4JDEB

Crystal structure of pud-1/pud-2 heterodimer
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
146
structure length
143
Chain Sequence
b'SGVTEQWAKVDIENKSDHVFKFQVLHQYTGNALEASKWVKLEPNQSAQILEKVHYNTGPFTTGTDNWKVHGIKQIETNLDDVVDGKVRILGEAWRSGHPDGADWKKHTLRVEDHAQTTVIKVLEKEVQFVSKSGTSTTDFYRH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein F15E11.13
publication title Characterization of PUD-1 and PUD-2, two proteins up-regulated in a long-lived daf-2 mutant.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Unknown function
total genus 34
structure length 143
sequence length 146
ec nomenclature
pdb deposition date 2013-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF18457 PUD1_2 Up-Regulated in long-lived daf-2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3820 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4jdeB01
4JDEB 4JDEA
chains in the Genus database with same CATH superfamily
3S34L 3TA3A 4M5SA 1I31A 4KO9A 2CQVA 1P4LA 2DIAA 2WXLA 1AJ7L 3O6KL 3OKYA 1A6TA 4Z7WE 4Q97A 4O2EA 4Y1AB 3RKDD 3PAUA 2G9HB 3VI3E 1F45A 3DUSB 2GBTA 4YDLC 1BGXH 5M95B 5FHAH 1AGDA 5DFVC 3QRLA 5EBMA 4JO3H 3UTPD 3IDYC 3KLQA 5DVPA 3FRPA 5AVRB 3VYNA 4F33B 1YMMD 1WO2A 4LGPB 2GJ6E 4NN6C 1IAIL 4UT6A 4FNSA 1L0QA 2ZCZA 1G1YA 1PU0A 2LHAA 5T1MB 3GKZA 2YFOA 3HNVL 4E9LA 1KULA 4JX0A 4PG2A 4O58L 4DNLA 2IXQB 1EHAA 3ZE0F 2WQ8A 2GEEA 5C0JA 1CGXA 1PZ5A 1ZRUA 1N8OE 3V0WL 1A4CA 1J05B 3SJVB 1MCIA 3K6SB 2Y7SA 4AQ1A 2ED7A 1JGEB 2Q5BA 5D2NA 3Q7JA 3K4ZA 4G9DA 3QUZB 3Q06A 1ITBB 5IVOA 4N5ED 2Q3XA 3ARXA 4FEIA 1T7YA 5KZCD 4L5FH 4OZIF 1YJDH 3SY0A 2YEVB 3W2DH 4PD4K 2YUZA 4HOWA 5IOPB 1MHHB 3MLSH 5FUCC 1CBJA 3HPJB 1NQBA 3PXJA 4BSWB 5IGXH 4UZUA 5E8NB 4EOWH 1RJLA 2J5LC 4QTHB 5FOBA 3TO2B 1HZKA 5KBMA 4WFHE 1YPZB 4DT2A 1U3JA 3IYLW 4UM8B 2X2JA 1WTGT 4NC1C 3VWKC 5ADPL 4BCZA 4TTGA 4K3EL 3PABA 4IOIA 9CGTA 5B7MA 1JN6A 2CM5A 2JFCA 3MN8A 1XQ4A 1P5UB 4RX4D 3UYOD 5IEHB 2V2TA 1FHGA 3WTUA 2HFGH 5IJDC 4TVPL 3H7BA 3CZFA 2A0LC 4PJCF 1A7RH 4WEBH 4AMKL 2XZQH 3AUWB 2OMYA 3EYSH 1G9NL 3HRZA 5KBDA 1IILE 3D69A 4XNDA 2L7EA 3DETC 3B56A 4P9ML 3RGBA 4XMZA 4I3GA 1EFXA 1OSZB 1SOXA 1RH8A 3HBZA 5A2FA 3IDJA 2UXTA 1O9VA 2BC4B 1F42A 4JZOB 4GW4A 3SKOB 4GT7A 4EZKA 4WAFA 1FFNB 1TTUA 3LHPL 5IK3B 4R4FL 1AAJA 1PX8A 4FHJA 3T6XA 2V5RA 2HP4A 3AUVA 3LD8C 5I15L 2HVBA 1EWHA 5IM7A 4OLXL 2VR9A 3BSHA 2W9EL 1EERB 2I32A 3RTQA 2NCMA 3VSVA 3QORA 3ROOB 3UAJA 1J18A 2MEJB 1GS8A 4HSCX 1OHZA 1WFOA 2AJYL 3R8BB 2VJ0A 5I1IH 2OMWA 4L1LA 2SODB 2X1XR 4RFNB 5IW6B 3A6CH 1NEZA 5AZEH 3U4BH 5I71B 3HPLA 3EJQA 4XMPL 3WLBB 4Z7AA 4ZW3A 1ADWA 2OP4L 3G6DL 2A83B 4I7ZC 1XF3B 2HSIA 5HGBA 1J11A 1AYRA 1DFBL 2R1WA 1M53A 3ZTCC 4NIYE 1JZ8A 15C8L 1WS7A 1AY1H 4ZMTA 5CINL 2ODHA 5EWIH 1W72B 2TRHA 4NN7C 1S4IA 1AHWB 3SBRA 2R0LH 4HK0A 1ORQA 2OMZA 5JOEA 2EVHA 5C9JA 3VFNA 3MBEC 4QNPF 3ZDZE 2JELH 4G6KL 4G72B 1KTJA 5CLTA 4ZUWA 3GQFA 1OARL 4S1RL 3LKOA 3WE1A 1MAML 5E8OB 3QJHB 2XTJB 3KYOB 4YSTA 4KI5D 5I0DA 2VDMB 4QJ5B 3MRIB 1UD6A 2Q76B 3ARFD 3G5ZB 4OGAC 1JWMA 1DQMH 4N1HB 1D3CA 4XBPB 3DVNB 5L2KD 5B1KA 4X99B 4ZFGH 3CSYA 4FFZL 4NQSB 4A1RA 4X5WA 1MW2A 1XTMA 2K6ZA 4BQ8A 1SY6H 1VJSA 2JCCB 1XGQB 4GXVL 5E2UL 3SE9H 2W07B 2JQAA 3D2TA 3QEUA 3AQZA 2GW5A 3ZKND 5J5EA 1ZLEA 3JV0A 5EO0A 1U4EA 4JDTL 1N64H 3NP4A 3OZLA 2EYTA 3EZJB 4NT6A 5AALA 1CE6B 4MJJA 5IVXE 4NHCL 4I88A 3QG6A 4IK7A 4JRXD 1DUYB 2BXYA 4TSAH 4BDVB 1KT2B 3B9DA 4K7PX 1S78C 3QDJB 1UT2A 3OLEA 4AXWA 5AG8A 1XTLA 4QI3A 1KNOA 1OW0A 5DK0B 4KY2A 2HRHA 2KMWA 1Q9WA 3L17A 4MNGE 3MRKB 2QADB 4RBPK 5JO5B 1A7OH 3CN0A 3F8UB 2P5ED 4JO5A 3SDCB 4EMZA 5KVEE 3U6RB 1PY9A 4UINL 5KAQF 4X4ZA 3VJ6B 2WOBA 2M26A 3FO2B 4OU3A 4E0RB 3FXIC 2VABB 5KVGL 2OSWA 3OMIB 2QPSA 4LDLB 4UV4L 1F11B 3U4KA 2WKOF 1OZTG 4E41D 3D8MA 2XTLA 1QLFB 1J8HA 2HG5A 4OZHF 4XN1A 4JFFB 4J1UB 3MV9B 2V3DA 3GM0A 4L9LB 4LIQE 2ADJA 3G5WA 3FZUC 4GT0A 1EH9A 3FQXB 5ITFA 2MH4A 4OZFH 5D72H 3NOIA 3BPCB 2XPYA 3FQRA 3K1KC 1HE8A 2VLKB 5KWYC 3OHXB 1EEYB 5DJ6A 3MPCA 3X3GL 5D7JD 3CC5A 4HCGA 1D5MA 1I7ZB 3C08H 2CRYA 1ZLUH 3KBFA 3WFBH 3EJCA 4KZDL 3B2MA 1R5WA 3MR9A 3VWJA 4G1EA 4O51B 4PR5A 1CCZA 2Q10A 4HIJA 4DPRA 3DI2B 1UCTA 4Y4HB 5C86A 5D70H 2NY0B 3FCTB 2NNFA 2NY7H 2UZPA 4ZMVA 1CT8B 3LIUA 3QCUL 4X7SL 3KPQB 4H8UA 4TTDC 1LVEA 2DMCA 2F7OA 5BQDA 1JYNA 3VFPB 1CK0H 1TZGL 3QFJA 2ITDB 3IGUA 4MMXB 2FGWH 1UZ8B 4IKIA 5LXGL 1BIHA 4CN1A 1PG7H 2F8OA 2NXYB 32C2A 3VX1A 4TVSa 2Y7LA 3OKKB 4ZUVB 2Q1EA 4N22A 3DVGB 3MV8B 3QBTB 4PRAB 5MERA 2OYLA 4P4RB 1IMHC 5ANMB 1DE4A 1DFXA 5EZPA 5BO0D 2WB1A 2GY5A 1U8OB 2Q87A 1J8KA 5D5ME 2HRGA 4FQIH 3RBGA 4HU2A 2BSRA 3K8KA 4H1LB 4PRID 3MBWB 2MKWA 1IC5H 2Z7UA 4X6EB 1ACCA 4ZOAA 5DMJB 1CDGA 4NAMA 1ZHKB 4P5RA 4FFWC 4WO4D 4F8NA 1R0AL 4UM9B 3BX7C 2MNJB 2EZ0D 4MCNA 2ZUQB 3PHSA 4QT5B 1JZFA 1BFSA 5EPMA 1F97A 4WWNA 3U1QA 2J4WH 3DGDA 3RY6C 4E9TA 5BW7A 3CU7A 3WXWL 3DNKA 4M9OA 1IZKA 1E90A 3FBKA 3HZ3A 5DO2C 3ZHDA 3PGDA 1IAMA 2A74A 3EH2A 1NPNA 2F0CA 1VGKB 5LLIC 1JD7A 2CA4A 3S5LB 4P4KD 1GGIH 3SDXB 3TYFB 2LAAA 3WIAA 4NCDA 4DN4L 1TETH 4XODA 1A65A 2VWEC 4OFQA 2B5IC 3HZVB 5KYXA 3IDNA 4RA0C 3QJSB 1R3IL 1X44A 1A4AA 1TJXA 4Y2DD 5DR5H 1PAMA 3GGWB 