1HZKA

Solution structures of c-1027 apoprotein and its complex with the aromatized chromophore
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
110
structure length
110
Chain Sequence
APAFSVSPASGLSDGQSVSVSVSGAAAGETYYIAQCAPVGGQDACNPATATSFTTDASGAASFSFVVRKSYTGSTPEGTPVGSVDCATAACNLGAGNSGLDLGHVALTFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antibiotic
molecule keywords C-1027 APOPROTEIN
publication title Solution structures of C-1027 apoprotein and its complex with the aromatized chromophore.
pubmed doi rcsb
total genus 9
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2001-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00960 Neocarzinostat Neocarzinostatin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.230 Mainly Beta Sandwich Immunoglobulin-like Neocarzinostatin-like 1hzkA00
1NOAA 1J5IA 2CBQA 2MCMA 1HZKA 1AKPA 2CBTA 1J5HA 1J48A 2G0LA 1O5PA 4JW3A 2CBOA 1NCOA 2G0KA 1HZLA 2CBMA 1ACXA
chains in the Genus database with same CATH superfamily
4KK5C 2EYRB 5IBTH 4U1NB 1A9EA 2COVD 5CCKH 1R3LB 3WNJA 3ORJA 5IMMB 4JCWA 2A0LC 2P7TB 1HHJA 1JGUH 3OAZH 3WN5B 2E6PA 1T21A 1NM9A 1MWAL 4JGMA 2DN7A 4N0RA 4UUJA 2DQ6A 5DMYA 1UACH 4HJIA 4QF1A 4R83A 4AM0Q 1HXYA 1GGIL 1IAII 1E5AA 5F1SA 2HVJA 1U3NA 4IDJH 3O3BA 4BSWB 1ZA3A 3QPKA 4H8WC 2DQJH 4OVVA 3QJXA 3DUUB 1U8MB 1W91A 2NY4C 5FO8A 1MNUL 4IKLA 2FR4B 5DVKA 1T66D 3TT1L 4O9HL 1AVAA 2OTUA 4EI5A 1TQVA 2ADGB 3RA7L 4F7KA 1ICTA 2OMYB 3OKNA 43CAB 4QXTA 4WGVB 1AJ7H 1HHGA 4FQIL 1UA6H 4PYGA 5AOIA 2PLTA 1X4XA 1SJMA 5JLZA 3GSNH 3A5VA 3NIDF 1RVFH 3RY4A 2ZKMX 4YDNA 4S1RH 5D8JL 5F6HJ 1TMQA 2EUXA 2P49B 3H4HA 4P23D 4WEUD 4WW2F 1LK3H 1PZBA 2GY7B 2QQNL 5AENA 4DW2H 2K6WA 3CX2A 1YN7A 4IRJD 4ZSOA 3DKHA 1AR2A 4HMDA 2AV1B 4Y4HB 1TJXA 1DUZA 3RQ3A 3BKJH 3O8XA 2H6PB 4GW1B 5HDQL 1LO0L 3VFNB 1F4WL 1BV8A 3BGFB 4ZXBD 3TU6A 5GISH 2G9HA 4HISA 2ODHA 4FS0A 4DGIH 4JO3L 4MYPA 4B41A 5GS1B 1JAEA 2WBJD 3KPNB 1X6NA 3U4BH 3TA4D 3STLB 1E5BA 4HJEA 5L4FA 2IOOA 1B0RB 1WE5A 4R97B 2EDNA 4ONFH 5EU6A 4Y1AD 5AW7B 5C0JB 5JA8B 4UMSA 2B2XL 4M7KH 4IU2A 4PCKA 2AQ1A 4KXCA 4MJIE 2VSDA 3SEPA 5DGRA 1LEIA 5DFAA 2BVQA 1KGWA 5I1EH 4N0CD 3N9GH 3WTXA 5GSVA 1I9RL 4J28A 4N2GA 3RZCA 3HI5H 2AJ3A 4LP5A 1FNSH 2WHVA 3CV5A 3D5OF 3QISA 4XP1H 3TVMB 2E6JA 3R0MA 5T8IA 4LOEA 3UADA 4YHYC 3WHE1 3QG7H 3TZVA 3WFCL 2D31A 1T2QL 1HHKA 4XOBA 3WAJA 3ZE1E 3RWIB 1UWFA 1XR9A 4OV5B 2B08A 1XL6A 1I1AA 5EHFA 2VW4A 3RWEB 5BQ7B 1XXDC 4OQTH 1SHXA 4R5TA 4ZFOB 3REWB 1CBVH 4Z7UA 3ULVH 1FHGA 5BO1H 3H8NA 3HG1E 1WZ1H 5KN5B 1PX3A 4C56E 4XNZC 4C56B 3ILQC 3ZIYA 3N1QC 1GRWA 3QWOB 3WJJC 4QYOA 3Q2VA 4PWKA 5EEZA 3MRMB 1X5YA 5K9KB 1E4KA 1FRGL 7FABH 3WO4C 2VQ1B 1WBYB 3CPLA 5FO2A 2VZ3A 4J7RA 3QUYD 2Y3AA 3CVHB 3VWKA 2ORBL 4TSBL 1FPTH 5DJ0A 3GHPA 4L5FL 1ZT4B 4B50A 2A9AA 4NQEA 5D7SL 3DX4A 4MWFA 1MHPL 2CO7B 3K46A 3RUGA 4BSVB 3BAWA 2PYEA 3BCFA 2H2PC 3KJ4C 4GBXB 3MX0A 2AJXL 2WGXA 3NDZE 4RNRB 4GQPH 4PV8A 2EXWD 4NJ9H 4I0CC 1N0XH 1ERNA 2L7EA 2X4QB 1UATA 4TS6A 2CJUL 4CU6A 4K0OA 1G7LA 1MFAL 3QEQE 1CDUA 5T3ZD 2FZ3B 4CSZA 1YSOA 3V4PA 1JD9A 1QFWI 2K7QA 9CGTA 3PREA 4UOW1 5E8NA 5CBAB 1NCAH 5HVFB 3FU3A 3BLKA 3P9WB 5IR1A 1QBLH 2AXFB 3ZQ9A 1S5IL 1Y1DA 5CN1A 2FX8L 3MBEB 4I2XB 3FCBA 1HSBA 1R6VA 4UNTA 3LJ3A 3E2HB 2CLRA 4O02A 4MCYA 5LKNA 2FH8A 4NNYB 4DZ8A 1KT2A 1EO8H 4P2RE 4L0ZA 2VW6A 4KDTC 4QHUA 3LNHA 4OI9A 5FFOA 5IVNA 4K8RL 1THCA 1E4WH 3O6ML 4P3DA 2CDFB 1MPAL 2Z31A 4NGHL 1MVFA 1DSFH 1YMMD 1V3MA 2LTQC 4S1DD 4APQB 1IB5A 2CCLA 3MJ9L 3P0GB 2DQEL 1I8MB 4N87A 3CNKA 3JTBA 4H13C 4OCNC 5ITFB 3GSUA 1HK6A 3UX9B 4F8NA 1NJ9A 3NGBC 3SDDB 4KTDH 2H2SD 2FATL 1ZLVK 2A6IA 3UTTB 3VFTB 2YGPA 1A7NH 4LLMA 2IAAC 3ZQWA 4JFXA 3VFWA 2NYZA 4WHTB 4CMMB 3VAEA 5AB2A 1AGFA 1PNCA 2BSBA 5KJRL 3T0BA 4AC2A 2ESVB 2C9RA 4LP8A 3QDME 5FKPA 2Q7YB 1FO0H 5FW8A 2DYPA 3QDMB 4L4TA 5ICYA 5ADPL 4ABWA 4GO8A 1K4DA 5DURB 4WGWB 5HJGA 5KVEH 1LE5A 1HIML 1VGKA 1OAKH 2ZG2A 1PKOA 1R9FA 3EZJB 4G1MB 2FL5B 2Y5EA 3EDEA 2X9YA 2HKAA 1FFNB 5D2LE 1V54B 1QX1A 4DTGH 4NZ8A 2XXGA 4CW1A 4OBRA 3OQ3B 2CAKA 1CQKA 4OLUH 2J2ZA 3HI6L 1RMFH 4LSTL 4BK8A 1O9VA 5KYWA 4J4PA 4CSPA 5SWQB 4W4OA 1TZ8A 3I9AA 3MRKB 1HQRB 3V6FB 5GRUH 5AALA 3OKMA 3VVWA 4EI5C 3LHAA 5BZDB 3UDWA 3MUJA 4KI5C 1QNIA 1Z66A 4CBPA 2X89A 4PRDB 2VM9A 2VLJD 1T0NB 1ZHBA 5L6YL 2GI0A 1CU4H 2VH5L 3QIBB 3JWDC 3OG6B 4RX4A 1CUOA 4GAYB 4WU5B 1OGTA 3A4FA 4CU8A 1DFXA 4Y4FB 2CUIA 2XNAA 1B9KA 3Q2CA 1MIML 4IQHA 5ECJE 2WNXA 1F6LL 4E41A 3FTUA 4GG8B 3ENEA 5BZXA 3ZKMC 2Q86A 4JGNA 1DHKA 2XXFA 1N5AA 4QRUB 4JRFA 4UDUA 3HAEG 2CLVB 3O8XC 1T6BX 4GAFB 2ZSVA 3HCVB 5I1DA 2VUKA 5MEPA 1Z0MA 2ZICA 2D3NA 3SDYH 4OCRL 4TNEA 3VH8A 4XB3A 3SPIA 2NY5H 4CBZA 5KVFH 3ZKSD 3B9KA 1HQ4A 1TFPA 1IM9D 2RH0A 5CGTA 4FJYA 2C9QA 5DUML 4ODXB 5DD3L 3L3GA 1VB9A 3CZGA 3MRDA 5SWSE 3D4YA 5AW6B 3QYCA 3UTSD 2VRKA 3ZHNA 4NQTA 3RTQB 4RFNC 3MRNA 2A73A 2GBTA 1YEGH 1KBPA 2FT6A 4PB0H 2NW3A 1X3DA 1OQOA 2FWOB 3HVNA 3KXFA 3RZCC 4PBXA 4KZDL 1XX9C 4NBXB 2UWEA 5DWUL 4PJHE 4KPHH 3TZVC 3J27A 4I0PB 4GXUN 3D34A 5ISZA 2Z7YA 3S7GA 1FL5A 4O58H 4DQOL 1UA7A 3CQPA 3UZQA 1RU9L 4LL9A 2Q3ZA 1I1AC 2P26A 3HKFA 4F8QA 5B1BB 4FLQA 4F7EA 2ERJC 3KBPA 