1HZKA

Solution structures of c-1027 apoprotein and its complex with the aromatized chromophore
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
110
structure length
110
Chain Sequence
APAFSVSPASGLSDGQSVSVSVSGAAAGETYYIAQCAPVGGQDACNPATATSFTTDASGAASFSFVVRKSYTGSTPEGTPVGSVDCATAACNLGAGNSGLDLGHVALTFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-1027 APOPROTEIN
publication title Solution structures of C-1027 apoprotein and its complex with the aromatized chromophore.
pubmed doi rcsb
molecule tags Antibiotic
total genus 9
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2001-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00960 Neocarzinostat Neocarzinostatin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.230 Mainly Beta Sandwich Immunoglobulin-like Neocarzinostatin-like 1hzkA00
2MCMA 2CBQA 4JW3A 2G0LA 1AKPA 1J48A 1HZKA 1ACXA 1J5HA 2G0KA 2CBTA 1O5PA 1NOAA 2CBOA 1HZLA 1J5IA 1NCOA 2CBMA
chains in the Genus database with same CATH superfamily
1EEYB 1MHEB 4JM4L 4RAHA 4ZOCA 2WQXA 5FCUL 4YC2B 5DWUH 5KBDA 2HA1A 2W59A 1KT2A 2RA1A 5AW7B 4Z95L 3EXJA 1CL7H 3T6VA 1LVEA 3CFCL 4J3VA 4HUWB 3IRZA 1GW0A 1U8LA 3OMAB 3O4OB 2C3HA 4IBVA 5AW4B 5I1KL 1EA9C 3VD9A 3MKGA 1P5UA 3KMDA 2C1OB 2I25N 1G43A 5AVUB 3QXUA 3C09C 2F6AA 4TQ8A 3L5IA 4KMQA 4XNXH 5JDSB 4BWWA 1JE6A 4JFYB 5D7LD 1BVLA 2EH7H 1ZJAA 4N2EA 4UB0L 2HFTA 2X4OA 1JNHB 4DGYH 4JFHE 3O3AA 4GMTH 5D7JA 3ZQWA 3ESUF 3BVXA 5E8PB 4U1HB 3QJSB 4ETYA 2FE0A 4E5XA 5C0AB 1HJBC 3GM0A 3SZ6A 4PJBE 5T1LA 2B4CL 1KY7A 3DX7B 4PJGE 4OZHA 3FRPB 3QIWA 4MLSA 5IFHL 1FNSH 4YDNA 3RTQA 4ZG1A 4GRMB 4L3EA 2AKRB 2NZ9C 3FC8A 1J1OL 4C56E 3IJYB 1U93B 4XP1H 4UQ3A 4KK9D 1I1YA 3BC9A 3QCVH 3KPTA 3QUHA 3LPFA 5C0DA 4P2RD 3N1GC 1IC1A 4I4WA 2OCJA 1IQDA 2VXVL 3Q3GB 3L1GA 4CVWA 1FL6B 4OM1H 3TZVA 5ALBL 3CZLA 1M71B 4GQ9H 2QGDA 3IKCA 4DW2H 1W6LA 4WSGA 3G08A 4Z7NF 1RK1B 2VXSL 5C6WH 5C0NC 1ZTXH 3HS0B 4I7ZC 5IVXA 5J6HB 1N70A 1RZ8A 4B50A 3W0WB 2VL4A 3GK8H 4HKZA 3SJVB 2EVIA 4DGUA 2DPKA 2BIIA 5AYUH 4WK0B 4NCC2 1KG0B 2IANB 5KVEL 5CD5C 3MCLL 3HBPA 4FXKA 4FJZA 1HX0A 3Q48A 4XOBA 4HOXA 3MMEA 2YXVA 4MNGB 4P46D 2EDRA 2AXGA 3WI9A 3EYQC 2VWEE 3IFLL 2UXTA 3ZL1A 1F4AA 4ZD3H 5MEOB 4IW4C 4N0CD 3UAEA 4MLIA 4BZ2L 3DBXA 3FQXA 5I1DA 3U2SA 3N1MC 3MLRH 3UJJH 1KT2B 1KBPA 2AJYH 2K0RA 4JPSA 3RQ3A 4WEMB 2OMVB 2YKLL 2QZ5A 1U8LB 2AXJA 3MKKA 1PFCA 5J13C 1S8DA 1FFTB 4NUJA 2G2RA 3ZTJG 3N9GL 1P5UB 3T0AA 3E2HB 2WD0A 1J9TA 1INEH 1KLFA 4JM2D 4JLRA 1MLCA 1TQBC 1LEIA 3S4SB 3IXAA 4X42A 5L8KB 1SOQA 1BZ7A 5D7SH 4P07A 3NQIA 4IBQA 5EO0A 4F58L 1BVLB 5GGTL 5HJGA 4Z7WA 1MIEL 3ORJA 5DK0A 3QB7C 2X4OB 1Z0MA 1M9SA 1I9IH 3LRGA 5I8OL 5CZXD 5HYSA 5B1AB 2LGNA 4L3AA 1CC3A 5D7KD 3N2JA 5D7JB 1X4XA 1QSEA 4NSKA 2MCG1 1IKFL 4G5ZL 1MAJA 4XNUH 1XFPA 2VKXA 4D0BA 4OLWL 4KRPD 4E5XB 5J1TC 3K2UL 1KTLA 5JZ7D 3BQUC 5T1LB 4A2GA 5LAXA 3RFRA 2MNUA 4QLRA 2FNBA 3C60D 4OZHB 4HK0A 4P23D 3QIWB 1GGIH 3OXRA 4BH7A 2JQMA 3RTQB 5LNEA 3B34A 4M61A 1D7BA 3O4LD 4L3EB 3QYNA 1FAIH 4UQ3B 1I1YB 5C0DB 4WTXA 4I4WB 1IQDB 1GGCL 1I7UA 3WUWG 3TZVB 4KUZH 3HE6C 4PGEA 2Z65C 1ZT1A 3IKCB 3G08B 4Q4EA 3O2WL 1YPZE 4JBSA 5CJXA 3L13A 1LO0L 1J1XH 2A1WH 3MYJA 4PRHD 2O6DA 2DQJL 5BW7C 4YMPA 5IVXB 1RZ8B 4R4ND 3BW9A 1KELL 4XMWA 2XRAH 2G60L 3LXAA 4HWNA 4HKZB 3GB7A 4IIZA 3FN3A 4NWUL 4UT6H 3S98A 4HJSA 1OGTA 3TBBA 4KNUA 3AAZA 3VXSA 4JFFA 1INQA 4FXKB 2UYLA 4LLDA 1CFVL 4BZ1H 4E9LA 4YDJA 1ETJA 1AGDA 3MMEB 2NY7L 2Y3NA 2AXGB 4RISL 2NY2D 1AP2A 3NZ8A 2E7CA 3DPDA 3FUKA 3FQXB 5I1DB 3U2SB 3R7QA 4PJBB 1EGJH 4OFKA 1S8DB 4JKPL 5FKAA 1JRHI 1A9BA 2G2RB 3HS8A 4JO5A 2I5YH 3MRMA 2IGFH 5J11B 5AW2B 3EO0B 1C5BL 2OMTA 3SDDC 4TTGA 4JLRB 1SHWA 1LEIB 1MLCB 3IXAB 3ARFB 4AIZA 2F8VA 2V8LA 4JN1L 3QIBD 5EO0B 4HPYH 4LIQH 1R0AH 5T1KA 3WEBA 4Z7WB 4TVPE 5TE4L 5DK0B 2ICCA 1DQTA 3D33A 1JTPA 3DYMA 5HYSB 3W9DA 1AHMA 1UACH 5JIKA 4KAQL 3ESPA 3FSAA 4U0QB 1QSEB 3ENEA 4NSKB 1IGYA 4AUUA 1OWWA 2XZCL 2J73A 4D0BB 5EU4A 2FCBA 2F5BH 4OZIF 1EZSA 1LK3L 4G42A 1KTLB 3SKMA 1SBSH 2ZUWA 5LAXB 5IJKC 1I31A 3T0EE 4HK0B 2KH2B 1NCTA 5JXEA 1ZPLA 3OXRB 4BH7B 2VR7A 1Z9MA 4DKTA 1EAQA 1P1ZA 3H3BC 1DQML 2FIRT 2V2XA 2BVYA 1ACYL 1E28A 2OX5A 4MXVE 4RFOH 2A9BA 4KHTH 1I7UB 1XGQA 4KKLD 1G9NH 3EBHA 4OCYH 3QRFM 3L5JA 3GSXB 1EEUA 1ZT1B 2JCWA 2WSPA 1LL1A 5JQIB 2F54D 4Q9QH 2ADIA 1IT9H 4L1HA 2YD8A 3MYJB 1PY0A 4LAJH 2A9CA 1NIEA 3CK0L 3M1CA 2EDYA 4GSDH 1EMTL 3BW9B 4FQ2L 1L9TA 3L5XH 2EEFA 3GB7B 3H9SD 4NQTA 3KJ6H 4AQEA 3PYCA 1WWWX 4R90H 4PS8A 4HXAH 3N43F 3AAZB 3VXSB 4JFFB 1INQB 4LLDB 2UYLB 5ITBL 4HGKC 1OB0A 1OZUA 1JPSH 2FO4A 1A3RL 1AGDB 1D5ZA 2ENPA 4XPBH 5DQJA 3TV3H 1CQKA 1R24A 1SXBA 4HIIA 1SXCA 3G6DL 4UT9A 1CF8H 1MRDL 3BWAA 3M1OA 1UFGA 4IIQC 4AYEC 1AP2B 2A3TA 1ECYA 3DOHA 4UMSA 1R34A 4GY4A 3KZ8A 1ADWA 3NZ8B 4P3CL 2W0LA 1GR7A 4YBLC 1LGVA 4X9FA 1OTSD 3SHSA 5E00A 1TG8A 3QHZL 1NGZB 4P9MH 1YEFH 1W2KT 4I0PA 5AL0A 1V05A 1TTGA 1HE7A 3MRGA 5HI4C 4N8CL 4WW2C 2AI0H 1A1OA 3N1PC 5FKAB 3T0EA 3SGDI 3MV8D 1BJMA 3ARZA 4KKAD 4J2QA 3MRMB 2EEDA 2F8OA 4GKOA 2OMTB 3VFPA 3LKOA 2H5UA 3L3OC 1EXGA 1UENA 4WGVB 2CD0A 3IEAA 1QA9B 4PJ7A 2OZ4L 2XWZA 4R7VA 4AIZB 4TOYH 1D5XA 2F53D 1EZLA 1SY6L 