4F80A 4XB8A 5FO7A 4OF6A 1AS8A 1MJ7L 5E94B 4KQ0A 1ESOA 1ORSB 2H3KA 3KWTA 3T4AC 3X1GA 5FYLL 1MJ8H 2VJXA 5IWLC 4DN3L 2ZKXA 3S34H 3FAXA 4E9XA 3B7TA 3O6KH 3OLDA 4C4BA 2PP8A 1XIWC 5CSGA 4LVEA 2DMBA 3DROA 1NGYA 3ATAA 4MD5A 5IQLA 3HUJA 1XGYL 2BSBA 4Y1AD 1JGDB 5I1JL 5AYQA 3TWCL 4WW1B 1F6LL 1A9BB 4BZYA 4KH2A 3U0TB 1OPOA 4XAWL 1B9ZA 1TG8A 1IAIH 2AAAA 2C3XA 3O81A 1PZBA 3A24A 3QDGE 3Q8CA 5D93B 5HHOD 1F13A 1IEAB 2A4EA 2UVEA 4O58H 3VYPA 3WN5A 3C2AL 3ZTNL 2O6PA 1IGYA 3VXRB 2ZSVA 3NK4A 3PAYA 1B4RA 3PJSA 3IJEB 5KYWB 1S9KC 1ZK5A 1AP2A 2CXKA 2BO0A 3APDA 3P77B 3VGDA 1W0WA 4JHWL 4OSUL 5HXMA 1EIBA 3S96A 3MI6A 3FFDA 4PS3A 1NGXA 2Z64C 4IKJA 2ENSA 1SYVA 5HD8C 5HDBE 3LQMA 3EZ8A 4NGHL 4OZ4A 3G6JA 4MHHG 3SJVD 3FB7B 5B7EA 2GT9A 1I1YB 3QUZD 5I18L 3UCQA 1N5AB 1L5GB 3EJZD 3G5XA 4OCYL 4K5MA 4TUJB 1THCA 5C08E 1S7WA 4CGTA 1F02I 3GSRA 2J6EL 3VI4F 4QY8B 4D9QE 1WZKA 3O4LA 3TX4A 1A4JA 4Q9QL 1PL3A 3QIUB 5AVSB 3IF1B 3GKWL 4I2XA 1A1OB 3L08A 3BWAB 4PHXA 4OD1L 5EZOL 5I76B 3PWPB 3LN5B 4X5QA 3GMMA 4K3EH 5JPNA 2RB8A 5J1AA 4AVJA 2CBTA 3TBTB 4YX2H 1S9WB 2WVVB 3RHWF 2ZUYA 4OFPA 2X40A 5LHDA 1M1XB 3U36B 4TVPH 5IQ9B 3N3EA 1CTOA 2YOCA 4AMKH 3VG9B 1QLRA 4TL4A 1G9NH 4B97A 5I17B 4C8XA 1XB3A 2JJVA 5LJYH 4X4XA 1IM3A 2CO3A 3QCTL 4LAJH 4P9MH 4L1HA 2R39A 3L9EA 3O3AB 2G5BA 1CI5A 3HMXH 3CDGB 3LHPH 4ZX3A 4BXVA 4R4FH 4YSRA 4UT9L 1MFNA 4JQVC 3Q43A 3GSVB 5I15H 4L37A 2OXHA 4HDIB 1V8HA 4OLXH 2CLZA 2PW1B 5C0BB 2EDFA 4H26B 5DJZB 1BXAA 4I9WD 2W9EH 1KV3A 3ULVE 2XPZA 4X8XA 2NNAB 3FFCB 2PO6C 3SE3C 3L4UA 1WRFA 3V4UL 1RUQL 2AJYH 4JO8A 4RAVB 4DP1X 5CIPA 1AGEB 3MRRA 3NJLA 3GSWA 1VFOA 2Q2EB 4Z76A 1E28A 2VDRB 3FYIB 3LB6C 4XMPH 2QPUA 3G6DH 4P49A 1SEBB 1T5XA 1U8HA 3ILQD 2NR6C 4KJWD 1DFBH 3HTLX 3GEFA 4DGWC 5IESL 1I7RB 3I9AA 15C8H 5CINH 5BZZA 1HTYA 4H44C 3SHSA 4JM4L 1OB0A 5DUBA 4X9IA 4U6YA 1SXCA 3EH1A 5D7IB 5GSVB 1QNZL 4G6KH 3CSFA 1AR1C 3CVIL 3V4PA 1M05B 1MCFA 2AI0L 4M8QA 1OARH 5KANI 2J7LA 2JWYA 3MRMB 4Z7UB 1DDHA 1MAMH 2GSIB 4JFEE 4DFHA 2HFEA 3QJRB 3LPGA 5MENE 4XCYB 2ZSWA 1OQXA 3B7RL 3MSPA 1I3VA 5KBNC 1MSPA 3TA4D 2N1TE 3TIDA 3ATFA 5I16A 2XTJD 5FGCB 1S7XB 3SQRA 1OQOA 4NP9A 3O8XD 3BPNB 4FFZH 4FKKA 4E9VA 4X7EC 4WJKB 4EVNA 4JFXA 4N8UA 1FFRA 2BP8A 4HEPG 2JH2A 1NFKA 1WBZB 4UQ2A 4Z7WB 1ZS2A 1JRHH 3STZA 2F7RA 3FQNA 3JV6B 4KNSA 3QHFL 5EIVA 4GXVH 5E2UH 1TITA 5E00B 4B9GA 4Z77A 1HOCB 4N9GB 4PJ9D 1KJVA 1T66C 2JNZA 4JDTH 5MP6L 1KEML 1EEUA 3STBA 4C56E 4NHCH 1VFMA 5EBGA 3MRQB 1IGTB 4ZZFA 1WA1X 1KSRA 4YPGB 5I6NA 1FZMB 4K3GA 1JE6A 2J6EA 1U8CB 3DX8B 3BSGA 4TOYH 1G7HB 1OF2B 3TM6A 3ULUE 3MAWA 5F7DB 4N2IA 1BVLA 4JUSA 2XKNA 3VFRA 4P0DA 3FB6A 3QDJD 3P40A 2NT0A 4PREA 1WQVT 2ICEB 5T1LA 1PDKA 4LPYA 4UINH 4FQXB 3ILEA 3OB0K 2QADD 5ACMA 1G1CA 4N2HA 1J1XL 1KB9J 2FT8A 2EDNA 3IFOB 1QFUL 5KVGH 4NUJB 3SDCD 1C7TA 5HI4C 1PZAA 2AVGA 2XDHA 1DZ0A 1NGWB 2BWDA 2OJEB 3Q13A 3QXWA 1D6EB 1DO6A 3PNWA 5LXVA 2XICA 5TD4A 2NY1B 5ISZA 3KR3L 1M7DB 3LZRA 2WK2A 3P69A 2VITA 1U8PB 4JFFD 3MV9D 5I9QC 4NC2B 4HA1A 3K3QA 3V8CA 1NMCB 3X3GH 2CDGA 4JRWA 4OQTL 1U8NA 1YEWA 4UT9A 1K5NA 2AJSL 3UZVB 5JIIA 4KZDH 2VLKD 4HJIA 4XB3A 3ZK0A 5DURB 3QCUH 4X7SH 4ZMZA 1VERA 4U1KA 3E1ZA 4QO1A 4NQCA 4Y4HD 2NY0D 1TZGH 1BLNA 4PPTA 3WTTA 1LK2B 3VXSA 5LXGH 4PWJA 1CQKA 3NJVA 3IDGB 1D5ZA 2DQFB 1CDUA 3DX3A 1JZ2A 1LMIA 3JUZA 2HTLD 4FNRA 1P4IL 3HS0B 5F7HA 3OLIA 5B8CA 4RNRB 3RL1B 4BZ2A 2A6DB 4HWZA 4QPEA 2WINB 4LVNB 5GHWL 4Q6IA 4QTFA 3MV8D 2FWSA 4FF9A 1EHLL 4N0UE 1XZWA 1ZA6A 4PU2A 4RLDA 4JLRA 4W9HC 4L9DA 1Z9LA 1WUNT 3GEWB 4UOW1 4B5EA 4U6HA 1U91A 4PJDF 3EHBD 2LT9A 4C4KT 3SO3B 2IAAC 4BGLA 1R5VA 4UIMB 1GOHA 3VFVA 1R0AH 3PFUA 2DQJL 1SLWA 5LAPA 4AV5A 1H8LA 4AENA 4NM8L 4B27A 2CO6B 3BFWA 4GSDL 5JZ7C 1VFBA 2V7HA 3WXWH 3CG8A 4C54A 1EDHA 3GSNA 1P7KB 1WWCA 4PRBB 5DMIH 4OGXL 5DJ8B 4LL4A 3L3DA 1NJ9B 1MDTA 1W6LA 5BZDB 5K9OA 3EDEA 2QEJA 4UDTA 1EHKB 1RXLA 1PAZA 2NSQA 1HZLA 4ZPTA 3ZDZB 2OTUB 3NJNA 5F1IB 1OPGL 3CVCA 1NWOA 2QR0B 4DN4H 1YVLA 3T9WA 5CIPH 2HUHA 1EZLA 3C9NB 5K39B 1R3IH 5JDSB 5BPPA 2CH8A 5C0CA 4HSQA 4HWEL 1E4XI 3P0VH 3QR2A 3WAKA 4NNXA 5IB3A 3F5WB 5FCSH 1NBZB 3NRFA 1MJ7H 2CJUL 4DOHE 4ZQKA 5FYLH 4F7TB 1JZEA 3FKUS 5HJ3A 1HDMB 4ZTPL 4DN3H 4AUYA 4AE1A 3SYPA 4ODWA 1UWYA 2JK5B 2FQFA 4F9PA 3IU3A 2X5PA 4N0CC 3SZKC 3P4LA 5DJDB 2G2RA 3R18A 4KKNA 4NUQA 3EGSA 3F62A 1AXSA 3DX1A 3GPSA 1XGYH 4PHZA 2DWSA 3GLZA 5CLXA 5I1JH 5IB2B 3T4YB 4WU5A 3TWCH 2Z35B 4XC3L 3HR6A 1NEUA 4NRYB 3T0EC 5IVXB 1P7QB 4XAWH 4ZS6C 2CZNA 3N5AA 3U46B 5IUSA 1YEDA 1MXGA 4FA7B 1V10A 1QSFA 3F6JA 5DS8B 1TQBC 1ZHNA 3ZTNH 2P5WB 3C8KB 4M43L 2WYIA 2FBOJ 4MNGB 4N90D 4NLAA 4JN2A 4ODVL 4EN3B 3C5SB 4ALAL 3MNZB 4N85A 1RZQA 3BZFA 2YQ3A 1JGIA 2EP6A 3VXRD 3L4YA 2GBVA 3DPBA 4JHWH 4OSUH 3W5MA 5D1ZI 4MMZC 5C3IA 1NFDE 2XN9A 1NC4A 5EOCL 3TONA 2DEWX 2MPAL 5C92A 3IVKA 5B1BB 3O6FC 4NGHH 1MY5A 4QXWA 4WFEE 2D7OA 1DVYA 5I18H 4K7FA 4HUUB 2CK2A 1RSYA 2CNYA 2WWKT 1QAWA 4IJTA 4E9YA 4OCYH 4PLKD 2Y2WA 2BVPA 4H5SA 2ZCKH 3KZ8A 2I25N 3W9EA 3S5YA 4Q9QH 3GKWH 5JA9A 3RVXC 2DICA 1N19A 4OD1H 1LE9A 5EZOH 1BFTA 4YIQA 1F3DH 2E7BA 1N18A 3QIUD 3VRJB 1PCXA 5EHFA 4XX1G 3RX5A 4ALAC 3QUYA 3PWPD 3BFOA 1PKQE 1OP5K 2PCPB 4LCWB 2YEZA 4YXKL 1JCVA 1GS6X 