XWDA 5E2UL 5C6PB 4Z7OE 3AZUA 1S78D 1UUSA 3K0YA 1GKOA 2Z6FA 4NM4L 5J56B 5FPIA 5D6DC 5K9QI 4FLQA 3IMTA 4YBLB 1D6EB 4N2FA 3MV01 4UT9H 4N26A 1UA6L 2ZNXA 4LOFA 1BW8A 5DK0B 1EDQA 4DEWA 3T65B 1JF5A 3IGFA 4P23A 4Y9EA 4TSCL 2VLLA 4J3WA 4DP8X 1PNDA 3V0IA 5ACLA 4OCSL 5C07B 1U8CA 5LJYH 3MLVL 1MW3A 1MPAH 4KAQH 5EUOE 4GAJH 1VCBC 2K6YA 3P2DA 2IJ0C 1H5BB 3GHEH 1CD1A 3BJ91 4JHWL 3FU5A 1D6VH 1E6OL 2AJSL 4NIYE 3INUH 2DYRB 7PAZA 1F00I 2V6HA 1MEXH 4MNQD 4JO4H 1IQWL 1IGTA 3CZUB 3TH3T 4RFNC 2XRAH 1CI5A 3MNWB 3BDYH 2C3VA 1QSVA 4DH2A 4LBAA 3GXDA 3RTQD 1NOAA 2VL5A 3ZMNA 5EU6E 1UJ3A 5IUCA 2RH0A 3LIZL 1OXYA 4U6TA 1SN2A 4M4PA 1FRGL 4KJQD 4UQEA 2BIOA 1J8KA 3ILEA 4LCWB 4UANA 3HR6A 4QO1B 2OJZH 4XWOD 4TSBL 4UDUA 2ZYSA 1HL8A 5IFHL 4FTDA 5E5RB 1PZ5A 1RZGA 2APXA 2GT9A 2FWUA 3N06B 2CIKA 4BH7B 3WO4B 3AACA 1CFNA 2XSKA 3KLAA 4O2EB 4X0KA 5F7DB 2BP8B 2GUOA 4PB9L 2SODB 3X3FH 1UJ3C 1OTSC 3B34A 1K4CB 3GSNH 3MBXH 4K94L 9PCYA 3PHSA 5K9OA 1JNNH 4UT6L 3BXNA 4WWKD 1V7NH 1S7WB 4Y19E 1MFDH 5E9DB 5TE7L 4F7MA 1JVLA 5CHNB 2J56A 2Q8BH 3SKNA 4ODTH 2PTTA 5F1IA 5CP3A 4PFEA 3WEOA 1LEIB 1UASA 4JW3A 1YNTF 4LNVA 4P57A 2QJDA 4FMVA 2GC7C 5F7FA 1CUOA 1H3UA 4XHJC 1JZFA 1BFVL 4HKBB 2WV3A 4CMMB 1R6VA 3DTXB 3BAYA 3FKUS 3WNOA 2NZ9D 4Z0BH 5A43C 2XWEA 5DQDL 5TGBB 1E27B 4JY4B 4XO4A 3ZDYB 1JNHB 1VZIA 3TIEB 1OK8A 1NAML 4GAAA 5GGRY 1A14H 3LRKA 4L1TA 4BSWB 3O81A 4NQSA 4NQVA 2OL3A 4PVBA 3IU3B 5GGVL 5EWIH 3LKQA 2BIQA 5SWZE 1NCCL 5E4EC 2BINA 3APMA 1N8ZA 4PLOB 3U4AA 3FS9A 1A7NH 3U6RA 1L9MA 3V0JA 5DI8B 3QPXH 5EH1A 3N91A 2OMTB 1MREL 4DPCX 4Y9GA 3VDBA 3VFRA 4YHIB 2UWEA 1MFUA 3MBED 3UAJD 4X6FB 3TA3D 3FTSA 3EF4A 1XB3A 2HP4A 2FWOA 1JJUA 2YMXH 1LP9B 3OKOA 3K5RA 3FQNA 4QJ5B 1RJLA 3MJ6A 4YXKH 5K9QG 4UQ3B 2DS4A 1ADQA 1IM3B 2MRYA 3L3KA 1GL4B 1AGBB 1DBBH 1XEDA 2FBRA 1OAKH 2DKSA 1TQCB 2CMRL 3NUKA 4ODVH 1ZIAA 4G7SB 5I8OL 2H1PH 2VW6A 2YLKA 1TVBB 3QWOA 3X1BA 4A7SA 1WWAX 3P73B 3FO1B 3QDJA 2RACA 3V0WL 2J1XA 4NWUL 3MVSA 1LQBC 5C08D 3OKNA 1BZDA 2IANE 4H25A 4KNSA 3P0VH 1KJ2L 2JQZA 3ZHFA 2EE0A 4QHLA 1MHEB 5D7JA 2XWTB 1O9WA 3E38A 4JCWA 4GW4A 4HIXH 4Z18A 2AQSA 4QPEA 5T8IA 3FAWA 4L2YA 4WFHD 4RISL 5EU4B 1EMTL 4R5VA 5KS9B 2X87A 2YS4A 4KGLA 4BFBD 2MNWA 2A2QT 4FTVD 4JRFA 5LBGA 1N2RA 1L7TL 25C8H 4H0GA 3U9PL 3A23A 4J6RH 2BIHA 4QLRA 4UB0H 1U8JB 1U30A 5D71L 5C92A 5D7JC 3GSUA 1JFQH 2K7PA 3I02B 1A02N 4X98A 2QVTA 3GXMA 5JPNA 1IEHA 5BQDA 3BIBX 2K6ZA 4QHUB 2XZQH 5TDPA 3W37A 2EIDA 2G60H 3DHJA 4JB9L 5JIPA 2GJPA 2FJSA 3PXHA 4ELMA 3ZK0A 3DJSA 1HX0A 3US9A 5KYYA 4H4NA 1P84K 1I7TB 5I6OA 3Q6GL 3I9GL 5DUJA 4PGZA 5HYSG 5GS2D 2UV3A 3K8KA 4G9FD 3D3VE 4LLWB 3UIYA 3MRGA 4G70B 4JFZH 2WCPA 4LPCA 5I16B 3SDDA 1SGKA 2CO7A 1LDSA 3W1ZA 5DRZB 4D8OA 3ARRA 