4JDEB

Crystal structure of pud-1/pud-2 heterodimer
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
146
structure length
143
Chain Sequence
SGVTEQWAKVDIENKSDHVFKFQVLHQYTGNALEASKWVKLEPNQSAQILEKVHYNTGPFTTGTDNWKVHGIKQIETNLDDVVDGKVRILGEAWRSGHPDGADWKKHTLRVEDHAQTTVIKVLEKEVQFVSKSGTSTTDFYRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Protein F15E11.13
publication title Characterization of PUD-1 and PUD-2, two proteins up-regulated in a long-lived daf-2 mutant.
pubmed doi rcsb
source organism Caenorhabditis elegans
total genus 34
structure length 143
sequence length 146
ec nomenclature
pdb deposition date 2013-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF18457 PUD1_2 Up-Regulated in long-lived daf-2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3820 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4jdeB01
4JDEB 4JDEA
chains in the Genus database with same CATH superfamily
1MELA 3WFEL 4AITA 5LKNA 1YEEL 3PQYB 3O2DL 3QJOA 5MI0C 5DEGA 3S3PA 3WENA 5ETUA 2FUQA 3NIFB 3QDGA 4HEMA 4PJXF 4KROB 3GLAA 3NK3A 3BPCB 3GBNH 5KVDH 2AEIT 2QVMA 3FB6A 1FFNA 3QWOB 1EHKB 4NC1C 1F4XH 2EDLA 1UT9A 5D7IA 9PCYA 4L0YA 2DQJH 4RMQA 1W6LA 2DKMA 3PDOA 1A9EB 2GIXA 4GKOA 5EN3A 5IVXA 1NAML 5JIDA 5F9AC 5CBEB 1WZ1H 4G5ZH 3S34H 1FNEA 4W9HC 4MMZC 1GC1C 4ORGA 1UHVA 5H94A 4B9GA 3FYIB 2VE6A 3P40A 1PFOA 3O0RH 1ZJAA 1KNOB 2HJKA 3OKOB 4ERSL 1MRDH 4I1NB 1IGCH 3T04D 4TTDC 3LS4L 4CBPA 4ONOA 3SPGA 2CZNA 3K80A 2IBBA 1QX1A 4AQEA 4U33A 4GMSH 3KEDA 1CIUA 3NZUA 5K33A 2YD0A 1C9SA 1QASA 4D8OA 2DB8A 2MCPL 1I8IB 3SGKA 2GT9B 2ZCLL 5I66A 3W57A 2EDQA 5KSVA 1YUKB 5FYLH 5CSGA 5D2NB 3TNMB 4NXKA 1J8HE 2P5WE 4LHUD 1T5KA 5BQDA 3LRHA 1IILE 1JI2A 5HHOE 3GMOB 3D33A 5KSUB 1VKXB 1RZ7H 3ZHNA 2WOBA 3M1BA 4JO8A 2BNQD 4ZPVB 5DMJB 2FEDC 1AKPA 2D0GA 4NKOA 5DO2D 1XGQA 3WFDL 1H9VA 2NYYC 3LZLA 3VD2A 4TVPH 3FO2B 4HIEA 4X9HA 2WUBL 1FLTX 3IS0X 4APQB 4ZDHB 3LKRA 2RA1A 1HHJB 5IROC 3FN0L 4L3AA 2VDPH 4QRQB 1F2XK 3UAFA 4L29B 4F9LA 3VXSE 3P0YL 1G1OA 4OGXH 5FS5A 1CTMA 2ZUWA 2Y07H 6PCYA 4L5FL 4WWPA 4JM2F 1T6VN 4G8GD 3CSYB 4Y4KD 4YDNA 3VSQA 2D3VA 3H7LA 1SJEA 4MJ6A 2MRYA 2IDUA 3S2AA 1ZPUA 4PLOB 3TGXA 5JHAA 2EEAA 2BNUB 5BV7H 4Z95H 3P73B 5GGQH 4QRRE 4QJ5B 4DH2A 3CFJA 1A6PA 5I24A 4AK2A 1T22A 2DQFA 2R59A 5DHVB 2OAAA 1TPXC 1QZ1A 3MDJA 3CLFL 5DJXA 4K94L 2J4WL 4F7TB 1YEHH 3ROOB 1PCSA 2F6AA 1JZ2A 4F2MA 4KKLC 2E9JA 5JIIA 1F97A 2IDSA 3VI3F 4IEFA 1RJZB 2Y6SC 5E4EC 3ARZA 5ALBL 4PBVC 4ZXBA 2YRZA 1ZLWK 5CEZL 1SHXA 1AXSB 2FL5B 4QIRA 3ZKQD 5HYJE 4KX8A 4JRFA 2FIKA 4XMKH 1QSZA 2AV7B 1KJMA 5HVFB 3VXUB 4HKZB 4ZZFA 1N18A 5HYSB 1QAWA 4H1LA 4OQTH 5LBSH 3LKSB 2HT4D 2AQPA 4NQDA 4P2CG 1X4XA 4UDUB 3L3IA 1OGAA 5C0IB 3NJFA 1NCWL 3QSKB 3B8YA 1K3IA 1J0IA 4ELMB 1X7TA 4PJ8D 4EDXB 3G5YB 4JFZH 3NFPA 4C4KO 2QQLL 5TE4L 3QG6A 5I30H 5I8EA 4BKLA 3GDBA 4NJAL 1HHHA 2EUZA 3HI5L 1L9OA 1XF3B 2VWEE 4XCCL 1I1AA 4YDIL 4X50A 1XF5B 2CIIA 4I4WA 4L4VD 3T3PE 3ZTDC 2EDYA 4QHPA 4TKWA 4YHYB 1OB1A 2HFGH 1ZLSL 2XTJC 4NGHL 3AREA 4KZCA 4B0MM 2ED9A 2EJ1A 2HLFD 4XP9L 2DDQL 2DQEL 2YEZB 2GI0A 1SXSA 2JKRM 1UKTA 4K5OA 4XN8A 1VACB 3PXJA 4YHZL 5GPRA 2PYED 4WUUA 1DDHA 4LBAA 1KTRL 1KF9B 4ICWA 4BEIA 3ZKMC 4YHNA 3GHPA 3BI9X 3SKOB 5LGYA 2WLZA 2Y5TB 5FYJL 4KHTL 2VR6A 2DV6A 1U95B 2E56A 3RVWC 2F08A 5HDBB 1Y18B 4LSPH 3QQNA 1AMYA 1EAPA 3EJCA 3GC3A 1OM9A 2FATL 2IWGA 3SGKC 4R6UA 2A73A 3NFSH 4YZFF 4JGMA 3VXMA 2OL3L 2Y1AA 2RD0A 3ZTNL 1USZA 1EHAA 2XX0A 2DKUA 2NY3B 3GJFH 4GG8B 3GSVA 4KPHL 5F7AA 4BFBD 5DMGD 5HHXL 3O4LB 4I0PD 4R3SA 2VITB 4DN3L 4M1DH 1P5UA 4Y2OB 4BUHA 4LPYA 2JB6A 4PJ5E 5A2FA 3WTWA 4P4RB 4BZ1A 2ED6A 4Z7WA 1NC4D 4HUUB 3ARFC 3FFCD 1OTSD 2VDOB 4LQ1A 3C8KA 3B43A 3P3YA 3UG3A 1DVYA 4MCZA 2MH4A 2CDFB 1OLLA 1KYUA 2MPAL 3VYNA 5F7YC 3BDXA 5IM7B 4QHMA 3GINA 2BY2A 4I2XB 3NIGE 3WIHL 5FHAH 2J5LC 1ETB1 1CLYL 1EJ8A 1UZ8B 2ADJA 3C8DA 1UGNA 3MLTA 5AVVB 1NANI 2O61B 1NGYA 3C12A 3HN5A 4JL1A 2DLEA 4RQQA 4L23A 1VGEH 2EECA 3ZDXE 3EJJX 2H8PA 3F85A 3G6JB 4XBGB 3EKCA 4MCMA 4YK4C 4PCKA 2A4ZA 1F11A 4ZXBC 5EMYA 1SBSL 3ZIMA 1U8NA 3GB7B 3WFEH 1MAJA 1NDMB 1YEEH 4PAZA 3O2DH 4RGND 4MS6A 3NAAL 4R84A 5E9DD 5FF6A 4YIQA 1I85A 3S97C 4LHQB 2WLLA 1U30A 2I60L 4MNGA 5FO7A 2ATAA 4HWBH 4NLHA 4JRYE 2X4NB 3QI9C 4XO8A 2X4OB 3S5LG 2JCCA 1XTMA 3H9SA 3REVA 4NP9A 3MMEB 4LLYA 1BSIA 1NPNA 3F7RA 1NAMH 3OSVA 2X6MA 5CAYB 4LNRB 4MD0B 2F7RA 3MJ7A 3VD9A 5MEPB 5GXBB 2F1AA 4IGBA 3TURA 1I1AC 3HRZB 2XN1A 2VUYA 5T5NG 3WN5B 3NDYE 4PP1D 4YHPA 3OHXB 4B7IA 4Z9KB 3C6EA 4DFIA 1FL5B 2VABA 2RJMA 4E9YA 3VFGL 1IGYB 3LS4H 1MCJA 3KPSE 1RJLA 4X5QA 4NWTL 4YN3A 5GS0L 3GXIA 3AM8C 3JWDL 3RX8A 2GY5A 1MG3C 2FGZA 2AJVL 3HPLA 3T1WA 3D39D 4ZJ9A 5IIEA 1R24B 2MCPH 5M7QA 1HQ4A 5FKAA 3CCHA 1AR1B 5FO8A 5BJTB 4Y4HB 4Y5XC 3ZDYE 4W70A 1AE6L 3WNLA 3VJ6B 3J7HA 2WLNA 3HFFA 2EDMA 4GP8B 4QRPB 4NAQA 3DX0A 2EDOA 2HUEA 4R96A 4W9GC 3HC4L 3OB0H 3RUGA 4X4YB 2XKNB 3WFDH 5CKGA 4BSWB 1FSKC 3HE6B 2ZOLB 2CDEA 4KKNA 4M5SA 5K59E 5FLVA 2WUBH 2BP0A 4Z7VF 4LPXA 4H8WC 5JIMA 2IANE 1ORSB 3IMSA 4JQVA 2EXWC 1M1XB 1IEAA 3FN0H 1P7BA 5F71A 4ZT1A 2D3LA 4QTHB 1YHPA 3U1QA 3P0YH 3QG7L 3AS2A 4PJCF 1OALA 3GSRB 1QTYT 2WIMA 2WO4A 1UKQA 