4AENB

Hla-dr1 with covalently linked clip106-120 in reversed orientation
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
188
structure length
181
Chain Sequence
TRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN, DR ALPHA CHAIN
publication title Peptide Linkage to the Alpha-Subunit of Mhcii Creates a Stably Inverted Antigen Presentation Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 43
structure length 181
sequence length 188
ec nomenclature
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4aenB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4aenB01
1VFMA 1J0YA 5DMKB 1VESA 3EYUL 2Q3AA 4K3JH 4WUUB 5FHBH 1DQMH 3PE9A 1TZGH 3HNVH 5HHXH 3MRDB 1JK8B 4U1IB 4PJ7E 5D7KE 4MX7B 2J8HA 2X42A 1U58B 4HH9B 3MFFB 3IJYA 5CS7A 3SKMB 1AFVL 4R8WL 5F7FA 5LWYL 3BP5A 4GAJH 1J0ZA 1Y0LB 1ES0A 2D0FA 1KCVH 2X9WA 4H1LB 5D2NA 3WKML 2APVA 4LVNC 3DARA 3LKRB 3R8BB 1U8JA 3RVTD 4OCWH 4JO4L 1A6AA 4M62H 1NBVH 3D18B 4NHCL 1F2XK 1YEIL 3DMMB 2ZSWA 4ONGL 1D5BA 3DO7B 1HZHL 2BCKB 4TUJB 3JV6B 3LQAL 1V7NH 1DVFD 5HYQB 5DS8B 1IC7L 1Y6MR 4GKOA 4ODTH 2JJTC 4FQPA 4TSCL 2XWTB 5C09A 3WUWB 1JHKH 4MYWB 4PP1C 2PO6D 3SDCD 4J4PC 4OIIH 1R3KA 4U6XA 5DUBB 1E4KC 2FYYA 2ADJB 3SQOH 1U8MA 1VGKA 3H3BC 3EAKA 3GSNH 1D5XB 1MJ7H 3O45B 1C5DA 4LNRA 1DSFL 3LIZL 5FYLH 3SKOB 3B9VA 5GGVY 4ENED 1FGNL 2VXQL 3RWFA 1ONQB 4N8CH 4V1DA 2WWMD 1KCSL 2XY2A 3UYPA 4RIRB 4ELKB 4LEOB 1YNLH 1EZVY 5LGHL 4Z7WF 4NQDD 4PTUB 1BBJB 2BVEA 4FQJL 2R23B 4BSWB 2XG4A 1F6FB 5L0QC 3L95B 2YD8A 1EEZA 1LD9A 1KACB 5DUML 2DN7A 3GJFH 4JQIH 2C1OB 2MKWA 2WMPA 1WSST 1EAPB 3OJVC 1YEDB 4XCCH 3HB3D 4FOMA 5IBTH 2VUOA 1GC1C 3NGBC 3GM0A 1AIFB 4PJBE 1NCBH 4Z0BH 4B41A 5I6XB 1J0JA 4BSVA 5EU5A 4O51A 5IFHH 5F6IC 4GKNA 4TQEL 4APQA 3KS0J 3VW3H 4PJ8A 3TZVD 5SWQA 2DYPB 2R2EB 1TJHH 4WO4B 4JFPB 3DECA 4WFGE 2E7HA 4O2EB 5JW5B 4I3RL 5F1NA 2A6IB 2ADGB 1U91A 1P7QA 3TPUB 1HQRB 1ED3B 3GJFB 3HS0B 1I8LA 4YIQB 2DI8A 1AGEA 5TH2A 4GMTL 1FL3A 4Y88A 5JPMA 2VXUH 3MPCA 3EYQD 4NN5C 3LKPA 2Y9RT 2QQKL 4XP5H 2FR4B 5CEZL 1G7LA 3VFUA 1XIWD 1YUHA 4LCIH 4OKVA 4X80H 1NUGA 3TA3A 3TM6A 1DFBH 4ZODA 1QFOA 2JELH 4RWYL 5KSAB 4OFYA 1T03H 4QOKB 2CIIB 4HJ0D 3ULSB 2YRZA 4G8GA 4Q6IB 2JLLA 2V7NB 2PW1B 1N2RA 4P57B 1K8IB 4TRPH 2Y5TA 2IF7A 4U1HB 4HGKC 1R3HB 3MV8D 4ZAKD 5E08L 2AV7A 5CMAB 5FKAB 4XB8A 5T3XH 1EFXB 1D9KA 2VLRE 3Q5OA 2X4SA 5GXBB 1HWHB 1T1ZA 3K2UL 3GBNL 2OL3L 1MCWW 4Z7VE 2EIZA 4DW2L 1QFWM 2C3VA 4ODHH 1UCTA 4J3TA 4KJPD 1KXQE 1OAKH 4FQQA 4QKXB 5EN2B 3TBWB 3ARGC 3S37X 4JFFB 3AXLA 1X7QB 3BN9D 1RUAL 2E27L 2PO6C 2IAND 3U46A 1MF2H 2VZUA 3BIBX 3QEQB 4PJIB 5DRNB 4I9WE 1K9TA 3F7YA 3P4MB 4PLJD 3VXOB 1CXLA 3SCMD 3D0VB 3VXSD 1KN2L 3S35X 4ONHA 1OY3B 1HSBA 3CC5B 3WIIL 4F8QA 2VXTL 5JW3H 4YDLB 3BYYA 4CVZA 4LVEA 4HMDA 5BVJA 4ODXB 5EFIB 5MEPA 2VDRL 2I9LB 2EYTA 1DQTA 2RHEA 2UYLB 3EJJX 4O4YH 4X7TB 3K81A 1FBIL 1T4KA 3KPNB 5JORA 4QWWD 4GRWF 1YDPB 4KK6C 3IDUA 4FZ8L 1OTUC 5KZCB 1KELL 1JZ5A 1IM9B 3ZKXB 4YX2H 4ZXBA 3RY6A 4LLYA 4PJXE 4U6YA 5DK0A 5J4MA 2XN9B 3CAFA 1IAKB 1E27A 1KOAA 3I02B 1MFBH 1SYSA 4A6YH 3IFNH 3UTTB 3QNZA 4FFWC 4YZFF 2BNRA 3C6SA 3TBYB 1TTFA 3TZVC 1PVHA 5IK3A 4KI5D 4RCAA 2CLRA 4UV4H 4YQXL 5GZOD 3AM8C 4DK3A 4HXBH 2IPUG 3B3IB 5DA0B 4OAWA 1YY8B 1CFNA 3RDTA 5J7CC 4MJ4A 1AI1H 2P5WA 5EOQL 4L3EB 4UBDC 1JFQL 4WEUD 5JXEA 1R5IA 4M3JA 1D6EB 3D48R 2G5BA 1LK3H 3UAJC 2VERN 3WFDL 4LAQH 2AK4D 2VDLL 1K4DB 5ENWA 3B9KA 1X5LA 4KROD 5E00A 2BRQA 1B0RB 1CGSH 2HTLD 2MTPA 1ZHNB 2YEZB 3E6FB 4A6YB 4QLRA 3RHWK 1J0HA 2Y07L 2P49B 1TQCB 5TF1L 43CAB 1ZOXA 3NIGF 3MUY1 2JB5L 4MCZA 1NCWH 5D2NE 4KKNA 2AJSH 1Z9SA 5I17B 4HJ0C 4XC1H 1FRGH 4XPAL 2PYFA 1LNUB 4ZUTB 3ZT6A 1ZLWH 3UTQA 3VWJB 4RAHA 2ITCB 2K1MA 3REVB 1BF2A 4Y19D 4ZAKC 1MHCA 1ETZA 1G7QA 2C7UA 1ULVA 4O9HL 4M5ZL 3BIKB 4HBCL 1YMMA 5I8OH 5C09E 1T7WA 5C0GB 1XCTA 5GGSA 2X4UA 4HEME 1NUDA 3RVUC 1QTYT 3BI9X 3G5XA 4KJPC 1T1WA 3BP4B 2CDEA 2K3TA 3BVNA 1BGXH 2EYSA 1IFHL 1AJ7L 4ZFOL 3KS0H 4V1DE 3ZT5A 2D9QB 3I9GH 5GISH 1IEBA 1MVUA 2F8VA 2NX5B 2O26U 3Q3GA 3FONA 2IAMB 3BP6B 5CCKL 4IJ3C 3NCJL 4QY8A 3TJHC 4PGDB 3TP4A 1VEMA 3ORJA 5EZOH 2ADFH 3SCMC 2JB6A 4JM4L 1HYSC 1X5XA 2LV4A 2XXMB 2H2SD 4J7RA 4D9LL 3BISA 1T2JA 4EI5B 4OLXH 2VZSA 4GW4A 3WNPA 1WCBA 5F7MC 4EOWH 4AYFA 4N0UA 4PBVC 2XNAB 3BGAA 2BHYA 4WW2A 2R0WL 5DFVC 1A9BA 3DX7A 3WFBH 2NZ9C 3KPLB 4G7VL 4QWWC 1TTUA 2OR7A 3WIHL 4LARL 1OW0A 4NPYA 1WITA 2R4RL 1UG9A 5C3LD 3HNTH 5FYKE 2EE9A 2NY1D 4R7NB 3SE8H 1IGIH 1A6UL 1AXTL 3QXWA 3WFCL 3C60D 2XG5A 5GQBA 3HC4H 1QFWI 1ZT7A 5I19L 5BQ7A 5HHOB 4K9EH 4KPHH 1NC2A 4KV5F 3LB6D 1LO0H 2VZOA 1KC5L 1W72H 2VXVL 1NCAH 3DRTA 1QBML 2L7JA 1U0QA 2YUXA 2FJFB 3Q1SH 2DBLH 3NAAH 4GAFB 4CGTA 5GZOC 4OIBA 5D7SH 5E6ZA 1MI5D 1HYRC 4HS6B 4Y4HA 1CT8B 1OAZH 1XGTB 4PS4L 3SDDD 1T21B 5FYJD 4LIQL 1ZLSL 1W0VA 4HLZG 2YPVH 1TJGH 2J8UF 4WI6A 1VEOA 4P23B 1RUPL 4TVPH 1OAYH 3WXWH 2AEPH 1ZHKA 4IHOA 2DBJA 1EMTH 3VXUB 4G8GE 3N85H 2H3NB 1ZA6B 4OLWH 4N8VB 4P2QD 3FB7B 3MBEB 4UNTA 4AL8L 1YNTA 4KROC 2ZCHL 4YNYB 4DGVL 3G6DL 1URLA 2VSCA 3PHOB 3EO1A 1CFVL 4KAQH 3QO1A 1AC6A 1OP3H 5C08D 1J1OH 4YXLL 1W72B 5CUSH 3N06B 4LK4A 4WDIB 