4JDEB

Crystal structure of pud-1/pud-2 heterodimer
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
146
structure length
143
Chain Sequence
SGVTEQWAKVDIENKSDHVFKFQVLHQYTGNALEASKWVKLEPNQSAQILEKVHYNTGPFTTGTDNWKVHGIKQIETNLDDVVDGKVRILGEAWRSGHPDGADWKKHTLRVEDHAQTTVIKVLEKEVQFVSKSGTSTTDFYRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein F15E11.13
publication title Characterization of PUD-1 and PUD-2, two proteins up-regulated in a long-lived daf-2 mutant.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Unknown function
total genus 34
structure length 143
sequence length 146
ec nomenclature
pdb deposition date 2013-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF18457 PUD1_2 Up-Regulated in long-lived daf-2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3820 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4jdeB01
4JDEA 4JDEB
chains in the Genus database with same CATH superfamily
3H9HB 3B43A 3MCLL 3VWKA 3TO4C 2QPFA 3K8MA 4H1LA 3IXTA 4KOBA 4S1DC 5HHOB 1ACCA 5DR5H 5F7FA 5DVKA 5IEHB 2Y24A 5B38B 2JCCB 1IC5H 3V95A 4QIRA 3U7AA 5DMJB 1HINH 1GR7A 2WSKA 2TRHA 1RK0B 2YXWA 1JHTB 3KW7A 2QSTA 3TN0D 2EYRA 2CR0A 3MNZB 1JF1B 5F89B 2RALA 1IJNA 3QBTB 4H0LC 3BFQG 5B39G 1C1EH 1EK3A 5K1JA 3TTYA 3AQZA 5H35B 2O26U 3IYLW 4HLEA 5BMFH 4XPAL 5IOPA 3DOSB 4OV5A 1EAPA 2CMRL 3OKOA 3L4UA 1MWAB 1QWUA 2AEPL 4FFVD 2NY7H 2IXQB 2W60B 2IQAA 2CPUA 4OLUL 2PF6A 3F83A 5EZPA 5IB5B 4GRLA 1NAMA 2V9RA 5FFOA 5HDBE 4JDTL 5ALBH 5E8DL 5JPMB 3LRKA 3NMEA 5TFSH 1G1CA 3E2HB 1Z3GL 2PUQT 4R7XA 3DYMA 1EVTC 3L5WB 4HJGB 1KLUB 1ROCA 3GF8A 3GJFB 2BLFA 1KBWA 3ZSTA 5HYJB 3P73B 1MVUB 5K1NA 4L05A 3NJIA 4AITA 5CIPA 5C0AD 2DQUH 3DUUB 4N1EA 1QABA 3ZGIA 5EULV 4X4ZA 2GTWB 4PWIA 3EJTA 3MV9B 4I1NB 3LPPA 2W91A 3LEXA 4WJ5A 3N06B 4FQHA 4AYMC 1SGKA 4L37A 1NFDF 3IU3B 4ICXA 2OL3L 4JFDE 3EBIA 1HH9B 3WG7B 5FWQA 5JOPD 2ZCHL 1N26A 2WKOF 3HI6L 2HT4D 3IGLA 1MF2L 1FCGA 2IBBA 4X8JB 5E00A 2R1YA 1XGPB 3SZ6A 4HCGA 4LRIC 5ESVA 1Y1DA 4ORGA 4LP8A 5D2LE 4ZMYA 1MIMH 4YSUA 4FQQB 3F7QA 1T7WA 4KPHH 4MQSB 3U83A 4B0MM 5M7QA 2R0LL 4P3CL 3MRFA 2FR4B 2QZQA 2KKQA 4KU1A 5EDXA 4HMEA 2NXZC 4O02L 1KEGH 1WBYB 3WE6A 4G5ZL 4PLKC 2FTAA 4GQPH 4EUPA 4DP4X 4A7UA 1TCRB 3VFRA 4R0LC 1G43A 4JKWA 4GMTL 2AQNA 4K7PL 4OF0A 4J3OD 5BJTB 5K9KA 3JVGA 5GGTL 5TE6L 3HMXH 1IGJB 3GZOA 1FL6B 1JNHA 3UTZA 3KMDA 5EU7E 2BNRD 4WI6A 1KYFA 1E5CA 3DTXA 3U7YH 3ULUC 3D0LB 2VJ8A 5DDHB 4HUXB 3VG0L 5T1MA 4P99A 5D2NC 3GB7A 4OCWH 1KELH 4Y4FD 1PX8A 5D7LB 1ZLSL 4N8VA 3D12B 4YDMA 4OD1H 4EIGB 1M1XA 2ZUSA 5A6LA 3ECBA 1EHNA 1OPOA 4JO4H 1D6VL 2YMOA 3ULAB 1UWEL 4DCQB 1VCAA 1LK3L 2FNWA 3HAEH 2IIJA 4TQHA 4A67A 1FC1A 4LEXL 4NNPH 2V17L 3V8OA 2Q9OA 4XC1L 4KK9C 4F2MB 3MRBA 1FN4A 5FFLA 2K4WA 5KYYB 