3UO1L 3CFIC 4PRNA 3MV8E 1VFUA 1WFUA 5L4FA 3ZQ9A 4AV5A 5D5MB 3LNEA 3WJJA 1SMOA 1Z0NA 5K69A 1J8HD 2P5WD 2XQ0A 3KGUA 2YQBA 4P3DA 4R4FL 4KI1A 1IJNA 4NN6C 5HHOD 4UTAL 1DJHA 2V6HA 4WU7B 2F74A 3RDTB 5BV7B 2WZPA 5DEJA 3VD0A 2J4WH 1HT6A 2K6YA 5KS9E 5D7IF 4PJHE 1ACXA 1WFIA 3P1VA 4YSCA 1OT1A 5JHDA 3ARDB 1GGUA 4IJTA 5ALBH 4N8PA 4UNIA 5F7FA 4JGUA 5IVXF 1JGVL 3VXSD 4ZTPL 4OKVB 1FJ1A 4NQTA 3DUSB 1AHWB 3M46A 4V2CB 3ZKXC 2FR4B 3OGCB 3IDJA 4M1GL 1T0NB 2QVTA 1SUHA 4D0BB 5C0BB 3PGCB 3WE6A 4JRXB 3ZZSA 3BCDA 3MRRA 1OF2A 1EV2E 3ORJA 3UAAA 3WY4A 4LIQL 4CKVX 1MQKL 1NCWH 2NY1D 2FO1A 2ARWA 5H2BA 4YSSA 3T8MA 2XXGA 3DTUB 2E86A 4LVHC 1J7VR 5TE4H 1V54B 4O2CB 3W9EB 2A38A 3LKPA 1UM4L 3T2LA 1E5UI 4HWUA 4NJAH 4TVSa 3ZO0A 4BFRA 1TMQA 3RNKB 1PLCA 1JHLL 3HI5H 3LNHA 4M5ZH 1ZVNA 4XCCH 2C7UA 4J3SA 4X8JA 4YDIH 2BO0A 1MHHB 5A7BA 3IJHA 3A21A 3VX1A 4WWKA 2EDFA 3D06A 4ZUUB 5GGRB 4YR6B 4NGHH 1NUGA 1U92B 3AXHA 2K7PA 4XP9H 2AQ2A 2DDQH 2DQEH 3MA7B 4EVNA 1FWXA 1UEYA 2XWJB 5HXMA 4HVBA 4YHZH 1A4CA 2V33A 1JPST 1T6BX 5F6HJ 1LE5A 2GAZB 4FQXD 4JY5L 3RGBA 3PQYE 1HHGA 2WWKT 1FNAA 3IXAB 5FYJH 1KXTB 3UCQA 5CBAB 4UQEA 2CG9X 1NCJA 3NIFE 3TTYA 3EYOB 3MRMB 4ZFQA 1MW1A 5AQ0A 4XMVA 5BZDB 3L7EA 3BLPX 5JPNC 1JVLA 2I9TA 2Y7QB 2DMBA 2FATH 2PWGA 3DPDA 1CGVA 4JFPA 4OZIA 2AQRA 5GS1A 1QOKA 4J3VA 4HAKA 2E47A 4JZJA 2OL3H 2O4EA 3ZTNH 1A7PL 4FKKA 2QSTA 5DSCA 4P3WA 3BH9B 1CZ8L 1OD7A 2IWFA 5KWYC 3K6NA 5C71A 4KPHH 5HHXH 1ZGLP 2ZOTA 2JXMA 4N90E 5F7DB 5C7XL 3CG8A 4F33B 1FCCA 5F7HA 1DJIA 2VIRA 4Y8DC 3GJFB 1B2WL 1MFEH 2QDVA 4N9OB 2EUVA 3ILPB 4WSGA 2IH3A 5TDNA 5A40E 1DQLL 2WB1A 1E4KC 4Z7NB 3NCMA 1ULVA 1OP9A 3SE9L 5FB8B 3OKNA 1H9DA 2CM5A 1S9KC 2BP8A 2BVPB 2DAVA 3KYNA 4OFDA 1UOLA 3UGEA 2XQBL 3QNYB 4V1DB 5TQ0L 4RFNB 4Y16D 5JW5A 2KLRA 1XSOA 2MPAH 3SO3B 4DP2X 3OQ3B 2X70B 1MHCB 2EE0A 3KPQB 2A6DB 1QR1A 1XSKA 1AYRA 4FG0A 1PLAA 3BYTA 1S7UA 4MA3B 3WIHH 3TN0A 1CLYH 1OOWA 3VD1A 4FEIA 5D2NE 4AEIL 3SCMC 5H37G 4OZHA 4FA6A 3P11H 1TZHB 1RK1B 4NZRL 1INEL 1QTSA 3FFOA 1LDPH 2FYYA 1K6QL 4LEOA 4LPUA 4NZTL 5B1AB 4DP6X 4PJ5D 2ENJA 2G0KA 2GBTA 3OZKA 5T3XE 5J6GA 3UG5A 1SBSH 1JYWA 2CIKA 5IW1A 3QHFL 1RIUH 2EYSA 1CXLA 3NAAH 5D1ZD 3VXMD 4H13C 1CL7I 1ZHBA 4KZEL 4NSKA 1EZLA 2D73A 3H1ZA 3UO8B 5A2AA 2JI1A 3KWUA 1CIDA 1CYGA 3SE4A 2CBMA 1DUYA 3OGOE 1U41A 4GAYA 1DSWA 1CLOL 2HTKD 3GMMB 5D4QA 1G94A 2NSQA 5DURD 2CLRB 3Q5OA 4BK5A 5CCJA 1FNFA 4G7SB 4WENB 2P24B 3I6KA 4J3OD 2B3RA 5HHQB 3PWLB 3UGUA 2H3KA 2XXCB 3Q8CA 1O0VA 2C4FT 5BRZB 2VXSL 5KBMA 2WNWA 5F21B 1D7BA 4OT1L 2C5DC 1RSYA 2ZNWA 1NAMB 1HH9A 2K6ZA 4GLRH 1I3UA 1LQSR 5JLZA 1CFNA 2P52A 4X6BB 4F15B 1E9OA 3RVXD 4LP5A 1KXVA 4UT9A 2E7LC 3NA4A 5SX5H 3VXUE 4NWTH 1NCTA 5GS0H 1E27B 4JQXA 3WDHA 1YNLL 2NXZD 4NYLB 4JRYD 5ICYB 3DIFA 1WISA 4XPFH 2I5YL 2IALB 2R15A 4AYFB 4LT7A 1TVBB 5KJRL 4HG4J 4QOKA 1F02I 3WNJA 3HTLX 4ELME 1YN6B 1T5XA 3OKLB 1ASOA 5CJOL 1G7LA 3UACA 4X9GA 1AE6H 4WI0A 4BFIB 5AENA 1RMFL 2W80C 5HVGB 2W60A 5F7UA 1KPUA 1WT5A 2QV4A 4EI5B 3HC4H 3CFQA 1M9WA 2G75B 4Z7QB 4NC2B 3HAEG 3AU1B 1JDDA 3U0WL 1CG9B 1Q9WA 4HUMB 5DD1L 2CWRA 4WHYH 1PYWA 4F3FA 2Z1KA 3VGDA 1TITA 1TU2A 4UT7L 1VSCA 3DVGB 1JFHA 1BX2B 2ADGB 1CURA 5SWQB 3QG7H 4TQPA 2W0LA 3KS0J 4IDLA 3VA6A 5D4HA 4N6QA 2YD6A 3UO1H 2VLLA 5I5IA 1EXGA 1XCTA 2BP5M 1AGEA 3Q3GA 1H15B 4I88A 1SXNA 4RVBA 4UZUA 4Y19B 1I4FA 2OMZA 4JKKA 3NCYP 4J5VA 4S0TD 3HE7D 2ZWZA 5D8JL 4ORZC 5DD6A 1EO7A 5DYOB 5C0JB 1X5AA 1MJUL 4IDJH 4Z3JA 4R4FH 4GS7C 4UTAH 5KVEL 3P4OB 1FYTA 3BZFA 1NLDH 5IQ9B 1B4TA 4NT6B 1KYAA 2ITCA 1YMMA 3QUML 1QFWI 5EZPA 2JCCF 4BQ9A 3HBGA 1FHNA 3BZDA 2IAND 1S4IA 4U1IB 4HWNA 3PP4L 5KOVC 1UC6A 2DL2A 2A4CA 4GAGH 1JGVH 1JGIA 3FH5A 2IADB 3EO0A 4YHKL 4ZTPH 4Z0XA 3ARUA 3V0HA 2G4EA 2VMEA 5C0NC 2EILB 4NZ8A 3CGTA 4YO0B 1AXIB 4FGMA 4WI6A 1M7DB 4OB5L 4UM9B 3MV8D 1D5BB 3ARTA 3V0AC 2K78A 3QXUA 2LE9A 3BAKA 2LU7A 4N3UA 4LIQH 3GXMA 2BCKB 5F7WC 1IBZA 1MQKH 1PBYA 3BWUC 5IJVB 3IETB 2OMWA 1RZGA 2ITEA 2ZWKA 1IBGL 2Z93A 1CE6A 1JF6A 1YEDA 4LSTL 4W1TA 5DJ6A 3X3GL 3VD4A 5DVOA 1T4WA 1U3HB 3K8MA 1YNTB 1UM4H 2WXMA 3GK8L 4BUGA 3AT9A 4I2XE 4XCEA 3TO2B 3HLKA 4BK5C 5A3ID 2YXVA 5DS2A 1G7MB 1JHLH 2UXFA 2X3BA 3QNZA 3BIKB 1FIEA 2R1XA 3PV6B 5KBPA 1K72A 2XPGA 1U3JA 2VL5A 3MBEB 3ZRCC 1U8PB 5FA3B 3SDCD 2V7NA 4E41A 2J8UB 3F3HA 4JW3A 3N2JA 2XVKA 3B3IB 3GSNL 4NRZB 3G6JE 4LOUC 4PJ7B 3RUGF 1WCBB 3TT1H 4J39A 2UYLB 2H1XA 2XN9B 2Z6FA 1TSRA 2X9YA 2HAZA 3BPNC 3AQDA 5H37H 3LN5B 1F6FB 2CO7B 2IBZX 3JTSA 3MRNB 3PPEA 4HCIA 1KXVC 2HP4A 3MRCB 1RHHA 3HR5B 4IMLB 2EIBA 2K45A 2XPZA 4JQXC 3KBPA 4KOBA 1W8NA 5KG9A 1BLNA 1FH2A 1Q72L 3RWCB 1IFGA 2H45A 2P8MA 5DEZA 2V3FA 1D5MB 1QSFB 2MPVA 2QSQA 4G80B 3ROLB 3SDAD 2K4AA 3DRTA 4G3YL 5KVDE 1XBDA 2X2IA 3FU9A 4JE0A 4NN5C 1CZ8H 3CBRA 2Y6TE 4OW6A 4KBPA 4GRWF 2BIHA 3L4CA 3M7FB 4AJ0A 5C7XH 1FL3A 2LAGB 3SYQA 5TK4A 3GIZL 1B2WH 3BT2L 3KPMB 1FVCB 2XWEA 3PQYD 1XEUA 1DQLH 4ONHA 1YN7A 1X5HA 5FAAA 3S5LB 4FADA 3SE9H 1NOAA 1NCGA 1WP6A 5J12B 4N25A 4PM1A 4Y5YA 3MXVL 4EUPA 5DJYB 5TQ0H 4KKQA 5EU4A 2UY6B 2DJUA 4H8QA 3TBSB 4WWKD 1BVOA 5AVQB 2E7MA 3IU4L 3WGUB 1BQHG 2CLZB 3Q48A 1FFPB 4YE4L 5G4NA 3A23A 3O3AA 4IJ3B 1AACA 1HSBA 4ENZA 3DX9A 2ICCA 4JFEA 1MAMH 4LSDA 