5JW4R 5T1KB 3S34H 5LAPA 2NY3D 1YUHA 3Q9QA 4AT6B 2OSLA 5SWSA 1BF2A 1Z3RA 4FNPA 5I1AA 3DRQB 5AEAA 5JW4Q 4P9HH 3WKNA 4KMLB 2IC2A 2DLTA 2L7EA 5D4HA 1IM3D 1IGYB 4PV8B 2BCMA 5CN1A 5F70A 2VC2B 3D4CA 1NEUA 3GSNH 4NNPH 4WWOA 1LJMA 1BZ8A 5EU4B 1MW2A 3WS6C 1MQKL 4JB9H 4G42B 1BP3B 4J2XA 4A6YH 1HAUA 3RGVC 2R0ZL 4BSVA 4EEEA 2Z6FA 4V33A 2HPTA 4B9YA 3IMTA 2QEJA 2JB6A 3OZKA 4RA3A 2WWKT 1QATA 3DETD 4OIAA 1P1ZB 3HZ3A 5GRJH 3VH8B 1HZKA 2JJVA 2V2XB 5DMIL 1KCUL 1EBPA 3CHRA 3RUGE 1QHOA 1AKJD 2DQCL 1E28B 2OX5B 1WICA 3FFCE 3QUMB 4QWWC 5FOBA 5FEBA 2IALA 3E0GA 3FT9A 3Q6GH 4Z3FA 1XGQB 2OAAA 3K8KA 3DVNA 3R8QA 2FECI 1CD0A 2Y6TE 3O2VL 4TRPL 5DD6A 5FHAL 5F89A 1L7IL 4MZIA 3BAYA 4PJ8B 4HS8H 1OM3L 2XXGA 2ADIB 1JWUA 4NQED 2Q8AH 5KWYC 1J88A 4L5FH 2VZOA 4U1JA 1ZA6A 1JFQL 2DRUA 3B2DC 1OWRM 4UV4H 3ZE2F 3QJXA 1TOXA 4HFWA 5F9OH 1GTNA 2JQAA 1QFPA 3LAFA 3MA7A 4MA8L 1OO2A 2MWCA 2COVD 2PETA 2XN2A 2WXLA 2ZX9A 4PB0L 1DQJA 2Y1VA 2E7LC 3H6JA 3A4AA 2FO4B 1D5ZB 4APXA 1BVNT 1R24B 4HIIB 2KLRA 4KU1A 3ZRFC 3ILEA 3ZTJH 5C0CD 1ZANL 3BWAB 4UQIM 3SIKA 1IRAY 2XTSA 4OV6F 1QRNE 3S6CA 5MI0C 4XN9A 3TM6A 1NCBL 5CCGE 1G6RA 3AS1A 1BMZA 3WD5H 3O11A 4OBRA 4O51A 2J72A 1MQ8A 5E00B 1JDCA 1KXHA 4I0PB 4Y4KA 5KJRL 1B0RA 3LRSA 3MRGB 1JZ4A 3PABA 1A1OB 1DJYA 3RDTC 1S7WA 3T0EB 4X5XA 2W0PA 4G7QB 4LAQL 1G6VK 5DMGD 1KGYE 5T5NG 3HUJA 3X2QB 2J7LA 1RPUA 3LX9A 4TQPA 3LKOB 5T3ZE 1E5YA 2XQBH 3Q2LA 1UQSA 4PJ7B 1DQLH 4JQIL 4QAMB 1S46A 3VVVA 3WJLA 3G04B 1D5XB 2VDRL 4I1PA 4MHHG 1SJEA 3GZQA 2VUYA 2WBKA 3TP4A 4PJCA 2OSLB 4B9JA 5SWSB 2R7EA 1MKFA 5I1AB 1INDH 3ZGIA 1QNIA 3ECUA 5C97A 1CFTA 1M05B 3NPSB 1JV5A 4XOAA 5CJ8A 4KKQA 1KEGH 2J6WA 5AOJA 1J9QA 4FP8L 3LN4A 4WW2F 4TNGA 4BSVB 2FWSA 2E76C 4XO4A 5FWRA 2JB6B 2ARWA 1HNGA 3H85A 2LLNA 1OHZA 2HXAA 4UOW0 5I8KL 4MQ7A 3SE9L 2YK1H 3D50A 3ERXA 3WYRA 3AB0C 3R0NA 1F58H 4YOKA 2Z64C 1BBJA 1Q0EA 3TH2T 5FOBB 3MAWA 2IALB 4I1RA 4K5LA 3EYUH 1WFIA 4AE1A 5DD6B 5IF0A 5F89B 1TKWA 2O30A 3MHZA 1A14H 1I8AA 2KQNA 1T6BX 1YQVH 1JWUB 3C6SA 4D9LH 4CVXA 4KOBA 1IFGA 4U1JB 1ZA6B 4M1CC 4JKLA 4WO4D 1MVFA 4HFWB 2FSDA 1HEZA 2X2IA 5F7KC 4DP6X 3MJGX 3D25A 3D08A 3P4MA 3MA7B 5DTFA 4PBDA 2DQFA 4H40A 2JCCE 4CN6A 2DQHH 4DFHA 5ICYA 1SBBA 4JHWH 4MCYB 1DQJB 3HG5A 3DHPA 5M94B 2WYZA 4FG4A 4ZZFA 4APXB 5JW3H 4P57A 4OSUH 3D4GA 2PO6C 3FCBA 1Y6KR 3B1TA 3WFCL 1GGUA 3UAFA 4R96A 2P80D 1G6RB 3CQPA 3GXDA 3UTSD 5FKPA 3O11B 2DYPB 4O51B 2IV8A 4UDUA 2B77A 2Y5EA 5DEZA 2FEDD 2WJ5A 4EQ3A 1CLYL 2ERJB 4N0YL 1VEMA 4BFOA 4Y4KB 3KDPB 1WRFA 1B0RB 3LRSB 2WXJA 3PABB 3DXAD 5K9JH 4YR6A 1S7WB 4X5XB 4DZBA 3E2HC 1ZT7A 3F83A 4Q6YA 3S3JA 5LO7A 1X7TA 4LSVH 2ED7A 3A6BL 2ZUYA 3HN5A 3NJGA 4FQLH 3ARDA 4F8NA 3H6AA 1LHZA 5CR8A 2FGWH 1T04A 1UQSB 1PNDA 3VG9B 1B4TA 2FX9H 1YNTB 3MUZ1 4GQZA 3HKZA 3LEYH 5DEJA 1PZUB 5J9PA 4YSDA 3U9UA 4PJCB 3H2QA 2FQGA 3ZYIA 4FD0A 4HIQA 4AQOA 4H8WC 4BK8A 3QEQD 1XTLA 5DQDH 3WN5A 4LXFA 1AQMA 1CFTB 1V7MH 1I9JH 3QHFH 2VZ3A 1JV5B 4JHAL 4P8QA 4UCFA 2B0SL 2MKWA 2WXFA 2YXFA 3F7LA 1FDLL 2CJ3A 3ARXA 3P77B 4LESA 4R97B 3NGBC 1KACB 1P7KA 2IPTL 1OAYL 5KVGE 1QASA 3TWCH 1MRFH 2RCSH 2ZCHH 3LN4B 3SDXA 2D2CC 1IKOP 1HOCA 1T22B 1ZA3A 3FU3A 3S7GA 4HUXB 1AR1D 1THCA 2HRGA 3L95A 3L9RA 4DKDC 4IJ3B 4ERSH 1A02N 2H3KA 2GT9A 3P0GB 2ZQKA 2A9ML 1X4YA 5TTRA 5C7XH 7FABL 5I71B 1U8OA 1BBJB 3OPZL 2QQNL 2PYFA 4NAJA 4PGDA 1DSFL 1N2RA 5ACZA 5I1CH 5HVFB 3QPXL 3GXFA 5IF0B 3TBCA 2XLLA 2ZUUA 1DVUA 4G1MA 1OP9A 1KWGA 4BQ9A 5LKNA 3C6SB 5LDSA 3THMH 3DA0A 4NT6A 3WMPA 5C09E 1JI2A 5F93C 4WJG3 2DL2A 1HEZB 5ADOL 4M1DL 3D25B 4JUSA 3P4MB 2XTJE 5DTFB 1HNYA 4Q6KA 4TSAL 5ICYB 4FABH 1U9KA 3L9YA 2AERT 2VQUA 2C9VA 4LCCA 4P57B 4FTVE 3ASOB 1WF5A 5CEXA 3VFUB 1A4AA 3ZZSA 1A7OL 2B3RA 3JVGA 4R96B 1S5IH 1UT2A 3WKYA 5FKPB 5CCKL 1KXVA 4XBEL 2NR6A 4UDUB 5E0QA 3JZ7A 2X4SA 5AL8A 4Z3JA 1NFDA 1XCXA 1F3DH 1ZXKA 4YHIA 3FPYA 4TTDC 3L4WA 5SWZD 4YR6B 1D5MA 3SODB 3F7VA 2IBGA 4AMKH 4DZBB 1ZT7B 2VLJA 3FQTA 1B90A 1NCOA 2QFRA 4YE0A 5ABDE 5F21B 1Y1DA 3ARDB 4U6VH 3ARFC 2N1KA 2YA0A 4S1SL 1E27A 3Q06A 1T04B 2EDOA 5GS0C 3SOTA 3QDJD 3V4UL 3CCHA 2BNRE 5E2JA 1J5CA 5J8OA 1W0VA 4XAKD 1WFMA 1BIIA 5J9PB 2AVGA 1E6OH 2JE8A 3U9UB 1K2DA 4Y4HA 3RGHA 2N59A 2CBOA 3WN5B 3OBAA 3PL6A 4AVJA 1CFBA 3PJNA 4GO9A 5IESH 3O2DH 3MNMA 2AZAA 3HHSA 1NAKH 4GKLA 4IQHA 4JDTL 1P7KB 5FFOA 5B39G 3LH2L 3L2MA 3HE7C 4Q58C 2EZ0D 3SZKC 2JCCB 4BH8A 2XFXB 3VE0A 3SDXB 5KBMA 3WELA 1T1ZA 4FQXD 3RKDD 1HOCB 1ZA3B 1GAFH 1PS3A 4JDZA 3L95B 3NJIA 3KLKA 2VWEC 5EBWA 1F90L 4QRPD 2NSQA 1IJ9A 2GT9B 4RGND 2AHIA 1ADQH 3BMVA 3WFBH 4ZI8A 5CNHA 3CC1A 4QRQA 1U8OB 3C5XA 1GJWA 2PYFB 5IROC 4PGDB 2N4IA 4HETA 1N2RB 2Z31C 3WLBA 5ACZB 2IBZY 3D2UD 3DRTA 3U2IA 4B9ZA 5CGMA 4N2LA 4HUVA 4DKFL 5D1XD 3GKWL 3L08A 4JFED 2ITEA 4G1MB 3ALWA 4S2SA 4XPTL 1DEEA 4NT6B 2XZQL 4EOWL 2DQMA 2DKSA 1NBYA 3JWOC 4GPVA 1P7QA 3QQ9D 4NKIH 2YMTA 4OJFL 1N5YH 2AK4A 3MUUA 2IAMD 4JJ5A 2JJSA 3CAFA 1AZCA 5JW4N 4AZ8A 1Y07A 2GJ6E 3F64A 2G9KA 3UZEA 4DUVA 5EU6E 1A21A 1DBJH 4G7YL 1EO8L 4LF3A 5IHWA 1NCDL 5CEXB 2P43B 1FIGH 2ZONA 4HC1H 2OL3H 4RMVA 4GBXB 1RFDH 1KLGA 2CMRL 1M42A 3ZE1E 3QQXA 4F57H 1AZUA 2FX8L 5D1ZD 3UYRL 2X4SB 1M6OA 1NFDB 1FNFA 2MQ3A 5DD1L 2YD0A 5DC9B 3SO5A 