1NBVL 3BPOC 1NGZB 1B0IA 4FLSA 5E9DD 1E67A 3TBCA 3LJ3A 1EH9A 3LQMA 3ESOA 1BYOA 3A6CL 3U4KA 1AVAA 1E3ZA 5CJ5A 1W80A 3FTSA 4P0DA 1PEZA 3NCWA 3WNJA 3RTQA 3F7RA 1XSIA 2BWDA 4HXAH 3X1NA 4A6YH 3I2CL 4S11A 2CDFA 4QJ5B 1KCVL 2ITEA 3OPZL 1EAJA 3KW8A 4JHAL 5IQ9A 5KZCD 4HG4J 1WISA 3K0YA 3KYAA 1QBLL 3DSFL 4A2EA 4NFDA 4I48A 1H6FA 3UYPA 5LBSH 5DI8A 3WN5B 4ZD3L 4EKXA 2DQCH 3B8YA 3NFPB 5JQ6L 5CO1A 5F6IB 4JGMA 3BRFA 3CD4A 3ZHKA 1UWFA 3ARBC 5B8CA 4Q9QH 4LPCA 5CLWA 2ZWSA 3SPHA 3A24A 1D9KC 1OAKL 1P7QD 1WFOA 3BIKB 1N0XH 2ROXA 2Z31D 5ACZB 3G9VA 1DCEA 3O2VH 1S9WA 1GTFA 2PR4H 2X4NB 2GKIA 1T80A 3AAZB 2XTJE 3IWUA 3QZPA 4E9TA 3O6KH 1ADQH 4UILH 1JV2B 3DX2A 2ESVD 2NYYD 3I6LE 4HS6B 4PRPE 5IBTL 1UXMA 1TYEB 1HILB 2XN9E 4AIZA 4G6KL 1HEJC 4IOSA 3NN8A 1MAJA 3HVDA 1OARL 5IVXF 2AJVL 1HYSC 2XQYG 4J3UA 3DETC 3JT2A 1OW0A 1T6BX 2IH1A 4JDEA 4H0HB 1NGXA 3Q8BA 1WAAF 1XT5A 3D18B 4NZRH 5EBLB 3V6ZA 4DESA 1O9WA 2KL6A 3HMXA 4B9ZA 4FXKC 2X05A 2YMXH 5BRZA 1CBVH 4M5ZH 2XN1A 3HZ3A 3K1KC 5BNXD 2XX1A 4RFOH 2OTUB 3VD7A 3ISWA 3E9UA 3ABLB 2WNKA 4CILA 3TIDB 3PDDA 4MDIA 3PREA 4NS0A 4ODSH 2R2BB 4TNGA 1U3HD 4M1GL 4HOWA 4F24A 1OT2A 1EJOL 1FJ1A 2QPDB 2VXTH 4JRYD 4KOCA 5DFTA 4AW7A 2XFXB 2R0KL 1QLRA 5KYUB 5EH1A 3WENA 2HRGA 1RP8A 5GSVB 3HAEA 1RHHA 3B9AA 3MRPB 1X9RA 3HA0A 4XP1H 1OL0A 4WUKL 5J3HD 2VRQA 3ETSA 3MFFB 3E80A 3QEQE 4QT5B 2XJLA 1MHEA 1BVLA 1OHQA 2OL3B 1YQVH 3CUPA 2WHVA 4LEEA 4GW4B 1X5IA 3LEVH 7PCYA 2ZUXA 3IDGB 2R29L 4PHZA 1YJDL 4XVSH 3EGDB 4IIQC 5JA9A 1E90A 1ED3B 1KLFB 4UZUA 1CT8B 2NR6A 5AAMC 3MLWH 2HJKB 1BZ9B 5D1QB 3QDJE 3NA9L 3QW9A 4A6YA 2GB2A 5D4HA 3QDJA 3DARA 3C09B 4AM0Q 1U92A 3GSUA 3FOLA 1SXCA 3MJ8B 4YK4B 2GK0A 2R59A 4NZFA 1X3DA 3LV3B 2F8IA 4ZO8A 5DD5L 2ITCA 4QTHA 4LSPH 5F7DB 2DQGH 4H0GA 4QY8A 1KENL 3BSGA 4L29A 2WXOA 4Q0XH 1CE1L 3GINA 4B3VA 4QF1B 2VLJE 2ZKXA 4QHPA 4Y9FA 3TZVD 5DWUL 3FXIC 5A2JH 2VLJA 4X0NA 4AVKA 3D2UA 5DRWB 4C8XA 1E43A 2NY4B 3L16A 2F5AH 4NCC2 4PCKA 1H8NA 3A67H 3N04A 3OKYA 3M6DA 4HXBL 4LF3A 2OXHA 1TU2B 4OFPA 5CN2A 1ZY9A 3BPLB 3UYRH 4JNXA 4ZTPL 1KULA 4ZT1A 1OSZA 4NC1E 2E7MA 1NAKH 5DO2C 3QI9C 4M8QA 2MKLC 2GABA 3Q5OA 2QMJA 4N26A 3TTSA 1ERNA 3VCLA 2E75C 3IEAA 1A9BB 1AZRA 3GBML 1SLXA 5EOTB 1KGIA 2IMNA 1U8JA 3CPUA 5C0AB 2Y6SD 3QIUD 4NKMB 3U0WL 4GOSA 4X6DE 2A6DA 1JDCA 4X6DA 5ITBL 5IUSA 4HJEA 1P69B 3E1F1 1KLGA 5CSZB 4XCNB 4GUQA 1W72B 5I8OH 2YAOA 4IHBA 4G1EA 4QEGA 4OCXL 1S8DA 5B1JA 3DV4B 2VXUH 4PJDB 1AGFA 3MLYL 4LT7A 4HZLA 2YA0A 4FXGB 4FABL 2QQLL 4YC2C 2YRBA 4HEPA 4P49A 4XCFH 4YHLH 1ZLDA 3LTVA 3VMOA 2E46A 4RCAA 1FBIL 1M6UA 1J5DA 2E9GA 4ONOA 2WN2A 4UINL 3E6HB 5AENA 1INEL 4U7SA 3TASA 4HOMA 3FCSB 2WNXA 4X5XA 5F9WB 4NLAA 4KQ4H 3S5LB 2ADFH 1D2PA 2CBTA 4XXDA 3VSQA 4EI5B 5T1KB 4EMZA 5IG7B 4PLJC 3SY0A 2B5IC 2XYBA 1ANUA 