4AENB

Hla-dr1 with covalently linked clip106-120 in reversed orientation
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
188
structure length
181
Chain Sequence
TRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN, DR ALPHA CHAIN
publication title Peptide Linkage to the Alpha-Subunit of Mhcii Creates a Stably Inverted Antigen Presentation Complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 181
sequence length 188
ec nomenclature
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4aenB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4aenB01
3VD3A 2H26A 5CUSL 5E2VH 3ARRA 3NCYS 43C9A 5T3XL 1ZOXA 2VLRA 4CMHC 4KQ4L 3LRSB 4OLWH 5E5RB 1S78C 5C2UB 3SKMA 2A74B 3JV4A 4Y1AD 2ENSA 2WBJD 4X6FA 3R4DA 1MCOH 3L3GB 1AGEA 3OKMA 3MCKA 3KPOA 1VFAB 3BPCB 1KFAL 1TPXB 4UMGA 5J06A 3Q2CA 5EO9A 4RMSA 4Y4FC 4Z7QE 1GGUA 5T1KB 3U7YH 3MACL 4LLDB 4K7PX 1TVBA 3B2UD 3FKUS 2BNUB 4WFFD 2W0LA 4ZS6D 4HS6A 2H6PA 5HD8C 1I7ZA 3DYOA 1QSFB 3CK0H 1QUNA 5EBMB 2VABB 3MFFA 4UV7L 4F33A 4LIQE 2JTDA 2KZ1B 1CXIA 2FEDC 4F2MA 2I5YH 4OCLC 4DZ8B 4NQVA 2IGFL 1I7TA 1L7IL 3F7VB 4FQLH 1GL4B 4GLRI 1P4IL 3N50A 3W39A 2HVJB 1D9KB 3LN5B 1F6FB 4D0DB 3NFSH 4CUCA 4XBEH 2C3XA 5GGSA 4HWEH 2GAZA 3LPGA 3D69A 4FG6D 4M1GL 4NGHL 3OKEA 3IGAB 2DAVA 4WI6A 4C83A 5JW4M 5GS1C 1HSBB 2ILLA 3K8LA 4CADA 1TQCC 3WXVL 4U1LB 4QHLA 4EQ3A 2HWZL 4PJ5A 1K4DA 3BKMH 3FAXA 1GC1H 4JFFA 3ARPA 3GSRA 1VADB 5FYJE 5C09B 1X5KA 3KYOA 5KOVC 2AEPL 5L8LB 3MUHL 5I18L 5ID1B 3UDWA 1S5IL 2Z9TA 2UWEF 4JO2L 4OGYL 4PREA 3RY6C 5IV2B 1RZKH 1OARH 3CSPA 5C3TA 3TP4A 4PJGB 2PYEA 2ESVD 4LBEA 1T22B 4XVSH 3H9HA 4LCUA 4PRIA 5EZJA 5GGVL 3L1OL 4FZ8H 4Z0XB 3OG6B 3D18B 3RY5A 4J6RH 1CU4H 4B53A 1NBVL 1NC2A 1MRFH 1JYWA 4Z7WF 4P46D 4HUXB 1A7QL 1EO8H 1R3IL 5IOPA 5FYKU 2X09A 4XXDA 5EOQH 3QIBB 1UM4H 1IBGH 4QKXB 1CE1L 3MV7D 3R0NA 5HGDB 3O8XB 1ZLUH 1BQSA 3MLTB 3NIDF 2FLBT 3CNKA 3T2OA 1IAOB 1K6QH 4XPFL 1GGCH 4G6KH 4PPTA 4R90H 4TPRL 3WHE1 5L88L 2X1PA 4DFIA 2YPLD 3BXNA 5BW7A 2OTWA 2YR3A 2F74B 1YNTB 5DXWA 1IGIL 4KJPD 4PP2B 1JI2A 3TT3H 5I1KH 4FABH 1EV2E 4R9HA 2X89D 3FQRB 4G8GA 1OSPH 1N26A 3B3IB 4XCNB 1NCUA 3QG7H 3SGKA 2CKBL 4V2CB 4K7FA 5BRZD 2DQCL 3QIUA 4XP1L 3HE6B 4IRSD 4LVNC 4PJHA 2EZ0D 1HZHL 4X7TB 3RUGF 3BDXA 4KKLD 2VLKB 5D6CA 8FABB 4MSWB 4XHJC 4D2NA 3BKJH 3Q6GL 2JCCE 1JZ8A 3DV6A 1BJMA 1ACYL 3RI5F 4M7ZB 4RQQA 3WIIH 4F15B 4MXVE 4WWID 3TFKC 4MNGB 4ZODA 2NYYD 5ITFB 4ERSH 2EIBA 3BKYL 5IM7B 4P3WA 3HS0A 2PTVA 1BOGA 1BQLL 3MC0A 4P5KB 1HN1A 2Z92B 4NUGL 2ADIA 1LVEA 3N1MC 5LAXA 1IC7H 1F11A 1KIRA 3VFOA 3GSXB 3QHFL 4PJAE 3TWCH 4QRPE 3ZKMD 3ULVL 2FGWL 2FDBP 3GFUA 4FFWC 3GMOA 2R2EA 4E9LA 1G6RB 3V7MA 5KS9F 4G8IB 1V05A 1A1MA 3QNYA 5IMLA 4KY1H 5FDYA 5EORL 1MJUH 3HI6L 3VWJC 4LOUC 1JFQH 1O7SA 5H2BB 4MAYC 4O4YH 1ZHKB 2BZDA 5IHLB 1IT9H 2AEWA 1RQ5A 5FK9A 4M5ZL 4P5TB 3EYSH 3LOWA 2ADJA 5FCSH 1A64A 5ANME 4HAFA 4ZOBA 4R2GC 3JVGA 1EK3A 1GAFH 2J12B 2QADC 4N1HB 4QHKJ 1CG9B 1JL8A 4ZNCD 4CMHB 2O61A 2MHAA 4M48L 3QWOA 3X12B 4IM8A 1T1ZB 3V7AE 1H3VA 3T09A 1OQXA 1AGDA 5F7WC 5BXFA 5K9JH 3QPXH 1N5AA 1GPOH 1MI5A 1W2KT 2V6HA 4JRYD 1J5OH 3BQUC 1EHAA 2ZSWB 3VD4A 4TSCL 1G7PA 4ZUVB 1NUNB 4FNLH 4PRPD 3QXAB 5GGUA 3MRDA 4XC1L 3DUHA 5BV7C 3U2SA 3WIFA 1A6PA 4XMPL 4HK0A 1JIBA 2IFGA 2C3WA 2CK0L 1WVZA 4MX7B 2AKRB 1YEDB 2IAMB 4JANA 3GMQB 4R8WL 3LZFL 4PB0H 2JELL 3NA9L 1XF1A 1B0GB 5D70H 3VFTB 4X5LA 2NNAB 3VXMD 3ZL4H 4H1LA 4CVXA 4M1DL 4BFIA 1FL5A 5F3HA 4GG8A 4C4KO 3CVHA 2DD8H 1BFSA 5MEPB 3ZTNH 1INEL 2VXSL 2V2TB 4JCLA 1BD2A 3QCTL 5GS1B 1UG9A 5C8JB 1TQCB 3E8UL 3BGFB 4JO4L 5IJKA 4O02H 1GCFA 4YNYB 1T5WB 4YBQC 4K3DL 5FUOL 2X4UB 4L4VB 1NSNL 4MZ2A 1EJ6A 4G6FD 3GRWA 3QIWC 4POZD 3AROA 1NGPH 4WDIA 3VXUB 1NGYB 2MFNA 1BHGA 3LB6D 4TNWK 1JGLL 3ALWA 4LASL 1K8DB 2JJTC 3KPMB 1QFUL 2OL3H 3O45B 1TDQA 5TQ0H 1SJVA 4HWNA 1E4KA 5IW6A 2IPKB 2ZOLA 3MR9A 4NO5A 4QXWA 3V9FA 3TLRA 1HQ4A 5DT1H 4YLQT 4DEPB 5B8CC 5GS3A 5I73C 2DDQH 4TSAH 4XCYB 3KLHC 3NFPA 1ZHNA 2MJWA 4Y5VA 2VZVA 1WEJH 3DUUA 1ZHLB 5TF1L 2X4OA 5C7XL 3VFUA 4FTVE 5J1TC 3QUYD 2F9BT 2PXYD 3B9DA 3S34L 4HF5H 3T4AA 4GAJH 1MHPH 4HX1A 4KK6D 1X6LA 2XQBH 4WW2A 4OF6A 3S98A 1ZVSB 5D1XA 1LO2H 5LWYH 1A47A 5HI4C 1SEBA 2XWTB 1A7NL 5FECB 4EN3D 3G6JB 3DHJA 3PWPD 5D7IE 4I4WB 3L5IA 1G9EA 4BFGA 4KFZC 4LLWB 4JFFD 3K8MA 5EUOF 2EYRA 3ZTJG 2DM7A 3FFCB 1LP9F 3HI5H 4PJCF 5FYKE 1JHLL 2RCSL 2ICES 3PWVB 1YZZA 1GOHA 1E4JA 2R56H 5ETUA 5F7EL 2A38A 3RDTB 1WZLA 1GSMA 2YMXL 3BZEA 2C7UA 3G6AB 4APQA 4YHMH 3JUZA 4XNYH 1HILA 4GQ9L 1PSKH 4PIRF 1HHIA 3FB6A 4RMWA 4AQOA 2KKQA 5C0AD 2A9NH 1GOGA 5L2KB 1VGKA 1D6EA 4RNRA 3DRTB 4NQCE 3HKFA 5CKAA 1FQ9C 4P4RA 5GS2H 4R0LC 5DMGC 5E2WL 2KQMA 2PO6C 5L7XL 3BP7A 3D25B 5ERWB 4X8JB 4OZIF 3U0PA 5D8JL 5I1HL 2YRPA 4OBRA 4GG6B 3VWJB 1IAMA 1A02N 4QXGL 4MAYB 4KROC 1UZ8B 3IJHA 2J4WL 1EMTH 1U8MB 1FNHA 3RZCB 1EO7A 4GBXA 3BO8A 3NZHL 2KZWA 3QDMB 4PJBE 1XIWC 1DUZA 3I50L 1UA6L 3O4OC 4LKCA 1XF5A 2DIJA 2QADB 2ZCLL 1NCAL 1AO7A 4QRRA 4GKSA 3WFEH 1PZ5B 4X6DE 2E7LC 1QFWH 3WKMH 4YX2H 5C6PB 5DJXB 2MSPA 2YD2A 3TJEH 4Z7UF 5T1DH 5LVEA 2CKBA 1CLCA 3CXHJ 4LDLB 1JWMB 3BQUB 2ZPKH 3I9GL 1H3UA 