2CGZA 2FWLB 3LIZL 5KZCB 1GW0A 4UV7H 5GS2H 3D1MC 3MO1A 3ZHFA 1G9EA 3CXDL 3OF6D 1N10A 1DFBL 1CFBA 2EH8L 2YXVA 4KK9C 3Q44A 3NA9H 4OFQA 4U6XB 1BQHG 1S78D 2VQUA 3JV0A 2Y1VA 1E4KC 2XX0A 3OZ9L 5DEFA 2AMUA 4QRRD 2FCBA 4GXFA 4JPKL 2DYSB 3V8CA 3DIFB 4XNUH 3MOBL 3VWKC 4X99B 3S2CA 2HT4C 1KEML 5E9DD 3IBOA 2CBQA 4AYFB 3TV8A 1WA2X 1IZJA 3BGMB 4OY9A 5DZOA 3SO3B 5IEKA 4ABVA 3BHBB 3QFJB 1TQSA 4XWGH 4MSWB 1IMHC 2O61A 5BOJA 1TR7A 1VPOL 2Z4QB 4HWEL 3RIAF 5HVHB 3KPSE 4CUCA 7CGTA 2CWRA 5TPWL 1NEZA 3IFLL 3SGJA 5KYNA 1NGYB 3FNKA 2Z91B 3WI9A 3X1BA 2EUZA 5ANMA 3Q9QA 1JYWA 2X4UB 4NZDA 1IGIH 3INOA 3ZOAA 4EN3A 3QJHA 5EU5A 3FTYA 3PWLB 4XC3H 5K59F 5E5RB 3CFCH 3NSCA 1X7TA 2F8VA 1KMGA 4NHCL 5JA9A 5LDSA 4ZFFA 4AQEB 1T2QH 4MXWL 5E00A 4ZAKA 2ICWB 2PW2A 4OLVH 3HNVL 1M42A 4OZFB 5DK3A 4XVSL 1EFXB 4HK0B 4XP9H 1YZZA 3HG3A 4YGVB 2YZ8A 4QI3A 5E8DH 3IF1B 2BIMA 4MQXC 2V2TB 4KFZC 4PJXF 4XPHH 1A3QA 1N9PA 5L88H 4NJAL 1TG8A 3DVNA 1VLXA 1XMEB 3E7JA 4G8GB 4R0LB 2CBMA 3RFZA 2P24A 1MAJA 3ZDXF 4HKXB 1S7QA 3HS0A 3TPUA 1KJ2H 2HN7B 1R0AH 4ZW5A 3VCLA 4Z78B 1DQDH 3ZZ1A 4DJMA 4M43L 5D1ZC 1HSAB 1LEKB 2NXZB 3BDBA 4JFDB 4LLUA 4NO2A 4YNYB 4YFDB 8FABA 4TUJB 2Z9TA 1H0DB 4M56A 4F7TB 1UG9A 3AY4A 3WEXB 4N2OA 1BZ7A 2WIIA 2OYMA 4UILL 2D2OA 5FOJA 1OHQA 4TL5A 4KV5E 2R69H 4HJTA 4QD2E 1UQSB 1UOVA 4WIQA 4IRSB 4FAAB 3HMXA 4PD4K 5ESAA 4ZFGH 5I16A 5I6LA 3MBWB 1RHHA 2F18A 1JPSH 1F41A 1A6AB 2ATKA 4PEEA 2DPKA 4Z5RA 4L3EE 5D71L 4AJVA 4DVRL 5IM7A 2CKBH 4M1CD 3O2WH 5JW5B 4KHTL 2FX7L 1RKRA 3DV6A 1SMOA 2BHFA 2JVUA 1TJIL 3IM1A 4FGMA 3F7VA 3ZDYE 3RX7A 3VTAA 1BW8A 4MDRA 3ZDYB 2R56L 2XZAL 4YBLC 3O9WD 4HIXL 4MDIB 5H8DA 5T1KB 4YAQA 2WP3T 4C55A 4FADA 5PCYA 1GS8A 3VYOA 4J4PC 1BSIA 4W4OC 2P8PA 4AIOA 3Q1EA 2WXMA 2VITB 1JCVA 5F7DB 3UDWC 4WO4A 2FGZA 5ALCL 3O4LD 3ATBA 1TETL 3MCG1 3B2UC 4UINL 3WXWH 2J8UA 1ZSDA 3F7RA 4HJ0C 1JYNA 3DBSA 1JZIA 1EBAA 2BNRD 3FQNA 3ARUA 3T4AB 3D30A 3FQUB 4Q4EA 2ZXCA 5HHMD 5KSAD 4RAHA 4I5BB 5A6LA 2PNDA 2DQEH 3MLTB 2BJML 1Y6MR 4JG1H 4NT6A 3FU7A 1RURL 5DFVC 4JY6A 5F70A 1J8RA 1BVLA 3FQXA 3HC3L 5FGBA 1M53A 1S3KL 1U3HA 2FGWH 1MREH 1AZCA 1SJXA 5C07A 2P42B 5AW3B 2ICWJ 3BH4A 1U8LA 2EDXA 3HZYA 5ACMA 4S11A 4JG0L 1JTOA 1AKJA 5T3XH 1OT4A 3N0AA 5HDBE 2XVLA 1AIZA 3C8KA 2CJSA 3B9KC 5HHVH 1ZGLB 1Q0EA 3CHSA 1IGML 3VXPA 4KY1H 4AUJA 3C5JA 4PJFF 5E2TH 5I1CL 1IKFH 2WQRA 4MXVE 1HILA 3VA6A 4GKNA 1I1FA 2PPCA 3TASA 4WVRA 1PZ5B 5B1AB 3T2OA 1T4KA 5GRWA 4FXGA 1WH0A 3GMNA 1TTBA 5GJSH 2EDRA 4PFEA 4TPRH 4FX5A 5F7EH 5DUPL 1NANH 4WY7H 3HI6H 2DQIL 1SVZA 2BZDA 2CO1A 4P4KB 3BLPX 3MREB 1M56B 1XGUB 1FZOB 1QEWB 2FJGB 2LQRA 2NY4D 5AG9A 4JAMA 3RWGA 1XGQA 2BSSB 1PZDA 4HXAH 4I1NB 4QY8A 1WD9A 2GJ6D 3X11B 3FFDA 1IJNA 1GTFA 3UBXA 3TYFA 4FLOA 4HUUA 3TBWB 1GZQB 4KZCA 4OQ1A 3F2LA 3OZLA 2EZ0C 1QHQA 3L3OA 4X6BA 5DRXA 2VLRB 1ZY9A 2CK2A 3K6NA 2R7EB 2IIJA 3E6FB 1UD2A 4KZ0A 5HYSA 1W8EA 5CKGA 4FF9A 4OFYD 4JW3A 1SGKA 3TH2T 2WJ5A 4PJ7F 4NN5C 1IGTB 1FNEB 4G6ML 4X4ME 5EO9B 4PVMA 3RWFB 3M17B 4I9WD 4OFDA 1V7MH 2NX5E 3HLKA 4Z3FA 1H15B 2DLGA 4M7ZC 4YBQD 3Q2LA 2WOYA 3EGDB 1CBJA 1T1XB 3FB8A 4K9JA 2NR6D 1VERA 2NSMA 3O45B 4X6DF 5B4MC 1FSKB 1YEWA 3QT2A 1QLEL 3OB8A 2ZUTA 4HWBH 4B0MB 4BKTC 4OZHA 1MHEA 4X4XB 5JHLL 1ZHKB 3MV7D 2GY5A 1DZ0A 1F8TH 5E24E 2CHWA 3JTSB 3QRGH 4ZTEA 3SGJC 4YS4A 4V11A 1VEOA 2QVMA 1MJUL 2RD0A 4N28A 1JZ6A 3BEVA 5C9KA 4Y9FA 4U3CA 3O0LA 5BVJA 4A7UA 3HZMA 4EN3C 5KSBE 5KSVB 4G8IA 3QK0A 4KZDH 2F7IA 1G9MC 3WTTA 1RZKH 2ZUWA 1IBFA 5DWUH 4PRAA 2UVEA 5EZOL 4KMLB 4ZAKC 3L4VA 4QPEA 4U3XA 5IMKA 4DKAA 4WWKA 2K7PA 1NCBL 1IFGA 1KWGA 3PAZA 1GHFH 1TCRB 4J3SA 4OZ4B 3MGTB 3NCJH 1YPZE 4JFZH 4QXUL 1LD9B 4QAMB 3S8FB 2OP4H 3TFKC 4JUTA 2NY1B 3CFIC 3RFZC 1P1ZA 1QUNA 3HS0C 3ARFA 1FCCA 1NC2A 1JWUB 5DS8B 2WQWA 4POZD 5IVZB 1P4LB 3HVDA 5C0BA 4PJ5A 1N64L 3EGSB 4ZOEA 1KBGH 3RVTD 1WCBA 3D39D 1SUJA 3AY4C 4WWOA 3ZYIA 2IBZY 3VU1A 2XZCL 3MOBH 4WRLA 3U30B 1KPUA 2EH7L 2V2XA 3EW3B 5D4JA 4Y4KD 3TCLB 3VFSA 3HJ0A 1N18A 4XMKL 5JPMA 2NLJB 3A67L 1NA8A 2MKLC 3K4AA 3KPOB 1LL1A 4YX2H 3L3HA 2V0AA 1P7KA 3FO1B 3MNMA 5F1IA 5KVDL 2WBWB 4N2EA 1VGEL 4NIKB 4XNQA 2AJZA 5CZRA 2XY1A 1AY1H 43C9A 4KI5F 4FQPA 3VI4E 1N2RB 1I3RB 3VI4B 3FAWA 1J10A 2YUZA 4AKQA 2GSIB 2LU7A 4BDVA 3QW9A 4TRPH 3TEZA 4JM2A 3GBDA 5D96C 4G6AC 2FO4B 1J5HA 5DYFA 4KJQD 4NM4H 3S34L 1OSEA 2KL6A 2OZ4A 3GIZL 2E86A 3NFNA 4Y7OC 5DMKA 2BHYA 1AG6A 1Z9SB 3GZOA 1CGSL 1J05A 4WO4C 1T7YA 3VB9A 2YPKA 3QFDA 4GLRI 1BX2B 3AG2B 4MXWH 4XOAA 5IZ7A 1FV1A 4H2CA 1SDYA 1NGWA 1P4IL 1IT9H 2I9LA 5H94B 4K94C 1PGRB 2YD3A 1RK7A 3D0LB 4AT6B 1XF2A 2VXQL 3BMVA 3IMTA 3T1FB 1H6UA 3HC4H 4Y5XB 4ES8A 4ECNA 5C6TL 2EAEA 2MPVA 3DX2A 1TENA 4QXGL 3II3A 3IFPB 3HG2A 3TNNA 2APTA 4A2EA 1YEEL 4V2CB 2IAMA 4PR5B 4FYSA 1MJ7L 1WWWX 3QXVA 5E1AA 4FEIA 5FGBC 1EO7A 2YQ2A 5DR5H 1U3HC 1RUKL 5I0ZA 4M8UA 4J3OG 1XCTA 2QLVB 4LNVA 4FI6A 3FSAA 1MI5A 3NZSA 1F3JB 2HJLA 3NP3A 4JFED 5JXEC 1WWCA 4UILH 4ETQB 4MMZB 3BAEH 1H5BA 1XV8A 4J3BA 4PJGE 3SCMB 1R34A 3S96A 5E4IA 5ESQB 5TE6L 1WFTA 2N1KA 1B2WL 3FQWA 4XMLL 3SY0A 4GSDL 5JMRA 4M7LL 1JDCA 2WWOA 4IIQB 4HZAA 3P30L 4WI8A 4HK3N 1I7ZA 3EJRA 1OP9A 1GCYA 4FERA 2ZCHH 2QQQA 3UG3A 4Z7QE 1D5IL 4BRVA 2F53A 1WFIA 5EEWA 