1A6VH 3U1SH 4M7KL 3QUZD 4HBCL 4JPSA 1E4WL 4YSSA 3MRHA 2WAHA 2FDBP 1WA2X 1YMMB 3ARQA 5CGYD 3ZDYE 3ETBJ 4XNXL 4WHYH 4WFHE 4TKWA 4AOFA 1RSFA 1WEJH 3ZKND 3TCXA 1LO4H 1C16A 1UASA 4P5MB 1KPUB 3SYCA 5F97E 4FQ2H 5IBLD 1N64H 3U4BL 3WLBB 5LG6A 5GHWL 1UHVA 3IPFA 4DP2X 1MQ8A 3H8NA 4OSUH 1MH5A 1WWCA 3VYPA 1VKXB 4P4RB 4Y4FB 1VLXA 3QCVH 3PUCA 3DURB 3T4AA 4GXVL 1JD9A 2QHLA 2YFNA 4JN2B 3P3RA 3KG5A 3MZGB 5EN3A 4ZNEE 1OAZH 1U2YA 4ZNEA 1G94A 1N9PA 1UB5A 3OM3B 5CEZD 4LAJH 4P2CG 3RL2B 1I8KB 2VLLB 4POZD 3KLHD 2CJSA 3LD8B 4YFEA 5E9DB 1A5FH 3KL0A 3RA7H 2HG0A 3EZJB 3QDGD 3RIFK 2GIYA 4AG4H 2X70B 4GUCA 1T0MA 4UQBA 2ZPKL 1BAFH 1CCZA 3PGCA 1XGQB 1QO3B 1U4FA 2X4TA 4DEWA 2ADGB 5DTFB 3KS0J 4WW2B 4GUPA 3VB9A 2HXAA 1YYML 4J3TA 4WI9A 1ZLWK 4UWQB 5GGSY 4C4BA 4DUVA 2CLVB 3IN0A 2UY7B 5IHHA 3IJYA 4PG9B 2L04A 2FL5B 2IPTL 1JSYA 1RURH 5EG6C 1T4KB 1IX2A 1VSCA 2BNUA 4ZMTA 3L3DA 2XKUA 4G8EA 4QYAA 4DT2A 5GGQH 4UM8B 2O5NA 1UM5H 1XIWC 4KKCD 4DGWC 4UNVA 2LV4A 4L3CB 5IJKA 4I9XA 3OWRA 2OMVA 2AV1B 5HI5D 3UTTD 1XF5A 3SKMA 2X6CA 1MFBH 2OJ1A 2WM0A 5T1DL 3T2OA 2ESVB 1RU9H 2RBLA 2VUKA 3EF7A 4XNUH 1GYUA 3WS3A 2CHXA 5ABAA 3VFTA 4Q6IB 1N68A 9PCYA 4FTVB 2H0PA 3IETA 4K71B 5JPNB 4IBZA 1OT4A 5A43C 1X5FA 2UYLA 5CEXB 2YA2A 4HPOL 4QJ3B 2WZ6A 4L9DA 2VDPB 5LAXA 4DAGH 5DUBB 3U0PB 1CTOA 2P8LA 3NRPA 1H15A 1YSOA 4U1SA 3QZLA 4NQEB 3WMQA 4FHBD 2VSMB 2OMUB 1OAQL 2ARJA 1P4UA 3NCCB 5CEZL 5ILTL 5KEZA 2BCKA 2VL5A 5GRUH 3UBGA 2BSRB 1GZPA 1OKEA 1NEUA 1QFWI 4YE4H 4JAMA 3VH8B 4FNPA 3PGFH 5A2AA 2VXSL 4E41A 4APQA 1XGYL 3PYCA 1FFNA 2R0WH 3QJSB 2ZOOA 2RCSH 2K6WA 5EC2A 5F1NA 4J2XA 2Y07H 3WY3A 3F85A 3BP7B 2W94A 3CVCA 5T5FL 5I19L 4XN5A 5LWYL 3CBRA 3WXVH 1UZ8A 1Z5LA 1PYWB 5FO2A 1WIOA 2Q86B 4HG4K 1SHXA 1BPVA 2I25N 4R9HA 3PABB 4KMTL 4U1HB 3CXDL 3DKHA 2GJRA 3B5GA 3EF4A 3ARGA 1DBAL 1E27B 3IPEA 2BDNL 5D1XD 5DHVB 2CNZA 1S9YB 1XGRB 4U1IA 4N2OA 2OR9L 3DGDA 4G7VL 1PD1A 1T04B 4HIIA 4KVNH 5FYLH 5E6IB 1A9VA 1QEXA 1HC1A 2CBOA 4OJFL 4L8BB 4ZPTA 4AXWA 2OR8A 3DHMA 3QEUB 3SO3B 3TT3H 4Z23A 2WXKA 3FUEA 4Z5RB 1CDIA 2PO6D 3KPRB 3QFGA 3MR9B 1N6UA 4P23A 4Z7UA 5DQJA 1R3IL 5BV7H 5DC4B 4GP4B 4Y1SA 5KSVB 2N0MA 1KIUB 2X40A 4G8GE 1YUHA 4G8GA 4XO4A 4RSVA 1YEIH 3DJRA 3FH8A 4UBDD 1CD1B 3HUJF 3DRTB 3GMQA 4LHUA 4BQCA 1N5AB 1ZIAA 4MJID 5ENWA 3WJMB 4NT6A 5IMLA 1E2VA 3CX5J 3NH7L 1CGSL 4G6AD 3S3CB 4PRNB 1CE6B 3LAFA 3ME0A 1HE7A 2B9AA 4JO3L 2HX7A 4MNQB 4GAJH 4L8SA 4JCMA 1AIZA 5EC1A 3KCWA 4ZX4A 3V4PH 3MOBH 4ABUA 4C4KO 1ZA6B 3MXVH 4IU3A 1LDSA 1V7MH 1ZIBA 1RPKA 1GZQA 2OPCA 1D5MA 1U8QA 4YHIB 3UMTA 6FABH 4URKA 1KF9B 1NCIA 1E4HA 4YHOL 3FTUA 3GZQA 3A21A 1RL1A 5I17B 3G6AA 5BQ7B 1HOCB 3G7TA 3QIUB 2BSED 5D7JD 2GVYA 2ZSVB 1OZUA 2A6KA 1AXIB 1M7IA 1KCRL 4AV0A 5IT2H 3VFNA 4RNRB 3UTOA 2Y69B 3UGUA 3HEIB 3KYOB 