5DJZA 1IGTA 4OLXL 5ADPL 3T4YA 2HRLA 1IC5H 4ACPA 3HMXL 4OZHB 5E56A 4LVHC 2QLVB 4HUWA 5BV7B 4IMKC 4LSUH 5JHDE 3OKOB 2WP3O 4O9HL 1TETL 1CLZL 2R23A 2GJ6B 3QRGH 4G3YL 4ONGH 1UACH 3U36A 3MXVH 4EXKA 3UTQB 5F9DC 2VIRA 2NW2B 1XCTA 2W9LA 1RY7B 5DA0B 4B7IA 2IBZX 4OF3A 4X83A 4OFIA 4F8QA 1P7KB 4W68A 2CPCA 1EEZB 1ZS8B 5GPRA 4RIRB 2ZG1A 4S2SA 2AJZA 5FM5O 5HYJA 2VITA 3LD8B 4IIQA 1I3RB 2OTPA 2OJEA 2ICEB 4WI5A 1RIUL 1DQQB 4OB5H 2R0LH 2HFTA 4ELKB 4NN7C 3WN5A 4A6YH 3O6FB 4M93C 1A4KB 2PETA 4PJIF 3KPRA 3HZVB 4KUZH 1E6OL 1Q9WB 3ARZA 4F57H 2I24N 4M7LL 4ZFOL 2HJFA 4WO4C 4RWYH 4KC3B 3T0XA 3QIWB 4G8EA 5B3JF 5HDOA 2CGRH 2YC1A 4U2YA 3VFVA 2PR4H 3MA7B 3D39A 3QPQD 1CFTB 3NZ8B 3C08H 2VXVH 3NFSL 5FF6A 1FNEB 1OAKH 2PTTA 1DSFH 4MLSA 1NGWB 4MJIB 1G0YR 2QQKL 5TE7L 5AUMA 3O41B 5GIRA 5B8CB 2DQUH 4JPKH 3WLBA 5I73B 2G2RB 3UJTH 2AQ2A 4NKOA 3QXDA 2D2OA 3TBYB 1PEZA 3AS1A 1FDLH 4Y5YA 3DUSB 3G5YB 4MJ2A 4X9BA 3RWDB 3KNBB 4PJFF 4JZJA 4AT6B 4Q0XH 3FT2B 4YHOL 1IKFL 4NM8H 1KIUA 2WWKT 4HKXA 3LKRB 4ORGB 3DX7B 4PS4L 4R7NB 3UC0L 2OJZL 4LRIA 4D94A 4W70A 5E5MB 2LAGB 5EOQL 2YN5A 3UPRA 2QKIA 3QUMB 1IBGL 1EJOH 5C3LD 3UTTA 3NAAL 1WT5A 3HPJB 2DS4A 1ZEAL 3FONB 3HG1E 3QXTA 3ZKNC 3BH9B 1K6QL 5FKPB 4ZUTA 3T3PF 4NKQB 1FNSL 3SGEI 4KRLB 4U49A 3NCFB 4PJEA 2GUOB 3UEZA 1BX2B 4V1DA 5HVHB 1UJ3A 2H41A 4E41E 5DZNA 2WW8A 2IC2A 3ARUA 3EO0B 2AGJL 1NUGA 2F54B 3QWRA 3T77B 1MCJA 4FQQA 2H2PD 4R0LB 3HE6D 2A0LD 2PO6B 1U8QA 5I1LB 5EA0L 4PRAA 5I74C 3SE4A 4PJDA 2ZUWA 1AY1L 3MOBH 3N06B 3BN9C 3HZMB 3VI4F 4RISL 2BOCA 1QP1A 4KROB 4LDEB 1JNLH 2DWDA 3SBWA 2F19H 1YEFL 3BESR 4EUPH 4JFHD 1NCCH 5JXAL 1JCKA 2AK1H 4KK8D 4OZGE 5F97E 3V5DB 2AAVA 3K0WA 1HHJB 5J6GA 3VFNB 5I75C 4Y19E 3SDXE 2KDGA 5HHVH 3TIEA 4XPAL 3I6GA 4IEFB 2AI0H 4LCCA 1ZLWK 5BO1L 5I15L 1HXYB 2ICCA 1PG7X 5ALBH 1B4RA 4HIEB 1A7RH 25C8H 1KBGL 5IGXH 5F9JA 3OZ9L 4I3RH 5E08H 1IT9L 3SGDH 4EDXB 5EC2A 2X7LA 4N8VB 1EERB 4LVHB 1MWAB 4S1DD 1SY6H 1QEWB 2O5ZH 1ZHBB 3MLSH 3MA9L 4GW1A 4P5TD 1QFPA 4I0PC 5D1QC 1OSZB 3MRMB 5FHBL 1QBML 1ZKAA 3JWOH 3QISA 1CFQB 1RZGB 2BOBA 5B39A 4P9MH 4YBHA 1YN7B 5C08A 5KSAA 1VA9A 3U7WH 2NXZC 4Q9RL 4MQXD 5K9JL 4X6CA 1Z6JT 4NPYA 4HC1L 1J5OL 4KTEL 4OGAD 3WL9B 1RVFL 4LSTH 4LIQH 5EC1B 3GSWA 4YBLC 1RZFH 5C2BL 2EIEA 1BF8A 4KWUA 2L7UA 1ZLUK 3ZMRA 1XF4A 2DQHH 4NWUL 4P4KA 1A5FH 3F65A 1IC4H 5FGCE 4OJFL 4M93B 1DEEB 5IP4A 2CD0A 5GRJL 4XP9H 1NKOA 3UBXI 32C2B 1WICA 4X4YB 4WO4B 1VPOH 5GS0D 1LO0L 1J1XH 3QQ4B 1FGVL 2IAMD 1VSCA 1AIFB 2VOTA 4L9LA 5IBUG 3ZL4L 2VXQH 2XTJC 4U1IA 1NCNA 1U3YA 4N9GB 5AZ2H 4PYGA 1EIBA 2X4TA 3VXSE 5FYJH 1NEZG 1A6TB 1MAMH 4JEGB 3TV3L 3TIDA 5DVOA 5F7DB 1FG9C 1QO3A 4HIJA 5FO8B 1NDMB 1SQ2N 2J2ZA 2G9HA 3ES6B 3EYFB 3F62A 4OF7A 1DQMH 2BSRB 1KCUL 1KPRB 4Z9KB 4JHBA 3ULUE 5DQJB 5B3NA 1T1YA 3HMXA 1NBQA 4YQXL 3N9GH 3I02B 3V6ZA 3MSPA 3ARFA 1FYTA 3TNNA 4MJ6A 1G1YA 4GS7B 3RWHA 3BI9X 2D9CA 5F7UA 5C70A 4CU7A 4Z76A 2NX5A 4L4VD 5ABDE 4OIBA 3ULVD 3W2DH 1S5HB 1NKRA 4G6MH 3GHBL 4G9FA 1MJJA 5HHPB 1VFUA 2CLZA 4K8RL 4FXGB 4GW4B 5TQ2H 2XZCH 4NN5B 1FZJB 7CGTA 3KPSB 4JFXB 3IVKB 2B4CL 4U1MA 4M6ML 4PJXE 5DT1L 5KSUA 3NIFF 1FJ1A 2P5EB 4ELMF 4M61B 4PRHA 3ZLQC 1B0WA 4WNQA 5F9AC 3RGHA 3AC0A 4U05A 5D2LF 4HFWB 5JR1L 4TTGA 2CJUH 3X14B 4PG2A 1FV1A 3LQMA 4RA0C 5KSBB 8CGTA 4L8BA 1MHPL 2HKHH 5IG7A 5I6XC 1HYRC 2XQBL 3A0OA 5DK0A 3G04B 4JQVC 1INQA 3MBEB 4UIMB 5EU4A 5BMFH 3RVVC 4ZFOA 4KGLA 4O2CB 3WNPA 2YA1A 3OR7A 5BS0A 2P8MB 1T1XB 1CGYA 3RRQA 5I74B 2AXGB 4MCZB 1NCTA 3CFBA 5D7LA 5C92A 1A6WL 3TO2A 3L3IA 5AYUH 1HINL 3FZUC 3U83A 3I75A 3FO2A 1HNFA 1XMWA 4I5BA 2C26A 4CDGC 4AH2A 2EE3A 2BVQA 3WJJC 5LKNA 2SEBA 4YHML 5KAQG 4HMCA 3P0YL 43CAA 2QHRH 4YAQA 2ERJC 4HKJA 3RDTD 3KYKL 2CDEB 5I75B 4WCYH 5I19L 2A9NL 2ZOKB 3FQWA 5IEKA 1DVFD 4C4KT 1KJ3H 5D7SH 3PGFL 5IBUB 5IVXE 4QXTB 5GSVA 1DN0A 1TJHL 3IKCA 3LV3A 5E9DB 3CLFH 1CGVA 1Q9OA 3WSQL 3CD4A 2W92A 4BH8B 3I85A 4JFDB 3RKDC 4DVRH 4NQEE 3HUJA 1FVEB 1VCAA 4EI5B 1RAMA 1WV7T 1LQSR 12E8H 4U6YB 1NC4A 4JDZA 2B1HL 2R1XA 1TVDA 4BSVA 3FTGB 1YEHH 2H2SC 2V5MA 5EU6B 5MENA 2R0ZL 1J8HD 2FECI 1IAKB 1R3HA 4DN4H 4H8WH 3T3MF 2X4SB 2A6JA 4NN6C 5GJSH 2GSIA 5DJCB 3MV8A 4JKWA 3RZCD 4I0PB 5D1QB 1X4ZA 2B8OT 2X2YA 2Y7QB 1YEKL 2EDBA 2OL3B 3QDMD 3WFEL 4M1CC 4YHLH 1RMFH 4HHAB 2K7PA 4PLKC 4YE4H 1BJ1J 3VCLA 1N3NA 1A1OB 5E8NB 1UM5H 3MRRA 4DQOH 5MP6H 3C5ZC 2HG5B 3GBLA 1PZUB 1T2XA 2YSSA 4NRYB 5D1ZC 2HJKA 4YBLB 4HG4K 5CILH 3HPLB 1OTUC 5DD1H 3W0WD 1Y0LB 1HYSC 3QDHA 3UXFA 4LSUL 4GUPB 1M7IA 3PHOA 3DX9B 5ISZE 3WFBH 2XKNB 5BZDA 4QT5B 3DRQB 1U8OB 4NJAL 4Z8FH 1I4FB 3MXVL 2HLFC 2HFFB 4R6UA 4H25B 4D9LL 4Q58C 1YECH 5H94B 2Q3ZA 4KPHH 1ZVYA 3N85L 4KKCC 2E6JA 1MRDH 3OAYH 5IR1B 2XTJB 1ZT7B 2VLJB 4UBDD 5FEBA 3VH8A 2BC4B 1AD0A 3HMWH 1GGBH 3WFHB 2V9RA 3PDOB 2A1WH 5KN5A 5F71A 1UT9A 1YPZA 2R0LL 3ZTJH 2PYFA 4JY6B 4RFNC 4WEMB 3QJHA 3KS0J 2JB6B 5C0GA 5C6WH 4O2EB 3MRKB 4KUZL 1WTGT 3EOBB 1G9NH 1H8SA 2P5WA 3O6FD 1GZPA 1E4XH 4RWYL 4ZOAA 5CEZH 5H35A 2XWJB 1N59A 2NY1D 1MJ7L 3BWUC 4L29B 3S5LB 2CGRL 3ZE0E 3PP3K 1Q0XL 4PV8A 4K07A 5JOEA 1MCEA 1KIQA 3C08L 4PJ9A 3ZYZA 2J5LB 2PW1A 4JRXA 4HMDA 3MV9E 3STBA 4FFYH 4TN9A 3MV01 