3CXFA 3WMQA 2YC1B 4YHIB 1QEXA 2F7RA 1YVLA 4C47A 4E42A 1D5MB 3ISWA 1PU0A 3F7VB 4WAFA 5AZEH 2VLJB 3FQTB 3IJHA 3V6OA 4PGBA 4RDQF 5IVXF 5F7HA 4OLZL 5AKRA 1E4WH 1UA6L 1E27B 4E9SA 4ZODA 1WA0X 4B7IA 1KLUA 2AJVL 4R4BA 1E3XA 3CCHB 5KVDE 3TVMA 3EO9L 4RMUA 3MUGA 5JPMC 1W0VB 1E5ZA 2YBRA 3JWNE 3WIFB 2XQYK 1I9RH 3RTLA 3FU6A 1K2DB 4HXBH 3NACH 4MAUL 1JHKH 4Y4HB 3QRLA 4H0HB 4L8CA 1IBZA 4PJ9C 3PL6B 4W9EC 1KENH 1N7MH 3NJHA 5FYJL 2VJ0A 2HTKC 2WSDA 3HHSB 3JWDH 4BGDA 1NCIA 1F4YH 4PJBF 5ERWA 4HJEA 3STBA 3MV9A 3IDNA 2WZ5A 4PJGF 3FTYA 3DK0A 3VE0B 4XNBA 1NBVH 1T1ZB 4H8WL 4YHZL 2IPUG 1U3HA 1DL7L 3KYMA 4NGHH 4O58L 2AK1L 4AV0A 1F8TL 4JDZB 5EBWB 4HX1A 1F86A 1RHFA 4I77H 3UPAA 5F1KC 4WFHE 4QRQB 5LBGA 2P5WD 3PXLA 3WLBB 5K59E 1PZSA 4OCRH 3DRTB 4PJ8C 1HU8A 4HUVB 4LCIL 1F45A 3OWEA 4PB9L 5B3SB 3GBNL 1OLLA 4H0IA 2V7NA 4J3WA 1TFHA 1FZMA 5JW5A 3CDZA 3QEHA 5F1SA 1NBYB 1P7QB 1AOZA 4CILA 1RIVL 2V3EA 1BW8A 5KZCB 1GC1H 4JJ5B 3GLAA 4PI2A 3WTYA 4HGMA 3EJJX 5AZUA 3STZA 4AZ8B 2XIIA 3FJTA 2JJUA 1A47A 5HPOA 4XAWL 4AENA 4B5ZA 5I1HH 1NAMA 1FYHB 3GLDA 4LF3B 3F6IA 4ZQKA 5BUPA 4EI5A 3LRKA 1FO0B 1NMAH 4GRWB 2BFGA 4OQTA 2WP3T 5D55A 4U7MA 2EEXA 1PBYA 1KLGB 5K93A 3U0TA 4G8GD 1MREH 4HPOL 1M6OB 1T7VA 1X5AA 3ZYZA 2APTA 3Q13A 3T0EC 3B7UX 1MNNA 2QQQA 4OI8A 3V0GA 4PGBB 1X5FA 5DZVA 4FNQA 3OTTA 5EO9B 1KMGA 2JB5H 3MBED 2EACA 3EDFA 4XXDA 1P9MC 4GSUA 2G3MA 1HHHA 2D0GA 2XPZA 1PG7H 4R4BB 3ETSA 4BXVA 4OB5H 2BY0A 3TVMB 5EEXA 3IFOA 3U36A 2CK0H 2CLZA 4FNRA 1KN2L 3LS5H 4JFDD 1G0XA 2R56L 3HJEA 4HWBA 4NEHB 4D9RE 5AOLA 3ZKMC 4Y89A 4L8CB 4G6MH 5CUSH 4BK5C 2K6WA 4XPGH 1BCIA 5GS0L 3QFGA 4QJ3B 3D1MC 3ATFA 2Q2EB 4DP7X 2VDNL 3QWRA 5IMLA 2DOCA 3BMWA 1W8EA 4LPYA 5ERWB 3VWJD 4KO5A 3MV9B 3IDNB 3VD3A 5JHDA 4DPBX 2WZ0A 3DOSA 5A2CA 1U3HB 2K78A 3KYMB 1XAUA 3EJQA 4HX1B 4CSPA 5CEZH 4MNHA 5CJ5A 2FHCA 3L4VA 3U25A 3FCSA 3HMWL 2XYCA 1ZTXE 5IBTL 3ZTNL 1NMCB 2J6EA 4LL9A 2AZUA 5JHLH 3QO0A 3EFOA 1DJWA 4RWYH 2XYBA 5HGHA 2K6ZA 4A2FA 1L0QA 1OK8A 2V7NB 2X4PA 1FZMB 1VESA 2DQEL 1P53A 1N10A 3VXUD 3CDZB 5JW5B 4OVVA 3M86A 3QEHB 4PS7A 3MGOA 4XX5A 1KTCA 3P9MA 1W72H 5D4JA 3QDGD 4Y5XA 5AKTA 4ZMXA 1ZV2A 4UZUA 2IGLA 2F7OA 4B9CA 2A4EA 4GXFA 3V0FA 1F56A 1PDKA 2O5XH 1MCNA 2G9HA 4FI6A 3LZNA 1FAKT 2DLIA 3GIZL 4URKA 4AENB 3JWOL 1NAMB 2DLEA 3IMWA 3VQ2C 2NTFA 2YR3A 3G9AB 4EI5B 1GJUA 3VXPA 3DUHA 2VLRD 4KTYA 2ESVD 4PJHA 2ERJC 3U0TB 4Y4KC 4IRSA 5JA9A 4YEEA 3Q8BA 4F92B 1ICTA 3CNKA 4X5LA 4XMLH 1PF3A 1SVZA 5B38A 4L4TA 3D87B 3OB8A 1SEBA 5D7LE 1U4EA 3QDAA 4XGZA 2FJUB 2F68X 1I82A 2GSMB 3O9WC 4H1LG 4N2HA 4UILH 4Y1SA 4HWEL 4XXDB 3G5XA 4G8FA 1FNAA 1HHHB 1S7QA 4QHUA 3VG9C 5L9DH 1D5RA 3OR6A 1FFQA 3ARTA 2XOTA 5I6NA 3U36B 2CLZB 1U2HA 3QXDA 2WB7A 2ED8A 4NFDA 4TNWK 2KPNA 3QWQB 3BPCA 4U1GB 2AJZA 1TTBA 5EU3A 4R97C 3BT0A 2UVEA 4FYQA 4QKTA 1J5IA 2WO2B 4XNDA 2FATH 5IMLB 2H1LM 1TUPA 3LHAA 4RQQA 4IDJL 2OFQA 2ZXCA 1ZHNA 5JHDB 4I3SH 4JR9H 3LMJL 4P2RE 1JVLA 3D06A 3N1QC 3DOSB 3D69A 3D4YA 5EHFA 2CXKA 1MXDA 3M88A 4MNHB 4AL8H 4PJ7F 3DROA 2OMWA 1XBDA 1PCXA 4L4VD 4MD4A 3FAWA 2WUCL 5T3XH 4MXVF 4ODBD 1MHPL 4KBPA 4Y4FD 3RVWD 4L18A 3VGFA 1CTOA 5FLVA 3IKKA 5F96L 2JI3A 1I1CA 4ODUB 4OLXL 4IGBA 4UDTA 3W5NA 3QO0B 1MCHA 3AU1A 1Q72H 5HGHB 2Y7QA 3KLHC 5GZOC 3BSGA 1IGCL 3E3QE 2D7TH 2X4PB 4W9CC 3KPSA 5GSRA 1U91A 3IFNH 2OW6A 2K7QA 3QUML 3JZYA 4FCAA 2FT7A 2ZG3A 2WK2A 2PPFA 3MGOB 5CILL 3NAAL 4Y5XB 1RUQL 4JHZA 4X6CA 1OP3H 5KUKA 3BH4A 5JDJA 1LO4H 1PDKB 4NZ8A 2P5ED 2G9HB 3H2WA 1CGTA 1R33A 5HTSA 1DN0A 2MPVA 3L7EA 5AW0B 3P9LB 1GTFA 5D93B 3TT1L 1BJ1H 3NA9H 1VADA 1JG9A 2NTFB 3HTLX 1HCFX 5EEUA 4XX1G 3VXPB 2CRZA 1IGFH 5I19L 2YPLA 2VM9A 4LASL 2Q3ZA 3QVAA 4M00A 32C2A 2FWLB 1B2WL 4PJHB 4TVPL 1QP1A 2H2SD 3VX0A 5I66A 3EJZC 2CNZA 1AYRA 4IRSB 1R3HA 3BKML 1A3ZA 5E51A 3DARA 1JGEA 5JXAH 3IMRA 2ENYA 5B38B 3BWSA 4L4TB 1YNKH 3LSOB 4DP5X 4AV4A 1SEBB 4LIQE 2EVJA 4ZS7H 4MZRA 2G4GA 4XGZB 4AI7A 4XCCL 5FW8A 5ITFA 3U79A 4EO5A 4NQCD 3G5XB 5BO0D 4G8FB 3CLEH 1A1MA 1KPUA 1S7QB 2HPOA 4QHUB 5IQLA 4Z78A 1MFCH 3OR6B 1JZHA 5D7KE 3UBXA 3HMXA 1JWMA 5F97E 3QXDB 1M2VA 3FSOA 4QYOA 3NCYP 1WBXB 1SUHA 1MELA 3L2NA 4K3JH 3KAAA 2WO4A 3BPCB 5F9AC 3WN5C 2AJZB 3IMUA 3CQFA 4KXDA 3CSBA 4XXCC 4NKQB 4NFCA 5EU3B 3ZYOA 3P3TA 4GSQA 2VZ1A 4H25A 2V9TA 2HX8A 2V9RA 4DPAX 35C8L 1JERA 3V6FA 2O61A 1V55B 4RQQB 3O4LE 5B3JE 4WI5A 1ZHNB 3ZRSA 2DD8L 2DEWX 4MTMA 3V8CA 2UXGA 4H4NA 4BQ6A 3D69B 5CZRA 5AYTA 3X1GA 1FG9C 4LSQH 2PW1A 4BIKA 2WXOA 4RETB 5CM1A 4F3FA 3CD4A 5EWIH 3O6FA 1B0IA 2LLLA 4IMKA 4OVUA 3DROB 2OMWB 4N0RA 2ZOUA 2E27H 3DJSA 3RUGF 1I85A 1RIUH 1FHGA 4PLNC 1PKQA 1YNTF 3GNMH 4KVNH 2NCEA 4PRHE 4B9KC 5HGBA 2ZWLT 4UDTB 4IGBB 5DRNA 3WFDH 2DM2A 3UP1A 4LARH 3AU1B 2OSWA 2DM3A 1NIDA 2Y7QB 2ZJSL 3DYPA 4R6UA 3RZCA 2EP6A 4XNAA 4Y5YC 5GSRB 3QZWA 1MZZA 1U91B 1FZOA 2WBJC 2NY0C 5ESAA 4XMKL 5L0QB 2BRRH 4NUMA 2V9QA 3S5ZA 4X6CB 1CU4L 1DDTA 2EIEA 3FHQA 3K3QA 4D2NA 4K5PA 2D03L 1RZKC 4R0LA 2DYSB 3U6RB 1ZGLP 1DN0B 3L7EB 2QQKL 4MXQC 4PLKC 4EZMA 3LH9A 1VADB 4JO4H 3JVGC 5DC2A 2CO1A 3I85A 2YPLB 4GBXC 4J3OG 1KXVC 3GHBL 2NR6C 4R84A 5DHMC 4YAQA 4GAJL 3QPQC 4GO8A 4KPHH 1KJMA 32C2B 4LSSH 4LVOB 5CHNA 5L7XH 3O4LA 5I66B 5KS9A 1R3HB 4K07A 4RZCB 