4Z78A 5JPNC 4RFEA 1WCQA 3O3AB 3OG6B 2FUTA 4AKPA 3RAJH 1GMEA 2YFNA 1GIGH 2LW3A 3MBWB 5HI5D 1DBAL 1QWHA 1JP5A 3ULVC 3IETB 4XN4A 3M1BB 3N55A 5AAMA 3RWJA 3P0YH 5L2JB 2BXZA 2VDLH 5E4AA 5E1HB 4ZUUA 3BP4B 4N90D 4Z6AT 2BNQE 4Z8FH 4PS7A 5A7EA 3TEZA 4G6AD 1BIHA 3HC4L 3QC5X 2F7QA 5DXWA 3SDDC 4DKDC 1PZ2A 4WNJA 3CFNA 1IBHA 1WIUA 2H6UA 2OTUA 4WDIB 5EU5A 3ESOA 2IXQB 4LKXB 2H6OA 4YBHA 1HHKB 4OIFA 3SDCD 4M6NH 1FGVL 1DDTA 5AAMC 1S7SA 1OY3B 3NEEA 5F7WC 3K6OA 4K5LA 3PWVB 4KKCC 3O11A 4GMSL 4WI0A 4BCZA 3INOA 3D48R 3VSQA 4AZ8A 1BIIB 3MC0A 2AK4B 1EXHA 4JO2L 4N1CA 4P2RB 4WV1A 3BGFC 4DP4X 1U8NB 4TRPL 5HPMA 4N5EC 3UP6A 3UAFA 4BCYA 2ZOLB 3H56A 1EDHA 4KO5A 3MRBA 2P26A 3OX8A 5F89B 5DF0A 4ADGA 3NP4A 3JZYA 4FJ6A 1MKFA 2VAAB 3TT1L 3FQRA 3IDIA 3IBEA 1SJVA 2ZOKB 3KHOA 1J5OL 1JF1A 1THCA 4LCUA 4LQ1A 5AZEH 1F4WH 2JQMA 3ARBD 1U3NA 2WLMA 4YL4A 5FGRA 3ZIMA 3FQXA 4XWGL 2IWEA 4JPWL 3MLTA 4RGOL 5JIMA 5EO9A 5ISZA 4PYGA 4WV1C 3HJEA 4BZ1L 3D4GA 4DGYL 5D7SL 4CW1B 5C0BA 5IVXE 1I9IH 3W5NA 4NDMB 3O6MH 3CC5A 2X9XA 1RJZB 2VXVH 3CUPB 4UDTB 2QQKH 3SE4C 2Y2WA 1XQ4A 1BQLL 4YSRA 4MKMA 1H8LA 4WK4B 3FO9A 4ODSH 5FOJA 3F8UB 4LVOB 5D7IB 4UIKL 3GBDA 2ZJSL 1Q9WB 4F7CB 2YAPA 1MFNA 1SJHA 4HUNB 2CO3A 3HZMA 2IDQA 3QZOA 3IGLA 1GSMA 2Z4TA 1Q0YH 4WUUA 4Y19D 1BVLA 2WYIA 3MV7D 3WTTA 5CZVL 2B4CH 2FX9L 4K7PL 2X40A 4YHYB 4M7LL 2NNAB 4XNDA 2ADYA 1OP5K 4W6XB 4PW4A 1AH1A 4JM4H 2QADD 3AQZA 3F85A 3KPOA 3CFKB 4GSQA 4JGUA 4TULL 1WA1X 5M95B 3KZ8A 5JO5B 4MD0A 3X1NA 3QS3A 5J3HD 3REVB 4ZXBD 5EUKB 4MNGB 5CGYD 2LV4A 5DCCA 1ETA1 1C8QA 3KM1A 3LV3B 3ZQXA 1FF5A 1DVQA 4WHTB 1JHTB 4DEUA 5I1HL 4E41A 2WXFA 1WYJA 1NEUA 2OA9A 3O3EA 2BRRH 4NQUA 1I1YB 4G59C 2WAQA 2ZUUA 3RUGB 4AV4A 2OTPA 5IM7B 4R4NC 3QFJA 1MELA 1TUPA 4QDGA 1KCLA 3AXLA 2B9BA 5INCB 1S7RA 3NK3A 5DLMH 3O6FA 1LHZA 3BQUA 3G08A 4X80L 3NH7H 3WFBL 2ADIA 2AEWA 4RH4A 2EC9T 2EXSA 4K07A 2NZ1A 3GFUA 3MRDB 2L7QA 5I8KL 5IBUB 4AQ1B 3VXUE 1CBJA 1UYWL 4Y8DC 5L88H 2PWHA 5IJKA 3WNIA 1XH1A 4JFXB 3TBTB 1JAEA 3DKHA 3GI9L 4I5BB 5SWSB 2ODHA 4RZCA 1S7UB 3QI9A 3NPSC 3HG1A 3LQZB 3C6SB 1JYVA 4Y16B 4X5QA 2H45A 3O6FC 3BQUC 1MXDA 1TF4A 2X4QB 4MSWA 4JFEA 4QEGA 3DSFL 3QUXA 1FHNA 3QHZL 1KEMH 3L7EB 3CN1A 4QXVA 4TLKA 2NUPB 1MLCB 1IAKA 2XN0A 3FTWA 4LVNB 5IJKC 1W72B 4MA8L 2FJHA 4R5TA 2OKMA 4XWOC 3D7PA 5F0PB 4WFFE 1L0PA 1PZBA 3EYUH 4PJIA 3ZSTA 3QI9C 2VQ1A 2VWEE 3MR9B 3KGRA 2WZPA 4FHJA 4MDJB 1FSKB 1PW3A 3DOIA 4DKAA 3OAYH 3GMOA 3J7HA 1D5ZA 3HCVB 3SPCA 1ZWIB 3H7LA 1ZHBA 5BO1H 4OZIF 4AYGA 4ADIA 1DJYA 1M42A 4EPSA 1ZV2A 1OAZL 1DQQA 2A4ZA 2NY4D 4YC2B 5DHMC 4ZX4A 4QRPE 2GITA 3GI8L 3V4PB 4NOBA 2VM3A 4RGNE 1OTUD 2Y23A 2YZ1A 3QA3A 4XN5A 5HHQB 4AT6B 4XMUA 4HLJA 5HHOD 3SOBH 4HZLA 1IIIA 3ARDA 1XH3B 3FYIB 