1T0MA 3QUMB 3KYNA 5HY9B 2A6KA 1I7RB 2QQLH 2YAHA 3I9GH 3KLAB 1CK0H 4FXGC 4S0SD 3ATDA 1MQKL 4ESKA 4OIIL 4HIXH 1EUUA 3V7AE 4Z7UF 3QQDA 5C0CD 1K5NB 4FTVA 4YDIH 2HPOA 2ZOKA 3DTDA 1QRKA 5KVEE 2VXTH 4EI5D 4PCTA 1OSZB 1PG7X 1ETZB 4KRNA 3ZTJH 3CDZB 1LO5A 4YHZL 3SBRA 3US9A 4Z3HA 4IM8A 2BY3A 3MRPA 5LNDA 1NMCB 1ZHNB 3CC1A 4I89A 4ORGA 1ETA1 1S9XB 3RWCB 2ENJA 3L3OC 4LKCA 4AH2B 3AROA 3OM3B 1M6OA 4MNQA 2X6CA 5DD1H 4ZUVB 1JGLL 4E9WA 2HTLC 4LKXA 1QWNA 1HXMA 1OOWA 3A6BH 1O5DT 1LP9E 2DWDA 2XBTA 3ABMB 4HK3J 1X5LA 4N20A 1LP9B 3IKCA 4GO9A 5ES4B 3WFHA 1GJWA 1QPKA 2IPKA 5C0NC 4RAVB 1XIWB 2YD1A 5I15H 3MJ7B 4JDEA 2N7AA 3FT1A 3MYJA 3UTZB 3SKNB 1BLNB 5I75C 3HB3C 3BC9A 4YZFE 3ETSA 2C34A 1W72B 3COOA 1XL4A 4N22A 2YEZB 1UB6A 1FYTE 4QCIB 5DHXB 4CAGA 4PQXA 4E42A 2WUBH 4PVBA 1TQCC 4M6NH 4P2OB 1QSED 3UGEA 4UTBH 3K8KA 1G7QB 3KYKH 5HYJD 1YYML 3NIFE 2Z34A 4X5XA 5EU6D 5BJTB 3GSRB 4PMFA 4X7SL 2B1OA 5EN3A 3CZEA 3P4MA 1BOGB 3FHEA 5AZEL 1AD0B 1O6SB 4KUZL 1DBJL 4PJ8B 5E2UL 5F89A 2FWSA 5HVWA 5TFSH 1F6FB 1JPFB 3T0XA 1SOXA 3ZW3A 5D7JB 1IKNA 3BUTA 3QQXA 3HAEB 2NY2D 2B9AA 1XAUA 5IVXE 2BOBA 3MACL 2JJWA 4ZX5A 4ODHH 1JDDA 1H8NA 3QA3B 1IBBA 3FUJA 5KVFE 1ZLUH 2VDKL 4L8DB 5EZJB 9PCYA 1HEZB 3OKEA 4WWKC 3ARDB 5FGCE 4ONOA 1DQLL 4AKPA 2QQKL 5HGAB 3EFFB 4YSSA 2ZCLH 1MWAB 3SBPA 3VTTA 3GJFB 3U6RB 4LASH 4WFEE 2XSKA 1R3HB 5I8OH 3D69A 3SJVE 4HS3A 3BH9A 1JN6A 4GG6B 3FBQA 3DTXB 3ARFC 3FT4B 4KMTL 2WXOA 4L18A 1RK0A 1EZVX 15C8L 4RGOL 1YECL 1VDGA 3IDXH 2XN9A 1FFQA 3P9LB 4YHIA 2NUPB 4OF5A 1OAYH 3OKDB 4Q2ZB 5HI3C 4HMCA 1HKLH 2WLNA 4G6MH 3WTSA 1BD2B 5CJBA 1FH2A 4A7GA 3B2VH 1AGBB 5CILL 4ELMB 2NY6D 3CVIH 3ECUA 4JFFE 1X4ZA 5DEJA 4UTCA 4XPGL 3NOIA 1DLFL 4LARH 3U2IA 4B9CA 4IEFB 2YJQA 1OM3H 3S36H 4TSCL 2NXYB 4NQED 1MFMA 3UIYA 1A14H 4UDTA 3T0EA 5JPMC 4PRPD 5MEND 4Q6IB 3HHSA 2QSTA 5AW5B 1BOYA 1FORH 2CALA 3PDGA 5DZJA 5IVOA 4KO9A 1IGJA 2W0PA 3DK0A 4ICWA 5IHZB 3LH9A 2X4PA 3WE6A 5LDUA 3B8YA 2DQTH 1G7PB 1H3XA 2EXSA 3EHBB 1EZLA 2OMZB 3GDCA 3I02A 4XHQA 5M7QA 4YFEA 3TF4A 3LVTA 4E9QA 5J9PB 4I48A 4JM2C 3E1ZA 1KCSH 3CK0H 5FW7A 3LD8C 4EBQH 5GQBA 4BUQA 5FV2A 4OJYA 4G8EB 3CC5B 3KS0J 3D50A 2KI6A 5F7WC 2FSEB 2OI9C 4OIAA 5GGTH 3WCYA 4F91B 5EZOH 1CYGA 2BXZA 4IRZA 4DGWC 4C4KO 4RRPG 4ZDHB 3WMPA 2ZUQB 4NO3A 2ITEA 4PJDB 1GAFL 2BOCB 3VXMA 4FNPA 3X2QB 2AJVH 4H1LH 4P9ML 1TQWA 3S3PA 2VL4A 2KYIA 5MEQA 3CFJA 5GGUB 2O5XL 1LM8V 4AL8C 3T08A 3N5AA 2YPLE 5IMOA 3WN5A 2YPLB 1HZLA 5D6DA 5JO5B 4UT9L 4U2YA 4Z0BH 4RFOL 2Z31D 1EANA 2DQGH 4YL9A 2EDDA 2IAMC 5CINH 3DYPA 1F58H 2J72A 1KBKA 3VD3A 2B8OT 5JYLA 3K71A 4MX7B 2PXYD 5I5JA 2ZX5A 2JXMB 1E28A 3OXRB 4CC1A 4I4WA 1U8KB 5ILTL 3MLRH 5C2BH 3QNYB 2FR4A 2FX9H 3TV3L 2HFGL 2EH7H 5CP7B 5KWYC 4X6FB 4JO2L 2BWIA 3K1KC 5DFWH 4UNVA 1E40A 1PKQA 3U36A 4JN2A 4U7KA 2Q6WB 3L1GA 2LFGA 5DJXB 2DH2A 4LRNL 1KJ2B 2R4SH 1WCQA 2DWSA 1EGJA 1GSMA 2BOLA 2IC2A 5DMGD 4CNIB 4EUPA 4YE4L 1SQMA 2LVCA 4IGBA 2P8MA 1D5RA 1Z9LA 1WEJH 4M9PA 4L3CB 4XPAL 3LYRA 3WFBH 3K2MC 2RQ8A 1YNTF 4LSVH 4WSKA 4WWPA 3KDMB 3AU1A 3CDYA 1UM5H 4ZUTA 1VJSA 4ALAH 3CU1A 1ID2A 2AV1A 2DW5A 2IQ9L 3C5ZB 5E2WL 4ICXA 2H26B 2RALA 1A6WH 1MFVA 4HXBH 1BVZA 2H6PA 1A0QH 2IADA 5F6IC 4ADIA 4MA8H 1DJXA 2XWCA 5BUAA 2EYTB 4EO5A 3PGFH 2WYTA 2R4RH 5D7IF 4ZTOL 3TBBA 1D7BA 2IH3B 1XTMA 1ADQA 4N1HB 3O3DB 2VZOA 1AXIB 4X4YA 4OZIB 4N2KA 1QSFB 3FSOA 2E75C 2ED7A 4P5MA 1NKGA 4UM9D 5JNYB 4YFLF 1C08A 4LDCA 2C9VA 3VU2A 2I60L 3VXUE 1F97A 3L17A 1IBHA 2DD8L 5MP6L 4MAYA 3CFNA 5TD4A 3FQRB 3LZFL 5H37H 5B3SB 4TLSA 5IG7B 1LO4L 1EHKB 4MS8C 2XJKA 4KGLA 3TVMA 2XV3A 1JGDB 3TBYB 2EQDA 3FN9A 4N5EC 3BP6A 5E08H 3BN9C 3C12A 1C5DB 1YEDB 4XVTL 5G4OA 5ABDE 3NJLA 3K8LA 4P57A 4XMLH 4AJWA 3EO9L 5C7XL 4HH8A 1T04B 4M7LH 4XMPL 2ZXGA 3KEDA 1OLLA 3AABA 3KLDA 4WQOA 4AGMA 1KEGH 5BVPH 1KYUA 2C8NA 2WLYA 4ZFOA 3REWA 4J3TA 2NTFA 2UZPA 1ASQA 4OFKA 3HPJB 3MGOA 3MLWH 3TWCL 3L7EB 5IBLD 3S8WA 4PMEA 1U93B 1V8HA 5IHUH 3AY2A 4K73A 1G1OA 1IKNC 2KPNA 3OQRA 5AOKA 1QAWA 4HLJA 1JVLA 3X3GL 4R84A 3HC2A 5T3XE 3JWNC 4AY0A 2VQ1A 1WBYA 5AVWB 2XVBA 4YDZA 3BVVA 3NUKA 2X4RB 4E5XA 4IK6A 4MCMA 3QRFM 1SFHA 4TQPA 3ZU8A 4UTAL 3DVIA 1E43A 1JPTL 3VMPA 1GPOL 1MEXL 4RA0C 5FUCC 4FJ6A 2GK0A 5C09D 4D7PA 4GBXA 4Y2OA 1CDGA 1IEAB 2IPTL 4G6JL 5AL0A 4IBQA 4HVBA 5DSCB 1AMXA 3D9AH 3KLQA 4LBEB 3AM8A 5L8LB 2NQCA 2DKMA 1SHWA 2YD4A 5IESL 1KV3A 4JDVA 4XNMB 2XTSA 1DVTA 3E38A 4N5UA 2SEBA 3HE6A 4Q7DA 1FIEA 2M26A 4BK5A 3E1F1 5AVSB 4H8WL 4DP7X 4PS8A 5CBAA 2YXWA 4KO7A 1Z3GL 3VFVB 4P5TB 2B9BA 2EIZB 2OR9L 1IU1A 2O5YH 2AXFA 2DQUL 3IJYB 3SPVB 4UIKL 3PDOB 3ARQA 3MBEA 3U4EB 5I17A 4I2XA 2FECL 1CLYH 3ESUF 5EBWB 2A3TA 2OMVA 5TE4H 3T0EC 4OLZL 3QUZB 5H2BA 2VSMB 3GSXA 1Q0YL 4WTXA 3GI9L 2VDOH 3TO2B 4NNYA 5KUMA 3O41B 3NZUA 4GMTL 1T2JA 3GRWA 3NPZB 3BVXA 1RUPL 3VGHA 4LL4A 2FSDA 4XN2A 3VXQB 5K1NA 3WNLA 2CDFA 1NFKA 1G5GA 1YLBB 1A7OH 3TO4B 1C8QA 2MFNA 4HBQA 1G7IB 1W0YT 3QZWG 3SKJL 2D2CC 2DYRB 2RA1A 2B59A 4U6HB 4JFSA 4B95C 1JSYA 1T1ZB 2BK8A 3SDDA 2EDKA 4YUEH 1WHOA 3UTTA 4UB0L 3DV4A 4LL1A 2BP0B 1WAEA 3RYMA 2VLKA 3MACH 4QRSA 4X80L 1S7SA 5E70A 4RWYL 5IOPB 3DHUA 3GT6A 5JQ6H 4QKXB 3G6JB 1MCDA 3RY5A 3B5GA 2YJLA 4QRPD 3GLZA 4KQ4H 1KIPB 5DF0A 