4XPTL 4QRPE 4TS6A 1FRGL 2Y36L 3BSZL 3D50A 1INEH 4B9CA 5FYLE 1K6QH 5I76B 2RAMA 3SQBB 5FM5M 2JLPA 3RYMA 1CD1B 5D4IA 5F8RC 3QFDA 4G1EB 4JE4B 3QHFH 1R5VA 4ZFGL 4D0DA 4F20A 4U2YA 2Z7UA 3B9KA 1ZSDB 2GJ6A 1ZAGA 4YAQB 3QYNA 3BKCL 4YVNA 1ZDSA 4U1KB 4AKQA 1CJYA 2VSMB 2VDKL 4LLUB 3LN9A 4KZEH 1MFNA 4L3EB 5EO1A 1BZQK 1NFDF 1Z9NA 1S9VB 3M17A 4KGJA 2DN7A 2Y06L 1CLOH 1DVFB 4Y4FB 4N2MA 5DRWA 3EOTL 2DL9A 1PEZA 3R19A 5D5ME 4XX5A 3O8XC 1L6ZA 1SZNA 3MRBA 5D6CB 1XSJA 3I3DA 3T0EB 4BRJA 1QABA 3VXRB 2CR3A 2DWTA 4IU3B 4MA1C 4CC0A 4MCYB 3ECBA 4OZIF 2VW4A 4Q7DA 5I8KL 4XC1L 2VXSH 5IMOA 1CQKA 1KELL 3EADA 4OT1H 5DTFB 4APQD 5F3BA 4NFBA 3DYOA 3MBWB 4ODXB 3MKKA 4F7MA 5CSBA 5M95B 1N0XL 1YJDH 2MQGA 5C0BE 3TVMA 1YNLH 4JRXE 3ZYZA 1AS7A 1R3HA 3OHMB 2BSRB 4MZIA 2WKOA 4H0LC 3MLSL 2DI7A 2I5YH 5F97E 5JDSA 1E4WL 4DP0X 3W5NA 5KJRH 3OX8B 1OQXA 1FAKT 4NRYA 3BWAA 1J86A 4WGVB 5FK9B 2WY3B 3G6DL 4NZJA 4M5YL 4PRAA 5CJOH 4J8RA 2AERT 2FWLB 1JRHL 3DUHA 1RMFH 4KJQD 4ZS6C 3DA0A 5J13B 1QI3A 3F2LA 5DRXB 3V6OA 4KI5C 1DJSA 4HCRL 3U0WH 2XWZA 3MGOA 3ZXAC 3DX3A 1RCYA 4OZHF 4R7LA 3NJKA 3MYZA 4XOAA 2WZ0A 4MAYA 1DJYA 4MQSB 2IDQA 3RIAK 1F4HA 3VXUD 4X6DA 3DUUA 1F90L 2PCPA 1BZ9B 1JPTL 5D7LA 3K1KC 1TTAA 4RSYA 2V3DA 1XH2A 3DC0A 2FLBT 1S7WA 2YJQA 3WUWA 1N68A 3MLRL 1LO4L 3QEGH 1VAHA 2EICA 4R5XA 5D8JH 5E95B 2W07A 4Z0BL 5DZOA 1MJUH 2HFFA 2NUPA 2VB5A 4NUPA 1ADQH 1E50A 2YJLA 4ANXA 4JG1L 1Q9LB 4TNVF 1CT8B 4NO2A 4E2OA 2ATPB 1SEQL 3FXIC 2Q7NA 4YDLB 4YHIB 2EUXA 1NIAA 1ESOA 3PP4H 2QHLA 4W9LC 4WNQA 1NA8A 3C9NA 2Q6WB 5GZNC 5CN2A 5KYYA 1EX0A 5LGKA 4HOMA 3E3QC 4QMEA 8FABB 3NRFA 4ZX6A 5AOIA 1S3KL 2Y0SA 3ZE1F 1J0YA 3VGAB 4FF9A 3JWOC 4OB5H 1ZV5A 5AVYB 1WBXA 1X5ZA 3EAKA 4G7VL 4DKAA 1KB9K 2J71A 4CGUB 4R0LA 4G9FA 1IE5A 5GSRA 2WCPA 2ZYIA 1BOGA 2FWSA 1QVOB 4Z3HA 4O9HH 1ZS8B 2OJ1A 4RGMC 2A4EA 5C08A 2VM9A 5MERB 2OZ4A 1S3RA 4ALAC 4E9RA 4LSTH 1IBGH 1LEIB 3SBWC 3X3GH 6PAZA 2WXIA 2NXYC 2VQ1A 4X98B 3S8FB 2H6PA 5JA9A 3GK8H 3V6ZA 4B5EA 1FVEB 4W9JC 4RAUA 4GQPH 4WI4A 1SYSA 2A0LC 2NY3D 1BD2B 5I15L 1YEIL 1KGUA 3HC3L 3VFPB 3VSVA 4QHUA 3RFZA 3OPUA 1EJFA 3BUBA 3O4LD 2XFXB 1AG0A 1SN2A 1D5RA 1N3NB 2AJYL 2WXKA 4TNWK 3GSNH 1WHPA 2BXZA 2BMKB 3ULVC 3SPVB 3WL9A 2AXWA 1QPPA 2PP8A 2UZIH 3MRGA 5DHDA 3LKOB 4MRCA 4PRIA 3T4YA 1BLIA 4LU5L 3UPRA 1CDBA 3PDGA 1BMZA 4R97C 4XX1G 1EFQA 4QAMB 3UTPE 5K9QI 4BFJA 3TVMC 4N1CA 2PO6B 1K4DA 2AXJA 1A0QL 3L5XL 4HEPA 1BCIA 1Q72H 2FRGP 3BJ91 1O6SA 1ES0B 5KSAC 4HZLB 2QELA 3KPTA 4O02L 4U3HA 1TEFA 4XT1C 4G3YH 1A6ZA 2NY0C 2FTAA 5B38G 1KFGA 1F6AA 1RZFH 2LVCA 5CSZB 4AMKL 2FUTA 4PJGB 4RDQG 4PTUB 3QO0B 3IVKB 5BRZE 2BWDA 2GIYA 3L9RA 2YPKB 1HDMB 1NAKL 3GIZH 4DGIL 4QXWA 1OARL 5BZXA 3BN3B 3VMPA 3GTVA 4BQ8A 4CVXB 2ENYA 1BP3B 2F7QA 1B6UA 1T1XA 1XWVA 1ZD6A 4WV1A 2CO6A 3MXVH 4IOSD 1JVOA 4P2OA 4HIHB 3H54A 2X1QA 4MLIA 4MD5B 4P4KB 5C7ZA 4KRPC 3UBFA 2UWEB 3OG4B 3KDPB 4ZX3A 2UXVA 1NIEA 2ED8A 3WNKA 4XO9A 4K3JH 3ZGIA 2BVTA 3DYPA 2DLHA 3IU4H 3E6HA 4G8EB 1AP2A 4YE4H 1Q8MA 3IJYB 5IG7A 5IFAL 5I75B 2MWCA 2UX7A 4P5TB 5L2KA 1YY9D 4M02A 1RD6A 1UACL 5EO0B 4XPTH 4TYUA 5ACZB 1FRGH 2Y36H 3BSZH 4RMBA 2CJUL 2JTYA 4Z7QE 3NGBB 3ZR5A 4NJ9L 3CK0L 3UEQA 3WNOA 4ZFGH 1RFDL 3LNIA 3BKCH 2YKKA 4JDEA 5EDSA 2HRPL 2KI6A 2VDKH 3QJZA 5IMLA 2OTUB 1K8IB 3KLAB 1GY2A 4JDZB 4Q2ZB 3VG0H 5EC2A 1BAFL 3EGSB 2HJFA 3DNKA 4Y19E 4PRBA 4DVRL 3PREA 3CN0A 4Y4HD 1X5XA 1PKQA 1ZDQA 4PGDB 1XGZA 1ZTXL 4HJTA 4HJGA 2YD9A 4QRPD 1U9KA 1YQVL 5FYLD 1Q9OB 4ODUA 3D18A 4R4BB 1EAQA 3NN8A 5CLTA 3HE6D 5I8KH 4XC1H 2P8LA 2PR9A 3QXDA 1KELH 3W9DB 4KI5F 3RJQB 2HG5B 4PJFA 4KFMA 4LVOB 4TVPD 4N5UA 5EUOF 5D1ZI 4YSPA 2BXYA 2V2TB 2VNCA 1TCMA 3DECA 2AHIA 1UENA 5C97A 1GSKA 1JGDB 4POUB 3TJEL 1N0XH 5CHNA 3QEUA 3QWQB 5CN3A 1W72A 1YC8A 1IARB 1ED3A 3FUKA 3TWCL 2IAMA 3HUJF 1A1MA 3E9TA 3DOHA 3MRDA 1UQSB 1E4WH 3TA3B 3GMPA 4GXUM 4ETQA 1TCRB 5LGHH 2EC8A 3UJJL 3G6DH 3RDTD 2UZYB 4M5YH 3WDJA 2BY0A 2VYRE 4F7PA 4OAWA 1JRHH 4P57B 3OJDB 3WJLA 5HPMB 4Y4KC 1DL7L 4Z3FA 1RLBA 1T2JA 3BH8B 3ARDD 4PRHA 5L2JA 4AMWA 1QO3A 2GC4C 4HCRH 2VISA 1J1XL 2N1TE 4NQQA 4NQCB 5I9QC 1B6DA 1MCCA 1A7OL 3V4UL 1AZVA 2J8UE 4KXZH 4E5XG 2AXGA 5TD4A 4ATTA 3FB5A 1UZ6E 4WU5A 1A47A 1AHKA 2NY6B 3X1BA 1UH3A 2K9UA 4PJ7E 2PPAA 5C0BD 1F90H 1JPTH 2XN9E 3BFQG 2BVOA 2HJLA 2IC2A 3DRQB 3VFRB 1OP5K 4Q97A 3D9AL 4G2AA 4N0RA 2PCFB 4PJIA 4AJYV 5B7MA 2H5UA 4WV1C 3MC0A 3MLRH 4MAUL 4XRCB 3C2AL 5ADPL 4P2OC 4Z0BH 1WGOA 1XF2B 1H3XA 5DMKB 2CDGA 2BJML 2FWOA 5HGDB 1T7ZA 3U0TA 2KLSA 5IKCA 4JG1H 1OAKL 2EXYC 4FX5A 4WFEE 1MJ8L 3BIAX 4L1HA 3ABGA 2BSDA 2R0KL 3HLAB 1TOXA 4LOFA 1AFVL 1VADA 2QGCA 2K9FB 2X6AA 2RHEA 1QSFE 2G5BB 3OB8A 3GRGA 5B3NA 1R75A 4BCXA 3SKUD 4NO0D 4R8WL 4PJ8C 3TC9A 3DMMB 4CKQA 4WF7A 4EJ1C 1E3XA 4XH2A 4C56A 3GXNA 1S3KH 3BVNB 2ZT9C 3EXJA 1YEWA 5SWZA 4QLRA 4Z77B 1AZCA 3ULVF 5CJ5A 1ZE3C 1SM3L 4EXPX 1F18A 1RERA 3TEWA 3L13A 4G6JL 3DOIA 4PJAA 5KVFE 3MJ9H 3APNA 5TH2A 1UXWA 3DX2A 3E7JA 3ULUC 1QRNA 1GVIA 4FQQA 2NLJA 2WYTA 1U36A 3DHPA 3L3DA 1GZQA 4N0CD 2OSWA 2CCLA 3RZWA 3T0DA 2R4RL 3T3MF 4YSOA 3QS2A 3RZCB 2R1WB 3QH3A 1FNGA 1CF8H 4GW1A 4EAEA 2Y1YA 4X5LA 1CO1A 5I1IL 4FXKA 5I15H 1YEIH 5D7LD 3HC3H 1HE7A 3NJJA 3DJSA 2NZIA 5LXGL 