1GOFA 1A6VH 4HC1A 3QXVA 2JJWA 3QUKA 4R4FL 3NN8B 5F1IB 4JM2A 1IGCH 5KVEH 1FZKB 3VFMB 1JVKA 3SO3B 1U93A 4I3SH 3S96B 1HH9A 3O11A 4MJID 3TVMC 1ETZA 5JIKA 4C55A 3G9AB 1CBVH 2YA0A 4P2RB 3PUCA 2MCPL 5J11B 2I26N 4M8VA 1QVOA 3CXHK 1SBSH 4LHUA 2YEZB 3QDGE 2VQUA 4QEGA 3F7PC 1X3DA 5KTEL 1N2RB 4GJTB 5I6XB 5IWLA 3QUZA 5FYKH 1TZHB 3IDGB 1AJ7L 1XH3A 2XG4A 4ZAKC 3DMMA 3T8XB 1CLYH 4Z7VF 3V6OC 3EDDA 1K5NA 1BVLA 2I07B 4KKAC 3UTSD 1NUFA 5DK3A 1P7QA 1H0DB 4JPIA 4JO3H 2APFA 2WP3T 2O5YH 4HPOH 4MCYA 3UMTA 4DTGH 2LU7A 3UPCA 4HWBH 5F21B 2Q8AH 35C8H 5EO0A 4D9QD 3MZTA 4BKLA 5DDHA 2FD6L 1UWXH 1KJ2H 5I8EA 4QTIL 3O3AA 4XZUA 3BEWB 4ODHL 3IJYB 3V4PH 5DURB 1G7HB 3QEQB 3TYGH 1EXUB 1NFDA 1XGQA 3IDMB 3GMLB 4PB9H 4HIHB 1WAAE 3RL2B 2JIXB 3VD9A 2BCKA 7FABH 2ERJB 3QFJA 2YD8A 5DUML 3V79C 4W4OC 2DQGH 2AV1A 5KVDL 5E00B 1HOCA 1NAMB 4K2UH 4NBYB 1U92A 4BK5A 3TBTA 2H8PA 3JWNC 1H3WM 5GJTL 2HYMA 2RBLA 4HT1H 2ARJQ 3GDBA 1X4XA 4UQ2A 2F54D 5I16B 3MZGB 1U2HA 1MEXL 2A6DA 2IH3B 3GIVA 3TN0A 3IFOB 2VLME 3WIHL 1JNLL 3ZT6A 2F19L 3DGGB 2ZCKH 2R4RL 1AXTL 3NCJH 2HN7B 2JE8A 3L3JA 4DKDC 1I8MB 4NN6B 1EA9C 1U3HC 5CGTA 5KANG 4GKNB 2DKSA 3VXRE 1NMCC 2F53A 2A77H 5JPNB 3K46A 4X5WB 4GMTL 4Z7NF 1IMHC 3ZDZF 2R8SL 3PGCB 1ZWIB 1JWSA 1CYGA 5F3BB 2P8PB 4EKXA 1A3LH 1E6JH 4JKMA 3MO1A 1JPTH 5DUBB 3UAJD 4RX4A 4N90D 2OZ4H 4JB9H 3L9RA 1I8IB 5D2NC 3AM8A 4C57C 4HLJA 1G6RL 4AG4H 5FB8B 5CD5C 3DVFA 4LGPB 2GSGA 1FHGA 1TNMA 2ZG2A 2ITDB 2O5ZL 1WWBX 3MGTB 2GT9A 1M71B 3MLSL 3HAEH 4AY0A 4DFHA 1J1PH 3UBXA 3S8WA 3LPWA 5IB5A 1FFQA 3BMVA 3TNMA 4L5FL 1GVIA 1QHOA 1B2WL 2Y25A 1AGCB 3MJ9H 5E99H 1DUYA 1NC4D 4WW1B 3O6MH 4P48A 5LGJB 1UWEL 1D5BB 1RURH 4JG0L 5HDQL 1IEHA 2GCYA 3ZE2F 4RMUA 1XGRA 4YIQB 5E7BA 4LSTL 1N5YH 2FX9H 1QKZL 1A2YA 2JF1A 1N0XH 4XNXL 2MOVA 3TO4C 2FR4B 1OTSD 4NZTH 4HJGB 2DF3A 3P11H 1YMMB 3TBSA 5JXEA 1AXSA 4Q6IC 3KYAA 4JREB 5ACZB 3KXFE 1NGQH 3EYOB 4KVCL 3I6KA 1LEIB 3I3DA 4YHNA 1LK2B 5T1MA 3RIAK 1N0LA 4I48B 3DX8B 1UEMA 1TCRA 1UXWB 4JHAL 5ECJE 1LEGA 3BISA 5C0CD 1J1XL 4KJWD 4M43L 3DI2B 3DETC 3GO1H 4DUWA 1ZT4A 4JFYB 2BNRB 3D2UD 3SDCB 4K94H 2C9AA 3FMGL 1Y6MR 2ZCHH 3VXPB 5EO1B 4PG9A 5FYJL 1S9VA 4EUPB 4PJ7B 1KPVB 4WEBL 2VXUL 1U8JA 4OLUH 2XA3A 2BERA 1KJMB 2BMKA 4ZPTA 1TJIH 2QQLH 3ROLB 1A6ZA 2ZNWA 4F7MA 2FYYB 5A16B 5C1MB 2D4DA 3MYZA 1JPST 3TVMB 1CFNB 3KWWA 5JOPE 4YO0A 4POUB 4EI6B 1YY9C 2WWMD 4WWKB 4YHZH 4B50A 1PX4A 2HRPL 2N56A 2EXWC 1G7QA 4J8RA 3W2DL 2EEDA 3IDYB 2VLRE 5LBSL 1RUQH 4XTRC 2QSVA 4ZAKB 1T21B 2KBGA 4X4ZA 1FP5A 5J13C 5HY9B 3SJVB 3MNVA 1RFDL 1TZIB 5HI5D 1NBYA 1FO0L 5IVNA 3ZYIA 4M4PA 1OGTA 3AU1B 4WUKL 5EPMB 3KPSD 1T7WA 5DRWB 1VFAA 1KACB 4P2QA 1G7IB 5FV2A 1RSFA 3CZJA 1PD6A 3IJSA 5DUPH 5SWSE 2HKHL 3RVWC 2VC2L 5T1KA 4PYHA 4HCRH 5DJ6A 1F13A 4OD1L 1L6ZA 4GRLB 4OCSL 4JE4B 1T5XB 1T66C 3PJSB 1QSFA 5ESQB 2NY5H 4LMQE 2P45B 4CU6A 3FT3B 2P48B 3QHTC 3MBED 2YHGA 4ZFZA 2HT2D 4NC1E 4JY4B 4MA1B 3DECA 1DBJH 5EN2B 1CL7H 1I1AC 1UKSA 1LDPH 1MHHB 5C07B 1D9KA 3LN5A 1AFVL 4FZEH 4D0DA 4PJGF 2YD3A 2N7BA 3WJLC 3QUZD 2IH1B 2JKXA 4J12A 1VFBB 2UY7A 1U3HB 5DJ0B 3DARA 4DGYL 4Z5RB 2QHRL 5HHMB 1KG0B 1NMCB 4PJ5E 4Y4HB 4U1LA 2HJLB 1S7UB 4WCYL 1OW0A 1JTPA 2YWZA 2A9ML 2FJGA 1AGFA 1KJ3L 1C16A 2HLAB 1A9BB 5D7SL 5F1NA 5C09A 4QCIA 3CLFL 2KH2B 2PYEE 2YS4A 3S35X 5IV2A 1FPTL 5HHNB 2HTKD 3H0TB 4PRIE 1LILA 12E8L 1UZ6F 5D2NB 1F3DJ 3UYRH 2B2XH 1LE9B 4Z0XA 3D18A 4JFDD 2OTUA 4EI5D 4WY7H 1LO3H 1NMBH 2Z31C 4EIGB 4NNPL 4HBCH 1PG7H 1KGCD 3CU7A 3ALXA 4LPTA 1ZLSH 2NR6C 2WIIB 3BJLA 5GJSL 2W0KA 1X5GA 2LTQC 2Y36H 3I2CH 3O8XA 4YK4C 3MLTA 3UZVB 3ARDC 2B7DT 4YHLL 1RMFL 2V5RA 1N8ZB 5KVFH 2XICA 1S9XA 1UM5L 3WS6A 1FFRA 4G8GE 4DQOL 2F74A 1YNTA 3IRPX 3LVEA 4PP2A 3FQRA 3TN0D 3TYFA 3O9WC 4LPCA 1DBMH 2XKUA 1IAII 2R0WL 3B3IA 4LP4A 4PJHE 4TQEL 3U1SH 4NM4H 3UO1H 5CBEB 3QDJA 3CH8A 4JPWL 1INDH 4X0KB 2YK1H 3B9KD 4X7TA 3VGBA 5DD1L 2F8OA 3TO4B 1QQDB 4MSWA 4O5LH 5HDBF 3FT4A 3MQIA 4HS8H 1HSAB 3SGJA 4IS6A 1OP3H 4LLAA 3C87A 4IRJD 4HMEA 5FO9B 4FQPA 3WIHA 1BIHA 3MLUL 5I2IB 5C0BA 3O3EA 2NY0C 5SX5H 3E2HC 3LKNB 4CVZA 3K74B 3MRCB 4ODSL 4KPHL 1A7OH 2Z92A 4EXPX 4NCC2 1KB5B 3B4NA 3ULUH 1DBKL 3ZYOA 3RJQB 3STZB 4R7DA 4DOHE 2XPGB 2DIBA 5TH2A 5I8CB 3L3DA 3VMPA 3GSXA 4S1SH 2VLJD 3MLWH 2Z8RA 4R4BB 1KEGH 4UB0L 4NZUL 3U9UB 3LIZH 2IALB 3PP4L 3O2VH 1G6RA 3B5HA 4G8IA 1IGYB 2QSQA 4L4TE 2XN9D 1QA9B 3NPSC 4RAUB 5H2BA 4DKFL 2DI7A 2WUBH 4OCXH 1ZHKA 4J3WA 5D7JB 1E4XL 1KCRH 3O3UN 1S9YB 3FJTA 3OJMB 4MNQB 3NABL 5GS2D 1FFOB 3OX8B 2E5EA 4N8PA 1S7RB 5KS9E 1ZE3C 2X1OA 1QSEB 4FOMA 4BQ9A 5J13B 5E1AB 4X98B 2BVTA 4J4PD 1AKJB 1A6VL 5CP3H 2X4QB 1T1ZA 3RPKA 4I3SL 3UJJL 4D0BB 2YXFA 3MRHB 1X5XA 2ZSWA 4IDJH 2PKDA 4GKOA 3H9ZA 2HH0H 4NKIL 2Q86A 4PTTB 3QXAA 4Y4FA 1Q1JH 3W9DA 4AIOA 1YEIL 3QR2A 1IAIL 4Y4KC 2WK2A 5DJAB 4I0CC 3C09C 4OIAA 1HHGB 4HK3J 3RP1A 4MX7A 2Q20A 4G5ZL 1CLYL 2NY4D 1FE8L 5GSRA 4FFVC 1YYLH 1JRHH 1B0GA 4HPOL 2O5YL 1KCSL 1BWMA 3VJ6B 4DTGL 5GXBB 1ROWA 4R26H 3ULVF 3KLAB 2NNAA 3QUML 3AS2A 4WI8A 1BMGA 2VR5A 5HHOB 1JTOA 2VDOH 1T7YA 1S3KH 3TYGL 2NZ9D 1BD2E 1BFVH 5MEPA 4LSDA 3O2DH 4L3CA 1ZVHA 1JZ4A 3SDYH 1IM3A 4H5SB 5C8JA 3QEQD 1ERNA 