1J1XL 2IG2L 3ABKB 3SZ6A 4PLOB 1BF8A 3WN5C 1QZNA 1AZVA 2W60B 2YD8A 3DC0A 4LGRB 2QMKA 5D6DC 2IFFH 1YNLH 3ZL1A 4Z0XA 4G1MA 4X9BA 1FVEA 5D5MB 4MDJA 4M7JL 2X4SA 1EX0A 2FIKA 2YGOA 1BXAA 1FNHA 5CSZA 5IROD 4PREA 2OR7A 4ZTPH 5I73C 5FECA 3LHPH 4KO5A 3V5KB 2YWZA 2E27L 4LIQL 4NKOA 2BCKB 1FBIL 1U8NA 5DRWB 1JWSB 1H6TA 4NWTH 5C08A 5HJ3B 2N7SA 1AI1H 2X6MA 2XA8L 5A2CA 4PRDA 1H6EA 2F15A 2CBPA 3KCWA 1HJCA 1GH7A 4F92B 2OBGA 4TVPD 4FFZL 4A1RA 4GXVL 3QCTH 1X9QA 3OGOE 4GAYA 3QORB 2YUXA 1TQUA 1SHSA 2YLHA 4Y4FA 1EVTC 2F7OA 2CHNA 3OLGA 4LHUD 4LLYB 5BOPA 2OKMA 4IGBC 4LSQL 3RX9A 1T1YB 2NY0C 2KBGA 4DEWA 2BFVH 3TH4T 3PIQB 1QFUH 2Z6FA 4X50A 5TE7H 1M57B 1FNLA 2CIIA 4JREC 4WHDA 4UZSA 5HDLA 4QTFA 1WITA 4FFYH 4LOVA 2C7UA 3MXWL 1TOXA 1CFSA 3CFTA 4KKAC 3H53A 3FXIC 4MJ2A 3VJ6B 1F42A 5TDNA 2O5NA 5HVGB 3TTSA 5HHNA 3HCVA 3TP4A 2D7NA 3M1BB 3QR0A 4I77H 2CBTA 3CVDA 3R18A 1WFJA 4PJAE 2VYRE 1OCZB 2BPBA 3AWGA 3L9RB 4YLCA 4H25B 1LWRA 1DQML 1SDDB 3GINA 1GVIA 2G5UA 4R97C 4D0BA 3UYPB 5T5FA 5FK9B 4ODXA 3ZZLA 4DPRA 4KNQA 4OGYH 1U2YA 1WPCA 3HMWL 5CGYC 3C6LB 3H6JA 4JRYB 5DO2C 1PYWA 1UD6A 5EC1A 4NUGH 5J13C 4OZHF 1CICA 4P48A 4MAYC 4OCLC 4B53A 4BA8A 3HUJA 2E6QA 1FDLH 2VC2H 3HE7D 4RMRA 4KUCF 2ALWA 4YHOL 1P5UB 1UXSB 2JK5A 3RWDB 3UEQA 1HX0A 5J11B 3UAFA 3TVMC 1Q94A 4HIIB 3FUNA 4XCYB 4XO4A 5F9WC 5EIIG 2OL3H 3IPFA 1MHHB 2WYZA 3QRLA 4DGYL 2HFGH 5DK2B 2VO8A 1CE6B 3O2DA 4H8HA 2DI9A 5D72L 2MQCA 1AKJD 5LCVH 1CD0A 3UMNA 1H8LA 1JTPA 5TGBA 5C0FA 3NH7L 1M7DA 2CE6A 3K1DA 2WLHA 4OCYH 4EE2A 3PJLA 2XDHA 2P5EE 2FTAA 3G5ZA 3BKCL 1MHCA 1R5IA 3E6HB 1AXTL 1Q9WB 3EADA 5CJQH 3RL1A 1U8PB 2WVUA 2XBDA 4XPAH 1NICA 3IT8D 3K2UH 4Z7NB 2JJVA 5EF2A 1AAJA 3TN0B 1M6UA 1YDPB 2LU3A 3INUL 1FFRA 4OGAD 1AR1B 4V1DD 4BV1A 5D1XE 4TNWF 2IQAB 4XVJL 5D1XB 3GMLB 1SXAA 2VDRL 1OCRB 4X99A 3W39B 2F19L 1BZOA 5IFHL 2BP8B 4HHAB 4MMXA 3FB6B 1TITA 3MV9D 4FQLL 1QI4A 4LXFA 3QFJA 5C1MB 1INEH 1ES0B 2PKDA 3GUFA 3NRQA 4GBXC 4P2CG 4ZX4A 1SY6H 3NIGF 4HSCX 5BV7H 1NMAH 2OSLA 3AM8C 5HDWA 1UKTA 2D7TH 1O5PA 3BAXA 1NDMB 2XTJE 3FQTB 3WEAA 4F57L 2XTJB 2PR4L 5GZOA 3HC0B 3HE6C 4JG9A 4LCWE 3S3JA 4LCWB 5DZLA 2K1MA 4M8VA 4ZS6C 4BK5C 3FO9A 1MCSA 4QJ5B 4JFHE 4M62L 1F90H 2ZCKL 2X4UA 3BD3A 3PQYE 1CIDA 4N3TA 2ZXWB 3PQYB 4GXUM 3ZN6A 5EIVA 1JFHA 2J8OA 3CTTA 1B88A 2WPGA 1NCCL 4U0QB 4U1IB 5EO1A 2YN3A 3MBEC 1W0WA 3WTUA 4LK4A 4K9EL 5HGGS 1HU8A 3OVUB 3E2HC 1EQWA 4JM2F 3HHRB 4KKCC 3VGFA 5KS9E 2OPCA 1Z9NA 5GGVL 5JPNA 1KCRH 3BKMH 5D1QE 5E9AA 1M71A 3U4AA 3D0VB 4YGVA 1NIFA 3GHEH 3BZEB 3IF1A 1CWVA 1ZJAA 2K8QA 1G9NH 1TMCB 4XH2B 3PE9A 3DJSA 3H56A 2F08A 5DRZB 4OCWL 1FL3A 5EZIH 4ZX6A 1JOIA 4HKXA 3BAKA 3V0JA 4ADJA 3QZLA 5AKRA 1QUPA 4FHJA 3GTVA 3SDDC 3WXVH 2AK1H 2DM7A 4NQCD 4JFDA 1LEKA 2XBZA 1BG1A 2K9UA 1NUNB 4LEXL 4BFEA 2A9NL 1XT5A 5E4OA 1KENH 2FB4L 5KOVC 8CGTA 4ZO6A 1F6AB 1XGPA 4WV1A 4B3EA 3SY6A 1KNOB 3DPDA 3H9SD 1YYLL 1KG0A 1AQKH 3G5WA 5F7UA 5EORH 1GPOH 4PI2A 1CGWA 1AXSB 1CVRA 2KQNA 4R26L 5AQ0A 5TTRA 4D8OA 2C4XA 5L4JA 4LE8A 3GKZA 3VGAB 1RIUH 3KW7A 3SE3A 3UPRB 1WZKA 3BIAX 3QP3A 3L45A 1YVLA 3PP4H 4RGMB 1BQUA 2R0WL 1QZ1A 3B3IA 4X7TB 1FZMA 4HZLA 2DDQL 5C0BD 1IAIM 2X2JA 3NA4A 2Y7MA 1PF3A 4FNQA 5HI3D 2XV2A 4M02A 2DQUH 1HYSD 4JL2A 1XGYH 3DIDA 2GBAA 1YA5A 2VITA 4PY8I 5F7DA 5IKCB 6TAAA 3O0RH 1MLCA 4XPTL 1DDHB 3KWWB 4TL4A 1K8IB 4G80B 2G5RA 5SWZD 4XNXL 4Z3IA 4PRHD 4G6KL 1C7TA 2NNAA 2DI7A 2J43A 1KIQB 1LQBC 3H7BB 3MV8B 4FQ2H 1N6QH 4XBMA 4Y4FC 5D2NA 3S35L 2OX5B 1VRSA 3FQ4A 1BM7A 1OF0A 3FQUA 4Y8AA 3SE8L 3FT2B 5TQ2L 2V4LA 4YHMH 1QTSA 4I5BA 3H4FA 3GFUA 3MLTA 1LO2L 2VTFA 4YC2C 1I4FB 2ZX7A 4X4KA 5DHVH 1B6DA 1AD9B 4NFCA 4AE1A 4MHHG 1NOAA 1YC8A 4A63A 3SBWC 4B97A 1HL4A 5IB3B 4X6EB 4I0KA 4FQHA 3PHQA 5E6ID 1FAKT 4J5VA 3ARBD 1N59B 4GRWE 4X6CE 5IJDC 1OHZA 1GMEA 3VXNB 2LLLA 3BH8A 3PLYA 3O6KL 4XBPB 2JV6A 4NAJA 3WIIH 5L0QB 4PUBL 5JHAA 2JB5L 3C60D 1MFCL 3KZ8A 4RGNB 2F7RA 3U4KA 4M6OL 1RAMA 3CN2A 1E4XH 1ZTXL 2EDBA 2N7BA 4MRCA 4GIPD 4P5SA 3V4PL 4WUUD 1ORSB 3DMMB 5FYKL 1CICC 1UB5B 2ZTBA 4KHXL 1PZ5A 1SOKA 2XWJA 3MTRA 2IAMD 4QO1B 5HI4D 1WAAA 3V0DA 2M2DA 3ZR5A 3FOLB 2ZPKL 1QBML 1CS6A 1UWXK 5AOZA 3EG9B 1ZA6B 1RZ7H 1MI5D 4P4KA 1FZOA 1QEWA 3PGDB 5L2JB 2Y2TA 4Z76B 3L3JB 4OD3H 4Z23A 5AW0B 1OB1A 4RISH 3FAXA 1IBGH 4ZW3A 1G5AA 2JKNA 2DQHL 4NSKB 3CFDB 4FG0A 3I9PA 1HWGB 4QRQA 2VLRA 4M1DL 3VD9A 1DBKL 2R2CA 5F3HB 3GS7A 1PDKB 3DSFH 5DLLA 4K5PA 3KH4A 2Q0ZX 1IGTA 3FT9A 3RWFA 3P9MB 3M17A 4Y5VA 5M94B 1QABA 4FTVD 4HJJL 4HKJB 4XP4H 1H15A 25C8L 2F54A 3EZ8A 3GO1L 4R9HA 1KCUL 1MCBA 3EGDA 4R5VA 5L9DL 4MMXC 4FLRA 3TIDB 1A5FL 3RDTB 3L7FA 3BIKB 1ZOXA 5T1LA 5F8QC 2H6UA 3BPCA 4JRWA 4A7GF 5H4YA 4F3FA 1Q9OB 5D7EA 5DD6A 3WFDL 3ZLQC 1E8YA 1V05A 4F58H 1JRHL 1SM3H 2VERN 1OGAA 4NRYB 4WK4B 5CLWA 3IETA 5INCB 2D0HA 1P4BH 5GZOC 3GUTA 1G94A 1IAOB 2PCYA 2AKRA 5EEYA 3FTXA 2VQTA 2ILLA 4AENB 2PWDA 5ICZB 1A1MB 1HE7A 1M05B 5G4MA 5IQOA 3I6LD 5J3HC 3TBSB 1A3RH 3NIDE 2WN3A 4UAOB 5JW4R 1XGTB 2W95A 4FG6C 3CSBA 3VI3B 5KYYA 2Y7LA 3FFCB 5C3LD 5CD5D 4GUQA 1ID5I 1XO8A 4JRXB 3VXQA 1MN4A 3U48A 5GS0C 3L2LA 3U9WA 4YLBA 1RIHL 4NUPA 4NI3A 1WFNA 1HVXA 3LVEA 5I74C 8PAZA 5JPNC 2WTRB 1N6VA 4N5ED 1SVBA 1TCRA 1HCVA 4OZ4A 