2Y4SA 3BEVA 3PGDB 1MLBB 2H1LM 3D0LA 2AJYH 1LYQA 1P2CB 2YRBA 5HJ3A 1KG0B 2XRAH 3SBQA 1OCZB 3GSUB 4WI9A 2XV0A 2OK0L 5E1GA 5CZRA 2DH2A 3GSNB 3QJVB 4NXSA 1SHMA 3RWHB 3VH8A 2HYMA 1K4CB 1CGTA 2EDEA 4BFGA 4V1DD 3MPCA 5C9JB 4GG6F 3FSVA 3GI9L 1I3RA 3B7SA 3LZQA 4S1QH 3QYMA 4I0PC 1A0QH 3L5XH 4HC1L 4L3EE 3TCXA 1UOWA 3BAWA 4RBPH 1A6TA 2D31A 2UVEA 2WBJA 3VRIA 2J88L 4DGWC 3FN9A 5T3ZE 5HGAA 5E2WH 4JCWA 1WA2X 4O02H 4NQXA 2ICWA 1AD9A 1DJXA 3UTTA 2GJRA 3DETD 3VFOA 1IFHL 3V0IA 1OTSC 3BQVA 3T0EE 3WJLC 3X2QB 5JZ7D 3VXRE 2OMNA 1SJVA 4AMKH 1GTNA 2COQA 4G9FD 5J4MA 1UXSB 4L37B 5J8OA 4X5XA 2VJ8A 2JIXA 3FTSA 2WLJA 4ZO9A 1NAKH 4DGIH 2BZDA 1NKOA 4DEPC 3QUXA 1OARH 2WSDA 2Z65C 1DQQB 1W2KT 1EUUA 4GNKB 4U6VL 3FTUA 5CILL 2AITA 1EEYB 2QADC 2X89D 4CVWA 2Y5EA 4MJ4A 4JO1L 5EU3A 4N6RA 2DLIA 4G1MB 3RVVD 3PUUA 3OMIB 4ZMNA 4LLQB 2MTPA 1KTDB 3N6YA 1HWHB 2Z1PA 2VLJB 5IF0B 4OFIA 3RHWK 2G5RA 5I16B 2H26B 4B9FA 1U3NA 1QW9A 4PR5B 1I82A 3T6WA 3FULA 5IFAH 1UJ3B 3MOBL 4RGNC 3WAJA 1FUNA 2JK5A 4QRRA 4XXWA 3RWIB 1E9PA 2R69A 3P54A 3NIDB 5AVTB 1UACH 2C3VB 5DK3A 4A38A 4FEMA 2W65A 5BRZD 1ZGLA 3IYLW 2CJUH 4FQHB 1DBAL 2I24N 5LQBL 2AV1B 4NJ9H 4FD0A 3T65A 4ZUVA 3C6LB 1OK0A 1RFDH 4LFHD 3SE3A 1WAPA 1CD0A 3IMRA 4OZ4A 1KN4L 3CHOA 4XGZB 2HRPH 3C6SA 1NEZB 1HWWA 4XNQB 4FKHA 1BAFH 4PP1C 4RMTA 3RVTD 1AHMA 3SKMA 3CZUB 4DVRH 2VDKB 5ISZB 3E8UL 2OMTB 4KUZL 3B2DC 1ZTXH 3F6JA 4L2LA 4MJ5B 2AEPH 2AK4B 3CXFA 4E42B 1HL9A 4TUOB 1EAOA 3BO8B 3EOYG 5FCUL 3ARBA 2YD5A 3EBGA 4X4KA 4EI5D 3TASA 3VFTB 3IFOB 1S5HB 3N42F 4DESA 3TO4A 4YC2C 2ZUXA 1JZ5A 1UCBL 2WWNA 4G7QB 1B4LA 4EZKA 5EEUA 4JFDA 3UZQA 4K3EL 3ARXA 4KKCD 4KQ3L 5IVNA 4BA8A 5KW9L 4B0MB 1UB5B 4YSQA 1TQCC 5HGBA 3U7YL 5L8LB 4RZCA 3G04B 4FHBD 3QT2A 1XAUA 4KTGA 5AW6B 4PV9A 4L1DA 3TJEH 3VFSB 2EADA 4N24A 4OGQC 4A7SA 2X4QA 4AIEA 5IVZB 4Y19D 3LEYL 4HQQH 5EO9A 3RWJB 3UGXA 1K2DB 3TWCH 1N9PA 1IC5L 2CE6A 2ICES 3IE4A 4U1GB 1THCA 5CD3A 4M00A 5HYEA 2X4RA 5MEOA 2X7LB 2AXFA 1DQML 3N1PC 4YDZA 1SJHB 1KBWA 3QDAA 5E4AA 3UJJH 4HIPA 4ACTA 2EXTA 4GUOA 2ZUYA 5K1JA 1AZUA 5T1DL 2IMMA 2ZX7A 4LBEA 1EGJA 1DL7H 4ZMQA 5I1DB 3AAZA 3QUZC 3TIEB 3KHOA 5K5YA 1HNGA 1BD2E 3F7YB 4M3HA 1J1XH 5ENWA 1NBYB 3MRPA 1A7OH 2WOYA 3V4UH 1JV2B 4PG2A 3DV4B 1U58A 2YAEA 4QO1A 4UM9D 5CEZD 3PWPE 3CFBA 4OJEH 5F93C 1R3KA 3MVSA 3QUXC 4ABUA 3D9AH 3ARVA 1BQKA 1DLFL 3BP7B 3AROA 1J9SA 1WZKA 3C2AH 5ADPH 3DTXA 2BJMH 3JV4A 3L3JA 4H7VA 1KTBA 4UI2A 4WHDA 5D93B 2HPTA 3UYPA 3V5KA 5L0QB 1U3HD 3ULUF 4ISVB 1OAKH 3DX6A 4ODSL 1MJ8H 2NNFA 4FKEA 4QWWC 1TKWB 5EFIB 4MJIA 2R0KH 3IMVA 4XBPB 1AFVH 2GFBB 1JPGA 2GSGB 2DEWX 3MBED 4U6HA 4RMSA 4YJZL 3ARYA 1O9WA 2NY1C 1YZZA 5DJ0A 1UG9A 4ZUWA 4MXWL 1MKFA 2MQCA 4KKBD 4R8WH 4XI5D 3JTTB 5DGRA 3D87B 4YDVB 4MQTB 3MREA 4PJGE 2PYFA 2XN9D 3I6LE 1R3IL 1A1OA 3U2SA 3US9A 5I18L 1U6AH 1QSVA 4U05A 4PJFF 1SM3H 1LWRA 1LL1A 4U3CA 1A1NA 5ESQA 5FPIA 2BOCA 1OKEA 3IGFA 4G6JH 2ZG1A 2DMCA 4M8RA 4PRHD 3M8OH 1X9QA 4L8SA 2I85A 4WFED 5FYJD 3G5VB 5J11B 4I9XA 1Y6KR 2YN3A 4FFWC 3T5WA 5JW4R 2UWEE 2FQDA 3TJHD 5ICXB 1OW0A 2C1PA 5GGSY 3GMNA 2P7TA 1QSFD 2R4RH 5H35B 3ZE0B 3RKDC 2YGQA 4BIKA 3RU8L 3C60B 4FQXC 4JO4H 4NFCA 1BXXA 5FOBB 1OM3L 5I1IH 3ARBC 1XH3A 2BSED 2E7BA 3NJHA 4X2UA 3HAEA 5LXGH 4JVUA 4DCQB 3FCTB 1AQ8A 2XSKA 5F3HA 2RH0A 3BGFC 3KJ4C 2IF7A 4ELKA 4Z1PA 2HB0A 3MR9A 2VWEC 4X6EA 1CN4A 5DJAA 2ZG3A 2PF6A 2HVJB 4Q89A 1T04A 2NCEA 4HA1A 1CF1A 2E7CA 4K5MA 1GZHC 1MCFA 4BE5A 5J5EA 2OYKA 4OIAA 1QMUA 5SV3A 2I26N 3FQTA 3GI9H 3I3EA 4LDLB 4YPGB 1YEJH 3KPSA 4HC1H 5ID0A 1WE5A 2I32A 4S1DC 2QPUA 1U4FA 2CXGA 2J88H 4J6RL 3UTSB 4BWWA 1IL1A 3NEXA 1BYPA 2CPUA 1ZT1A 4MFHA 3G5ZA 1EZSA 3NUKA 1Y1UA 3P9MB 1M2VB 1QWHA 2GB2A 3ZUCA 1Z9SB 4MDRA 3FT4A 4O02B 3KXFB 5T1MB 5FFLA 1TO4A 4C59B 3DGDA 4YSDA 5KYXA 3Q2LA 5INDA 3BRDA 2HVBA 1K8DA 5I73C 3O3EB 4DP8X 1UOKA 4GAAA 4K55A 5IQOA 1WUNT 4FAAB 5T5NF 3BGMA 4PG2C 3D2UA 5J9PA 1JHKL 1I9JL 4GEIA 5CILH 1H6EA 3K2MC 4JO1H 4DZBB 5DRNA 4A6YL 3TPKA 4L3ED 3N1FC 1Y1DA 4TOYL 4CNIB 3D48R 5JHLA 3LKNA 1DVFD 4Y4FD 1DE4A 1H3TA 3P02A 5FKPA 3S36H 2IXQB 3T0ED 1R9FA 3GLZA 3MOBH 4OFVA 3PL6A 5D1ZC 2P46B 4U3XA 2R1YA 2WXOA 3SYOA 1P6FA 1S7TA 4OLEA 3U9UB 4DJMA 1RUKL 5H4YA 4GRLC 5JNYB 1Y0LB 2WM0A 2WQVA 2V9UA 4Z78B 4UQ9A 4N5EC 5LQBH 2B4CL 4M6AA 3MRKA 2F61A 4NQCE 4A2FA 4U3SA 2IGTA 3FHEA 2WBJD 1T83A 3MTXA 3TFKD 4V2BA 2W9LA 5F70A 2QQNL 1AANA 2E27L 2EC9T 1OGPA 5DWPA 4P46D 1KN4H 1IAIM 4XODA 2BRQA 4F5CE 4F91B 3GSOA 3UTTD 3O4OC 2XG5A 3QUMA 5CU5A 1F0LA 3DV6A 4L18A 4XNYL 5GS0D 4DP9X 1M6OB 1OVZA 4L8SC 1JTPA 3UAJA 1N19A 3E8UH 1MLCA 3QORB 2W91A 4KUZH 1V05A 2QKIB 1G4MA 4F58H 3X14A 4X7CC 3RVXC 2PWDA 1M7IA 5FCUH 2PW2A 2NMSA 2APFA 4K9EL 3V7AG 1BVKA 5BS0A 4GKLA 4U6XA 1UCBH 2NXZC 2J12B 4K3EH 2VRQA 1AO7B 4MWFB 1OWRM 3KVPA 5DT1L 3NP4A 5JPMC 1HHKB 43C9A 4HOWA 4HFUL 1RZKC 2DQIL 2LW3A 2OS7A 3RTQA 4XP4L 1FORL 4XP6H 4X9FA 5DJ8A 1L0PA 5BRPA 3PYCA 4M4RB 5KYWB 4EKJA 1A3RL 1AGFA 1LNUB 2VXQL 3CFDB 3LEYH 3NABH 3OJ2C 3SJVA 4OFYA 1UFGA 3RKPA 1IC5H 5C0AB 3WCYA 1KXQA 1A6WL 5FDWA 1JZIA 4IU2B 4HUXB 3LQMA 1DQMH 3NZHH 1BQHA 3BQUA 3B9EA 1O9ZA 3HKFA 2YGOA 4PRPB 3S35X 4G42B 1NLBL 5T1DH 1U3YA 3BPCA 5EDXA 3L4UA 5J6HA 3W1ZA 5E2UL 3WEMA 