3PWPB 4RX4A 4PJBF 2OK0L 5FHAL 5JOFA 2CDFB 5DRWB 4QGYA 4HXAL 5GSRB 4E0RB 4I9WD 2CR3A 4CNIB 4ELMA 4EVNB 5CBEB 4TPRH 4P59H 2Q8BH 4QXWA 5ICXA 1E6OL 3ZTNH 1JJUA 1BQHA 1OSPH 1SY6L 3GHBL 1BVLB 2BSRA 2VAJA 3HZMA 5HHMD 1CLOL 2KBGA 4R3SB 1P7KB 5CEXB 2HG5A 1GZPB 3OF6A 1YC8A 3LRHA 4ZFGH 4HIIA 3EOYG 4LVNB 5BXFB 3B5GA 4RMQA 1A6TA 3X14B 4MD0B 4MWFB 4XT1C 4B53A 4JQVA 4J3SA 1CE6A 4P99A 2VLJD 1PSKL 3HI6H 3IDXH 1V3LA 5ADPH 4PJCB 4M1GH 2ORBH 1KV3A 4WU7A 4E41A 5TDOA 2H1PH 4HX1A 1JHLH 1CE1H 3VD4A 3BEVA 3GJFK 4U6VL 2C1PB 5DI8A 2NR6C 4KZDL 4FQLL 4LFHD 2BVOA 1CXHA 5L2JB 1JGVL 2H2SC 4WFFD 1JGEA 3BHBB 2W59A 1GC1H 4MQXC 1X44A 3PP4L 2WK2A 2IADB 4Z0XB 4F7CA 3VH8B 3WD5H 1BFSA 5FO9A 2BY2A 2CIKB 4OQTH 4M6ML 3BP7B 4NCDA 3S37L 1KCRL 1QA9B 2F19L 4YUEH 4MA8L 1EJOL 2BNRE 3VFMB 3IFPB 1ZK9A 1NMAL 3MLVH 4MZ3A 2QKIB 3FT2B 3CFCH 4ZO6A 1NGPL 2NY1C 5CJBA 5HI5C 5EPMB 2FZ3B 4YXKL 1ND0A 3JUYA 4Z7VF 3ROLB 1FIGL 1MAKA 5AUMB 1QP1A 5F96L 2HFGL 5L0QB 4M7KL 5K9QG 2P5WE 1J0KA 2WNGA 4OB5L 5GGTH 3SE9L 3D3VA 4RRPG 35C8H 2VXSH 1HXYA 2C3WA 3NGBB 2QSTA 4DZ8A 1XCQB 1BFVL 3IDJB 3QDGD 1RJYB 5HGAA 5IVXE 4P2RB 2VWEE 5CILL 5F6IB 5HBBA 3HI5H 4Y5YA 5HGBA 4PRPB 2YN3A 4OF6A 2Y36L 3TH3T 5KVDL 2NYYC 5LG1A 4JPIB 1IL1A 4UT9H 4EIGB 5F7DA 3N50A 5KVGH 3RFZC 5EU4B 4Z7WB 4BQBA 5C0DA 1M71B 3OHXB 4Y4FA 3JWDL 4H8WH 5A2KH 1J1XL 2DDQH 3L5IA 4GKZB 4U7KA 1QR1A 3BH8A 1GCFA 2NY7L 2YWYA 4X7FC 2H9GA 1GGIL 3SDXA 2P45B 4PRBA 5J9PB 5JHLH 1IZKA 4NN5B 1YMME 4JFDA 4BH8B 4ESKA 1YYLH 2L7UA 4HWBL 5IESH 2LE9A 4PJXF 5JO5B 4ZMAT 1IEAA 1UXSA 2X1QA 3MLWH 1QQDA 3QULB 4MNQA 1MUJB 4R26H 1T22A 1ZT1B 5EIVA 1C7TA 4N0FB 4LPCA 4NQCB 3BRFA 4ZYKB 3GSWB 4FQHB 3UJIH 4F80A 5ABDE 4UOJA 4FQXD 2O5ZH 4P5KB 2Z92A 1AHWA 4F33B 3LV3B 5GRWA 1ZWIB 3W39B 4HIHB 4L4VA 3F6IA 1KN4L 2YPLA 4IOIA 4HMEA 1A7OL 3L3DB 3UPRB 3QB7C 2HMID 1NGYB 2BNUB 1R5WB 5LBSH 4OM1L 3ZL4H 4WV1A 3HE7A 1DEDA 2BOCA 2YA2A 1OM3L 2Z4QA 3V6ZA 1KCUH 4O02H 4N0UE 4LCCA 5DGQA 4ORGA 1RUML 1ZS8A 2FWOB 1RJZA 5LGJA 4WFHD 3ARGB 1JBJA 4Z7UA 2ITDB 1BZ9A 1OSZB 3FQNB 3FTGA 4PJ5B 3TBSB 3CD4A 3V4PH 2AEIT 2PO6B 1U3YA 4XXDA 3RPIB 3IU4H 3TJEL 4YHZL 4NZTL 1HINH 4E42B 2NXZC 1JWUA 2EEBA 1XR9A 3H7BA 4FQ2H 4UI2A 2F5BH 4P3WA 1MFDL 1RK0B 3UYRH 5E5MB 1G1YA 4ZTPL 5GRXG 3D25B 4QHKJ 1AQKH 4KQ4L 4LCWA 3PP3H 5ICZB 3KWWB 3Q6FB 4WWKB 3FOLB 4ETYA 3QQ4B 4NO0D 1S9KC 4RAVB 4XNQB 3DX8B 4JJ5A 5D2NC 4GRWH 3QZWB 1HI6A 3FRUA 5JTWA 2B0SL 5IQ9B 2HLFD 4LVHC 1FNAA 2VLKD 1C8PA 2IBZY 4OCXL 4HUWA 5E2WL 2GSGB 4Q2ZB 2HVKB 5JW4N 1G7PA 3RWJB 5J3HC 1HDMB 4XVJH 1LO5A 3TZVB 4EXKA 2HWZH 3FQUA 4KRPC 1VHPA 4QHNB 3QR2A 5K9QI 1A6ZA 5IB4B 4U49A 1EDQA 2VLMD 3OAUL 5EO0A 3X3FL 5I8KL 1KB5L 4MQSB 4Z8FH 4LU5H 4XPHH 2BC4A 4N90E 4WEBL 3ZO0A 15C8L 1I7ZB 5DQ9B 4I0KA 4GRWB 4ELME 2LU4A 5EU7C 5DJ0B 1XGRA 2J3SA 5DO2D 4HUVB 4QHUB 5ALBH 5HY9A 1TCRA 2HJFB 2IH3A 4ZPVA 1LEKA 3TBTB 3L3GA 3UTPD 4RGND 3WDJA 2BVTA 3V5DB 1GL4B 3IDNA 5K33A 2E7LA 1UZ6E 1Z0MA 5KN5A 3QXDB 5INDA 3JV0A 1M05B 5GS0H 1NFKA 4OFDA 3TO4D 4QGTA 4FQXC 4PUBH 3PNWB 5D1QA 5D9SA 4Z77B 3FO2B 4G80B 2KQMA 2R8SL 1P4BL 2IQ9H 1DQJB 1SVZA 3FQXB 4U3HA 5FUZL 4WHDA 4R96A 5DK3A 1ZA3A 3CFBB 3ZDZE 3SDAA 4Y0GA 4CU6A 4ZAKB 4KTDL 4P2YA 3BN3B 4E41E 3QUXA 5DMJB 1T6VN 3ALXA 1UEMA 3V5KB 3S88L 4HUXB 1OF2B 4PJ8C 4DK6A 4ZFFA 2JIXA 2X4NB 1CFTB 3CVHB 3DRQB 4HKJA 5IIEA 1U8KA 4LL9A 2XV6B 3VXRD 4GUPA 3BXNA 3K3QA 5D4QA 4F7PA 2NY3C 4EUPG 3HFMH 4QNPE 5JDSA 5DMYA 4BZ1L 1WZ1L 1A4JA 3AS3A 1I8LC 1F4YH 4WI4A 3MLRH 1GHFL 1PLGH 3IU3B 1U8HB 5JXED 1KNOB 1S7WB 3RU8H 3I75B 1CD8A 3C5ZD 4GXVL 4GAGH 1SJEA 1R3IH 2CGRL 5A2IH 2OTWA 1AGFB 4IJ3B 4UT7H 1HNFA 5E8PB 3TA3C 4QYOB 3SCMB 3D3VE 2ESVD 3GZKA 3X13A 1PYWA 1YEJH 2OTUB 1BEYL 2GIYA 3TNMB 4NOBA 5IB1B 1EBAA 4U1SB 5L88H 1PZ5B 3O4LD 3FJTA 1MJJA 4NRZB 2EDQA 2NMSA 2V9QA 1GAFH 5LAXB 5L7XH 2IBGA 1WBYB 3H9HB 4X83A 4YC2C 2FX7H 3W81A 2PUQT 1EV2E 4LNVA 5BV7L 3O4OC 3WUZA 2R0ZL 3WHXA 3X12A 1J10A 1KJ2A 1UQSA 2WWKO 4Q6YA 1Y6NR 4K3DL 2VB5A 3CSGA 2NNAA 2LABA 5LCVL 3OL2A 4M6NH 4UB0L 3GSOB 5FIEA 4Y89A 3R0NA 3FN0H 3SDXE 4PR5B 3DGGB 3C09B 1JN6A 2AEQH 2RR3A 4JFDE 4LPWA 5EZLB 4G6KH 1UCBL 1JNNH 4JKPH 4M7LH 4HKBA 5D71L 2A9MH 1JZ6A 1AD9A 5HTSA 2MCG1 4JDTL 5EA0L 3QAZC 4E9LA 5HHNB 1MREH 4FRWA 5CP3A 4MNQE 4Z7OE 4YR6B 4JGMA 5T1LA 3GSXA 1XR8A 4I3SH 5BW7A 4JO1H 4LPYA 1M7DB 4YPGB 4HQQH 2FL5B 4G42B 5DO2C 3MCKA 4ALAL 4WENB 4CRPA 3IXTA 2AK4B 1I9IL 3HRZA 1WUNT 1LO3H 3QCUH 1K2DB 1D5MA 4KROB 3ZKQD 1YEHL 5AZ2L 1U3JA 3F5WA 2VITA 3L3JB 4L4VE 4LSQH 2YPLE 3WEXA 2UZIL 5GRUH 3TYFA 3K4ZA 3O6FD 3RAJL 1UACL 5DJ2A 4AIXA 1YQVL 1RAMA 3IFLL 4FNLL 4MVBC 4ZS7L 3MRNB 4KQ3L 1W0WA 4ZXBC 2NLJB 4AY0A 3RY6C 3GMNA 2Z8SA 2A83B 4GQ9H 2DQJL 1SY6A 1CL7L 1YPZA 4MJID 1JTTA 1WBXB 5H35B 3U9PL 1R5VA 5IVXF 3OR6B 5F7WC 2J8UB 4XTRD 5DTFA 2YSSB 1UYWH 1WZKA 2P48B 1WIUA 4ODVH 3HMWH 4Z7UE 3CDFA 3I6LE 4LAJH 4P2CG 5H37H 4MA3A 3D5OF 1H9VA 3GMPA 4NGHH 5K9KA 4WI3A 3GB7B 3MQIA 4U1JA 4JM2A 4J6RL 1XGUB 1IRAY 5HHQB 1U8QB 5ERWA 4HEPG 3VRIA 3AAZB 2J4WL 1CI5A 2H45A 2O5XL 3P4NA 3BWAB 4DN4H 2PXYA 3DVGA 3BKYL 3KLHC 4QT5A 5JXEC 2LVCA 2G60H 3CCHB 3FO1A 4WJ5A 3C5ZC 3MV7A 1LEIA 4PJBB 3BPLC 1Q9WB 