1TETH 1JGEB 3IJ8A 1CGVA 6PCYA 4ZX4A 4I3GA 5T33H 4ZS6C 5F7WC 2BY3A 4OLVL 1L6XA 2ZG2A 4KTGA 2OW7A 3FTZA 1QHQA 4M8UA 5D70L 1TSHA 2EXYC 5JQ6L 4EDWL 2CJUL 2M26A 5ITFB 4MVBD 4HIXL 3H7LA 4LQFH 1J5DA 1DVFA 1DLFL 4K71B 4Z78B 1A1MB 1KPUB 2R59A 4LFHG 4TULL 5AB2A 4JANA 2G3ZA 3UBXB 2HJKA 1JWMB 4OD1L 4MAYA 4A7SA 3KVPA 1M2VB 1MY5A 4QYOB 3I6LD 1KN4L 4GI8A 4I5BA 3IJSA 1KPRA 5D4QA 3PL6C 3ALXA 4CU6A 2WLKA 1DBMH 2HKFH 4H25B 2GIXA 5FW7A 2BSSA 3V6FB 2O61B 2Q2LA 3I74A 2EDHA 2XTJC 3GSUA 1X7SA 4MCZA 2VLMD 4RIRA 3TCLA 4BE5A 4ZSOE 1NZRA 4J8RA 4MJJA 3DPBA 2NXYD 5TPWH 5IVNA 3CFNA 5MENA 5FW6A 2PPEA 3EXLA 4YS4A 5F7DA 5ANME 2PW1B 3LOWA 3RVTC 3VB9A 4F3FB 2ZKHL 3L5HA 3O6FB 1ONQA 5DURD 2WXQA 3GBDA 3KE0A 1KB5A 3PGFH 3OPUA 2F54E 1H6TA 1WD8A 4Z76A 1PKQB 3MNVB 5CZKA 5HGBB 1JVOA 2X89A 3WIHL 3PHSA 5DRNB 5G4NA 4F91B 3H9SE 4DTGH 1BM3L 1A7RL 3P0YH 4MJID 1UHVA 2PR4L 3CE1A 4P59L 3P30L 3SKUD 4WY7L 3RZCB 1E4XL 1A7PH 2ZCZA 3QZWB 1IAII 2R23A 2VDMH 1DCEA 1WZLA 2AGJH 1KGJA 5ESAB 5GPRA 3FTWA 3DX3A 1JGLH 3N44F 4WEUD 2HX9A 3K5RA 2JCCF 4WZ9A 4NJAH 3HR5A 4AYGA 3SDXF 2BWQA 5ENWA 3RI5F 2AXFA 5IHBA 3WTWA 3I75A 3PREA 3TA4D 1EEZA 4R0LB 4KY2A 2VO5A 3KPNA 3QJHA 4GRLA 1E7UA 3REVB 5T3ZL 2HKHL 4BINA 5DA0B 4E9XA 3WENA 5GGSY 1SFDA 4YUEL 1NL0L 4DVBA 4O2CA 2EO1A 3R1GH 4W9KC 2YN3A 4OZGE 4QTFA 2F19H 3MV8E 4LO9A 3GSQA 5KYNA 4H1LH 4YAQB 4ADJA 5DSCA 1NC4A 5CHNB 1KJMB 4EN3A 1JMZA 5KSBA 5I5RA 1MJ7L 3MRHA 3O4LB 3MLWL 5KS9B 4KROC 1BYOA 4ZW5A 4HAKA 2H47C 2YFOA 2ZWYA 1SQ2N 3O6MH 3UL4A 3SQBA 2WLHA 2YKKA 2F53E 1ZEAH 3UTPD 4DZ8A 3PNRB 5ANMA 2ARJQ 2GJJA 3Q1SL 3BXNA 1TPXC 3IDYC 1LWJA 4LLQA 2QZQA 2F54A 3BOVA 3L48A 1DHKA 5FCUH 1FNLA 1MCOL 4PRHB 4JANB 4U6XA 4Z95H 1EANA 2HJKB 5F7FA 1R3KA 5INCA 5E99H 3H9SA 4MAYB 4G43A 5D6DA 4OD3L 2E56A 3A67L 5E5UB 5I1KH 5DUMH 1JXDA 4I5BB 1ZS8B 3IJSB 2MCPH 1KPRB 3PQYA 2E47A 2H7WA 1WG3A 4WEBL 1NINA 3ML9A 2BSSB 4NRZB 3VXTA 1VZHA 4Y5VC 5HYIA 1UCBL 2NY2B 1NFDF 3GSUB 1O9WA 3PP4L 4PUBH 4RIRB 3TCLB 5AKSA 4J8RB 2C3WA 1WTGT 3DPBB 2GKIA 4MB5A 1KWKA 3WKML 1J9RA 1U3HC 1UGKA 3D09A 3FL7A 4ZUTA 5MENB 1KTRL 2ICWA 4HCIA 4HCRL 5F7EL 4MA7L 3I3DA 2C9XA 1RCYA 1ONQB 2KYIA 3EH4B 3MJ9A 1NICA 4J12A 4KXZH 1D3CA 1KB5B 1NUFA 2B15A 1VENA 3EOYG 4AV5A 4NQEE 5E5MB 1PLGL 5E7BA 5F1NA 1EDHA 2YRPA 3MLSH 3MFFA 4C8XA 2M2DA 3AFLA 4Z76B 1YEKL 2O93L 1M3JA 5FUZL 4OKVA 2EXWD 1C5DA 3CN2A 4F37K 2F08A 3P4OA 3ARQA 3GXTA 3MNDA 3CBJB 3QIBB 3TYFA 4K73A 4U3SA 3B9KD 1U21A 2R23B 3D48R 1T7YA 3BVVA 1QLEB 2WCSA 3HG4A 1JPFA 3BFOA 3G5ZA 2DKUA 1L7TH 3KBEA 3RI5K 5C0CE 4J3OD 5C07A 1LWHA 1KNOA 5LVEA 3HR5B 2MKLC 3II3A 2F7IA 5ENWB 3JWNC 2AXFB 3I75B 5ALBH 1EEZB 3KPNB 3QJHB 4GRLB 2WZ6A 4Y9CA 4J4PC 1T0PB 4LSUL 1EPFA 2FRGP 2HYMA 3EUDA 1KV3A 3T8MA 2VXSH 2R2CA 4L3CB 1M3IA 2ZUTA 4DVBB 4O2CB 3PCYA 4Q8BA 2XVBA 3GBLA 3EOTH 4F8OA 3GSQB 3A21A 4NQVA 3KR3H 5E2TL 5DSCB 1NC4B 1OAQL 4KK5C 4LNVA 3CMGA 4EN3B 5KSBB 3BKYL 3IGKA 3MRHB 2WXPA 4L0PB 1CR9H 3N40F 4AMXA 4LFHD 4X9HA 1Q9WA 1F3RB 2CGZA 5C71A 1SHXA 1AKJA 4DOHE 4NUPA 3SQBB 2JTYA 1YEDB 4DZ8B 2I9TB 5ANMB 1X44A 1IZJA 3OAUL 2BM3A 3ALPA 3MFGB 3NJVA 3VFWA 4AYDC 3QZOA 1Q0XH 4LLQB 4HGWA 5KVGL 1WEJH 2F54B 4NQEA 4BZ2H 4GT7A 2RQEA 2DIJA 3WNIA 1T0NA 4U6XB 1WS8A 4Z3TA 1VGKA 3FAXA 2J2ZB 1AO7D 1R3KB 5INCB 1FGNL 3H9SB 2YKLH 1CK0L 4G43B 4PJXE 5DMKA 1T20A 4YHKL 2DQDL 1KIQB 2CH8A 2NCMA 3FKUS 2A4ZA 4JW3A 4YE4H 3N9GH 1CE1H 4GRWF 3PQYB 1J12A 1S7TA 1TQUA 4JO8A 4Y9BA 5IMMA 2YN5A 1BG1A 4G71B 4ABWA 1WT5A 3HVDA 1WFTA 3SN6N 4M3KB 4XMUA 3VXTB 3W3BA 1QFWH 2F7PA 2DH3A 4QXTB 4LMQE 1WZMA 3FN9A 1RXLA 1ODUA 4QRSA 2J55A 3ZDZB 4F58H 4HKXA 2EUVA 5GGTH 3Q8FA 1MIEH 4ZUTB 3EH2A 3SE3A 1JZEA 2ICWB 1N9PA 5IB2B 5I8OH 3Q2CA 3UEQA 4BKTC 4TNVF 2GPZA 4OZGB 3AQZA 5SV3A 1MCWW 3KH4A 2EIKB 4R2GD 3WKPA 1IKFH 5B3NA 1G0DA 1HDMA 3MFFB 2N7BA 3FN0H 3DV4A 2H2PC 4JZJA 5JLZA 1R3LA 3D07A 1BQUA 4APQA 3K2UH 4OKVB 2DBLH 1OQXA 1C5DB 3OKDA 1AQDA 3C12A 3D3VD 2JI1A 3P4OB 4U0RC 2F53B 3OHXA 4D7PA 1MNUH 5A3IC 1X4ZA 3TYFB 4U3SB 1JZ5A 4RMRA 2D3LA 3F12A 3WOVA 1KCRH 2W1NA 1GOHA 3JTBA 5LXGL 1JPFB 4XVSL 3S9DB 4DQOL 4ZMTA 2HSIA 1W16A 5C07B 2OBGA 4Z0BL 3NSFA 2CM5A 2BIQA 1GGCH 3UTSE 4P5TD 2CNYA 5C0BA 2D31A 5CLTA 1A6TA 3ECQA 1ZS2A 5D93C 5GGSA 2DBJA 3A6OA 4B95C 5DYOA 4TKWA 3HG1A 4YDIH 5B22A 5SWQA 2KKQA 4Q6IC 3DXAE 2EUXA 5IQ9B 5KANI 2FO8A 3NZUA 3RVVC 4NQVB 3TN0A 1KELH 3PAYA 3ZE1F 1CXKA 4N25A 1OP5K 2YWYA 1Q9WB 1WIPA 4U49A 4YSTA 1A7QL 1MAML 1AKJB 1FO0L 3VVWA 4I18A 3MXVH 1PYWA 2MOVA 3W11C 3SPVA 2CBMA 1QRKA 3IXTB 3VG0L 4BCZA 5JA8B 3VFWB 4PFEA 2HFEA 4HGWB 4PWFA 2Y4SA 3QEQE 4NQEB 4YHML 2HJLA 1JYNA 1DQIA 1T0NB 2YOAA 3T1FA 1VGKB 1OGAD 4XVTL 4CBZA 1E5CA 4MAZA 3G6JE 4F2FA 4RMSA 2LU5A 4R4FL 5DMKB 1T20B 2CSPA 5CSZA 3GYRA 3QXVA 4FXGA 3CSTA 1IC0A 1C5BH 2KMWA 1S7TB 3CXHJ 1LEKA 3CDFA 1OCWH 5T1MA 2I7OA 4JRXD 1XCWA 2J1YA 1BXVA 1NFIA 2YD3A 3AG2B 3BEVB 5C0CB 1NTDA 4G6FB 1MFMA 3NCWA 4XMVA 4QRSB 4HKXB 1WBZA 3CH1A 2FBRA 1XIWD 4OGAD 5E6ZA 5E9AA 2WLLA 3BAKA 2CM6A 1FUNA 1A7BA 3FQWA 1CYGA 2VN6A 4IS6A 2O6EA 1SMOA 5E24E 5TK4A 3TNMA 2YGVA 3EH3B 3FXIC 3VXOA 4ZMZA 1UWYA 4TMPA 2XZCH 2DV6A 1HDMB 2ID5A 4XH2A 3QYMA 1E8XA 4JZJB 3DV4B 1DSYA 1R3LB 2WXMA 3LB6D 5LCVA 3GM8A 