3BN9D 5CJOL 1TNMA 3G5XB 4Y19D 3GTNA 4XCCH 3HRZB 3KWUA 1MCQA 2XWBA 1IAMA 4UM8A 2W65A 2O1AA 1BBJB 2VDNL 3MKKA 3TESA 4KROC 1T3FB 1ULVA 2DL2A 3FJTA 5DS8A 3MRRB 3VXSD 5F3BA 4JN1H 1P4LA 2BS9A 1ZGLM 2OYLA 3RL2B 1IGFH 1I7UB 3C08L 3K3QA 1OAZL 2WXQA 4HS8L 4Y9GA 2AJSL 2J73A 3AB0C 1MAKA 4M4PA 4Z7OF 4WV1C 1KBBA 2QKSA 4CRPA 1RZJC 3PXHA 4JMXA 3L5XH 5I0WA 5I18H 4AGLA 3TCLA 4GUCA 1CT8B 4Y16B 1A1OA 4TNVK 1NAML 1LDPL 3W5NA 3KPOA 2CIKA 4L29A 3DBXB 3CUPA 4X98A 1EEYA 3UAJD 1I7TA 5FHAH 5I1KL 3SE3C 4Z7WB 2A77H 1R24A 1Z3RA 3RFRA 1HKFA 3NCEB 1O7SA 5EOTB 4YSAA 4FABH 3S5LB 4WHYG 4YXKH 4ANKA 2D03L 4WNQB 3ZKNC 2XN9D 2JNZA 1CTOA 4KVPA 2GSIA 5I0VA 3EGXB 4XXCA 1ZVYA 2Z7WA 2FO4A 3W3BA 2DS4A 2WXRA 1JHTB 3OMAB 2WXHA 4Q6KA 4X7FC 3T2PA 5TDOB 2BNUA 2FBOJ 4TQ8A 3BGAA 1Z9SA 4R6UA 4U6TA 1T0OA 4PWIA 1T4WA 2FECI 5F0LB 3LEVH 3D12B 4JCMA 5LBSL 2IGTA 3E8UH 1II4E 4AM0B 2BSED 2COQA 5H94A 4S2SA 2JFCA 4BCXA 4F33A 3JWDH 2VDQH 3D0LA 1IC1A 5D2NC 4OT1L 4UT6A 4AT6A 3II1A 5I19L 3T1FA 2H3NB 2ICCA 3GB7A 3P0VH 2ATAA 1R17A 2R29A 1UCBL 1DN0B 3UPAA 3IK2A 3KCPB 4F24A 4YMPA 3BD5A 5E8EA 1OK0A 2VXSH 2G2NA 1KB5L 4B0MM 4QRBA 4FKEA 2VLJE 1Z9OA 1FAIH 4NQVA 4ODSH 4N1CA 2UXTA 1F3JA 4ETQA 3DDGA 3KPLB 1ML0A 1MLBB 4MHHI 5EBLA 3AXIA 3VXMD 4PTUA 3ELAT 3IMVA 2A2QT 1GZPA 2DJUA 4WTQA 4L8CA 4XC1H 4APXB 4X9GA 5FM5O 3IS1X 4OJFH 3BZFB 2JQMA 4LBAA 1BFTA 1UJ3B 3ASNB 2VWEC 2Y5TB 1OE3A 5J06A 5HY9A 5I0XA 1KBVA 2AEPH 4Y1TA 4E9VA 3QZWB 3X17A 3AG1B 3R1GL 6PCYA 2I07A 1F2XK 2VDKB 5F7HA 6CGTA 5E7FA 5C0DA 4JKMA 5EFIB 3DA0A 1G9ML 1K5NA 4P4KC 2I32A 1ED3A 3C9NB 4HJSA 1A6UH 5IUSA 1U92B 1BZEA 35C8L 1WYJA 2R1YB 4YDJB 3WTVA 2EEAA 2X41A 3MRJA 1ZIBA 2Y25A 2MOVA 3L4XA 4JGJA 1ETZA 1OE1A 3UTSE 4L4VA 3MBXH 3CDZA 3DGCR 3LS4H 4JDTL 4XMZA 4E68A 4L9LB 1DBBL 5IIEB 4N26A 1S8DA 2IMMA 1RLBA 4P9HC 1FIGL 3G08A 2D3JA 3RRQA 4BQCA 2B5IB 1EAPB 4I7ZC 2VDMH 2IALA 4ZUVA 4HLZG 1DO5A 3OKKB 4CSSA 1ND0B 2WCPA 5BUPA 4H0IA 4ZO9A 5IBUG 3PWPE 3ULUD 4Y5VC 4RAVA 1XIWA 3PWPB 4Y4HD 4L0YA 3BKYH 4O2FB 4HUWA 4QUOA 3SKNA 3LS5L 4UAHA 1BLNA 3SYAA 1NGPL 1WK0A 5DEZA 1BPLB 2BP3A 1A4KB 4LPVA 4LOUD 1KCKA 2CKNA 2FEDC 4IBWA 2D7OA 2XICA 1ZK9A 3KYAA 3MCLL 4MA7L 5DJ2B 2UZXA 4YIQA 3BRFA 1CFQA 5E8OA 5FKAA 4M6OH 4PGCB 3VDBA 4MKTA 1QRNB 4HULB 4AQ1B 5BJTA 3O6FB 2H1PH 1LQSR 4CADA 2H41A 3BQVA 5E9DE 3ZXAC 4DN4H 2BWDA 1AD0A 1O6SA 4EDWL 2WTOA 1KXQA 5E5LA 1UTDA 1JPFA 3DJ9A 4G9FE 1TPXC 5CFHA 1YN6B 2XPGA 4G9FB 4NCDA 4U2ZA 3JV4B 3HAEA 2FYVA 4R2GB 3PGCB 5IW6B 3N40P 2DIEA 4O02H 2ZKXA 5EZJA 1KPRA 1BFVL 2XWXA 3OV6A 5GGRB 4P3CH 3UYOD 4F7PB 4DP4X 2QLYA 3L5WB 3EFFA 4KKQA 3UOAB 3X14B 2L7QA 5E2VL 3GJFA 3HG0A 4N8UA 3U9PH 3U6RA 1QTYT 1R3HA 4U6YB 1OALA 1XCQA 3QQ9C 4L37B 5EZLB 3U2SB 3E3QC 4MNHB 2AABL 4OM0H 4PSPA 1GJUA 4W9JC 1YNKL 3A6CH 1MNNA 3HIZA 3LXAA 3MNWB 4DOHE 3S8GB 1YG9A 4PJCA 4DOHB 5AVZB 4DO6A 1UH4A 4LLDB 1U42A 4C56D 5INDB 4PJBA 3UC0L 3OKDA 2GJRA 2LV4A 1MOEA 2WXNA 4Q2ZA 4QOKA 2YGQA 4PP2B 3U0PB 4WCYL 4UIMA 2P8LB 3FUDA 2AERT 3ES6B 3AQXA 4RAUB 1AGBA 1TEYA 3DRQA 3P02A 5EIIB 2AAAA 1R3JB 4IEFA 1UYWH 5DS2A 2IOMA 1CIUA 3BUDA 4WI0B 1M9SA 2NSXA 3BQUA 4QWWC 4Q6IA 5ADOH 4ZPTB 1L6PA 1PAZA 4XPFL 3DOHA 4E2OA 4WNJA 4GBXD 1JF6A 2X1PA 3KVDD 1F0LA 4U6VL 3IDJA 1MXDA 3F65A 3SDAA 5LG6A 2PWEA 3N1PC 4ISVA 1CDHA 2OZNA 2X4NB 4NZUL 1CGVA 4W9DC 1XH3B 1Q72L 4YWGH 1C16A 5KAQG 3K72B 4RH4A 1DBAL 3DETC 4PY8J 3LX9A 5IQNA 4DUXA 4NQSA 3CN1A 5TJWK 5IFAL 4XXCC 3DOSB 3WJMB 3KLSA 3RGVB 5HSFA 1BQHA 1ZE3H 1ZLDA 4ZZKA 3ZZSA 1JL8A 1QI3A 4AEEA 2WB7A 4LHJB 4UU9B 2CG9X 1NCUA 5TQ0H 2QEJA 2FSEA 3MBED 5IK3B 4JHUA 2PCPB 1JG9A 2IDUA 4OJDH 2UZIH 4UT7L 4KKCD 5K9JL 4KX8A 3VFOB 5GXBB 4PWGA 3LCYA 1S5HB 2BFGA 3IU4H 1DDTA 3ZL4H 3LDBB 1TLKA 3CFUA 4N0UE 3QDJB 2DJMA 3QARA 3TNMA 3RPIB 1N8OE 3Q1SL 1M7UA 2PW1B 4XMTA 1IBYA 1JV5B 3VXRB 3BYYA 2MPAH 4LSUL 5KUKA 2ID5A 1URZA 2CDGA 4APQD 2VDNH 2X70B 2CA4A 5DJYB 1C5CH 2YK1H 3LXBA 2DY2A 4XP6L 3O4LE 4Q56A 1A9VA 1EDHA 1FFPB 3C08H 5I8KL 5J12C 3NFSH 1CD1B 5HHPB 2WUCL 1U8KA 5FF6A 2C3HA 2P48B 4GSQA 2C7FA 3AFLA 3ILPA 2ZG1A 3RVVC 3X3FH 4FQQB 1B4TA 2BNRE 3ESMA 3HUJF 1FLRH 2VL5A 4NKIH 4PB9L 5B7EA 2ESVD 1KYOJ 4LSPL 4LVHB 4CVZB 2EVHA 3D3VB 3QDMD 1E5YA 4QRTB 1OAUH 4TN9A 2Q6WA 1HTYA 5CEZL 4RA3A 4CSTA 4JKWA 1TJHH 5DJXA 2W07A 4FMKA 5L2KA 5DURD 3EYSL 1S4IA 4X8GA 1CGTA 1U8IB 1Y0LA 2BIQA 3F04A 4NUQA 4YHKH 1GGBL 1MFEH 1ZKAA 5HD8D 3HI1A 4DK3A 1MDTA 4PJXE 1U8CB 2HAZA 4HFUH 5LGYA 1E5ZA 4L3CA 2HX8A 4Q9CA 5FOBA 3KDMA 4N6RA 4GW5B 1BQLL 5E1IA 1K72A 4WLCA 3ZDXE 3WNNA 4E9LA 4WJKB 3ZDXB 4MD0B 3W9EA 3GIVA 2BSCA 5T3ZL 2XWDA 5C0AA 3DXAB 2R1WB 4UV4H 3N2JA 4KVCH 1GIGL 4GKOA 4JM4L 1HDMA 4U33A 1IQWL 2BX5A 3IE4A 3OAUH 1WGVA 4F1ZA 3QIBD 3NTCL 4OF7A 2IH3A 2DBLH 1SNRA 4G7YH 3EH4B 3Q6GH 5HYIA 2AQSA 4PLJC 2R2HB 4Y4FD 2OFQA 1BXXA 3ZVVA 1QSFA 4YSOA 1EERB 4NKQB 1C5BH 3IU3B 4LPXA 3ZKXC 2GCYB 2OXHB 1U8OA 1XFPA 1N3NB 4UNUA 1D9KA 1EMTL 2W8CA 3BUYB 1CGYA 5DJ8A 2IVFC 3VD0A 1JNNL 1G7MB 1TZHA 4H8QA 2V3EA 2CNYA 5HJBA 3NCFB 4JGUA 2OAAA 2MHAB 4KKZA 5IB4A 1JGDA 5GHWH 3EYQD 2OXGA 5ALBL 4Z77B 2B14A 3ECBA 3FQ1A 3O3AA 2HJFB 2BM3A 1J1OH 5GGQH 1OO2A 3PHOB 1VZGA 3FCGA 4J3VA 3MJ9A 2CCWA 5I6NA 2D3LA 3C6SA 1QKZL 3DSNA 4I9WE 1IARB 