2WLLB 5D7SH 1NA8A 3WIFA 3K6SA 3VXMD 2RH0A 3O3BA 5IFAL 4UU9A 1SQ2N 3PV6A 1A9EB 2AERT 4KTGA 3DX1A 2IALB 1SM3H 3M1BB 3T1FA 2X89A 5IB3B 2XZZA 4I9WD 1BX2B 2VUYA 4G42A 2Y1AA 3U6RA 3U7WL 2E9BA 2J8UE 4QAWA 2YEZA 1SOKA 4QRSB 2P3YA 3RHWF 2CXGA 2YPKA 2CKNA 4XP4L 4NYLB 1IFHH 2CGZA 2O4EA 3FYEB 3Q8CA 4QXGL 3WO4C 1IZJA 3CHSA 4LLWB 1C5BH 1Q9LA 1BWMA 1HEZB 3FTYA 4L1SA 4OKVB 5EUOB 3B1TA 3L1EA 3FU7B 4PV9A 3QUZB 2RIKA 1KDIA 4UQDA 3VI4B 2QLVB 4G80A 2YSSB 4O58H 1HCFX 1JTOA 4RMRA 4YPGB 4LDLB 1MFEH 3EJZC 1XGUA 4PBDA 1R3KA 3V9EA 5CHNA 5CN3A 2YGQA 2VWEC 5IB2B 2CHWA 4QHNA 3D69B 5LGHH 1WZ1L 3CH1B 2AJ3A 3GDCA 4UV7L 5LNEA 1CZ8H 1MJJA 1WPCA 1SXSA 3EGXB 4OTXH 3SGJC 3T77B 2YAFA 2LTQC 3JT0A 5E24E 2WXQA 5HVGB 2BNQE 1RZGB 3D3VE 1SN0A 2NY1B 1NCUA 3MJ7B 4XZUB 3BQUB 3BWUF 1CDHA 4FQPA 5I18L 5I8CA 2NTSP 3BFWA 1Q4NX 4RX4A 1K72A 1CFNB 4XTRD 4IEFA 1JNNH 1WIPA 3MNVA 4IRSC 3WIHH 4G8IA 3IJSB 3NSJA 4RISL 1B2WL 5A1AA 2ADIA 5LNGA 4J1UA 4WWPA 1PNCA 2JCCF 5JW5B 3SDYH 2UWEF 5T3ZD 3QDGB 5F1IB 2EVIA 3D39B 1R75A 3SE8L 2ATKB 2ZJSH 1S7XA 2H32A 2CGRH 4OBRA 2YPLD 5E9NA 4C83B 1NCAL 4L3EB 4OUUB 5E2VH 1NL0H 1YPZE 3I02A 4HGWA 3UPAA 1YPZA 4U1GC 1LWJA 5IMKA 2JJWA 2Y5TB 5K9QG 1L6XA 1LQSR 4ZUWA 1I1YA 32C2A 4U3HA 4CN1A 2D7NA 3FB6A 5E2TH 2SEBA 3ZKXC 3QR2A 1QA9B 1FL3B 1ZVHA 3GI9H 3SYOA 3FO0L 4J27A 3MI6A 5ISZE 4JMNA 4ZFFA 2ERJB 2X7LB 4GSUA 4KUZL 3TO4A 3WTWA 1FDLL 4QXWA 1H6EA 2WQRA 2CCWA 2BW4A 1ID2A 3SDDC 4X6CE 2CE6A 2AK4E 4X6CA 2P42B 4R5TA 4BFNA 4DPCX 4DZBA 3IJ7A 4OCMC 3V0DA 4WENB 1GS8A 2YQ2A 1GGCH 2R69H 5F7NC 2ID5A 3FO1A 5H4ZA 3CZNA 5BZXA 3SDXA 5AVRB 2Q6WA 3OQRA 4OFQA 4W9KC 5EDSA 5MEND 2H4EA 4Q9RH 1KJ3H 3DJSA 4XGZA 4IDLA 5KVGL 5IB1B 3UBXB 4L9LA 1N18A 3BWUC 2H6PB 1NPUA 4D9LH 1LTXA 3NIGE 1L9QA 4LCCB 4ECNA 5KW9H 5HGDB 1ES0A 3MREB 4L5FL 4MBRA 2GIXA 5JIQA 1G6RL 2I5YH 4PEEA 1RXLA 1JK8B 4CC0A 2AAVA 2NUTA 4FFWC 4K3DH 2DJUA 5DJ6A 1FHNA 5CP7A 4NN5B 2BVTA 1BIIA 3OMAB 5I30L 1OGAB 4HUMB 2G3NA 3GBNH 1SEQL 2Q7AA 2ZUUA 1XMWA 4GSDL 5AEAA 2H26B 7PAZA 4N9GB 2FT6A 3FB7A 3WIHA 2N7SA 2DJSA 2J1YA 4HIJB 1FZMA 4D8OA 4HU8A 2F5BH 3DTUB 3WUWA 4TSAH 3ZKMC 2ZYIA 1DVYA 3QZMA 4U1JA 4F27A 5JPMC 3QAQA 2VCOA 3IJHB 4WKZA 1M4KA 2N1TE 3E2HC 4GKOA 4KRPB 5JW4M 3VFOB 4GP5B 4BKLB 4AYFB 1EO8L 4LRIA 1PZ5A 5FA4B 3ZMEA 1VERA 1TO4A 5DS1A 2YWZA 4DEPB 3KYMA 1RJYB 2JQZA 1AO7D 1OM9A 2H3NA 3KPOB 2XU9A 4XH2B 2CHNA 4N86A 3NIDB 2VLRD 4NQCE 1TQVA 4C57C 1S9XA 4JEGB 3CU7A 3WBDA 2J3SA 3EFFB 4H25A 3C6SA 1UC6A 5HPMA 4P3WA 3L1FA 3BPNB 4U1NB 1CURA 2KZBA 1A1OA 4TV3A 4KX7A 4WHTB 4PRHA 1A7OH 1ZTMA 4MS8D 3HKZA 5I1LB 4ZUUA 1EIBA 1G1OA 5CR8A 1P4IL 1DBBH 2EDNA 4HISA 4MVBD 3C60D 4AH2A 4HHAB 2Y7LA 5LB1A 1OCOB 4AQ1C 4HWUA 4TQEL 4KQ0A 4GNKB 3S5YA 2FJFB 5L88L 1ZPLA 4Q6KA 5KVEH 4UAOB 4YWGH 1JV5A 4JDVA 2NMSA 