4YNYA 5JW5A 3OAZH 2EO9A 1DBBL 3MRFA 3U0TB 4M9OA 2A2QT 4K2UL 3EGSA 2UWEB 4XRCA 1KJVA 3AREC 4JFOB 2CDGB 4X9IA 4C56B 3RY6A 5FGSA 1GHFH 4UQ3A 2L4OA 1B88A 4Z7WB 1KLGA 1NGYA 4YDJB 2VDKH 2VKWA 2WINA 4LCIL 1LO4L 2Z31B 1FO0A 1CDGA 2ZCKL 3OKKB 2X4RB 2FZ3B 4OFYA 1MCPH 1WITA 3GSQB 5CZKA 3GHEH 5TDOB 1FFPA 1T3FA 5CHNA 3CFJB 1MH5A 2A77L 3FN0H 3BYYA 2E7BA 4YK4B 3ARDB 3G6JF 2A73B 1ZHLA 2JCCA 4LQFH 2BX5A 2Y9RT 5KSVA 1CD1A 3QO0B 1IJ9A 1JPTL 1JTTA 3TJHC 1R3JB 3I84A 3QEHA 4JB9L 3TC9A 2Z91B 1WCQA 4B0MM 2ZUQC 4YDVB 3RUGB 1ZVSA 2Y07L 3TZVC 1T83C 1NEUA 3IDUA 4MD0B 4NQDD 1QRNB 3LH2L 2XWTA 4M9PA 5FECA 2G75B 1EUUA 2EH7H 3C9NB 3FO1B 2OP4H 1DQJB 2R0KL 3HNTH 1MWAL 1Q0YH 1S7XB 4PJAA 3FFCA 5C9KA 4TUKH 3GUTB 1S8DB 3V8CA 1DQDH 3ZSTA 3PQYA 4FRWA 1BZ7B 5E99L 4Y8AA 1UWGL 4JN1L 1PKQB 3MLZH 3MLYH 4N8CL 3E2HB 1LD9B 4GG6F 5DRNB 4MVBD 3G6AA 4IRZH 1BM3L 4F7EA 2NTSP 3OB8A 5T3ZH 5EUOE 4QRQB 3C60D 3PIQB 5L2KA 3STLB 4OFVA 3VG9B 3RKPA 1Y18B 3DRTA 3L3OB 1KTLB 1UWXK 4H26A 1NDGB 2B0SL 4TUJB 1IFHL 3D25A 4XMLH 5ERWA 3RNQB 1D5XB 1YMMD 3H42L 4X6EA 2LE9A 4GRWH 3VWJA 1PG7W 1MCDA 4PJBB 1UZ8A 4GRMA 2DYPD 1HDMB 2DB8A 1H15A 4NKMB 5GGQH 4I2XB 4P23D 3G5ZB 1AO7E 4X6DB 4Q2ZB 4BZ2H 4BA8A 2YPKB 2Q8BH 5GHWH 4OZHF 2ZCHL 3ETBF 4OM1H 4U6TA 3V0VA 4Z7OE 1EEYB 1PZ5A 2YZ1A 4DGVL 1XR9B 4WTWA 1P9MC 3ET9F 2WMPA 3SDCD 5DJXA 5GGRY 1QACA 1E0OB 3IXAB 3R06B 3F7QA 5DJYB 3GNML 4HXAL 1JMZA 3O0RH 2XNAA 1HKLH 1AE6H 5C0BD 1XT5A 3IFPA 1JWMA 3BQUA 4K3EH 2GY7B 2R4SH 1J0HA 1ZA6B 4ETQB 4QXUL 2ZUSA 5DSCB 2ZZUT 4TRPH 2M8XA 2MKWA 3PWUB 4HD9A 3SOBH 3OAUL 5CEXA 3DV4A 3CPLA 2C3HA 4Y4KB 3OKOA 2DQFB 2MWCA 4U1JB 2ZKHH 5D9SB 1RUQL 2VTFA 3ILQC 2GJ6A 4Y89A 4PJ8C 4WWKD 1WISA 4NDMB 5DMKB 4MXQD 4Q74A 1G1CA 1KULA 4GT7A 2D0FA 3MRLB 3PWLB 2NW2A 3P9WB 4HWUA 1TVHB 3SKJH 1VACB 3SQOL 3PL6B 4OLYH 1HQRA 3QDAA 4NYLB 2IANB 1L4IA 2ATKB 5HYJE 4LQ1A 3BVNB 1EEZA 1ZS8A 2J8HA 4KKBD 4RIRA 3K7UA 4KDTC 2OR8A 4JFQB 3MNZB 1A3QA 1RUKL 5J12C 1I1FB 1I3RA 2BJML 3ARBC 4QTHB 3C8KB 1DQQA 3AAZA 2WUCH 3FHQA 4OLVH 3BIAX 1B4JH 1XR8A 4ZXBC 1NCBH 1CK0L 3KPRE 1CDUA 2ED8A 4H0GA 1A4KA 5K59F 5CEYB 4RGNB 4IOFC 4WFHE 2Y06H 3AREB 4NO2B 2D0HA 2NY2B 4YZFE 5EU7E 4GRLD 4ZUSB 3QIWA 2F5AH 3D39E 3BOVA 3ESUF 3GKWL 3H7LA 4ZFFB 2BVPB 1KCVH 4WUUB 2VERN 3MA7A 3NACH 3BGMB 4FTVA 1LDSA 1CFTA 4PGCB 1M1SA 4JZOB 2EDXA 4Y7MA 4FZEL 2JJTA 4JFPB 1C8PA 5DO2D 4JVPA 1NGWA 1FNGB 2FBJL 3MREA 5C07D 3UTZA 5FIEA 3RBSA 1J1OL 3P9LB 3DTXB 2GFBA 1ORSA 2G2RA 4MGXA 5LCVL 3PHQB 2W07A 5EZOL 1JV5B 4MNHB 5L9DL 4YHPB 3BDYH 3P4OB 5D71L 4Y4HD 4KRMB 5TGBB 5FYJD 1YYMH 4P3DB 5SWZB 4K23L 1JUFA 1C5CH 5F7HA 3IFLL 5AWNH 2ARJB 4KI5E 2DLEA 2J8UF 1NUDA 4LL9A 3DSFL 3OPZH 3LKRA 2ZUQB 4ORGA 5GGSY 4KTDH 5AD0A 4XC3L 5T1LB 1BFTA 3F7RA 2ZNXA 1NMBL 4UV4H 1R5VB 1AH1A 4HBCL 5E5MA 3NA4A 2DLGA 3LQAH 3UTTE 1ZLSL 4FA8A 3QUMA 4PJFE 3D3VE 1LP9B 3O4LB 4LSRH 3S36X 4PJCB 1B9ZA 4WJ5B 3HPJA 1WC7B 3LEVL 4NQCA 5FKPA 4ZSOE 5KVFL 4NO0D 3AXLB 2XACC 2P8LA 3U4EB 2IBGA 4JQXA 3FO9B 2GUOA 5EBWB 1BX2A 5DQ9B 5F96H 4WHDA 5HI3C 4LAQH 4CBPA 2VISB 1CICD 3X3GH 4NM4L 1QYGL 4G80B 4OUUB 5E8OB 2YD7A 4QOKE 2AXFB 4HUMB 1T2QL 3WNMA 2X6MA 3RFZC 2BDNL 3OXSA 1INDL 3ZKXB 2DI8A 4L8SB 4S0SD 3EO0A 4K9EH 1E27B 3QWQB 4ZTPH 3T77A 3ARGC 4OZIB 4PJDE 5CLWA 4ETYA 4R0LA 4D9RE 1RPQA 2C5DC 3QA3B 2KL6A 1U91A 4R4ND 2HT3D 3UJIL 4I18C 4UUJB 5IHBA 4OKDA 3TA3D 4CN1A 5JPMB 2V2XB 4ODXB 3QULB 4BSJA 3JTSB 5HGGS 3LKSB 4PTUA 1RUPL 3T0EC 1XIWA 3RTQC 3QCUH 5L8JB 3OF6A 3ULUL 3VFNA 5EUKA 5I66B 3I6LE 4ZDHB 1OCWL 4AMKL 3EDFA 3GI9L 4OF0A 1W0VA 2D0GA 3MLWL 2E7LA 4Z7UB 2G60H 4LEXL 1TMCB 3LIZL 4QRPD 5BCAA 1YY8B 3O2VL 4OFKA 2BNQB 4HGWB 1YC7A 1CLOL 3FRUB 1GRWA 2XI9A 4J1UB 3DXAB 1MWAA 4IMKA 1QEWA 2XT1B 1ZHBA 2BY3A 1IQWL 4R96B 1XGTB 5D7JD 3C6LC 1JZ5A 5GZOC 1OSZA 3VRIB 3HA0A 3MRMA 5IQ7H 4PJ8B 1RZJH 1B6DA 1BQHG 5C08E 1CT8B 1CFQA 3X17A 3DYMA 1ORQB 2VSCA 5DD6B 4X6CE 3MROA 4ZOEA 1JN6B 1YN7A 4AL8H 3QFDA 2FL5B 1AKJD 1F58L 2X1XR 3WL9A 3WFDL 4GAYA 2DL9A 5IK3B 2HH0L 3JWDH 5EC1A 1C08B 3CMOL 3FB5A 1C5DA 3OV6A 4G8FA 4RBPK 1K3IA 1L7TL 2AABH 3ARBB 3S6CA 3P77A 3VXOB 3NCCB 3MXWL 1GJIA 2W60B 1CVSC 1MNUH 3BP5A 1NGXA 4ZXBB 5FA3B 3GJFK 1RJYB 1DEEA 5FM5M 5B4MD 1LEKB 4X4XA 4YDKH 4XNZB 1CF8H 32C2A 2R1WA 5I1JL 3RIFF 4GSDL 4X4YA 4WO4A 1RK1B 3QQ4A 3CFCL 3DVNA 4YPGA 3SDAA 1AIFA 3WHXA 3BPOC 5I30H 4QF1B 3REWA 1XCQA 2X44D 4WU5A 2VDOL 4GXVL 1MJ8H 3RNKB 1S3KL 1A6TA 1QLEL 3CFEB 2VR4A 1OPGH 5D96B 2EEAA 3O2DL 5HHOD 5F7DA 4HUVB 2GJZB 2WBJC 4ZTOH 3TCXA 3SE3C 2YOCA 5FO8A 1NDMA 3EAKA 4NHUB 3ES6A 4FQ2H 4M6AA 4PBXA 3OGCA 5IHZB 1B0RB 4DWHA 2VR9A 2ICWB 1FYTE 1AXIB 3I02A 2X9YA 1TZGH 3EHBD 1OB1B 3DROA 2NX5E 3RZWA 5EZIH 1UADC 1H5BC 3B2UC 2DLIA 1A7PH 3V2AR 4ZS6C 4PUBH 1PYWA 2VDKL 3S35H 1D5MB 4YHIB 5CINL 5CJQL 4OIIH 1TITA 4FXGA 4GW4A 2G5BA 1FZJA 1MCPL 4JFXA 2YD5A 3S3SA 2XZQL 5CEZD 1OGAB 1P2CA 2P5EA 3VFPB 4LHJB 4M61A 1YJDH 4J3UA 2N4IA 4E0RB 4HFWA 2V5YA 5C0DB 3X14A 4FG6C 4OSUH 1FAKT 4H88H 2W9DL 5KSBA 3L3HB 5KANI 5B21A 3IS1X 3TT1H 2PN5A 1BQHB 4IOIB 2NW3B 1NMAH 3G04A 1I7RB 4U2ZA 3KPQA 1A9EB 1EVUA 1RU9L 4UIMA 4KV5F 4YXHH 4AJ0A 3O6KH 4MYWB 1BAFH 5BS0E 4K3HA 1JPFB 