4OGZA 3E9TA 1J88A 2A83A 3L7EA 3IJ7A 1V10A 3NCXA 3GHBL 3RTQD 4N86A 1MCNA 5EA0L 4FNRA 3LQZB 4KTEL 4F2MA 3SPJA 4JJ5B 5DHMC 1Y07A 2GIYA 3CN4A 3J2PA 2QSCH 1A4JB 5HGDA 3SE4A 2BDNL 3MV7E 2B7DT 4YE0A 4I0PD 5AKSA 3EH5B 3IRZA 4OW6A 2WC7A 1N6UA 1ECZA 1X5GA 4OKVB 3MQIA 4NQXA 3EUDA 5I66B 4AMWA 4XE0A 2WTPA 5KANG 1IEAA 3MZTA 4KRPC 4XAWH 3GKWH 1FFTB 3VYPA 4LBEA 2Z35A 2ITFA 5KZCD 5JW3L 4MJ4A 3H2WA 2I25N 1ZD6A 5ENWB 3SGEH 5HHOA 4I1RA 1PLGH 1E9PB 4A6YL 1NFIB 3IRCA 5EO0B 3FN0L 4KKRA 3W0WB 4DPBX 5FHBH 1WFUA 4PJFE 1OP3H 4YHYB 5JORB 1KULA 1WP6A 4PJFB 2Y6SC 5D1ZI 4NKDA 2EIZA 1G7JA 2YIHA 4HAGA 4ZS7L 5FB8B 3N40F 1QO3B 4DVBA 3U4EA 3IJHB 2R0ZH 3BWAB 1VESA 2KERA 2WXPA 3N6YA 1DVSA 3HMXH 4NQDB 4U1MB 3AQDA 1K8DA 4Y2DA 1EIBA 1NMBH 3BQUC 3CFBA 3WS3A 1OV8A 2C9UA 1M2VA 4K71B 3FUMA 1IGCL 4Q6IC 3QFJD 4TVPH 1L7TH 4HOWA 1WUNT 3SQOL 3TO2A 4BFBD 1IBZA 3IKKA 1QLRA 4NNPH 2BVOB 1HL5A 4XNZB 1CLOL 3SDAC 3CZFB 3L95B 1JRHI 3WL9B 4BE5A 2EDTA 4DERA 3D39E 1NCDH 1OAJA 4JRLA 1Q0XL 5IW1B 4BFIB 1VFUA 2NNFA 3L3IB 3V9EA 3WO4B 4IOIB 3MGAA 1PG7L 3SDXB 2PWFA 1TLMA 1WVZA 5JHDE 1NQBA 2R51A 2BMKB 3LZRA 4OVUA 5JHDB 5BRZA 3HNTH 2CRIA 3GC3A 2BP0A 2DTSA 3IDMA 3MRCB 3KJ4B 3WFZA 4PJ7E 1UHVA 4HH9B 1NLDL 4A7SA 4AYBA 3VW3L 4YGAB 5IJVB 32C2A 2E7BA 5C97A 2BSTA 5AL8A 2AQTA 2IANB 1EFXD 2X3BA 4JPQA 4K94H 4FFTA 4K2UL 1KIPA 1QYGH 5IB1B 1A6ZB 2D4DA 4H5SB 2CO6A 4X6DE 1YRKA 4X6DB 3MUUA 4OM1H 1Q1JL 3LQAC 4BKSC 1FZKB 4KKLD 4G8GD 5HP5A 4KXBA 2CK0H 1CQYA 1FG2B 4ZNEA 5KYXB 1RUAH 4C58B 5JIIA 2OMXB 3SD5A 3DJTA 5E0QA 5LXGL 4FQCH 5FUOH 4IK7A 1FJ1B 2NXZD 4JFDD 1A6TA 1E2VA 1KCVL 1KPVA 3LPPA 3T6WA 5TK2A 1IC5L 2DLFL 3RY6A 3KPQA 3T4YB 2R8SL 4NAMA 1JWSA 1SFDA 1WAAF 3VQ2C 3MRLA 1L9TA 5HJ3A 4IRSD 2DQFA 4ABQA 2AEQH 3I50L 5KG9A 2CPCA 4XZUB 3N43F 5CF3A 3OJ2C 1G7HB 4TM9A 2XN0A 5IV2B 1LJMA 5KBPA 5ITBL 1WWBX 3NGBB 4LLYA 4ERSL 2IPUK 2P5WB 3AJ7A 3BD4A 2V3FA 1NGQH 4JQIA 3B9AA 1T1YA 3AT0A 4JFEE 2Z7UA 5KSUB 4FMVA 1UZ8B 4WKZB 1ASOA 1RZIB 4ZMVA 1BAGA 2HTKD 4G72B 4U1LA 5T1KD 5HYEA 1A9EB 5DMIH 2HRGA 4NC1E 4R4ND 5E1HB 2EC8A 3M1BA 1T21B 2A74B 3PDDA 4UT7H 5DGQA 5D4QA 3SD2A 3V79C 5CZXD 4KXZH 1NKOA 2FLMA 4UUJB 1VADA 3GPSA 4QF1B 1CPUA 1HXYB 4L0PB 1MFDH 3L9RA 3A21A 2HVJB 3O3BB 1ZA3B 2GITA 5D70L 1SDDA 4A2MA 4PD4J 2EC9T 1A9BA 1I9JH 2BLFA 4ZK8A 4KK8C 5FO8B 4ONGL 2B0SL 1D9KC 1Q8MA 4JRYA 3TEXA 4NLAA 2FBJH 4MD5B 4NKMA 3DOIA 1EJOL 5JXAH 2ZYHA 1CDCA 3OKNB 1UXSA 5AEAA 4I9XA 4QXTB 3RWDA 3ZT7A 1HHGB 2MNUA 3O2VL 2X2IA 2WYHA 3HS9A 3MCKB 5HGHA 5JLZB 5ID0A 5E6SB 5SX5K 4J3WA 4NDMB 5DK2A 3W11C 4DO4A 1CE6A 4K8RC 2Y07L 3TM6A 2DWEA 3UJJH 4TLUA 4RMUA 4ZSOE 3V4UL 3QCVL 1SBSL 1YN7B 4ZSOB 4N2DA 4F7CA 3AXHA 3QI9C 1URLA 4NRXA 2CHDA 2VDPH 1DUZB 5HHXH 3O8XB 3T6VA 3MJ8A 1DQTA 4PI0A 4K3JH 3BXNB 2WZAA 4TVSa 1PY9A 1S7VA 3GSQB 5F1NB 3SE4C 1EZVY 4J8RA 1QSEE 2G9HB 3P0YL 1SXBA 4LPWA 2C3GA 5HYJE 3ZX1A 5B39G 3R7QA 2RGSA 5EU6E 1OE2A 1F18A 5F97E 5T33H 5J5EA 4IU2B 5L4MA 3RWJA 2JELL 4HIHA 2QPEB 2AP2A 5D55A 3WEBA 1MH5A 1LEIB 3IWUA 2XA3A 2EJ1A 1J8SA 2CGRH 5GSVB 2BO0A 3FK3A 3RZCB 3EXJA 4G3YH 2VLRD 3HC0A 2AJ3B 4R4FH 4WI5A 1A7PL 1FE8H 1KLFA 1SN0A 4YBHA 2N0KA 5KANI 5E2JA 1I85A 3TZVB 4DAGL 4F8LA 1HHKB 4DP0X 4ELDA 3CQFA 3Q3GA 1THAA 5E94A 3KHQA 2NZ9C 1XR9B 3D2UA 1MWOA 1I1AB 1QWHA 4K3EL 4G1EB 2W0KA 4CDHA 4G5ZH 4Y2DC 4EMZA 4J6RH 3CXFA 4Z7UB 4HHWA 3C8HA 3HG1A 5CKAA 4EZLA 4P8QA 1AIFA 2VDMB 1EGJL 3GNML 5CUSL 5I71C 4P59L 3ROLA 5L7XL 4QYOB 2J44A 5AG8A 3CPLB 1SYVA 4FE9A 3VWKB 4BIKA 3VNZA 4FYRA 4NQEE 3W56A 4LQ1A 3WSQH 5CJXA 5IBUB 2EDMA 5MENE 1GYAA 1X5MA 2OZ4H 2X2UA 2PYEE 3V0HA 3RUGB 4B6ZA 5FYJD 2PYEB 2X44D 4HCRA 1UXWA 2KUTA 3ZGHA 4AYSA 4PV8B 1UJTA 2KT6A 4NQQA 1KNOA 1Z1WA 3EBGA 3W1ZA 1G7LB 2OJEA 1T6VN 2NZIA 3QEQA 4UOJA 4YHLH 4FFVD 1ADQL 3V4PB 4AL8H 2BW4A 1KJ3H 2AFNA 2DKUA 2XWZA 1FA4A 5I30H 4DF9A 4A39A 4F37K 3Q7JA 5IR1B 2VCOA 2NY1D 1OLZA 2LU5A 2D7PA 4MJJA 3OJMB 3LPWA 5HDRA 5I1GL 2DOCA 2TAAA 4X7TA 1ZEAH 1X7QA 3S3DB 4B5EA 4DSYA 1BYNA 4A37A 4ZYKB 1LK2A 2CLRB 4MCYB 4KAQH 5LWYL 1NTDA 3VWJB 3PP3K 4OGXL 5B3JF 2XI9A 3U0WH 4DZ8B 4X7EC 1KT2B 1MW0A 2R0LL 3RY6C 2N56A 1DL7L 4FXTA 4EVNA 1QLFA 4ODUA 3N0PB 3PWUA 2DWYA 1CLZL 2I7SA 4N8VG 3LV3A 1K3ZA 1K8IA 3ULVD 1QNZL 2XC8A 5BRPA 4IBLT 2WBXA 3MV8A 5GJTH 1KIQA 3H7BA 4M8RA 3GSUB 3V6ZA 1NJ9B 2H45A 3CN3A 1TVHA 1IC7H 4AITA 5D1ZB 4AGOA 2PYFA 2HLEB 4LLMB 4FKHA 1PFOA 1XGZA 3VFWB 1RH8A 3HR5B 4KGJA 3VDAA 1ROCA 1S9YB 2BC4B 2XRAL 1AGFB 3T0VA 4PP1D 2V5RA 5FKPB 4BUHA 1CYXA 2X42A 4L4TE 3FU8A 1IILE 4L4TB 3K5RA 5ICYB 2WZ5A 3QPXL 1E0OB 1WAPA 4L1DA 1JGEA 4DKTA 1T5WA 1LE5B 3TT3L 2YAFA 3EJCA 1VGKB 3PXJA 1URIA 4Z8FL 3F7QA 3T2QA 5JHLA 2BVPA 1XGRA 2HRPL 5GGSA 4Y2NA 2FD6H 4XN8A 5CSBA 4AW4A 1MFUA 1I1CA 4FFWC 2VMJA 1EHLH 4W9IC 4XBPA 1WBXB 4MXQD 4CW1B 2DWTA 4HU2A 2XZQL 2J2ZB 1KYDA 1MAML 4MNGE 5DJZA 1G1CA 4EF3A 3Q8FA 3OKMB 4OF6A 1AOHA 4QO1A 4O4YL 3S88H 2WKLA 3FOLA 3UTOA 3VQMA 4GSXA 1OF2A 4R8WL 4QHPA 4WEBL 5IFJA 4PBDA 1H3PH 5AWNL 1OGTB 3G6DH 2WO4A 4UM9B 5F9OL 1A02N 3PGDA 2XNAB 4X8CA 4RRPA 1EXGA 1CI3M 5I8CB 1R19A 1OD9A 1X9LA 3SCMD 5CZVL 1TTFA 2RBLA 3NSFA 4E41B 2VDNB 4MVBD 2O6PA 1GMIA 1N5AB 3FW6A 3QAZC 5FC9A 4UDUB 3NT0A 4RMTA 5KOMC 5AD0A 3ZL2A 