4OLXH 3N0PB 2D7PA 2WXMA 2DYSB 1LE9A 3BAXA 1DQJA 2QADD 4Y1AD 2A0LD 2VQ1A 4ATWA 2A73B 2OFQA 5HGAA 4DGYL 3DX8A 3GXNA 4KDTA 3GSOA 2HN7B 4FFYA 2WXIA 1NFDE 1J8HA 4ZUSB 5C70A 4PTUB 1NFDA 2JKRM 3PNWA 3H7BA 3VGAB 3VXMB 4XPFL 1AQHA 2YD8A 3WDJA 1PZAA 4XMKL 1F4WL 4OY9A 4XBPA 1D5BA 1QSFD 4FYTA 1AZZC 3TV3L 3HLAB 3AU0A 4ZPVA 2VDML 3Q6GH 5SWSB 1CLOH 3BW9B 1GJWA 4NO2B 3V5DB 5HDOA 1NFIA 3LMJH 1EDHA 3HG1E 3ARBA 4ANKA 1L7IL 2WUCH 3HG1A 3BN9C 4K9EC 5LGJB 3F00A 4GG8A 5FM8A 1AHMA 1YNTB 3AT9A 2JJSC 5DF0A 2WTRA 5LDUA 5AAPA 3KJ6H 3FUMA 1IB5A 3GXIA 2XWTB 4NSKB 2I9TB 4AUJA 4O4YH 1KJVB 4HALA 4O9HL 1KXTB 4YO0B 5EBWB 3BWAA 4M7ZC 4G9FA 4GO9A 4KGLA 3A6BL 1UA6L 2B20A 5A16A 1A4AA 2F54D 4Y9BA 1Y6MR 1TMQA 5I5IA 5CINH 4LFHG 4PW4A 4FP8H 1BOGB 3CX5K 5C6TH 1AYRA 2X9XA 3WN5C 4LZKA 3JUZA 4QTIL 4JFED 2IDFA 3MQIA 3SYAA 1T6WA 1XHHA 2BS71 1SBSH 4ZODA 5BS0B 5DK3A 1PY9A 4NQVA 1G6RB 1JN6A 3QEHB 5KVFL 1J5HA 4UYPA 2IQ9H 3K8LA 1EAOA 1ZLEA 4H88H 3HB3D 1EUTA 1JHLH 3CVIL 3HC4H 2BMKA 4YGAB 2N01B 3P54A 1T1ZA 1TT6A 3WS6C 1LE5A 1UGNA 4KJQC 1FNSH 3FQNB 4QNPF 3WMSA 4YDZA 1SHMA 3II2A 1AZUA 2XC8A 4YXHL 1JD7A 1BZ7A 1DQLL 2OZ4A 3Q13A 3SQOH 1TCMA 3HI1B 2JELH 3W5NA 1BVZA 4CW1B 3U2SA 1ZHLB 3MV7D 4HX1B 2BOCB 3EYVA 4Z8FL 2PXYD 2O30A 4A7SA 4NKOA 4POUB 4X6FA 5KJRH 2FSDA 5F88B 5JW3H 1G7IA 1HZHL 3HNSL 2FX7H 5C3TA 4XCYB 4O2EA 1KY7A 3K6FA 4Z9KB 4MMXB 3JUYA 4K8RH 1VGEL 3WEOA 3HI5L 3GJFK 3ZIYA 5SV3A 1BBJA 1P6AB 2G2RA 2WWNA 4IIQA 4YVUA 5F7HA 5EOCH 3ALPA 2PYFB 3MUY1 4RGOL 4XNMB 3WL9A 1X9QA 2AGJL 2E76C 2AXFA 2EVHA 3ZE0B 2Y3AA 2J6EH 2BC4B 3QNXB 1H3PL 2AQ3A 1E6OH 2DAVA 2WW8A 3GPEA 3L3KB 1I7RB 3PPEA 5EBGA 3B3IA 4LSDA 4E9XA 1S9VB 1KT2B 1F02I 5AYUL 2L7QA 4NBZB 4ZTOH 3T65A 3II1A 3L7EA 4WO4D 1EX0A 5IQ7L 3PHAA 4KKRA 2IWFA 2PW1A 1DFBH 5TF1L 3TCLA 4YEFA 1NCDH 2D3VA 1N10A 1BOYA 1L9NA 1AZBA 3CFBB 3BJ91 4ADJA 2BO0A 3QUXA 5IVZA 2WLHA 3ARYA 3QXAA 4ILDA 4PQXA 5IVXE 5JXEA 1NICA 3V4VL 1CFSB 1WAAE 4QRUB 3SPCA 1T03L 5MEPA 4M1DH 2YAQA 5D1QC 2AHIA 1MXGA 4N85A 4LLUB 2JJUA 1GGBL 3PWLB 3C09C 3X2QB 2P5PA 3CIQA 4YHYB 3KPPA 3OJDA 2APBA 5F7YC 1CFQA 1UWXH 3PP4H 4AM0B 4JZJB 1LM8V 3IFLH 1K4CB 1QYGH 3O8XB 2VLKA 5DHDA 3RGVD 1U93A 1N3NA 5JIPA 2O1AA 3UBHA 1KXHA 3E1ZA 3D33A 5C92A 2XPGB 4HSCX 1U9KA 1FCCA 4MJHA 4DK3A 2NY4C 4I77L 4XVUD 4LL9A 3RWCB 3F05A 2IOMA 4J3OF 1PL3A 2EIBA 3IFNH 2DY2A 2EAEA 1SFHA 3UMNA 4NHUB 2EACA 4H40A 4Y5VC 4FFVC 4IOFD 4JCLA 1ZK9A 3BPLC 1DSYA 4OGXL 4UOW1 3VX1A 4X7FC 1PZUB 4FA7B 4U6HA 5DK2B 2A6JB 3QUMB 2X41A 1NZRA 4KKAD 2R2HB 3FFCE 1NJ9B 4TM9A 3FFCA 5DJ8A 4BZ2A 1NCTA 5KYWB 3FO2B 3U30B 5I5JA 5BZDB 3F12A 2VDMB 1XF4A 1E5BA 1P7KB 1SJEA 2DQEL 1J05B 1AO7B 2W0PA 2V2TA 4K7PY 7FABL 5ERWB 3SGKC 5T1LA 1GGIH 4U3XA 2ATAA 1IEBA 3F04A 2IG2H 4LARH 5FHAL 4YDLB 2JIXD 4JDZB 3LKRB 