5IT2H 1QR4A 5LGKA 3ARGB 2GK0B 2P8MA 1T1XA 3SDXA 5CJXC 2OP4L 5D7LE 2GJJA 2YD9A 3HNTL 2DTML 4X7DC 4DGIH 1FIGH 4P46C 2GITB 5FYKD 3P30H 3Q6FB 3TPKA 4NRXA 4N1EA 2OR7A 4UT9H 3MLYL 5IFAL 3GI8H 1T1WB 3QNXA 5C0ND 4V2BA 4KQ3L 1JGDB 3T0EB 3MUGB 1ZA3A 4ZFGL 5IVXB 2PCPB 2ZOKA 3T2NH 5CSZB 5TFSL 4HZLA 3ILPB 4OGXH 2EDOA 3EW3B 4QXTA 5GRXG 4GFTB 4KJPC 5D5MA 3VRJA 3QEGH 3HUJE 3LEXB 5E9DA 1U8PB 2V7NA 5CBAB 5IHUH 4ZUWA 1NEZA 1BBJA 1FVEA 4U6YA 3K4AA 2ORBL 4IRSC 1UYWH 2EZ0C 4KKLC 2VJXA 5IQ9B 5MENE 1CGSH 2K7QA 5DR5H 3WD5H 3FTGA 4NBXB 4D8PB 1KN4H 5EU6A 1JMXA 1IAKA 5FHAH 3MV8E 3OAZK 2X4SA 1QR1A 2D9QB 5DHYB 1J0JA 1YDPB 3L5XH 3C6LB 1CGWA 3SCMA 3B83A 4I0PA 5D1QA 1JHTA 3GJFA 4HJ0D 3BIKA 2NYYC 4OFDA 1KC5H 2HKFH 2GEEA 3W81A 3BW9A 5GGVY 5BRZE 1CR9H 2HAZA 3QQ9D 4UT7L 5IMMB 1A1OA 1U0QA 4CN6A 1V3MA 5E8NA 2RAMA 5C0RH 1IQDB 1HKLL 2HG5A 3IETA 2HFGL 2QR0A 3LKPB 1ED3A 4J3XA 3BE1H 5ESVB 4NO3B 1FC2D 2AK4B 1IM9B 2YUVA 3ZKMC 1MIEL 3IU3B 4Q9BA 1R5IB 1VGEH 1OLZA 1X5ZA 2IADA 4GUPA 2PW2A 1DQLL 4LCWB 4L3EB 2XKNA 5JHDD 1FSKB 5FUCC 3CVHH 3DRQA 1IL1B 5ICXA 1I4FA 2NTFB 3H7BB 1BZ9B 5DMJB 4J3OC 4XX1E 4OLYL 4JO1L 1FGNH 4NC0B 2EE9A 3BUTA 3MCLH 4N68A 4XHQA 1ZT7A 1M6OB 2IBBA 3P4NB 1UEYA 2VE6B 3FQUA 3GBNH 4ZQKB 4R97B 3PL6D 4JY5L 3GRWH 2I60H 2ZSVA 1Q72H 3WFHA 2EDRA 3PDOA 5CUSH 4Y1AB 5T3XH 5EIVA 4KQ4H 4JY6A 3RWJB 2DJUA 3RA7L 4D0CB 4W6WB 3WFZA 2JB6A 5IMOB 4O2EA 2P5WE 1T89A 4QRUB 5FAAA 1T4KB 1RK0B 1ITBB 4PJXA 5J0BA 2GTZB 3K3QA 2EC8A 1PKOA 4O58H 5E03A 4J3VA 1OD7A 1EFXD 2F5AL 3CH1B 4L29A 1H5BB 5HVFB 4RGND 1KFAH 4GRWB 2R69L 2OXGA 3NACL 4JRXE 2NY2D 3SDDB 1K3ZA 4JRYE 2R2HB 1KEML 2E8YA 4L8CB 2NY7L 4KHTL 2FSEB 5IVOA 4XX1G 2NCMA 4ELMB 5F1IA 3OTTA 4U1NB 1FZKA 1AQKL 3MLRL 3VFMA 2BSED 3S96A 3BZFB 1DLHB 2A6KA 4HWZB 5DRZB 4Z78A 3PE9A 4G42B 3WUWB 1G7MA 4P2RA 3SDAD 4QHNB 3MMEB 4JLRB 4DN3L 1P4IH 2EKSB 4G43B 1F4YH 2AEQH 2YEZA 5AWNL 4YEFA 5E6IB 1XF3B 2ZG3A 3T1FA 2FHBA 3IYLW 5IIEB 1WFUA 4PLJD 4M1GH 4JQVA 4NGHH 1TZHA 4I13B 3WBDA 2P42B 3A6BL 2HFEB 3T8XA 4KTYA 3WXVH 4UV4L 2HWZH 4POZC 1HHKB 5DFVD 1CFSA 2PTUA 4P0DA 5T1LD 1QLRA 4JFEE 1H0DA 3H9SA 1U8NA 1Z9SA 3BT2L 3QZWG 4F8TA 2ESVB 2AEPH 3LB6C 5DJ8B 4OGYH 4JO2H 1JF5A 2EH8L 3R1GL 2HVKB 3HG1D 4ZO8A 2FIKB 3SN6N 1BBDL 4P2OC 3QRFM 1I9EA 3RWCB 3WO4B 4KUCD 5I1GL 1NFDE 3O2DA 4RSVA 2CIIA 1G7HA 1UQSB 4HGKC 5GGVH 3L1OH 3B43A 3IDMA 2VDNL 4NP4L 1NBVH 3MV7B 3IT8D 3QFJE 4HIHA 3WJJA 4M8QB 3GMPB 4LAQL 3ELAT 4UTAL 1R3IH 2JIXA 2CRMA 3X3GL 5FOBA 3SE8H 4E5XB 3ZDXF 4E41D 4CJ1A 3P73B 1CE1H 5J1AA 1BVKB 1MCQA 2YPLB 1A0QL 1YEJL 3QUYC 2PXYC 4U3XA 3TH4T 4XPFH 4X4ME 4KK6C 1NFIB 3GZKA 4TPRH 4HH8A 1RD6A 1ZTXH 3M17A 3ZE1F 5I1EL 2UUDK 4IRSB 2P1YA 1IGIH 2BRQA 2DQIH 5ICZB 1DFBL 1WUNT 3L5WA 3F58L 1AI1H 4NNXA 3IFOA 1IZKA 4EN3C 4HEPG 3VXRB 2CKBH 3DGGA 1TTGA 4XP1H 5IMKB 1I8MA 2HN7A 2F53E 2XRAH 4WTZG 5K9KA 2JK5A 1UH2A 1WSST 4JFZL 4OZ4B 1J0ZA 1KCLA 3Q6GH 4CKVX 4X5WA 1YEGH 4NJ9H 1KB5L 4Y19D 4PY7B 2HTLD 1FL6B 4XH2B 4F7CB 1ACYH 1D5IL 5EDXA 1ZWIA 3GSVA 5F3BA 2P8PA 4MDJB 5HGHA 2YPVL 3F12A 3MRPB 2VL5B 3C5ZA 3BKYH 5DHVB 1TFHA 1W0WB 5I0DA 4XB7A 3FOLB 1I8IA 4K3JL 1BFOA 5D1ZA 5FB8A 4GLRH 1A4JB 2Z4QA 2BNQD 4FQ1L 5F93C 4BZ1L 5JDSB 2P49B 2X10A 1NLBH 2QTEA 3MGTA 2VZ3A 3RIAF 2GHWB 5CZXD 5T5NF 3L3KA 1MSPA 3GSOB 5IQ7L 1WWAX 1RZJL 5I8KL 3WNNA 4XP6L 3D85B 5EOTB 5EORH 1AGCA 2VYRE 3HI6H 5DVKA 4WW1A 4UDTA 3U6RB 4BH7B 1ULVA 2FX8L 5IFJB 5E8PB 3QI9D 4M5ZH 3VI3F 4JG1L 4OCMC 4B41A 3H3KA 1WZMA 1T6VN 4YIQA 1V7ML 4KGJA 3JWDL 3RJDA 1CS6A 4DW2H 5MEOB 2X4PB 1ONQB 3QZWB 5MERB 4XMKL 1HXMA 5I1CL 2FR4A 3LKQB 5J9PB 4JM4H 3SCMD 5ACZA 1T0PB 1FBIL 3EYOA 3VA6A 4M48H 1BOYA 1WGOA 3MV9A 1J88A 4P9HC 4F7TB 4I48A 1YUHA 3DX8A 4YDKL 1UXWA 3MFGB 3GK8H 4PRPB 3KPNB 3QO1B 1LO5A 2VDLL 3OG4B 3B8YA 4ZPVB 3SKOB 4G6AD 5GRVL 5I30L 2BXZA 2BNRA 5DGRA 5E2TL 1PQZB 4O51B 3BH8B 1YMHB 4YXLL 3RGVB 4XC1H 1QFWM 3SKUD 5LGHL 2LQRA 3QDGA 4P2CG 3VE0A 5BOPA 1DTUA 3VXSD 4PJ7A 5A2FA 1KPVA 4U7MA 5JMOC 2YKLL 3DVIA 4MLIA 1WFNA 4HDIB 3V52L 1KJMA 4RRPG 4R8WH 3LZFH 2DM4A 4FQ2L 1RHHA 5A16A 3ULUD 1UH4A 5HGAB 1CFNA 2EDNA 2H26B 3T2QA 2FBOJ 1X4YA 2VLRB 4M1DH 3CCHA 5C0IB 3HR6A 1TPXC 2DM2A 2Q1EA 4Z7QF 3O3DB 2BY0A 1INEH 2VXSH 5FYJU 2AJSL 3QCTH 4ZAKA 4X6FB 4JO4H 5FDWA 1E28A 4G6FB 4OIIL 1F4XL 2E27L 5HY9A 3V6OA 3SJVA 3DO7B 1AGEB 1KUMA 2ICWJ 3OKMB 4K3DH 1TZIA 4W81A 5FUOH 4OQTL 3GM0A 1HCVA 1NSNH 4XCFH 3LDBC 3QPQC 1N64L 3U79A 5EPMA 3OGOE 1KCKA 4P2QE 2IJ0C 2CIKA 1G7IA 4HS6B 1UXSB 2FJHB 1JGLH 4GOSA 4LASH 3ZKQD 4Y16D 3MFFB 4JCMA 2EE6A 2P7TA 1QFUH 3QH3B 1MFDH 3HC0A 1NMAL 3C5SA 2W38A 4Y2DD 3RL1A 3GMNB 4F2MB 3ECBA 1QSFE 3IAPA 4YXHL 4W4OA 4NQVB 2MQCA 3QUXD 4KXZI 3VGEA 2ADFH 5D6DC 5ESQA 3QUYB 3EOYG 4X80L 5TF1H 5C7XH 3Q0HA 4JY4A 1QOKA 2GAZB 3D69B 2X9WA 4DGIL 3OKEB 3BZDA 3S34H 1IGJB 1A3RL 4C83B 4TSBL 1FIGL 1AP2A 2DKMA 1G7JA 4CADB 2DQEL 4U1GB 5DVLA 5IJKC 3PWPB 2I9LB 1OY3B 3GI8L 1S7WA 2UVFA 2IH1A 1MLBA 2FX7H 1O0VA 4JFFB 2R2BB 3FN3A 4HLZG 5DJ0A 1A7NH 1KG0A 3OR6B 4UNTA 4PREB 2HJLA 4U6XA 5J3HD 2OLDA 3S37L 5C09E 1RI8A 1NCWL 4AEFA 3BP4B 5TDPA 1D7FA 1A9BA 2HLAA 5GRVK 5EZJB 2OMNA 4XGZB 1JHLH 1FFNB 4X7FC 1J9CT 4XB8A 2RCSH 