4TULL 4N68A 5IY5B 4BBWA 2ARJA 5I1DB 3QNFA 1W8NA 1TEGA 1PDKA 5E5UB 5MEPB 4OB5H 5J57B 3WLBB 2WWKT 3TEWA 1XXFC 2IDQA 4A2LA 2A6JB 1SLUA 3CWGA 2VM3A 4HGWA 3VH8B 2HWZH 5TF1L 4J3OC 3HRPA 2PP9A 3JWNH 5K33A 2J4WH 4PJCF 3NAAH 4HYTB 1JNHA 3B9KB 1HQ4B 2OJZL 4OLYH 4R7XA 1IL1B 2DM3A 1S7XA 1YEKL 1IC4H 5SWSA 3RDTA 5HI5C 2YPVL 3C2AH 3X1NA 3M6DA 4PS4H 2ZOOA 1OARH 4LEEA 1Q9OA 1DTUA 3MRNB 2A73B 4W68A 4QJ3B 5JIDA 3EDFA 3KYMB 2NW3B 3U9UA 3KXFE 3Q48A 5CXPA 4AZ8A 1O0VA 5INCA 3KXFB 5DRNA 1XF5A 2YSTA 5I5RA 4M5YL 5LHDA 1DJWA 1BFOB 4PJHA 1XEUA 4AENA 1BEYL 2UWEB 5CSGA 5EF3A 1I85C 1E8ZA 5A2FA 3WIFB 1Z9MA 2W5PA 3TBSA 5ISZB 3BYTA 1FL5B 1XGTA 3QCUL 3UZQB 4OCSH 2OCFD 3GMRA 3VI3A 1DANT 2A1WL 3BJ91 4JEGB 3U7AA 1XIWD 4KO6A 5C09E 4TQEL 4KJWD 4V2BA 3EJYD 1TYEB 3BAIA 2LGNA 4JRXA 2ZXAA 4MLSA 4JPWH 4A68A 4F7EB 3QBTB 5I1LA 1N67A 3B4NA 4GQ9L 4N8PA 3MO1B 2VJXA 1ZIAA 3IJ9A 4BRJA 1U3YA 4Q9RL 5KTEL 1H3UA 1S7RA 1T7ZA 1WC7B 4BGDA 1SDAB 1AYRA 2H0PA 4H8PA 4P2OD 3OKYA 3WNIA 1NAKH 2KPWA 3F58H 2HFFA 4ZFZA 1U4FA 1TDQA 2CGYA 5D7IE 4NN5B 4PJDF 5DEFB 2XT1B 4WAFA 1RXLA 4D0CA 1BBJA 1R5WA 4ODTH 4M7ZB 2WYIA 4HQQL 4PJ8D 3MRRA 5CJXC 1XAKA 5IEKB 2CMRH 4G7SB 5DU7A 5D7JD 1VCBC 1J8HB 2WXFA 2EVGA 1S7WA 2O61B 5J6GB 4IRZH 2PCXA 4JJHA 2R1XA 3KPSA 1J18A 3FSZA 4XI5D 5EEVA 3ARDD 1NEZB 2G2PA 4TV3A 2VN3A 1FFOA 5G4NA 1CT8A 2EVFA 1KFAH 3G04A 4Y16A 2CUMA 2YQGA 5I6OA 5ANME 1ANUA 1UOWA 3L81A 4WFED 5ANMB 5T5FL 3G3LA 4JO1L 3RU8H 7TAAA 3KLHD 4Z7WA 3QHZL 3D2TA 3KMDA 4EN3B 1PL3A 1JNLL 2NNCA 3QJHB 4RRPM 1IIIA 5EOTA 4RGMC 5EU5B 2HCZX 2CLZA 5M95B 2ADFH 2R2BA 1DQQA 4WNQA 2EEFA 3FBKA 1XR8B 2W9LA 4D3CH 1HINL 3PPEA 1OXYA 5E00B 4ZAKB 2PW2B 2YN5A 4XTRD 1JHTA 1BD2D 4NPYA 5TDOA 1SEBB 1UWGH 1JD7A 2QTEA 3O2DL 3VFUA 1G0YR 2P43B 2Q9OA 4M61A 4BH7B 5FYJU 3FZUC 4LNRB 2D8KA 2OM5A 3DVNB 2NXYD 1YEFL 2HT2D 1BDYA 2HKFL 4G70B 2P24B 2Z3FA 3GDBA 1S7QB 3HS0B 5GS2D 5A2AA 3TPUB 4AM0A 2PPDA 3BW9A 4QTIH 2EO7A 3VCLB 3RKPA 3DIVA 2V7HA 1KZYA 4LSRH 2V8LA 1GGCH 1E65A 4EUPH 4NO2B 4B60A 8FABB 4UQ2B 3L2MA 3MLYH 5EOCL 3KCPA 4S1SH 3EHBD 4NO0B 2VR4A 4M1GL 1BZ7B 1WGOA 2AQPA 3ULUH 1L9RA 3FRPA 3MLXL 4FI7A 3DX3A 5LN4A 5I16B 5ESAB 1JI1A 4DKEH 3MR9A 4TVPE 1RHHB 2IWFA 3RHWF 3QUKA 3VA2C 4M8QA 5AZ2L 5ACZA 2A4ZA 4MJHA 4ELKB 3MODH 3NK3A 4CVWA 4Z5RB 1J11A 4L3EA 1OPGH 1A7RH 5FA4A 4ZFQA 2BP5M 1PZUB 2JIXA 4XMXA 1T20A 4ZD3L 4JE0A 1FYHB 3WKPA 4BZ1L 3Q8BA 3MKGA 5I5MA 4JHAH 3F7VB 3TJEL 3OPZL 4JFUA 4EKJA 4RGNC 4APXA 4AV5A 2YPLD 3BE1L 1GC1L 2HLAA 3L8QA 3X12A 1KN4H 2O72A 5TK4A 2Y5TA 4NBYB 3WIHH 3A3YB 3MJGX 1RY7B 3QZWA 4WO4B 1CI5A 3SPGA 5KBNC 1GZHA 2VZUA 2EP6A 2ATPA 3DUHA 1OCWH 4MTMA 4W9HC 5EFIA 1NBZB 1OTSD 2BVYA 1JPEA 2J8UB 3C9NA 4MQ7A 1DL7H 4U31A 1U92A 1BA9A 1I1RA 3NACL 4IOSA 4N8CL 1KCBA 3CLEH 3FQNB 3HFML 2EXYC 3HOGA 3P73A 4JFPB 5IHBA 4UQCA 3TA3A 1JUFA 5IIEA 1K3IA 2WLMA 1BVLB 3FQXB 4N2FA 1EAPA 1JERA 2EIBA 1U3HB 2VRQA 4M6MH 1DE4A 5DVNA 5C07E 5JZ7D 1JZ8A 1E8XA 1UM6L 4FQJH 5C07B 3OKKA 1QR1A 1P6FA 2XQBH 3HZYB 3KM2A 4WK2B 2JI1A 5LVEA 3UL4A 1KSRA 1TIUA 1B3JA 2Y2WA 1J87A 1BF2A 3C5ZD 3CVHH 3VB8A 4YDMA 1F02I 1RZJL 1L3NA 2C9AA 3VXPB 2CUAA 2W9EL 3MLPA 2VE6A 1VAHA 5F96H 2K45A 4L48A 1T5KA 2XX1A 4GKNB 1I1FB 1U6AH 2AW2A 2AEIT 4FXGB 3GMNB 4ETYA 5IGXH 2G2RA 4M48H 1FG9C 5HHQB 4N6QA 4YXHL 2P80A 4M00A 4PGCA 2O6FA 4V1DE 1QSFD 1UD5A 1TEFA 2ZUVA 4LEOA 3SGDI 2BERA 1ET5A 3KG5A 5EF0A 4BKLA 4DFHA 2W0LA 2A9BA 3RWGB 1QPPA 1XGQB 3V4VL 1SXZA 4QY8B 3MV9E 2BY2A 3MUGA 4KI1A 3FFDB 1MF2H 3BWZA 3UBXB 2MQ0A 2R0KL 3OD3A 4HUUB 3TYFB 3EYUL 2WSDA 1A6VL 1AS7A 1MG2C 3JWOL 2I26N 2H9GA 4YK4C 4RZCA 2PWHA 2CBOA 4YSRA 4JB9L 5DRXB 3GBNL 4UT9A 1YY8A 2AGJH 3GRWH 3SSGA 3WKMH 1QFWL 5HYSB 4H20H 4M5ZL 4YDKL 5TH2A 4RWHA 3QIWA 5EZLA 1EBPA 3U2SA 3EYFA 4MNHA 4X4MA 3V6BR 1D3CA 4K7FA 4NZTH 1KYFA 2NX5A 3B2DC 3I74A 3MNWA 3H42L 3R0NA 1NIAA 2VXUH 5E8PA 1ZTMA 3IDUA 2Y36H 1E9OA 3FB8B 5E9NA 1PQZA 3GSNA 5I75B 3HB3B 4ZQTA 1F4AA 5DJAA 2XACC 4I3RL 5I1JL 4Z1PA 3TH3T 4JZOA 2P8LA 4IBZA 3REVA 4HKBA 3ES6A 4J3UA 1TQCB 4OZHB 1H3VA 1I82A 5EIIA 5AYUH 1IM3A 1R3JA 1IKOP 3PJNA 1LXMA 4HA1A 4Y16C 3TS8A 4ZPTA 2VDPB 3ZJAA 3BZ5A 1IFRA 3L6FA 3BEVB 5BVJB 3HZMB 3EF4A 1ZT7A 1W80A 4G8IB 3V0EA 4ZOCA 4YXLH 2VN7A 5J1TC 4N2IA 3TX4A 1FHNA 1O6VA 1XH3A 4FQ1H 1MJ8H 4OIFA 2NUTB 1IFHL 2G30A 4Z9KB 1LO3H 3DURA 2VKXA 3DOSA 5DD5L 3WJMA 5IMKB 2DLEA 1D5BA 4WWKB 4FA8A 4P5TD 1YPZA 1AO7A 2NZ9D 3TBVA 5A3IC 2NNRA 2V2WA 4HIPA 1FVCA 5KVGL 1BAFH 5IK3A 2A38A 3O3UN 4K3HA 5LQBH 1BYOA 1EAOA 3QUZD 1P1ZB 1QUNB 2C1OA 2VRAA 3ARFB 4WK0B 4JKPH 1ZLSL 3LRMA 5LGKA 2QFPA 1NC2B 5C0BE 3KJ6H 3ISWA 3MLZL 2NY7L 4PJ5B 4A2GA 2K4AA 3GI8L 2YRZA 1JV5A 1WCBB 3VXRA 2I85A 4GAJH 4R7LA 5C0RL 1RUMH 1ZVSB 3TO4D 1CDJA 4RDQG 2X70A 1MRCH 3NEEA 3CAFA 3NIGE 5DEGA 3ZHLA 2NT0A 1KPUB 3PAYA 1V7NH 1QFOA 1Q4NX 3BVWA 1OW0A 3DVGB 5SWZE 3EJJX 4PRHE 3KVPA 5JPMB 3GBLA 2KLSA 4TOYL 3ZSSA 5HHPA 4KQ3L 4C57C 3QHFL 3IJ8A 5F1IB 3W57A 2DKSA 2K6YA 4FQQA 5DLML 4XNQB 2AJZB 1DVYA 1EO5A 5D4IA 43C9B 3L4WA 2Y6TE 3M1CA 5E4EC 1AHKA 3D3VA 4XOEA 3GZKA 4LCCA 5F1KC 3PABB 4BDVB 4WJ5A 1RCYA 4QAWA 2ZKWA 4JM2B 4X0KB 4AMXA 5T5FH 1MCIA 1BJMA 1C1EH 1IZKA 4R3SA 3LD8B 2R9HD 3DO7B 2ZXDA 2YMXL 5F1OB 4CN6A 