4AENB

Hla-dr1 with covalently linked clip106-120 in reversed orientation
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
188
structure length
181
Chain Sequence
TRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN, DR ALPHA CHAIN
publication title Peptide Linkage to the Alpha-Subunit of Mhcii Creates a Stably Inverted Antigen Presentation Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 43
structure length 181
sequence length 188
ec nomenclature
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4aenB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4aenB01
3ULUH 4KDTC 4D0BA 2VQTA 3V5DA 3VG0L 2DTMH 3O3AB 3S9DB 1F4YL 3FRPG 3RKDC 1MRCH 3H9ZA 3N1MC 1AXSB 1XCTB 5IIEA 3AREA 2FEDD 3JWOL 1YY8A 3OG4B 1L9NA 3WO4B 3ZYIA 3RHWF 3F6IA 3CVHL 3WIHH 1PGRB 3EJZD 4CU8A 4HV8A 4GG6F 5D8JH 5D1XC 1IQDB 4O02L 3PHQB 1M6OB 4XRCA 3T3ME 4HJGB 1OARH 3FN0L 2OX5A 4J1UB 2OSLA 4P46D 4LPWA 3OAYK 2H6PA 5DA4A 4EVNA 3SE8H 5AZEH 4Y16C 3HRPA 2ZJSL 1RIUL 2H41A 1IKFH 4GXVH 3FONB 1FBIL 1EERB 4A2LA 2AV1A 4QTHA 3ECBA 4AEHL 1KLGA 3KVQA 1DTUA 1LE9B 2KQNA 4MB4A 3UYRH 2N1KA 2A2QT 5FHBL 2K1MA 4C55A 4NN5C 3IDYC 2DQTH 4KWUA 3LKPA 1FQ9C 1R5WA 1M7XA 4JRXD 2AQ1A 2MHAA 4KKCD 2CKBL 1SBBA 5KSAC 3ILPA 1JNLL 5ACLA 2HWZL 5HJ3B 4L4VB 5C8JA 1RJLB 2VDLH 4O4YL 3I75A 4LVOC 3RWCB 3MA9H 5TGBA 3SDXA 3B5HA 2B5IB 4I77H 3TCXA 3VMPA 1S7QA 4UTAL 3OKOA 1MCBA 1PKQE 2EO1A 3MACH 4GMTH 4QRPB 3VXSE 2YZ8A 1PG7W 3WD5H 5DUML 3IFPA 1HHGB 2XICA 4TULH 4Y5YA 4Y2OA 1U8NA 1AQKH 1CE6B 1YEKH 3DSNA 2DL9A 4QGTA 4EN3A 2RAMA 5H37G 4B7IA 4MXQD 2VN7A 1N2RB 4TTGA 1UM5L 3SJVD 1KIRA 2YPLD 2WINA 4B50A 4U0RC 1FNGA 3INUL 4NHUB 4WGWB 1KPRA 2L4OA 3JSSA 2VUOA 4E41B 1ITBB 4JAMB 1AO7A 1Y6NR 3UTTD 1MNUH 5HHME 1D6EA 1AFVH 3ARQA 3VFSB 3DGGA 5D96C 3SHSA 1OSZB 1EFXD 4BELD 4NZTL 3MXWH 1S3KH 3MCKB 4OB5L 4JO4H 2HFFB 3IYLW 4X98B 1MCKA 2JTDA 3TA3D 2JB5L 1UWGL 1T20B 3WN5C 3BZFB 5CS7A 3HB3D 1H0DB 2APFA 2FEEI 1TCRB 5F9WC 4ZFGH 2FGZA 4IJ3B 1W0VA 4NZDA 3LPGA 5DSCB 2JK5A 4X7EC 5F9JA 4FQPA 2QADC 3M8OL 3V0AC 3H8NA 4NHCH 2CDEB 1NBYB 4KHTL 3BSZH 3MRNA 2HKHH 1SVCP 4XX1G 4JFPA 1B3JA 3B83A 3CH1A 1EJOH 4JY4A 3DXAB 5E4EC 2YD8A 3O6FC 3PWPD 1QKZH 1KN2H 2DD8H 1T5WA 3TJEL 1X6LA 3ISWA 2ESVE 1EO7A 4WEMB 1EGJA 4WTZA 2APXA 2Z31C 1FORH 5IEHB 1HK6A 2B20A 4JHAL 5IM7B 1SYSB 2UWEA 3HE6A 2VOTA 1H3VA 1IFHH 4DUWA 3ZTJH 3O3AA 1P2CB 1AXSA 2DF3A 5C0RH 2F19L 5KZCB 1H3XA 4EBQL 4EXPX 2QLVB 3H0TB 4GW5B 2EDKA 3GK8H 4I13B 1JIBA 4H1LH 3NZHL 4JO1H 3V6FA 4M43L 3S35X 5J9PB 5AZ2L 3KYNB 3WDIA 1BQHB 2NW2B 5EDXA 3PHQA 1M6OA 2IANE 3ALPA 2PO6D 2WNGA 4HJGA 4NZJA 1MPAL 4J1UA 4G42B 2ZOLB 3EFFB 3H9SE 2VABB 1KG0A 3QXDB 4ZAKC 1MCHA 1VFUA 3FONA 1BHGA 5F9OL 1IGJB 3ETBF 3MLTB 1FFQA 4LAJH 4POZD 1LO0H 1JZ2A 2CLVB 4LFHG 4EKXA 1LE9A 3UROR 2VR4A 5C0AB 5D1QA 3G6JF 3PIQB 1BVKB 3QFJE 1RZ7L 3Q5TA 1TMCB 4R4ND 2KZWA 1YEGH 5CJ5A 2AS5M 1ZA3B 3BKMH 3VXNB 5KVFL 2EH7H 2ARWA 3U0PB 4X83A 1NCCL 5HJ3A 4LL9A 1IE5A 3QR2A 1RJLA 1GOHA 5JW4Q 4WUUA 1MWAL 3IT8D 1ZLWK 4NM8L 3RVVC 4AEIL 2EKJA 1KB9K 4X6EB 3EOTL 3ESUF 5LG1A 4ZUUA 4QRPA 3FT4A 3GO1H 3QIWB 1HYRC 1HHGA 3QZWG 1QFOA 3AUVA 4LSPL 4LCCC 5J6HA 2NY2C 5DRNB 4R26L 4KRLB 3R0NA 5HD8D 3MOAH 5EA0H 3SOBL 5HPOA 4KROD 4HIIA 1IM9B 1LEGB 1N2RA 5DURB 3MROB 4PV9A 3GIVB 2B0SH 3HPJB 1IGCH 1XF4B 4YDVB 5DLMH 4NHUA 3HMXL 5BJTB 5FV2A 1DSFL 4E41A 4JAMA 3HNSL 4MSWB 1RURL 3MRPB 4HLZH 4C56B 5E08H 3ULUE 4LCUB 3CDFA 1U8QB 2HTLC 1FLRH 3OF6A 1ZHNB 4R3SB 3VFSA 2QQLL 3PGCA 3IETB 4C4KT 1RY7B 3LQAH 1YEEL 1EMTL 3AU1B 3B8SA 4KJYB 3WFBH 3MCKA 3O6KL 5IR1A 3PWNA 2HFFA 1DQLH 4HC1L 2Z35B 4FQ2H 4RGMB 4CDGC 1YNKH 1T20A 2W1NA 3BZFA 1H0DA 2IG2H 1TCRA 3G6DL 1BP3B 1KB9J 5LCVH 1T89C 3TCLB 4WI7A 2BFVL 5FCSH 4QCIB 1WSST 4DN4L 3WO3B 4PJXE 4HQQH 2CDEA 2EYSA 1T7YA 3MXVL 4R9HA 3UDWA 3DUSA 3HS0A 3DXAA 1TLKA 3O2DL 2E8YA 1G7MB 1H3TA 1I85A 5I15H 1FYTE 4MS8C 3MA7B 8CGTA 1BF8A 4F9PC 2VXSH 5IB5B 5FFLA 1UM6L 3C8DA 3D9AH 3BQUB 5IEHA 5FGCE 4LSTH 2CO6B 3RY5A 5IM7A 1NFIB 1SYSA 4XP6L 1Z9LA 2GT9B 4KKAD 2P45B 4P2QB 1F8TH 2D9QB 5GJSH 1MF2L 1KTLB 1RUQL 4OCYH 1P2CA 5GXBB 3ARSA 1KXVC 3FT2B 4PG2C 2B1HH 2DM3A 4A6YH 1AH1A 2UVEA 1ROWA 3H0TA 3TC9A 1KEML 1YY9D 5KJRL 3R06A 4ORGB 5F96L 3N9GL 4P5MA 1CN4A 4V2CB 5F7LB 2YWYA 5C0DB 1P5UA 4QLRA 1K4CB 4RWYH 2NW2A 2P8LA 2IEPA 5HI4D 3VD9A 1DR9A 4OQTH 4G42A 2FSEB 2HJLA 2ZOLA 2VABA 4EIZC 4FFYL 5T5NF 1MAKA 4NYLB 1HQ4B 5IVNA 3DLQR 5IK3A 3MLTA 3OQ3B 2CLVA 1T0MB 4AIZB 4OF6A 3HI1A 2VKXA 5C0AA 4Z8FL 4RMUA 3PIQA 4U1KA 1BVKA 4UT6H 1QPPA 4JM4H 2CMRL 4UU9B 3ULVL 1VADA 1XGQB 5B21A 3VXNA 1WISA 3KPRB 3U0PA 5CD5C 3GMOB 4HUMB 4I2XA 3NTCL 4WEBL 4JFEB 5CEZD 1IAII 3T65B 4XBEH 1IC7L 1KB5A 5K9QG 5D7JD 2CLRB 2FBJH 2ICEB 2HFTA 4NC1E 2NXYD 3WFDL 2R1YB 4WDIB 3Q0HA 4X6EA 4ZTPH 3VXUB 4AL8H 4PLKC 3QIWA 5F7WC 5T1LD 1BFOB 1CL7I 5FUOH 2Y07H 5DRNA 2R0KL 4CVXB 1RUKH 5I75C 1MJUL 3QIUB 5F88A 1QYGL 1U8OA 5E2UH 5JIKA 1TNMA 3GSUB 1IM9A 1LEGA 3T0DA 5D5MF 3MROA 4Z7WB 3VA6A 3GIVA 2VDQL 4WI9A 2V2WA 1FP5A 1YYLL 2NY3B 4MAUH 1N0LA 5BJTA 2W9DH 4MZ3A 5E03A 4HWEH 5EBGA 2LAGB 2YR3A 3MRPA 4C56A 4LCUA 1U8QA 4R3SA 1ZHNA 2NY6B 3IETA 3WN5A 