5DTFB 1SYSB 5F7EH 2UV3A 5K9QG 3RVXD 5D93C 4ZOCA 3KYNA 4P5MA 4NQED 4X5XB 2YMXH 5D2NA 5C0AB 4N0FA 3LRGA 4L1DA 3VXNA 4EVNA 4TTDD 3F7YB 3EYVA 3V6BR 2H2PC 1JZ6A 3HE6C 2P24B 2A0LC 4LSQL 2YUWA 1IGML 2WIIA 4NCC1 1KELL 2JCCF 3BMWA 1EVTC 2OTWB 1AC0A 4PGJA 4WHYG 5L7XH 5GGRA 1MCFA 4HIIA 1N8ZA 4CMMB 1J86A 4P2YA 3OMZA 4MXVF 1CR9L 5D8JH 5I1HH 1KIPB 4KK8C 3FO0L 4QXGH 4XVTL 5D6CB 2J4WH 1VEOA 3QXUA 3QDJE 3NZHH 3Q5OA 3LSOB 5IKCA 5CBEA 2VLKE 3WDHA 4ZUUA 2Q76B 5D7KE 1JZ2A 4X0KA 3JV6B 4RQQB 3TO4A 1NCAH 1OAQL 1VGEL 4YH6A 3BX7C 4Q6IA 1ZSDA 3GSNB 1MY5A 4IBLT 1HSAA 3H2WA 3OKLA 4TOYL 5ISZD 1MHCA 3CVIL 4OF8A 3HS0B 1C12B 1BOGB 1W72H 4MNGE 1YNKL 3QBTB 1CN4A 5I2IA 3MRNB 5IBTL 4S1DC 5LAXB 3D5OF 3I9GH 3NIGE 3AFLA 3K1KC 3LKNA 3MRCA 3LQZB 3A6CH 4YDIL 3VFOB 5ADPH 3HMXH 5HDBE 2AXHA 1KB5A 4P5TC 4N0CD 2VDRH 3STZA 2R2EB 2XPGA 1Q72L 4O9HH 3QNYB 1A1MB 4PRBB 4JGJA 1TETH 1CLZH 4G3YH 4R4BA 3RI5K 4MQXC 3U9UA 3WFCH 3CDFA 4FXKA 5FK9B 4OGAC 3EJZD 3QXWA 2Q6WA 1JF1B 1CIUA 1BP3B 1IGYA 1NL0L 1MFAL 2RGSA 5C9JB 5T3ZD 5LXGL 1NFKA 4RAUA 4FHBD 2V17H 1W0YT 1DANU 4O58L 4JDTL 3VXTB 4EQ2A 5FGRA 1FZOB 5I1IL 3CFDA 2CMRL 2O61B 2R9HD 4MNQA 3PABB 5J6HB 4KJYB 1S7RA 1RIUH 1AGDB 3IKKA 1M4KA 5SWSA 4CRPA 4FQXD 2MKLC 2FLRT 1MI5B 4IJ3C 5E1AA 5GS0C 2QQQA 3MV9D 4CJ0A 5IB1A 5EBLA 2IAMC 1G7PB 1JZ7A 1E6OH 4NOBA 3SDDD 2X4QA 1C5BH 3BPNC 2D3VA 3LDBB 3QSKB 4M7LH 5JIIA 5GGUB 3VRLE 4D0BA 2YBRA 3I3BA 1KYOK 3U2SB 3WIFB 3FQXA 3OKNA 5IF0B 2VZOA 4PTTA 3E6HA 1F4YL 2AEQL 1ZLWH 4YJZL 1A22B 4JANB 3QDGD 4OZFB 1FORL 2QQKH 5E6ID 2XXMB 5TE7H 3D87B 3BGFC 4J3TA 5DD0L 4CU8A 4H1LB 4XXCA 4CVXB 3NCEB 4Q9QL 1RJZB 2C3VB 5JDJA 4XAWH 3ULVC 3M8OH 1FL5B 4WHCA 5F3HB 1I1AA 5CIPB 1QSZA 4YHOH 1BLNA 1IKFH 3S9DB 4P99A 1B3JA 2QSTA 1BECA 5K9OB 3MJ8A 1PGRB 3MJ6A 4PS4H 3UC0H 2OJZH 3E1F1 1QSVA 3IDJB 4XCEA 3SE8L 3WLWD 4XBPA 4DEPC 3NAAH 5I1DB 2EKJA 5L6YH 1ZEAH 2UWEA 5DS8A 2ED9A 4TULL 4HUUA 2CRIA 4C56A 5TE6H 1C1EL 3VXUE 1ZTXL 1FNSH 1V7NL 5D93B 4NZDA 4NO5B 4YDJA 2DQIL 3U48A 4LPXA 1AI1L 4OQTA 1ZHNB 1OHQA 2Z31A 4Y5VB 3OKKA 2VLMD 2EYTB 4M02A 3S88L 2X4RA 1G9MC 2XRAL 2WNGA 1RUAL 3GSQA 2D7QA 2X4OB 2AGJH 3VFUB 5D7IF 3CSYB 3CFJA 1SM3L 3VXRD 1YEGL 4NJ9L 3P0VL 4HX1B 5EA0H 2A73A 2H32B 4WW2B 5J7CC 1AR1D 3IXTA 1AY1H 5GRYA 5B38G 4ONOA 2ICWI 4RISH 1GXEA 4U1HA 3RDTC 1BVZA 4BUHA 3O9WA 4JAMA 3NGBB 1ZMYA 5DI8B 1YEFH 1VDGA 5JXAH 1W8OA 2LAAA 4YDVA 5TDNA 1DVFC 4XPBL 2EYRB 4F58H 4MD0A 1QRNA 3G6JE 1EPFA 2G75A 3VW3L 1NLBL 5ITBL 5ETUB 3FO1A 3HE7D 3WS3A 3FFCE 3T0WA 1S7XA 4GMSL 4GAFB 4XPAH 3BZEB 3T1WA 2C7UB 3PQYE 4APQB 5I15H 5BO1H 3GUTA 5LQBL 2D31B 1HILB 5IFHL 3FB8A 3CFIC 2CK2A 1BZ7A 1PKQA 3FB6B 5I8OL 2J7LA 1KBGH 1LD9A 2CO6B 3OZ9H 3RHWF 4L4TA 3D85D 4ISVA 4M7JH 3RZCC 2XY1A 2VSDA 4PJBF 1QNZL 4HGMA 3VXQB 5L2KE 1F42A 5E2JA 4KMTH 5AG9A 4PRDB 4QRQA 3HC3L 3ZSSA 4DW2L 3BP7B 3PIQA 5E8DL 4U1SB 5CJOL 5HBBA 3STLA 3MA9H 3U0PB 4KKNA 1Y18A 4JM4L 4X6DF 3Q3GA 5FHBH 1KTLA 1QBMH 5KS9A 4Z0BL 4TUJA 1X5FA 3KXFD 4AEEA 3VWKA 5CFHA 3BO8B 5HPMA 3RNQA 4ZYKA 3JTTB 5IBLD 4Q9RH 1DUZB 3W11D 3WYRA 4WU7B 3EDJA 3TBWA 3JZ7A 4LKCB 3GK8L 4HC1H 4WEUD 4KTEH 4P3CL 3QDME 2W9EH 3BZ4B 4QRRB 1RVFH 1OAXL 5C2BH 3SGEH 4NKMA 1I1CA 4I2XA 5EB9A 4OD3L 1SEQL 4UILL 2YPKA 4Y5XC 4NWUH 2VO5A 1PY4A 1EEYA 2CKBB 1RJCA 3DSNA 4LEOA 4OJFH 4IJ3B 3KHQA 1I8LC 3RGVD 5C86A 5J89A 5I17B 5GRJH 5DJZB 3PWJB 1IGTB 3F8UB 3IXAA 5DJYA 3BPNB 4UBDC 5JUEL 2PUQT 4HUWB 1LO0H 1FGVH 2YUZA 1ZA6A 2BVYA 2H1PL 4OZHE 4H20L 2P43B 3P4LA 5DSCA 3KPPB 2CQVA 5JOPD 3PWUA 2J6EL 3U36B 1MUJA 3FOMA 3LD8C 2YZ8A 3TV3H 2VIRB 2D03L 4Y4KA 2GJ6E 1XCTB 2DQFA 4U1JA 5B38B 3ARYA 1EAPB 5D9SA 4F37K 5TPWH 3K2UL 3KLDA 2VLRD 1R24A 5IEHA 2AJXL 3O6FC 1V3KA 1KCUH 3MRLA 2APTA 1U8LA 2NY1C 4U6HB 1TVHA 4YQXH 5HYJB 1VACA 4MD5B 2VITB 4XCFL 1DDHA 1MFCH 1M7DB 2IANA 4XAKE 2R29L 2ATKA 4L3AA 5DQDL 1WWCA 4JFQA 2XKSA 5F7LB 4YR6B 3GHBH 1S7QB 1I1FA 4LPWA 1IEAA 5E4EC 1U6AL 1MCIA 4K8RH 1JF6A 3QQ3A 5HJ3B 1MFDL 2HJFB 3L7FA 4L8DB 2B4CH 4G8EB 2DM3A 4M6MH 1T2JA 1H3XA 2C4XA 2ADFL 2YC1B 1FLTX 5CEYA 3GMMA 5SWQB 3AREA 4NO2A 1MFEL 5JR1H 5FF6B 1I7UA 3HZKA 1I85C 2BVPA 4S1QL 4R3SA 1P4BL 4LPYA 3AGVA 5KW9L 3WLBB 3QXDB 2WQ8A 4KRNA 1F90L 4JFPA 2FX7L 1OP5K 3TBVA 4O2FA 3ARQA 2W1NA 4Y5YB 5KBNC 4GW5A 1FNGA 1FAIL 3P9LA 2UVEA 3DTXA 4JZJB 4PJ5D 1K2DB 2VKXA 1N6VA 3PHQA 1MREH 4KUCF 4WRLA 1KNOB 4PGDB 5TGBA 5SWZA 1O5DT 1A6WH 2ARJA 1HINH 1IEBA 2PYED 3CDGB 2CR6A 3U82B 5EWIL 2AERT 4PRID 1U3JA 2F8VA 3UPRB 5HVHC 3B9VA 1DVFB 1NC2D 2V9TA 3P0YH 4LSSL 3TZVA 4DZBB 1T83A 1GGIL 1A6AB 1P1ZA 3KYKH 1R5VA 4M6OH 5I19H 5A40E 3PP3H 5EUOA 5MEQB 1UGNA 3LS4L 4KK5D 4PG2C 1LP9A 3KG5A 3PGFH 1TJHH 3RWEA 1REIA 4PJEB 1WC7A 3WSQH 3KDMA 3HZYA 4V1DB 4KJQD 1CZ8L 2O26U 2EDFA 4PGBA 5E95B 3AXLA 1J8HB 3U4EA 2B1HH 3F5WB 1T0NA 1ZLVH 3P4MB 3UCRA 5F44A 5EBWA 2E9JA 3DX6A 4G8GD 2EDEA 2CLVB 3V6FA 1CXEA 2VISA 2R0ZH 4OZGF 4FQQB 3QIUD 4G80A 5E8OA 5IB4B 2AXFA 4MJ5B 4UTBH 1U8QB 4LLVA 2F54E 5MI0B 5TE4L 5L2JA 3SDXF 2ZUXA 2FGZA 1E27A 1MELA 2A6IA 1P5UA 1YEKH 1WIUA 1WBXA 4DAGH 3UAJC 3CUPA 2DWDB 2XFXB 2M2DA 4XPGL 1T20B 1W72L 2E7CA 2EECA 4BQCA 2KPNA 1GC1C 5J6GB 3W0WB 5JPMA 2CRYA 4ODXA 