1CFNB 1T03L 1AGBA 1P4UA 1B2YA 2YQ2A 1MCPL 3QCTH 5CJBA 4RBPH 1HOEA 3FONA 3LS5L 2PUQT 3TJEL 2FO1A 3BH8B 2YN5A 3HG5A 4YFLF 3D3VA 3WNPA 4ZW5A 1F4XL 3EGDA 1RUML 4FQ1L 1FFPB 3O0RL 4JL1A 3RZCA 2XKSA 3CIAA 3VUAA 4UT9H 3F58L 2H0FA 4FHBD 4HAFA 1O0VA 1MPAH 4ZFZA 5D5MB 5EZJA 2KI6A 1NBYA 3QXDA 1XL4A 4S1SL 4K15A 4WTZG 4XO8A 5K9KB 2FWOA 1NBQA 5IP4A 2WXMA 2WTOA 5BXFB 3RVUD 1KXQE 3V4UH 1RUQH 1AZUA 4HF5L 4JFDE 3KLHC 3IFNL 3D08A 5DT1L 3ZOAA 4TQIA 5ESAA 3FFCD 1U58B 1XR9A 2H2SC 5C07E 3ECVA 4PJXA 4DKAA 4NFBA 3BEWB 1IJ9A 3HFML 3KLAA 4OM0L 4AQAA 5BRZB 4N0FB 4M7ZB 4YHPA 2Y3NA 1QOKA 2H3XC 4X5PA 3VA2C 5IESH 4GBXC 5CGBA 4GXFA 5D2LF 2ZNWA 2UY6B 3U4EA 4JM4H 4M1GL 5EF1A 1JSYA 3T2NH 4KK8C 5ETUA 5HGHA 3B9VA 4QOKE 4LEOB 4UQ3A 2X4UA 4X0KB 1C1EL 1UCBL 3JVGC 3QUXA 4KX7A 2EILB 2C1PA 3CVIH 3NCYP 3MLTA 3RHWK 4OZIA 2AI0H 1E7VA 4ZUTB 3IJ7A 2D7TL 2GUOA 4A38A 1HJCA 2OX5A 4KGJA 2J55A 1KPRA 1HFUA 3MRLB 1FYHB 4IGBA 3X14A 4X7CC 3L3OB 3F7VB 5DVKA 1GGTA 1LL1A 4FS0A 3QFDB 1S5HA 3QA3B 3BP7B 2Z1PA 5DYFA 4B9ZA 2OZNA 2IF7A 35C8L 4DIXA 2LTQB 3H9SA 3H2QA 5JMRA 3UBXB 5EEVA 1FVEB 3NDYE 2MNWA 1LO0L 2R4RL 4IBYA 3MOQA 4GAYB 4Y5YA 5H4ZA 3QHFH 1FYTB 3CV5A 4MB4A 3L13A 4LLDA 5DHVA 3CSBA 2JTDA 5MP6H 4Z7QE 4XCCL 1KEMH 3KYNB 4HX1B 1G9ML 5ACZB 1CFTA 5DQDL 3V5HA 1EAQA 3UAAA 1U3ZA 2YO3A 4HUKB 1CLCA 2CUHA 2VZ3A 4NYLA 5AAMC 3TS8A 3P1VA 5IHHA 5F6IB 1RHFA 5HYQB 4PSPA 5CBEA 2Y22A 4GUPB 3QDGB 4XNYL 2GG1A 2YZ8A 4QRSB 4UTAL 2QKSA 1GYUA 5HPMB 5JW4N 1VADA 4R7NA 4HUVB 1Q9OB 3CFJA 1WVZA 5C0NC 2GJ6D 4LU5L 4DEWA 4AK1A 5CGMA 1Z1WA 1VACA 4CVZA 1TJIH 4K8RL 2YXMA 3L8QA 3MOBH 3L48A 2OA9A 3A5VA 4DVBA 3FCSA 3MX0A 1U2YA 1F6AB 4TRPL 1J1XH 3T0AA 4PLOB 4Y16B 1U92B 1QFUH 4L4VE 1GZQA 2Z93A 2WHVA 1CD1A 1QTYT 1R24A 2VZUA 5FKPA 4R5XA 4MJ5B 4FQXD 4QRBA 5HDBB 1N2RB 3QISA 3ZDXF 4HG4K 3OSVA 2GTWA 2P24B 1G9MC 3GUFA 3KXFE 3JUYA 3FSVA 5EU5B 5FUOL 1BEYL 3MVSA 2GJZB 1LNUB 3F12B 3T2PA 1QKZL 1BXXA 5C08B 1Y6KR 3CFUA 4XCFL 1TSRA 3NSXA 3GZKA 4S0TD 2P8MA 5GRUL 1FBIL 4XOEA 1U8KA 5FUZL 1YC7A 5F1OB 1WISA 3Q9QA 4PS8A 2NY1D 1ZLVK 4DFIA 1FJ1A 1JMZA 3MV7B 4OQTH 4X50A 2AJSH 4KK6D 3BKCL 3BUYB 4M62L 4PJ7E 4V33A 3OKLB 4K8RC 1SHXA 3JWNG 4WFHD 4YQXL 5TH2B 3PUCA 2R7EA 5B22A 2IV9A 2EC9U 2H1PL 4N2FA 3ASNB 5ID0A 3QWOA 2DQTL 4AQ8C 5IQMA 5DURD 1UZGA 2FEEI 3UG4A 1OSEA 2KUTA 3U9UA 4KAQL 4DO6A 4IKLA 1MCWM 4L3EA 1JYWA 1P4IH 1YEGL 4NX0A 3RA7L 2A9AA 3N9GL 5EUOF 2EKJA 4O9HL 5H35B 1DP0A 3IS1X 3R06A 3ARBB 3T0DA 5GRYA 4BFGA 4MSWA 5GHWH 3FJTA 5FGBC 3MFFA 4LPTA 4YZFE 1EHLH 1DVSA 1SEQL 2PMZA 4Q74A 5E5MB 3RFZB 5I0YA 2FJHA 3F7YB 5AAWA 2EYSA 4KK5C 2ZUVA 4JHBA 1BAFH 5I6OA 3D25B 3MROA 3SKNB 1KDJA 4IBSA 1TO5A 3ZBMA 4U2ZA 4WNSA 1C08B 3C60A 4O2CA 3L5HA 1BOGA 4H8WC 4U49A 2AITA 4QKTA 5CEYB 1DUZA 2VISB 4LSUL 4NM8H 1FSKB 2YD2A 5DJ2B 5JOFA 3NGBC 4GSDH 5I5JA 3RL2B 5DVLA 1QI3A 1IUZA 4FD0A 3G6AA 5HYSA 4UUJB 1XV8A 3CHRA 2FHBA 4OGXH 2BVTA 2GTZB 2I26N 2ARJB 2N01B 2R83A 1RCYA 5IFAH 3S3PA 1A2YA 2WKOA 1X6NA 1OPGH 4YSAA 3O41B 1NIBA 4NI6A 4OZHA 2VT0A 3VG0L 3WS3B 4UV7L 3K74B 3P54A 2MOVA 1UD2A 3MJ9A 4S1DC 2I7OA 4JFEB 2OM5A 5ABDE 4HWEH 2C7UB 4JM2F 3CN3A 1C16A 4DP8X 2CGZA 2CJUH 4UTAA 2JB6B 1ADQL 3GB7A 3QI9A 2Z8WC 4I8DA 4XXCC 4DK6A 4AGQA 2YA2A 1JV5B 2YPLB 2YAHA 3NJMA 4JQXA 5CD3A 4F91B 2WV3A 2HUEA 2VXQL 4P5TA 5D4QA 3BLPX 1S7TB 4LP8A 1XSOA 2V2WA 1UXLA 4PJ6A 4I0CC 3ETTA 5CSZA 3DJ9A 4F2ME 4Z18A 1GL4B 1Z3RA 2HN7B 4OT1L 1NIAA 3G5VB 4XC3H 1KIRB 3DIDA 3W82A 1ASOA 1G7PA 1GZHC 3S36L 3LS4H 3SYOA 1Q94A 3IDXL 3A3YB 4OF3A 2QGDA 3LZPA 1EA9C 3RYMA 2E74C 3WJMA 1SMOA 1JDAA 3REWB 3I2CL 1PBYA 1LEGA 5AW5B 3P02A 5C2BL 3GMPB 3HE7D 4OB5L 2UXGA 4M43H 5B1AB 3ZUCA 5DJYA 2YAFA 2W95A 3VVVA 4ALAH 4BK5C 1K4DA 1AGFA 1KB5A 3VE0A 1NC2A 4RIRA 3OJMB 1M56B 3TH3T 2XIBA 2MHAA 3ZSTA 5L4IA 1JXDA 5D1ZB 4M00A 2LFEA 1VCBC 2NZ9C 2WCPA 5DDHA 4EN3D 5AW1B 5EOCH 3QQXA 2Z8SA 2MPAH 2P1YA 4BA8A 2PCFB 5IEKA 4GUOA 4OLYL 4DAGL 3K81A 1A4KA 1WFJA 3T1FA 3VD5A 4FXGB 4MS8C 3S3CB 1DVZA 4RESB 1E5UI 1I3RB 1ZK9A 2OTWA 2JTYA 3PWNA 4X2UA 5I73B 1K2DA 4XGZA 5LCVL 2Z3FA 5C7XL 3IXAA 4LCUB 3FT2A 5AD0A 2FEJA 4YHIA 5DMKA 3AREC 3OVUB 3SDYL 5IF0A 4G8GA 4DPAX 4QHUB 1TDQA 3CFEA 3F00A 5I8EB 2X88A 5MEQA 2Q86A 3N43B 4LDEB 2W59A 1EO5A 2W92A 4N2KA 1RUAL 1SJMA 3NMEA 4IW4C 3U0PB 3FT4B 2H2PD 5EU6E 4R2GB 2HJFB 4NJ9L 3RDTA 2AJVL 4YXKH 3SPVA 3B2VL 1J5OL 1E3ZA 5IW1A 3CVHA 5IHLB 1MCPH 1IU1A 4L8SB 5FV1L 3MRGA 3VGFA 3P4OB 3ATEA 4LCWD 1G5AA 3IAPA 4EF3A 3LS5H 4HJ0D 4J7RA 5AB1A 3TJEH 2ZE0A 4O5LL 3BCFA 4HJJL 2P80A 2YC1B 3PQYA 4GLRI 1S7UB 1E5ZA 1RQ5A 2IANB 4FQ1H 1RUMH 3O0RH 2VW6A 1X9QA 3LXBA 1GGUA 3F58H 5E9NA 4Q56A 5CBAA 4N8VG 5DLLA 1QSEA 5KSBF 4CAGA 3HKFA 4PGEB 4LNVA 3UTTE 3VFTA 5IFJB 3FN0L 4S1SH 4N0UB 5JXAL 1A7QL 1TZ8A 2A9DA 3UROR 1DEEA 4HF5H 2V8MA 5BVJB 3IFNH 2EIDA 2SEBB 4P2RA 2WMPA 5DT1H 4NRZA 4NAJA 3U1SH 5KSAC 1TZIB 1R5IB 4KKBC 1U41A 4R0LB 3HFMH 3GUTB 4LKXB 4MQXD 4OM0H 2AJ3B 4DKFL 1ADQA 1W6WA 3VH8G 3QZOA 5KJRL 5LGKA 1IC7L 1BMZA 4MMYB 4XOCA 3INUH 3NEOA 3PCYA 3QJZA 4GI8A 2FJFA 4HHGA 2OYPA 5L4FA 4LK4A 4NFDA 1GTFA 1FZJA 1WWWX 2WXGA 4CADA 1O75A 5E2TL 4M1GH 1MI5E 4L8DA 2DQDL 3CFNA 1CDJA 4YBLC 4PN6A 2WZPD 5C0DA 1C1EH 3IDMA 1UCBH 1FL3A 1MFEL 