3QPXH 4DW2H 4NWUL 2JJTA 3AU1A 4KJYA 3F7YA 5I8EB 5DRWB 3NH7L 3S98A 5IT2H 1WVZA 4L1DA 3GRWA 4YFLF 1S9KC 1MCSA 3W0WE 2A9NH 3ULUC 1J1OH 4XVTL 4O9HL 2NX5D 3N1FC 5FGSA 1UZ6E 1NMAH 2OK0H 1EPFA 3B8YA 3TCLA 4G7VH 5EWIL 4QCIA 4YHIB 2VZTA 5DWUH 3SDCD 4FQQB 2DQJL 3T3PE 4FS0A 3EDJA 5JW3H 5DJYB 4NCDA 1G7MA 2I9LB 2OP4L 2YA1A 4DZBB 3EDKA 1BQSA 4JFFE 2ICES 3MA7A 5IB5A 3F5WA 3BQUA 3BT2H 4PRHB 3KPLB 4FP8H 3OV6A 2GT9A 1JZ6A 2IFFL 2ZCKL 4P2QA 5TDPB 3B9AA 4PJ8D 3IU3B 4OIIH 4XNZC 3MJ9L 1RUMH 4R8WL 3FT2A 1JZ3A 2X5PA 5D70L 2E6PA 2GKIA 2CJUH 3PQYE 2HLFD 4ORGA 4PGCA 4L8SB 3IF1B 1KCLA 4OFKA 2F54B 5C0DA 1K4CA 3VGAC 3GI9L 3UC0H 1Z3GL 4YDIH 4QRQA 1FAIH 3VXTB 2ZOKB 3DVIA 2FSEA 4W6XB 1MFNA 2X4TB 1PBYA 5I71B 1RHHB 2PETA 5EC2B 4Z7UF 4NYLA 1HQ4A 3D69B 5DFVC 1G6RH 3VFMB 1KIPB 5I74B 4X7SL 4XZUB 2IWGA 2YD9A 5F6IC 5FDYA 1UXWB 1T0MA 4AIZA 4Z7NF 1I8IB 3NFNB 2WWKO 4LMQI 1SY6H 3BH8B 7FABL 4PJGF 3UX9B 3MNVB 1RQ5A 3C9NB 2Y06L 1NCAL 3WFCH 4F8TA 3UJIL 4UU9A 1BFVL 4OZIE 1WWCA 3IGAB 1XGQA 3JVGC 4I48B 3KPRA 2F8OA 1UYWL 3SBWC 3GMOA 2PXYC 4OJFH 1D9KC 3MBED 1ZWIB 2H45A 5C08D 1KCVL 2N4IA 4KHXH 4JFEA 3T77B 4JCMA 5GZNC 4BH8B 1MLBB 1QFWI 3LPWA 2CLRA 2ICEA 3IDIB 3QAZC 3T8XB 5B4MD 5HSFA 3IJHB 4NJ9L 4WDIA 4N0CC 1DQDL 4M4RA 2P8PB 3MLRL 2RB8A 5F44A 4XVUC 1ZT7A 1HIML 5D72L 1BFOA 3K1KC 3BGMA 4CVXA 3Q3GB 2R2CA 5C6TH 1AHWB 4OLZL 2VDPH 4M03A 4DKFH 3OAZH 3GSUA 2YRLA 3HC3L 1AD9B 2FECL 1U2HA 4Z7WA 2WP3T 4MAYD 3MLVL 3F12B 4PREB 2K9UA 1RFDH 1TVHB 2X1XR 3NFPB 2BC4B 5F89B 2NYYD 4HZLB 3GI8L 3MJ6A 3K80A 4PJDA 4PV8B 1VA9A 3K2MC 4KAQH 2XKNA 1UM4H 1WFNA 4OI7A 4X4ME 4QT5B 5HHPA 1JTTA 3BKCL 2PYED 4P4RB 4UB0L 1MCLA 1IC4H 5I8EA 5DRWA 3C09C 1LK2B 1E6JH 2FEEL 3BP4B 2GITB 4H0GA 3FN3A 1PQZB 3OKLB 2DKUA 1VACB 4PRNB 4ZOCA 2DWEB 5D2LB 3D5OF 1KLUB 4YHIA 3U6RB 1VENA 1FNSL 1R3HB 3TT1H 5GS0H 1A6WH 4I0CC 5DJYA 1KEGL 1QFPA 1T1XB 4G7YH 1EFQA 4NQEE 5DJ2A 1BX2B 2I9LA 3LZFH 3SJVE 3JWDH 5IWLA 3STBA 1J1XH 3I02B 2QEJA 1DLFL 1GAFL 5FF6B 2IBGA 3L3DB 3ZKNC 1WGOA 2EE9A 5E1AB 3UTSB 3CVIH 4J3OC 4K3HA 3O41B 1UCBH 2QKIA 3EO9L 1QR4A 5C0ND 2BZDA 2GCYA 3UTPE 5IMOB 5TDPA 1CXHA 1P7QD 2NXZD 3IU3A 5CEZH 5CZXD 1OP5H 1YMHA 5I1IH 3GSWB 1OW0C 3EOBB 4RDQF 1NCWH 1EX0A 4L8SA 3IF1A 5I8KH 3DGCR 5CP7A 4QWWC 2F54A 2LTQC 2VXQH 5LBSH 3PV7A 1EDQA 3VXTA 2ZOKA 3X12B 1RHHA 5EC2A 2VYRE 4PLJC 4JKPH 1WBXB 5DUPH 3D69A 5LWYL 3VFMA 1XR9B 1WZMA 3QEQE 4HJJL 2X41A 4XZUA 5IW3A 4UMGA 1UXWA 4Y19B 2XTLA 1I8IA 1WF5A 3NFNA 2UWEE 4Y4KC 4X5XA 4BA8A 3BH8A 4OZHE 5J57B 1U6AH 4HXAL 1CDGA 4Q9BA 3MNVA 3QEGH 3C9NA 5EUOB 4RISL 4PJFF 4UZGA 3NPSB 5DT1L 4DEPB 3IGAA 4I48A 1A8JH 3QDMD 5C0BE 3GSNB 1ZWIA 1F58L 3D25B 4HLJA 5EUKB 2OXHA 3A6CH 1X5JA 4YHOL 3T77A 4J7RA 3OPZL 4BH8A 1FGNL 4Q74A 1MLBA 3ZE0F 4H25B 4O2EB 2J3SA 1CFSB 3T8XA 1AI1L 4XT1C 3IJHA 5JXAL 1H5BB 3A0OA 2FEDC 3KWWB 1PY9A 4EQ2A 1HXMB 4LRNL 3TIDB 3LQAC 5FGBA 1E4WL 1BQLL 1MFCH 4PYGA 4JPKL 2BCKB 3EJZC 3Q3GA 5E6IB 3SE3A 4L4TB 2LV4A 1D5ZB 4NZUH 5HDQH 5JHDD 4RNRB 3ARGB 1AD9A 3KHOA 2BNRD 3B9EA 3KHQA 4P46C 4QRRB 3F12A 4PREA 5DD3L 3E2HC 3S88L 2BC4A 5F89A 4FTVD 4HZLA 4CN4A 4JO2L 1AR1D 5IHBA 5CZVL 1DQJB 5D71L 5IMKA 1FG2B 3GKWL 1VGKA 4L4VE 3SE9L 2CXKA 2LVCA 4M6AA 2Z4QB 1OGAE 3FO2B 4QT5A 2MPAL 2BK8A 2BERA 4P4RA 4JFZH 1NLDH 4QRUB 1KJ2L 2CGRH 3DUUB 1LK2A 3BD4A 5EZOL 5KN5B 1N5YL 3R4DA 32C2B 3UEZA 3ZYOA 3BP4A 1IAKB 3H2WA 2KZ1B 2QHRL 3HMWH 1PQZA 3OKLA 1VACA 4ZUVB 4OD1L 1G7QB 5IVXE 3ROLB 1MJ8H 2DWEA 4NRXA 5D2LA 5KVMC 1P84K 3QUZC 3U6RA 4GQPH 1OAQL 5CSZB 4R90L 1F3RB 5E5MB 3HI5H 5C07B 4D8PB 2AABH 4M1DL 2VLRB 3MLXL 4AG4H 1T1XA 1IGTB 2HRPH 2L7JA 1BX2A 4JHZA 4MVBD 2E7LC 3I6GB 1QD0A 5HDLA 5FF6A 3L3DA 3P9LA 3UTSA 4MJIB 1KFAH 4JVWA 2DIBA 1ODAA 4CU6A 4LPUA 3O41A 2VDNL 2F5BH 3RP1A 4R97B 5IMOA 2KH2B 4KVCL 4MXQC 1NC4D 2IH1B 4JPIB 2EDFA 4Q9CA 3KXFD 3LKQB 3S34H 2APVA 1JF6A 1M71B 4OGYH 3V6ZB 4HWBH 4RGNB 2DQEH 1JYVA 4X80L 3EOBA 2DLTA 2G60H 1CWVA 2ICCA 3WUWG 2BNUB 5M94B 5BS0B 2IBZY 2XY1A 1DN2A 1WWBX 3OAUH 3IXTB 3BW9B 5KVGH 4IHOA 5KAQF 4OFIA 1MRFL 4IS6B 2BVTA 3X12A 1P84J 5J1TC 3FOLB 4PJCB 4QY8B 3DXAE 4K71C 4KTYA 5HHXL 1JN6B 3TA3C 4QHMB 3ARFD 4GRWB 1MCOH 3HB3C 1ZGLA 1XIWD 1WBXA 3EDEA 4I0PB 4YEEA 3R8QA 1XR9A 4UOJA 3U7YL 1AE6L 5KSVB 1OWRM 5EIIB 4Y19A 3TH2T 2MKWA 4M93C 5JW5B 4RX4A 4C54A 5EUOA 1BJMA 5KG9B 2KQMA 4LASH 1HI6B 1A7OL 1IAIL 4ODBD 3GSNA 3NCMA 4JHBA 3D25A 2OXGA 1HCFX 5CUSH 3P0VL 5EUKA 4GUPB 3QUMH 3IDUA 2Q76B 2VC2H 4M48L 2MCG1 3CLFL 4O2EA 1CFSA 2EEAA 4ZNCD 4XWGH 1A0QL 4YK4B 3W39B 1H5BA 1QSVA 2X4NB 4P2RB 3KWWA 1B4RA 1YJDH 5IB3B 1N8ZA 1HXMA 1LQSR 4NO3B 3TIDA 3V5KB 3NCFB 5HTSA 1M4KA 2YN5A 1V3MA 2FH6A 2BCKA 3BO8B 4L4TA 1UA6H 3VH8G 1DEEB 1D5ZA 3TIEB 4RNRA 4UIMB 3MRRB 3ARGA 4JCLA 2X40A 2PO6C 4R7NB 5IP4A 4QRRA 5K9KB 2GK2A 1NEZB 1R3KB 3HTLX 4XCCL 5DVOA 4DUXA 1DQJA 5BZWB 4POZC 2J12B 1FG2A 5FXCH 1OAXH 1FO0L 2Z4QA 4ZOBA 1BJ1J 5CEZE 4NGHL 3ZDZE 4QRUA 3DUUA 3WNPA 3P3YA 5DK0B 5KN5A 32C2A 4QNPF 1IAKA 3QHFH 4FXGB 5EH1A 4ZUVA 1G7QA 3ROLA 5FO9A 4G9FB 1QUNA 5JMRA 3FO1A 5I1KH 4GS7C 5ISZE 1OPGH 1I3GH 4OLYL 3QI9B 4TNVF 2NNAB 5CSZA 3TM6A 4J6RH 5E5MA 1DQTA 4PRID 4LLYB 1QLEH 5C07A 3RKPA 