3QWOA 5I6MA 3KGTA 3QR0A 2WQSA 3MBXL 3FW6A 4CMMA 4JAMB 3LPOA 2Z91B 3B6SB 3LHPH 3ZW3A 3F7VB 4FJZA 3SDDB 3GBML 4GO9A 1SVZA 1N6UA 4P3CL 4LDCA 2F15A 2XPYA 4MKMA 1P6WA 3P77A 1TDQA 3L2LA 3BW9A 4XMLL 3CBJB 3GTTA 1BJ8A 3N41B 1DLFH 1JBJA 3V0EA 4Q9QL 1IB5A 5IFJB 1I8MB 5KBDA 1RZQA 2DWDA 2O5ZL 5DJDA 2O72A 3DVIA 3SKNA 1OE2A 4ODWB 4O5LL 2R0WL 4ODSH 1TLMA 5GS3A 4L8CA 3UBGA 4IBWA 4ADGA 4PWJA 4Z6AT 3TV3L 4R7VA 3HS0B 1I1FB 4FHJA 2R8SL 4RNRA 4A2DA 2WP3T 1Q94B 1A2YA 1I8IA 4JMNA 4JY4A 3V4PA 2KPNA 1NL0L 3MKGA 4MXWH 4BUQA 3OQRA 4O4YL 5D2NA 4S1RL 3IMBA 2VKWA 4WK4B 3OKDB 4KNQA 1JWUA 1R3IH 2NR6D 5A3IC 5I18H 1F3DH 3BP5B 3EJYD 1FA4A 4ZPVA 4JFWA 1N10A 3LKQB 5F0LB 3AXLB 2BS9A 1H3GA 3FO2A 3T3PF 1U8HA 2OYLA 4BGDA 3Q6FA 2AJUL 2N3JA 2PO6D 2MCG1 3SDCC 1JXJA 1RJYB 4FXGC 2BIPA 4GOSA 4FYSA 4F37F 1D5ZB 1OV8A 2FT8A 3Q1SL 4HOZA 1NGPL 5ESVB 2ZXBA 5C07A 4AH2B 1DEEA 2GITA 3QZBA 3ZSSA 2PW1A 3O2WL 4TRPL 1O7DE 3DK2A 1F3JB 4B9YA 4FQJL 3O45B 3UAJC 3CHRA 2VLJE 1TTGA 2ZUQC 2ZX5A 4JANA 1DN0B 3RU8H 5AOKA 1ANUA 2HT3C 3MYJB 1I8KA 1OM3H 3VTMA 2AI0L 1FNSL 5ICZB 3P2DA 4GQRA 2WXJA 1AQKL 4M7KL 5AW4B 4B9JA 4XPBL 1IJ9A 3NH7L 3NIDE 3I6LD 3FQRA 1TO5A 3MTRA 4GKSA 4GW4A 5DHVA 1GHFL 1VERA 2P9RA 1EDYA 4GT0A 5ERWB 4LCCA 3EH4B 2KDYA 4P5MA 4P05A 2KMWA 4OV6F 3I75B 5DHEA 4OCYL 1N5YH 2C4XA 1KJ2A 3B5GA 2MKWA 4R7XA 4WLCA 1G5AA 4L4JA 2EEFA 3CDYA 4XXCC 4P4KD 4ZAKA 5ELIA 1XIWA 2J56A 1OAZL 2PTTB 3HCVA 3V0WL 4LMQE 1DZBA 1ZT4A 4J6RH 4LLDA 5I6OA 4PLKC 3K4DA 5I28A 3GMQB 5ISZE 4EI6B 2CGZA 2OKMA 3IPFA 2MQ0A 2ZZUT 2JKNA 3K8LA 3AY4A 3KVDD 4KROC 3IDXL 2OI9C 3NFNA 3WIIL 4YMPA 3PF2A 1WH0A 2RQEA 2XWBB 2EDRA 4BHUA 1KY6A 3NIGF 3PHAA 2UZXA 3D85A 4A2GA 4P2RB 3KR3L 4IIQA 3PHQB 4XE5B 5DR5L 5FGBA 1QHPA 1BFOB 5AOLA 4JZOA 2GSIA 1JHKH 1I9JH 1INQB 2YARA 2OV0A 5IV2B 3VWJB 1OP3H 4LAQL 4A6YH 2WMPB 4ZFOL 3ZDXF 4OZGB 1EWHA 4TOYH 5JXEA 2A6JA 3N85L 1CI5A 3LD8B 3UZVB 4ACPA 3BD5A 1ZTMA 2W0FB 4HS3A 3FOLA 3NMEA 3QCUL 2YMTA 3CX2A 1KOAA 1GGBL 2Y5TA 4UIMA 4W9FC 1Z5LA 4HPYL 4LLWB 4HMCA 4WFFE 4BH7B 1LO2L 3IDIB 5F9JA 3VXOA 5E00A 1PDKA 2Z31B 3AABA 1HXYA 3BAJA 4O2EB 1VHPA 1RUKH 3QZMA 2CHWA 5DS8A 5F1IB 2AFNA 3Q8BA 2ZOOA 2YGNA 4ZW5A 2I9LB 4NI3A 5CCGE 2B4CH 2VMFA 2Q86A 2ZNXA 5D2NC 4FQPA 4HHWA 1D9KD 2QQNH 2E27H 3KCPB 4HDIA 4L9LB 1GR7A 3PS6A 3LDBC 3R7QA 3C5XA 3TBCA 3M7OA 2DQ6A 4NBXB 1A5FL 1LP9B 1N70A 2NY5H 3PCYA 2Z92A 3QPKA 3U0PA 2R39A 4N2IA 5TFSL 3KPRB 1O7SA 3TA3D 1CD9B 2EVFA 4XNYH 3PFUA 5E03A 5FHBL 1LTXA 5E6SB 1E43A 5I1CH 2P44B 4Y1SA 1QLFA 3A4EA 3GZQA 4HUUA 4U1NB 3U46B 2R29L 3WAKA 5JO5A 5DA4A 1XGTB 1PMYA 1T89A 1FNLA 3S88L 5AKRA 5B38A 3TCLB 4UT6A 5IM7A 3GGWB 4A04A 4I2XA 2HCZX 4H44C 3GNML 3T4AB 1AC6A 5F88A 4UTBA 1F4WL 2QZQA 3ZDYF 3F00A 2WWKO 2NY6D 4HBQA 2XNAA 3L3OB 1ZXQA 2DQIH 3RJOA 2Z4QA 5JOFA 1DO6A 4OI8A 5EORL 1FZKB 4Y2DB 1FORH 2B20A 4YSAA 1ZA6A 3BISA 1NGXB 4MD4B 2Z35B 4UOJA 3H3PL 1A3RH 1ET7A 2VXQH 4NPYA 1SHWA 5K59F 2IQAB 1NMBL 3SQOL 2P5EA 3VXQA 2D7PA 1XIWC 2EYTA 4L1LA 2NY4D 3KNBB 4M48L 3IGAB 4QHNB 5IB1B 1ACYH 3QIWA 4MXVE 3ZE0E 1WZMA 3CLEL 1TQWA 1T7VA 5E2UH 5HI5C 1DQDL 5EEZA 4RMVA 3B2PA 3MBXH 2GPZA 3A67L 4JKPL 2X4PA 3DSNA 4Z18A 4A63A 5IQ7L 2GG1A 2E7DA 2H9GA 2BNRA 1AOZA 2OMXB 3GBMH 3VGHA 1AZZC 3KL5A 3QIBD 1FN4B 3PV7A 4I3SL 3U30C 4TUJB 2Q2EB 4FNPA 4LNRA 5KS9F 1A9BB 4PJHF 4XMLH 1A7RL 3I3BA 3SGDH 2XZQL 4XNZB 3UTQA 1F6LL 1ZJBA 3OKMA 3KLHC 3CLWA 4ZBJA 4WFHE 3BCFA 5I23A 4YHYC 2A1WL 2FJSA 4Q9QH 1S8DB 1J0ZA 3RRQA 1LMIA 2FJFA 4JQIL 4LPTA 5J57B 3IBEA 1BG1A 1IGFL 2VCOA 2O5ZH 3D4YA 1AH1A 1KTLB 2A5UA 1MW0A 1BMGA 4O5LH 2OFQA 2R0WH 1NCCL 3DPBA 4WI8A 3OAZH 3RZCD 3UTSE 5DDHB 1G0XA 2ICWJ 3GSWA 1O6VA 1FGVL 1G9NL 3LB6D 4ES8A 1ITCA 4C57C 5LUMA 5K39A 5EZJB 3LIZH 5HHNA 5MEQA 1ETA1 1KT2A 1OXYA 4GFXA 1NL0H 1QEWB 3L3HA 3TH2T 4O4YH 4L3CA 3K6SA 3KXFE 4S1RH 1UVQA 4XBEL 1EXUA 3WJMA 3LQAL 5B3JE 1ZWIA 2HFEB 5J1AB 2VN6A 5FA4A 5JDJA 1ZIAA 2NY3C 1BFSA 1QUNB 3ESVF 4I13B 4OI7A 1CICA 4LCYB 4M8UA 2AJUH 3ZRFC 3HBPA 3MCG1 2Y7MA 2XETA 5I0ZA 4J4PD 1HINL 4JHAL 3CSFA 2R2EA 1ECYA 3Q1SH 3T6ZA 4LGRB 1NGPH 1YECH 4XPHL 2YKLH 5C8JB 4MZ3A 4N2OA 5F7EL 3QE5A 4D9QE 5E9AA 2V2WB 5E8EB 4N85A 3RVUC 1JZHA 3VX0A 4KVCL 1BYNA 3U48A 1EEQA 2YPLB 2VLRB 2E6JA 4XMXA 1T89C 1L0YA 1J05B 4RX4D 5I26A 2AI0H 3NIFF 2XBDA 4M7KH 1AQKH 4PV8A 1R4XA 1FO0L 2CA3A 3NH7H 2Q0ZX 4XPBH 2X41A 4W68A 3KBFA 2FT7A 4HWZB 4E5XA 5EZIL 5CCHE 4XO5A 3EO9L 3NSDA 1SMDA 3RPIB 5B22A 2Y2WA 4Z7UE 4OCYH 2A99A 4NCDA 4XXDA 2AQ1A 5E9NA 1YDPA 3CX5K 1P7KB 5IHUL 2J73A 3U6XA 5I1JL 4XE0A 3OC8A 3W38A 3HOGA 1I3VA 3UZEC 5A6MA 4AQAA 3BEWA 1OAZH 2VZTA 3V0WH 1TNMA 1T0NA 1M9SA 3BN9D 4UV4L 1L5GB 5C0EB 2VLJD 4KJYB 3GBDA 5DQ9B 2ENQA 2ZYSA 1SN5A 1KLGB 1HFUA 3SD5A 1T0MA 4JRXA 4AZ8A 3AB0B 1H3WM 2YPVL 3MGTB 5GRYA 1AZRA 3IDYB 5TJWK 5CEXB 3QIWC 4X4MA 4POYA 4XZUA 2CBOA 4F92B 2JE8A 4L4TB 3B2XA 5EEWA 1ZTXE 4YL4A 3ECVA 3QUHA 1W0WA 3MRLA 2MOGA 1UB6B 5D1XE 3G08A 3PJSB 3C6LD 1H3UA 1EEUA 1IIIA 3FAWA 3HVNA 4JPVL 4NO3B 5C86A 5DR5H 5KUMA 3D09A 1V5JA 5I8OL 1A64A 1DANU 1YY9C 4NAJA 2ZWNA 3EFDL 5B39G 1XR9B 1QZNA 1AS6A 3TJPA 1N6QL 3WN5C 1T21A 3OHXC 1JZ8A 5FGSA 2C3XA 1J87A 4LCIL 2QFPA 4A6YB 2ICEB 3C87A 3OV6A 4R2GC 2MTAA 5C0AE 1UH4A 