3TVMC 1O6SA 1SN5A 1AG6A 5GGSY 2D7TH 4AV4A 4IRSD 1L6XA 1SZNA 2QT6A 3RBSA 3T77B 2E7MA 1HSBB 3UTQA 4MTMA 3MO1B 2N0KA 3VI4A 2IWEA 5DEFA 4J3XA 1ZDQA 2Z92B 4G8EB 3V0EA 2F74B 3C6LB 3QH3B 2V5TA 3OPZL 3W0WA 5C6WH 5CEXB 3KPNA 4DOHB 2X1QA 3FW6A 4Z0BL 1J12A 35C8H 5KYYB 5DHXB 3BHBA 3CZSA 3QXAA 5BV7B 3ZRSA 2BS8A 1HEJC 2WAHA 1LYQA 4POZC 3MDJA 3BI9X 1LO0H 2R4RH 4ZMLA 3N91A 2A38A 1EVTC 1MCOH 3BH4A 5IG7A 4F7PA 3QUML 4XBGB 3MRHA 5ENWA 3S48A 4ZXBB 2WY3B 2NX5A 2XX0A 4XCCH 1G9MH 2GIYA 1JHTB 5DQDH 3II1A 2QBWA 3ECBA 3RGHA 4NSKB 3QJFA 4XNYH 1XGPA 2AQ3A 2JJUA 3FU7B 4UTAH 3VXTB 3FTGA 1PD1A 2YQBA 5F88A 1PG7W 3DBXB 4R4BB 2XT1B 3T65B 3QR1A 1NAMB 3STLB 3UAEA 3QDGD 2Z4TA 4D7BA 4K8RH 4W4OC 4P2QE 4G43A 4GXUN 3KEDA 3V0VA 5GS1B 5KBPA 4TRPH 1GSMA 2OMTB 4ZG1A 4JB9L 1G6RB 3NN8A 4DO4A 1CBVH 5HGDA 1NCWL 1PVHA 2FK9A 4QTIL 1NFDB 3QZNA 1M71A 1CDYA 3HHSA 3LKRA 3EBAA 1AZVA 4XN8A 4Y16D 3NFPB 2B4CC 4L8BA 3REVA 4CDHA 5FUOH 1WAAE 3ZVVA 1BEYH 1T20A 4KQ4L 4JFUA 1QKZH 5FCUL 2NQCA 4XCFH 1NCUA 5GRUH 5IB4B 4U7MA 1FBIH 1JRHI 5FUZH 1EK3A 1HINL 43C9A 1TVBB 3KNBB 4PCYA 1IFHL 4WTWA 5C08D 4C83A 5E9DB 3T0VA 4KNQA 1GXEA 1GKOA 1OTSD 4RGMB 2E7CA 3BKCH 2CKBL 4M62H 4D9QD 2MKLC 3CFMA 5EC2A 1WD8A 3C5ZC 1IM9B 3W11D 1S7RA 1FHNA 2CWRA 1TOXA 1Z5LA 4PRDA 1ZIAA 4YQXH 3AS0A 4YHYC 4RMQA 5KUKA 2H1PH 1PKQB 4YSPA 3WEBA 3Q6GL 3L5XL 3SYQA 3TJHD 2XLLA 1HN1A 2DQTH 2ZOLA 1A25A 3FRPG 3TXAA 1GW0A 4RMTA 4HV8A 1EXGA 2OW6A 4KAQH 3PAVA 5F9WC 1AO7A 1CB4A 2LFGA 4U1SB 3MNDA 1C5DB 3B5GA 4J28A 4LKCA 2O5XL 1YEGH 1H5BC 2V9RA 2IPUG 3RA7H 3N9GH 3SDAB 2ZKWA 3MXWL 4O9HH 4Y5XB 1NBCA 2DF3A 2HLAB 2JJTC 3GC3A 3KH4A 3CVBA 4U0RC 5K1VA 3GDCA 3TJPA 5AW6B 4KDTC 4P46C 1KY7A 1CLVA 2Y72A 4Q2ZA 3LRSB 2XG5B 1EGJL 1SEQH 1NPJA 4O02L 1Y0LA 3ARBD 2Z31A 4H7VA 3EJYD 3HBGA 3GBML 2J25A 3RKDC 4JFDB 4FQQA 3ULVD 2XA8L 3QNXB 4TN9A 5EZIL 2UWEF 1LDSA 4JNXA 5C0EA 1E5AA 2F61A 1HH6A 5DYOA 4HGKC 1DJHA 5C07B 1U8LB 1E2ZA 2QPEB 4LSUH 1BSIA 3MGTB 1X4XA 4FN0A 1EAJA 1H3VA 3QGVA 4Y19A 5GZNA 5SWZA 2D2CC 2X05A 4H2AA 5EDSA 1I8LC 4PJ5E 1IBZA 3IJYB 3KLDA 1QYGL 1OP5H 2H0JA 5KN5A 1SVBA 3RWIB 3CUPA 3K5SA 2X6BA 3QUMA 4LFHG 1U3HB 4X4YB 4QOKB 3V5KA 1TTAA 2FCBA 3ASWA 4ODUB 4ADJA 5I75C 3VG0H 4XO3A 2ITFA 3NIGF 2KT6A 5DWUH 3WKML 2DQHL 1SMAA 1XCQA 2HA1A 3P73A 4N5EC 1JPSL 5JW3L 1KBKA 1ADQH 4JFED 5MEND 5CILH 2VB5A 3UTSE 4HUXA 2R15A 2H32A 1BZ9A 2EDQA 5DO8A 2VXQH 2P7TB 3FUEA 1SF3A 2VZTA 2OSLB 3G08B 5EF2A 4GRWF 5FM5O 3UTZA 4QXGL 1QATA 4HUWA 3KPTA 1ZDSA 3AT9A 4U6VL 5C0GA 4PJAE 4IOSD 1Y18A 4IRZL 5IBTL 1JK8A 2H6PA 1TMQA 4Z7QB 3L4CA 4BFRA 1WS8A 4OT1H 1SVZA 2NY4B 1F1AA 1T2XA 5I1DB 3S36H 2P46B 3JZYA 2UVFA 3KPSA 5DRWA 3IDXH 5CJOL 5DJ0A 3RGVA 2GEQA 1NEZG 3OQ3B 1L3NA 3I2CH 4C56D 4YDLB 4G6AC 4HZLB 5C2BH 4OB5H 5EMYA 1D9KA 3U7YL 1AKPA 1VZIA 1N9PA 1VESA 3IDYB 5EU4B 4Q4EA 3WJLA 3BPOC 1INDL 1JG9A 4AGPA 3FN3A 3IJHA 3ULUD 4WW2C 5HBBA 2WLIA 1ZTXE 5PAZA 5HVHC 4FFVC 4HQQH 1Q0XL 1TJGL 3ZPDA 4OLYH 2CMRH 4DAGH 1HHIB 4PJDA 5D1ZD 4A67A 4MDJA 1BD2B 5FWQA 3S2CA 1NDMA 1JV2B 3PHOA 4MNQE 3WYRA 1SOSA 4YSQA 1OSPL 5LCVH 2XRAH 3WMPA 1LEKB 2Y69B 3KXFB 5C7XH 1JPGB 2Y5EA 4BCYA 4HPOL 3O2DH 2JI2A 3V0JA 1A7NL 3SDYH 3ESVF 4DP4X 4AW7A 1T2JA 2AAVA 2CCLA 3WNKA 5C09E 2Q7NA 2UXVA 1UXWB 4M6AA 5JW5A 1BG1A 4ONOA 1XCWA 2EABA 5A2JH 4DZ8A 2KPNA 4PJ7B 1RUAH 1TF4A 4WV1B 4Y4KB 5E4OA 4HULB 43CAA 2YD1A 2ENYA 4N25A 2F54A 4KDWA 1X5YA 4NJ9H 2AJVH 3I3DA 1KFAL 3B2VH 1J5OH 3QCVH 1CXHA 3VWKB 4GH7B 1VAHA 5FOJA 1EZVY 2IPKB 4P05A 5EC1B 1PZ3A 4LSPL 3C75A 4AZ8A 2CAKA 1AC0A 5I74C 4F3FB 1PLAA 3NJFA 3VFGL 1GCYA 2FSDA 4O5LH 4HJJH 2HMID 2XVKA 1JWUA 3ZZQA 3O0LA 4KMLB 2P44B 1BFVL 3CFDB 3UACA 4HJTA 5AL8A 3ZTDC 4B9CA 4D0DA 4KI5C 1F3JB 4I0PB 1VSCA 1DQLL 4CBZA 3ARFC 2PYEA 2VR3A 1GPOL 5KS9F 5J6SA 3FN0H 1GZPA 5I2IB 5JXAH 1A7QH 2XWEA 2N7SA 4PGBA 4NKDB 1UJ3B 2GITB 4Z7VE 1KCKA 1Q9LA 2ED9A 1N0XL 3ZKNC 1A1MB 1J88A 5GRZA 4PY7A 1DVXA 3TT1L 5KJRH 2DLFL 4DKFH 4GSRA 4KKAD 3QE5A 5F72S 3TTSA 3VI3F 1IC7H 4YWGH 4NQDB 3DHMA 3WKPA 5K9JL 4MD4A 5HY9B 4ODXA 1JZHA 1JS4A 1I4FA 4XP6L 3UTOA 2G4EA 1IBBA 1FVCB 4J3OG 4N0RA 5EULV 5E2TH 2AQRA 4ONHA 3WS6A 4KMQA 1KG0B 4ELME 2DQDH 3M1CA 4D0CB 3FOMB 3JTTB 3W5NA 5B3SB 3B7UX 1ZT1A 1MFEH 4HGWB 2BY1A 4UQ9A 4L8CA 1CI3M 1ZA3A 4AI7A 4IRZA 5HDQL 3BIKB 3CFQA 1KLGB 2HTKD 2WQWA 3NZUA 3TF4A 3V4VB 3MJ8A 2ENPA 2E76C 4HIEA 4BHUA 5HHNA 3IMTA 2H6UA 4HJUA 3N85L 1G7MA 2FD6L 4GIOA 2VDOL 4CW1B 3ESUF 2EDHA 4P5KA 3OPZH 3OR6B 5F89B 1LEIB 1OVZA 3FHAA 2V9UA 1E9OB 3QJXA 3DDFA 4KKCD 4Z0BH 1SJEA 3C6LD 3PS6A 1FZKB 4WJ5A 3L9BA 1T6BX 3PWLB 4HMEA 3WE6A 4X4MA 5BS0A 1S7QB 2VDLB 2Y9RT 1NDGB 5AVZB 3TNNA 3VO0A 3GNML 4LHJB 2YBRA 3SGDH 4NO5A 2GKIA 3LNHA 2B4CH 5D7JC 4FG6D 2ISDA 2J43A 4XXWC 4ZOCA 2LU5A 4HUCA 4F2MB 2ZX5A 4ZXBD 1WZ1L 1CIDA 4LRIC 5DUJA 1P1ZB 2BW5A 4HEMA 4CSPA 3ZE1F 4DSYA 2EDWA 1JI2A 1G94A 3GMOA 5DHMC 3VXMA 4EUPA 3DRQA 4M61B 4PH8A 3RPBA 1KYUA 3AM8C 4FQHB 1UEYA 1UC6A 2AEPL 1T0MB 3PGFL 4ZMPA 2E6QA 2AQ2A 3Q3GB 5D1QA 5E5RB 4TNGA 5KVFL 4YE0A 1UFUA 5LO7A 3T0EE 2BNRE 2VDKB 4NHUA 3CDZB 5CJQL 4O00A 4JVPA 5L2KA 5MEPA 1RIUL 4FXKA 3M17A 3EF4A 5LKNA 2NOYA 4JB9H 2I9LA 1NCWH 3QT2A 4PI0A 4QTIH 1DDTA 4L29A 1EHXA 2F53B 3N44F 3PWJA 4WSKA 