4D8PA 2W0FB 2VLRA 4BQBA 4I3RL 4OZGF 1IGTA 4FABL 4KK5D 3MUGB 3I6GA 1FPTH 1OAKL 2PKDA 4LEOB 2KPNA 1NLBL 4MJIA 4KK9D 4NKMA 5HD8C 4NDMB 3LN9A 3QJHB 5IMMB 4XP4L 1EHNA 4M1GL 4XPBL 4J3SA 4HPYL 3SO3C 2IH1A 4JPIA 4C4KO 3LKQA 3G6AA 4O58H 1CLZL 5HGDB 3RTQB 2WM0A 1M71A 4GMSH 3V6ZA 3D39E 4UDTB 4ZO7A 1PX3A 4WUKH 1NL0H 4J4PC 1SMAA 4J8RB 5IJKC 3ME0A 4R4FL 1S9WB 3QXUA 4BH7B 1MUJB 2AJYL 2GHWB 5FYJD 1MLCB 1INEL 1JGUH 3VWJD 3SKJH 2BNUA 1BEYH 3OGCB 5BS0A 1N6QL 5D7IB 1T04A 4BQ6A 3IXTA 3BW9A 2HVKB 2ATPB 4IS6A 4PY8I 3TT3H 4YEFA 4Q58C 1DVFD 2BXZA 3U9PL 3FOLA 3BGFB 4PJCA 4B0MM 3TFKD 3QT2A 1X5YA 1JN6A 2A6DB 2BOCA 2A9ML 4QHMA 3RWGB 5HXMA 1CE1L 4HMDA 5IB2B 3ZTJG 2Y6SD 4AEEA 4EOWH 3B2VH 1NGQL 5KSVA 5DQDH 5EZLB 3CLEH 3BP5B 4M6OL 4PG9B 5JW5A 4JPWL 4O5LH 1RULL 1L6ZA 1WZLA 3RWFB 2IPTH 1I9IL 4H1LG 1BWMA 2DYPA 3L9RB 5ADOL 4XP1L 1JBJA 5KG9A 5DI8B 4L1HA 4NSKB 1HI6A 1GIGL 3LV3B 5IJVB 4YGAB 2D3VA 1KXTB 1NAKL 1QFWL 4GUPA 1CGXA 3MOBH 4OFDA 4GSDH 4YC2C 3EYSL 1CVSC 5DHXB 4HIEB 1CGSH 4OIBA 3CK0L 2YOCA 4P2RA 4HAFA 2I26N 3TBWB 3NCBB 5IF0B 5IB3A 1FJ1B 3RY6C 4NO3A 3V5KA 1C12B 1YY9C 5ALCL 5DC9B 5FM8A 3MLUL 2W0PA 3BO8A 3O4OB 3HZYB 1DUYB 1QBLL 3TIEA 1H8NA 3MRRA 5GS1C 5HI4C 5DGRA 1NGXA 1FC2D 4X6CF 2EDJA 2QQNL 1NEZA 1R3KA 2QQKH 5DEZA 3RL2B 4U6XB 3VE0B 5GISL 2PTVA 5BZWA 3KPRE 3RPKA 3S37X 5GS0C 3ULUL 4QO1A 2C1PB 4M7LT 2DTML 2DWDA 2NY4B 3JWDC 3IFLH 4GRMB 5DHYB 1QHPA 5DK0A 5I2IB 1RMFH 1FH5H 1ND0B 3VMOA 3VXUE 4FXGA 1ZHKA 1YQ2A 3WIHL 5LXGH 4G6FD 4XB7A 3WIIH 4G9FA 3EUUA 5IW6B 3HZMA 2FNBA 5I1CH 1A6ZB 5D7JC 1TENA 1OARL 1RZFL 3QI9A 2BVQB 2NNAA 2VR9A 3HG1B 2NXYC 4KPHL 5KSUB 4LLYA 4OQTA 3UP1A 4HLZG 3N85H 2W0FA 5AZEL 5E95B 1QTYT 3NCEB 1IKFL 1HEZB 4GXVL 5FIEA 5F93C 3ZDXF 4KROB 3MUGA 4OBSA 1RI8A 4OSUH 1NFDB 2MQ3A 2V17H 4NDMA 3UYRL 1E27B 4RMWA 2JCCE 5IMMA 2YUVA 2OZ4A 2DQTL 3KS0H 4I4WB 4NC0B 4LNVA 2R8SH 3UTTA 3RTQA 3GSRB 4PY8J 1JV5B 4UDTA 4YFDB 2Q20A 3UAJD 5JOEA 4GOSA 1EFXA 3L5XL 4XPAH 3V4UH 4BH7A 1DE4B 1MUJA 1S7WB 1MLCA 1G9MH 2VDLL 1UADC 1A6VL 2DQCL 4YQXH 5D7IA 3G04B 2OM5A 4HS6B 2AGJL 3TA3A 5C0EB 2HVKA 2ATPA 5IQ7H 3FQXB 4WW2C 5I1EH 4IOFD 5DVLA 5KVEH 4U7KA 2A6DA 3RWGA 1MHHB 1YEKL 4PFEA 4HGWB 1AJ7H 5CHNB 3PWPA 1RZIB 4GKSA 2AK4D 5HGAB 5EZLA 4PRHE 3BP5A 1SMOA 4JM2B 1PJ9A 3ARZA 5KOMC 3MQIA 3EDFA 2VLKB 3ZKXC 3RWFA 1I1AD 3L9RA 1WCQA 5DI8A 3RAJH 4NSKA 4WFFD 3WYRA 3HC4H 3LV3A 5IJVA 5F1NB 5TE6L 1MNUL 4QHUB 3SPVA 5C71A 1JTOA 1F97A 4NPYB 4P5KB 3ABZA 2F54E 3HR6A 3MXWL 1GVIA 2Y25A 3PJSB 4JO4L 2G2RB 4U7SA 5LAXB 1TQCC 2V5YA 1B4JH 1R0AH 4PRBB 3U9UB 1INDH 3TBWA 4NCC1 1FJ1A 5DEGB 2PO6A 1C12A 1A22B 4LPVA 2XQBH 1T21B 3MRHA 2R2BB 4Z76A 3B9DA 1DUYA 3CDGB 2XZQL 3IS0X 4U2YA 3BSZL 2HKHL 1JI1A 4FG6D 3TYFB 1EJOL 5J7CC 4WWKD 4YWGH 3DPBA 1QKZL 1KN2L 4MJ6B 3MJ7B 3LEYH 4KJPD 3AMLA 3RX8A 2X7LB 1QP1A 1I7ZB 3VE0A 1DBJH 3U4BH 1FORL 3OMZA 4ZFOL 1WUNT 1ZVSB 1FC1A 2FX7H 5FYKE 3NA9L 3L95B 1IFHL 4RMQA 2ZCLH 2X4PB 1OSPH 1MI5E 2UZIH 1T1YB 1NMCC 4Y5XC 5FYJH 4GRMA 5DHYA 1EHXA 1JGVH 2C3XA 3H6JA 3BP6B 5C0RL 5I2IA 5JUEH 2ZUQC 2XTJB 3ZL4H 4MMXC 3GK8L 2VL4A 3EOAB 1LDPH 3LPFA 3BGAA 5I6XC 2M1KA 5C3TA 2VDML 3C87A 4KI1A 5IW6A 4N8CH 3OAZK 5L0QB 4LEXL 2R29L 1A6ZA 4TNWK 2J6EL 3QUYC 5T1LB 3BWAA 2BVQA 3UO1L 5D9SB 1U0QA 3HG1A 5B4MC 3EJYD 4QRSB 1E4XL 1C1EH 1J0HA 4OCMC 3O3BA 4JHWH 1DUZA 5L7XH 1PG7X 3PF2A 1MIMH 1NFDA 5HGBB 3CIQA 4OZFH 3QIUC 3MYZA 5I1GH 1N3NA 3KPSB 3O2VH 3PP3H 5I17B 4YHML 3ULVF 1RAMA 3LOWA 4BM7A 3NCJH 1V3KA 4I4WA 1MCNA 3VWKB 4MAYC 1YEGL 2Y5EA 3UBXI 5IESH 3SDXF 2J4WL 1JV5A 3TO2B 2NYYC 3BKML 2XN9D 5EZIH 3QULB 2YBRB 2EXWD 3FB6B 3O4LB 4WO4C 1DE4A 5T5FL 1G7JB 1S7WA 2CRMA 5EIVA 4PRPD 5F7EH 3W2DH 1CF8L 2ARJB 4HGKC 4HS6A 2NX5B 5C0EA 2B2XL 5GJTL 2FX8L 2D0HA 4TUOB 4I18C 2ZSWB 1WBZB 3GO1L 5JORB 3WEXB 2NLJB 2APTA 4YR6B 4EUPH 1E28B 3SDCB 1MHHA 5MP6H 4HGWA 1F11B 1TPXC 4XMKH 5CHNA 5EA0L 1RZIA 5HGAA 5BW7A 1N4XH 4WHYH 4Y7MA 4IRJB 1YJDC 3TVMD 2X1PA 4PIRF 2PW2B 2ZUTA 1OP5K 3T2PA 2B0SL 2VLKA 1FNFA 1Q9OB 4JO3H 2FO1A 1IGCL 1KTRL 1LP9E 2DQGH 4P3DB 5JA8B 1ZSDB 5CINL 2Q6WB 5IW1A 4KI5F 4XAWL 1MFDH 4PJ8B 5EU3B 3MO1B 3NPZB 5E08L 3LEVL 4QHUA 5A2JH 1YDPB 4OCWH 4P9MH 5C0NC 1IT9H 3LQAL 4P5KA 1MY7A 4OGAD 4LSVL 3RY6A 3WFBL 1FZJB 1BGXH 2NXZC 5L8KB 3NCYS 3P30L 2G2RA 4JKWA 5CZXC 1EVTC 5LAXA 2X4QB 4FQ2L 1YNKL 1UKTA 4PRBA 3U9UA 3N1GC 5T3XE 2IG2L 3V0WH 2B1AH 1KCSH 5B8CC 1CG9B 3BN3B 5LCVL 5TQ2H 4UNUA 1T21A 4YE4H 3REWA 2R2BA 1R3LA 1WFUA 3CDGA 2UYLB 3FFCE 4HQQL 4NQCD 3MRQB 4PB0H 5CP3H 3PWVB 4QOKE 2JJVA 3TYFA 3HNTL 5C0JB 1TNNA 5DHVH 1W72B 3R1GH 2QJDA 4MJ6A 3C5SB 2PTTB 5F1KC 3MJ7A 2YA2A 5I15L 2I9TB 3R0MA 2X9YA 3VXRD 2X7LA 5EUOE 1I7ZA 2VXSL 3ZE2E 3D9AL 5I74C 3O45B 4LSTL 1ZVSA 3UJJH 5F1OB 6CGTA 2X4PA 5GJSL 1T1YA 3S97C 4OCYL 3MBEB 5C08B 3BP6A 4A6YL 2B1HL 4LPXA 5KW9L 4W4OA 4LVEA 3TJHC 3Q6GL 1OOAA 4N68A 2X10A 3EOAA 3S4SB 4FN0A 2ZNXA 5CFHA 1OM3H 1NUGA 4XPHH 4CVZB 3RZCC 4RWYL 1M05B 4ODTH 43C9B 4L4TE 5FUCE 4OCRH 5T1LA 3TO4C 3V6BR 1QQDB 1V3JA 3BRGC 5D9SA 1KN4L 4LCIH 5GRYA 3KLAA 3FTGB 4QRSA 5F7DB 2FBOJ 4EXKA 4YXLH 4POYA 4HFUH 1I8LA 3NFSH 2QV2A 4YXKH 4KQ3H 4UI2A 1YA5A 2A6JA 3QCUH 5DD5H 3T0ED 3AXLB 