2EKJA 3OKDB 1YEEL 3T3PE 1AQDB 1S9WA 5AD0A 5F3BA 3H56A 5CCHE 5L2KA 1AXSB 5FM4A 4KKNA 5AAMC 3OHXB 3L4ZA 2MNWA 1CLZL 2ITCA 3TU6A 4XN1A 3F12B 1R6VA 5GJSH 2C1PA 1DQMH 2IH8A 1YEIL 2WXKA 2R0KL 3KBHE 1L5GA 3H0TA 1ACYH 3QEQA 2Y5TA 4CSTA 2JKIS 4KNTA 1DVTA 3TT3H 4PRPD 3SKJL 4UIKL 4PJXB 1A6TB 1UG9A 2FK9A 4B5EA 2GY5A 2M83A 5DYOB 5AW3B 3FT0A 3HG1B 4OT1L 3IVKB 1X6NA 5SWQB 1W6WA 2LFEA 2TRHA 1CFMA 2YQBA 4QRTA 3V95A 3Q05A 1E50A 5SWZE 4D8OA 5KVDL 5CCJA 3WTUA 4CU7A 2H1XA 3EHBD 3CK0H 5IJBC 4LVOC 1KUMA 4FQ2H 3TN0B 4CUCA 1G5AA 1E40A 2ZYRA 4HA1A 2XWJA 2YGPA 2EDKA 4KK9C 5CU5A 4S1RL 1WZ1H 2WLIA 3AY4A 1TYJA 5E9NA 5ITBH 4L4JA 3P4LA 3QDJE 4JPQA 3IS1X 4HMDA 4I18B 5EN3A 2IGTA 2F1BA 3SPVB 1CICD 1LWRA 1SOXA 4XAKE 5D2NE 1QSFD 4PGCA 2KS0A 2J5WA 3EJSA 5J89A 2HFEB 1SVBA 3CZGA 2WYIA 2HJLB 4OJYA 2W94A 3WAKA 3WHXB 3T1FB 2IDQA 4NWTL 1VFBA 3QWOA 1URZA 3KPRD 5LWYH 1KJ2A 1A4JA 1RVFL 5JPNA 4GXUM 5CSZB 3E3QC 2YPVA 3V5KA 2WW8A 4LSPL 4FXGB 5KBPA 3TL5A 1NKGA 1OGPA 1LEKB 4PG2C 3S8GB 4P46C 2WQSA 5T1MB 1NFIB 4QRPE 2BZCA 4MMXA 1JYVA 4FL4B 2D9CA 4RGNE 5I74B 3GRWH 4N0CC 1MW0A 2QT6A 3LJ3A 4ZUWA 1SY6H 4XP9L 2ICEB 1WBZB 1G7LA 4GQPH 3PWJA 1V3JA 3LH8A 4UNIA 4Z7OB 2EIBA 3F58L 2WLLB 4ODWA 4U1MA 4Y9FA 5DUPH 5L6YL 3VFVB 4JGUA 3LNHA 2R8SL 3FQWB 4IS6B 4Z7IA 1OOAA 3S3BB 2WAHA 4XPHL 4LRIA 4JE0A 5D1XE 1IC4L 3TNMB 4JFEE 5FDWA 1X9QA 4N5EC 3VXOB 5EF0A 4JM2C 4JO1L 2ZICA 3FHEA 3BJLA 3T8VA 4ZW7A 1ZIBA 3M07A 3NK3A 5TF0A 1S9WB 5F3BB 3ZDYB 5AD0B 2R0ZH 1RSFA 5L2KB 4MA3A 3VGEA 3DUSA 4UOZA 4PLJD 3B6SA 2ITCB 2P49B 2WNGA 3OF6A 3UPRA 4HK3N 2C1PB 5CZXC 1CB4A 4XC1H 3RKPA 3H0TB 1M7DA 1KCUH 2B3IA 3NYKA 1L5GB 3QEQB 3QORD 2Y5TB 2E4TA 5FAAA 4Q9BA 2DQCH 1QABA 4KY1L 1UXWB 1TJGH 4E9TA 1IM9A 4KNQA 4EKJA 3ARED 2EH7L 4KRPC 2TSAA 1P2CA 3O2VH 3QDMD 3BVNA 2H1PH 4X8CA 5JZ7C 1L7IH 5B8CA 2DJUA 1OM3H 4M8QA 3C60C 2X4TA 4QRTB 1FN4A 4P23C 4F2ME 4GMTL 1IVLA 4LB8A 3AS3A 3L9EA 4ETQA 3NSXA 2XWJB 5KYYA 4MA8H 1AQHA 2XG5A 2WLIB 4GAFB 1M6UA 4QXWA 5EUOA 3V79C 1QD0A 1JK9B 2Z35A 1G9NC 5DHVA 4AVHA 4M93B 5B7FA 2ZF9A 5GGQL 4YO0A 3DKHA 1XR8A 3QRBA 3HG3A 4Z0XA 2AEOA 1FNSL 2FAUA 1ZANH 3HN8A 4PJFE 4G8IA 2QKIC 4PGCB 9PCYA 3V7MA 2WCPA 4XWGH 4XP1L 1B0GA 1XAKA 2ARJA 2O5ZL 2VDPH 4X6CF 5A2FA 3IRCA 4R4NC 5ALCL 5E1GA 3TEUA 3GGWA 4JQXC 1K4CA 3IDMA 1VFBB 4G7VL 4OM1L 1U95A 1GPOL 4GQ9L 1KJ2B 1A4JB 1ET8A 4AQAA 5JPNB 2VDLB 3V5KB 1P7HL 3ABMB 1ZTXL 4AMWA 3B56A 4GO6B 1BA9A 5EC2A 1J0IA 2NY2C 4X8XA 4YBHA 1QWUA 4MMXB 2QVMA 2VDRH 3FFOA 4HHAB 4HK3J 4QRAA 3QDHA 3QUXA 4ZUWB 2XTLA 1LE9A 1YUKB 1BYNA 1G7LB 1A2YA 2XQYG 3WY1A 3PWJB 4LPCA 5JO5A 3F3HA 4ODWB 2P5WE 4U1MB 4ACTA 2E3VA 4M62L 1KEML 2DTSA 3PAZA 2AXWA 1XXFC 5CLWA 2I24N 1A7NH 4ZD3L 5FDWB 4QHKJ 4JM0A 4LP5A 5D7IA 4L1BA 3RY5A 3BJ91 3UJJL 4JRFA 4M8RA 3DMMD 2R27A 4QTIL 4JKMA 4FP8H 3BE1H 2WNWA 4X8GA 3QDJB 1UYWL 3QIBC 4K8RD 5I18H 2BP8A 3DUSB 4JREB 4ZFQA 3B6SB 4Q7DA 5I8KH 3SE9H 1INEL 3J2PA 3L1EA 3OLEA 3UERA 4P9HC 1M7DB 4J27A 4GI6A 2EEAA 3BWZA 1OSYA 5D7SL 3CHSA 3IMVA 2XACC 4LLUA 5A2LH 1IM9B 5KSAA 3O8XD 2JIXD 3KLSA 3DOIA 1P2CB 3N42B 2NSXA 1QHPA 3BVNB 4G8GE 5B8CB 3I9GL 1S3KH 1S9YA 3RX5A 3TO4A 2LVCA 3FBKA 1OLZA 4M8QB 2VR4A 1I1AA 4X2UA 2X4TB 5BRZD 4E5XG 1E8ZA 1FN4B 3MODH 2KT6A 4FJ6A 3ZOAA 2R51A 1Z9OA 4GIPD 4ETQB 4JM2F 5DGQA 1ZVYA 4XNUL 1DUYA 5DJ0A 1T83A 3AUVA 3ZTDC 5KYYB 3K0WA 2XG5B 4GSXA 1MFVA 1ZD6A 3HBQA 2J8HA 2Z35B 4N9GA 1FNHA 1FLTX 1UWXH 5DHVB 2PTTA 4RFEA 4FX5A 5AW9B 2VDKH 2NY6B 3CUPA 4Z0XB 1GGIL 4JFDE 3D2UB 3HI1A 3TA3D 2YD9A 3WKQA 4ZAKA 4UNVA 4G8IB 3WFCH 1DLHA 5TE7H 2L0DA 4RH4A 1J86A 2ARJB 4J6IA 1LDSA 4NRYB 3QCUH 3GGWB 1CLYH 1K4CB 1NOAA 3IDMB 5D6DC 5FHBL 1U95B 4GNKB 3UJIL 4F7CA 1A3QA 2Y23A 3C6LA 4N2IA 4AQAB 5CINL 2LU7A 5BQDA 4BUHA 1FV1A 1OT2A 5E1AA 3ELAT 3M7OA 3MZTA 1J1XL 3A6BH 5E9DA 4F7KA 1ZVHA 2CJTA 4ELME 2OMYB 1R46A 1HSAA 3HMXL 2XRAL 2CO2A 4UT6L 5B3JF 5IW3A 4DUXA 2AP2A 4TN9A 2J88L 3QUXB 3VMOA 1OTSC 1T1YA 4H8UA 1LE9B 1A2YB 4ZMYA 1H3XA 2Q20A 4Y2DA 5JO5B 4M7LT 4M6MH 4RBPH 3CG8A 4PJEA 4G9FA 4P06A 4KKAC 3C2SA 3ZLQC 1MCFA 2CPUA 3B7TA 4JHAH 1MHHB 4NYLA 5D7IB 1FDLH 3MLVH 3D0LA 4HWZA 2EYRA 3GXMA 3MBEA 1CXLA 1MWAA 3VXUE 2Y36H 2C9QA 3MLYH 5GZNA 2QKSA 1KTDB 3QDGE 3SE8L 1BV8A 1EGJL 3X11A 3FO9A 4RLDA 2VQ1A 2A6JA 2BP8B 5CP3H 2I5YL 2NY3C 5FC9A 2WGXA 4PREA 1KCKA 3T6ZA 1HQ4A 3OAZH 2GBTA 4X9GA 4JO2H 5C0AD 3QCTH 3S8FB 5DRWA 7FABH 5DMJB 3U9PL 1UJ3C 2DLFL 4ZJ9A 1OV8A 1CS6A 2VLRE 4WIQA 1ZLWK 3WMSA 1DSFH 4LLUB 5HYSG 4HPYL 4LIQL 2KZWA 5KSUA 5KSAB 3QH3A 2W91A 4BBWA 2ESVE 1S6NA 3VI3E 2JNZA 3TO4B 1S9YB 4I2XE 7PAZA 1PKOA 1I1AB 3JUYA 1T5KA 5C0JB 2VAAA 4X0NA 3ATDA 1VRSA 3DETC 5KJ7E 3IJEA 4HALA 1DUYB 5DJ0B 4M1DH 1NFAA 3Q8CA 4TSAH 3LQAC 3B7SA 4UAOC 4ZMVA 2J8UA 5FK9A 5CEYB 3WTTA 4L8DA 4N9GB 3KBFA 1WP6A 2PTTB 4RFEB 3W0WD 3MUY1 3CUPB 3SJVD 4ZAKB 1IAIM 5EORL 1DLHB 4LQ1A 1A7OH 2IAND 2DQIL 2XPGA 4QGTA 2UVFA 4YDMA 3RIAK 1BFTA 4G8AC 1EEQA 1G9NL 4OCYL 3QDGA 2XICA 1MCPH 4F7CB 4M02A 4L8BA 2BVUA 4C59B 1VCAA 1SVCP 1FV1B 2V2WA 3HZKA 4KWUA 4Z9KB 5E1AB 1O0VA 5I0WA 5E9DB 3QXAA 5EBMB 1PVHA 4GSDL 1HSAB 4S1SH 5KSBF 2VZSA 5I6MA 3P3SA 3UG4A 3V4UH 4TUOA 2UWEE 4L4VE 3DHMA 4R90L 4DN3L 4UQBA 1Y7VA 1D2OA 4ICXA 3WL9A 5FGSA 