4OTXL 2R2EB 2V5MA 1N0LA 3NFNB 5DMKB 2V6HA 1FNAA 3ZO0A 1J05B 3TGXA 2OI9B 4JY5L 5BS0B 4XRCB 1B4JH 2YPKB 4GO6B 2BVEA 3QFDB 1GZHC 5IWLC 3ABLB 1FV1B 2X87A 4QT5A 1I3UA 2FQEA 4XBEH 4KNSA 3ALXA 4MD0A 1DVQA 4HETA 2PMZA 3ESNA 4IDLA 1UZGA 3P3UA 3DXAA 2R1WA 3SE9H 4WUUE 3TA3C 4J3OF 4TTGA 4XP5H 3TNNB 4Q14A 4PGDA 1IAIH 1T2XA 5DUJA 5E1AB 2GBVA 3QORD 1E6JL 3OAYK 2ED9A 5EBMA 1IAKA 4ZI8A 1MI5E 2WJ7A 2HJLB 1L9NA 2GCYA 2OXHA 2UX7A 5J8OA 1J1PL 2KZBA 4ZMQA 1AYOA 3UJTL 4PJGA 3BUYA 4K3DL 1J86A 4KKBD 4HCFA 3FQWB 5I23A 1G7MA 1NDTA 2PF6A 4LU5L 4OD1H 1SQ2N 2Y7OA 1QA9A 2QGCA 2J25A 1I7ZB 2DEWX 1NCWL 4Q89A 4K7PL 3ETBJ 4KZEH 1ZLWK 1QHOA 2F53B 3P3SA 3GSOA 4JKNA 1B4RA 1HOEA 2HJFA 1Y6KR 3ME0A 5IHHA 3LH2L 1FNFA 1FZJA 1FO0A 2YMTA 1UM4L 4OZGE 4FTVE 3ZIMA 3ABZA 3P4OA 3C6LD 2YC1A 2ZOKB 2P47B 4JRYD 2QSVA 3U7WH 5F6IB 3FO0L 4HIJA 3DPBB 4OCMC 3CHRA 4Q74A 3TJHC 3BT2H 4GMSH 1ZANL 1TJGL 1CF8L 1A4JA 3MRPB 5GS0H 3RVWD 1K5WA 1NL0H 1R33A 2J6EL 4HCGA 2VAJA 4GIAA 4FEMA 4ORGB 2DLHA 4LKCB 5F0MB 4MNQE 1KN2H 1T5XA 3VXTB 1M6OB 4MNQB 3V0WH 4XZ4A 5ELIA 2Z93A 5I6XC 3NMEA 1RZFH 2NY3C 2DTML 4UT6L 1HXMB 3QIWC 3JYCA 2LU4A 2DWDB 4NP9A 4WF7A 3IKCB 3WFHB 2I27N 1GCFA 3RKDD 2K6ZA 1A66A 1LILA 5B1JA 2R83A 1GSKA 1JI2A 4P2QB 4JDEB 3MYJB 2UXVA 3APDA 3FYEB 1AHWA 1XCWA 1NGZB 2X40A 2WN2A 4XWOC 1E9PA 3SKMB 2ARJQ 3SQBA 2BIPA 1MRFH 3W0WA 5JORA 2W9DL 1PTZA 1FYTA 2H32A 4JJOA 3KGUA 2G3NA 3T1WA 3TN0D 4BZ2H 1OQXA 1NLBH 2WWMD 1AR1D 3BZ4B 4LQFH 2GUYA 5FB8A 3KNBA 5D1XD 1BBDH 4FFZA 3BWAA 3KPRB 1BM3L 3LKOA 2PO6A 4NQDA 4QNPF 1CE1L 4X5XB 2VDLL 2WAHA 3D18B 2X10A 3P4MB 2ZKHL 5F89B 3W2DL 3TYGL 3O4OB 2AJUL 3NABH 5FUZL 2DEXX 2CU9A 1KGXA 5I1IH 1QI5A 5IVXA 1RIVL 1FLTX 2XTJD 2DQDL 3JWNE 4P04A 2BOBB 3H0TA 4JMNA 3VFPA 1IX2A 4BFNA 4LCWD 5DZVA 4GI6A 3OR6A 3OKEB 3SDXA 4X5WA 2EUVA 4RBPK 3PQYD 3MFGB 3N42B 3UACA 3S37L 5LGJA 5FUCE 2J7LA 1OTUD 3JQOB 2VIRB 1HCYA 2YKLH 2QKIA 3D69B 3SJVA 1AQDA 2H47C 4HS3B 1TVBB 2A9MH 1OANA 4ZO8A 1JN6B 3CVBA 4GPVA 3CMOL 2AJYL 5C70A 3B34A 1KXTA 5A2JH 1RK0B 2YAMA 1W16A 1J9SA 5C0GB 2XN9E 4EQ3A 1NBVH 1CR9L 4LVEA 2ROYA 4HUNB 5BMFH 3Q5OA 4EAEA 1A6ZA 4YHIB 4H5SA 4G82A 1DP0A 3NZ8B 1E27A 3DI3B 1MDAA 3VSTA 1MIEL 1JMZA 1I3GH 3L2NA 1MFBH 2CO2A 2D7MA 1JYXA 3CJJA 1OW0C 4NNXA 1PEZA 5FYLL 4X9FA 3GGWA 3K80A 3ZHDA 3T0EB 4JY4A 1G43A 4UDTB 5JOFA 5BW7A 1CURA 2WXGA 2GHZA 5EUKA 5FV1L 4PG9A 3UG5A 2VKWA 2VZTA 3H1ZA 1TTAA 3DO3A 3OHXA 4IMLA 1H6FA 4LVHC 4W6WB 1Z2KA 5CIPA 5DZNA 1A2YB 1MCOL 4LCCC 3CLFH 3V5HA 3THML 2KHAA 4RSVA 4I48B 4TNFA 2NCEA 3V55A 1TF4A 1G7HA 3AT9A 4Y0GA 3KDPB 4HAKA 2GJJA 4EXKA 5FLUA 1CB4A 4KVNH 2E9BA 3P11H 5C92A 4O51B 5JW4Q 1ZLEA 1HZKA 3VXME 4P06A 1DR9A 4LCYA 3Q6FA 5MEQB 3CFJB 1RPUA 3BFQG 4ZMAT 1X5JA 4MJ6A 5KW9L 1RV6X 12E8L 5IMOB 4XHJC 4NCC1 3RB7A 1JHLL 2A74A 3FZUD 4M03A 2JCCA 3LMJH 4ENED 3I2CL 4Z7OE 4GAGL 3K6DA 3N91A 1EHAA 4Z7OB 3BWUC 3MV8D 2GVYA 2Y4SA 4MAUL 2CXGA 4P9HH 4UQ3A 3K71B 3F7YA 2GTZA 3CDFA 1E28B 3BOVA 5I73B 4I4WB 1BWWA 1FNGA 3UYRL 3VSVA 4A2FA 2LAAA 4Z95L 5F7KC 1F1GA 1KJMA 1E6OH 4GS7C 4W9ZA 4N0YH 4OLXL 2C4FT 2WKGA 4MD5A 1SJHA 3L9YA 4U1GC 3GXUB 1PKQE 1V3JA 2MEJB 4QHKJ 1PKQB 5AVQB 3U36B 4JN2B 4PGBA 4PJHF 4F8PA 3B5TA 3QPQC 3S4SG 1JFQH 1PZ2A 1BQRA 3MCKA 2V7NB 2YBRA 2JB6A 1DVFA 2X5PA 4ABUA 4NDMA 4AEIL 3NESA 2VLMD 1OCCB 1PLAA 3VI3F 4EUPB 6PAZA 3VD1A 4AIXA 3E0GA 4IGBB 2OJ1A 2FJFA 2P8MB 2NY0B 1ESOA 5E0FA 4M6AA 2VNCA 3PCYA 4AGQA 2ZF8A 5EIQA 4JREB 2PPFA 3ULUE 2MTPA 3AU1B 4RGND 4ZUTB 1INDL 2V17L 3C5SA 2XWRA 5D7KD 5EMYA 5IQ7L 4U05A 3DMMD 4Y89A 2IADB 4JCLA 2ADIB 3ARGB 3BXNA 1LWJA 2XVKA 3S3BB 4Q0XL 2CKBA 5FYJH 5D9SA 3GSQA 2L3BA 3RGHA 4AQZA 5F1NA 2EIDA 4XCFL 3GBML 3MA9H 3MXVH 4H26B 2HVKB 4FI8A 5F7LB 4GH7B 3ZT6A 4AVIA 4AEHH 4X4YB 3KGTA 2UVFA 3KR3H 3UEZA 5MHSD 1LMIA 4P5MB 2PTUA 1C08B 4G7VL 4N24A 1P7QA 4JR9H 3VXUA 2EO1A 4HEMA 5J13B 4LMQI 5B1JC 4MAYB 3LQAL 2Q3AA 2PTTA 3O3EA 5DHYB 1AHWC 2WQ8A 4RCAA 3RAJH 3U1SL 3O6LH 4BINA 1TZGH 3QIUA 4NLHA 5F9WB 2EDOA 3B7YA 2VLLA 1OSPH 1OT1A 2XXMB 3BP6B 4Z7WF 4BQBA 2OMUA 5J7CC 1UD8A 4FG4A 1XF4A 4XNYH 2AK4A 2IPUG 2JF1A 4P57B 3MLVH 4PJIA 2X1WL 4MJ5B 3RVUC 4G1EA 1RFDL 2PO6C 1S7UB 4O2CA 1AGDA 4DH2A 4PY7A 3BAYA 5IT2H 2IJ0C 3IDYC 2NTFB 3RDTD 4K71C 5EH1A 3MGOB 4GW4A 6FABH 5GRJH 4HBCL 1KELH 5A7BA 1DJIA 2XZZA 3APCA 3QZOA 2EINB 2Q8AL 3PWNB 3H3PL 4WWID 3S35X 4FNLH 1KC5L 3OB0K 4E5XB 4W9CC 4HJGB 4J3XA 4AYGA 5EOQL 3ROOA 1QFHA 1LGVA 1R3KA 1NINA 3FFCD 1ZANH 4WI6A 1A3LL 2GK0B 1X5XA 1YCSA 2QKIC 1CF8H 3GS0A 3LRSA 3OAZK 4JRXD 1U30A 4Y2OB 1LE9A 3LZNA 3DX6B 4Q9QH 2CDEA 3NSDA 4LCIH 1FGNL 3WHXB 2GEEA 3OHMB 3US0A 2B4CL 3OL2A 4JDVB 1YY9D 2Q8BH 3KPTA 1W6LA 2MJWA 2Q2EB 2SEBB 3HE6B 4OFVA 2WIMA 3OSKA 1NBYB 4NENA 2HLFD 3GRBA 4W9LC 1A7QL 2R29H 4PU2A 1YEIL 1MVUB 2HFTA 4OSUH 5EWIH 1P5VA 1KYOK 3HLAA 1PS3A 3GMOB 3N85L 5J1AA 4D9LH 3B3BA 4I2XE 3MC0A 5I17B 1PY0A 4LHUG 4MA3A 3K0YA 2OMVB 3CLWA 3RDJA 5H2BB 4ZYKA 1R3IH 3GSXB 5BW7C 4OJCA 3VWJA 2NYYC 1FGVH 3T6XA 1K6QH 4JHWL 4EZMA 4FP8H 2HKHH 4FZ8L 3OHXC 1I9IL 4HPOH 2L0DA 3HN8A 3NRPA 3ZT5A 3MCYA 1CFVH 5C0IA 2OULB 5E99L 3P40A 3M46A 4RFEA 2QVTA 5J56B 2FUQA 2CPUA 2ZKHH 4K23L 2B59B 3UTTE 3QDGB 3ARXA 3Q5TA 5FDYA 5D1ZA 1PMYA 3DV4B 3QUMH