4LCWE 5ESVB 3T4AA 4CN6A 2ED7A 2XKNA 3QH3B 4M7ZC 1WAAA 2GCYB 4XBEH 2J8OA 4OF8A 2EDRA 3SGDH 1JI2A 5E5RB 2R2CA 4BZ2L 2AJ3A 3GJEA 2AJXL 2J6EH 3QSKB 5K9JL 4JVPA 4Q9BA 3N0PB 2EDNA 3HZKB 3EFFA 1JGUH 1NSNH 4PG2A 2BOBA 2E9IA 1MRCL 4GBXD 1G6RA 2COQA 5DEFB 1FFNB 2A2QT 4MNHB 3KPPA 1Y18A 2HFFB 3GMOA 3WE6A 4LHUA 1D6VH 1G9NC 2DLFL 4UDTA 4OLVH 4QHMB 1VACA 3BZEA 1FNGB 5I1LB 2Q7YB 1BFTA 3V6FB 2QADD 5TE4L 3PWVB 5ISZA 3QUZD 2A6KB 2NY1B 3MRCA 1KENL 4HKXB 3CLFH 4KGLA 4M00A 1RY7B 2FIKA 4C57C 1AQDA 1AXIB 3MYJA 4YDJB 4UNUA 5F7LB 1HOCB 3KLAB 1CXIA 4P2OA 2CLZB 4WW2F 4KK8C 2A6DB 4YGAB 5IMOA 1FCCA 2FRGP 3WS6A 4PGEA 3P11L 1T5WA 4UV7H 3K74B 4OQ1A 1GGBL 2AERT 3QUML 3MJ9H 1XGPA 5D1XD 3I3EA 3B2UD 2QQNL 4ETQA 1WF5A 2OM5A 4P5TA 4F57L 1OAXH 1AR1D 4TSBL 4U1KA 3U82B 1Q8MA 3MGOA 1RZIA 3R0MA 4NQSB 1BWMA 5DDHB 4L3AA 4X8XA 1U42A 1NC4D 4QRQA 3F58L 2VLRB 1NLBL 1OL0A 2VDOH 4LLMA 2D7TL 2R1YA 4P2QB 5GZND 3VMOA 4Z7VB 3P0VL 2GFBA 4P9HL 3D69A 3OJDB 4YDKH 5LJYH 2DKSA 1U8LB 2QQLH 3WN5A 1FP5A 3HR5B 3VA6A 3W9DB 4IS6A 3DSNA 1X5ZA 5I1KL 3DROB 5M7QA 3CPLA 1FZMA 4NM4H 1G7JA 4EQ2A 4XNMA 1QVOB 2I07A 4U3XA 1WK0A 3RIFF 5DJ8B 3GUTA 3K46A 5C0JB 4WHYH 4OF3A 5E1AB 4YGVA 2EDFA 2PW2B 5I66A 3QIWA 2WWKT 3U7YH 2BSTA 4Q97A 3SY0A 3BZDA 5E8NA 1XT5A 4YBHA 4QRRA 4UTAL 4YDIH 1A6VL 1H0DB 1HHHA 1II4E 3CDGA 3PWLA 1NGWB 4S2SA 2Y72A 3T0EA 3U7AA 1HKLL 3C5JA 2X5PA 3CSYA 1TVHA 3UDWA 1XF4A 4HFUL 2DQIH 2IH1A 4HZLA 3L5XL 5E0QA 4DZBB 1V3JA 2VRAA 5J6HB 5HPOA 4Y4HC 1S7QB 4AM0B 3KR3L 1MLBA 1X5FA 4X8JB 4G8FB 4U1LB 3HUJA 2D9CA 2DQEL 4IIQC 4U4BA 4PJGA 1JPGA 5HI3D 1QSVA 5FKPA 2VABA 4LGPB 2WBJD 1GOFA 4F9PA 2Z93B 5JW4M 1KCKA 3QHZL 2E6PA 4CN1A 4PJXB 4JFED 4JPVL 1E6JH 3PP3K 2CDGA 5HYJA 5J6GB 5TPWH 1I7TA 1I1YB 1P6AB 1ZLUH 4DFHA 5FYKU 3VFRA 2DQTL 3WSQH 3SGJA 1MAML 2C3HA 1MCFA 3I6GA 3S3JA 1UZ6F 3C9NA 1HHKB 3DBXA 3V7MA 3N9GH 1TXKA 5ITBH 3CFKB 4NHUA 4JFDD 1I1FB 4LLQB 1P2CA 4D9QD 1KBGH 4NSKA 2NXZB 3WS3A 2W9EL 1CIUA 4I13B 4DGYH 3MRMB 3DHJA 1N8ZB 3REWA 3EIFA 4NZUL 3ZDZF 1RVFL 4X6FB 2R39A 1R3JB 5ITFB 5DT1L 2X4QB 2NXYD 3VG0L 5IJKA 3ARDA 3OR7A 1CU4L 4Q9RH 2QADC 5TFSL 3QUZC 4IRZH 2X4RA 3OKNA 3O0RH 1DLFH 1B88A 3C87A 3ILPA 1U92A 4WNQA 4FZEL 1A8JH 2R9HD 5JHDA 3F12B 1I8KB 3IJYB 1AKJD 1LHZA 3U0TA 4RRPA 3BP5B 5IMKA 1ES0B 3RNKB 4FABH 4OI7A 3A6OA 4QNPF 5D2NB 1ZANL 1QEWB 1PY4A 1U8JB 3L7FB 4K94L 1F8TL 1JNLL 4KHXH 3BRGC 4M5YH 4GT7A 3RRQA 1A6AB 5TDPA 3WHE0 1J5OH 3IKCA 3FN9A 1I4FA 4L29A 2ZSWB 1D5BB 5J12C 3RJQB 5L8JB 1KB5A 1IKFH 3ALWA 1HIML 4P9ML 3EYSL 4AG4H 2KKQA 1L0YA 3JVGC 4JDVA 3V52L 1YYMH 1ZHBA 1UB5A 4PV8A 1A3RL 3I6LD 4OGXH 4KRPB 3F7PC 5C09B 4OJFH 3RY4A 2VISA 1IC4L 3GMQA 5TQ0H 1R3KB 4U6XB 3LEYH 3VXNB 5FK9A 2FYYB 1U8MB 2Y06L 1VGKB 1YPZE 2V9RA 4NT6A 3ALPA 3O3EB 5C0CA 5HDBE 1WWWX 1NAKL 3NCYS 1C5DB 4LNRB 2GSIB 3MJ6A 3P4OA 2AQ1A 5AZEH 4V1DB 3GI8L 4NWUH 5B8CA 1EO8H 3ARWA 2IMMA 3MRFA 4OUOA 5FYKH 3AREA 4ZS6D 4XAWL 3MNZA 3BT2L 3BSZH 3RL1B 5GIRA 3LN9A 4UT6H 1LD9B 5E94A 4WVRA 4H20H 4ZD3L 4KMTL 3FB6A 2EDWA 5BZWA 1RJLB 3EW3B 5JIKA 3MV7E 4LQFL 4HJGA 1FYTA 1SJHB 1R0AL 3WMSA 4BSVB 5EU5B 4O51B 1WAAE 4GKNB 1NUFA 4Z7OF 4APQB 2CKNA 5CZXC 1GGTA 1EZVX 1KFAH 2OJZH 4KVCH 5CIPB 1PKQB 3D85A 4PJ8B 2EKSA 2G75A 2AXJA 3RKDC 2F5AH 4XNYL 2B1HH 3GSVA 4JG1L 4Y4FC 5F1NB 2NY3B 2X10A 1U91B 4MD4A 1P7QB 3X3GL 4WUKL 2FGZA 5E4IA 1I7RA 5HYIA 4XWOD 3SJVA 1MCNA 1AGEB 5TH2B 4S1SH 3IDMA 1FL3B 4PB9L 5JPMB 1NDGA 3CH8A 5ISZE 4IRSD 2HRLA 2V5RA 3K2MC 3LKPB 4XMKH 3OJ2C 1XF2A 4DWHA 3IDGA 4QRTA 3UEZA 1G7LB 1IVLA 1IC5L 3MCLL 3NABH 4U1GC 3VFUB 1MNUH 3TN0A 4I48A 4BYHA 3TA3B 1GYAA 2XWBB 1FNEA 2FX9L 1EHXA 1AXSA 5GS2D 2EDHA 1C5CH 4Z7UF 2ZUWA 2C3GA 4HWUA 4G8GB 4K7PH 1C16A 2HLAA 3VXMD 5T1MA 2BVPA 1KTDA 1BD2A 3L9RA 3MR9A 4OV6F 2Y5TB 4QTHA 1MY5A 4OCYL 4O58L 2R9HC 4C4KO 2XTJD 2H32B 5BCAA 4WI9A 5CJXA 1OT1A 3WHE1 2AV7B 3EYOA 4WW1A 3RQ3A 1DBML 1D9KB 1WZLA 3HE7C 4IRJA 3O4OB 2X4SB 5K9OA 5KVEL 1T1ZB 2ZUTA 1RIUL 2EIZB 2MNUA 3O41B 2I5YH 2CUIA 4LCCC 1K4CA 5BS0A 3ARFA 2BERA 4FQQB 3S6CA 2ARJB 2X2YA 1TITA 5DC4B 3EHBC 2AJZA 3ULVL 3ULVD 1OAUL 1AO7A 4KXZH 4MDJA 2YKLH 3OKMA 1LO2L 1INEL 5D5MA 3U46B 1V7ML 1OAQH 2DB8A 3VGHA 3QAZB 4L5FL 5DWUL 1I1AA 3BKCH 4YH6A 3F7YB 1Q1JH 5C0IA 2X89D 3LEXA 1QPPA 2ZUVA 2X09A 3OZ9L 4QRRE 4ONHB 4FQ1L 1HSBB 1I8MB 3T0EE 1MLCA 5I2IA 4DUXA 4CVZB 4XBGA 4NZDA 3EZ8A 3R06A 1NH6A 4PGCA 5EWIL 2Q8AH 4N1HB 1S5HA 2Z91A 5BVJB 3R4DA 1QACA 3DXAA 5MEPB 5F9OH 3QDHA 4JO2L 1YQ2A 1QKZH 2EYTB 3QWRD 1ZAGA 1T7XA 5JORB 5D8JH 4PJGE 3MBXL 5CLWA 4S0TD 2IG2H 3CH1A 1F4AA 4ZXBB 1E4WH 4QRPA 3JWOL 4LLYB 3V7AG 5HYJE 2J12B 1MFCL 4YAQA 3RGVA 1LVEA 1T3FA 1E27B 3KXFD 3V79C 1SYSB 2DKMA 1IQWL 1F11A 1ZGLP 1F97A 3DUUA 1MCOL 3LAFA 2Z31A 3TWCL 3W5MA 4OFKA 3QNZB 4HFWA 2BNRB 4PJAA 5C0RL 3AB0C 4PB0L 5EZJA 5IK3B 2CLRB 3U30C 4YWGH 3GNMH 4JHAH 2F15A 3EFDH 3IJHA 2BFVL 1TNNA 4OAWB 3L7EA 4EUPA 3RDTB 4JFYB 2DQHL 2P5WB 1G9NH 1SYVA 3S9DB 2ICEA 3MC0A 4KJWD 1NAML 5F3BA 2MQCA 1PG7X 3VFNA 4Q0XH 3EUUA 5DJAA 3C5ZB 5J57B 2G5BB 3UZQA 4OD1H 3BPLB 1SJVA 4HJJL 5ENWB 3B9KB 4UQ3A 5E00B 3JSSA 4DVRH 4M7ZB 5IVXB 5JHDE 4N0YH 4X7DC 2HRPL 3ARQA 3VDCA 5C0AD 2VZTA 4YK4C 3RWHA 