2B5IC 4Y2DB 3TO2A 1P84J 4XPBL 3O45A 4JFWA 4M7ZC 1OAZH 2BNQA 4PJEB 5FO9A 2XWBA 4QHNA 4G9FB 5F3HA 2XN0A 5E6IA 5FB8A 5DMGC 3K7UA 4K9EH 3GBEA 4UF7C 4A2DA 3TJHD 4NYLB 3D0LB 2FX7L 2EYRB 3MBEB 4HWZB 1MWAB 5EIVA 3V4PA 2X9YA 3BIAX 1YEFL 3S5LA 3LKQA 1TLMA 3FO9B 5D7JD 2A6JB 1VDGA 1MAKA 1VKXA 1HN1A 1TEFA 2K4WA 2P5EE 4NKDB 1HQ4B 2X9WA 3F6JA 2OXHA 3VA2C 4N1EA 1BQ5A 2CR6A 5JIQA 4ABUA 1QQDA 5DRWB 3L1OL 5T1LD 4TOYL 1SOSA 4I87A 1A9VA 3ZDZF 1EO7A 4A2EA 4PPTA 1DR9A 4HCGA 5I6OA 3QIWD 1IEHA 2H0FA 5KSUB 3S34L 4KZDL 3QH3B 1J0ZA 4IMLA 3RTQD 2XY1A 2DQGL 3QW9A 1TTFA 3DI2B 4L3ED 3GKWH 2R1WA 4OZGF 4P9HL 2VAAB 2XZQH 5IKCA 2YAHA 4NP4L 4TXVB 4EOWH 2ZUXA 3TZVD 3UAJA 1XGTA 3IJEB 4NNPL 5A6IA 2K7PA 2ZWZA 4G11A 4JB9L 5ELIA 4NQCE 5LGKA 2BXZA 4I8DA 3KL0A 3ZN6A 2ADFL 1ACZA 2J8UB 2FSEA 5FK9B 2YHGA 4L8DB 2J57A 2F5AL 5IQMA 1EO8H 2CDEA 3LZLA 1NCDH 4HJGA 4DP2X 4CVUA 1WJ3A 1MPAL 5GRJL 2Y24A 3A4EA 1IGTA 2XPGB 4N4YB 3EIFA 4FFYH 3N41B 4UI2A 2CMRH 3HG0A 3S96A 1A4KA 3QFDA 1BAGA 3MPCA 3VU2A 3QDGB 1UD5A 4L8BB 2HCZX 2E75C 1T0OA 1MJ8H 3HZKB 4HIJA 4QYAA 2FJHA 2Q8AL 5TDNB 2X6VA 3QXAB 2H3XC 3Q5YA 4OLZH 1O7VA 1OGSA 2IDCA 1UA6H 3CFBA 4PIRF 4UV4L 4FL4C 5I0ZA 5I74C 1U36A 3KHQA 2AJVH 2XNAB 1DJSA 1DZBA 1UWEL 4TUOB 2ICEC 3BH8A 2ZPKL 3K4AA 4FKHA 2FEDC 3DHJA 3WL9B 4FFWD 3OVUB 3TO2B 3HAEG 3O45B 3V6ZA 2BNQB 1JGDB 3DX1A 5FO9B 2ROXA 1JMXA 3ROOA 1WUNT 4LLMA 4W9FC 5E6IB 5F3HB 5FB8B 5GRYA 3OGOE 1Q1JH 4BELD 2FVNA 5DR5L 3WD5L 4PWKA 8CGTA 2FLMA 1AGCA 1IVTA 5EU5A 3V4PB 1A8ZA 4C4BA 3IFPA 3RG1C 4L8SA 3S5LB 4Z6AT 2AMGA 4O5LH 1DL7H 2AK1H 1F8TH 1QSED 5AVXB 4KRNA 1M7IA 1WITA 5BRQA 1VKXB 1HK6A 2W65A 1BFVL 3FCTA 4F9LC 4XRCA 2OXHB 4JQVC 2BS9A 1X5HA 1NBQA 2XQBL 5EEWA 4X83A 1YMHB 2GW5A 4OCSH 3H1ZA 3HB3B 1SMAA 3UJTH 1I75A 2QPEB 2YA1A 3BP7A 3I9IA 3QZLA 2CBTA 3L16A 4IMLB 4TVSa 2L04A 3KGSA 4LCIH 4PB9H 4BFJA 2IF7A 2R1WB 4ANVA 3AQXA 1XDTT 1INDL 1YEJL 5HDOA 3VSQA 1AR1C 4ANWA 4ZMOA 4N2AA 4G1EA 4IOSA 3IDXH 5FFLA 1KEGL 1XGTB 3AY4C 3B5GA 4JG1L 3VFOA 4P5KA 1YLBB 2OMZA 1VIWA 4M93C 2FSEB 1WCQA 3FQUA 1BQRA 4WTZA 2BCKB 1EX0A 1R17A 2BVEA 2CDEB 3I6LE 2YK1L 4HJGB 2X53A 4HEME 1OW0C 1IGTB 4IOFD 4JFFD 3VXSD 2FYVA 3LQAL 3S96B 1BWMA 1A4KB 1H3VA 1WUZA 5KYUA 1KCLA 1I8KA 4PJXF 3EYUL 5C0GA 5JPNC 4NZTH 2NTSP 2VLME 3NSDA 4MDIA 4W6WB 3V0HA 3WXVL 1BXAA 2B7DT 2FJHB 2LFGA 1R3IL 4D9LL 1I8MA 1IILE 3RWEA 3K6SA 4XN7A 2XWCA 3NP4A 3L4CA 4W9HC 3GFUA 1LMKA 1HT6A 2ZCKL 3VDAA 2QJDA 2DQHL 4ZOBA 4GLRH 4OZFA 1BXXA 4G6JH 4YHPA 4UOW1 2LTQC 5I73B 4XMZA 2ZXBA 2R56H 3V6ZB 4P2OA 3ROOB 4LLMB 3ECWA 4MJIE 3GKZA 5HHQA 3TH3T 3GS4A 3UCQA 5GS0H 3DIDA 3FK3A 4UMGA 1WWAX 2HT3D 5T1KD 3VGDA 1AGCB 1O9ZA 2O4EA 3MROA 3GQFA 5TDOA 4BUQA 3C5ZA 3IFPB 4XX1E 2Y72A 4L8SB 5KW9H 2XA8L 4MRBA 2XPYA 4JREC 3WN6A 2E7MA 4PMEA 4OFDA 1FNGA 2Y7MA 5D2NC 1M7IB 2OULB 2W65B 4LSVL 2XVLA 3FCTB 5C0RL 2Y7SA 4XRCB 1DJZA 1PGRB 3LXCA 3K71A 3G3LA 4U6YA 1A64A 2FUTA 2D8KA 4HH9A 4HUCA 3JWDC 3QUGA 1K4DA 3BP7B 2WUBH 5JXED 4GEIA 2WINB 3UACA 2EZ0C 4HPHA 5KYXA 3BRFA 1QPPA 3H9HA 4XB3A 4MDJA 1ROCA 4FQXC 1O6VA 4JZNA 3RKDC 3BUDA 3CZNA 5DQDL 1IIIA 1FC1A 1V7ML 4G1EB 4O2FA 1A3LH 4RGNC 3EFDL 3OC5A 3FO2A 1UD6A 2EXSA 2CGRH 4JHUA 1X5GA 1FJ1A 3ZDYF 3TWCL 3VFOB 4P5KB 4C57C 2RCSL 4Z77B 2BXYA 5MEPA 2ZCHL 1GKOA 2OMZB 2C4FT 2X1WL 1X5IA 4B27A 3FQUB 1NH6A 4ERSL 1OSPL 3JWOH 1SPDA 5D1XC 3K6OA 5C0FA 5DRZA 1MCDA 2GG1A 2Q5BA 3H42L 1PZCA 1JS4A 2WOYA 2ZZUT 2Q10A 5C7XL 2DY2A 4RNRA 4PW4A 3QQ9C 1NCWL 1SXNA 3LCYA 3T0XA 4NI3A 2XCMC 3F7PC 2WLMA 5KYUB 1I8KB 1JF5A 5A16A 1DO6A 2LAGB 5C0GB 2IAMC 4ORZC 1GC1C 2EEBA 1MCCA 4MDRA 3L3DA 4G2AA 4MDIB 3OMZA 1GZQA 1Y18A 2WANA 3ETBF 3BKJH 1I8MB 3RWEB 5I76A 4HWEH 5I6KA 1UH2A 4I0PD 4AEIL 1VEOA 1RZJH 2VQ4A 4QF1A 3CGTA 4YDLC 4KK8D 4BXSV 3WIAA 4FABL 5FYJU 5C3LD 4OZFB 5D1ZC 3ARUA 4G8EA 5HI3D 4YFEA 1KZQA 1RUPH 4P2OB 4QTHA 2VTFA 5HHQB 4G82A 3Q6FA 5G4MA 3ULSA 2AEPL 1FL5A 4QY8A 4UNTA 3MROB 2IDSA 5TDOB 1AHKA 3C5ZB 2AJ3A 4IDJH 5F72S 1N6UA 5SWSD 3VGAC 1ID5I 2JKLA 5B1JC 3HFML 2CQVA 2ZUVA 3SPIA 4AMKL 1FNGB 4PSPA 4XCNA 2VC2H 3BQVA 2UZXA 4QRBA 4U6VL 5T5NF 2WUCH 2WWMD 5DC4B 3K71B 4NB7A 4U6YB 3OQ3B 4A55A 4N6RA 2NZIA 4OLXH 5F96H 4HH9B 5SX5K 1K4DB 2Q7NA 1H3TA 1LQSR 3KEDA 3FULA 5KYXB 1HEHC 4HYTB 1E6OL 4Z8FH 3H9HB 3S37X 4BWUA 1G7PB 1I1AC 3MNWA 4MDJB 4ECNA 4JZNB 3VD1A 3A24A 4PJIA 3UDWC 3QUMH 3DX6A 4CSZA 6TAAA 4M03A 1GHFH 4O2FB 4UQ2A 3FH7A 1N4XL 5CILH 1SGKA 1NAKL 2XG4B 4ZTPL 5DURB 3FO2B 1RUQH 1OOWA 2P28B 3LZOA 1FJ1B 3DURA 4Y1AA 2OXGB 2Y7OA 3BD4A 4UV7L 5CMAA 5MEPB 4RGMC 3BGFC 2EE0A 5HJDA 2FLRT 5DUBA 1QLFA 1UOVA 3UBGA 3H53A 3PXHA 1AO7E 3TT1H 1UM6L 2NX5A 4U3XA 1ZIAA 3T4YA 5DRZB 5C0FB 2OPCA 2P8LA 3CN3A 1ADQL 3SCMA 2DJSA 3WFBL 3CVCA 2BSCA 5FGRA 5AW6B 3VFGH 4RNRB 4TVPH 4FG6D 3MOBH 4X7DC 4LVNB 3EDDA 4E9RA 2KLTA 3BKMH 3N42F 3SPJA 5A16B 2TAAA 1HXMA 4FYTA 3PU7A 3L3DB 3HI6L 3KWTA 4UQEA 4WWKA 1Y18B 2DQTH 2V5MA 4U1IA 2XWRA 5FX3A 3U2JA 5I76B 1URIA 1NGQH 1G7IA 3VSUA 1TVHB 2GI0A 3AQDA 4KC3B 4Q2ZB 2VB5A 3TF7C 2LU3A 4QF1B 3KM1A 4NN6C 4YGAB 1LQBC 2NW3A 4PJ5A 1ZLUH 1CO1A 3QUZA 3EBGA 4G8EB 2GAZA 5ACMA 1F2QA 3SKNA 1PG7X 1DANT 1DBJL 3D3VE 4QTHB 3OL2A 3V4VB 1KTBA 1FIGL 4JFTA 3Q6FB 3ZE0B 2HFGL 1UD3A 