4DP5X 3DMMD 4YX2H 2V8MA 5CCHE 2WZAA 3UIYA 3BUPA 3O3AA 2NX5D 2FATH 3QORA 1QHOA 3LN4A 2WVTA 1T2XA 4WW2F 2IAMB 1FH5L 1RUKL 3D6GA 3RJOA 5HI4D 2QQNL 1OTTD 2HT4C 2PCPA 5H2BA 1YNKH 5F9WC 5L2KB 1UJTA 2WP3O 5C7XL 1G7QB 4XB7A 4RDBA 3QUGA 2AJSL 4EI5C 3R7RA 4E2OA 4OD3L 2BJML 1IKFL 1MI5E 1Q72H 3CBKB 3EDJA 4IHOB 3EDEA 3IFPA 3C60B 2C5DC 4E42B 3OSKA 2Z35B 3GMMB 4HHWA 4JVUA 3BPCA 2E6PA 2XBDA 3BE1H 5DZPA 2K70A 2QFPA 4PJEA 4WI5A 3U4AA 1TZAA 2FX8H 3VI3E 3MXWL 3VI3A 1BG9A 1ROWA 2ZG1A 1JXFA 5AL0A 4KK6D 2RB8A 3EG9B 4FERA 3S5LG 4MZ3A 4J3OC 1LK2A 1Y6NR 5DEJA 5AKRA 4AGNA 1MELA 4NQTA 1I8AA 3WTVA 2FLBT 1X5GA 3GRWA 3LQAL 4DGIH 3CG8A 2ENSA 4B95C 4MA7H 4LP5A 1PG7H 4N2AA 1BJMA 1WFNA 3CVHH 3TO2A 2EDFA 5LVEA 2H3KA 1HAUA 2BRQA 4R2GD 3SB3A 1DEDA 3RWJB 4Y4FC 4G9DB 2N56A 3ELQA 4GIAA 4J3OG 5D71L 2AKRA 4DVRH 2UXFA 2WYTA 3DX7B 1DVTA 2DQMA 2DQTH 3PWPE 1AGDA 4L8CB 2MNUA 2CO3A 2MNWA 5DHYA 4K5PA 2G2PA 5DLMH 4BCXA 3LD8C 2E3VA 5GGVY 2QHRH 4G3YH 4TULH 4JFFD 1JUFA 2ETWA 4XP6L 1FRGL 2ED6A 4TMPA 1A4JA 2XWZA 5GRJH 4NQXA 4P06A 2XG5B 4CKQA 4OM1H 1HNGA 1E4XI 1HHKA 4ZMAT 4UMSA 3FQ1A 3FPXA 4N0RA 4MD4B 5IP4A 4JO8A 4WW2C 1M3IA 2D73A 4UNUA 3JV4A 4JY5H 4AYID 1V10A 2WO3B 2FRGP 5F9JB 2ARWA 2F54B 3B2UD 2NY0B 1WBXB 1YJDC 4R5XA 4X0KA 3TH2T 2WVVB 3FL7A 1AFVH 4PJBB 3ZTNL 3BP4B 4HWBH 1MHHB 2ZWNA 3KD4A 3OKKA 4HP5A 4PD4J 5DMKA 1ZLUK 4K9JA 3Q3GA 1ZANL 4CMHB 5KJ7E 2A9ML 1I3VA 3HNVL 3P9MB 4PRDA 4JFHD 5I1GH 3WKMH 2Z31C 4W9LC 2CBQA 5J0BA 1ZSHA 5SX4H 5KUMA 4GRWB 1FLTX 4R84A 1DLHA 1KGCE 1CXIA 1VFAA 4ZJ9A 5BO1L 1TETL 5IJCC 1E0OB 4N1CA 2XVGA 3R4RA 3CU1A 4HLZG 5I8EA 2NYYC 4WIQA 4ZFOA 2GBTA 4JCWA 4ZO9A 2OSWA 1ESOA 2LFGA 4OLZH 3DDFA 5FYKL 4Q6IC 1YEEH 4OJEH 4F9LA 1F13A 3A47A 4GEJA 4K71C 4QRPA 5JPNC 1T5KA 2I60L 1MKFA 1MQKH 5CAYB 1DQTA 3S34L 4N24A 3B7UX 1D7FA 3APFA 5E8NA 2YWYA 4O2CA 5EO1B 5AYQA 1FIGL 2B1OA 4XI5D 4CC4C 5DZNA 3V0WH 1H6UA 1T4WA 3C12A 4WY7H 2XKNB 3FUDA 4G43A 1AKJB 3FONB 2KDYA 2I69A 4QRQA 1XAUA 2V5TA 3KYNA 3TONA 3CSYB 3BAYA 1CFTA 4FNLH 4KXAA 4GKSB 2E47A 4JL1A 3BDYL 4M29A 5E1IA 5E7FA 5AW2B 5E2UH 3CLEL 5FAAA 4ALAH 4KDWA 5B3JF 5E1AB 4Y5YB 5IMOB 1EA9C 1YMHB 5KS9B 4M4RA 4WI8A 4LLYA 2YXMA 4TUKL 4KI1A 1XX9C 3PGDA 4PS4L 1HQRA 4NUJA 4WI0B 3QNYA 2DLGA 1SY6A 4PWGA 3VH8G 2UXVA 1CK0H 2E9JA 4X5PA 1HZKA 1F4XH 3LYRA 3T3MB 3VO0A 4ZFGL 1H9DA 3QJQB 3MVSA 4B9PA 1I31A 4LVOB 3V55A 4A37A 2GJZB 1IAKB 5GGRA 5ABZA 2FT7A 3FO9A 1D5ZA 4ELMA 4PJ9A 3DXAE 1F86A 3CQQA 3MFGB 3DXAA 1DN2A 3HG3A 5CKAA 2MCG1 2CBPA 2DWDB 1X4YA 3N1PC 2JNZA 3U82B 5ANMB 2QV2A 2BVEA 2BRRL 3C5SA 2NY5L 1GYCA 4HYTB 4EDXB 5I75B 4D0BA 1MG3C 4KFZC 2O6DA 3SO3C 1D5XB 3FT3A 4ZW3A 1G7MA 3JBG7 4HWBA 4QRRB 1W91A 4Y88A 4Z7OB 2NZ9D 3VI4F 2QGBA 3OG4B 3TZVC 2UY6B 2PW2B 2B77A 1RZIB 3UROR 3NCEB 3P4NA 1FYTE 3CJJA 