3WBDA 3FU5A 3KPLA 1HWHB 1WA0X 3A23A 4W68A 4E9QA 4CJ1A 1KLUA 2ZWZA 4QIRA 3VCLA 4KQ4H 1PD0A 1UGNA 2X41A 2IG2L 5FCUH 2JXMB 2BCKA 4WFED 5CR8A 4Y5VA 5J3HD 4BELD 1OP3H 1HINH 3NPZB 4AJVA 5D2LA 4HVBA 1S7SA 3DV6B 4LB8A 5JIPA 1IFHH 2YAQA 4OKVB 4GKZA 4C59B 3KGRA 4C57C 4OLVL 1U8QB 2CKBH 2EZ0C 3L1FA 4N6QA 2EEFA 5L8JB 4G1MB 2OAAA 2CIKB 5IR1A 3MLUH 5E9DD 2XPGB 1KXTA 5FYKU 1D6VH 4IIQC 3IKCA 4JR9L 3AWFA 4HJ1A 3S97C 5GS0D 4FNUA 5EU6B 5F7NC 1WWAX 3MGOA 4ZO9A 1IM9D 3CH1A 3HZKB 3L5XH 1DN2A 3TN0B 2EDEA 5E08L 1P7BA 1CU4L 2DQCL 3DIFB 3T3MF 4DUWA 1U4FA 1ZT7B 2ERJC 3NCBB 4X83A 5CP7A 2XFXB 4OUUA 1A3ZA 2O5XH 5F7KC 3VMOA 2XWBA 5EN2B 2MCG1 2IC2A 2A9BA 1YDPB 5FGRA 1NCHA 4NZUL 4ZOBA 5AYUL 3SE4C 3MXWH 4KHTH 2UY7B 1JNLL 3BGMA 3ZKQD 1Z5HA 5E4IA 2BS71 3MLVL 2FWLB 3EF7A 1ETZA 2YSSB 3LYRA 2WKLA 4JDZB 3QEHA 3DX6B 1EGJH 4K5LA 4O02H 3RWDA 2GFBA 2OQJA 4F8TA 3UTTB 3LEVL 5I0ZA 4CNIB 1J8SA 4TVUA 2NT1A 2PR4L 1XH0A 4FCHA 5E4AA 2DM2A 4BUHA 3Q05A 1HCYA 2WLLB 2P8LB 3MCLL 6PCYA 1TQTA 2BSSB 2XA8H 4OF0A 1MW3A 2Y1ZA 3D06A 1LM8V 1P2CA 2BHYA 3AT8A 2WP3O 3V6FB 4JFDD 3BGFB 4KUCD 4WU7B 1KPUA 2LAGB 4J8QA 1NOAA 4P5MA 4QHNB 1XF4B 3NIFF 5C07D 1TZHA 1PIGA 2X7LA 4NCC2 1QYGH 4FL4B 3FQTB 1MI5B 1L9NA 1PZUB 4G80A 4G7YL 3ZO9A 1HL4A 2HRLA 1BG9A 3NPSC 1X5LA 4ZD3H 5E5UB 1G7LB 4YMPA 2AKRB 2CE6A 1HNYA 2IH3A 2FQEA 3IS0X 3PWUA 2WZAA 1FIGL 4QOKD 4HS6A 1BBJB 1ZHBB 5D7SL 1MXDA 4PRIA 2A9CA 4Z6AT 2E6PA 4R96B 4XVTL 5DD6A 3WKMH 5L88L 1BPVA 3BESR 2ATKA 3OWEA 5JW3H 1JPSH 3DX7A 1YN7A 4YXLL 4WO4A 3MREA 1G84A 3L4TA 3E3QC 3ARGB 4QHPA 1U95A 3EJZC 4L48A 4XMLL 5FHBL 4BE5A 4F7EB 4XN2A 2OL3B 2OV0A 3CSGA 4WUUB 4QXGH 3JWDL 4A55A 2X70A 3PP3K 4U6VH 3M7FB 1QWUA 1IIIA 2F5AL 1IAKB 5TTRA 5AOMA 2IDUA 3AY2A 1EJ8A 4IRZH 2HKAA 3OKDB 4JFHE 5IBTH 3RWEB 1KJ2A 1SGKA 3CXFA 4N8PA 5H94B 3NACL 2Q2LA 4PM1A 2B14A 2GIMA 1HI6A 4P4KA 3D18B 5CNHA 3O6LL 5DJCA 5CJOH 4Q14A 1UD4A 2CBOA 2NY4D 2ZXEB 1A02N 2J8UA 3V0DA 5EUOA 5FM8A 5IQ7L 1C12B 2IBZX 2COVD 2R2EB 4Y2DA 1KC5L 1P5UC 1H3GA 4L2LA 2ICWA 3L3GA 4LPUA 2FBJH 4H13C 2G60L 4PJBE 4XN4A 3M1BA 1INDH 1SFHA 2B15A 5EOTB 1FCGA 2VL5A 3SCMA 1YG9A 3GMRB 4NFCA 1Q0XH 3E2HB 1H15B 1TJGH 4RFEA 1QFWM 1YEJL 4OCNC 1LWHA 5ICYA 1HJBC 5GJSL 1NM4A 2D31A 4FYSA 4N6RA 4F2FA 5I6KA 3NBNA 5JHBA 1BYNA 4L4VD 1KIPB 1T1YA 1ULVA 3QIBA 3D85B 1CDBA 3WDHA 4A2FA 4ZFOB 4EUPH 1RU9L 4HPOH 4NDMA 1A7NH 2XXFA 1HKLL 1EJFA 4ZI8A 4AMWA 4TUKL 3KXFD 3BZ4A 3QQNA 2PXYA 1WBXA 3CPLA 5DGQA 5HHOA 5AUMA 4I48B 1QR1A 1I8KA 2DD8H 1ETJA 3WUWB 2ARJQ 3FO1A 4BUQA 1TNNA 2X4NB 1CGTA 1X6LA 2VDML 3SPJA 2XWZA 3U2SB 4N0YL 2FR4A 2Z8VC 3AZUA 3ILQC 4RFNC 5HHQA 2R29A 4KJWC 1CVSC 5I71C 1OD9A 3CSTA 4PJFE 4YK4B 2BIIA 1PZCA 3CFCL 3WTXA 1A6PA 1KFAH 4Y4KD 3W81A 2X44D 1S7VB 3RRQA 1FL5B 3VSQA 4OJCA 4JM2A 3VXUB 4ZO8A 4LSPH 4AGOA 1K4CB 4MQSB 1IL1A 1XH3B 1MIML 1QX1A 3VFGH 3QUZA 4JFOA 3VWKD 4F7CB 1NM9A 3X2QB 1BJ8A 4PRHA 4CC4C 2XXCB 1BFVH 4M5YH 4DQOL 3C09B 2OMVB 1CICB 4UOW0 3FCGA 1DQLH 3ZDYB 5DMGD 3ETBJ 4QRFA 5DA4A 1GPOH 1B6DA 4R26L 4APQB 2VIRB 2AEWA 2XTJC 4I0PD 4UU9B 1ZE3C 2JI3A 4JCWA 4MDIB 4MX7A 1LP9B 3IETB 3GRGA 2J71A 4JRYA 4OZGE 3V79C 2J72A 1COBA 1N0XH 4LMQE 4Z7NF 3G9VA 4DP9X 3TT1H 2AV1A 5HDLA 2DLFH 2CSPA 3ARQA 5GRXG 4C4UA 2XNAB 2QFRA 5K9JH 5BO1L 1WITA 2ZP8A 4MCMA 1WD9A 3UBHA 2K3TA 5FPIA 4XP6H 3HHRB 3LXUX 1HAUA 3HG3A 1KBPA 3GIVA 4PJ5B 2E4FA 4N5UA 4GP8B 4MS6A 4DW2L 2DQUL 2P47B 4YHOL 3BW9A 1URIA 3AY4C 5HDQH 2OFQA 3O45B 4PP1D 4S2SB 5LG1A 3X13B 4J2QA 4JFVA 3BKML 4L4JA 4P06A 2BVQB 2QADC 4YZWA 3MUUA 1QO3A 2FATL 3N85H 2FDBP 2FD6H 3SDCC 4PVBA 1QHPA 3FSWA 3K0WA 2VDOH 4X6BA 2YPKA 3I6KA 3W56A 5TGBA 2QVMA 3E6FA 1BJMA 4ANUA 4BIKA 1GJIA 1C8QA 3OGCA 4OIIL 4N26A 1IVTA 2Q8BL 2DRUA 3OXRB 1L3WA 4NQTA 2NRDA 3GNMH 2HFTA 4L9LC 2FX7L 4XZUA 3BAKA 2NYKA 5K33A 1BQLL 4PJAB 2DWDA 4F1ZA 4OGAD 1CFBA 1HL8A 5G4OA 1WZ1H 3BWZA 1AHWA 4GEJA 3JSSA 1JFQH 1HEZA 1P9MC 4A2MA 4DGIL 1D5XB 1GYCA 3BUDA 3QEQE 3GJFH 2K78A 4OJAA 4A6YB 1N0LA 2AEPH 3UG3A 4Z3TA 5INCB 4FNPA 4E42B 5KVFH 2GSGA 3V6OC 1ZLWK 1I8IB 3KYOA 4HBCL 5CJQH 5KSBA 2F1EA 3QUKA 3MRCB 3O8XA 3GJEB 4NLHA 4QR7A 2HTLC 2Q76A 5A6LA 4JPIB 4G8FA 2X9YA 4OLZL 2IWKA 4MMXC 1MELA 4WRLA 2NXYC 4LCIH 4PRPA 1S78D 2FO4A 1IV8A 2J20A 3QIWB 4PJ9A 4JG1H 4PGCB 2M1KA 4MAZA 2YK1L 5IVNA 1AD9A 3B3IB 3FB8B 4PWEA 3PDOA 4WI9A 4RRPA 4JFYA 3TBYA 3N1PC 2HB0A 3BP4B 1QQDA 3B7SA 3L9RA 3VFMB 3BQUA 1ZIBA 3J07A 3X17A 4CVXB 3T0WA 4KOBA 2XZAL 5C09B 4N20A 4OLVH 4K3JL 4Y9BA 2E9BA 1E27A 3QDJA 1IC0A 2ZOKA 5IKCA 1DBBL 4JR9H 1R1CA 2J12B 3UAFA 3DI3B 2ZUQC 3QO1A 3KHQA 5I9QB 2IWFA 3FZUD 4IBVA 4I1PA 4JDEB 1WZMA 4W6YB 4HK3N 4OV5A 3RIKA 1JI1A 4Q52A 5EU6D 5SX4I 2DQCH 8CGTA 3OAWA 3NZ8A 1KFGA 4U1LB 4ZMYA 5M94B 1F11A 3WFEL 2YGQA 4NZUH 5E0QA 5AYUH 1F1GA 4FNQA 1WIUA 5HI5C 2ZXQA 1JNLH 3HAEA 1YHPA 4JFFA 3EJUA 3MLVH 3EUDA 3AXIA 4XHJC 2DI9A 4LHUA 3WEAA 4DJMA 4LPCA 5D9SA 4JVUA 1EANA 4OIAA 1XEUA 4FG0A 2AJZB 4NN5B 3LEVH 3W9DB 2COQA 2PR4H 1NZRA 3OHXA 1EEYA 4J4PA 1ZV2A 1NTDA 2KZ1B 3MCLH 1SHWA 1UWXH 3UTTD 4B41A 5B3JE 4YHML 3SGKC 2FO8A 4Y4FC 3OMNB 1UGKA 3IU4L 4O51A 4LMQI 2NMSA 1HWGB 4MZIA 4Y4HA 2YS4A 5IROC 2CLRB 1P5VB 3SGJA 3RNQB 2X4TA 4WWKA 1JUFA 5A2LH 5DZ9A 3QYMA 2XWJB 1JWSB 