5HGBA 2M8XA 1UC6A 1BQHG 3KPSA 1MQ8A 3EHBD 4JFDD 1GOGA 3LKOB 1OAUH 3I3EA 3KGRA 5IKCB 2APWA 3BPNB 4UT6L 3VWKA 4X7FC 2MCPH 5IHUH 4WEUD 4EIGB 4JM4L 2GAZB 3CC5B 2I07B 3TO2A 1IGML 3QULA 2D2OA 5I76B 1ZHLB 1AR1C 3FB6A 3GZKA 3ROOB 3O4LA 4JN2B 1G7JA 3RVUD 5K9JH 1HINH 1JJUA 4LKXB 1BQUA 4OAWB 4DZ8A 2UY6A 4OLUL 4R4BB 3BRDA 4A2MA 2FBJL 3LMJH 2NX5A 4S1RH 1QNZH 4AL8L 1WBZA 4MA8L 5JORA 3WEXA 1GRWA 2VLRE 3X3FL 4YR6A 5FUOL 1E28A 3SDCA 2P5ED 1NCBH 4K7PL 1FHGA 2YD4A 3ZT7A 1RUKL 2R69L 2XXCB 1YEJL 1CGUA 5E2UL 1PZUB 1U8LA 4IRJA 2PW2A 1QSFB 1Q9OA 2VZOA 4P3DA 4MAUL 4PB9H 5HHOE 1ZSDA 3CSPA 4KRMB 4MVBC 1X5AA 5FCUH 4RGNE 3C5JA 4TSAH 4Z78B 3MV9D 4W6WB 4WFHE 4HWEL 3EYQD 1Q9KA 4PJ8A 5EU3A 1BD2D 5E8NB 3DECA 3ES6B 1I3RB 5FM4A 3SY0B 1YDPA 1YPZE 3AMKA 4NIKB 3QPXL 4DW2L 3EYUH 1FZJA 4UUJB 2NY0D 5GGSY 3JWOH 5I9QC 2X4QA 1AIFB 3GBML 1J1OL 3CVHH 4ODSH 1AXTH 3OHXB 5HYFA 3U79A 1CG9A 1T3FB 4GRWE 4G7VL 4KY1L 5DWUL 3IFNL 3MRQA 3PWVA 3QHTC 5C0JA 1NC2D 5ACZB 2DLFH 1W72A 2ZJSH 3C5SA 2PTTA 2I9TA 1OD9A 2N7BA 5J06A 5C6WH 1XIWC 2X09A 3O45A 4N5ED 3BT2L 3B9KD 4UIKH 2IQAB 3K2UL 3KLHD 4YLQT 4NBXB 3K8MA 4MYWB 4S10A 3WSQL 3QISA 2OMNA 4ZSOA 2QTEA 4H0HB 4U0QB 3MBEA 1RUML 5C08A 4ZS6D 3QUXB 1KIQB 2DLIA 4MHHI 2CJUL 2Q3AA 4HIJA 1CK0H 3S4SA 4O4YH 3MNWB 1KJVB 1QA9A 1LK3L 3T0BA 1IMHC 4CVZA 2ICWB 43C9A 1T4KB 5ID1A 4Y4HD 5A2LH 1QQDA 4MA1B 3FTGA 5DUMH 5F7DA 1G9MC 3PXHA 5JHDB 3KG5A 2MTPA 2DIAA 4J3UA 3NIGE 5MI0B 1G6RL 1O0VA 1CD1B 2BNRB 3AXLA 2H9GB 5FGRA 1IBGH 2AKRA 3NACL 4APQD 1J5OH 5FUCC 4FTVB 4GLRH 1UM5H 1SY6L 2AJ3B 4R6UA 5IKCA 3ZYZA 5D2NC 3OJVC 2Y4SA 1A5FH 3MV8E 3KPMB 2GAZA 3CC5A 3DV4A 3AAZA 2LE9A 1A4KB 1ZHLA 1U8JB 3IKCB 2FATH 3ROOA 4JN2A 4OJFL 1HXYB 5D5MB 1BBJA 4XBPA 4FQIH 4PUBL 4NZTH 4OAWA 3QUMA 2H32H 4G9FE 4R4BA 1ULVA 4OB5H 1A3LH 1FZMA 1OL0A 1J11A 4L8CB 3SGKA 3D3VD 4RAUB 3FMGL 1JPTL 3P9WB 3M8OH 3JV0A 3C60D 2GQHA 5C6TL 5IROC 3NAAH 2XRAH 4DKFL 1ZOXA 1T1ZB 1NQBA 1NCTA 4OV5B 3VD3A 2ED9A 3TJEH 1Q9LB 1QSFA 1RFDL 2NTFA 1EV2E 5JIPA 3G08B 3V6OA 3K74B 4L29B 4K9EC 4KK5C 1CICB 1A21A 4Z78A 2UVFA 1NC4B 1P7QA 5SWZB 3KXFB 4JDZB 4KAQL 4KK9C 3L3GB 4AENB 3ES6A 4CN1A 3SY0A 2OL3H 3D18B 1ZKAA 1L7TH 2HA1A 4RFNC 4RMRA 3SDDC 2YKLL 1IC4L 4GFTB 4UUJA 5C09E 1E6JL 1S5IH 1GHFL 1NGZB 4JDVA 3CFBB 1AIFA 1JPFB 1N0XH 3IXAB 3OHXA 4M43H 1T3FA 3VWJC 3X11B 3HNVH 4G8GD 1J8HD 1MPAH 3ARFB 2P5WD 4HG4K 3CXDL 4NFBA 3TT1L 5GS0L 1A6WL 5ACZA 4KTDL 5IVZB 1DVFC 4G7YL 5AAWA 1I8KB 2IMNA 3LZFL 4JREC 3TFKC 1J1XL 1UWEH 5D7LD 3SDAD 1Z2KA 3I2CL 2FJHB 2AK1L 2IQAA 3B2UD 5FA3B 2CRYA 5FYLE 4DAGL 3BDXA 3QXAB 2EDRA 5CBAB 1WC7B 1CZ8H 5HDBF 4Z7UB 4M8QA 5CEZL 3STLB 3QUXA 1KIQA 3RI5F 2YXFA 1PDKA 4U1SB 4BKLB 1HYSC 4O2FB 3V52H 1NCWL 3NIDF 4PJAB 5I8KL 3MNWA 5E0QA 1MWAH 1KJVA 4U6VL 4Z7VB 43CAB 4DVRL 3QDJD 2ICWA 3BDYH 4PJEB 1JYNA 5LBSL 1TCMA 1T4KA 4U05A 4JN1H 4M02A 1AD0B 4ZNEE 2AJVH 4DOHB 3NOIA 4Y2DD 5JHDA 1U92B 4LSPH 1TZIB 3RGVB 5HVHC 4R26H 5DUPL 4BUGA 4HG4J 2FO4B 2AP2A 1CD1A 2BNRA 2H9GA 4HCRA 4PJ5B 3DHJA 3SOBH 1E4KA 4F9LA 4FTVA 5L88L 5HVFB 2AJ3A 3BPOC 5AD0B 3QEGL 3DBXB 1JWSB 4YUEH 3KPMA 2EO9A 1QBMH 2JJSC 1A4KA 1RURH 1U8JA 3IKCA 4JPVL 3KAAA 4V1DD 1DP0A 1W0YT 2OQJB 4KJQD 3BWUC 1DQQA 3A6CL 4GO6B 4N9OB 1EVUA 3AS3A 2WIMA 1P1ZB 4NZRH 1PVHA 1WQVT 4C83A 4RRPA 3TGXA 4Y8AA 2WUBL 3GSQB 1KNOB 3VI3E 4L8CA 4MQXD 3BKYL 4KU1A 1HSBB 4Z7WF 4RAUA 1GPOL 5MEQB 4KKBD 3QIBB 4MHHG 5INDB 5EPMB 1NFDE 4NZUL 2BRRL 4D94A 4PJDF 5T3ZE 1P7KB 3MXVH 2UUDH 5D7KD 4XCYB 1GYAA 1FFOB 2AEIT 1R24B 4OLVH 4OV5A 3RZWA 2AEQL 2VLJB 3VI4E 1OLZA 4EQ3A 2W9LA 5GGRA 4PBVC 4OIAA 4HK3N 5EOTB 1UM6H 3ILQC 1WTLA 1CICA 4PJ9B 1NC4A 2AW2A 5SWZA 5KANI 2O26U 1CDUA 3KXFA 4JDZA 3H3KA 3L3GA 2VUYA 2BNQB 2FLRT 4EI5D 3D18A 2ZUXA 1RUQH 2QL1A 1MVUB 4JFZL 1NLDL 2DB8A 3E0GA 2CGRL 2ZZUT 5FHAL 3RX7A 4XMPH 1NGZA 4XC1H 1BECA 1KEMH 3UAJC 2BVPB 5KJRH 1JPFA 1GJIA 2CK0H 3N9GH 3IXAA 2WWMD 2WUCH 5I8CB 4Z6AT 1W0WB 3X11A 2E3VA 4YHNB 2F8XC 5CKGA 4TSCH 3JV4B 5LQBH 3PDDA 3G5VA 3GHBL 3ARFA 1VFOA 2AAVA 2R4SH 4LU5L 4FFYH 5IVZA 4IOFC 2HRPL 1I8KA 2BRQA 2XZCL 4XXDA 2OS7A 4ZPVA 5SWSD 2MWCA 2D7TH 5LVEA 2DDQL 2FJHA 1U36A 4RA0C 4NQSB 5FA3A 4QF1B 2KKQA 1XF1A 3QXAA 1I4FB 2HFEA 1WC7A 5CBAA 1JUFB 5HVGB 5E8PB 3NA4A 3DSFL 1SBSH 1I1AC 1LDSA 4YDJA 4HWBL 2P46B 2DQEL 5GS2D 4U1SA 1JPST 3HCVA 4WIQA 4BKLA 2G60L 3QDGD 4O2FA 4K8RC 5CEXA 3NTCH 3DURA 1NCUA 1XF3B 3EKCA 2D7PA 4PJAA 5D1XD 3BMVA 2P42B 4Z7VA 43CAA 4WFEE 5H2BB 1AC0A 4PJFB 3A6BH 4BUHA 5HYEA 1JZ7A 4PJEA 2R39A 3PGDB 3TN0B 5I0DA 1R6VA 3VDAA 1AKJB 2A1WL 4F3FB 1AD0A 3FO0H 3GMRB 1ZEAL 4P5TB 4LBEA 5ESAB 1U92A 1TZIA 3GB7A 1MCOL 5FOBA 4GG6E 1MJUH 3VXRE 5D2NA 4PJ5A 2DMKA 2QSQA 3T0VA 3T2OA 1BPVA 4CBPA 1I3UA 3IDJB 3PWUB 4FG6C 1VPOL 3BZEB 1YYLH 4LGPB 1FNHA 3U1SH 5AD0A 4WWKC 2OI9B 5HYJD 3DBXA 5IG7A 3IVKA 1JWSA 1NDMB 2GJ6D 4NQDD 1REIA 4M7ZC 4LASL 3VFWB 1K4DB 1X4ZA 4S1SH 1ONQB 4F37K 1F3DH 4QRTB 4Z7QF 2B39A 2XTJE 1ZE3C 5IBTL 5CUSL 4NWUH 1WT5A 1P1ZA 1TIUA 1A1NB 4LDLB 3GMQA 3RDTB 1OP3H 1X4XA 3GSQA 1KNOA 1JHKL 2HG5A 4H8WL 1VKXB 2BY2A 5KS9B 4XVTH 4O9HH 2K7PA 3VG9C 5DJDA 1HSBA 1ZXQA 4P0DA 1DBBH 1U8HA 5LKNA 5MEQA 1F4WH 3CZFA 4PRIA 