1QKZL 1M7IA 3APDA 1NIBA 4NO5B 1R17A 1BV8A 4RSYA 2Y06L 4KMLB 5AW1B 3WG7B 1C16A 1NAKL 1XR8B 3T6ZA 4M62H 5ACZA 1K3ZA 1KNOB 2CKNA 3H0TA 3JVFC 1PU0A 3WIHL 5E6RB 4HGMA 4HUXB 3HPJA 3RFZB 3JVGA 1I3GH 2I69A 4E9YA 1JK9A 1T03L 2A6KA 2OM5A 3C60A 4LAQH 4AM0B 2HTKD 3VFUA 3L4CA 1I8MB 4Y2DD 2X6MA 1H6FA 3ARDC 2MOGA 4BJLA 4CC4A 1U8KB 1UZ6F 2Y7MA 4LEOA 5E8NA 4DZBB 5FAAA 1JXKA 3BVVA 4JGMA 4ETQB 2BCKB 4HXBH 3T0EB 3B7RL 2VDNH 5TFSH 3STBA 1E30A 2OYKA 4NRZB 4HIHB 5JQ6L 2BNQD 2WQXA 1FLTX 1P2CA 3MTXA 2YEZB 4PR5A 4AMXA 4AMWA 4E2OA 3JVGC 1DLFL 2AJXH 3UJIL 4XC3H 2H9GA 1RKRA 3C60C 1F41A 3B9KD 2DQDH 2D2OA 4PU2A 4G7YH 3ZKNC 4HBQA 4NNXB 4MXWL 1PZCA 1IM3D 1MCEA 3DPBA 1VA9A 3VXQA 4CC4C 4CBPA 4EDXA 1A6UH 2PMZA 1IBGH 4K8RD 3S0PA 1J48A 3HC3L 4PRIB 4O02L 2EIZA 2K6WA 5I1JH 4ZFFB 5DJYB 4FFZL 3DUSB 1GOHA 3SPGA 3HUJF 3TO2B 2BOLA 4BHUA 3BZDA 5T1DL 5CJBA 1A7PL 1M2VA 1S5IH 3FSAA 3VXMD 3JTSA 2IGFL 1P4LB 4JPKH 3BWZA 2V17L 1EH9A 4L37A 3LNGA 2FHBA 1B2WL 4HIJB 3ATDA 1JGIA 4NC1E 3FHAA 2RJMA 1Y6KR 5KSBA 4Z1PA 1WO2A 4XCCH 4H40A 3UMTA 5LUMA 1CE1H 2X0WA 5C8JB 5DZOA 1UADC 1P7HL 1TLKA 3LPOA 3WKPA 3LNIA 4BQ8A 1CDIA 4APXA 2YEQA 2NUTA 4KZDL 4F20A 5ERWA 1DYZA 1W0VA 1A3QA 1NBZA 4B97A 2EYSA 4M7LT 1ZOXA 4JPVH 1OT4A 5KW9H 1TEFA 3KD4A 3SEPA 4XPTL 4P23B 1HCVA 2VLLB 4IRSB 3P2TA 1U6AH 5D7KD 5T1LA 3U25A 6FABL 5E1GA 3O45A 5CD5C 3NAAH 1SN0A 1N10A 2E8YA 4F7TA 1S7TA 3BKJL 1I7UA 3VXPA 4OCXH 4L0PB 5GXBB 1BQUA 1CFVH 1T22A 1OAUH 3ZIYA 1IGTB 5BV7L 3VXTA 1WFTA 1DANT 3ZO0A 1IAMA 7TAAA 2I9LA 2WLLA 4K9EC 5DHVH 1EHAA 2JI3A 3OKEA 1RMFH 2ZP0T 4IRJA 1J0ZA 4M56A 4DAGL 1UJ3B 2NDFA 4UTBA 2H26B 4L48A 3C5ZA 1LEGB 3B9VA 1XBRA 3HMWH 1IM9A 1G4MA 1U8HB 1Z0NA 3WENA 2YPVL 3AWEA 4UDUB 3SDCA 4H5SB 1UVQA 3LQMA 1RZGB 4HPYL 3BUTA 1CE6B 4Q0XL 2CIKB 5AKTA 1U2YA 2I7OA 5EUOA 3KLAB 2N0MA 4JQIL 4JNXA 2NQCA 2BVQB 1RK0A 2GUOB 1ZANL 5IQ9A 4IRJC 4JQVA 4BKTC 1TJMA 4XX1G 4XVSH 4A7GF 3C5ZC 3TN0D 1URLA 4MA7L 5G55A 5K9OB 2ATAA 4FNQA 5IGXH 3BXNB 3NIFE 5G2NA 1P1VA 5K1VA 3SDCC 3SKNB 4X8GA 2PTTB 1F97A 5F1IB 4JM2F 2RIKA 5LO7A 1E4XI 1N64L 2HKAA 5EU6A 4P57B 4A2GA 2EUZA 1IC0A 5E4EB 2AK4D 5E2TH 3FC8A 4KUZL 1G7LA 4D3CL 3ZE0E 2C26A 3OF6D 2HTLC 4LSRH 3TEXA 1KBWA 5FHAH 2YBRB 1EERB 4WO4B 5AOIA 4RA3A 4P9HL 1NPJA 2XTSA 1Q90A 4GSRA 2EUWA 2BZCA 3KPQA 2FJFA 4NQSB 4NQVB 4TSAH 2OL3B 4UNVA 3HE7D 4M6OH 4NHCL 3LZRA 3LKQB 3N9GH 3SBRA 5BRZE 1BVKA 1FVCA 2AQPA 5IMMA 1MFCH 4ATTA 1FAIH 3O4LE 5F97E 3FCUB 3KLHD 3PJLA 5F7NC 3VXSE 1NDMB 2PO6D 4S1RH 3U6RB 4PV9A 1F0LA 3MHZA 1FNFA 3QW9A 1RLBA 4JFFD 1WP6A 2UWEB 4WFFD 4XVUC 5F3BA 4PY7B 4N0RA 3PGCA 1G1OA 5HYQB 35C8L 4Y2OA 2P7TA 3PAUA 5D1ZI 5EF1A 3JV6A 2R0LH 1A6TB 2FWOB 3GSWA 1JPTL 4DPRA 3BN3B 3MLXL 4WRLA 2EEBA 3QDMD 