3AROA 2IAMA 3P2DA 3VFPA 3N42F 5IJVA 4XMWA 4ELMB 2F6AA 4G7YH 1KB9K 4Q58C 1QZNA 3X1BA 1OT2A 4WHTA 2BNQA 3BFQG 3BO8A 5D93C 3MV8A 4E9SA 1MI5D 3QYNA 4PJEE 4RQQA 3BDBA 5ANMA 2WP3T 1FIGH 1L0YA 3NQKA 3OJDA 4GQPH 2PYFA 4XRCB 5IMLB 3DSNB 1V27A 3L3JB 4YXHL 4XVTH 4JGJA 5L88H 3G5YB 3WY4A 4GUQA 1VPOL 5C0AA 3NCWA 6TAAA 3W39A 4BSVB 2DQGL 4YXLH 4H1LA 1ILSA 5DO2D 3GSOA 3DUHA 5FHBH 4XMLH 2YD5A 1KPVB 3NCXA 1KCRH 1E0OB 4PLKC 3NCEB 1Q9KA 4P5SA 3ME0A 3ARGD 2MCPH 3JWDH 3FB5B 5CEZE 4NKQB 4IJ3B 2F5AH 2VSKB 4HZ1A 3U1PA 2E59A 5BCAA 2FJSA 2XBDA 5A43C 4Y2OB 2XG4A 5H37H 1I9IL 2BJML 4RMRA 2RR3A 1PKOA 3UXFA 2BY3A 3NACH 2VLRB 4MAYA 4ABUA 3U25A 4GG6F 1Z9PA 3O6LH 4GO6B 5DA0B 5J1TC 5JPMA 1U8JB 2EAEA 5EOCJ 1T22B 4J3BA 1YLBB 3SDDB 2EYRA 5E5LA 4JJHA 3I75B 4XCNA 5DJXA 1KC5H 4KKPA 1MZYA 3QWRA 4J6RL 3HZVA 2G60H 3KWXA 3LZOA 2PTUA 2BNRB 1JHLL 3VG9C 3X12A 2VDRL 5CKAA 2D4DA 3UPRA 4R3SB 1ONQA 2GABA 2V7NA 3CX5J 4CDGC 5I1AB 3RIFF 3RDJA 1XVSA 4KTGA 4TV3A 1YEJH 4P2QD 4QRQB 5GJSH 4ZMAT 2ZOUA 4MFHA 1OAZL 5EEYA 2UWEA 1MEXH 5B38B 4PV9B 5BZXA 4L0PB 3V52H 3RX8A 5F0PB 1RU9H 4G9FB 3PL6B 5AOJA 5DD3L 4WHYH 1HKLH 3RUGB 3RVUC 4JHUA 2C3VB 2X2UA 3D85D 4TUKH 2VC2B 3QZBA 7PCYA 4WW1A 4WTQA 1AG0A 4ZUSB 1D7BA 2VAAB 1KTRL 1OGTA 3P3SA 1NCDH 2DZEA 2VDMH 2XVLA 1ZE3H 4N0YH 1KGJA 1MCWW 2R0WL 4LBEB 1C5CL 3DO3A 1IEAA 1YEIL 3CFCH 4XNMB 2NQDA 4XAKE 4J3TA 4P2OA 3GXUB 4A2LA 2NNCA 2R51A 2C1OB 2NUPB 2I60L 4UIKL 3RG1C 4F5CA 5KYWA 1SVCP 5GGUA 1LD9B 1OGAA 2H0PA 1NINA 3PLYA 1TUPA 5EO1B 1MIMH 2QHRL 4FI6A 3DJZA 3VXUD 3SPGA 4HFWA 2X09A 1A9EB 4KITB 1YNLL 4CL7A 3I9PA 4YUEL 1Q1JL 4P2CG 3II2A 4R26H 4XMTA 4PW4A 4BRVA 4Z7IA 1G87A 3PPSA 1MFDH 1CICD 2R2BB 4KGLA 3QIUA 1GC1L 1XSKA 3RNKA 2W0PA 1OE2A 4APQD 4CU8A 3PWPA 2ZKHL 3BPNC 2KLSA 2RAMA 4M03A 2C9PA 4H25A 5F9DC 3O9WB 1HQRB 2ZWNA 4KTEL 3A4DA 4YHZL 5BO1H 2X6VA 1N59A 4HKBA 1WGOA 3RB5A 5DU7A 2Z7YA 4UMSA 5I17A 3LRHA 4UDUA 4LLYB 1J9QA 1J8RA 1JOIA 2PO6D 4ZS7L 3S37L 3T8XB 1ERNA 2F9BT 3ARWA 3O3AA 3V6BR 1PS3A 4DW2H 2DQUH 3T08A 1T89A 4R9HA 5MI0B 4H8QA 2FZ3B 1HSAB 2YAPA 4YAQB 1YMME 4PJ5D 1NFIA 4GMTL 3D1MC 3LB6D 1XGUB 3BKMH 5LNGA 3BRFA 2C34A 3FQWA 2NR6D 4WTXA 1F2XK 2FATH 2PW1A 5DJZA 3LV3A 3OX8B 4FQXC 4HCRL 1KY6A 2NNAA 4X6DF 4JREC 5EBWB 4BKLB 2WXNA 1YN6B 3V0GA 1IKNC 1MHCA 2CK0H 4RAVA 1AGEA 4HIHB 5ALBL 1BVKB 2V2XB 5D4HA 4CKQA 1WBYB 4OIIH 4D0BB 4ZFFB 3DUUA 2Q8BH 3FPYA 1Z3GH 2G75B 4NQXB 5L8KB 1QSZA 3UTSD 2FX7H 2VKWA 3NJJA 2NY1C 1BQLH 3LKQA 4BFFA 3BZEB 1DQJA 2GK0A 3GSXA 3QXVA 4KK6C 3RWJB 2BZCA 1NKOA 3HHMA 5E23A 1NMCC 1FN4A 4GKSA 4G6JH 2UX7A 4FMFA 4RA3A 3DDGA 4NPJA 3IE9A 4M5ZL 1DLHA 4DGIH 1RK0A 2A5UA 4XNQA 1MLBB 1IKOP 2IIJA 4H1LH 2BW4A 4FADA 3L5IA 4BM7A 3MU3A 3KWWA 2GSIA 4U3SB 5I26A 3SBPA 4K5OA 4N3UA 3BDYL 4HBCH 3LMJL 2Y7NA 4PJBB 4XCYA 5F44A 5HYSG 5KS9A 4MZ2A 5KAQG 4WVRA 2W65B 4QLWA 2DLEA 5E95B 4BBWA 4B9KC 3UYPB 4F1SA 1A6AB 4U1GB 4OLZH 1TTRA 3ETSA 1F6FB 1F3RB 1S7XA 4XP5H 4IMKC 1AMXA 4QMEA 3HS0C 4JZJB 3QP3A 1MJUL 3AAZA 5DVNA 2YK1H 3WL9B 1N10A 4ANXA 5B4MD 4LVNC 4OD2A 3VI3A 4PJ8A 3QIWD 4KI1A 2YUWA 3K71A 1FV1A 4TUUA 2DN7A 3TASA 1HILA 3MRPB 4MNQD 2OYKA 3IPEA 1WFIA 2VLJA 4LNRB 2XZAH 3RWGA 2VSDA 1BF5A 1VGEL 2MMXA 2PPEA 3B9EA 1I85C 4K3JH 4JKKA 5DZNA 4LSRL 5GRWA 4YPGA 1KIQA 2Q7AA 4HAGA 1FZMA 4F15B 2GJ6A 3MJ7B 3SO3C 4JFZL 4EI6B 5C09D 1DBBH 2BX5A 3VX0A 3CNKA 2Y24A 2CHZA 1H9DA 4YDJA 4NQEB 2HVKA 4AITA 1RIVL 4PJFB 5IMMB 3PHQA 5FFGA 1R3JA 1HC1A 5I6LA 3DOIA 3SD2A 1QRNB 5LGJA 2ICEA 1OZUA 4BH7B 2EKSA 4NZFA 3OKMA 3CDYA 3LQZB 3TCLA 4BFJA 1UVQA 1Y6NR 3EJRA 5F2FA 4NUJA 5IJKA 5A16A 3ZYJA 3WTVA 4WO0A 2YKKA 3WFEH 2CIIA 4LARH 4H88L 3UX9B 1IJNA 1UA6L 4XVJL 3IDIA 4TL5A 5TK2A 5FYKE 3MV01 1NAKL 1LWRA 4ETYA 2BDNL 3I9IA 1UXMA 5KYUB 2CG9X 3SQBA 5EEXA 1EFQA 5HHXL 5I6MA 3WI9A 3TEYA 1NGZB 2ZOOA 2X4OA 4N2MA 1W91A 4ENEC 1WT5C 5F96H 4OZGB 3B34A 3UZVA 4MQ7A 4Z78A 4X6FB 4W9CC 4PJHF 5DI8B 5KVEL 4R7DA 5I82A 2HJKA 1YY9D 5ERWA 3DIVA 5C9KA 5IHUL 1T3FA 2DW5A 3BOVA 1KIUB 3IB4A 4KO7A 4IEFA 1BYPA 4EDWL 2CA3A 3NA9L 4FGMA 2IH9A 2XYBA 3T09A 1JZDC 4KXCA 1C7SA 3BAXA 1LK2A 3G6JE 3DHJA 4LIQL 3EG9B 4GAFB 2D0GA 4GW1B 2NNXA 2G30A 3KJ6L 4FMVA 2MTAA 4X8GA 3SPHA 5T33L 1HHGA 2K1MA 3VH8B 1FDLH 1Z6JT 5JHDE 1VKXA 4L3CB 4WKXA 3G04B 4EN3C 4YXHH 1FNSL 4I2XE 1YQVL 5BOJA 5JZ7D 4X0NA 1VPOH 1PNDA 2I9TB 2HKHL 3VXPA 2DQGH 3LZQA 1NANI 4ZAKA 3HCVA 3KDMB 3TURA 4IBWA 3HI1A 4J8RB 2AXGA 5AVVB 5L0QB 4HIXL 2IMNA 5DQ9B 1XH2A 1OIOA 5DF0A 2X3CA 1TCMA 1WFUA 2AERT 2R2HB 3CBKB 3K0YA 5DUML 3V0HA 8PAZA 2NW2B 1R3LA 2R1YA 3P9MB 1O7SA 2G5UA 3LVTA 1HZHL 5A3ID 2CO6A 2B08A 1LMKA 3U4AA 4QRTB 1I9IH 2A6JB 2BJMH 3KPPB 1OCOB 2W88A 1YQ2A 3L7FA 5DRNA 5E1QA 1OM3L 1P7KA 1KEGL 3LNFA 4YE4L 2PCXA 5CWSB 2OYMA 3JQOB 2NW3A 2H2PC 4S10A 1U93A 3KLLA 3MA7A 1NA8A 3AACA 3QEQB 5IJCC 1A3QA 4LQFL 2M8XA 4J6RH 1U6AL 3UZEA 1MRDL 1XL6A 2MFNA 2WNGA 1ZSDA 4N1CA 2WKGA 3SDDD 4ZMNA 2H9GB 2FSEB 3EADA 1UEMA 3LKSB 2VDRH 4HJ0C 4PW3A 2DJ4A 2AK1H 3VRLF 2WUBL 1L9SA 3B9KB 3DOSB 3T0ED 3NUKA 1QHOA 2BNRD 4KRMB 1F41A 1OAZH 2JIXA 4HIIA 3ES6A 5E7BA 5K5YA 4BFBD 1T1ZA 1BP3B 3VB9A 4JKWA 1AKJB 1TVDA 1XCTA 5DJDA 2K8MA 3MYJA 3RJDA 3LY6A 4LCVA 4P3DB 2C9AA 5DD3H 4YZFF 1XXDC 4R84A 1JGUL 