3MO1B 3MUGB 3C5SB 1NC2B 3QCUH 2AK4D 2NY2B 1GGBH 2ISDA 3WS3A 5D7JD 1FZMB 4HPYH 4XMWA 4HSAC 4JKLA 1LO2H 3EYOA 5DZPA 4PRPE 2EIEA 1P5VB 3FO1B 5DK0A 2K0RA 4NOFA 3HHSB 3FK3A 5E8PB 1EJOL 3D07A 3EFOA 4Y8AA 1AR1C 1KIRA 3PDDA 4XVJL 3CH1B 3GEWB 3T2NL 4B53A 1GL4B 3I85A 4B7LA 1KBVA 1SLWA 4DP4X 5KJ7E 2F9BT 4XPGH 3V55A 4LO9A 3EF4A 3L6FA 1CFMA 4HS6A 4OLZL 5IMKB 3OXRA 2DS4A 4LASL 1A5FH 3HE6C 1Z9LA 2LLLA 4F33A 1A7QL 1CVRA 2B9BA 5TFSH 4YSEA 4FN0A 5BXFB 4WO4B 5FHBH 4E9XA 1KWGA 1IGTA 3TF4A 3H9HB 2N56A 1QSEB 3D0AA 2R29H 3HI1A 5FXCH 3IBOA 3K6OA 3D85D 2LLNA 4YNYA 1T1WB 1AZBA 4DO6A 4HSQA 2J1KA 3MUUA 2YRLA 3DXAA 1QA9B 3JVGA 4XWGL 1ZV2A 2ENSA 3AACA 1E4XL 1QQDA 1WUZA 3GNMH 4P9ML 4C83A 1F4WH 4CILA 4ELMF 3U7WL 2ZOKB 1WV7T 3RDTC 5BV7C 1I9IL 2PXYA 3ILQC 2Z7ZA 4Y2LA 5EORH 3P4LA 2D7NA 4NUGL 4UQBA 5A6IA 3WMSA 1C5DA 5BUPA 1H3PL 3H3PH 4HGWB 5F89B 5DC0A 1NMBH 3SQOH 2YAOA 3ARGA 3DIVA 5D1QA 1AHWC 2P8PA 4OUUB 1L0XA 2EACA 2UUDH 3FUFA 1R5WB 5LCVL 4FNSA 4M48H 2CMRL 4X4ZA 2PN5A 1BBJA 2ERJB 2ZYHA 3I9GL 1O5PA 5DFVD 1VGKB 1MH5B 1Q0XL 3OR6B 1IBHA 3CLEH 1BYOA 1DQDH 3KW8A 3OLIA 4TMPA 2R4SL 2M83A 3IXTB 4MKTA 3A67H 5HSFA 3NZSA 4JKPH 2CLRA 5IQ7H 2O6CA 1BZ7B 3QQ3A 4Y1AB 2VDRL 2ZOUA 5A16B 3AC0A 1B90A 4I3SH 1OB0A 3GEFA 3DBXA 3E2HB 3RB5A 1A7RH 5I2IA 1KLUB 1P9MA 2J2ZA 1BBDL 2ZSWA 3KH4A 4JHBA 2C9SA 4B9PA 4X7SL 1K5WA 1Q1JL 4D9RE 2A1WH 1RK0A 1MN4A 3G9VA 2Q7YA 1UD3A 2A2QT 4JQIH 5GGVH 3ES6A 3L3GA 4X6CB 2WTRA 1NCCH 1MJJA 1DFXA 4FULA 5AOZA 3C60D 3CVHA 3PNWB 4NKMA 3SSGA 4L48A 4Z3TA 1FGVH 1G9NH 2Y3AA 3O3DA 2IALA 4G82A 1KC5H 3DVNB 3VRJB 1U0QA 1F1GA 2XT1B 3X1EA 2DWEA 4I18A 1CYXA 4OD2B 4F7EA 2LFGA 4XBEH 1NGZB 2QR0A 3LXAA 1U91A 3LQAH 5TF0A 2AF2A 1J8KA 3MFFA 3QIUB 1EFXA 3NYKA 5E1AA 1DBBL 4E9WA 3EBAA 2G0LA 4P2RE 2JELL 3JZ7A 3VI4B 4IHOB 2XIDA 1MI5A 4U6YB 4Y7OC 3U1SL 2X0VA 4GY4A 4X99B 2GTWA 4YX2L 1HINH 1NDGA 4HIXL 4JHAH 5F7MC 4OZGE 4TNFA 4PJ9B 3A47A 1AQMA 4XPHH 2ADGA 3UTSD 1XZ0B 1ZHNA 5SWQA 4I48A 5F7EH 3QDMB 2EO1A 3WFBH 4HK0B 2I7OA 1KIPA 2GCYB 1JP5A 2OCJA 2K4WA 4LNVA 5E99H 5B1JC 4B5ZA 4E9SA 1JVKA 3CZFA 6CGTA 2GK2A 1JGUL 3ATFA 1S7QB 2FIRT 4RFNC 5DYOA 3I9AA 3SO3C 2VLKB 4QRUB 2IGLA 1FO0H 4GSUA 2ARJA 1K5NB 2WB7A 1JHTB 4P2QA 4WFGE 2NW2A 4EN3B 3US1A 4LL9A 5EZIH 3EO9H 3JVGC 3OKEA 4GW5B 4IRJB 3LIUA 3SGEH 5E8OA 3CDGA 1S7VB 2DQCL 3NSYA 1JS4A 1ZHLB 2PXYC 3OL2A 2JJSA 2Q1EA 5IHUH 5I1JH 1S78D 3LN4B 3RJDA 1PJWA 4YFLF 3VTAA 4D9QD 4CMHC 1I8AA 1EJ6A 5HI4C 4M9OA 4KJPC 4QT5B 1LP9E 6FABL 5I0VA 1D7DA 1QI5A 4UV4H 2EKSA 3II1A 3KPRE 5DQJA 2VAAB 1EVUA 3VAEA 1T7XA 1FVDB 4TM9A 2YPVH 2B0SL 2QHRH 4FMFA 2D7MA 2W59A 4ZMOA 3I6GB 3L2MA 4Y9FA 3APDA 3H2QA 1MCLA 5KYUA 4NQUA 3SYAA 1EO8L 4MHHG 5DJ2A 3U2JA 5C0CB 5DVPA 2AKRA 1KPRB 2HVKA 1SRDA 3EO1B 1SOQA 3FSAA 1NCDL 4KX7A 3PABA 5D2LB 1N2RA 2KH2B 4I5BB 5I8OH 1GMEA 5FA3A 1TEYA 1ND0A 4Q74A 5F96H 1EEZB 2XJKA 3P4MB 4AVKA 1P9MC 2GJPA 1YUHA 4B9KC 4ZTOL 1NBZA 4JJHA 1N6QH 4FG6C 5CF3A 2NPLX 3BDYH 5C70A 2X28A 2OCCB 1E2VA 4LCIH 4ZFOB 3QZWB 5IW3A 5E24E 4YDJA 3PHSA 5D9SB 3QORD 2AGJL 4H0IA 4JN2A 4F15C 4K5LA 5DFWH 3L4VA 1TYJA 3KS0H 2FO4A 4Y5VB 4LLMA 4N2LA 4KQ4L 1HX0A 1B0GA 2DQHL 1T2XA 4Z7IA 3QJHA 5GIRB 4U1SB 3TBYA 3W11C 1EJOH 3GHBL 3RVTC 4EKXA 1AO7D 4Y7MA 5CO1A 4BFEA 2OMYB 5D5MF 4LLAA 3RAJL 4XVJH 4JK0D 2ZG2A 1I1CA 1LWHA 1WBZA 4J3WA 1A66A 1L0QA 4EI5C 3GMLB 3AG4B 1MSPA 4ZUSA 4DVBB 1PY9A 3BHBB 4OLZH 1M56B 4L8DA 4JLRB 4LASH 4H1LG 3HMXA 5EIIB 2J8OA 1A7QH 1KENL 2R27A 4FJ6A 4ZPTB 5C0AD 3WIAA 3FFDA 3U4AA 3SBPA 1MUJB 4G43B 1A7NL 4XVUC 5DMYA 2FJGB 1D5XA 5IFHL 4AGOA 2CQVA 4QY8A 3D25B 4ZTEA 1RAMA 4H8PA 3EOBA 3K4AA 1UWXH 5HJGA 3WLWD 3T8XA 1ZT7B 2BOBA 4U1HB 4GUPA 4D7PA 1TT6A 4N0UB 4QXTA 4K7PY 4LKXB 5I82A 2PUQT 4HX1B 3SDDD 1WAAE 1E4XH 1JL8A 2CO3A 2DLFL 4O51A 4IBUA 4TL5A 1BECA 3U7WH 2VERN 1I9IH 1KV3A 2NZ1A 4MNHA 4GQ9H 2DBLH 3GXTA 3LRKA 2AQNA 4BXSV 4P2YA 2YBRA 3RGVB 5C6TL 2JB5L 1T1YB 1H3PH 2IPUK 3ABKB 3WG7B 1TQTA 1PZUB 2C3GA 5IB5B 4ZFFA 3NCWA 3HJEA 4F8PA 1D2PA 4XNMB 3MLVL 4PSPA 4CGTA 3NSFA 4QF1B 3H42H 2IPTL 2KC0A 4LLUA 3I9GH 1XXFC 4W9ZA 2BC4B 4JM2B 2BFVL 4D2NA 4CJ1A 3MV7B 3RIAF 1AXTL 3L7FA 4U1JB 4H26A 2YPLE 1F4YL 2VLRE 3MACL 3D3VB 5A1AA 2GK0B 2BNQB 3FZUD 1CWVA 4PLNC 5I8CB 3MRFB 3VD7A 4N9GA 1U3HC 3AGWA 4I9WE 2VDRH 3FB7B 3TNNA 3VXRA 4XVTL 3CVBA 3BUQA 2YAFA 1S7RA 4DQAA 2X6BA 5KTEL 5DEFB 1VRSA 1BBDH 4IRSB 4MAZA 2EQDA 1U8QA 4PWEA 1EPFA 3MBEC 1MVUB 1WWBX 2UY7A 3MXWL 2J57A 4NIKB 4R26L 1Q1JH 2C1OB 3WFHA 3C2SA 3CQPA 4G8GB 3VI3B 4NUJB 4QYOA 2CA4A 1KGXA 2HWZH 4DK5A 1I7RA 4JREC 2DIBA 1YCSA 4HKJA 4APXA 4NDMA 4CSZA 1FL6A 5E6IB 3IDMA 3ZT5A 1UCTA 3D05A 4RWHA 1HYSD 1JK8A 2YD2A 1D7FA 1LVEA 2EH7L 4M93B 5FYKL 1OO2A 1SLXA 4M5TA 5DA0B 1PJ9A 2EH8L 1QLRA 1LEKB 2H2SD 2C3HA 5IBTL 4IKNA 2W81C 3H56A 4L4TE 1H8SA 3GSXB 1RUPL 1HXMA 5D1QD 5IB2B 1PG7L 2Y7SA 5C2BL 2WAQA 3FTWA 3TXAA 3VWKA 3MV9B 5AVZB 3QUKA 2ZWSA 1DBBH 2AEOA 1OCRB 1U8LA 1WZAA 5DRXA 4P23A 4UAHA 5H8DA 2QV2A 4D9RD 2ZSVA 1B0WA 2F18A 3AQYA 1ZVSB 2JELH 3HZMA 2Q10A 2J44A 4OGAD 2G9HB 1L4IA 4MQ7B 3U1SH 3FT1A 4NQEE 4RFEB 4BKTC 1XT5A 4YX2H 5EEYA 3TIDB 3V7AE 3MNZB 4ANVA 5L7XL 3KPNB 4QRFA 4PGEB 3QXWA 2DTSA 4TNWF 3VB8A 4WSJA 5J12C 2YAPA 2Z9TA 2EDTA 