1A3RL 2X6MA 1FYTA 5BZWB 3V79C 1FNHA 3U46A 1DDHB 4OLEA 3N6YA 4A39A 1AYOA 4XMXA 5C07A 3R7QA 1RZKH 2ZUYA 2DQIL 2ITDB 2VDQL 4P2RD 1U8HA 5H37G 3VRJA 1EO5A 3CDCA 2CIIA 4WSKA 4FFZH 3SE6A 1HE8A 1Q9KA 2X4UA 3G6DL 1QRND 4AGQA 4DKFH 2GJ6A 1MJ8H 1JZ3A 2X53A 4FQLH 4P8QA 4ZUVA 3IGKA 3T3PF 2HKFL 2W81C 4KKBD 3QHFL 3GMNB 5FC9A 1MWOA 1MFVA 3HZMB 4GO6B 2VN6A 3VWKD 1KIQB 2ARJQ 1IAIH 1MFUA 4HS8L 4ORZC 1CGTA 4WTQA 2N3JA 1QD0A 4ES8A 4G7QB 1JGLH 3NFNB 4K7FA 2MHAB 1KEML 1OTSD 4ZOAA 2CUHA 2Y6SC 3BKCL 3QIUC 3D07A 2VXVL 4J3VA 4X5QA 5G5DB 2PTTB 4G82A 5HGBB 4EN3B 4KZDH 3RFZB 3JV6A 3MA7B 3Q1SH 3HE6B 1G6VK 4JFSA 2F6AA 3IDIA 3OBAA 1EXHA 5BVPH 3HUJE 4Y19D 2ZONA 3AROA 2VWEE 1GJUA 3F65A 4ZSOB 3EJJX 3HFMH 4Q9CA 4D3CL 4KY1H 4M3JA 3T4YB 1UYWL 2YEQA 4MA3B 4GRLD 5A3ID 1ZEAH 5FUCC 3KLDA 3ULVD 3DHJA 3RIFF 1R3LA 1WFTA 2C9SA 1AQDA 1MRFL 3D50A 2B59B 1HS6A 1SMOA 4RMWA 1F4AA 1BV8A 4OJYA 1MN4A 1R5IB 4KAQL 5T3XD 3QJZA 4M7LH 1SEBB 4J8RA 4DKEL 4PRIB 2PCFA 3EOAA 5DHMC 1THCA 2CA3A 2DWSA 1CU4L 4D2NA 3QUZC 4J6RL 1Q1JH 2A74A 3C8DA 1JFQH 3L1OL 1LO5B 3MMEA 3WKYA 3DVIA 4XMTA 5DRZB 4HWEH 2HJFA 5CNHA 5SWZE 1OB1B 4LIQL 4M5YL 4ZFZA 5F0PB 5SWZA 1GYWA 3T2NH 1JERA 1OXYA 1WG3A 3ZKNC 4Z7WA 4DN3L 4N2FA 2YN3A 1J9QA 3L17A 5CZKA 5IBLC 4XODA 1NC2B 5BXFA 1DO5A 1UM4L 3VM5A 3MCG1 1V3KA 2QKIB 3P4OA 2NY1C 4QHUA 2Q76A 5AW0B 2Q7YB 4DUXA 1G5AA 3MV8E 4XNYH 2XICA 4LPTA 1PW3A 1U8IA 5J9PA 5DS8B 5JIDA 4OT1L 5IW6A 2BP0B 4G6MH 1SUJA 3LSOB 3W2DL 3HZKA 3VW3H 4WHCA 4FFZA 1BQHA 4POZC 3KLHC 3EDKA 3IJ9A 5MEOA 3G08A 1H0DA 3FB5A 1RUPL 4UANA 3PHOB 2Z65C 3FSVA 4X7SH 3SDDA 1R0AL 1G4MA 3QXDA 1YDPB 5CF3A 5CR1A 1KJ2B 3PS6A 3ASWA 4G6JH 1DVFA 1HCVA 2K3TA 1G7LB 3QQDA 3WFCH 5KSBF 2WWKT 4WWOA 2WXLA 4TNVK 5K59F 3V6OA 5HY9B 2G60L 2H2SD 4TNFA 2HUEA 1QI3A 4TUOA 3WOVA 2Y7MA 1NAML 2X88A 3R06A 3ULVL 2K6ZA 2W9LA 2VAAA 3GC3A 1O6SB 5KN5A 1TTBA 2V33A 3RAJH 4PS8A 4WUUB 1TTUA 2GITB 2Z4TA 4ZXBB 3HZVB 3Q2CA 2ERJC 4JHZA 3WFEL 4YHPB 5F9OH 2ZNWA 4KKCC 4ISVA 3GHEL 1IUZA 2NT1A 5GZNA 2GTZB 3DBXB 4XMVA 5HHOE 4M8RA 3LX9A 1XD1A 4NRZB 3LDBB 4YQXL 2V3EA 25C8L 2MNJB 5KYNA 2JCCE 5C9KA 3MO1B 1W0VA 2UWEE 2V9TA 3EHBD 2UWEA 2IO5A 3C9NA 3RNQB 2OQJA 5EIQA 2FWOA 4N8CH 3WUZA 3S2AA 2WB7A 3P9LA 4W9GC 3CHQA 1X44A 2J56A 4MAYB 5E23A 1ZGLP 3VXSB 5ICXA 2IGTA 2ZXQA 3C6LA 4K2UL 3MLPA 4HFWB 4UM9D 4IU2A 4B6ZA 1RVFH 3TL5A 3LS4H 3CCHB 3DVNB 4U1KA 2CR6A 1CYXA 4LCCC 1PFCA 2HT2D 2QR0B 2D9CA 1TYJA 2WLMA 1M7DA 3ZQ9A 1JYWA 3S0PA 1B0RA 4FF9A 1A2YB 2AXJA 1HH6A 2VQTA 12E8L 1CDJA 3IMTA 4Q9BA 1KWGA 1OGPA 5HYJE 3HRZA 4H2AA 1RFDH 4LOVA 1H6TA 1JTTA 3W0WE 1MNNA 1GIGL 3UBXG 4NN5C 3W0WA 3KPSA 4NN6B 4QXTB 1DQQA 3N40P 3T0EE 2XIIA 3T0EA 1ZVSB 4G59C 4TTDC 1EFXB 4XCEB 4AMKL 5LGKA 3LRLA 4U1LA 3NCFB 4OM0H 1XR9B 4QWWC 1E9OA 3ARTA 4AT6A 5ADOH 