5B22A 4MCZB 2LFGA 1RIVL 3OB8A 1QFUH 4NWTH 2PYFB 1D3CA 1OGAD 5D1QC 5T33H 3UTQB 3ME0A 4UILL 1RPQA 5DLML 4HIXH 3HC3L 4U1MA 5HYEA 4KDWA 3MLSH 1KLFA 3DV6A 4OCSL 2BP3A 3SDAC 1Q9LA 5DXWA 1MHCB 1ZTXL 4K8RC 3O3UN 4AEFA 3MLZH 3UMTA 1YMMB 4PYHA 5JNYB 3BJ91 1I7UB 1XCTB 5GGSB 3HC0A 4OTXH 1YJDH 2H8PA 2X4UB 3WO4C 5GPRA 1JMZA 4DOHE 5SV4A 5AYUH 3G5XB 3KHOA 5C0CE 1YN7A 3AFLA 1S7RB 4OT1H 4XZUA 2CDEB 3BVNB 1P4IH 3HE6D 5E99H 1X5KA 3MZGB 2VDPL 3M45A 3FHAA 2D2OA 3PABB 5FB8A 4PRNA 1D5IL 1IEBB 5D2LF 1MVUB 2DMKA 2EH8L 2F8OA 4ZOBA 3Q3GB 3FONB 2A77H 4TOYH 5JR1L 4DAGL 3L6FA 1QBLL 4QY8B 1HCVA 1RURH 4FHBD 4H25A 4W6XB 2JB6B 1I9JH 2BNQD 1RZKC 3CGTA 5DJZA 1ITCA 4G5ZH 1R6VA 3WCYA 4LEXH 4GW4B 1WCBB 1FYTE 4JRXA 4JFHE 2APTA 2F53A 4Q9CA 1K6QL 2DTML 4WW2B 2GAZA 1A9BB 2IPTH 3QDMD 3VGEA 2WUBL 4MJ2A 4C4KT 3CFJA 1IE5A 3NFNA 3SKNA 1HK6A 2XQYK 1E4JA 4NPYB 2GITB 1I85C 3ARPA 3FAXA 3O2WH 4ERSL 3O2VH 1CBVL 4FQCH 2VR9A 1PQZA 3J7HA 1DN0B 3QFDA 5DUPL 1ORSA 2P8PA 5E8OB 1ZLUK 5BQ7B 1H5BA 3NZ8A 2YD1A 4WTWA 3V4VL 5A1AA 3QHFH 4EDWH 2CK0H 3SJVE 1SBSL 3DRTB 4N0CD 4FTVD 4CBPA 1BOYA 1WFTA 5BRZA 4QRUA 1UM4H 3F7VA 4L8CB 5CP7A 3B2VL 4P5TD 1FQ9C 3EYUH 4Y4HB 5I1EL 3LMJL 3P30L 1UB6A 4PD4J 1YPZF 4QRSA 4X6DA 5ETUA 5HDBF 1BF8A 1AC0A 1MPAL 1W0VB 5J1TC 3U4AA 1YEGL 3CXDH 4CDHA 4KJWC 1U3HA 1ZHKB 4IHOB 3ZKND 4XNXL 1AFVH 4R8WH 2VO5A 3FO0L 3K8KA 1N6QH 5GGVL 3QQNA 3HTLX 3TVMD 1EK3A 3V0WL 1H3GA 2XKUA 1YNTB 4WTZG 3UBXG 4LBEA 2VMFA 1C7SA 4MB4A 4OGZA 2QTEA 4JO4H 3EO1B 2VN7A 3QO1B 5C2UB 1NCDH 4XAKD 4NHCH 1YEIH 4K55A 1G9MC 1CFSB 5C0FB 2ATKB 4HUMB 3LQAH 3MRQA 3KJ4C 3SHSA 3RZCD 3VFOB 2ZUQC 4YXHH 4K7FA 3LKNA 4TSCH 3EDKA 5JOFB 4GG6A 4RMTA 3F62A 1A1NA 1OARL 5BS0E 5KS9A 1KPRA 1WAAF 5E7FA 5FF6B 4PRDA 3DO3A 3IDIA 3QRFM 5C1MB 3JTTA 1DBJL 5ICXB 1T83A 1AO7E 2QADB 1BQHB 1JUFA 2AABL 2VC2L 1BAFH 2BSRB 3HZMB 4JPKH 1PDKA 1DQLL 1P6FA 4OLYL 4GG8A 5D5ME 5EOCL 1BVZA 1KCSH 2YK1L 4HDIA 5HJ3B 3GKWH 5DD3L 3PQYD 4HIIB 3E2HC 5LGHH 5JW4R 3G5VA 4G9FD 3HE6C 1OCWH 2RCSH 3QDJD 1NBYA 1A6TB 5F8QC 4LQ1A 3R8QA 4Y5VA 1VKXA 2YOCA 2FCBA 5DQDL 1CE6B 3CNKA 4P3CL 5GS1C 3DXAE 5J12B 3FCTA 3T0BA 3ARZA 1J18A 4WU7B 1H15A 4E41B 1HH9A 4KUCD 4HX1B 3T1FA 5B38B 5DI8B 1ZGLB 1FO0A 4HZAA 2W9DL 1F4WL 1C08B 3UPCA 2NPLX 1WFOA 1PY9A 1TZHA 4JREC 1JGEB 4PGZA 4QRPE 3RUGA 5ID0A 4TQEH 5D6DA 3EOAA 4Y4KA 2EDBA 5T3ZL 5C0BD 5CLTA 1J7VR 3LPGA 4OCRL 5GGRA 4HS8L 1A22B 4NCC1 2MPAH 2FEDC 4I3RH 2ZCLL 4YHOL 4KRLB 4PJAE 1MCSA 3E3QE 2MWCA 1JYNA 2Q87A 3CZFA 1MHPL 3QG6A 4GRLA 1KPUB 2AGJL 3HCVA 1ND0B 5E9DD 1DBBL 2UY7A 4IDJL 4U6TA 3S4SG 1IBGL 3K1DA 1NDMA 2AVGA 5E70A 3TBVA 3FT3A 4F37F 5CEZH 4F9LA 3D3VB 4HKZA 3WS6C 3TCXA 1HXYB 2Y6SD 2OJEA 4X6CA 4K7PY 3IT8D 4DZ8B 1FGVL 5MP6H 4EN3A 1L7IH 25C8H 3HNSL 4MD5B 4P5TC 4Y5XA 3UJJL 5HGBB 3C08L 4ZO7A 3UC0H 4Z7NE 4XMLH 1JNJA 3EO0B 3GSUA 3ZKNC 1IQDA 3MXVL 5F7DB 1DUZA 5E08H 1DE4B 5FYLE 5C0DB 2DL9A 3TVMC 4Y4FB 4WCYL 2CKBL 4J3WA 3K2UH 3GBNH 1QR1B 2MOVA 2IGFL 3BH8B 4DW2H 2CPCA 2H9GB 3WN5C 3UP1A 3O9WA 4PRBB 1LDPH 3LY6A 4JFDB 3RWGA 1JP5A 3W11C 2X70A 3B83A 5DD1H 5DD0H 3TV3L 1IEAB 1UXSB 4KVNL 5JUEH 3PHQA 5SWZA 5JIIA 3SE4C 1QQDB 3FO9A 4MNQB 1T22B 2B8OT 3QIWC 2H2PD 3AVEA 3UBXI 4D8PA 3NH7L 2DIAA 1FORL 4UAOC 3T0EC 2Z92B 1AHWB 2EDKA 3LS5L 4UU9A 1KN2H 2ZG2A 3UDWC 4XCYB 5JMRA 1RMFL 5SX5K 4L4VB 2VXTH 2YPLB 4BFIA 3DOSA 2PCPA 2OYPA 4DKEL 4O5LL 5DJDA 3HE7B 2KQNA 2BOCB 1FBIH 3KG5A 2DQCL 3EDDA 4EIZC 2Z4QB 3FFDB 4JRXE 3MA7A 2F53E 2J5LC 4LCCB 1JTPA 1KELH 2PYEA 4ORGB 1ZS8B 4OZGA 4R97C 1RJZB 5LGJB 1SM3L 3QI9D 5D7IA 3SKJL 4L4TD 3SGJC 4XX1G 4Z7UB 3V6BR 1BZ9B 2VYRE 3FTGB 3BQUD 4FFZH 1CTOA 2I27N 1KSRA 1A6PA 1N64H 3PGFH 1JWUB 1XR9B 3VGDA 4YQXH 5EZIL 5FV1L 1VSCA 5EUOE 4UQ2A 2D7OA 2ERJB 4NRXA 3IF1A 4PLOB 3THML 2IWGA 5ESAA 5AEAA 3ARDC 1EEQA 2FB4H 2MQ3A 5BRZE 1N0XL 2ZNXA 3BZFA 2DAVA 1JPSL 4LCWB 1C12A 1UWEL 5T1DL 1EVUA 2AJYL 3WFDH 3TIEA 3IB4A 1NGQL 4X6DE 4KH2A 5EIQA 2AJVL 2H41A 4XP1L 3KPQA 3MUJA 1Z3GH 1R24A 1ACYL 5HHVH 2R29H 5MHSE 4HUUA 2ZOLB 2Y07H 1HI6B 1I1CA 2Y6SC 3FRUB 1N59A 3MODL 5IEHA 1P9MC 1MCPL 3G6JA 3P2TA 4RA3A 4XPAH 3RA7L 4HUWB 3NCFB 5DZLA 1YEFL 4QF1A 2CD0A 1G7PB 3FHQA 3AB0B 1LO5B 5I18H 1GH7A 1WIPA 2APXA 3U30B 3FQUB 1I3UA 1LE5A 2QSCL 3AU1A 3S3SA 4M1DL 1A6ZB 2NY5L 4X7CC 5EO0B 2FGWL 4M5ZH 4HBCH 4LASH 4GG6E 2BC4B 2FO4A 5LXGL 4PP2A 4UOW0 5KS9E 4PJFA 3OG4B 5GRZA 3FQRA 4K8RH 4F15C 5L8KB 1XGRB 1T89C 4OZFH 5I74C 4NO2A 2HP4A 2I60H 1OWRM 5B8CC 2QSVA 3T4YA 1IFHH 2IBZX 5AWNL 5HY9B 3PGDA 4UNVA 4ZTOL 1EA9C 1NMCC 2Z9TA 3HG1A 1TCRB 4XPBL 5LVEA 2IH3B 4ZPVB 4WHTA 1T7VA 1LE9A 5I15H 3L3GB 1I9EA 2E6JA 4YK4B 2ZPKH 5SWSA 4YBQC 5KN5B 2H2PC 4XPFL 4QHLB 5INDB 2FECI 3NCJH 3MMEA 4ZNCD 3DMMD 4FQIL 4NQEA 2A9NH 2HT3D 5D1QB 4JM4H 4FFYH 5F1IB 3RVXD 1FVDB 4R96B 1ZA3B 4K3JL 3SDAB 5FHBL 1DQML 1H8OA 2M2DA 3HNVL 4D9LH 5HHXL 1CICA 6FABH 3HPLA 3SGDI 1AD0A 4XP9L 3KAAA 4NZJA 3PF2A 2R0WH 1T0MA 4JZJA 3DETC 1ZEAL 3PDGA 3MNVA 4ZFFB 2JIXB 3IKKA 3RUGE 4MAYA 4M48L 3V4UH 4HKJB 5IIEB 2Z35A 3BEWA 3DUHA 3P3YA 1WV7T 4LARH 3ZDXE 1RZ8A 2IJ0C 2R4RH 3PIQA 4GUPB 4ODBD 4ZUVB 4F7PB 4I3GA 3AUVA 5CZKA 1AXTH 1WC7B 3WFCH 1C5BL 1T0NA 5JDSB 