1XD1A 4NO2B 2WSDA 5IB2A 3T4YA 3T0BA 4X4KA 3WENA 3N1GC 4G9FD 3PL6D 2AZUA 3B1UA 2OCCB 5IVXA 2PTTB 1TXKA 2XY2A 3BSZA 4BE6A 3HE7A 2KERA 5CJXA 1EMTL 4MQXC 2ZWKA 2B59A 1FO0B 2Y4SA 1HIML 3EO1B 2R0WH 4M7LT 1C5CH 3FO9B 5TF0A 1YEIH 3FN9A 4CSSA 4NBYB 1CURA 2V33A 2FNBA 3C8KA 4DKTA 3PFQA 4G42B 3HE6A 4MNGA 2CGYA 4UIKH 2F7QA 2I60H 2WBJB 3LKPB 1SUJA 3DYOA 4IOFD 4M7ZC 4NO0A 2WXIA 1ID2A 5DCCA 1KYOJ 1HT6A 4NBXB 3KYMA 5F3HB 1XGTA 3US9A 2DY2A 4MLSA 1ECZA 3F85A 2WLKA 1XXFC 4DP2X 2QHRH 3OHMB 5CJ8A 3TA3B 3HVNA 2DM3A 1P4LB 3UO1L 3CD4A 5FDWB 1NUGA 1A7BA 4UYPA 1B4TA 5FFLA 1GIGH 4FYTA 4Z3HA 3DC0A 1YNLH 5T3ZH 3GSQA 1MZZA 4YUEH 4PCSA 1Q1JH 2A9ML 5L2JA 2FIKA 1AGDB 5EBMB 4R90L 4N9OB 1IARB 3FRPB 3L3OC 1IQDA 3UYRL 4HC1L 3WFZA 3DVFA 1GC1H 4AT6A 3RIFK 3DURA 3JV4A 4L0ZA 1A6VL 2LTQC 1UOKA 4BZ1L 1UKTA 3T5WA 5TQ0L 2OXGA 5CS7A 2ZNXA 3WCYA 1LILA 4KTEH 4YHZH 5C0JB 1SLUA 3GHPA 3WO3B 4AQ1B 3O9WD 3VXNA 1Z2KA 2R23A 5D2NB 4G9DB 1GJUA 1R46A 4BFIB 4ZS7H 2GB2A 2VMFA 3S37H 3UO8B 1EV2E 4MA7L 1RZPA 5F6IC 1J1OH 1ZCRA 3ET9F 3SY0B 3UBFA 3TFKC 4FQLL 3GBEA 3DO7A 5F9OH 2DPKA 2H2SD 3QPQD 4GMTH 5CP3H 5ISZE 3K72A 4NWTL 5ICZA 4I4WB 3KPOA 5AKSA 3QHTC 1CF8L 1RJLB 5D5MA 5FOBB 4GBXD 5GJTL 2RD0A 5HDOA 1AOZA 4HCRH 5K9KA 5EO9A 2FRGP 4H0HB 3PABB 1CFMA 3PE9A 3APMA 3AU1A 1RZFL 2K4WA 2V8LA 5ALBH 3ML8A 4N86A 1JN6B 3D2UD 4ONGL 3S8FB 4QRAA 2A4ZA 3C6SA 3LZFL 3FTZA 5JIQA 2ZOTA 1J10A 3T6ZA 4E2OA 3VD0A 3ALPA 2V2TB 2ZF8A 3MLZL 4X98B 1EUTA 1M2OA 2E7DA 2IDCA 3CIQA 3CZFB 3F7RA 4NQCE 5HGAA 2OMYB 3HRZB 3TO4A 1OTSC 4IRJA 3D69B 2H41A 1I1AA 4K71B 4HD9A 2ATPA 3HI6L 1URZA 1UG9A 1EFXB 4LOVA 3W11C 1HWWA 4JFHD 4M5ZH 4HHAA 4IRSA 2OR9L 4GW4B 2FX8L 3ULVL 3NIDF 4PJGF 1SJHA 3AU0A 4PB9L 4QJ4B 5IM7B 4I18C 4YNYA 1O5PA 2NXZB 2VUOA 4LF3A 1TJHL 3BDYH 3LMJH 4ELKB 3GXDA 1TCRA 4XTRC 4ACPA 4Y0GA 1AD0A 1BMGA 3F7VA 3QORB 5EZLA 3JZ7A 5DFAA 1BHGA 4E36A 3QA3A 1MCSA 5F1SA 2IDTA 1GJWA 4JDVA 4ANWA 4PVLA 1EXUB 1OAJA 2VQ4A 3HPLB 2H6OA 3HUJF 1MJUH 1FVEA 1JF1B 2UYLA 5GZOD 12E8L 5HGBB 3X1EA 3ARBC 3OAYK 5EDXA 1DR9A 5C0ND 2R1WB 2I24N 5JHAA 1PJ9A 2D2OA 2YA1A 3EJYC 5AB2A 5CZKA 2LW3A 3NESA 2IGFL 1RJZA 3HN5A 5BRPA 4G6ML 3RFZC 1ZANL 1SLXA 2L0DA 2Y2TA 1ORQB 3ULVC 1T83A 5C9JB 2FQGA 1VGEH 5HDWA 3VFNB 3PU7A 3GSUA 4RGOL 1JD9A 4NPYA 3QDGA 5DHYA 3LKOB 1IKFL 2PF6A 1DVQA 1MJJB 4QRSA 4HC1A 5K93A 1W8EA 2CDFA 4NZ8A 5C0CE 1RIVH 1IT9L 4HW6A 4YGVA 4M56A 1MHEA 1FSKC 2H0EA 1JWMB 3UJJH 3O2WL 2ZD0A 4LLAA 1DBAL 1NICA 2O6CA 3F7PC 3CSYB 4Y16A 2BIOA 2WQSA 4YSDA 4JFTA 3MODL 3AWGA 4JKLA 4H88H 3KYKL 1UA6H 4XVJH 1UWFA 3TBBA 4BK4A 7CGTA 4EXPX 2YEQA 3QEUB 1NAKH 4OM1L 1NH6A 5EO0B 3L2MA 1QW8A 1PG7X 2GJZA 5FYJU 1OB1A 5C08A 5HHXH 1I1RA 2EYTB 4NT6B 1PCSA 3V9CA 2YWYA 2X6AA 4DVRL 1IBDA 1QPXA 1BYOA 1OAKL 2YMTA 3QG6B 3ULUL 4XZ4A 3R1GL 1M7UA 2HXAA 4LDOB 5AB9A 3B9AA 6CGTA 1QSFE 4AXWB 4ZX4A 1KNOB 4Q0XL 1Q9WB 2H1XA 5IHUH 4OLWL 5CU9A 2FEDC 4EDWH 5HYFA 3NA9H 4EN2A 3WDJA 3EDJA 1YCSA 2JE8A 3QR0A 4HALA 1ODUA 2XN9E 3CJJA 4JPVL 1CXLA 1LDPL 4FG2A 5TDPA 5I1GL 4K23L 1BA9A 2Z7WA 4MRCA 2MRYA 1BREA 2LR4A 4YDIL 1J8HB 2VN7A 2YSTA 2NY5L 3O3EA 3BMVA 1QFWI 2MWCA 1RY7B 2ADJB 2FH6A 3I84A 1L9QA 3GMNA 4KOCA 5T33H 5I8OL 5LDSA 4JPSA 1ZLUK 3VFWA 4ICWA 5FHAL 1EUUA 4H4NA 5ITFB 1MVUA 2QVIA 5LBSL 5EBLA 1FNSH 1YQVH 3FQRB 2QELA 2J88L 5DJ6B 2HKHH 4MCZA 5DEJA 3CC5B 1D5MB 1P53A 5JORA 5D1ZC 1GYWA 3MR9B 1R5WB 3L5JA 3VWJB 2LOEA 2UZXB 4G1EB 4PR5B 5GGTL 1IB5A 2Y23A 4K2UL 1DQDH 4HIJB 4HIXH 3ZMRA 4FXGC 4AW4A 3RVWC 5DZOA 4J5VA 2IJ0C 5DUMH 4U1IA 3QQ3A 4QF1A 5I73C 1KTBA 2PP9A 3H6JA 1J9RA 2A9NL 4S1DD 1HZHH 3TBSB 4CVUA 1F1DA 4J2XA 3QFJB 4JZNA 3VDCA 1PFOA 2OBGA 1OM3H 4B9YA 5FX3A 1KEGH 32C2B 5EF0A 4YE4H 1WDAA 2X12A 3FUJA 3D3VE 5FB8A 4GRLA 5AZ2L 5I1EL 5DZJA 2CHXA 1QRKA 5GGQL 1DE4B 4LOUD 5GSRA 1N67A 1BOYA 4LQFH 3EYVA 2RALA 2UV3A 2MPVA 1IBFA 2AQPA 4JCLA 2BSRB 1U6AH 4R2GC 5HVWA 1MRDH 5IGXL 4TNEA 3QEQD 5MENA 3F64A 1MF2L 4I5BA 3AB0B 3GRWL 4ICXA 3NJGA 4MRBA 4K9JA 3SIKA 1CFQA 2WUBH 3T3PF 3LH8A 5IMOA 4Z7OF 4JJ5A 4Z3IA 1OL0A 4XPGL 4XXDB 4GS7B 1R33A 3H7LA 5BOZG 1RI8A 3N0PB 2C5DC 4N3TA 5CGYC 3B9KD 3RWCA 3RVTD 4HPYL 4IOSA 3ZE0E 4IIZA 2CHDA 4FXLA 3TBVA 1K3ZA 2FL5A 4N28A 4P9HL 5ICXB 5HVHB 1K5WA 5IMKA 3ILPA 1JGUH 1AKJD 4X5LA 3BXNB 1S9YB 2C4XA 1HHKA 2HN7A 2XA3A 2A74B 3RWFA 1AQKL 2D3VA 2NZ9D 5FA4A 4C56A 1Y07A 4OZIE 2BWIA 4DKDC 4AUUA 1EMTH 5I66A 2V17L 3MQIA 4MZ3A 3NJKA 3UP1A 4KKAC 1HIMH 4MS8D 5AYTA 4EPSA 4FEMA 5FK9B 1X4ZA 5KYXB 3IDNB 4R0LC 2N1KA 1CGWA 3AGWA 2EECA 1T5WA 2QLVB 5B1JA 4Z1PA 5BV7L 3DGCR 5JQ6L 4NP4L 2VXTL 5F7FA 5FO7B 3D12B 3LEXA 4G3YH 4AYBA 4RMVA 3Q2WA 3HB3B 3SE8L 2PKDA 3H9SE 4ZMWA 3VQ1C 2Q7YA 5JA8B 2WBJD 4KY1L 5IB1B 4A2EA 3QO0A 3UO1H 5AZEL 3PP4L 4EUPG 2HTKC 5A7BA 5CFHA 2I5YL 3NABL 4ETQA 3DROB 3TA3D 1NGYB 3VXOA 1I3RA 4MD5B 1CVRA 2A9MH 4R4ND 3KVDD 4PJCE 1RL1A 2JKIS 4S1QL 4FLHA 3LKNA 1E4KC 4R90H 5EWIL 5JQIB 1DYZA 3UYRH 4KKCC 4HC1H 1UM5L 1TVHA 3Q2LA 4QHUA 2NUTB 3C6LC 1MH5A 1NAML 4GG6A 1A6VH 1XFPA 3AS3A 4F20A 5LBSA 3WN5B 4JQIL 4TYUA 1PF3A 4BZ1H 1IGYB 5TQ0H 1G6RL 2ZUTA 3PJSB 4OF7A 2OMUA 4FG6C 4HJSA 1AP2B 3KCPA 1B0RA 3ETBF 2QDVA 2YRBA 1W0WB 4GAAA 4ZXBC 1BBDH 4OFYD 1QI5A 2ESVA 1S5IL 2WXRA 1NGXB 4L8SA 