1TVBB 2HT2D 3CPLA 3JWOC 1UA6L 5EPMA 3OG6B 2ZNWA 5INDA 1P7KA 4XCFH 3KPSE 2DQJH 3LDBB 4HBCH 4XCYA 4UT7H 1FFOA 3HAEB 5T1DH 1R24A 3OKNB 3MGAA 3EJYC 1MELA 2KUTA 2OP4H 3ULUF 3BEWA 2VLJA 2HJFB 2A83B 3MX0A 4G80B 5EOTA 5IFJB 2X4UB 1AGFB 1JHTB 4PJ9A 5CJXA 1HHKA 2R2EB 2NR6D 3O4LE 1XAUA 4Y89A 4N1EA 2FD6L 2IFFH 2ZCKH 3V0VB 4L3ED 4BZ2H 4HF5H 4KGLA 5ICZB 3T1FB 1I75A 1C16B 3NZ8B 5E70A 2BVPA 3QHFL 3ZT5A 3VXOB 5I8CA 3RBSA 1EHLH 1MOEA 2VLME 1D5IH 5I1KL 2WAHA 4YHNA 3PXJA 3GI9H 3RBGA 2EYRB 3U46A 2C7UB 3JV4A 3O6FD 3MRKB 1YNLH 2CUMA 5E9DD 1QLEL 1S9XB 3OX8B 3HPLB 3B6SB 2XG4A 1DZBA 4QEGA 2WANA 5DFTA 3MMEB 3SQBA 3UPCA 1FPTL 1OT2A 1S7XB 2LU3A 4MD5B 1KPVB 2R0LH 4J2XA 1LE5A 4NQSA 1H9VA 1UT9A 4QF1A 3QJFA 7FABH 1BD2E 3ZKQD 1RZJL 4CMHC 5HYSG 1JUFA 2Y06H 5E8PA 3FL7A 4O58L 3LKNB 1MFEL 5J3HD 1BFVH 4GMSL 1TDQA 4M4PA 1U8KB 4WUKL 1NL0L 2H2SD 4G6KH 2J8UB 2Y9RT 2V6HA 3TF7C 4BK5A 2VAJA 1KCVH 4NNPL 3MRJA 1OTUD 4DQOH 3SKJL 4HT1L 1U3ZA 2AEWA 3LD8C 5H2BA 4PJFA 4DWHA 5H35B 1MHEA 1CLYL 4OGAC 3C8KA 1X44A 3PGDA 3TN0A 3QO0B 1AKJA 3TT3L 4F3FA 3MLRH 1RZGB 3GMRA 4HKJB 4IRZH 1KTKE 4P5TA 5BRZD 1HIMH 5DYOB 3WJJA 5ESAA 4U6TA 5T33L 4NO5B 4EOWL 3B2VL 3OKMB 2P49B 3FCTB 2D31B 3CLEL 2JJSA 4EDXB 3PWUA 3MLVH 4O5LL 1LO5B 2IPTL 4MD0B 1F6FB 1QSEB 3GI8H 1NDMA 5F9DC 2J8HA 3TZVD 3VD5A 3DX6A 3I6LE 3VFWA 5JNYB 1K4DA 3KJ6L 1LD9B 4K07A 4OCSH 1A9EB 1ONQA 4UQ3B 4XNXL 1Q0YH 4R2GC 3G6JE 4RMSA 1X7QB 2OTWB 5KBNC 3RVVD 3BKCH 4J3VA 4GSDL 1A1NA 2BY3A 1L0QA 3RDTA 5I1LB 2R4RH 3FN9A 4OZFG 2QSCL 3C5ZC 1G7PB 3G5XB 1UB5B 5KS9A 5A2IH 1X5LA 2YK1H 4WJ5A 2NY2D 2VAAB 1PSKH 4LK4A 1R3IL 1CD0A 4YXHH 2RQ8A 2X89A 1EZVY 3VXSD 4XGZB 4P2OB 5CIPB 2H2PD 2ITCB 3BZDA 5GGTH 5GRVK 3HAEA 5K9OB 1L7IH 4BFBD 1IQWH 5DHVA 4Z18A 3V4PH 4AM0B 2HJFA 2A83A 5DS8B 5IFJA 3VJ6B 2X4UA 1JGEB 1AGFA 1JHTA 1VGEH 2HTLD 2R2EA 1WK0A 5FM5M 4U1GB 1U3HB 5GS2H 3EHBC 4OZGB 3V0VA 1BWWA 5FO8B 4JZJB 2OLDA 4M9PA 4EUPG 5ICZA 3T1FA 1B9ZA 4L9LC 1C16A 3NZ8A 1RMFL 2Q3ZA 1PW3A 2CKBB 1I1RA 3AY4C 4PRPB 1R5VB 1FH5L 3WS3B 2VZVA 4F2MB 4JDTH 2FCBA 1Y6KR 3BESR 4WHYG 4MNHB 5T3XL 2WIIB 5LXGL 1DN0B 3VXOA 1Q94A 3BHBB 3WIIL 4HKXB 5J12B 3B3IA 5I1CL 4P4KD 2EYRA 1S5HB 1BIHA 4DVBB 3MRKA 1T0PB 4X7DC 1S9XA 4MS8D 3N85L 3OX8A 3PWLA 4Y4FD 3B6SA 1QSFE 2WBJC 2AK4A 4BFEA 5LWYH 1N5AB 2GSIB 1FVEB 3MMEA 3FQRB 4MD5A 5J13C 3JTTB 1KPVA 3T4YB 1QZ1A 1ZA6B 1YECH 3VMNA 1I1AA 4FMFA 5GGVH 2BHYA 4YIQB 4X8JB 4WI4A 4HGMA 5DFWH 2NY1B 2ESVD 2F74A 2R8SL 3E8UH 4GLRI 3LKNA 3PG2A 5BQ7A 3F7RA 1OB1B 1U8KA 2C3WA 5AWNH 2J8UA 4XPAL 4MA3B 1J12A 3L1OH 1T2JA 1XF5B 3U30B 4LHUD 1G9ML 1A02N 3OPZH 5DK3A 2H8PB 5DJCA 1HSAB 3KYKL 5H35A 3G9AB 1AI1H 4LAQL 4U31A 5JXAH 3S5LB 3AB0B 3QO0A 3V2AR 5I1EL 1RZGA 2VB5A 2I25N 4JB9H 2AXFB 5DYOA 1UJTA 2FX9H 3EYOB 2VSCA 2IAND 4NO5A 5D1ZD 1FZOA 3TESA 2C3HA 4O2CB 4WWKA 3OKMA 4QTIL 3H9SD 1CDBA 3S35L 5J0BA 3FCTA 2D31A 1FDLL 3QA3B 2QSTA 1FL5A 1RJCA 1XGTB 4EDXA 4NN7B 1AGBB 1LO5A 4N0YL 5DD3H 3U4AA 2MQCA 5GGRY 5EU6B 3DRTB 2IBZX 4MD0A 4KVNL 1QSEA 4JO2H 4NO2B 3NBNA 2FL5B 3RAJL 2EC9T 4HBQA 5JNYA 1LD9A 3HC4L 4RBPH 5CZVH 5D71H 1A9EA 4UQ3A 2Q87A 3MUHL 1QR1B 3QFJD 3B9KC 4X6CB 1X7QA 2OTWA 1FSKB 3KLHC 2C3GA 5C0CE 2OTPA 1KJ2H 3K4DA 3WNOA 4NNXB 5I0ZA 5EZOH 1V3LA 4XAKE 5I1LA 4JZNB 4ZXBC 4PLKD 4ZS6C 5EC1B 1G7PA 3G5XA 1B4JL 1UB5A 1R0AL 1INDL 4IMLB 4K3GA 3IS1X 3IJSB 2BX5A 3CAFA 4K9EL 4ODUA 3LAFA 3SDYL 4R90H 4XGZA 4P2OA 5CIPA 2Z8WC 4IM8A 4KJWD 3QSKB 5I73B 4Y4HC 3V8CA 3LS5L 3KYMB 3MLXH 5K9OA 3T0EB 1T7WA 3TLRA 3Q5YA 1KIUA 4YWGL 2FB4H 2DM2A 2AJSL 5EU4B 3SE4A 5BVPL 4AM0A 4JFDB 1ACYH 5DJXB 3LRGA 5CILH 1DBJL 1JGEA 1M7IB 2FX7L 4APQC 5AUMB 2VDNH 3MV7B 1U3HA 3X3GH 5D5ME 2ZCLL 2R9HD 1OSPL 2UZIL 3X17A 5FO8A 5LGKA 3SCMD 1JGVL 3UTZB 5EOCL 2CKBA 4KRPB 3HN3A 4PRPA 4JKKA 1R5VA 4F2MA 2ERJC 4OLXL 4N90E 4S0TD 5L9DH 2WIIA 1DN0A 1LDPL 2WQRA 2WW8A 3BVNB 1WBYB 1J87A 2C4XA 4HKXA 3OR6B 4Y1AB 1J1PH 1MWAB 4N8CL 3WFZA 3V7MA 5GGQL 1S5HA 1K8IB 1QFUH 3AC0A 3DX8B 4TUKH 1NKOA 4DVBA 2X9XA 1ED3B 4MJ5B 3GMLB 1QRNB 4NN6B 5FB8B 1EK3A 2L0DA 3DROB 2E7HA 5L7XL 2GSIA 1FVEA 3CMGA 4YBLB 3TVMA 3FQRA 3JTTA 3T4YA 1CIUA 1U8PB 1TTGA 3C60C 3O2VL 1J86A 4YIQA 3HHRB 4KK8C 2ED7A 4X8JA 4AQ1B 4WV1C 1UH4A 4X9IA 5D7IF 4MCYB 4J12A 3P9MA 4GT7A 1OB1A 3BFOA 5CJBA 4R0LC 4XXCC 4MA3A 2A0LD 3P0VH 1XF5A 2NY0B 3SGEH 3AFLA 4M48H 4KXZH 2EEDA 2H8PA 1I9JH 3BH9B 1HSAA 1A0QH 3S5LA 3DV6B 3UPAA 1BZ7B 1FCCA 3DYMA 3UTOA 4LGRB 2AXFA 3Q1SL 5BOZG 3EYOA 5DFVD 4PGBB 3PDGA 4U3CA 2V5TA 1R5IB 1UJ3B 5MP6L 4FQLL 1MFBH 4CAGA 2VWEE 2DQHH 4XMKL 1I1CA 3KJ4B 5SWSE 4ONFH 1N4XL 3EW3B 3PL6C 3ZSSA 1YNTB 2BSRB 3QB7C 1OT1A 1XGTA 1AGBA 1K3ZA 1RVFH 5CWSB 4LPYA 3DRTA 3DYOA 4JO3L 4Z7UE 4XCCH 2FL5A 3U7WH 3L5HA 1D9KD 4WWID 4IRSB 4Q6YA 4UQ2B 1MFDL 1F3JB 3MGTB 4Z7NE 4M6MH 2WWKT 4CUCA 1FO0H 2A38A 1QR1A 3VGGA 4D0BB 1KTDB 3B2UC 4X6CA 4P9ML 4PJIB 4PJGE 4N1CA 3IAGC 4XP5H 4NNXA 1BGXL 3AREB 1P4BH 1U3JA 4RA3A 4JZNA 5F7UA 4IMKC 5EC1A 2AEPH 5H8DA 4DOHE 4IMLA 3AM8A 5SX4H 5CKAA 4HV8B 1G7HB 1G0DA 2IQ9H 3IJSA 4NOFA 5TQ2L 4K3EH 4GRLD 3MFFB 4RMTA 4OLYH 4PJ5E 1YYMH 4OFPA 1A14H 2H6PB 4EVNB 3WDJA 3KYMA 4F15C 3T0EA 4I3RH 4Y0GA 5FYKU 1NCNA 1D6VL 