2Q6WB 3OKOB 4JBSA 5EBWB 2GEQA 3ROOB 4XTRD 2Z1PA 1RJLB 4HXAH 1B6UA 1XHHA 1P5UA 1XMWA 1H3XA 3KBPA 3L3KB 2W60A 4JVWA 4KY1L 2DQUL 1RVFL 1WTLA 1OPGH 4P2YA 2XXGA 1MCPH 4JANA 2KDGA 1KXVA 5KTEL 1D7CA 2YQBA 4G42A 1N59A 2WZAA 1QPXA 3F6JA 3L4UA 5SWZA 1PIFA 1PDKB 3GSNA 4NGHL 1Z5HA 1CXLA 4M9PA 3FHQA 3QWOB 4QI3A 4ZUTA 4NEHB 4APQD 2XWBA 5L7XL 4WSJA 3EJSA 1ZE3C 2X89A 12E8H 3OKNB 1MCOL 4H25B 1YY9D 4QRQA 2WYTA 4N2CA 5I8CA 2FEEL 3AS0A 1E8ZA 2J5LC 3ZVVA 1P5UC 2UZPA 5CGYC 3MYZA 1EHXA 3I3DA 1NCBL 1KBPA 2VO5A 2YSSA 4OZ4B 3V55A 2YMOA 1KXVC 1YAIA 4GW4B 2RD0A 2EO7A 4L0ZA 5JW4R 1BQSA 2ED6A 4Q56A 4FQIL 5A2JH 5JR1L 1T21A 1MNUL 1FNSL 3O3BA 3CDFA 4GAFB 1DUYB 3DXAB 1F3DJ 1V3LA 2GSGA 3IN2A 3D9AL 4HKZB 2P80A 1QW9A 2P5EE 4L2LA 3PJNA 4HWZA 5E7FA 4AMKL 1QLRB 4N8CL 1ITBB 3R4RA 5CGMA 3VNZA 2Z34A 1RUPL 4JO1H 3B7TA 1LWJA 4X98B 1IE4A 2PF6A 5JPNB 4WFED 4KNTA 1F8TL 4A6YH 4AIEA 1S9WA 1MFAL 5AW0B 1SVCP 3E8UL 4UWQB 5TDPB 3MRIA 3QRLA 4WFGE 1J0IA 2IANA 2YKKA 5AVSB 3DO7A 5AEAA 3W9DB 4ELMB 3V6ZA 3GJEA 4BSJA 3W5MA 3D6GA 2B39A 3EOTL 3ETTA 2VB5A 1NL0L 1WBXA 3LH2L 5KYYB 1MHPH 5F44A 3U46A 2MCPH 2V37A 2I07A 2WPGA 2WBKA 4L8SB 5IHZB 5J6GB 4GW5A 3MRGB 4UT7L 2QEJA 4FXLA 3SDDB 1KY7A 2I9TA 2CO7B 3RWIA 1UXLA 2Q7AA 4Z78B 3VSTA 3GEWB 1CYGA 4CC1A 4EQ2A 1SXCA 1KIPA 3R06A 4BKSC 3F7KA 2P8PA 2ZX6A 5DO8A 4G8GE 3VCLA 4UTAL 3MCYA 3GXUB 2QT6A 4LMQI 4Z0XA 3K6DA 2E6JA 3DX4A 1BBDH 3RWJB 1H9DA 1QX1A 3JTTA 3TNMA 1X5KA 1R5WA 2E4FA 4A38A 4DKEL 2WXNA 2BOCA 1J5IA 2OTUB 4G72B 4J6IA 5DUML 5EU5B 2VN7A 1TQBC 3OGCA 2N01B 3COOA 1NCAL 2VSMB 3KH4A 3PWJA 3KWTA 3D3VA 2FR4A 4MJ6A 1P69B 3RQ3A 4OJDH 2P5WB 4AZ8B 2P49B 2EDDA 3RDTD 1H3WM 4LP4A 1K6QL 4F7PA 5MEOB 3EOBA 4WV1B 3WSQL 5HPMB 1GCYA 1MFVA 5A7BA 3BWUC 2V0AA 4NZJA 3SDXB 4FADA 3MRBB 2W9DH 3OX8B 4LQFL 2YPLE 5D1QD 4TVPL 3M1CA 5MI0C 2QELA 3MJ7A 3AXHA 1WBYA 3TU6A 3FQRB 3IDIB 1KGXA 1JF1B 1KELL 2CLRA 3DV4A 3OMNB 1B3JA 5AYUH 1QFHA 5D7LD 2CKBL 3MLTB 5EO9B 5ISZB 5A2LH 2Z0UA 2GG1A 1JZ4A 1IQDA 3MODL 1VFBA 1YN6B 3S88L 5C0BB 4CMHC 4JFTA 2DQEH 4MHHI 3VYNA 1N4XH 1IV8A 3IFPA 1KJVB 2FBJH 4OR1A 4YAQA 5LHDA 5FO7B 3RA7H 1SJHB 4R4FL 1ZLDA 3ZRSA 2PR9A 3D0LA 4WEEA 4DNLA 4WUUB 5TPWH 5JLZB 4PRID 4AEHL 4CA4A 3K8MA 3BVNA 4ZTEA 3L5XH 1CT8A 2BP5M 1YPZF 2DM4A 3ZL2A 4YL9A 3ULSB 3HI5H 3UG3A 1FHGA 3OPZH 4NUJA 3G9VA 4KK5D 4WI9A 3CD4A 2K70A 5H35B 3D8MA 5HDBF 1YMHA 3OVUB 2HSIA 4B6ZA 1QFWM 1RUKH 3BSGA 2ZSVA 4PP2A 1I8LA 2A83A 4R83A 3D51A 1YLBB 2AJYH 3DTDA 1UCBH 1HWGB 2GIYA 4L8DA 4MD0B 4P46D 1Z9OA 5I15L 2WM0A 5IVXA 4MAZA 5GRYA 2FHFA 2KBGA 1IEBB 4RZKA 3VRJA 4ZD3H 3X1FA 3NJVA 2WP3O 4M43L 4J3BA 5D1XE 4LARL 3VMOA 5BS0E 3QDAA 3SYOA 3S4SA 1JZ8A 2XTJD 1AKJA 2JV6A 3FNKA 5TK2A 3NPSB 1I8LC 4IRSD 1RV6X 3K74B 