5AOKA 1SYVB 3A22A 1ZKAA 3QQ9D 4OZ4B 3G6JB 4DHLA 1QUPA 3CN1A 3HLKA 2YLKA 4FQLH 3G5XB 1BQKA 3QZLA 4KKBD 1ND0A 1S7WB 3GSRB 5FWRA 5GS0L 1N64L 4H8HA 3O4LB 3G3LA 1ZGLP 3NSYA 3RX9A 1A4JB 5JHDB 1CF8H 3B5HA 4I2XB 2P8PB 5GJTH 1AQHA 5IFJA 2DKSA 4V2CB 4N0UA 5AW4B 5GS1C 1MWAB 3SBWC 3GMMB 4YHLL 1XEDA 4G8IA 2YAOA 4QNPE 5J1AB 3QYCA 1Q0YL 5JPNB 1RZFH 3ABLB 3J2PA 4HWBH 4ONGH 3OAUL 3EO0A 8FABB 3MCG1 1DQQB 3LZFH 2FEEL 3TVMD 2Z0BA 3NSDA 1VFUA 1UASA 5J3HC 3GRWA 2DWTA 2Z4QA 3MLZH 4GO8A 4LFHD 3V0AC 3IAGC 3GUTA 2FBRA 1QLRB 2XZZA 4NIKB 5GQBA 2JJSC 3FAWA 1VEPA 4WDIA 4X4XB 1IM3B 1ZVYA 2BVUA 2XX1A 1INQA 4RDBA 5CEZD 2G5BB 3WJJA 4I0KA 3DOHA 4B50A 3TZVA 2OR9H 2X4PA 3D7PA 3CTTA 5LBGA 3UGXA 2FX8H 5GS0C 1O7DC 2XWTA 3FMGL 3ULVH 4ZQTA 2FAUA 2FQDA 1QR4A 2QKIA 2ZIDA 1OT4A 2V3FA 2OXHB 1RK1A 3L5WA 2CLZB 2FYVA 1TJHH 3O3UN 3GWJA 1HSBA 3WD5L 2Y7QA 4JEGB 4S0SD 5I1KL 3LRLA 2Q9OA 1EJOL 5DC2A 3C08L 5F7YC 2NXZD 2Z92A 3FCUB 2D7NA 1F2QA 2NY3B 3MRRB 1CLZL 1WCBA 2WCSA 5EEWA 5KYYA 4V1DA 3UAJD 2W0LA 1V55B 3SDAC 2A6IA 4Y5XC 3EGXA 1JTTA 12E8H 1ZXQA 5J9PA 1T5XB 1U8HB 1WFNA 1H6FA 3EDFA 3S98A 5D7EA 2MQ0A 2DJSA 1CK0L 2WYZA 2IGFH 4OCSH 2ITCA 4G6MH 1PG7L 5DUBB 3BQVA 4U6YB 5AKTA 1NIDA 4YN3A 1XWVA 1ZTMA 2CHNA 4YDZA 3EDDA 5J57B 2ROYA 3DXAA 2G3ZA 3V4PB 1XF1A 5ILTL 2GAZA 4RGOH 4M8QB 4M1CD 4Z7VF 4OZHE 3TTYA 2FT6A 5C97A 1DDHB 1IKFH 1DCLA 3VXTA 1GMEA 5HHPB 5C0BE 1C9SA 2HFEB 2ZSWB 3DBXA 3VD1A 2Q0ZX 1AIFB 4TLKA 2O93L 1NAMA 5CHNB 3STLA 3FFCE 2EIEA 3O2WH 3TIDB 2CO1A 5I16B 2NY6B 4JQIA 1DBAH 5HJDA 2OW7A 3BZDA 2WTRA 2OMTA 2XQ0A 4XAKD 4EVNB 3WFDL 1K72A 4JFXB 4X6DA 1SN2A 5BUGA 2XFGB 3MODH 3T71A 2BP8B 3V10A 1U3HC 2WD0A 5IOKA 3C5ZD 3KYKH 3FQNB 4HXAL 1II4E 4Z77B 5JNYB 1G43A 4MGXA 4OM1H 2VMDA 4R8WL 3OQRA 5G5DA 3Q5OA 3HMWL 3UJIL 2WNXA 1V7NL 2APSA 2DJMA 2R8SL 5IB4A 3MC0A 1SY6A 4DVRH 2AS5M 1OAKH 3ULUH 4WKZA 1N8ZA 1S8DA 2W8CA 4LCCB 1TQCB 3ERXA 4Z7UE 4KVCL 3I6GB 2YHGA 4U1MA 2LVEA 4NKOA 1BVLB 1LO5A 2XKNB 5MEOB 1NFAA 3VFRB 4UTBL 3FB6B 4MBOA 1KXVA 4PREB 4B95C 2B3RA 4OLWH 5T1LB 5K59E 1PDKB 5DR5L 4RSYA 5C70A 2GJPA 2OR7A 4N2CA 4JPVH 3SEPA 5I1GH 1LDPH 1G7JA 4XVSL 3HZYA 4K23H 4WFFE 1BM7A 2NY4C 1A3LL 1W16A 4CMHB 3RE0A 5EU3A 4G5AA 4YDIH 3NJXA 4U3HA 2NY5H 1FAKT 4AYID 3PNWB 3UC0L 1NSNL 5I8OH 3ARTA 4PCTA 3KW8A 3VSTA 2YD9A 1TYRA 1MDAA 5ISZB 4YC2B 1NLBL 5LBSH 3L7EB 2VITB 3SKMA 5ALCL 5T3ZE 5A6IA 3LRSA 3QQDA 2J88H 2NDGA 3NPSB 2VNCA 5HVFB 1U8NB 4AQEA 1K5NB 1PNCA 4PJXF 1ZVHA 5C0IB 2CALA 2EO9A 4J3OD 4OZFA 1KXQA 4AIZA 5GGTH 4K2UH 5JXEC 3QNXA 1H6EA 3INOA 4HH9A 4CMMA 3VWJD 4U1KB 4ZRGA 2QHLA 3WIFB 3ZKSD 3ZT6A 4I77L 1RJCA 5D1XA 1BF8A 2A9NH 1M6OA 2AW2A 4QO1B 4NQCB 1REIA 3O3DA 3NZHL 1BLNB 4M93B 2CJSA 3VXSB 3EOBA 4GW5A 3VACA 3WY1A 1D5ZB 3DMMA 2ZP0T 2E9GA 3PQYE 5AZ2H 3QFJD 5I1EH 3AITA 4X4YA 1GVIA 5GGQH 3GS4A 4HWZB 3KMDA 1KCLA 3HG1A 1BCIA 2I69A 4M6ML 1B6UA 4O2FA 4PBVC 3BAYA 3QDHA 4WV1C 4Y4KC 1IEBA 2X4RA 1QSEE 4GYBA 4JL2A 4Q6IB 4N2BA 4JRLA 1GS7A 3ZZLA 4DGUA 1ZA6B 3K6DA 1SLVA 1MF2H 4JLRB 4H0IA 3GRWH 3T2OA 5JYLA 3D6GA 2AQ1A 4P2RE 3LXCA 4FYQA 4QXVA 1NUDA 1U91B 3BJ91 4YX2L 2BIMA 4XPBL 4GEIA 4XPGH 3B7YA 3VFVB 2E0PA 3HJ0A 2E8ZA 5H37G 5DMGC 2MQCA 4HPYH 4I89A 2J1ZA 2P7TA 1T1WA 4OUOA 4MJHA 3JYCA 4PJHA 5AWNL 4AENB 4G6AD 3EXLA 4OV6F 4G5ZH 4I0PC 2F7IA 3CK0L 2CO7A 3L3IA 1E6JL 4P9HH 1VFBB 2V7HB 5LNDA 3NVQA 3O11A 2RCSL 3GSNB 2WW8A 3KL5A 3TNMB 5DSCA 2W60B 5E6SB 4AEHL 5K9OB 2G9KA 5JHLL 1YEHL 5IY5B 4YL4A 1AQKH 1R47A 3V4VL 5KOVC 5KJ4A 4FFVD 1OD7A 3PDDA 1FNEA 5I1DA 5DD5H 4ZPTB 2VN5A 3HMXL 1R34A 3N55A 4JFSA 3MLWL 2V17H 1UJ3C 1QUNB 1OY3B 4MCYA 3S6CA 1GA2A 4KKZA 4HZLA 3VI4E 2JKXA 5C0CB 3RWHA 5BV7H 5JQ6H 2BY2A 2F08A 4NNXB 2VXTH 4NP4H 5IB3B 3W0WE 1CWVA 1IEHA 1ZY9A 5FS5A 1KUMA 4ZQKB 2B77A 2IOOA 3SE8H 4UTBA 5HJ3B 1VA9A 4KY1H 3FBQA 3T6VA 1XF2A 4L4VA 3PP4H 4PP1C 1CPUA 3IU3B 4LVOC 1X5FA 3N41B 2I5YH 3NABH 2HT2C 3F7KA 5E1AA 3U79A 3DO4A 4IK6A 2G2RB 3Q2CA 1CN4A 4X5XA 1Z9SA 1AXSB 4HETA 4HKJA 2NX5E 4KRLB 3C8HA 3WMQA 4IDJH 1W15A 1XBDA 4GI9A 2CLVB 4S1QH 2BZDA 2JKTM 2ZUUA 1N68A 4WU5B 1U30A 3QULA 2ILLA 1SXSA 5JIMA 5FYKD 1RP8A 1UM5H 3VD9A 1OLZA 3OAYH 1NAMH 1TTCA 3J7HA 4G7SB 1BQ5A 2MQGA 1YEDB 2VDKL 3ZYOA 1QSFB 3KH3A 4JQIH 1ZHNB 5LG6A 4PJ7A 2G0KA 5H8DA 1G6RH 1ACZA 1H8OA 4JN2B 4GI6A 4RRPG 4H8PA 3MNWA 3PJNA 4XI5D 3EYOA 1SHMA 3VWKA 1S5IH 4FDWA 3CFBA 2XN9B 2VXSL 1BPLB 3VGEA 3QJQB 4PJIF 1EEQA 4AKQA 1E9QA 2JKSA 1JRHL 5I1LA 1F4WL 4K7FB 4ES9A 3S8WA 3OF6A 1IGIL 2W0FA 3ULSA 3ZU8A 5D96B 1YNTF 4H5SB 5EA0L 3AMLA 5GS0H 1KLFB 5KSUA 4TQEL 4H0LC 3W9EB 5BRQA 4Q6KA 4FCAA 4FAAB 4BFKA 1LE9B 1USQA 3L3HB 4YIQB 1JNJA 1QPPA 4P23C 2CCWA 4YHLH 5DZLA 4ZTOH 1WP6A 1B90A 1Q0YH 3VFOA 4YSUA 5JHDD 4TOYL 2WYTA 2P5WE 3OAUH 3H53A 2BOBA 3HAEG 3WEXA 3VQMA 2DLIA 5CD5D 4LHUG 3AW5A 1JXJA 2D03L 1AGBB 3FUKA 5C0RL 1N12A 4M4RA 1AIZA 1FVDA 1HL9A 1U8MA 1AO7E 1WC7A 2DWXA 4XE5B 2P4AB 3AJ7A 3FONB 1THAA 1PZ2A 1DJSA 1EQWA 1L9OA 4OJDH 3D3VB 1IM3D 4HS8L 4EI0A 1U3NA 4HWNA 1FFOA 3FMGH 5LUMA 3RZCB 1K8DB 4HBQA 2YMOA 3QHZL 4QRPA 1JDCA 2IO5A 5J8OA 1ES0A 1CLYH 4ZFZB 1DVUA 1CLOL 5EZJB 3V4VA 1QA9A 1LK3L 3WD5H 1NBYB 3QXDB 3HMXA 1ILUA 1VDGA 5I1KH 1EJOH 5I5MA 1B4JL 2FWOB 3NCJL 3TN0C 4LLMA 3MBE