4L2YA 2HT2D 1JGUH 1PPIA 3VFVA 3ZTCC 4F7KA 1JAEA 1JZ7A 1QBAA 2ZUVA 3GJEA 3BVWA 1J88A 3GMRB 4TSCL 4FDWA 3RPBA 4JHVA 4UUJA 1G7JB 2A6KA 3NRQA 1JN6B 1I9RL 1ETZB 4PVMA 5TF1L 2IFGA 1MCPL 1FO0B 1P7QB 4AT6A 2DQCH 1PX4A 4TN9A 1AKJA 1MWAA 1AY1L 3O6FA 4LARL 3LRSB 5B7EA 1N12A 3L1EA 4X0NA 5CJQL 3VWJD 1HZKA 2L4OA 3CPLB 4ZMPA 1DVSA 5FUOL 3O9WB 1T1ZB 2YMOA 5L6YL 6FABH 4Z23A 3OAYK 3UYRL 5GGTA 3AG2B 2R2BA 2V9TA 3T0BA 3MAWA 4Q9CA 2ZJSL 1N8ZB 5J56B 3IEAA 1SDDB 2B0SH 1QSEE 1FZOB 1CGXA 2YXFA 4OKDA 1YYML 3LMJL 3QUYA 3SZKC 4H1LH 3CFCL 1WAEA 1ZS8A 2Z31D 2EVJA 3F12A 3AS0A 4WFGD 5J7CC 2BWQA 3STBA 3KPOB 2TSBA 3O3UN 1MI5D 3IDUA 4KO6A 1EO8H 1DVFC 4Y4FC 5AB1A 4JFOA 1FVEA 1NCDH 5SWSA 3KLSA 3F5WB 1BD2A 4K7FA 2VN3A 4EE2A 3IK2A 3SODB 1QPKA 4CW1A 2VR9A 1DUZB 2B3IA 1FAIL 4TQHA 5HBBA 1MCIA 1MY7A 2WSPA 2KT6A 3BPOB 2K8MA 4JZNB 1D3CA 1NC4B 2BMKA 4LSSH 4ZTOH 1GXEA 3PWPA 3KPRD 4Z7QF 3MX0A 4LLVB 1E0OB 2R0ZL 3WIFB 4JFYA 2YSSB 1B0RA 5PAZA 3QQDB 4GSDL 3B2UC 4ONFL 1W0VA 4AXWB 4QXUL 2AGJH 2XG4B 3O11B 3HZVB 2VZUA 1KZYA 1QP1A 3UBXB 1KXHA 1OSZB 4FG2A 5ADOL 3UROR 3FTYA 3TPUB 4MA8L 1IVTA 2VJXA 2H32A 4KQ4H 2OW7A 5IK3A 2DQHH 2ZP0T 2IOOA 3GIVA 4QRSA 3ZHDA 4WKXA 1IQWH 1R3LB 1NKRA 1JTOA 2NCMA 1OIOA 3FQXA 3GHBH 3MHZA 3R06B 4HZLA 5GS0C 4PCTA 4NRXB 1E28A 1YY8A 1ZVYA 5JW3L 3RAJH 2DMKA 4DP1X 2O5NA 1LXMA 5FEBA 2OMVB 2Q76A 3UOAB 2F53B 1MG2C 1WITA 4Y1AE 5H4ZA 1IU1A 4Y2DD 5CSZA 5IR1A 5F9WB 4BINA 9CGTA 3QQ4B 3BT0A 4LMQI 5EEVA 1T20A 4JMXA 1CFQA 5E9DB 1GJIA 1KENH 2IVFC 5DI8B 4N2AA 1J9TA 3OKKB 4Q6IB 5LGJA 1E5BA 2CO2A 3G5WA 2HUHA 4MSWA 3TV8A 5IB4A 5IFHH 3EH3B 4QHLA 1LEGA 4CBZA 1NUNB 4BZ1H 5JHMA 4X6CE 3QEHB 2FSEB 4AV0A 1FG9C 2QPEB 5F0MB 5I71B 1YPZB 3ESOA 4KKAD 5I1AA 4Z3EA 3RIKA 4OJFL 4NHCL 4CVZB 4OM1L 1VPOL 3VDCA 4OF7A 1EZVY 2A74A 4TNGA 2DLFH 3P9WB 1G0YR 5IW6A 1OGTB 3KWXA 4AENA 1FFOB 4EDWL 4N4YB 1KCLA 4HSCX 5G5DA 3P4NA 1JNHB 3IRPX 4LCWA 1TPXB 4NPJA 1LD9B 5C6TH 2JB5H 2HLAB 4YLQT 4X83A 5G4OA 1TJXA 2I27N 2EYRB 5BMFH 5KSBA 3VI4E 1QFUH 4YDMA 5AFAA 5CGTA 2DYPA 4PBWD 1N5AA 2J8UF 5MEND 2W92A 4IBSA 3LXCA 2VXTL 5E4EB 2GTZB 3MLVH 4FLRA 4GBXB 4URTB 5EA0L 5GJTL 3VGAC 1RZ8B 5A2KH 2IPTH 4K15A 4LEXL 3QDME 3CFEB 4HUWA 5JMRA 2GUOB 1URZA 3KLAA 2JWYA 2WNKA 4PJCB 2BFVH 1HSAA 4J3UA 5AAWC 3G3LA 1AXTH 2NX5A 1U8MA 4PGCA 1J5IA 5DHYA 2X2UA 2OYMA 4ZW3A 5DEGB 1NFKA 4P2AA 5ETUB 4DGYL 4XVSL 1CPUA 4JFXA 5CUSL 4KXZI 4BDVA 4F8QA 3Q2CA 2JJTC 2MIZA 1PLGH 3FB6B 3P69A 1FFNB 2VR4A 1XGRA 5KTEH 2BRRL 1CDGA 5HDLA 2VDRB 2NUTA 1ODUA 4U1LA 1KB3A 1M71A 4G8IA 1A4JA 1BZDA 3F65A 3QFJA 3M86A 4R4ND 4YLCA 5BQ7A 3D51A 2HFTA 5IVXB 1RH8A 3L45A 1FNEB 2JNZA 2A6IA 4GRMA 1RZJC 1F42A 1F58L 2W9EL 2NR6C 4ORGB 5H94B 2VE6B 4W6XB 3CDZA 3EGDA 4HALA 1MRCL 2YPLD 2EH7H 2VLRD 4ZO6A 4UQDA 4UT9L 5FYKH 4BZ2L 4WCYL 3OR7A 3D69A 2HJKB 2EH8H 1I53A 4XVOA 4WNSA 5DHXB 4CDHA 5IBTH 4KXBA 1Z2KA 4HIQA 5E1HB 4YXKL 1RUPH 1FF5A 4HK3J 4AQEB 1PG7H 5C2BH 2W95A 2KYIA 5C0CE 2BVYA 1LILA 1U8KA 5AZEL 4B41A 4PJXA 4NN7C 5I66B 1HKFA 1FC2D 5D2LE 3ELAT 5KSVB 3EYVB 3D6GA 1OK8A 1AGCA 2KKQA 3PAVA 5AYUL 4FFVD 5F6IB 5J06A 1IMHC 2CJSA 4DN4L 3ZZQA 5HHMB 3S48A 4D94A 4E68A 1TJIL 3QR1A 5ESAA 3I02B 3M1BB 1WEJH 1CBJA 4P5KA 2TRYA 5EUKA 4NKOB 1XGQB 4UBDD 3IDGA 1L9QA 3DRQA 5L7XH 4HIEB 2FGWH 4UM8A 5GZOA 1I7TA 4NWUL 3LKRB 4FZ8L 4F8LA 5F44A 4XRCA 3ZTEA 3Q43A 3C8HA 3IE9A 1XF2A 4L4TD 4O58L 2HXAA 4P4KC 3SGJC 5ECJE 4JB9H 5BVJB 4TSCH 1BXUA 2ZKMX 1D6VL 4YBQD 2XV3A 3KH3A 1I9RH 1SJEB 4MJ6B 4HJSA 5E5MA 1MCDA 4Q52A 3QC6X 3NCEB 1DBML 1MCPH 1BV8A 5I75C 3MRQA 4P5TC 2NYKA 4GRWH 1AY1H 4LARH 3T08A 1N59A 5CJXC 5CJQH 2YAMA 3DK0A 2Y7NA 3CFJB 3S3SA 1KCWA 1T22B 2DQFB 2FJHA 5IJBC 3J2PA 4PIBA 5FUOH 5K93A 5DJXB 1UZGA 3QZPA 3NGBC 2L7JA 5L6YH 3L4YA 1HOCB 3UYRH 1Z9MA 4OF8A 1A02N 4J1UA 4F2MB 1NC2D 1ZGLM 4IEFB 2NY2D 2ZJSH 3VSUA 3QCVL 4ZXBB 2VOTA 3X1FA 1BOYA 4DW2L 1YYMH 4FJYA 3LMJH 4BBWA 3R8QA 2FIKB 3CFCH 2XZAL 3FUEA 1KB9J 5EBLA 3HNSL 2F19L 1KJMB 3WU1A 4JFHD 2CUAA 3LSOA 1HESA 2ODHA 5EOTA 3GZOA 4FABL 4UQ3A 5EV7A 15C8L 2D0HA 4H1LB 4N0UE 5EF3A 5FO9A 3HRPA 4QCIA 1G1CA 4NQDB 1BVLA 1OGAB 3VXNA 1G84A 5F7LB 5KS9A 2X6VA 4PWKA 4CDGC 1KN2L 1FGNL 2YOCA 3NFPB 3QAQA 3QG6B 1FAIH 3PGDA 2B2XH 4FHKA 4EZMA 4KZDL 3VFUA 4BKLB 1AQHA 4UNUA 4W4OC 3W56A 2WZAA 3CZGA 1HHHB 2JKXA 3BMVA 4WO4D 3ASWA 2D7QA 5DUJA 5KANI 4P48A 1GPOL 4LVOC 2CIIB 2HN7A 4OIBA 1FLRL 4I4WB 4ONFH 4QXUH 4YBHA 3X12A 7FABL 1UM6L 1PTZA 4KHXL 3EH1A 1OB1B 5ADOH 2WBXA 4MA8H 1X5GA 3AREB 3ZDWA 1I1RA 1G7QA 1JZDC 3SY0A 4WUUB 2IDCA 1DDHB 3MV7E 4FYQA 2XYBA 4KKPA 2YUXA 1YJDC 4YHNB 3MRHA 2D3JA 4G59C 4M6NL 3D3VE 4KC3B 4X6FA 4YSRA 1KLFA 2O1AA 4HIIA 1Z3GL 5AVUB 2BNQE 4L3FA 4XMPL 1IE4A 3UDWA 4WI5A 3AWGA 1EAPB 2D2OA 5ABZA 4JFFA 2EE9A 3TBWA 5CZVL 1GZPA 2VQ4A 4PG9A 2A73B 2H41A 4GMTL 4UMSA 4KDWA 2DQTL 1MW3A 4NQSA 3VXMB 3TWYA 1XBRA 3FTVA 4G8GE 3VI3E 1Y7VA 3EZJB 5HJDA 4E36A 1UEMA 2NY6C 3GSVB 3QS3A 3SYPA 4HBCH 4F8OA 5JORB 1QYGL 4R3SB 5SWSD 1A6AA 3SHSA 1P5UB 4Q9RL 2K8QA 4AQ1A 5GZOC 1PD6A 1OSEA 2JB6B 1PL3A 3BDBA 3U4EA 4UAOB 2BDNL 4YL9A 4UDTA 1FH5L 4IMKA 4OJFH 4Z7WB 4OM1H 4X42A 3VVWA 7CGTA 4NP4L 4PR5A 5AB2A 5KEZA 4Y1AD 5EB9A 2DD8L 3C8KB 3PWNA 4MCZB 2CBTA 2OP4L 3GO1L 