4YGVB 3OL2A 2OZ4L 5EU4A 4Y2DC 4JFDA 5DJXA 4JFXB 1S9VB 2NW3B 4M7JL 2ADIB 2EC8A 1M7IA 1YMMB 5TFSL 5EN2B 4LRIA 4N8PA 2VDKH 2DM7A 5AUMA 1NEUA 4LIQE 2BXYA 4HIXH 3LKPB 3CH8A 4X6DF 4LLDA 1P4LB 4S1DD 1CLZH 2ZUVA 5IVXF 2MHAB 2DLEA 3UTZA 3HUJB 3ILPB 4MNQB 4GAJH 2C1OB 3PGFH 2Z91B 4R4FH 4ELMF 1KC5L 5C8JB 2AJYH 3MR9B 1INEH 3BVNA 5I8OH 4KJQC 4X9BA 1N6QH 4XPHL 4P23D 3OR6A 2MSPA 4Y1AA 1AY1L 1MWAA 2UUDK 4HUXB 3SDXB 1FV1B 3RUGE 4YPGA 4ODTL 3W0WD 1K8IA 1TQBC 4OCRL 3DX8A 4KMQA 2P5EA 2DI8A 4IIQC 1ED3A 3U9PH 4LCIL 3GMLA 2V9TA 4MQXC 1EBPA 5FB8A 3DOSA 4MA7L 1L9MA 3NFSL 5I30H 1S9YB 1U8NB 2VLJE 3FRPA 1QPXA 3QCUL 5DD5L 1NGQH 4KKBC 4EN3B 3V5HB 4OT1H 1U8PA 3LRHA 5JR1H 1WLHA 4JPWH 1L6XA 1EEQA 4K8RL 3GMNB 2GTWB 1OAUL 5FYLL 4JFFD 5FEBA 2BNQE 2VDRL 1MCWM 5ADOH 1MVFA 2MCPL 5IHUL 2VH5L 2DQFB 5GRVL 4MCYA 4LCWE 3HMXA 2GJZA 1K6QH 4ODHH 4G6MH 2BVOB 1NAKH 3CFCH 4QWWD 5MEND 1QRKA 3OGOE 1HINL 4ZTOH 35C8L 5F71A 1KOAA 4EI5C 3BH9A 4XHJC 4HK0A 3LMJL 3RPIB 3LQZB 4S1RL 3PQYD 3NVQA 4CJ0A 1BZ7A 4HC1A 1QNZL 3ARDD 3VGEA 4WNQB 2AERT 3HRZA 5ALCH 1J8HB 4TNWF 5E9DE 3E3QE 1A6TB 4PGBA 4PJ7B 4OGXH 1NCBL 2WWMC 3C2SA 2P5WB 3GKZA 5F9JB 1R5IA 2O5XL 1NC2A 1T66D 3RWHA 2E9JA 2F53B 1GGUA 1T03L 4GJTB 2BJMH 3VGDA 1YNTA 2BSRA 3DMMC 3SDAB 3H3PH 1JI2A 4KRNA 1IEBB 2QQNH 5ESQB 5CWSA 3BPLB 3O2DA 1A6AB 3B9KA 4ERSH 3LCYA 2WSKA 1H8OA 4TVPH 5HBBA 5IFAH 4OFYD 4TSAL 2V7NB 3G5ZB 3MGTA 1KTDA 5HGHA 2EH8L 3WS6A 5DD1H 4PJIA 3QZWB 4U1JA 2JLLA 3EYUL 5SX5H 3DNKA 2FLBT 3RNKB 4PJFE 3VFNA 1MQKH 4ENED 1JZ5A 4MXWL 1P4IH 5KOVC 4FQJL 4ODSL 1AXTL 3SKMB 3V6FB 3RWEA 4K94H 2JELL 5D4QA 5EORH 5BRZE 1G7HA 3L5WB 4WFGE 3B43A 3VDBA 1UZ8A 3ZE0E 4HH9A 3MFFA 3RVTC 1WZ1L 1RZFH 4G6AC 2ZG2A 4PP1D 1H15B 3GDBA 2YA0A 5T3ZL 4KPHH 1KG0B 2DLFL 5CMAB 3P0YL 4YGVA 1A6UL 3RL1B 4YHYB 4R96B 4JFXA 1S9VA 2NW3A 5DA0B 3MLWH 2N7AA 2BMKA 2ADIA 4UIKL 1YMMA 5EN2A 5D1QB 5D6DC 4MNGE 4G6JL 3TNNB 2P8MB 2OYPA 5C9JB 2K3TA 5ABDE 1P4LA 2EKSA 1OP3K 4GBXB 2FIKB 3MSPA 1EO8H 3HUJA 4MNQA 3VXQB 5H94B 2C1OA 2DS4A 2EDEA 2DKSA 2Z91A 3L5XH 4FQXC 3MZTA 5DZOA 5EU5A 3MR9A 4TYUA 4JQVA 1CK0L 2YUZA 4WUUB 1A6VH 3OR7B 3OB8A 2DQCH 3QUZD 2AGJH 4HUXA 2VITA 1FV1A 3ZMRA 1MIEH 4Z95H 1A7RH 1D5BB 1WAAA 4ZUUB 5C0FB 3FT4B 4CVUA 4G8FB 3O9WB 1S9YA 2CK2A 5J6HB 5CGYD 2CSPA 4JQXC 1IBGL 1J5OL 4JZOB 3V5HA 2HT2C 1LWRA 1OTSC 4HIIB 1F3DJ 4RSVA 4NQED 3GMNA 2GTWA 3S36H 4PV9B 1RUPL 2EDQA 3P2TA 1NCDL 4UV4H 2FECI 5T1KB 3MV11 2DQFA 4NUGL 1BAFL 1A5FL 3CNKA 4P59H 4FZ8L 1AO7D 3QWOB 4Y5VB 5TE6H 2CUHA 2UZXB 4BQ9A 2FATL 3UTPD 5DJ6B 2BVOA 1SQ2N 3HE7C 2NR6C 4LVHB 3PGCB 4FQIL 2NMSA 4BFIA 3NIFF 5IR1B 3I6KB 3PWNB 1A3LL 3RPIA 4OKVB 3LQZA 5EZJB 4H20L 4WNQA 1CFBA 3BI9X 5TPWL 1J8HA 3DI3B 5D7SH 1A6TA 2VSDA 4PJ7A 3C08H 1B2WL 2P5WA 3MREB 4CW1B 1B0GB 1RIHH 2XZQH 2F53A 3NAAL 2EYSB 2XRAL 3QQ9D 5DTFB 3DUSB 3HS0B 4LVNC 3SDAA 3BX7C 5D93B 1TTFA 1IEBA 5ESQA 3E3QC 1A6AA 3E1F1 3QEQD 5K9QI 4ZUTB 2V7NA 3IKKA 3VFVB 1JPGB 3FQUB 3HC0B 4PJBB 4V2BA 3G5ZA 4OD2B 3NA9H 2CIKB 2OL3L 3QZWA 1L4IA 1L7TL 1ZT1B 2I60H 5L2KB 3QDGB 1MSPA 4N0UE 1RU9H 1NSNL 3P73A 4JJ5B 3QP3A 3RNKA 4PYHA 3NMEA 4UBDD 5C0BD 5D1XB 3MJ9A 3RY4A 1S5IL 2CD0A 5J3HC 4RZCB 4HUNB 1MCWW 2BDNL 3O11B 3R06B 3TEUA 5ILTH 2H2SC 1N0XL 4KZDL 3T04D 4HDIB 4P5MB 4X9HA 3SKMA 5AAMA 3JV6B 4OLEA 1XR8B 2VDMH 2GSGB 1OTUC 2P24B 3L5WA 4JANB 4Y16B 3VXME 4LEXH 2P8LB 2R29H 4YDLC 3DYPA 4OF0A 3HNVL 2J6EH 4DN3L 5C2UB 3QNXA 5C2BL 1H15A 3UO1H 5J1AA 2HJLB 1E4XH 1ZAGA 3DX7B 1JRHH 5CMAA 4NN5B 3IDYB 4LF3A 1OP9A 3K0WA 3RL1A 4R96A 3WMSA 5JXEA 1UWEL 3FQWB 5IK3B 4DUVA 1AGDA 1NAMH 3VRJB 1NGYA 3GJFH 3O6ML 2CRZA 4YHMH 5EO0B 3HI1B 5KSAB 1BFTA 3GFUA 5KSBE 3TNNA 2GJ6B 4NQDB 2OTUB 3KPQB 2P8MA 4U1KB 5C9JA 1CZ8L 1MHPH 1P7HL 4GBXA 2FIKA 2J4WH 4V1DA 4LVOB 2HT3D 1VADB 4L4VD 3TZVC 3VXQA 5H94A 3ZKSD 3FQNB 3FB8A 2V2TB 4I2XB 3V52L 1OGAD 5T5FH 3E6FB 3VW3H 1FL6B 4OV6F 2BHZA 1KB5B 3OR7A 1CF8H 3WJLC 3BDYL 2ADJB 4MMZC 5T5NG 2JF1A 1B0RB 2AXJA 2B2XH 5GJTH 2FX8H 4JN1L 4QNPE 1D5BA 2AJVL 5C0FA 2DM4A 3LEXB 4G8FA 4XMLL 5EFIB 3QDHA 3O9WA 2R0ZL 1G84A 5A3IC 1NDGA 3CUPB 2JCCF 3ZE1F 2CKNA 4U0RB 5F88B 1GL4B 4JZOA 4X4XB 3V9FA 1U8OB 3LKRB 4N8VG 1RJYB 3BYTA 2FIRT 4L5FL 1C7TA 2H2PC 4OZGE 2V2WB 5T1KA 5D96B 4J4PD 5DMYA 5CINH 4TVPE 4YUEL 4XAWH 1QBML 3WFHB 3QWOA 4G9DB 4Y5VA 4DFIA 5HHQB 4EZMA 5DJ6A 3LEVH 3BD5A 2UY7A 2H1PH 3PE9A 4HX1A 3WN5B 4PJHB 4YNYB 4NZRL 4LSVH 5F9WB 3F7YB 3P30H 3I6KA 4NQTA 4OKVA 4Z7OF 2VL5A 3CX5K 2QADB 4GKZA 3MRLB 5IOPB 1U2CA 5EZJA 1S78D 4HFWB 4RCAA 5E4EB 3O6FB 1RZKH 3MREA 4CW1A 3LN5B 1B0GA 3OB0H 5DC0A 1ZHBB 4P4KC 3DXAD 5DTFA 2Z31B 3HNTH 5BO1H 4LDEB 1VCAA 3QHZH 4HJ0D 4OLVL 4KDTA 4L8DA 4Y4FC 1IAMA 3F5WB 4ZUTA 3VFVA 3HC0A 1JPGA 1X4YA 3FQUA 3MLYH 4PJBA 3EYVA 4OD2A 2CIKA 2MQ0A 4OCLC 5L2KA 1ZT1A 3TYGH 3QDGA 4WHTB 1HWHB 2Q8BH 2WMPA 2Q1EA 4JJ5A 5KZCD 3W5NA 2R0WL 3CU1A 5D1XA 7CGTA 5KW9H 4XMPL 4LQ1A 4XC1L 4RZCA 3CFJB 3Q6GH 2GW5A 5K59E 3O11A 4PGCB 2CK0L 4HDIA 2EDBA 2VO5A 2WUCL 3JV6A 5E6YA 1TZGH 1XR8A 3CX5J 2GSGA 5IFHH 2P24A 4JANA 4Y16A 4ZAKB 1VFBB 1HILB 4QRQB 4TSCL 5LQBL 1KN4H 2J7LA 5BV7H 2R4SL 3DX7A 1N6VA 5D6DA 1JF1B 2NY5H 4RBPK 5EU6E 3W11D 2ENYA 