5I19H 1JMXA 1CDUA 3RIFK 1SJEB 1V7NL 1J1PL 1KJ2H 1QBMH 5BJTA 2OTWB 4ODTL 2B2XL 4OFIA 1CDYA 3TN0C 1JHKL 1AY1H 4MA1C 1F4XH 2RJMA 2Q76A 2GTZA 4JFXB 5ELIA 1BFOA 3X13B 1PYWB 3LQZA 3C8KA 2FH8A 1MJ7L 4LKCA 1ZLSH 1T20A 3QEUA 3U48A 2RQ8A 4PGBB 5FYLD 5CGTA 3U79A 1MJJB 4NQXA 1RUPH 3BE1L 4OLEA 4N8CL 5D5MF 4KTEL 5FA3A 2VTFA 1A3LL 4MLSA 4XPGH 5H94B 1YNLL 4AL8H 4QXTA 3OKLA 5CP3H 5DJCA 5CJXC 3G6DH 5KOVC 3WXVH 2X6MA 1CFVH 4CMMA 4IRJC 2CMRH 5D2LB 3WHXB 4YXLH 1KJ2B 1ZV5A 1NFDA 5GHWL 1KIRA 1UQSB 2BRRL 1FZJB 1S7SA 1RV6X 1F6LL 2HTKD 3RX7A 2OXHA 4FXKB 4CN4A 5IBTL 2NNAB 1TJIL 5MI0B 1O5DT 5EIIA 3ARFC 4POZD 1JWMA 3P9LA 1NCBL 4R4FH 2I25N 5FHAH 1G9MH 1JN6B 2BDNL 3DVFA 4UOW1 4YHYC 4AJ0A 2P8LA 1MJ8L 2IQAA 4HKBB 4I8DA 1VENA 5KSAD 1E6OH 4EQ3A 4QOKD 1SY6H 3GHBH 5SWZE 1TJHL 4PRHA 1T2QL 1CLOH 1RHHA 1IGCH 3I84A 1I1AC 5T1LB 3GRWL 1XR8B 3WNMA 2B4CC 1EUUA 4PJAF 5IV2A 3MCKB 1KLUA 3IXTB 1P69B 1MQKH 1T5XB 3LKQA 4GLRI 1L6ZA 1O7VA 4RGOL 1D5MB 1WLHA 4KKCC 1OGTA 1BIHA 3F5WB 2VITB 1DLHA 2DM4A 3CVIH 4NRYB 2V2TA 2VXUL 1EFXD 3RTQA 3MOAH 3E1F1 1QFPA 3ETBF 2ZJSH 1JZ2A 1V3MA 4KTYA 1QLRA 5DF0A 5DC0A 3DMMC 4OLZL 1QLEH 2WW8A 4PJ9A 1W0WB 3KJ4B 2JELL 5AD0B 3KYMA 2ZUQB 3GMNB 5C7XH 5FECA 4KI1A 1YPZB 4LSSL 1NJ9B 1JGVH 1QBAA 3B5HA 2PYEE 4JFFD 1R5VB 4G8EB 3RGVC 4HV8A 4YHML 5D7IE 3DGCR 1FJ1B 4Z7NF 2Z31C 2EZ0C 4MA3B 4M6MH 3GMPB 5L2KA 4Z5RA 5K9KB 3QEQD 5IQ7L 4U1JB 3VG9C 5CKAA 5T3XL 5T3XD 1BMGA 5HD8C 2WLZA 3DX6A 1G6RH 3T08A 5C6PB 5EU6A 5ERWB 3VRIB 1NGPH 3IDYC 4YXKH 5CD5D 3HE6B 3P4NB 5GJTL 4Y2DA 1FIGH 5BMFH 2PXYB 1DBKL 4KDTC 4ODHL 3DVGB 2P46B 4M7KH 1S7TA 4QT5B 3RP1A 4YEEA 4OB5H 3QWOA 3FO1B 1QG3A 5GS1B 4KJQD 3T4AB 1H8SA 2X7LA 2LAGB 2XKNB 5D7LA 4J3XA 4AT6A 1I8IA 2VKXA 1SMAA 1IM9D 1E28A 3DHMA 1Y6KR 4GKSA 5MENA 3GJEB 1CDHA 1MF2L 3GK8L 3RI5F 3KPTA 3KNBA 2XN9D 1W8NA 3EFFB 4JREB 5A2LH 2Y36H 1MCIA 5KVDH 2C4FU 5EU3A 3O11A 1G6RB 5DHXB 3G6JE 3KPPB 5ADPL 1FNLA 5SV3A 3WE6B 4LDEB 1G7MA 5TDNB 3BAEL 4JVUA 3NFSL 5C6WH 3QDMB 3FFCD 3JWDH 4UDTB 1J1XH 1MCBA 1VACB 3BZEB 3K1KC 3BDYL 2JJWA 4O4YL 1H3UA 5ISZB 2DQUH 1S7VA 3MRCB 1GGIH 1NCNA 3L3OA 2FIKB 4L3ED 3LPWA 1AQDB 3MYJB 1CD1B 2KZWA 4YHPA 4P2OB 3C2SA 1K8DA 3MJ8A 4PJFE 5IMOB 1SEQH 2E7MA 2R0KL 1JPTH 4PGEB 4FTVB 1RHFA 5K59F 1MFBL 4NKQB 1YECL 3IFNL 3QBTB 3G5YA 1MH5A 2JF1A 3HG1E 4ETQB 4P5TB 4PJEA 5KSAC 4U1KB 5D1ZA 2W0LA 3WKNA 3MGOB 1X5IA 5F93C 3VE0A 4UV4L 2CKBA 5SWSE 2I9TB 4Q6IC 5EUOF 1NCTA 4TN9A 3S36H 5T5FL 1A7OH 1I9RL 5GGQL 1RZ7H 4NQEE 3VWJD 3PHSA 5E2UH 5F21B 4LLMB 2R1YB 4OM1H 4WTZA 4NO5A 2GJ6A 3GSQB 3UBXA 5I8EA 2GFBB 4Y4KD 4NJ9H 2CLVB 1OM3H 3D69B 1QRNE 4LGRB 4JQXA 3VFGH 4LAQL 4BQ8A 2KUTA 4X6DF 3WN5B 3VXPA 1IGML 5IMMB 1CGSL 3PWUA 2P24A 3MZTA 1RUMH 1NKRA 1FZMB 1G7JB 4XNMB 3J8F7 2I07B 2NQCA 2LVEA 3GUTB 3QQ3B 1S3KH 1NCWL 4EEEA 1S78D 4RSVA 1E4XI 2W65A 5I66B 4XC1L 1FRGL 4C56A 4YHZH 3QIWB 4MJ6A 4NZTH 2BSTB 1H5BC 3SY0B 3DI3B 1ODAA 5E8NB 3VWKA 4QRRB 5BZDA 4HGMA 1HHHB 4N0RA 1MAJA 3PWLB 4S2SB 4UAOB 3T0EB 2IAMD 3UO1H 3C5JB 5HDOA 1MFDH 1EUTA 2VZ3A 3CSYB 1TVHB 1XF4B 3MGTA 1HEZA 4HZLB 2IH1B 3ILQD 4TTDD 2G5RA 4I5BA 5I8OL 4NBXB 4GG6F 3EDFA 4HK3N 1MLBB 4KQ4H 5KS9F 4EI5D 1JPGB 2C4XA 4TUOA 3C5SA 4LSUL 4MSWA 1UVQA 5F7EL 5F7UA 5FKPB 2VABB 1U3HC 4YO0A 2PR4H 3DURA 2J5LB 1L9MA 3ARBA 4KJQC 2CDGB 5HYJB 5D93C 3KPSA 4R97B 1JV5A 1I7TB 3UXFA 2EDTA 3MV01 5GISL 3KJ6L 3VFRB 3ULUL 4KUZL 2YPKA 5EBLA 3I6GB 2NCMA 3C9NB 3DBXB 2DJ4A 1U93A 4OCXH 3AC0A 5E2WH 32C2B 4PJHA 4U7SA 4NHUB 4YBLC 1TPXC 5EZOL 1P2CB 3V7AE 1NFDE 2ADFL 4NSKB 5HHOD 3TH4T 3WS3B 5B3JE 1VB9A 4NC1C 3REWB 4NQVA 2EEAA 2P7TA 3OAUH 2P5EA 5I8KH 1KB5H 3Q6GH 3O6KL 4M93C 2BSED 4S1RL 3LRSB 1WIOA 15C8H 3ARDB 5HVHC 1GVIA 3OR7B 4PBWD 1T83C 2BX5A 3WFBL 2C26A 2DQDH 2F54A 4P46A 2MJWA 2R15A 2X4RB 3OKNB 3RUGF 3ILPB 1U92B 3NTCL 4WNQB 3S4SA 4LLUA 3RWCA 4P23D 1GGUA 4CVWA 5IB2A 3ZDXF 3HNTL 4PRHE 4XNUL 1BX2A 3VXUD 3U0TB 5IMKB 3TFKD 1IMHC 5HGDA 2WANA 2MFNA 3HC4L 3MBED 3QXUA 4XCEA 1RZJL 5DD5H 1WT5C 5F71A 1VA9A 5TDPB 4Y5VC 4KPHL 1JF5A 3IKCB 5DURB 1BQLH 1I4FB 3BZ4A 5TE7L 1NCAL 3OKOA 2CRZA 4HIEA 1KB5B 4OZIA 3NAAL 3H9SA 5E8EA 2R8SH 5D7SL 1ZHBB 1UB5B 3OTTA 5E95B 5FUZH 3WJJA 4PV8B 5DMKA 4WUUA 3QIUA 2EXWD 3PWPD 4KTDH 1YC7A 2QLVB 5CJOH 2VLLB 3GI9L 5EORL 1FH5L 2VOTA 5E6IA 5GS3A 3MFFA 5D6DC 5FM8A 1OAYL 4Y4KC 2AEPL 4TVPD 3WXWL 3QA3A 1EMTL 1P5VA 4NT6B 5C0CB 3K4DA 2AXFA 1CLYL 4H1LA 4F15B 1A47A 1WFUA 2BK8A 5I74B 5F1SA 4MQTB 5B8CB 3TIDA 5L2KE 2V17H 3D39E 4BZ1H 1NMCB 3MRFB 1WZ1H 1J1OL 4GRLC 2J6EA 4FXLA 3W9EA 1GHFH 1S78C 3E6HA 5CUSL 3X11A 4JY4A 5EU6E 5GIRB 4GXVH 5T1KA 1UKTA 4AK1A 5E94B 4L3CB 3GMRA 3H2WA 3OG6B 3FB6B 3U6RA 1LDSA 5BZWB 5DUBA 4RQQA 4HJGB 1FYTB 2H6PA 1P84J 1FAIL 4TPRL 4P59L 2Q8BL 2OI9B 5D7LE 4TTDC 4Q58C 4M3KB 4Y5XC 4G43A 5DVMA 3SKOA 5T3ZE 1FDLL 2APWA 3MNWA 5MENE 3JV5A 4BELD 4R90L 3AGVA 4NZRL 4UIKL 3D85B 4LEOA 3G9VA 1N0LA 4JY6A 4BQ9A 4ZFGL 2EKSB 5IUSA 2G75B 2VAAB 2QR0A 4B5EA 1BBJA 2R23A 4Q9QL 1KT2A 2IPUK 4BSWA 2R0ZH 5EUKA 4MD4B 5IKCA 4NUJA 3HI6L 3IDXL 3SJVB 1EAPA 4L1DA 3IDMB 5LCVH 2ORBL 4UB0H 2E7BA 1NDGB 3I85A 3O9WC 3QJFA 2D03L 2D7PA 2NY0D 1XF2B 1CE1L 5DZNA 4OF5A 1INDL 3IDGB 