1XGUA 3QULA 3JTSA 15C8L 3LKSA 3A6CL 4YDLC 3VD7A 1RZKC 1D6VH 4HAGA 3TIEB 3E0GA 3I6GB 2VDRL 4FQCH 3OKYA 4JDVB 4Y5XB 4LCCB 5I66A 2PF6A 4EBQL 3MJ7B 2QQNL 3NTCL 3A6OA 3GB7B 2MQ0A 5T5FL 2QV2A 1BIIB 1P9MA 1W8NA 4NSKA 4Z7UA 3IDXL 4WFGE 4NJAH 3WFCL 5F9JB 4D9LH 1RUML 5EC2B 2EDDA 3GBML 3DVGA 1UCTA 1QFHA 3N85H 4NRZB 5DHXB 2AJUH 1OTSC 5DK2B 2P47B 3KVQA 2V17L 1J8KA 5FYLE 5FCUL 1EAJA 4J1UA 3NBNA 3IU4L 4OF5A 3BPLC 4NKDB 1CE6A 5B39B 4LU5L 2AVGA 1WTLA 1EX0A 1XGTA 4R96A 3TGXA 5I9QC 5KSAB 3VRIA 4PJ8A 3GMRA 4NPYB 4JGMA 1EUTA 3VWKD 2NY1B 4KJWC 1FVDB 1T03L 4JN2A 5DD6A 1QD0A 1C5BL 3UX9B 1MCWM 2Z35B 1MI5D 2FL5A 3EJYD 1SHMA 1SYVB 1ZGLM 4NZRH 5CP7A 1MJ7H 1MAJA 5HYQB 1P84J 4KDTA 5IK3A 1Q0XH 4D3CH 3WXWL 5E7FA 5E6ZA 2OQJB 3ARBA 5E4EB 4XP4H 5JMRA 3HLAA 1VFOA 4PJIA 4ZXBA 5FA3A 1RJYA 1U95B 4R4FH 1NBZA 4UOW1 4K55A 1MLCB 3ULUF 4KRPB 4N8VG 2ZUYA 2WWMC 3RWIB 2X4TB 1KLUA 4XAWL 2CLRA 2FEEI 1RK1A 3M8OL 1JPGB 1EBAA 2MCPH 1QG3A 4G6JL 3TPUB 1BREA 2E7MA 4GS7C 4JZNA 4QF1A 5E8EA 5ACLA 5KTEH 3RNKA 3NH7L 5CSGA 3UTSB 5HI5C 1AJ7H 3C6SA 2DKUA 2VRAA 3IDNA 1BD2D 4YFEA 1DE4B 2GJZA 3V6ZB 4HUVA 1HI6A 1Q94A 3TNNB 4NN5C 1M05A 4MJ6B 3WMSA 4XVUD 4PJXF 3RWHB 3MLPA 4M5YH 2ICWA 5L6YL 1UB6A 2R1YB 4PJFA 2J6EA 3D3VA 4OCRL 4LSVL 4FP8L 2FD6H 3PGDA 1OB1A 4G9FB 4QTIH 2J8UB 1AGBA 1MJJB 4ODHH 5TE6L 2P4AB 4MQTB 2CLZB 4ZSOA 5T3XD 1LE5B 4WFEE 5DEGB 3HNVH 4NUJB 3P40A 4U1MB 5SX4I 1TENA 4ALAH 1D5MA 4YHIA 4PRHB 3MBEC 5DUMH 2HT2C 2CXGA 5KVDH 1GH7A 5HDLA 2GK2A 4QOKA 2P5EE 2NY6D 5CSBA 4QNPE 1BJ8A 1OGAA 5GJTH 1RIHL 2V7HA 1NCDL 3MOAL 3FN9A 3EO9L 3KJ6L 5KOMC 5KSBE 3QUZC 2DMBA 5EU4B 1J11A 1FZMB 1MEXH 3L3HA 4LLYB 3WIHH 1XF2A 4MB5A 3BAEH 3M07A 1BQHA 2R4RH 1AXTH 3OR7B 4HFUL 1I7RA 5D1XD 1U8IA 4X99B 3KPTA 5BVJA 3D0VB 3K8KA 4F58L 3B8SA 4DCQA 3CFBB 5D7LB 4ZD3H 4BQBA 1JPFA 4GMTH 2OBGA 1VKXA 2R8SH 2HTKC 3L3IB 5IVXF 1QFOA 3ARGA 2GK0A 3RVUD 3EIFA 4KVNL 4NIKB 3I75B 5J56B 4I5BB 4AH2B 4EDWH 2BVQB 2W0FB 4EI5C 2DWEA 4I18A 2GITA 43CAB 5F8QC 3Q6FA 1X44A 2J8OA 3CU1A 4YAQB 3VGAC 3UYOD 5EU5A 1G6RH 1F4HA 1T1WA 4ZD3L 4APQD 3FQWB 5F1SA 1S7VA 5IEKB 5DLML 4YDLB 3T0EA 4M7JL 3RTQA 3MUGA 1DN0B 1AQDA 1ZK9A 4KMTL 1Q9OB 4Y2OA 2PCPA 4WVRA 1XGPA 2AP2A 1G7LB 5D5ME 1F6LL 1NC4B 3ILPA 5E9DE 2DN7A 2XZZA 4JQIL 4HUNB 4JFDE 5KVGL 1T7XA 2JJSA 2DQDL 1JHKL 1BEYL 1R5WB 1U8PA 4L5FH 4LDOB 4UINH 3TN0C 1B2WH 2VZUA 2XYCA 1R3HB 1UWEH 5F7YC 5IW1B 1PJ9A 2J3SA 3B9KC 1P4LB 4NHCL 5M7QA 1F3JA 4JG0H 5EU6E 3QNZA 5HDQH 3V5HA 2W9EL 4GBXD 2CXKA 3LRHA 3BPLB 1QKZH 2ZP0T 3V4UL 4XNXH 4IRJC 1ADQL 1MVUA 3VCLB 1T7VA 1AO7D 3C6LA 4IHOA 4QRRD 5I9QB 3T65B 4JJ5A 5E24E 4OKVB 4KVCH 5C0CB 5IMMA 2YSSB 4JHAH 1GGTA 1IQDA 3D2UB 4I1NB 5I71C 4M43H 3L95B 1M7IB 4P59H 2VWEC 5FKAA 3OL2A 5ESVA 3RWFB 4HKZB 5ACMA 1XZ0A 3FMGH 2JB5L 1R5IA 1KTDB 1NANI 5JLZA 4WEBH 1W72A 2VXTL 2VXUH 4LCWA 4L3EA 5TPWL 1CFVL 1NLDH 4ZS7L 2ITCB 3VMOA 1IL1A 2NTFA 1BZ9A 4TUOA 4PGEB 3VH8B 3OXRB 5MHSE 1JYVA 1MQKL 1QPPA 3CAFA 1MFCL 4W4NA 4X6BB 2XTJE 2VLJE 4U7SA 1M6OA 3P4NA 3ZE0F 1YPZB 2VE6A 3FHAA 1OAZL 1T6WA 5HYJD 5FO7B 2AJVH 2HRPH 4J4PC 3QJHB 4LLUB 5LBSH 4GRWF 1UENA 2J5LC 4OLZL 3HTLX 4Y1AA 2IFFL 2WBJA 3O3BB 3SE3A 3VFGL 4OCYL 1GZPB 1RFDH 4D0CA 1RJLB 1N59B 3DURA 5IMOA 1FO0H 3KPRD 1Q9LB 2ADGA 3N1QC 1ZT1B 3SO3C 4QRUA 1Z9LA 1IGFH 4WUKH 5FFLA 1F2XK 1R0AL 2AV7A 4WFHD 1MY7A 3CH1A 5J11C 1H5BA 2I25N 5IB2B 4XNMA 1CXLA 3D39D 4I77L 1XFPA 4MZ3A 1CDHA 4HW6A 2NY4C 2VC2H 1U93B 4OD1H 4L8CA 4KAQL 1BGXH 3BDBA 4OCSH 1DP0A 4ZO6A 3JXAA 4ELMA 5EBGA 5INDB 4LHUB 5CJBA 2QBWA 5D2LA 4P2RE 2F5BH 2EYSA 3BZFA 1DLHA 2AJ3A 4HWZA 5DRZA 1JNNL 1MREL 2NZ9C 3QUZB 4KK9D 3MMEA 2X70B 1XH3B 4RFOL 3ZDYE 4ODUB 1WFTA 4G43A 3DMMB 2EIZB 1XF3A 1AFVH 4U3HA 4KI5D 4MA7L 1K5NB 1BVLB 1AR2A 1F4WL 4KU1A 4LARL 1MPAL 1WAAF 4JPIB 5ELIA 4DGYH 3PXHA 3EYUL 1WCBA 2Y5TB 3SY0A 4BYHA 1U2CA 4M6OL 3EUUA 2X41A 5DDHB 4AZ8A 4BKLB 3H9SE 2EDYA 5I8EB 3S5LG 4UIKH 1HHKA 2YUXA 3ROOB 2A9MH 4WI9A 3UTTD 1KPUB 3LY6A 4YFLF 2CUIA 4FS0A 5I76A 5K9QI 2ESVA 4XNUL 5DJ8A 2HVKA 1FPTH 3EDKA 1I8KB 2FIKA 4FQJL 4P46A 3VGAB 5C0FA 1UQSA 2AV1B 2FH8A 3C5JB 4V1DD 4NBZB 1IZJA 1HOCB 3MV7A 2NXYD 1U92B 2K9UA 3GMPA 4NNPH 1BJ1H 2H8PB 2M26A 2VN4A 3DBXA 2NY3D 4E5XA 4UTBL 3P73A 1F4AA 3QWRD 2C1PB 1LNUA 2YPLA 4DAGL 4MB3A 3LS5L 3GIVB 2X89A 3TN0B 2GQHA 4JKKA 4FQHA 1A1NA 4D9RD 5E94A 4HIXL 3L3JB 5BRZA 3GSNL 4RGOL 4LLMA 4IRSA 5IUSA 3B9KB 5ICZA 3ZDXE 5F88B 1R3LB 3QT2A 4P9HL 5E4IA 2R0WH 4TQEH 3NCYP 2OYPA 1IILE 3G5VB 4JPWH 1MHEA 2HMID 5IMKA 5J57B 3TESA 3GIZH 4KMQA 1D6VL 5GRUL 4IRJB 4FQCL 4OZ4A 3MO1B 2O5XH 2DJ4A 3ZE1E 2VQ1A 2FWOB 5DJ2B 4PY7A 1FL6A 1ZANL 4FMFA 3L9RB 5BV7H 3FRPG 4M62L 4MDJA 4MVBC 3MLUH 3BD3A 4BM7A 2RFXB 2VL5A 1KB9J 4BUGA 4FFZL 5DHVA 1W0WA 5I71B 3FOLA 5JZ7D 4ODSH 4YXKL 2DQJL 3C60C 2VLLB 1OTTD 4YGAB 1WBZA 1EZVY 3VG0H 4GXUN 2AJUL 4CW1B 4E42B 2DLFL 3KS0H 3UBXB 1DBKH 3FFDB 5KJRL 2APBA 5JDSA 3X13A 1J05A 3BSZL 3OKDA 3KPLB 1DUYB 3LN4A 4MD4B 4UB0H 3DWTA 3HC4L 3BEVA 4NZUH 3WS6C 4JREC 4N0YL 3PP4H 2XN9B 5M95B 5FXCH 1IVLA 3O2WL 4ONHB 2FHFA 5EOTA 3QAZB 4GAGL 5AG8A 1XGRB 5KSAD 5C08D 1HHHB 1JGUL 4MQSB 4DKFH 4P23C 4DVBA 4BH7A 5E8PA 4CGTA 4NZRL 