3W2DL 3US0A 35C8H 3MBEC 4PYHA 2OL3L 3ULSB 1CGSL 1FL5B 4QY8B 4NS0A 4LCWD 1M4KA 3UCRA 1IB5A 3VRIA 2AJ3B 4NN5B 1QW8A 4R8WH 5DZLA 2DD8H 1MOEA 2F8XC 4PM1A 1F1AA 4MX7A 4PV1C 4Z7VE 2NNAA 2A83A 3AABA 3MLZL 2IOMA 4XCNB 2YUVA 5DZ9A 1UZ8A 4X4ME 2UZXB 5TJWK 3L7FA 2LQRA 1FBIH 5ICUA 1CXIA 3U0WH 5DD3L 2CA3A 4N85A 1UVQA 3BUYA 3OWRA 1AS8A 4N6RB 5LG1A 2I26N 5EB9A 4LLYA 5HD8D 2WN3A 3DSFL 3VWJC 4CDHA 4RMBA 5FOJA 1I9RL 3SBQA 4HXBL 3MNWB 3R18A 1JHKL 4PJIB 1S78D 2IPKA 4C4KO 3DX6B 3QNZA 1RV6X 1KENL 1N7ML 4G9DA 2BPBA 4NI6A 3PRZA 4XMKH 4UQ2B 4UM9A 4AL8C 1ERNA 3QS2A 5H2BA 2CO6A 2UX7A 1CU4H 2BHZA 3DURB 4Y1AB 2D03H 5CMAB 3H55A 1NBVL 5DUBB 1GXEA 1QLFB 3AWGA 4NGHL 5I23A 1B4RA 1OGAE 2PPAA 2E7DA 4AGPA 2NX5B 4NPKA 3ET9F 3HBGA 3P0VL 5ADPL 3T4YB 2PR9A 2P8LB 3SCMB 3FU0A 3MZGB 1UWFA 4RAVA 3S37L 4GAJH 5F7BA 2RR3A 1FFNA 3FT4A 4YHYB 2YAFA 5L2JA 2D3VA 4JRXE 4POUB 3TV8A 5HYQA 4PS3A 2JJTC 4LHUG 1HINL 4OCRL 3EYSH 1S9VA 3K80A 1F4WL 1HXMB 3BDYL 1BJ8A 4Z7VA 1G6RH 3DC0A 3PV6A 4CJ1A 4IKJA 5IVOA 1TQCB 5D70H 1HZHH 4U1IB 5AKVA 5AVSB 5JQ6H 4EDWH 4EMZA 1AKPA 5H94B 5A2IH 2Y0SA 1G7IB 5I16A 3PLYA 3BUIA 2YEQA 1JJUA 3BLPX 1AAJA 5DFWH 4FZEH 4I1NB 1ZLVH 1PD6A 1GC1L 2H26A 2NW3B 1YHPA 1BQSA 4PJ5B 3MRJA 3K1DA 3BPLC 1Z9NA 2DTML 3NDZE 3QUZB 2GAZB 3ARDD 1IC5H 4U2ZA 3SKNB 5JIDA 2D3NA 1DZ0A 4LPUA 4F9PC 3KW7A 5EZIL 4L9LA 2ZSWB 3LD8B 2Y7NA 3ARSA 4KDWA 1SYSA 5CKGA 5DS8A 1DVSA 2ICWJ 2F58L 2TRYA 3VRIB 3U46A 2VDQB 1MZYA 2KHAA 3FSVA 3FUEA 3OXSA 3LIZL 4JG5A 4JKNA 4KH9A 1NDMA 2FL5A 4MX7B 4JFOA 2NNAB 2IDTA 2A83B 3HHRB 1CD8A 1KULA 4PRPE 3X1EA 2ZKHH 1UZ8B 1E4KA 3UGXA 1TENA 2WMPA 3L7FB 4PTUA 5AB0A 1PG7L 1YEWA 3TF4A 3QP3A 3IGUA 1UVQB 4NO0A 3BUYB 5T1DL 4ZXBA 2QADB 4K7FA 1KSRA 3QR2A 2QR0A 3WIHH 1BFSA 3QXWA 3LS5L 3BO8B 4LLYB 2XV0A 1BM3H 1E30A 3QBTB 2EDFA 3P30H 5F88A 1OAJA 1KYOK 5B4MD 2YQ2A 1PJ9A 4G6ML 1EJFA 2IPKB 3DECA 4L37B 3QNZB 4NO2A 3TPUA 4G9DB 2W80C 3N3EA 4Q9CA 4ONFH 4UM9B 1E3ZA 2Q3AA 4AUJA 4Z7UE 2YXWA 1U8HA 1QSFE 5H2BB 1JXGA 2CO6B 1WS7A 3RVWC 4Y4FC 5GGRY 2OI9B 2CR0A 4CRPA 1QFUL 5T3ZH 2VERN 3CC5A 3BVWA 2PXYA 3UTTA 1NL0H 3DWTA 3CIQA 3AT0A 3HA0A 1MF2H 4IBUA 3T0VA 4WNJA 4RAVB 3RNKA 4R7XA 1XQ4A 1BZ9A 2JLPA 4CKVX 1FFNB 3FT4B 4ZK8A 4NC2B 5L2JB 1T6WA 5HYQB 4FQIH 3MLWH 1YYLH 4A7GA 2GSIA 3H9YA 1S9VB 4F7PB 2E46A 3LDBB 3QG6A 5BMFH 3DBSA 4Z7VB 1JTTA 5CWSA 1FF5A 3PV6B 1TT6A 4ZMWA 4ELMF 4X9BA 1MJJA 1HKLH 1ZKAA 2EDQA 2Y07L 4U4BA 2DW5A 1IQWH 4ODXA 4DCQA 4FLOA 1UB6A 5CD3A 2H26B 4A2MA 4MQXD 2J8UF 2VLJD 3QUKA 1ED3A 2H2SC 5I73C 3MRJB 4NZFA 2R0WH 1DE4A 2A6IA 3A67H 3PFUA 3MRFA 3V0JA 1HKFA 4N0FA 3QT2A 2Y9RT 1Z6JT 1IKNA 3KH3A 2WHVA 4Y19A 4U6HB 1IV8A 3ABKB 2YGQA 3LKSA 1Q90A 5DS8B 2O6CA 1UCBH 1AACA 3P54A 4HT1L 3PP4H 3NCCB 4ODHH 2RJMA 2IQAA 1ES0A 2K8QA 3IS0X 4Y4HD 3HN3A 3U46B 3X1FA 4PY8J 2FUQA 3OXSB 4QCIA 1AQKL 3WKMH 2H32A 2HG0A 2IJ0C 1NDMB 1L9NA 1WLHA 2FL5B 4JFOB 3MUJA 3KPRA 4DEUA 3QDME 3B5HA 2ZUQB 4DEWA 4TQEH 1EAPA 1ACCA 1D7DA 4PTUB 5L9DL 2F74A 3V9CA 1X5MA 2Y2WA 3U4BH 2V6HA 3QHTC 1GZHC 4NO0B 4ZXBB 2EUWA 4K7FB 3AROA 2ZXEB 3ULVD 2QR0B 3BZDA 3AG4B 4DAGH 3VI3F 2G3NA 3T5WA 5E95B 3BUPA 2YSSA 4ZDHA 1F02I 3C75A 3OMNB 5F88B 5ISZA 5I2IA 4GUPA 1R1CA 5B1CA 4QD2E 3WNPA 3SGEH 4AC2A 5CS7A 1J05B 4BQ8A 1WCBB 1J87A 1XIWB 2CKBA 3EOBA 3QPKA 3TPUB 4PLOB 3NA4A 3FB5A 1AXTL 4I13B 2FATL 1U8HB 2FHBA 2R29A 4MJ4A 2NUTA 1NMBH 2XXMB 4XNYH 2K9FB 2ZTBA 3CHQA 4FQJH 4Z3IA 4M7LL 3I2CL 4LSUH 4OU3A 3CC5B 5EDSA 1QFOA 1P7QD 2PXYB 3BX7C 3UTTB 2AK4D 4AL8L 3RFZC 3MSPA 4AJYV 2MHAA 5KZCD 4JFVA 2XT1B 1KFGA 1WA1X 3CLFH 3RNKB 3TBYA 1BZ9B 1OAQH 4IBSA 4X7EC 4MYWB 1QR4A 2HH0H 2XUWA 5JW4M 3X1BA 2GSIB 3QORA 1HI6A 1C7TA 3QG6B 4ZOAA 2EUZA 1Y6NR 5BOJA 1T7XA 2D7TL 5DJ6B 4G59C 2DIAA 5IUCA 4NCC1 4XCFH 3T3MB 1PY9A 2DQ6A 4CBPA 3ZT5A 5ESVA 3VXNA 1VCBC 3GXIA 4DCQB 1WAAE 2UWEF 1UB6B 5CD3B 4IBLT 1CUOA 4NP9A 1X7QA 1UKSA 1ET5A 1LO4L 1FGNH 3QUKB 4NQXB 1WTLA 2QVTA 1ED3B 4CADA 1NANH 2FH8A 1DE4B 2A6IB 4FF9A 5C08A 3MRFB 5AAWC 4N0FB 5GQBA 1Q9OA 3GZOA 3SB3A 4ANXA 3NA9L 4JKWA 2DB8A 2DJMA 2OMNA 4Y19B 4PS4L 1IGFL 3TVMD 3L4YA 1P69B 3GTNA 4DP1X 4EXKA 3LKSB 3UROR 5ACLA 4YZFE 4GW1A 1UT1A 3AADB 4MVBC 5B38G 2PPDA 1XF3B 3BIKA 1F3DJ 2CUIA 2ZKMX 2IQAB 1ES0B 1F41A 2R4SH 1WFOA 3OG4B 4NN7B 4YSUA 2AQRA 4WU7A 2H32B 3D51A 4BJLA 1QI3A 4UINH 1J7VR 4BFFA 4LEOA 1N3NA 1C08A 2Z93A 3SQRA 3KPRB 4ZS7L 1UWGL 4YSAA 3K72B 3RX7A 3V4PL 1X5LA 3MV9D 1IBGH 1J5OL 3CLEL 4LBEA 2VJXA 2LABA 4YDKL 1MFCL 2F74B 5BRZE 5DS2A 2ZOLA 3NIFB 3NG5A 3ULVH 3IRPX 4XI5D 5IQOA 1XGZA 1H15A 1FNEA 1I8LC 2X41A 1TZIA 1MIMH 2YSSB 3SDAA 2VN7A 1ASPA 2NXYC 5I2IB 5ISZB 4GUPB 1YC8A 1JK8A 1CIUA 5C70A 2X1QA 1QVOA 5GHWH 2VABA 2B9AA 2CKBB 3EOBB 4NDMA 5IG7A 4NPYA 4QR7A 5F0PB 5LDUA 2K3HA 1BECA 5LXGH 4XVSH 1A5FL 4DQOH 3FB5B 3FH8A 2W81C 3W39A 4Z0BH 1CLVA 4K7PX 1GMIA 1OP5H 4P4KA 3ETBJ 1P5VA 1AYOA 3ESOA 4NC0B 1EUTA 3VTTA 4YXHL 1DCLA 5EWIL 1EV2E 2PCFA 1QX1A 1P4IL 4KKCD 3BRGC 1H3WM 2D0HA 4GI9A 2MHAB 5MEQA 3OB0K 2E27L 4YNYA 1RIUL 2A7BA 2ZOWA 5CLXA 5LQBH 4LVNC 3HOGA 1Q1PA 1FVDA 1RURL 3WFDL 3IDJA 3NJFA 5I8EA 3QORB 1HI6B 1A7QH 1GJIA 4EI5D 4ONOA 1FO0H 3EDKA 4GRWH 4E9WA 2YGOA 5BOPA 2QGEA 2NQ3A 3B2UD 3O8XA 4GKSB 2VOTA 5FO2A 7TAAA 