3QUYD 4WI7A 3KPRA 4OD3L 3PXJA 3TN0B 1I75A 4I48B 3CK0H 4MA1B 1FLTX 2WM0A 5HGHA 1FNEB 5D71H 1AXSB 3WIFB 4LSRH 5D7IF 5J89A 2DYPA 5EA0H 3WD5L 1QYGL 4WO4A 4OQTL 4U0RC 1C16B 2HLAB 4P2RD 5T1MB 2BVPB 4PRPD 1KTDB 3B9AA 4W70A 4QTHB 3L9RB 3MR9B 3W0WA 4PRIA 1I3RA 3EJZC 4PJEE 3G04A 3P0GB 2K7PA 4ALAH 3MLVL 3WL9B 1ED3A 1QRND 5F9WC 5J8OA 1GIGL 4YIQA 1EH9A 1YEHH 5CD3A 5EC1A 1RK1A 3EYOB 4WW1B 3VCLA 4FN0A 3U36A 1UKQA 4IRJB 5K9OB 2B4CH 3D2UA 3MLYL 1U2CA 3RAJH 5I30L 3KPMA 2FR4A 3V9FA 35C8L 4K9EC 2GJ6E 2VXSL 2CH8A 3TT1L 3IFLH 4NBZB 4FNLH 4ZS7H 4CL7A 3UTSA 1K4CB 5BS0B 3ARFB 3U4EB 4AMKL 2CIIA 2DQJH 4YHLH 3A67L 4LDLB 3HR6A 4ZUWA 1AO7B 3GRWA 3HI5L 4YHYB 1RFDL 4MDJB 4U1HA 4DKFH 3OKMB 3RKPA 5D5MB 4MMZC 2ZG1A 1N5YH 2FNBA 4UT9L 4C56E 1I1AB 5JOPE 5FKAA 5C0IB 2XACC 3LEXB 1B0GB 2DDQL 3O6LH 1MLCB 1N26A 2O5XH 4OZ4A 5I2IB 4JCLA 4XBGB 2EIEA 3OXSA 2DI7A 3R06B 4PGCB 4BH7A 2HH0L 1S5HB 2Z91B 1EEYA 5FA4A 4JJHA 3DXAB 5JHLL 3VFVA 4ISVA 2VDMH 5EN2A 3SE3A 1S9XA 3T77A 4EUPH 5IESL 3AMKA 3ZYJA 1CDIA 1A6WL 1KGCD 3RBSA 3DYOA 1AR2A 4QRPB 4R26L 2XXCB 4BZ2H 3MLXH 3O2DL 3SGEI 1CZ8L 5JMOC 2V5SA 4JPWH 2A0LC 5DRNA 3ARGD 3UJIL 3ABZA 4YAQB 3RGVB 3V8OA 3KPSE 1MCDA 1T3FB 4KC3B 4PJ5D 1CFQB 1F11B 4Y8AA 3STLA 5EBMA 3DUUB 2Z31B 4HFWB 4WY7H 4PJAB 5FOBA 1I3VA 5EZJB 2DLFH 5HSFA 3VG9B 2DICA 4TULL 2N1KA 5LBSL 2Y4SA 3ZL4L 3IJHB 2JJUA 4X7TA 1EGJA 3L7EB 5TE4H 3TESA 1B6DA 3IDYB 4RBPH 1KENH 5DJXA 3KPNA 4EUPB 2P5EE 1KG0A 5KG9B 1KCUL 3LCYA 1SYVB 3OX8A 5F3BB 1BJMA 4N5EC 3V0AC 4X5WA 1F45A 3VFNB 5DJAB 4JCMA 2NY0C 4WWKD 3RL2A 3P11H 4JE4B 4UQ3B 3BKML 2OR9L 3QUYC 1GGBH 1A7BA 3VXTA 3V4PL 4KK6D 3PGCA 1TVBA 3I2CH 1OTUD 4ODSL 3BH9B 3V8CA 3DIFB 3UTTA 2QQNH 3IU4L 4Y16A 4F37K 3RWHB 4RFEB 5JQHC 3P9MA 4X4MA 4C83A 3GSNB 2GJZA 2F5BL 3JXAA 2EC9U 3CZJA 3QIBA 4N68A 3F7QA 4FFWD 3T3MF 3DTXB 5CWSA 1NLBH 3DUSA 4U1MB 2PTVA 3DV6B 1E0OB 2D7TH 1Q9LB 2ATPA 4OZIE 1CICC 3H9SE 3U0WH 1AQKL 1RU9L 2UWEA 2Z0BA 4DKAA 4KU1A 4WUUE 5IWLA 4JZJC 3WJLA 5KVFL 2QBWA 4ZQKA 3P40A 3D39D 4G6AD 2APBA 3PV7A 3HC0B 2H8PB 1IJ9A 4EJ1C 4UBDD 2YEZA 3E6FA 2IBBA 3PL6A 1YN7B 4XZUB 3UAJD 3WDIA 1OLZA 1UENA 4HWZA 4BQCA 4JRYA 1WJ3A 5DEZA 4JR9H 4PRNB 1HQ4A 3T09A 1A6VH 4G6FB 4XVJL 1OWWA 5I16A 2R0LH 1NFDF 5B3JF 3REVA 2HWZL 1PKOA 4P3DA 3VRJA 3L6FB 2GTWB 5E6YA 4HFUH 3CU1A 4H26A 4H25B 4MXWL 4H8WC 4XPHL 3N1MC 2VZ1A 2HN7A 5DSCA 3KR3H 4J3VA 5DJZB 1SEBA 2E9JA 1D7FA 4Z78A 3MRJA 3NZHH 3IVKA 4JRXB 2F53B 4BM7A 1L0XA 2CUMA 4OZFG 2GAZB 3P0YL 5HGGS 1AE6L 3ECBA 3QHZH 4XPTH 1XMWA 2BVQA 4OLUH 4JPVH 1CVSC 3CVHL 3RVUD 3AS1A 1A0QH 3SKNB 2W9LA 2DQTH 4M6OL 5FUCC 1MCQA 5HDQH 1MAMH 4Y1AA 2NX5A 2E5EA 3MYZA 4Z7QE 4PV9B 3WFHA 1MFNA 5GS0D 1PQZB 1IC1A 3QFDB 1REIA 1ORSB 2P8PB 4E5XA 5EUOB 1H5BB 3NZ8B 1QSEA 2W9EH 4WFED 4XX1E 3QFJA 3FT4A 2IQ9L 4X9FA 2PETA 4DQOH 4NZUH 5HI4C 1RVFH 3FAWA 1A21A 1JF1A 5BRZB 4QRUB 3OJMB 4DTGL 3D9AL 3F7VB 5FM5O 3TJHD 3QXAA 4H0IA 5IF0A 2KPNA 3GGWA 5F7NC 3KPRE 3MV9A 1CU4H 1HYSD 5D1ZD 1UB6B 4N5UA 4QRSB 4X6DB 5ETUB 5I1DB 3RGHA 1M1SA 1A3QA 1I1RA 3NVQA 1U3HB 1IILE 1MRDL 5DFVD 4BSJA 4HCRA 1TNMA 4WWKC 2NZ9D 4M8QA 1NEUA 4JGUA 3W0WE 1ZANH 1F4YL 4PRIE 5D93B 3MLRL 4LBEB 1JNLH 2D7MA 3HI1B 3RU8L 4O00A 5B21A 4GAGL 2IPKA 4WU5A 1R3IL 2DD8L 3PWJB 1N3NA 1UC6A 3ES6B 2B7DT 2EICA 1OP5H 4P9MH 3EYSH 5C07E 4YBLB 3V52H 1MJUH 1TPXB 1IAOB 3MRQB 4LHJB 4J3OC 1A3RH 3QPQD 4I0PA 4K7FB 3LKNB 2UVEA 3ZDYE 4GG6B 3L3KA 5L88L 1IC4H 3UTSE 5KS9B 1KPRB 5JOPD 4X7SH 3T2OA 4M93B 2O5YH 3FFCB 5J11C 5D7KD 4PRDB 2M1KA 3IDIB 5HVHB 4NFBA 3JTTB 1AGBA 4PLKC 1MCLA 2H3NA 1NAKH 1FO0H 1ZA6A 1JUFB 3MRRA 4LLVA 5IB3A 4G6AC 2YBRB 4YNYA 3WFEL 1QO3A 3CMOH 4AZ8A 3NCYP 2DLHA 4OD2A 5DR5L 4GG8B 43C9A 3GI8H 2DWDA 3ARYA 4FA8A 2YZ1A 3OXRA 1FL6B 2NW2A 3G5VB 4JZOB 1YMHA 5KJRL 3BW9A 4Y2DC 1KTRL 3BT2H 4X9GA 5E7BA 1U8IB 1UFUA 4Y5VB 1VKXB 4KK5C 1J8KA 5FO8A 4RZCA 2FBJL 5CINL 2CDFA 5DRWA 2WV3A 4G7YL 1QD0A 2AS5M 5JA8B 1IGJA 1CXFA 1V5JA 1H15B 1HH9B 1JNNL 5F70A 3BIAX 3T1FB 2A9ML 2AK1H 3OAZK 1GRWA 3ZYIA 3STZB 5AAMA 1U8NA 1FO0B 1WTGT 5C8JB 5DEGA 1TZHB 2X41A 5ID0B 3RUGB 4R3SA 5IB5A 2KH2B 4I3SL 5D7JA 4Y4KB 1GZPA 5GGRB 1MRFL 1NQBA 2P5ED 3QCUL 2HJLA 4BUHA 4XNYH 5ILTL 1EJ6A 3X14A 4MD0A 4S1DC 4MWFA 3X3GH 3CZFB 4WUKH 5GRUL 3QG6B 3B9EA 4GRLB 2YA0A 4AENA 3G6AB 4JKKA 3HCVB 3LN5A 4TSAL 3U7WH 3R1GL 4PB9H 4XHQA 4JKMA 2NW3A 3BX7C 4XVTH 5GS0C 5E8DL 2RFXA 1NDMB 3TBVB 3FT3B 2D3VA 4GQ9L 4JG0L 2JJTA 1IC5H 1PX3A 4HKZB 2FX8L 4LFHG 4X6EB 2OJEB 4XGZA 2FX9H 3UJTL 1E4KA 3MJ7B 4KJYB 5CJQH 5TE6H 2VDKH 3STBA 5TJWK 4ODVL 3H8NA 3HMWL 1TVDA 4OBSA 2NR6D 3FMGL 5A2JH 4Y5XB 4NGHL 1MWAA 5D1ZC 1QA9A 3O3AA 3UTTE 3QXTA 5M94B 4MQXD 3IFPA 4PJ7F 4O58H 4F58H 3QIUD 1FFOA 3GSUB 4WFGD 4X4ME 3FT2A 2JK5A 1IQDB 1XGYL 4OF7A 4XVUD 1BOGA 1DUZB 4LGSB 4Y8DC 4LHUG 1CF8H 1Q9OA 1J11A 5AUMA 4DFIA 4OGYH 4LPTA 2G60L 1LGVA 1RIUH 4JQXC 2XYCA 4K7PX 5HI5D 4M1CC 2UWEE 1FSKC 1LQSR 4M7JH 3C2AL 3CIQA 2HAZA 3O9WB 4CADA 4LCUA 1XCQA 2H26A 5A40E 3QJHA 3L1OL 3RWGB 3TLRA 3QPQC 4HW6A 1OAUH 4EZMA 1T04A 3PHQB 4YFDB 1NSNL 5SWZB 1VGEL 3C09C 1NGZA 3PJSA 3FO9B 4NYLA 1WBZA 4UDUA 1INEH 1V7MH 2C3XA 4D8PB 1FC1A 4L5FH 4U0RB 3T3PE 1D6VL 