2EIMB 1TCRA 2DZEA 4LSPL 2L7JA 3Q1EA 4PS8A 4JKPH 2YAFA 2EJ1A 2I5YL 3NJJA 5FV2A 3D85A 3BQUB 2JCWA 3UMNA 4XAKE 1PLAA 2ADIB 1J9CT 1URIA 4Q7DA 3ZT7A 5I0VA 5JHAA 5CJOH 1G6RB 4NJ9H 3BLKA 3DO3A 1YECL 3EJPA 3T77A 4DPBX 4G8FA 2VGLM 2FRGP 2MKLC 1WTGT 2X70A 1IX2A 2WWKT 3C5SB 4QF1A 4NQCE 5CN2A 4LCIL 1CN4A 1ACYH 1NEZB 5K33A 1GVIA 1E8WA 2BNRE 4RZCB 3QI9B 3HG1B 1NGZA 4LIQE 4Z3EA 3B2MA 3PGDA 5EG6C 1A1OB 5D8JL 3MRLA 3OKMB 4MSWB 2OW6A 1SOQA 1EJOL 1OIOA 2NXZD 4JFEB 4B9FA 3QUXB 4N2MA 3RPKA 1Z5YD 1HKLH 4OLUL 3TJEL 5F9AC 2ARWA 4HWEL 1OW0A 3LXUX 4G8EA 4ANVA 4AEIL 1T3FA 3CVDA 2VDML 3LEXA 3I50L 2QGEA 2AAVA 4PJIB 4B0MM 4NKOB 2D7TL 2HZHA 3W11C 5J57B 2VQ1B 4UV7H 4MQTB 5J1AA 3UFIA 4O9HH 3QNXA 4PMFA 3VXUA 4GUCA 3GNMH 4UILL 3GMOB 5DR5L 2C9AA 1D5ZB 1BYPA 1FPTH 1LDPL 5EBGA 4PGDA 3L2LA 4K23H 1DSFH 1ZHBB 3QXDB 4JMNA 1IZKA 4KY2A 4C4KO 1OW0C 4ZYKA 1SXNA 3U7WH 3QQXA 4HIEB 4R90L 2VDKH 1CFQB 1IC7L 1OAQH 3HOGA 1DQQB 2OCFD 4OF6A 3UROR 2QQNH 1GC1C 2GITB 3HE7A 2B4CC 3Q48A 5F9WB 5EEVA 3H42L 5A2IH 3OM3B 3HZKA 3GLEA 2BIIA 4JKLA 4KV5F 1PYWA 3DA0A 5C2BL 2CLVB 1NCUA 4FLRA 2XG4B 4WO4D 5DSCA 4DP9X 4LCVA 4R7LA 2EH8L 2FX8L 2IDUA 4HS8H 4BFNA 3ARPA 4FNRA 4OI9A 2K8QA 3KGUA 2GUYA 5ACZB 4UZUA 2ZP8A 4K3EL 3AITA 5KYNA 3D4CA 3HE7C 3OPUA 1CPUA 4NQEE 3HPJB 1PTZA 1CBVH 3DPDA 3A4AA 1LJMA 1JK9B 2A6KB 1LM8V 4DPAX 1G9NH 1DUZA 3TFKC 5F9OL 1AE6H 3VFUB 1F4HA 3VD0A 3FBQA 5EU7E 3FJTA 2AXFA 2VDPH 15C8H 1KTKE 4J1UA 4NPYA 5KN5B 3IMWA 2NW3A 5E8NB 1SYSB 4QRPA 2AJVH 4B9YA 4X4XA 3UPAA 1GGYA 5IT2H 3OZLA 3TFBA 5CBEA 3F64A 2VWEC 3E1F1 3PDDA 4FQQA 5MP6H 1R5VA 4WKZA 3CLFL 4JDZA 1AQKH 1KV3A 1VACB 2C3GA 3MDJA 1P2CB 4PJFE 3U48A 1KCKA 2K1MA 3IDXL 1BMWA 3LKSA 2AHIA 3QPQD 4HALA 5GIRB 3S35X 4RIRA 4YO0A 3BX7C 1JGLL 1FYTB 4LLYB 3I9AA 5CEZE 2IG2H 1NMAL 3BUDA 2DIJA 3JWNH 3DPBB 2FB4H 4KDWA 1KGUA 1XSIA 3VAEA 1A6WL 3S7GA 3MA9H 4RGNC 5JDJA 1IT9L 2X2UA 3V5KA 1WRFA 1GZHA 3KWVA 2NSMA 4JFSA 3VGBA 1A66A 4B96A 3IRZA 4IOFD 4XZ4A 4WJ5A 3JTSB 3FN9A 2DKUA 3QZWA 4POZD 3D2TA 3P4OA 4OB5L 4ATWA 2HH0H 3RRQA 3NA4A 5C0DA 5DJ8A 4ZTPL 1KXHA 4KZEH 1GZHC 2XVLA 4X5WA 1JCKA 4DCQA 3DXAD 4APXB 5LCVL 2NUTB 1LO0L 5ERWB 4LOEA 5DS8A 1W0VB 1KPUA 3JWNE 3ZMEA 1NBZB 1GGBH 2EYSB 1AS7A 2QGBA 4U4IA 1UENA 5DMJB 3BVXA 4NAJA 4DSYA 1HNGA 2WKGA 1CGVA 4IU2B 4JJHA 3CPLA 5T1LB 2CHDA 1NMBL 2OK0L 3O45B 3LXCA 4BFRA 4PGEA 3QCVH 4F7TB 3M17A 1I7UB 2ZCLH 3LXBA 3P11H 3ZBMA 3VXPB 5I1GH 3L7FB 1K8DB 4FF9A 1OGAE 1MDAA 1OP5H 1U8OA 2PPFA 1T22B 3SJVD 1CG9A 3X14B 4XMLH 1D9KA 5D4IA 2PETA 3GS7A 3RIAK 4ANWA 2C7UA 1XXDC 2I9LB 1G0YR 2WLLB 3BO8A 2CSPA 2ZOWA 2BS9A 3OKEB 4Z7OB 2VMDA 3P54A 1HINL 3NCJH 5AW6B 3FT3B 4XXDA 1MY5A 1FL5A 4RQQA 2HLFD 3N41B 4IRJB 2KC0A 1SLVA 3AREA 3C5ZB 1MVUA 