3FQWA 5IB1B 1JWUA 2D7TL 4LP4A 3VRJA 5GS0D 9CGTA 5D1ZC 5C0AD 2ZG1A 1P9MC 5EO0A 1KXQE 5KSAA 1SJEA 1Z9SA 2GJ6A 2OTUA 3KPQA 4NQDA 4HUVB 2O61B 1JNJA 4X6CE 3MPCA 5A1AA 5LGHH 1SBSL 1IGMH 5JDJA 1C5BH 1ZTXH 2V2TA 3FQNA 3FO9A 2YWZA 3E6FA 4AK1A 1FL6A 2ZKHL 1VESA 1P6FA 3ULSB 4OLUH 4MQSB 3A6BL 1F02I 3SGEI 1HH9A 2ADJA 4LSQH 4LCCB 4W81A 2NY2B 1B0RA 4KXZI 1SEBA 4JQXA 3QIWD 1PKQB 3FO0L 1ZT7B 3LEXA 4MA8H 5EFIA 3X3FH 3U4EB 3WLWD 5ISZD 1TJIL 3BGMB 4JFQB 3CUPA 4K7PH 3N0PB 2R69H 5DZLA 1CD8A 1EGJH 1YEJH 4X4XA 3LKRA 5DURD 1RJYA 1OHQA 4XC3H 3SQOH 3MV7E 4KJWC 3AVEA 4U1HB 3U1SL 4MWFB 2JIXB 4S1SL 4PJDB 3WFHA 5I1DB 4G9DA 4L3EA 4M6NH 5HHQA 2XKNB 1JK8B 1I1FB 3O8XC 5FV1L 5HHPB 5HHMB 4K7PX 3L3OB 4PJHA 3D39D 2HMID 5DZNA 4YNYA 2VERN 4Y1AE 2R9HC 5ITBH 5L6YL 3SCMC 1KJ2A 3T2NH 3MRLA 3OKDA 5IOPA 1PZ5A 1I7UB 4H5SA 3GBMH 2OR8A 4HFWA 1QRNE 4M3KB 1N7ML 1DBBL 4PPTA 3O6FA 1F4WL 1T2QH 5SX4I 4KY1H 3CJJA 3LN5A 2EDNA 4ETQB 3IFNH 4CJ1A 1ZHBA 3QXWA 4XCFL 1CR9L 2XZZA 1C7SA 4HBCL 2Z31A 4GH7B 4UT7L 4DKEH 3BISA 5T1DL 2Q86B 4K94C 5DJ2B 3B4NA 4PS4H 4F7TB 4UV7L 4TQEH 4LSUH 3BQUD 2BOBA 5ANME 2XFXB 2ESVB 3OWEA 3K2UH 1H3GA 2VZUA 2QKIB 1YEDA 1LO2L 2GCYB 4E0RA 3WSQH 1SJXA 2EZ0D 5MENE 2IAMC 4BZ2L 4HF5L 1S7RB 1W8OA 4WHTA 3UZQA 1YMHB 4KKLC 1U58B 2O5ZL 3CFJA 2HFGH 2VN4A 2D0GA 1MAML 3SO5A 3WV0A 5CP7B 3T08A 2A0LC 3UZVB 1LK3H 1EHLL 4OLWH 1D5IL 4MD4A 4ZAKA 1CBVL 1OQXA 1VFBA 3OJ2C 1HILA 1A9BA 2IANB 4NFDA 4LLUB 1YNLL 1FNEA 3HA0A 2G9HA 4C57C 4HWUA 4NUJB 3RVXD 4LNRA 1JF1A 3H9SB 4F57L 3FOMA 3MBXH 5IB1A 4C58B 3NACH 3MLSL 5J4MA 2R0LL 3Q6FB 2RGSA 4X5XB 2OMBA 3TZVA 2GJJA 4HUWB 4HUVA 2O61A 4RDQG 4PJAF 3ARBC 1DL7H 4Z7VF 3QFJB 4BSWB 4PJEF 3KPRD 3WJLA 4Q6IC 4G6KL 3MV01 1RD6A 4HUUB 5EBMB 3L6FB 4U1LA 4DQOL 3A6OA 4PUBH 2XWTB 3ULSA 4MQTB 3RX5A 1XGYL 2LQRA 5CJOL 5JW4R 3QUYD 4UAOC 5EB9A 4LCCA 1CU4H 3VXUD 4G5ZH 3I84A 5I75B 1PKQA 5B38G 2F15A 1MJJB 4IRZL 3D2UB 3FMGH 1KT2B 2XY2A 3U4EA 2FDBP 1JPTH 4JFQA 3QIUD 5IBUG 5E7BA 4UILH 4TOYH 5M7QA 4NC1C 1G9NL 4GRLC 3QWRD 1RIVL 4CADB 2E9IA 3FAWA 3P77B 2NY3D 3WLBB 3WUWB 4I3SH 4U1HA 1LVEA 3NGBC 4MWFA 4DGVH 2JIXA 2NZ9D 5EU7E 4NQXB 4OCSL 4WO4D 5AEAA 5I1DA 4PLNC 3WFEH 5IMKB 3ULVE 1Q0YL 1VGKB 1JK8A 1I1FA 4KDVA 2NY6D 3WXVL 3VRLE 1FO0A 3L3OA 2P48B 2HVJB 2YKLH 3JWNC 4HS8H 4I8DA 2I24N 3SDXE 4S1DC 1T89A 1KENH 1GHFH 2R4RL 3VGFA 1I7UA 3IDNA 4XPFH 1TJGL 2YK1L 3QQNA 1PSKL 4NRXB 4ZODA 4YXHL 4P23C 4ETQA 1QBAA 4NQVA 4F9PA 1KGCE 1WCBB 2LFGA 4X7TA 3CXDH 4PJXB 1ADQL 4KTDH 2VZSA 5GGTL 2Q86A 1C08A 1L7IL 1INQB 4F7TA 5HHNB 1IQWL 3V4PL 3O2WH 1BREA 3I2CH 1YPZF 3P9LB 4PRHD 2RCSH 1FYTB 4XNZB 2XFXA 2VZ1A 2AK1H 1V7NH 2ESVA 1VGEL 1AO7E 5JZ7C 4PG2A 4NO0B 2VISA 5FGCB 4DAGH 3LVEA 4XTRD 5GRJH 3C6LC 1KSRA 1S7RA 5TJWK 3VH8B 1U58A 2O5YL 4KI5E 3WCYA 1IAOB 3VGAB 1UCTA 4JDTL 4DK6A 2DQDH 2EDYA 4XNUL 2F54D 3FAXA 3P40A 4U6VH 4WCYL 4XNYL 4DVRH 3CFDB 4TNVK 4IHOB 3F7PC 3F65A 2IANA 3L5JA 4LLUA 5F6IB 1D5XB 3ZDYF 2Z8SA 3GEWB 4NUJA 3ARDC 3H9SA 1ZGLB 3BZ4B 5HY9A 3SGJC 1PFCA 3TPKA 1YECL 3Q6FA 4ZDHA 1T66C 4OM1L 5L88H 5GGVL 4HUWA 5SX5K 4YHKH 2PXYB 4LIQL 1D9KB 4OF5A 3LHPH 3E8UL 1BOGB 1J0IA 3QFJA 4BSWA 3TJHD 3E6HB 5FYKD 2FJGA 4JPVH 3QAZB 5AWNL 4HUUA 3GRWH 5EBMA 2JJUA 3L6FA 1UACL 3BMWA 4HK3J 1MI5D 3L1OL 3U7AA 3RZCD 2XWTA 4MLSA 1F2XK 2BVYA 4X7CC 3TO4D 1MCCA 1ZK9A 2EE6A 5F72S 2WUBH 4U1MB 3PDOB 3BKYH 2Y36H 1MJJA 3D2UA 4YZFF 1N8ZB 4JB9L 4ENEC 2FX9L 1KT2A 1FE8H 1GPOH 3F58L 3GM8A 3JXAA 3I9GH 3WHXB 4M7LH 2BRRH 4LHUG 4CADA 4FQ1H 4PP1C 3OXRA 1YQVH 3P77A 2AEQH 3WLBA 3WUWA 1RZKC 3UPRA 5DRZB 1TFHA 3SGDH 2CLZA 4NQXA 2ZSVB 3C09B 2F5AH 4ZFOB 5KS9F 4H0IA 2JKXA 4EJ1C 4MQ7A 1W2KT 4WUUE 1DBAH 2HVJA 3QPQD 4P2YA 2P47B 5A2FA 4WI3A 2W0LA 2GTZB 5EU7C 5FHAH 4BYHA 1EEUA 5J11C 4DTGH 3K8KA 5F3HB 3RWDB 1U95B 5F7YC 4GKOA 4QRPE 1IILE 1VEMA 5FO9B 3WIHA 3S6CA 1AGEB 4H1LB 3EOYG 3FO1B 3UJTL 2E9BA 4JRYB 1JZ8A 3GHBH 1WCBA 2HT4D 1FIGH 4LU5H 4PJXA 1JZ4A 3ELAT 1INQA 1SEQL 2FB4L 2XZCH 5HHNA 4Y5YC 3U2SA 1HZHH 5DD6B 1E4XI 1ACYL 1JRHI 2Z8VC 5ECJE 5CILL 1FYTA 2DDQH 4NKMB 5DD0H 2IH3A 5CGYC 4E41E 4EN3C 5BV7C 3ALXA 5MEPB 4NO0A 5GGVY 1GC1H 3GJFB 2GEEA 3X3GL 1QHOA 1WWAX 4KTEH 2C3VB 2LVEA 2NY5C 4YH6A 4RFOL 1HE7A 3G6AB 4AQOA 3DSFH 1MFAL 1EXUB 3VH8A 2LTQB 1IAOA 5KVDH 1F4HA 2YMXH 4XVJH 2EC9U 5L9DL 3PQYB 2J5LC 1J1PL 1ORQB 1T04B 1HKFA 3CFDA 1CLOL 4GW1B 1QFUL 4KI5C 5T3XD 4LSDA 4TUKL 2A1WH 4NBYB 3OKEB 2KDGA 1D5XA 1ZEAH 3GSXB 2BOCB 4UTBH 4Y4KB 2IGFH 4Z77B 3FFCD 3BZ4A 5GS3A 1EJ6A 5EBWB 3X13B 8FABB 4LARL 4QOKD 1KUMA 4IDJL 2J8UF 4D0DB 3JVGA 1GGCH 3QQ9C 3SBWA 1VPOH 2ATKB 2PXYA 1D9KA 1ZLSH 2DYPB 3X14B 1BOGA 3MZGB 1ETZA 3P4LA 3U36B 2X1QA 3E6HA 3DO3A 5E00A 5IBTH 3CFIC 3HE6C 5JOPE 1F90H 3U48A 5MEOB 3GM0A 5AG9A 3ARWA 4ONGH 1QG3A 2Y23A 5KTEH 1I9JL 4OF3A 4U4BA 4U1MA 1JHKH 4BZ1H 4H8WH 3T0XA 3PDOA 4UBDC 2I27N 3WO4C 2CPCA 1JNNH 5E6ID 4P46B 1UWXH 3GJFK 4L4TD 3D1MC 3WHXA 3E2HB 1MFBL 1N26A 2DQHL 3ARGD 4ONFL 5JQ6H 2PUQT 3WKML 5C0AE 3OJDB 1UVQB 2HN7B 1NGXB 4FA8A 2G5RA 3VRIA 1RVFL 3T0AA 4PGDB 4AJ0A 1OAYH 5DRZA 2OCFD 4XNQA 3U7WL 2ZSVA 4JRXB 4M6ML 1HHHB 4I2XE 4ZFOA 2FD6H 1PKOA 5CGTA 2DWDB 4PBXA 5TDOB 3GMMA 4U1IB 