1VFOA 4JRYE 3WNLA 4Z7WA 1HSAA 4R4NC 1M71A 4UU9B 5FYJL 4OLVL 5CEYA 4FQ1H 1P53A 4YLQT 1W0YT 5HDLA 2NYYD 5F9WB 5KSBA 3BGMA 2VLRD 3T04D 4BFIB 3MRPA 4K23L 2PCPB 3CLFL 4X98A 3O8XD 2AXHA 5DJDB 5FXCH 4JO2H 5E2TH 1DANT 4UINL 3MBXH 3MA7B 4UV7L 2K7QA 3ARBC 5EO9A 3BD3A 3MJ9L 3GO1L 2FJHA 1DBAH 2PYEB 3JWOH 1ZT1A 2IFGA 4BFEA 4BJLA 2NY2C 1QNZL 5D7IB 5EOCJ 2ZUYA 4U0QB 1OAXL 3S97C 4Z9KB 2ZG3A 4F33A 1IQWH 2W0FA 5E03A 1MCOH 1OB1A 3H3KA 3TWCH 4Y1AE 2NX5E 3MCG1 1NLDL 5C0RH 4JO3L 7CGTA 4PB0H 3L3DA 3WFZA 1RQ5A 3M1BA 4UQ2B 1QSEE 3FB5B 4IOFD 2A6JA 4OZIF 3QFJE 3GKZA 4RNRB 4NRXB 1F3JA 4YDKL 2DQHH 1JPST 4JLRA 3QT2A 3SO5A 2GI7A 4P46C 5DVLA 5ADOL 4GAYB 2JKXA 1C12B 3MV9E 4H5SA 3O2DA 5IBLC 4RBPK 4TUKH 1DVFA 1DEEA 4KKBD 2ITDA 5CSGA 3FQNA 1EO5A 3ULUE 3SDCA 5IHLB 2N7BA 4HUUB 1A4KB 5HPMA 5C07D 1N59B 5DQJA 1CDJA 5EG6C 2XA8L 4E42A 5IEHB 4D9RE 3MLTB 2X4TA 1QSZA 4QXGH 4N9GB 4KHTH 4QF1B 4GW5A 3HC3H 2NXZD 4OCSH 1XZ0A 3QIUC 3RI5K 3D25A 3S34L 1FG2A 5DRXA 3NIFE 1LE5B 2KDGA 3AU1B 4XVUC 4NQDA 3RNQA 5E6IC 2R69L 3FOLA 1WVZA 2FO4B 4PP2B 4W81A 1JVKA 3VGBA 1E6JL 5KAQG 5GRJL 3LSOA 1EHLL 4NO2B 2NY0B 3JV4A 1B2WL 3WSQL 2X40A 3PGDB 3S35L 3HG1B 3QUYB 2FLRT 2VQUA 4Z7QF 3A6CH 4WHTB 4RMVA 3WDHA 5ITBL 5FFLA 2UUDH 2GK0B 1D5IH 3O81A 3P77A 3MRBB 5SWSB 1KBGL 1HDMA 2EH8H 4WTXA 3TZVA 3Q2CA 4DGYL 5FDYA 5JR1H 4DN3H 3MMEB 4DAGH 1QBLH 4NQEB 3AM8A 3OKYA 3PDDA 5EO1B 3RVVD 3BO8A 2Q3ZA 1BJ1H 4PRAA 4NM8L 5J3HD 2E3VA 2WQ8A 4H88H 1I7ZA 1QRNB 1B9ZA 5HVFB 4Q9RL 1CICB 4KRPD 1IAIL 5C09D 4MJ5A 3O0RL 4M8VA 3O8XC 3SBWC 1HCFX 1RD6A 3H42H 1FN4A 1FFPA 1S7UA 1T0MB 4JZJB 3MRHA 5D96B 3GM8A 3KLDA 3MNVB 2HJFA 3B4NA 4JVWA 1XIWA 1RIHH 3BMWA 4G9DB 2FIRT 2WUBH 2VN4A 4EI6A 2Z35B 3BEWB 3MLUL 5EOTB 1RZ8B 2DMBA 3PIQB 5E2VH 4V1DD 1CLZL 2FJGA 4JFOA 1J5OL 3QCVL 4ERSH 2VE6A 1T0NB 1M05A 4NJAL 1VFUA 3KYOA 1PBYA 1WWBX 2X44D 4AG4L 4NNYB 3FO2A 3OKDA 4Z77A 3N1GC 3S98A 1SBSH 3HZVB 3MV8A 5BJTB 5IGXH 1WISA 3ZDYF 4PY7A 3B2VH 3DLQR 2Q76B 4IOFC 1T1XA 1BFOB 1N5AA 4CKVX 5I1EH 2VKWA 3LQZB 1JYWA 4HWNA 1GXEA 2OL3A 2Z8VC 3C8KB 2R2BA 4NN7C 1CFTA 3CVHA 4LKCB 4A2LA 1T20B 1IGTA 3QEUB 1YEGH 3QCTL 2UZXB 1N4XL 4NQXB 1IZJA 4MMXC 4XNXH 4APQD 1UADC 4NWUL 1LK2B 3EOTH 5FA3B 3FO0H 1YN6B 4PJ8D 4M61B 3FOMA 4KKBC 5FYKL 5FYKD 4QXTB 3OKLB 1LO4L 5DJCB 4MZ2A 1U8HA 2NTFA 3DPBA 4CMMB 2IANA 4ZSOB 3VFTA 1FVEA 3QEGH 2NY3D 5JA9A 2AQ2A 1RZFH 3RVWC 1P7QD 4QO1A 1NFDB 1KIRB 2R2HB 1S7SB 3B8SA 4MXVE 5E8PA 4QTIL 2Y7QB 3SCMA 3VXSA 2FO1A 3P9LB 4P5MA 2OTUA 3TNMA 3VI3E 4U1SA 3DJ9A 4F7MA 1OARH 1OP5K 7FABL 1M7IA 3TA3D 1A1MA 2P8LB 2OJZL 4KVCL 1KFAL 1DBJH 4OFYD 2YD7A 2AABH 4Z76A 2VC2H 3LVEA 4L8BA 2J2ZA 4LSVL 1QBBA 1RHHB 4G8GD 2DJSA 1X4ZA 4OLYH 5GGRY 1L7TH 1CK0H 5E5UB 5EOCH 1FE8H 2AJUL 3E8UH 5DD3H 5IV2B 4Z7WE 1KLUB 3LKQB 4F8TA 2XZAL 3D0LA 1OGTB 3E0GA 5ACZA 2EYRB 4S1SL 3F65A 4HGWB 1DLHB 5MEQA 2V2TB 5KSBE 3F6LA 1D9KD 3RTQB 1ZSDB 1MCCA 1ZVSB 3TEUA 3OV6A 4PR5A 3SE3C 4OCLC 5IM7A 2DLEA 1HHJB 2P44B 5EBGA 1QLRB 1BVKA 4F7TA 1NL0L 3MRIB 4PJ9B 2X9XA 3RVVC 4Y1AD 1DQQA 2W9DH 1F4WH 1Z0NA 4IMLA 5FECB 4DGIL 5L6YL 3FQWA 4X9BA 4K7PL 4YR6A 4JHWL 4UTBH 3QUKB 4OV5A 3ZHLA 1GGCL 5J11B 4L8DA 1X5AA 3T8XB 5T3ZH 1M7DA 2F74A 5L8LB 1ZLWK 1LMKA 2FL5A 4G42A 4OCRH 3MXWL 2AK4A 4JN2A 1JYVA 5JIPA 4HS8H 5L2KB 4Z5RB 3D39B 2ZCLH 4YHOH 3HKFA 5IROA 3MV9D 2IC2A 4A2MA 5EU6B 2ICES 3QEHB 2AGJH 5I1JL 4Y2DB 4IDJH 2ZOKA 1IBGH 3VGAC 5IW6B 4MQ7A 2UWEF 4LRIA 3ZMRA 3LKSA 1UA6H 2P8MB 4MA7H 3QWOB 2A83A 5BO1H 2I26N 2E7CA 2X1OA 4HG4J 4RWHA 1YEKL 4Y19A 4JDZA 5D7LB 3MA9H 4AT6B 2GJJA 2J8UA 1FGVH 2GKIA 1I8IB 4MVBD 2YKLL 1E28B 4GKSB 3EYVA 4ZXBD 5MENB 2W60A 1T6WA 3HNSH 1U95A 4Y16C 4U3CA 1OAQL 3UJJH 5KOMC 5CAYB 5C3TA 3KNBB 1KIPA 3C08H 3BKCL 4D3CH 3T3PF 1Q1JL 5A3IC 1XGQA 2DIBA 3QIBC 4NQTA 1XF3A 3O11B 1PG7W 3TO2A 4KY1L 5HHQA 2CXKA 4OZFA 2OSLB 5DK2A 4APQC 3MXVH 3UPAA 2BNRD 1G7MB 4I77L 4DUVA 3LKOA 3H3PH 3IJSA 4MDIA 4WCYH 4WI5A 4ZFOA 2CO7B 2CKBH 5CBAA 5F9OL 1QKZL 2HYMA 1TETH 3H7LA 5IWLC 5FCUL 1S7VB 4NQDE 1DL7H 3RDTD 2HVJB 5ESVA 2P5WD 2GCYA 4UUJB 3KLHD 2YRPA 2P42B 4YHPB 5IHZA 3MJ8B 1BWWA 2EXYC 4U31A 3TV3H 4M9PA 1H3PH 4K71B 1Q0XL 3HZKA 4KVNH 2B1AL 1EBPA 5DD6B 3B9KD 4HUKB 3WYRA 5INCA 2X05A 1FFNA 3G5YB 1F4HA 1DQDL 3N1PC 1MH5B 1S9YA 2FLBT 2DWEA 3NH7H 4R2GC 3O6ML 5D1ZB 2DQGH 2EH7L 3CXHJ 3LS5H 3OSKA 3VE0B 1QPXA 4QHMA 5F1OB 2CKBB 5FO7A 1EIBA 2Q7YA 3WIHA 2YUVA 3V6FA 3O3BA 4L9LA 3CDYA 1XAUA 3C60A 1G9NL 4O5LH 2GJ6B 3UBXB 4ZG1A 5I8EB 5F44A 1MCRA 5TGBB 1MIEH 1F13A 3L3IA 4Q0XL 5IHUH 2DQCH 1Q38A 1KLGA 4PREA 2HFEA 1BBDL 1D9KC 4J8RA 1YMMD 3ZZ1A 1FSKB 3VXPB 5DGRA 3HLAA 3PWUB 3UZEA 2D4DA 1JGDA 1SM3H 1C1EL 4KK8D 3SKJH 1OP3K 1MI5A 4LRNL 1TQBC 5CEZE 1VPOL 3MO1A 4CVXA 4ONFL 3SDDA 1QHOA 2W65B 2A38A 4IDLA 4NWTL 3CSBA 4MJ6B 5ICYA 4PJ7B 2AI0L 2V7HA 1OD9A 5BZDB 4HIXL 3VGGA 1OQOA 3MLSL 1HHIA 4P2QA 3NIFF 4BKLA 3MGTB 1JCKA 3MV8E 2YS4A 5C08A 5IFJA 3BOVA 4I5BB 1N0XH 1PEZA 1X5JA 4UIMA 3HR5A 5CSZA 1QLFA 1X5HA 4KKLC 1L6XA 2XY1A 3KLSA 5T1DH 1MEXL 5AYUL 4U2ZA 1A2YA 2AJYH 3C5SB 4TUOB 4MSWB 1UVQB 2Z8WC 4XI5D 1QVOA 2OQJB 1UJ3A 5I71C 1KPVA 1NGQH 4OT1L 5DJ8A 2AJVH 4YO0B 4XC3L 4XP1H 1UWGH 1ZVYA 