3EYQD 4BKLA 1L9PA 4HOWA 3HB3C 3CBJB 3ALXA 5E2JA 1LMIA 3QAZB 4GQ9L 5KG9B 5FYLD 5EIVA 2O72A 1JGDA 1FFRA 5KYXB 4OIAA 4K2UL 3JWOL 4NC1C 1D9KC 3PHAA 5DEFB 1X7SA 1P4BL 2ICEA 4P2OD 1PQZB 2W5PA 4L23A 1BVZA 1HI6B 3RWEA 5J7CC 4HAFA 3EO9H 1GW0A 5KSAD 3AT0A 4F2ME 5IQ9B 3NCWA 3VD5A 3ZL1A 3IU4L 3QIBB 5C7XL 1G7HA 1JV5B 2DEWX 2WJ5A 2J1ZA 3AREC 2NMSA 1T5WB 1RIHL 3KYOA 4NUPA 2H41A 3QXUA 1P53A 5E8EA 5GSVB 3EH1A 2ZX5A 3NSYA 5IKCA 2OLDA 4QXGL 4YFLI 1QLEH 1EPFA 3EO1B 4ZAKA 3WKNA 2MIZA 3X1EA 3MLSL 4FXKA 1QUPA 3QIUA 1KJMA 5HHXH 2HRHA 2P5WD 2ICEC 1FDLH 4FQ1L 4DGWC 2R2BA 1K5WA 3CK0L 3UTZA 1OE3A 2XLLA 3HZVA 1G7LB 5L6YL 3N04A 2VXQA 5FHBL 2A77H 2FATL 4R0LA 3DGGB 4LKCA 3RU8H 3D18B 3HBQA 2X6UA 4GY4A 4OGXH 1PAZA 1KULA 1GHFH 4ZAKC 3KPQB 4AGMA 2PLTA 1U2HA 4KJPD 4FXKC 3CU7A 5IG7A 3QIUC 3OLGA 2K78A 3ZW3A 4F33A 2VLRE 1RZKH 2BH0A 2P47B 5IVOA 4OZIE 2OAAA 1BVKB 1JGVL 3V52H 3UEZA 1FVCB 5C0CB 2J1WA 5IMMB 3IWUA 3DTUB 5DD3H 5E2UH 3I6GA 4PV9B 2HRPL 1PNCA 3VTTA 3MLZH 5DHVA 4ZFGH 2X3AA 3NEOA 3VI3E 5A3IC 4LF3A 4X4YA 4LLAA 4Y2OB 4FHBD 3WU1A 1UOVA 1WFUA 3JV6B 4R97C 2F8IA 3PRZA 4CGTA 4U6YB 3GSWB 1RFDH 1KXQE 2EINB 3GM8A 3FW6A 1UWFA 4TSCH 4LFHD 2EACA 2VAJA 2YAOA 4TNWK 4N0FA 3A6BH 2ERJC 4GO9A 4GSDL 1SOSA 4OCSH 3PIQA 1JHKH 1GCFA 2J5LB 2HVKB 3CMOL 3MLVH 1P5UB 4G83A 2BS8A 5T3ZL 4I88A 3OWRA 4J3OD 3MLWL 4JANB 4JHWH 5C0EA 3MNVA 1E6OH 3LZQA 4GUPA 2AJSH 4YN3A 1N59B 3OXSB 5I19L 2AJ3A 1CC3A 3ATFA 3DX6A 5BRZA 3GSNB 4FZ8L 2CE6A 5CUSL 4ZUTB 2VISA 3V7AE 3O4LA 4LPXA 1I9RL 2J2ZB 1UZ6E 1GY1A 3VXSA 4AVKA 4DP5X 4HFUH 5LGYA 4QRQB 4LGRB 1N6QH 5I8CB 3CVBA 1A5FH 2JKWA 3H85A 4GIOA 1OB0A 2IAAC 1O75A 1QFWI 3VWJD 4MD4A 2YSSB 3POHA 2MPAH 4G11A 2UY7A 2IQ9L 4C58B 2UXTA 3BAWA 5IFHH 4GBXD 2CDGA 1T21B 2Z8SA 1IGML 3QT2A 4MB4A 1YNLL 2ZWYA 3TJHD 2GSGB 4CVXA 1T7YA 4K55A 2DL9A 2J20A 5AVRB 2OMUA 1SM3L 4L4TB 2V2TA 4HWZB 4PB9H 3V7MA 3DURB 3HUJE 3VTAA 4K94H 5FYJD 2Y0SA 3QFDA 2NQDA 4UT6H 5AVUB 3UC0L 2VCOA 3D12B 1VZHA 1GW6A 1RI8A 3GEFA 1S9WB 4NPJA 5C0AD 4MJJA 1UEMA 2Y22A 4NOFA 4ZW6A 5F7EH 2W07B 4XE0A 2IANB 3DO7B 5C6TH 2Y7LA 4KTDL 3QDGE 3V6ZB 1YDPA 3GJEB 3IDMB 2Y7SA 2A0LC 5F96L 1WBXB 3D30A 2A38A 4GRLD 2YUWA 3MSPA 1KYOK 3U46B 4LPVA 4PCTA 3DO4A 2I07B 2R8SH 5D93C 3ZE1F 3B8SA 4GW5B 3FFCE 5FKPB 5D72H 3RG1C 2V33A 1RZJC 2I9TB 3RWIB 1B4JL 4FQCL 1W8NA 3O2DL 3NSDA 2EEFA 3R06B 4QHNA 5DC2A 1J12A 1GR7A 5IY5B 4OQTH 3VCLB 4N2NA 3BZEA 2P5EA 4Z0XB 2WNWA 3C08H 4TTDC 4E5XA 3X3GL 2A6JA 1U9KA 2Y72A 4Y89A 1E4WL 4ELDA 5KSUB 1MZZA 4NENA 4C56E 1PCSA 3WD5L 2JI2A 2BOCB 2HG5B 2YD6A 4MQ7A 3WHXB 4U1IB 2CO1A 4GKOA 1JDDA 3OGCB 1JWSB 4WU7A 3SPVA 2WLIA 2ADJA 4X83A 4XN2A 1CU4L 1ET5A 1SFHA 4K15A 3K6SA 5AZUA 2WTOA 4KROC 4D9QE 3S5LG 1SYVA 4JKMA 