2FBJH 5ESVB 3VXNB 3DI3B 1ML0A 4HC1A 4OFYD 3HHMA 5BZDA 5D8JH 1X7QB 2C5DC 2Z92B 5LGHH 4JKKA 4CADB 4M7JH 3MR9A 5C08B 3Q0HA 4K3GA 1RH8A 1Q9OB 2OMUA 3ZYJA 3CIAA 1UOWA 4AUYA 4UBDD 1TEGA 5D71H 4GW1B 4KMTL 2NDFA 5L7XL 1X5ZA 2X6AA 3R06B 3BIKB 3CFKA 4H13C 2VZUA 5C0AE 1CFNA 4WU7B 2A74A 3SGJA 4U1NA 3ABZA 4HG4K 4LEOB 1N3NB 3B3BA 1C08B 1L4IA 3VRLE 4CC4C 1XEUA 3QWRD 5CFHA 3TJEH 3UBXG 3CN0A 4F7EB 1N0XL 4FYRA 5EZJA 5LUMA 1RUML 3KYOA 4LBEB 5JHDD 2GCYB 1KB9K 2BMKA 4UZSA 2WVUA 2NYYD 2ZOLB 3T0WA 5F71A 5I1LA 2RGSA 2HKAA 2XIDA 2XQ0A 6PAZA 1YEGH 1H15B 1FNEB 1XL4A 1TZIB 1HAWA 3H3PH 3SDAB 1G87A 1YEHH 2IH3B 3GC3A 2CJSA 2IEPA 1JK8B 2PCXA 5DJXA 5HHMB 5IW1A 1QVOB 3BN9D 1MCQA 1LXMA 5F9WC 5IG7B 1DBML 1E4XI 2HKFL 3APFA 4NPYB 4OW6A 1YEIH 3W0WE 4G3YL 3SJVE 2WPGA 4LOFA 2F15A 5D2LA 1N64H 5F2FA 3W39B 3BAEH 4UIMA 3IB4A 4KHXL 1G4MA 3GLEA 5ICZA 2IANE 3KYNA 3CWGA 4DJMA 1H3UA 5TPWL 2I07A 3BVTA 4UIKH 4FLSA 4NIYE 2EXWC 2GIYA 3IDGA 4AQ1A 1WV7T 4MNGE 4N2OA 5TD4A 3DK2A 4C54A 4FQ1H 2X6MA 2PCFB 5IFJA 1HFUA 4LL1A 5KVDH 3DTDA 3PGFL 3ZMEA 3B9KC 3T2OA 3MGTA 4YNYB 5MEQB 4U33A 2ATAA 2JJWA 2Y1AA 3BAIA 4N20A 1HEJC 4PWEA 4ZUVA 1GMEA 1FVDB 3MA9H 2P42B 3W1ZA 4J3OC 3QZWG 3ILPA 1PL3A 3IDJB 4QXGL 1NAMH 3EJCA 4PWJA 4Y2LA 2GTZA 4AXWA 1ILSA 4XC3H 4DTGL 3P0YL 4QJ5B 3NJMA 3GWJA 2O26U 4V2CB 1A7PL 1TQCC 2C9SA 2ZCLL 4OQTH 3O8XB 2JIXB 4K7PL 4MKTA 5I1JH 3WU1A 5EOCL 3VWKA 5T8IA 2VMEA 1J11A 4IRSD 4IDLA 5MP6L 3DUUA 1JGLL 3U4EA 3ZHLA 5BZDB 5I5MA 1IBFA 4NJAL 4L4TD 4WHYG 2DYRB 4X6DA 3SQOL 3MR9B 4NUQA 2YXMA 1RVFH 5CJBA 3RBGA 4DESA 2OMUB 4LSPH 1JZJA 3R1GL 1UEMA 3MI6A 3SGKA 3BPNB 1G7JB 3LD8C 3EKCA 2V7HA 2F19L 1QNZL 1AMXA 4PD4J 5FGBC 2E9JA 4CU8A 4DP0X 2HVBA 3CFKB 1L0YA 4JO3L 3BVUA 4YK4B 1YMMD 2EKSA 2R0LH 4HWBH 1CFNB 5E08H 2CBQA 1O6SA 2A74B 1U3JA 3FB7A 4OZHE 1HOEA 1ZEAL 4U1NB 5L6YH 5FYKD 2R8SH 5D1QA 1IC4H 4L3EE 3UBHA 3GJEA 5EZJB 3KYOB 2BMKB 4JO1H 3WY2A 5I1LB 2WLNA 1G7HA 4U6TA 5DA4A 5E99L 3VMNA 3G5YB 4KI1A 4XZUA 4QHKI 5A40E 4TLSA 5F8RC 5D5MA 5DUML 1UUNA 3BH9A 2MCPL 5DJXB 3FUJA 1IIKA 5IW1B 1HH9A 1M9WA 1U2YA 2VIRA 1CDJA 5IVXE 1JCKA 3PWNA 4I48B 4IGBD 2J8OA 3SGEI 3RHWK 2J6EH 4MMZA 1F1DA 4KY1H 4R2GC 1CTMA 3LTVA 5E4AA 4PUBL 4UIMB 5ICZB 2YQGA 5J56B 1TZAA 1DDHA 3KYNB 4MB3A 4I0CC 3KPSD 2V17L 4LEEA 5D96C 1FSKB 4ODTL 1GGBH 5DJ8A 5JHLA 3ULUD 3IDGB 3IPFA 2N0KA 4AQ1B 3TPKA 5EU7E 1ZLSL 3EH5B 5FV1L 5IFJB 3ESVF 5E4EC 4JPWL 3OKLB 5SX4I 3AM8A 3CX5K 4JS7A 1W72A 2CHDA 3MLSL 4ZNEA 3CVDA 4ZUVB 2CO7A 4HWUA 4IU3A 4AYID 5JHBA 3GJFA 1G94A 3ILPB 4RA0C 2KZBA 4XR8C 4H0GA 2GTZB 4AXWB 1EXHA 4E41A 4P5TC 25C8H 1M57B 2YPLD 5GGQH 3GI8L 4JN2A 3ARVA 3VWKB 2WKGA 5FYLD 1U0QA 4N8VG 4L1SA 4N6QA 5B1KA 1L7TL 2O5ZH 3D85A 3DUUB 3U4EB 1A6ZA 2XKSA 5LBSL 2GJPA 4YLBA 5ALCH 2JVUA 3RVXD 3WJJA 4OCWH 2ZE0A 1WZKA 4JDEA 4JZOA 4TSBL 4G7VH 2P9RA 2HT2C 4UTAA 1GPOH 1M2OA 4Z7WE 1FLRH 1T89A 4BFKA 1K5NA 2ENJA 1PPIA 3HIZA 2XN9D 3EOTL 2V7HB 4KJQD 4PJAA 3LNFA 1QSEE 2F9BT 3KR3L 1K85A 4CC1A 3ARGA 5CR1A 4HLZH 4UM8A 1CR9L 4J3OF 4WUUA 2H4EA 1MI5D 3TEYA 2EKSB 2EJ1A 3QYCA 3F7YB 1O6SB 1YO4A 3A6CH 3FB7B 3FRUA 2R69L 1OANA 3KJ4C 4G80A 3V4VL 1AHWC 1MUJA 5FYKH 1NGXA 4M62H 1KEMH 2BSRA 3HZYA 2ZUQC 3FYEB 2B1AL 3MRQA 1DP0A 1ULVA 5F0MB 4KO6A 1Q0XL 3ME0A 2QSVA 3CZJA 1WEJL 3GJEB 1SF3A 5KOMC 3MU3A 3GUTA 4GKNA 2QMJA 4U1LA 1RK7A 2KBGA 4NKMA 4QTIH 2GJZA 3IAQA 4XZUB 2ZAHA 2MJWA 3O6FD 2N3JA 2AAAA 3GHPA 1UYWH 5D5MB 1UZ6E 5K9QI 4YE4L 3BH9B 1CE1L 4IBZA 1XIWC 3IAPA 4OGAC 4B97A 3U6XS 1HH9B 1L9OA 4N5ED 1G9HA 2VIRB 3KPMA 4RFNC 2V5RA 1YYCA 5IP4A 2W60A 1EFQA 1BF8A 1QFWL 2DDQL 4MMZB 5I1GH 2HVKA 2EDDA 4U7SA 3WSQH 1PSKL 4OI9A 4Y16A 3RZCD 4PR5A 4D94A 1DDHB 2XDHA 3VXSE 2YRBA 4JFFE 2MTPA 1FRGL 1HYSD 3LB6C 1BMWA 4AG4H 1G1YA 1F11A 3ULUH 5DJ8B 3I9GH 1H8SA 4LVHB 1UD4A 1A6UL 1KXTA 3MCG1 4YQXL 1WVZA 1EHAA 3O3AB 3PWVA 3GT6A 1DVQA 4K3DH 1QBLH 4CL7A 3VTMA 4MB4A 4Q97A 4FMKA 3BD3A 4IK6A 3FN0L 3JT2A 3UIYA 2CO7B 4IU3B 2NZ1A 3E9UA 3GJFB 3MLPA 2DBLL 5HJ3A 2G4EA 2NYKA 2QPDB 3S2CA 3U7YH 3V0WL 5GJTL 3M7FB 4FNUA 1UD2A 4E41B 2J21A 4XP5H 1CBVL 1MNUL 4UANA 1T2JA 3QIUA 4JN2B 4OCXH 3TIDA 2FGZA 4JPIA 5FYLH 1KCRL 2EVGA 5LXVA 1W8NA 1A6ZB 3EHBC 3LS4L 4PSRA 1TEYA 3Q2VA 4HMCA 4ENZA 5FHBH 4JZOB 1NCJA 4MS8D 4YXLL 3UJIH 3SYOA 1BJ1J 1YDPA 5CINH 2IWFA 3IU4L 3TBVA 4YDIL 1DVFD 1JPTH 4IEFA 1RZ7L 2X9XA 4PJAB 3WFEH 3HW7A 2FBOJ 3S88H 3HMXH 1CICC 1MDAA 2C4XA 4MSWA 4KVCL 4MAYD 3ARGB 4UM8B 3CVHA 4WUUB 3CFIC 1R5VA 2GUYA 2J88H 3BLKA 1I8UA 3SYPA 4Z7VF 3MRPA 1E7VA 3FRUB 3LN5A 4G80B 1IBDA 1MUJB 3T2QA 4UTBL 1NGXB 1F3JA 2XA3A 3MXVL 3HZYB 1EFXA 4KDVA 4A39A 3BZ5A 3MRQB 4KJPD 3ME0B 5JUEH 1B2YA 1BWWA 2QGCA 1QAWA 1YG9A 3JV4A 3DBXB 3GUTB 5MEND 4GKNB 1BMGA 4U1LB 4X4XA 5DHDA 3RWIA 4KJWD 1MSPA 2GJZB 3T6XA 1AZRA 3SE8H 4M6AA 4V1DA 3H3KA 4NCDA 4OBSA 5ETUA 4NUJB 4S0SD 1QSVA 3I6SA 4CVZA 4C4KT 3H54A 2R2EA 1EWHA 1OCWL 4BFEA 1KLFB 1ZCRA 3KPMB 2W60B 2X89D 2ZT9C 5HYEA 2GK0A 3OAYH 1TFPA 5DGRA 3U9PH 1VFMA 2HVKB 1BZ7B 1IGML 2DLFH 2HTLD 3FS9A 3L5WA 1UATA 4Y16B 5DYFA 4PR5B 3LZPA 4WFFD 5D7HA 3K8LA 3BGAA 2OSXA 1ESOA 1F11B 1IO4C 4Y7OC 1OXYA 1XT5A 5EZOH 5IBLD 3F00A 1KXTB 4MFHA 5IEHA 3PWVB 2UZPA 4PLJC 2BRQA 1OF2A 5LG6A 1PIFA 1QKZL