2VIRB 4Z95H 3SPVA 1ACYH 4ACPA 5E99L 2J1KA 4RFOL 3ARBB 1QRKA 3CDCA 4OCMC 5F8RC 5I1HH 3KPSB 1JV5B 2NY2B 2WIIA 4P4KA 3IAGC 4YDVA 3MODH 2YPKB 1PFCA 1H0DA 4RA0C 4ZFZB 4PBXA 2A74A 4TOYL 4BK5A 1U93B 4L8SA 2IANE 1YEFH 3W2DH 2WINA 2L4OA 1RURL 1A7NL 4DEPC 1NC2D 3GIVA 4XBPA 1I9JL 4I0PC 2FSEA 4M1DH 1J05B 4X8JA 4G8FA 3DVNB 2P7TB 5I1GH 2NY5H 3VXSE 2P5EB 4LEXL 3VRLE 5KW9H 5T5NG 1CL7I 1BIIB 1UXWA 1LEGA 5LXGH 4X9HA 3VGFA 3ZKMD 4PJXA 4Y4HD 1DP0A 2VLJA 3LZFL 3JTSA 4P46B 3RDTC 1OPGH 2XZQL 5CZVH 3S4SB 2ENYA 4RFNC 1I1YA 2Y25A 4LLUB 5IB2B 5AWNH 4ZTOH 1BX2B 1MCWM 5JQ6L 5HGDB 3O2VL 4H1LH 1SVCP 4FQCL 3B9KC 4XCEB 3MTRA 3OKEB 4GSDH 2P43B 4F2MA 2VWEC 3AS2A 4XPFH 3MRMA 1HILB 4LSPL 3RWDA 4HIEB 4R6UA 2UUDK 4OZIB 4C58B 3H9SB 5E8EB 4CVUA 3QIUB 2VZVA 4KI5E 4RX4D 2HKHL 1FLRH 4N90D 3SGKA 4V2BA 4XP9H 3S5LG 1KUMA 3CXDL 5E6IB 3F12A 1I8KA 5D7JC 1NCCH 1ZEAH 2G2RA 3QA3B 1KJVA 4M48H 3RNKA 2GHWB 2AXFB 1N6QL 4JY5L 1QEWA 1TDQA 4P48A 4CMHC 3L7FA 1F6AB 1WQVT 3QDGA 2AK4E 1EEUA 3TIDB 3V5HB 1NCDL 1C5BH 1O7SA 3OF6D 4AIZA 5D72L 3W9EB 1A5FH 1A7PL 3EBAA 1RZGA 3E6HB 3T2NL 3X11B 4JY4B 4MXVF 4KV5E 5T1KB 4XMPH 1HNGA 2D0HA 8FABA 1J1PH 4D0DA 1JPFA 5FGSA 4YXHL 3EYFB 4FG6C 2B2XH 3GMRB 5F88A 3ARVA 3VI3F 3U6RB 3ROOA 1G7IA 4O2CA 2V2WA 3VXNA 4RQQB 4E41D 2H6PB 3O3EA 4Y19E 5HHPA 4X4XA 1T80A 2J8UE 2GSIA 3MRGA 5AYQA 4G43B 4RAUA 1OTSD 1BAFL 2KL6A 4KRMB 3MNWB 3O8XB 4JPKL 4B50A 3BE1H 1YJDC 4LHQB 3SOBL 4KTEH 4L1HA 1YNKL 4XI5C 4HWBA 3ELAT 3GKWL 1A3LH 4GMSL 4JY6B 4OSUL 2XT1B 5HXMA 3VFWA 4WW2C 3NA9L 4CW1A 4WHCA 4ODWA 2QR0B 1OCWL 3ARSA 5FUOL 3SO3C 1KT2B 3BPOC 3RL1A 2RCSL 4YJZL 5EUKB 5KSBF 5KTEL 5GHWH 2BRRH 1OW0C 5IKCB 4NUJB 2BY3A 2DTSA 4FQXA 5I1IL 1PJ9A 1RJLA 2VL5B 2ZWLT 1TJIH 3QJFB 1SJHA 1GPOH 4JFZL 2DF3A 2EDOA 2V2XA 2BDNH 3D3VD 3KPRB 2SEBA 3LOWA 3BKJL 3GHEL 4HK0B 4PPTA 5IT2L 2J88H 3EJYD 3A6BL 1MJ8H 4GLRH 5HGHB 4NCC2 5KSVA 5CIPA 1PKQA 4U05A 2LU7A 2R56L 4NN7B 4I0CC 4XVSH 1T2QH 3ZKMC 5EB9A 3CFEA 2OS7A 3GRWH 3W0WB 2FEEL 2CJUH 2MPAL 1ADQL 4PRIB 5CZXD 5FV2A 1I3RB 3G04B 4ELMF 4F7EA 3BJLA 3KPOA 4RGOH 3T65A 5EC1B 5CD3B 9CGTA 1RK1B 3VCLB 4AQ1B 5ANMA 3RKDD 1VADA 3U36B 4Y4FD 2K9UA 5C07B 3D2UB 2FEEI 3KPMB 4PY8J 4HT1L 5CEZD 1EERB 5LGKA 3INUH 5IHBA 4OLZH 4WRLA 2DQFA 2XWBA 3UTSB 5IJVA 5MP6L 5HYFA 5B4MC 3KYKL 1L7IL 4X99A 5C2BH 25C8L 4LSSH 1XF1A 4MGXA 4ZUWB 1JWSA 4YHMH 1S9VA 4F3FA 3UC0L 1MI5E 1OLLA 4XMLL 4MNQD 4EDXA 1M6OB 2H32A 5FYJE 5CGYD 4LIQE 5EC2A 5IQ7H 4NO0A 3MOBL 4PG9A 4PYGA 3GIZH 3RVTC 2JJSA 5LQBL 4L4VD 1MIML 1JGLH 4P2QE 2YPLD 4OZ4B 4NKOA 5GJTH 1H3VA 3OXSB 3O41A 2VLKA 1DBKH 4BH7B 1CR9L 2OMBA 1EEYB 5FA4B 3RY5A 4XB7A 1LDPL 3HE7D 5C08E 3VFVB 3S8WA 4R9HA 1G1CA 2ARJA 4ISVB 1EGJH 3LQAC 1DVFC 1S9XB 5DD1L 3T77B 5DD0L 4JQVC 3QNYA 4NC0B 5JUEL 3QPXL 3SDCC 3RIAK 4G3YL 1B6UA 5I1AA 3GK8H 3QP3A 3EHBD 2WBKA 4J23A 2ARWA 3BUTA 1B4JL 1OTSC 2FD6H 3LH2H 4WI2A 4ENEC 3STLB 2M8XA 1J88A 5EBMB 5DHYA 4HHAA 1I8MA 2WWMC 5D6CA 5FOBB 3M8OL 4WGWB 4W4OA 5HHME 3BAEH 3NFSH 1WEJL 4X5LA 1OTTD 1VCAA 3C8HA 4I2XA 3BDYH 1QSFA 3RWFB 2AV1A 5DZOA 5DJXB 2EDDA 2AAVA 1KG0B 1SBBA 2VR5A 5DMIH 3S96A 3TO4A 3VGAB 5CHNA 3OX8B 3HB3C 3T0DA 4X5WB 4LCWD 4TNWF 2NY4D 2R0KH 2VLJE 3RL2B 1EEZB 3U0PA 3EO9H 4XP4L 2B5IC 3VXTB 1OD7A 3SDXF 2X9YA 3BYTA 1YECH 1TVBB 3PGCB 4FFZL 3EJYC 4UMGA 2QHRH 4MCYA 1N64L 3PGFL 4Y16B 1BREA 4ZDHA 3P9MB 4WFFE 4C83B 1MCKA 2GJZB 3MGAA 3QIBB 4Y5YC 1WFNA 3VXRA 5T5FH 4X6BA 1FPTH 1I9RH 5GGQH 5CWSB 4JFYA 5F7HA 2B20A 3DUSB 2N7AA 2FB4L 1UKSA 2ATPB 5SWQB 1MCJA 2UWEB 2XPGA 2IFFL 2ENSA 1E4XH 4HH8A 3C5ZA 3EYQC 1I3GL 3VU2A 4B7LA 3ISWA 4ZQKB 1IGMH 2R4SL 5BVPH 2CQVA 1XIWC 1Z3GL 5IVXA 5HHVL 2R29L 1CLCA 2RIKA 3S36X 3QO0A 3NN8A 3PL6B 5EBWA 2CRYA 2A1WH 3I50L 2ESVA 2FATH 2OP4H 3ZHKA 1ZVHA 4EXPX 2WP3O 5A43C 3B8YA 1Q72H 1YUHB 3O3DA 1X4XA 3O4LA 3QDGE 4HWZB 4JN1H 4JRYB 4OKVB 1NGXA 4XWGH 4KWUA 5ALCL 2VH5L 3IXAA 5JXAL 1HQ4B 1YZZA 4R2GB 4Q74A 3LN4A 5I16B 2ID5A 1BLNA 4LMQI 5I18L 3VFPA 5CGYC 4P3DB 3VRJB 5I75C 4AEIL 4H26B 4XRCA 5EDXA 5D1QD 3VRLF 1N2RB 1AHWC 1U41A 4LASL 4URTB 5JNYA 4EBQL 12E8L 1QZ1A 2HN7B 5DSCB 1I7UA 3FN3A 1SEBB 3SDAD 3SDYH 4Z78B 3MRJB 5GRVK 4XP6H 4K8RL 1DTUA 4K8RD 4N1CA 3IVKB 3QUXD 4LSUH 5A16A 5F7EH 2GYSA 1O0VA 1N7MH 1S7RA 4GH7B 5F6HI 1JRHL 4WV1C 2I60L 3OMZA 5A2FA 3ECBB 4M43H 4HMCA 3K80A 4AEEA 4K2UL 3OPZL 3MV11 3DV4A 5EU7E 1A14L 4QXUL 2BVQB 4H0GA 3MSPA 5M95B 2JIXD 3QRGL 4I4WA 3VJ6A 3PWNA 4MS8D 3WNNA 2C3VB 2YHGA 3PABA 3BN9C 5I15L 1RUQL 3KJ6H 3ULUH 4KUZH 4J2XA 1TQBB 2ZPKL 1TMCB 4Y1AB 4HCRH 2VDQL 1JRHI 1RULH 3WFHB 2A9NL 3AXLB 3VMPA 4E5XB 4PLJC 3K8MA 5SX4I 2FHFA 5JIHA 1QSEB 4FFYL 3QFJB 3FT4B 4IM8A 1HHGA 2G9HA 4KI5F 2R1XA 6FABL 1JF1B 4R4BA 1CIDA 3O6KH 4S1RH 1OTTC 2E9BA 3QXAB 5IF0B 2ERJC 2D31A 3GGWB 1QFWL 3MV9B 4BUGA 3O6FA 1RZKL 4R7DA 1UM6L 3V4UL 2UY6A 3NTCH 1PKQE 3K4AA 3V0VA 1NFIA 4FXGA 5I71B 2XRAH 2W92A 4XNUH 2CR6A 3LHPH 2GITA 2NY4C 4YHKH 4M8QB 4MJIA 1T4KB 2DIJA 5DJYA 3HUJE 5I9QC 1DN0A 3HHRB 1RZJH 5E8OA 4WFHE 5IMLA 1BJ8A 3DSFH 1TCMA 4K3EL 2IPKB 1FNFA 4WU5B 5TE7H 1UH2A 4U7MA 1KJ2L 4U6YB 5ANME 1N3NB 5DK0B 4HF5H 4KI5C 1G0XA 4L8CA 1AY1L 3HRPA 1F4XL 2XI9A 1CYGA 1ERNA 3GBML