5DFVD 2YN3A 4X4ME 3D3VB 1L0QA 3O0LA 2FR4B 4LEEA 4M7KL 4MJ6B 3UJJL 3DETC 4PB0L 1EIBA 5C6WH 4WNSA 2NR6D 3EOBB 3L9RB 1QTPA 3AAZB 4G8GA 4I13B 3CFBA 1ZXKA 4ODUA 5HGHA 3ABKB 3VG0H 5I8OH 5ALCL 3GBML 2NCEA 1AR2A 2BFVL 4C57C 1V05A 2WINB 3AS3A 5IB1A 3MJ7B 1WBYB 1NH6A 2BX5A 4A6YA 5E9NA 4AZUA 3DV4B 3UPCA 2I25N 2ZX8A 1UM4L 2YA1A 1CD9B 2FIKA 5FFGA 2ED8A 4NKMB 5F93C 2BSDA 3T6XA 1IQDB 4UNIA 2EC9U 2DWEA 2YC1A 1VFBB 3AB0C 1V3KA 2DYPD 2FQDA 1MH5A 2FZ3B 3Q9QA 1J87A 3E7JA 2HFFA 4ORGB 2DWXA 2W1NA 1KFAH 3IFPB 2LVEA 1DN0A 3RHWF 5K9KB 1ACXA 1OWRM 3U9PH 4OFDA 1WBZA 1MUJA 1ODUA 4GG6F 3ILQD 1FYTD 1NKGA 3L5WB 4Y8AA 4KI5F 3GO1H 1B4LA 2XA8L 3ESVF 4GIAA 1BGXL 3MFFA 5E6ID 3D0LB 1N5YH 2YPLA 3TWYA 2IMNA 4FG6C 1KLUB 2VDLB 5GZNA 3WOVA 1CT8B 4ZS6C 3OJDA 1QYGH 1IO4C 2O1AA 3FK3A 1OM3L 4OFIA 3BP7B 4AYSA 1JRHI 3AG3B 2VYRE 3EFFB 4NUJB 2Y25A 3BUIA 2CCLA 1I1CA 4HLZG 1A9BB 3O6KL 5IEKB 4GSXA 3PGFL 3MXWL 1YMHB 3Q6GH 3BDXA 5HHNA 4PP2B 2AQQA 2A83B 3CFCL 4QT5A 5I6XB 1TTUA 4L8DB 1NCNA 2XV0A 3S2AA 1YNKL 4OLXH 5IVXB 1YNTA 2J6EA 2DQ6A 2X2IA 4Z7AA 3OKDA 1ZPUA 2V8LA 2WVSA 5AOZA 3VRJB 1HH9A 4MJIE 3U9UA 3IJSA 1UOLA 4NJAH 3WMPA 4XMTA 2X41A 3KLQA 1JNLH 3F7QA 2AGJL 5A16B 1AKJB 2WXMA 1NSNL 3S35L 1GYCA 4OTXL 4RX4D 1ZS8A 1EO8L 3HC4H 4NBZB 1TCRB 4NRYB 1TSHA 5CSGA 4Z7IA 1CZ8L 2H7WA 5IOPA 3QDHA 2R4RH 3D85B 1A9EA 1KCUL 4UF7C 1KSRA 1FQ9C 4G6FD 1PLGH 4NRXB 1Z3GL 3T77B 4KMTH 5BOZG 5TQ2H 4G8FB 4DO5A 4WI7A 5ICZB 2X70B 3BMVA 3QGVA 4QF1B 2RALA 1YYML 3RP1A 5IOKA 2EDRA 3LVTA 3L3GA 1XB8A 4GMSH 4O2CB 3S6CA 1NGZB 4I1RA 3GIZH 2BWIA 3WS3A 4KZ0A 2KH2B 3MOAH 2FSEA 3L17A 4JO2H 5HVWA 1MRFH 5KSAA 3MRLB 4TRPH 2XACC 4Y5YA 1JZJA 3QJOA 5L4JA 3M88A 2BW5A 5D1XA 3SBPA 5BVJA 5BS0A 3RPIA 3WEMA 5EC2A 2JJVA 3X17A 5GRZA 5EZPA 4G8EB 4QWWD 1T3FB 3LEXB 4UOZA 4TVUA 4I0KA 1D5IH 3M6DA 1RUAL 2W0LA 4Y4HB 5CEYA 1GZQB 1BFTA 4PY8J 1WEJH 4XWGH 1JI2A 5B1BB 6PCYA 2BSTB 4P2OC 3GZOA 5J1AB 4RGOH 5HYJE 3VXUB 5KSAC 3ZDZB 3QWRD 3VDAA 2GJZA 5D1XC 1G7IB 4ANKA 4NQCA 3APCA 4QTFA 4ZYKB 2J55A 4J2QA 1Z32X 2BNRA 2IDCA 5F21B 3T2QA 4L05A 3VG9C 5HBBA 1BQLH 5HDOA 4H8WH 4AVHA 4HUUA 2V4LA 4Q89A 4UIKH 4WEUD 3EJYD 2ZJSH 3HZKB 1KLFB 3CNKA 3R7QA 1PYWB 3T08A 2OR9L 1AAJA 2WTRB 3E80A 1TOXA 3F7YB 2Y5QA 3FB7A 3IE9A 4X9HA 4KK8C 3PU7A 4XPAL 5DZLA 3X2QB 2EO9A 2YFOA 5C3LD 4K7PH 4HZAA 1IAIL 3MPCA 3ARYA 4M7LH 1HK6A 1DQVA 4FNLH 3R1GL 4XPHL 4BZYA 5E7BA 4FEIA 1NBCA 4H1LH 5C0GB 1NDGB 3NRPA 1EBAA 2Z4QA 3B2DC 3Q8EA 4F1ZA 5C0CD 5FGCE 1DUZB 2F54E 3T71A 1IBBA 2XQYK 2AXFB 2WYHA 4J1UB 1ZSHA 1FFOA 2K0RA 5F1KC 2NW3B 5AZ2H 4URTB 4XVOA 4PJXF 1A21A 3B3IA 2X3CA 4L9LA 1F1AA 2G9KA 4FQQB 4XO5A 3TBCA 2CJSA 1R5VB 2WXIA 4WKZB 2BHFA 4PRNB 5C70A 4JDZB 5MENA 5IQNA 4AITA 1AY1L 3LKSB 4U31A 