1FFNB 5DMIH 3GGWB 4XP5L 2GTZA 4FOMA 1P4BL 4MZ2A 5GGSB 5F3HA 4A6YB 2HT3C 3QUZB 3RWDA 1U95A 4P23A 1ZHKB 2AEPL 3F7VB 1ITCA 3AS1A 2OJZH 2EDWA 2XXMB 4YO0B 3W0WA 1AGEA 4H1LA 5B3JF 2IQ9L 3HZMB 1KULA 1Q1JL 1DBKH 4K3EL 2B5IC 4JRYA 4MCZB 2VZ3A 2F58H 1YYML 3RNQB 2J6EA 1A14L 2VLRD 1ZLVH 4XVSH 3RIAK 4B7LA 5DMKB 1BIIB 2ITDA 5DD6A 1GGIH 3BOVA 4NQEB 2SEBA 3SJVB 2YPLB 3TBTA 1CFQB 1E4JA 1CFVL 1OW0A 4C56E 2VDKL 5DDHB 5MEPA 3GJFA 4KMTH 1CXIA 5CJ8A 5B39B 5FYKH 3SDDD 2C3VA 3HR5B 4HIXL 1RZJH 5HHOD 4LHQB 3UTTB 3ZO0A 4RGND 1MFEH 5HHVL 4WFHD 1RK1A 4HMEA 1EZVX 1IEAB 1EXUA 1YEIH 2EDDA 4GAJL 1Q72H 1EFXB 3PGFL 4PLOB 4UT9H 5JPNA 2YUXA 4NNPH 1S7VB 1F2QA 1PY4A 4HT1H 4F7MB 5I8OL 4FFVD 4MXVE 3PQYA 4K71B 4MGXA 4CDHA 1ORQA 3TA3B 3BP7B 1T7XA 4X99B 1CLYH 4GW1A 2D4FA 1IVLA 4UNTA 4CN6A 3OKEA 2FRGP 1FZKB 1BMGA 3GSXA 4M93B 4Y4KA 4LPTA 1S78C 5I30L 4Z77A 4IJ3C 5T33H 4I0PD 2X1OA 5EBWA 4UINL 3X13A 8FABA 3PWPB 5IHZB 3MUY1 1F6AA 4GKSB 4OT1L 3D0LB 2W91A 2FR4B 4D0DA 5JR1L 3QEQB 4DCQB 4I9WE 3UDWC 1P5VA 5EO9B 2ATKA 4P2QE 1BM3L 5D93C 4OFYA 3X14A 1I85C 4HJ0C 5D6CB 3LH2L 1NUDA 4OZHB 1K2DB 3MRMB 1HYSD 4QHNA 3KJ6H 3U36A 3I50L 4IEFB 4XNXH 1K6QL 2QQQA 3RIFF 4ODHL 4OZIA 1FYHB 4G6ML 3SPVB 3CFCL 5BXFB 5DRXB 5F7KC 2EYTB 5C0BB 4ZQKB 5GRWA 5HDBE 4ZTOL 5MEOA 4TTDD 3MGOB 1C5DA 3HFML 2D7QA 3CD4A 3K46A 4UOW1 4FXKB 4P2RD 1GOFA 4AMKL 2QSCH 4RGOL 3WE6B 3NIDE 1UG9A 2PO6B 1IRAY 1R3IH 4OGXL 4P46A 4TN9A 2CXGA 3MRHB 4Z76B 5TE4H 1A7QH 3V4VH 3TBVB 2BJML 3OJDA 1UVQA 2HN7A 3H3PL 3RA7H 4HPOH 4OF8A 2ZUUA 4ERSL 3F6LA 4PGDA 3W11C 2ZCHH 4TVPL 5IFAL 4X4YA 1QBBA 4KMLB 1KELH 4JRXA 1HHHA 3PNWB 1NGWB 2DJUA 4JFEE 4ZS7H 5DD1L 1CDIA 3MV8D 3LRSA 5TDOA 4U1IA 1FFNA 1QEWB 1MCJA 1OGAB 4X4MA 2M26A 3GGWA 2FHFA 2W59A 1CQKA 1QSZA 1MQKL 5TH2B 4G3YH 5E94B 2PR4L 5GGSA 4GS7B 4A6YA 5E8DH 3QUZA 4ISVB 1P4IL 2Z92A 2XKSA 3F7VA 5T3XH 2PCPB 4G9FD 4YO0A 3K4AA 4X6DB 4K94L 4KH2A 4PY7B 5EORL 1EEYA 5E2VL 4K23H 5IVXB 2BY0A 4GAYB 4GKNA 3QI9D 2E7LA 3BWAB 4MCZA 3WIFB 3RNQA 2YZ1A 1O7SA 3B9VA 4ELMB 3LS4L 4Q97A 5DMKA 4Z7WE 1BIIA 2CQVA 3QIWC 3O3BB 1DUZB 3LY6A 3ILQD 2PTUA 3FHQA 1JNHB 3WLWC 3SO3B 4NQEA 4ODVH 5INCB 3SJVA 5ERWB 2YPLA 1G6RB 3MLWL 5E99H 1N3NB 4ZUSB 1CFQA 4PJDE 3I3BA 4XPTH 5DDHA 4LSRH 4N1HB 3GSNH 1D3CA 5B39A 3HR5A 4WHCA 1Z5LB 1JMXA 4P48A 2X4OA 5TDNB 3SKOB 3RTQD 3UTQB 1SM3L 2YUWA 1IEAA 1EO8L 1SJVA 3CSBA 1W8NA 5IEKB 1S7VA 4NRZB 4XHQA 3U83A 1M1SA 1OF2B 4F7MA 3VFRB 3HI6L 5C09D 2P43B 4LSSL 2JJTC 3KYKH 1T6VN 3BP7A 4LAQH 3P4OB 2HMIC 4X99A 1MIEL 4Z95L 3EFDH 1A7RL 1H8SA 5M95B 3RWJA 4RGMC 1IJ9A 5E8OB 5I18H 1FZKA 1A4JB 4ZO8A 1MJ7L 3IU4L 3EIFA 2ED8A 2IC2A 1D5MB 1G1CA 4QTIH 5IHZA 1PX4A 3S35H 2IFGA 1FDLH 3D0LA 2FR4A 2PNDA 5FYJU 3QEQA 3PABB 4DCQA 1BOYA 3C2AH 3S36L 4N0YH 5EO9A 2B4CL 4UV4L 4O00A 4KVNH 3P11H 1NBVH 4JY6B 4B5EA 1X3DA 4D9RE 5D6CA 4OZHA 1K2DA 3MRMA 4P59L 4UDUB 5IW1B 4K8RD 4YC2B 4PGZA 3BQUC 5FYLD 3KYAA 1XCTA 1YN7B 5I1HH 2DICA 3MRGB 5BXFA 5DRXA 2EYTA 5C0BA 4ALAL 2AVGA 4ZQKA 2D0FA 3ORJA 3WUZA 3MGOA 1KJ3L 2EZ0C 1BJ1H 2WLYA 2XPGB 4FXKA 1IQDA 4U33A 2XQYK 2GIYA 3WE6A 5GS1B 1GGBL 4LCYB 5D7SL 3PHSA 5IGXH 3C08L 3QEUB 2EECA 3REWB 4BK4A 1CCZA 1R3LB 1N64H 4KUCD 1RIHL 5FKAB 4XCNB 4NM4H 4K9EH 3SDYH 3F62A 4S1QL 2FGWL 4LMQE 3TBVA 2QHLA 3LS5H 1ZLUH 4YX2L 4PJIF 3VFTB 2AJSH 5BVPH 1KCRL 2XA8L 1TVDA 3RVXC 1DLHB 1N6UA 1T7ZA 3V95A 3T09A 4KFZC 3BN9C 3K7UA 1YEHH 1IC5H 4RQQB 3PNWA 1NGWA 1E0OB 2NY4D 5F7NC 3QO1B 5BMFH 4M5YH 4L4VA 3KR3H 4CVWA 2I60L 1QEWA 1OGAA 1RU9L 1IKNC 1DJSA 4NWTH 1HNGA 5EOCH 2BSED 5TH2A 3RWCA 5E94A 5AYQA 4BSJA 4JG0H 1I7RB 2ADGB 4ISVA 1GC1C 4OLXH 4WTZG 5D7JB 4Z7QE 5ILTL 25C8L 2E7CA 2PCPA 4X5LA 4P9HH 2NXYB 2Q7YB 4X6DA 4PY7A 3U0TB 4GRWH 5IVXA 4GAYA 2IJ0C 5GGQH 5JOFB 3IDXL 4BFGA 1S7SB 1MREH 3HG1D 15C8H 1CE6A 3WIFA 5ISZB 3GSVB 3KLAB 4ELMA 1TTUA 1JRHL 3FZUD 5GPRA 1MCDA 1EO5A 1ZT4B 2A6JB 1JNHA 1H3WM 3M45A 5T3ZD 3T1WA 3HUJF 5INCA 2YN3A 1NAML 5ERWA 1G6RA 4ZUSA 4X6BB 4P99A 5IBLD 1O7VA 4J4PA 1BBDH 5IJKA 3UBXB 1I8MB 1Z5LA 5TDNA 3SKOA 1SY6A 1MHPL 3UTQA 3P0GB 2XACC 2NY3C 4NKIL 1HWGB 1J0ZA 1OSZA 5LJYH 4N9GB 2BSTB 4HEPG 2NZ9C 3D39B 1WAAF 5IEKA 1NUNB 4NRZA 4WW2B 5ICXB 4X98A 3VW3L 1OF2A 2NY6C 5D2LE 4KKNA 3VFRA 4DZ8B 3OXSB 1IGIL 3V7AE 3P4OA 5CD3B 6FABH 3BD3A 5DSCA 4KQ4H 4U49A 5DJAB 5E8OA 1A4JA 3Q1SH 4ZOAA 1JMZA 1NBYA 3ZKXB 4FQLH 1D5MA 3DIFB 4GW4B 5CJQL 3UTSE 4H8WC 4YBQC 4JM2D 4D0CB 1U8LB 3PABA 1RJZB 2VLKD 1WEJH 1JFQH 4JY6A 5IWLC 2FJFB 4UDUA 3C5JB 2XV6B 2YD7A 3PV6B 1Q9KB 4LLWB 2V7HB 1YN7A 3CZJA 3SGDI 1TQCB 2H1PL 3MRGA 1WITA 4XPGH 4GW5A 4PJ7F 4XTRC 2XQYG 1GXEA 4DGYH 3VFPB 5GRUH 4F7PB 2XPGA 5GGUB 5FO7B 5J9PA 3KYNA 1BQHA 3VU2A 3BDBA 3ARVA 5GS1A 4WI2A 2DLHA 1F13A 4WFED 4L8SC 2EICA 4ACPA 4PTUB 4LCYA 3EFFA 5E24E 3QEUA 1RZKL 3QXDA 2RJMA 3CDCA 4QXGL 5FKAA 4XCNA 1FNAA 1IGJA 4Y19E 1A3RH 5BO1L 3W5MA 3OZ9H 4X5WB 2YC1B 3QHZL 5I71C 1D6VH 3VFTA 1UXSB 2OZ4H 4P3WA 1DLHA 2J88H 1ACZA 4M7JH 4LLAA 4L3AA 4MB5A 1NMCB 4R2GD 4Y5XB 3RU8H 1RUAH 5TFSH 5DJ0B 1BZ9B 3MLYL 1ZA3A 4RQQA 2ZUQB 4GAGH 3QO1A 2DBJA 4ZSOB 3TYGL 1WIPA 1JGLL 2Q8BL 5I6XB 5LGJB 1CD9B 3JBG7 3C5ZD 2XTJD 1I9EA 1AXIB 1I7RA 2ADGA 4JG1H 5D7JA