4NQXB 5EU3B 3SGJC 5MEOA 4D3CL 3B5GA 3NABH 2X4PA 5ILTL 3QZWA 3SDCC 5I1AA 5HYSB 4OV5B 3ARWA 5T1MB 3LKQA 3PDGA 5J9PA 4P4KD 4YUEL 1TCRB 4PLOB 4XP5H 4K71B 4XP4L 1LEGB 2FECL 2FJFA 1QLFB 4JRYA 4NNYA 4F7TA 5F1OB 1J0YA 1ZLVK 1ZT4B 3BKCH 3P2TA 3UJJH 4PRPA 3KPNA 3FB7A 1OT1A 3HRPA 1YN6A 4LLQB 1ADQA 2BNRE 1L0YA 3SKOA 4YC2C 3THML 4NKIH 2X1WL 4TNVF 3OHXB 4N0UB 3QCVL 3K81A 4KRPD 3Q1SL 1U8JB 4H0HB 3CZFB 1PQZA 4O51A 1YMHA 4WWKC 1A6ZB 4PJ7E 3NCBB 4MXQC 2NY4B 1YEIH 1IAIH 3MLVL 5ESAA 2D7OA 3IDYC 1RIVL 3RPIB 5CMAA 3KWWB 2EDWA 4G5ZH 4YO0B 3RQ3A 1FE8H 3VXMA 1MCRA 4LFHD 4M5YL 4KKBC 2C4FU 1KCSH 5T5NG 4WTZA 3ARFD 4NQSB 5DD3H 1RZIB 4JFEA 5BVPL 1FYTD 3JWOC 4AEIL 5IVZB 1L0QA 3QUMH 1V3JA 2RIKA 1OF2B 2NX5D 5C0JB 1FL3A 5C0IA 4WV1C 3LMJH 1N6UA 3MNVB 4RMQA 1H3PL 3O3DA 3HNVL 4G9FD 4F7PB 4JKLA 1NBYB 1T7ZA 4Z7VA 3P9MB 3SJVE 3V6OE 4ALAL 2IPUG 4CVWA 5EOCH 1GZQB 1OGTB 3C8DA 4GRLC 3DO7A 2HP4A 3QJFB 3HN3A 4HV8A 1DBBH 1N4XL 3WE6B 4P2QB 1EHLL 4PRHD 5C6TL 3SE9L 4A6YB 2H3NA 3IF1B 3IJSB 4EUPG 4P2OA 4MA1C 2BHZA 4X4MA 3KGRA 5EOCJ 4C54A 4RGMB 5DJ6B 4L1HA 3KR3H 1L9MA 5DO2C 1CVRA 1UXSA 2FJHA 3U4BH 4LCIH 3X11A 1WJ3A 1LO4H 1P84K 3BAEL 3QH3A 4U3CA 4NFDA 3GMNA 4ZFZB 3DIFA 4Y4HC 1EGJL 2FATL 2LU4A 3QUYA 5DYOA 1UM6L 2PXYA 5BS0D 3OSKA 4MA8L 1U8HB 3MUJA 5F70A 2A83A 4XNQA 5DF0A 5EFIA 5D7LD 1SJEB 4EDWL 5C07E 2Z93B 1IRAY 3UZQA 3LHPL 1JBJA 1IGJA 3RBGA 3OJDA 4NQDB 4C58B 3K4ZA 4UU9A 1NAKH 2P46B 4EN3A 4GQPH 4NT6A 4AENA 3PWPA 2XA8H 2Y07H 2I9LA 2FJGB 5HHME 1AGFB 1C16B 2R2BA 3LH2H 5F1NB 4A2LA 1DN2A 4EOWL 4QCIB 4PY8I 5F9WB 3OR6A 4OD2A 1ACZA 3O6LH 4PR5A 2C1OB 2R0KH 2IPTL 1MWAH 5FYLH 1FH5L 3BP4A 1NH6A 3OWEA 4AQ1B 2Y23A 4XGZA 1FFNA 3MGOB 4UINL 3EFFB 4RAVB 3KYMB 1SYSA 2OTUB 5DTFA 5F9OL 1CICC 5D2NE 1QBLH 1UWGH 4JN1H 3EO1A 1JPSH 4ODVH 4N8CH 4X5XA 3C60B 5C0AA 4WIQA 5SV4A 1BM3H 2YRZA 4RRPA 2Z8WC 3GSUA 4PJHF 3OB0H 1V3LA 2LABA 5MEND 3U7AA 3F7YA 1DLFL 4OAWB 2VZSA 4M7LT 2P24A 3JV0A 3MV8D 4R4NC 4U1KB 2HT3C 1S9XB 3MNWB 3TA3C 2B0SH 1IFHH 4M7KL 3TYFB 4I8DA 2DYPB 5GRZA 1J12A 4CMMA 4UT6L 2YD1A 1KIPA 4N5ED 4DKEH 3H42H 4N0RA 3N0PB 3CX2A 3QDJB 3A67H 4P23B 5GS0L 4U7KA 3NFNB 4AYFA 3MBXL 1RZ7L 1KSRA 2VDQL 4P59L 3LSOA 3FT4B 4IS6B 2OK0H 2Q76A 2BY1A 3EYQD 3JV6A 5FGBA 2E6PA 5IB3B 3C2AL 4DGVH 5C0BB 3GSNA 3O3EB 2OSLA 3EOAA 3AUVA 4CVZB 1C12A 1I9JH 5EULV 5KG9B 5CJ8A 1NLDL 3AMKA 3GNMH 4HXAH 3TCLA 3VFWA 1HIML 5FA4A 3MRNA 4R7DB 4KZDL 1Q9KA 2DMCA 4NOFA 5TH2B 4QXUH 3LQZA 3L3DB 4LHQB 4YC2B 4CN4A 4MS8D 4I9WE 5D7JC 2CDFB 4LCYB 2UZIL 2Q7YB 4YPJA 2AJVL 3OAUH 4ENED 5JORA 3MLXL 5AZEH 4NFBA 4PRBA 1N6QH 3QEUB 1I3GL 4OCNC 1DL7L 3BHBB 4H8WC 3LRSA 5L8KB 3CFKB 1YC8A 3SQOH 2EDQA 1JF1A 2A74A 2EDKA 5C9JA 1UKTA 1IGFL 2P5WD 1LK3L 3L3GA 3VXTA 4MNQE 5AYQA 1FZOA 3MGAA 1NJ9B 3BPCA 5CWSB 1YQVL 4WV1B 2DQTL 4OM0H 4U6VL 1RUKH 2EEBA 3PABA 1QSEE 2BJMH 4PJ9D 5B4MC 5J6HA 5EZLB 4KJYA 1YA5A 4OTXH 4JRXD 4XPHL 3V5KB 4LLDA 2APXA 2CUHA 2BNUA 1CK0H 5CAYB 1BGXL 5EBMA 2VABA 4JM2D 2Q86B 1G9ML 1VERA 5D72L 2BHYA 4UNUA 4DZ8A 4JHWL 2F5BL 4Y4FB 3W9DB 3GKWH 1R6VA 3F7VA 3ZKSD 1WBYB 5IF0A 4QRSB 5A1AA 4LHUD 5GZND 2IEPA 2HVJA 1H9VA 5A2IH 5DWUL 5JW4N 5GSRB 3RAJL 3ZT7A 1JJUA 4OZFA 3MRJB 2BSTB 2FBJH 3IGAA 3DMMD 1HSBA 2E7HA 4GKZB 1JK8B 1J1OH 1T04B 1PY9A 3EHBC 5GISL 5D6DA 1F3DH 5LCVH 3C8HA 4UIKL 1P7QD 4YHKH 5EZOH 1RJZA 2C3VA 4DKAA 5L9DH 1VADA 5D71H 4JFED 3BYTA 3QHZL 5HHOE 4K23H 5ID1A 3IFLH 4L3CB 2VDPH 1EEUA 5DEFB 5CIPA 3V7AG 1IM3B 1BF2A 4PJGA 4XPTL 3EBAA 3DSFH 3B2VL 5CZVH 1G9NC 1T22A 5ADOL 4OBSA 5K9OA 5JW5B 2BVUA 4XC3H 1KT2B 4F9PC 3MRFB 4S0TD 2CH8A 4JPVH 2CKNA 2DJSA 3BWAB 3EGSB 4HUXA 3IDJA 4F3FB 1ND0B 3QFJD 4XRCB 1KJVB 3QIBA 3OJ2C 4NO0B 2UWEE 5I1DA 4UQ3B 4RBPH 5HGDA 4C56E 3LEVH 4M4RA 3S36L 1KLGB 2YWYA 1IAOA 2WINB 4P2OD 1CICB 3GJFH 1FO0B 4Z7WE 4WW2F 2VQTA 2IQ9L 4K8RD 5CEZE 5JHLH 1AHWC 1FFPB 1T3FB 2CO7B 2XTLA 5CHNB 4F80A 1MH5B 3PG2A 5DRXB 4XCNA 1QYGH 1T2QH 2EYTA 3HE6A 2BDNH 3GIZL 2JCCB 3NIDE 1WWWX 1MF2L 2VLKA 3Q48A 2F53D 8FABA 2LV4A 1KENH 1CD1B 5J8OA 5KSVB 3CSYA 3VU2A 2O5XL 4HG4J 2FIRT 3TA3B 3QEHB 2H32A 5BV7L 5C0NC 3UJIH 3IAQA 3DPBA 4LVNB 3MODH 4H0IA 4MNGA 4RX4D 5JNYB 1WFOA 5ITFA 5IM7A 1X9QA 3RUGE 2I9TB 3S37X 5DI8A 3U46B 1EGJA 1KLFA 5CGYD 3CXDH 4P5KA 1QRNE 1RUPH 2AJYL 3VG0L 1EHXA 1NGZB 1MQ8A 2XZAH 4PJAB 1QRKA 4QRPB 1OCWH 4AMKH 4KH2A 3VG9C 3GI9H 5JOFB 3PQYB 1EHNA 5K93A 4JQXC 1X5HA 4LEXH 3WO3B 1HNGA 3HCVB 3FAWA 4F7EB 1GIGL 1PKQE 4LNVA 2D31A 4CAGA 4G9DB 3UTPE 4QWWD 1CFBA 1UB5B 1CLOH 2X5PA 5ANMB 3LEYL 4P5TA 3W5NA 4MXWH 3VXQA 4HJ0C 4H26B 4PRDA 4ONFL 2XQYG 3MOQA 3OJVC 1IQWH 4U1SA 4Z7OF 3QQ9C 1JP5A 5JXED 4X6EB 1CG9A 4XP5L 5GQBA 3S4SG 1FN4B 4GRMB 5JQ6L 3IDIB 3X12A 1H15B 3JTTA 2XOTA 3BKCL 2YA2A 4WU7A 1MCWW 4R2GB 4G7YL 1F58H 1IKNC 2WM0A 4LPVA 3V0VB 3BZ4A 4I2XE 3WFDH 4ZUVA 3CMOH 3H3PH 4F37F 1L7TH 3QYCA 1Y6KR 2XNAB 3MXWH 3IFPB 1A6UL 2AKRA 1YEDA 1MRCL 4LRNL 2IAMA 5I17A 3PWJA 3GMQA 3IS0X 3L7EB 4PP1D 5A3ID 5ALCH 5I1JH 4GSDH 4GH7B 3PL6C 4ZMAT 5CEXB 3CFCH 3DV4B 4TNWF 4WI4A 5DD3L 3CPLB 3MRQB 3RVTD 1JNHB 4BFEA 3VFTA 1KB9K 3KPPA 1QZ1A 2F58H 1FG2B 3ESVF 4NQUA 5E2VL 3E3QC 4GXVH 3LMJL 1I3VA 3CC5B 4OLWL 1QLEH