3FN0H 3HKZA 3REWA 2MCAA 1VEMA 1DVYA 1M2OA 4YO0B 1DANU 3WFBH 2QMJA 1X7QA 1GGCL 3HE6D 4ZPTA 2MJWA 1C5DA 1I53A 1YEFL 1G9MH 5GGQL 3FTGB 1JVKA 2IIJA 2MOVA 5FM5O 5B1KA 4D9QD 4OM0L 5FB8A 4NQEA 4L9LC 3V5KB 1NCWH 3G5VA 3GI9H 2LAGB 7FABL 1I9JH 5LGKA 3C09C 4PIRF 1QFOA 4WJ5B 1FAKT 4MB1A 4F15C 3P30H 5GGSY 4L1DA 4KDTA 1EX0A 4JRXE 1QWNA 3LKNB 4NXSA 2X5PA 3P4OB 3DSFH 3TBVA 1FBIH 3QHZH 1FNHA 3HNTH 4G6JH 3KPPA 4PJ8D 4B9GA 1AS8A 3VWJC 5C0DB 2OCJA 2WK2A 4KUCF 4KWUA 5C7ZA 1P9MA 2EEAA 2FWSA 4PJFA 3TYFA 3CQPA 1H15A 5EF0A 1KF9B 3BZ5A 1QZNA 2YD9A 4DW2H 4EDWL 4DCQB 2XN9E 5EU7C 1DVXA 2UVFA 2ZCHL 3N0AA 5DS8B 3OQRA 1KPUB 4GLRH 4L4TD 2P8LA 2B77A 1YPZE 4WSKA 1DCEA 4XH2A 3IAGC 2ENQA 1JGUH 3NZHL 4JM2D 4Z7QF 3CPLB 3HA0A 4OT1L 3EXJA 3L3JB 1T20A 3AG4B 1P9MC 3CX5J 4QRBA 2H8PA 5FUCE 5HDBE 1OAZH 5CS7A 3MFGB 4NN7C 3E6FA 3M17B 2I32A 4L29B 3RDJA 5C0IA 3HB3B 4G43A 3NSFA 2ZOOA 3MV11 4R84A 1CGXA 3UTOA 3UDWA 2CO6A 1CG9B 3CN0A 1YRKA 1LMKA 2VDNB 3HR5B 1E5ZA 3MJ9L 1Y1DA 2XBDA 3BO8B 2CA4A 1FI8C 3I9PA 1QKZH 4O51A 4M3KB 2FNWA 4XXDB 4CL7A 4NZRH 4V1DE 3U6XA 4DO4A 1ILSA 1PY9A 4IOSD 3BAXA 1J88A 2QQLL 2XG5A 4MXQD 5HJ3A 3LQAC 3QUMA 5EPMA 3HFMH 1T03H 2Z91A 1YHPA 5DD1H 3VWKB 2ICEB 3J8F7 3FB8A 4MA1C 1UM5L 3BKCL 2X1OA 5HDRA 3RWEB 5HSFA 3GBLA 3RJQB 2G5BA 3NK4A 4TUKH 4HCRL 1G7HB 4N22A 5JIKA 1NCJA 1OGAA 4R8WH 1YZZA 4D0DB 2Y6SC 3ULUH 3KYOB 1Q8MA 2ICWA 2B14A 3JWNC 5E8EB 1PX8A 4KHXL 4OF3A 2EDHA 5DC4B 5IKCB 4ZAKB 2PP9A 3KYKL 1DLFH 2Y1YA 5HGDA 1LQSR 2HPOA 4FXKB 4LDOB 4XNYL 3UJIH 1CFMA 3QIUB 1LE5B 2ZOTA 3JWDC 2X7LB 3CSPA 5F6IC 5JZ7D 4XMPL 1A7OL 3ES6A 2R2BB 3UTZB 4GW1B 1RZ8A 1MQKH 4CNIB 3HZVB 2FBOJ 4AL8L 2IF7A 3HC3H 5EZJA 1EVUA 4O02H 4R0LB 4AC2A 5IBLD 4L3CA 2R9HD 3GMQA 4YLCA 4NP9A 1E9PB 1UATA 4I3SL 1DQLL 4XCYA 4AE1A 1XR9B 2Y4SA 4MXVF 3RB5A 3N3EA 4KPHH 2IGFH 4F2MA 5FM4A 1KIQB 3QPKA 2AW2A 1BA9A 2GJRA 5HJDA 1XCTA 1C5BL 4HKJB 2O5YL 3L95A 4WQOA 3MCG1 2ZAHA 5DHVB 3LPWA 4HEPA 3NCEB 4X4YB 1A8JH 1FZKB 2BPBA 1DVFA 4KV5E 3BPNC 1N12A 2VOTA 4E0RA 4L1SA 2Q86B 3GBNL 3KH3A 1P7QA 3ZE0B 3V79C 4ENZA 5I73C 3ILQC 1NBQA 1YEJH 3WY2A 1QI5A 3U4BL 1VPOH 4N0FB 2H4EA 4JFPA 3ALPA 2ZYRA 3G6JB 4NCC1 6FABH 1HHHA 1YJDH 4H20H 3PREA 4TF4A 3BKJH 1XX9C 4PJEF 4I4WA 3CHPA 5C0EB 3MNVB 4PJBF 3RURA 1DVFC 2E7CA 2VLRA 2YOAA 2HLAA 3CSTA 4ZO9A 4NQDD 4C4BA 1F1GA 5BRZB 4OZIA 3S37X 3VFVB 4E9SA 2MQGA 4OIIH 2VISB 3MGAA 5I0WA 3O4LB 5T5NG 5D70L 3VXSB 1MIEL 4KKNA 1KYUA 3E3QE 1T83A 3CHSA 3HI6H 3MRNA 4E9XA 5CCKH 1E90A 3VI3A 4I48A 5TE6L 2R51A 3N43F 3STLA 1HC1A 3R18A 3FO2A 3LXAA 2B59A 2E6QA 3CBKB 4MD4B 3FL7A 3P9LA 4YE4H 3S34L 1T2JA 1TQSA 3NIDB 3QNZA 2F8OA 4TNVF 1KXQA 2DB8A 2QBWA 1MJ8L 3V0GA 4J4PA 4J8QA 2EIJB 4AKOA 4W9DC 3FUIA 2CDGB 4QRUB 3RIKA