1IC4H 2Q7AA 4LSVL 4EDWH 2JKLA 4YUEL 2XACC 3V7MA 1KB5A 3CIAA 1QRKA 5HHVL 5AG8A 3MV9E 4KITB 3B2VL 1OAYL 4QHMB 1R3JA 4M9PA 1I8LA 2OR9L 4OJAA 4UQAA 2WO3B 2EO7A 3EH5B 1A4KA 2E4FA 3FPYA 2LVEA 2AQ3A 3DMMC 2ADJB 2Z34A 2ZCZA 5IOPA 1XF4A 3GS0A 1VLXA 1XGPA 1X6NA 1KACB 2YGPA 2E8ZA 1PIFA 3MLTB 1NGYB 2VXTH 3O2VL 1MDAA 4RQQB 1JMXA 1MFMA 3JWOL 5GJTH 5EA0H 4OLYL 1JTTA 3S37L 4AI7A 4FQLL 3Q9PA 4ZO8A 1F11B 4ZRGA 1BEYH 2AVGA 3TBVA 3K91A 1U8NB 3RWEA 4ODHH 2CHDA 3F7KA 4BCYA 2OSXA 2A9NL 4DGYH 4XVSH 3OSKA 5FF6B 2MCMA 3QIUD 5CUSH 4FTDA 2ZP9A 5I1KL 3NEOA 1RXLA 3F8UB 3S2CA 1Q90A 1SUJA 2WLLB 2BRRH 1UTDA 4MNGB 5FO7B 4RETB 3LB6C 5IQLA 2DYRB 4JBSA 1F45A 5KJ4A 3U4BL 1FZJA 1PEWA 3K5SA 3P9LA 3HPJB 4X5PA 3PGFL 3ZJAA 2FEEL 3H9SB 4B9IA 2PYEE 1MIEH 1T4KA 1KGWA 3B7TA 4PJ9D 3ULVL 4EUPG 3FOMA 4LLYB 3BYYA 4AMXA 3OF6A 2FBJL 2CLVA 3TYFA 3MJ7B 2EKJA 1BA9A 4IGBB 1F58H 1J8SA 2X2YA 1MRCH 1IRAY 4YHPB 3DROA 4PJEE 4BZ2H 2X4SA 3HG3A 4UT9H 1UOVA 4WCYH 1A25A 3GRWA 4X7FC 1YNKL 2VABB 2VLKD 4MMZA 4NHUB 1E7VA 1RJLB 2JFCA 1VFBA 1NCOA 4EN3D 4IOFD 3HW7A 4JCLA 4EI0A 2DYPD 3L5HA 2HTLC 4B95C 4LRIA 1TVHA 2PNDA 5I1DA 4I77L 3HPLB 5IIEB 3UDWC 1HQ4B 5FKAB 3CCHB 3ERXA 3HC0B 1U8IA 5FO8B 2EDBA 1CL7L 5AYUH 3UIYA 4OCNC 5IHWA 1RL1A 4UB0L 3DX7A 2NX5D 1JDAA 1TJIH 1RK7A 3CC5A 4R96B 2CCVA 3FFCE 5HHPB 1PX3A 5KSBF 2EEBA 4ABWA 4Z5RB 2CDEB 2BP0B 5LNEA 3I74A 1DQIA 4NWUH 2DM3A 4FZ8H 1FCGA 1V7MH 2WLIB 1IEAB 3KYKL 4J27A 1XDTT 4AGNA 3QRGH 5FWQA 1OAUL 4O58H 4ZD3L 4AQ1C 3HG0A 5AOMA 4M43L 2J7LA 4KMTH 1D6VH 4HHAA 4F9PC 5C0CD 2R23A 3QFJD 2WTPA 3CUPA 4PRNB 5IROA 2VDLL 3OWEA 1DVQA 2ZX8A 1DBMH 1S6NA 2GFBA 3ULAB 1TR7A 3VW3L 4WW2A 1XCXA 2F53E 4P3DB 5AOJA 2QEJA 5GSVB 2H3NA 3MRIA 4L8BA 2WQWA 2WW8A 2FX7L 2F74B 2YS4A 4GRWB 3VACA 4UV7L 1J5OL 4I87A 3E1F1 4NQVA 2E9WA 4PV1C 1N0LA 5E9DE 5GGRY 5JHDB 3CFTA 3C6LC 4U1MA 3GD1C 4PJDA 1ORQA 5T1KA 4ENEC 3QCTH 1LE9A 4LOEA 5KZCD 1T7YA 5IVOA 4RCAA 2X6UA 4A66A 4DW2H 2VDNL 1FJ1B 3HIZA 4Q58C 4ATWA 2DICA 2XZAH 1F3DJ 3DGGA 1BVNT 3HNSH 3VD3A 3IDJB 1HEZA 4Z7VA 4W9IC 3S8WA 4HV8A 4FXLA 4J6IA 4PJBA 3WI9A 3PWJA 4FABH 1YPZE 2CJ3A 5E8NA 2CBQA 4PS4L 3MRRB 4U4IA 1OF2B 3S5YA 1J0KA 3B7UX 5EC1A 2ZAIA 4ZSOA 1KCKA 5H2BB 5LCVA 5GRJL 1FGNH 1XQ4A 4IBYA 4N2CA 3WY2A 1VJSA 4XTRD 3AJ7A 2DEYX 1HHIA 3BH4A 3LKPB 3V9CA 4KZDH 2ITFA 1CE1L 3RA7L 1SDAB 3AVEA 2VXUL 3EDDA 2AW2A 3DJTA 2X6CA 3WUWG 2Q3ZA 4EBQL 2C7UB 3CVIL 4X8JB 5HVHB 1GPOH 3M1CA 3V95A 1FLRH 7FABH 3IJHB 2WP3O 4H2AA 4WWKB 1UM6H 4KHXH 1X5KA 5J89A 1RVFL 3D39E 4MVBD 4OBRA 1X7QA 1TQUA 4K3DL 1Q9KA 3MQIA 1RP8A 4EVNB 1QFWL 3LV3A 4XNXL 5DZJA 4PJCE 1AS8A 2H3XC 4DZ8A 5IREA 4I85A 3BZEA 2V7HA 4PREA 4U1GC 1LE5B 1HHGB 4M6NH 4BFOA 4S2SA 4LPCA 1Z3GH 1FFRA 1WWAX 4XMPH 5CZXC 4AYMC 1T7WA 3QDJA 3FT2A 2OSLA 2QPDB 3FU3A 4HEME 1E7UA 4LRIC 2AEWA 3BKJL 3L7EB 3NA9H 2YHGA 1R46A 4LK4A 3RGVD 5C3IA 2I9TB 5CZVH 4XCYA 1OTTD 1DFBL 1JGEB 1E5ZA 4GMTH 4JFPB 5EOCJ 3RWDB 2AXHA 4OZIB 5LBVA 1M7XA 2OJZL 5GS1B 4JZJB 4PGBA 4RAVA 5E94B 3IS1X 3MNWA 5DSCB 3WTSA 4RRPA 2XV6B 2YXMA 1WS8A 3K46A 4ODTL 3VM5A 3HB3B 2W9DL 2ZXQA 4OU3A 4M4PA 4IHBA 4PY8J 5IVXE 3QJXA 3ZE2B 1NIBA 4KXAA 1ZLUK 5KVGL 4RZKA 1QYGH 2JXMB 1J1PL 4GI8A 4MXQD 2NNXA 4JM2D 4LSRL 3ZPDA 4Q9RH 3MV7D 4H4NA 2VIRB 3VE0A 5ACLA 3KGRA 4KNSA 4EUPH 2CR6A 2D4DA 2IH3B 3D3VD 1Y6MR 2BDNH 3F7QA 2CO4A 3G6AA 4L0PB 5TDNB 1FH5H 2C9AA 2X05A 4QGTA 4KRMB 5CR8A 3BOVA 3O41A 2Z7WA 3OKNB 4NP4H 2BP8B 3KYNB 4YPJA 2DD8H 2V3EA 1RJCA 4XHQA 5JW5B 1UA3A 3GO1H 2OP4H 1E9QB 4LSVH 1PNDA 4J12A 4EEEA 4YUEH 2WD0A 4IRSD 5HHVH 4AE0A 5HYQA 2X2JA 1QR1B 3B2VH 4GSXA 3ARFA 1FDLL 4WW2C 3SPIA 1S7UB 3R8BB 1MCOL 2TSAA 3TN0B 4MNQA 4Z7UA 2Y7OA 4OFQA 3Q9QA 3BRGC 2IFFL 5HHME 4HKBA 1M6UA 4HEPG 3ZN6A 2YQ3A 5E6ID 3JWOH 4FOMA 1DEDA 2R2HA 3H7BA 2XQYK 4JDVA 2FYYB 3A4AA 4LEOB 3S37H 5CZKA 4DAGL 1ZMYA 4JKNA 5J6GB 4FQLH 1P4LA 4DKTA 3AXIA 3S37X 4G83A 2CIKB 5IW1B 1JZEA 4CADA 1E5CA 3ULUL 5CLWA 2IH1A 3WHXA 5C09A 5J11C 1TFHA 1OPGL 2A9NH 2EYSB 2ADIA 3KDMA 1ZHBB 1J9QA 3QPQC 1OD9A 4KVNL 2OMBA 3MV9D 5D7KE 5I1KH 3T6XA 3EDJA 3C60C 1JPSH 1DUYB 4BGLA 1HCFX 4MMXB 3HKZA 5IP4A 1GTFA 4GAYB 1U8OA 4XWOD 1QHQA 3VSTA 3LPPA 2AJZB 1VCAA 2K7QA 3K72A 4YDKL 4KK6D 5D1XA 4JHZA 4NO5A 3U4BH 3DJ9A 1R17A 3PGFH 1AI1L 4JEGB 5LO7A 3I6KB 3AWFA 3NJLA 1JZJA 4AC4A 2QVKA 1TTCA 5CINH 5IEHA 2FBJH 3QI9A 4J2XA 4GKNA 5IBUB 1SYVA 1JJUA 3L1OL 4WUKL 5GJSL 3CWGA 1KPVA 4XOCA 1QATA 4F2ME 1HZLA 1JMZA 1V10A 3V5HA 1MFUA 1HH9B 4JFSA 43CAA 3WBDA 3UG4A 4F37K 4Q9BA 5JLZB 1JF1A 1LO0L 1YNKH 2Y69B 3RY4A 1CFNB 2ZUUA 1TZ8A 1W72L 1E9OB 1W8OA 3P3TA 4N87A 4PRPA 1PW3A 1NJ9A 2YEQA 5IQMA 1P7QD 1O7VA 3DIFB 4I77H 2BW4A 4NQDE 5F9OL 1OGAE 2J20A 3HBQA 1S5IL 4QOKB 5TPWL 2WLKA 3L95A 2IQ9L 4N3TA 4FI8A 1T5XB 3AM8A 3KBEA 1CL7H 1G7LB 3NIDF 3O9WD 4WI7A 4UB0H 4WI0B 3TU6A 1SXAA 2W60B 1KPUB 2QL1A 4FQIL 4XMTA 4M03A 4F57L 4D9LL 4LCUA 4Y5XA 1Q9WB 4ZMYA 3T0WA 4WGKA 1GGCL 4XNBA 4YXLH 2H0EA 3UTZA 1CD8A 3ZQWA 1PYWB 3KYKH 2FQFA 1XR8A 4XN1A 4F3FB 1BDYA 2B08A 1OT2A 1TEGA 1IM9A 1TU2B 2CKBA 4ZD3H 5CCKL 3ABLB 3SBRA 3CHPA 4M43H 1R5IA 1PY0A 5EU6A 2A83A 1XCTB 2VDLH 1AGEB 3Q3GB 1I4FB 2OMZB 2HX8A 4D8PA 4KRLB 2ZXEB 5DD6B 2CD0A 3VW3H 4JGNA 1RPUA 1MF2L 3WKYA 2ESVA