3Q2NA 4BD4A 3ZRSA 5JW4Q 5I0VA 4OQTH 3UCQA 1Z9PA 2X4SB 5DR5L 3KPLB 4PWEA 1J18A 1F11A 2OK0H 1THAA 4IOSD 4C56A 1UATA 4NP4H 2HVBA 3L2MA 2UZYA 2GW5A 1A66A 4N2IA 3BLPX 4IGBB 4J12A 4ZUTA 5HDLA 1OAYH 1S7VB 4OF5A 3ALWA 4KRPC 4NUGH 3U36A 4CSTA 1C1EL 2GAZA 3QIBD 4ENEC 5D1XC 3ZTDC 1IAIM 3HFFA 4WKXA 5BMFL 3R0MA 5C0CD 4WFFD 3ROLB 5BRZD 1VGKB 5EN2A 3C08H 2Y06H 2ZD0A 1FFPB 4P4KD 3OKDB 4ZW8A 2EEXA 2VYRE 4A04A 1OP5H 2ALWA 3LKPA 5ALBL 4Y9CA 3GLZA 3OZ9H 4GT0A 3SQBB 5TFSL 3MRRB 4PJ8D 2HFTA 3X12B 2WCPA 4IKIA 1OAJA 1BGXL 4PJGB 1U8PA 4ZX6A 1A1MA 4BWUA 1IT9H 1S7QA 4DW2H 1BMGA 3IFOB 5AL8A 3TA4D 3S35L 4GBXA 4WWKA 3TC9A 3V4UL 2DQUL 3TH4T 4UBDC 4P46B 1KN2H 3AG1B 3LKOA 3WGUB 4P2RB 3BQVA 5D5MF 5B4MC 1Y6KR 1BVOA 1NMAH 2WLYA 5DRNA 1AXTH 4S0TD 2Z9TA 5FGBC 4MCYB 4NI3A 2NR6D 4AYGA 5E5UB 3EJCA 4NKIH 4F1SA 5BRQA 1BZ8A 1T89A 3VGBA 1T2QH 4MMYA 5F7AA 4ZTEA 4L4TE 4UAOC 5FKPA 3IXTB 5L9DH 4NEHB 5A6IA 3D4YA 4PJ5A 3Q8AA 3O4LE 5ABDE 3O4LA 2EIZB 4J4PA 1MIML 1P1VA 5BW7C 3D2UD 3VGAC 1H8SA 4MZ2A 1QRKA 4JQXC 2GTQA 4JZOA 1USZA 5CP3H 3ZR5A 1QHQA 5GRZA 3VFWB 2Q10A 1KEGL 1MLCA 5IOPB 1LILA 4KQ3H 3BIBX 1EAPB 2ZX5A 3QQ3A 1IC4H 3MOQA 3OKOB 2Y4SA 4BFFA 2Y0SA 4JGUA 2JB6A 2IQAB 3OKLA 1W15A 2B3RA 4OQTA 1U41A 4GRLB 1NAMB 2YOCA 1GCYA 3HMXL 2AQSA 5HDBB 1Z9OA 4UTAA 3OMZA 3MACL 1MW3A 1XF2A 1GRWA 1ITCA 3G5XA 4G7SB 1XSOA 4XNBA 5KANG 3U7YL 4KXZH 4P2QA 5ECJE 3ZE0F 4F8PA 4OCWL 1L3NA 2APTA 4RWYH 5CIPB 4Q14A 1RIHL 3E7JA 2AP2A 3SIKA 4A2MA 4JO4L 3DJZA 1DQKA 4FGMA 4WNQA 3WNNA 4GUOA 4X5WA 1DJYA 3I6KA 3GXTA 1J0ZA 4CVZA 1NEZA 3BD5A 3FU9A 2DLIA 1PLAA 3LEXB 4NNPL 1B88A 3M7FB 4WLCA 5HHQA 3TPKA 4XCCH 3CFNA 4L37B 2OMZB 5LO7A 3LPFA 4PS3A 5GRXG 3TH3T 2AS5M 4F1ZA 5DD0H 3GDBA 1C12A 3I6SA 3QIWA 1UKSA 2G4GA 4PBXA 3VD5A 2Z1KA 1ZHBA 1IM3D 1VFMA 2YGNA 3QCTH 4HXAL 2R1YB 4A6YL 4P3DA 4JKLA 5HP5A 4X8XA 1YNLH 1D5IL 4ORGB 4X4KA 1A8JH 4WWID 1U42A 4LHJB 4YBLB 3FU8A 4HAGA 3AG3B 3M7OA 3IS0X 4KK5C 5FM5M 1GKEA 1YEWA 3MRFB 4LQFH 2NY2B 1A7RL 2DQCL 2J5WA 2FWUA 5E1HB 1OB0A 4Q9QL 5KSAA 1B6DA 2P9RA 3VFRB 3AY2A 1FQ9C 2VXQH 3GO1H 2UVEA 4PCYA 3SGDH 1N0XL 4P59H 4M48H 1I3RA 1T21A 5K9KB 5AOZA 1M3JA 3VRIA 5J06A 1XSKA 3O2VL 1G9HA 1NFAA 1JNHB 2PR4L 5IF0A 4XP5H 1H8LA 2K78A 1IMHC 4MMXC 3O6KL 1U21A 2GHZA 4OLVH 3OXRA 1O0VA 5CMAA 5T1MB 2F19H 3GB7B 1UACH 4WK0B 3VA6A 5D1QE 5IGXH 3GXPA 1UQSB 1P5UC 1FL5B 1UXSA 4AYSA 1HI6B 4CVXB 1P53A 2JJTA 1M1XB 3QO0A 3UFIA 3ECBB 4NIYE 3L7FB 2HPTA 1D2OA 2PTVA 3NCJH 1Z32X 3MKGA 3WV0A 1UADC 5DJ0A 4MJ5B 1IGYB 1PX4A 4QNPE 3MRBB 1YEJH 1P4LA 4ODHH 2CO6A 1KZYA 3AC0A 1AQKH 5DD3H 2YMXL 4O02A 1CBVL 3RWFA 4M5ZL 3MLTA 4YDKH 2C9PA 2CDGA 5LCVH 3WFHA 3TN0A 1S46A 4RFEA 4PJAE 3RTQB 1KPVA 4PJAA 4AQ8C 1NDGA 3KLKA 1FO0H 3RU8H 3GSXA 3EH1A 4ODSL 2V37A 4ZDHA 1K5WA 5AOJA 3RZCA 1WWBX 5IQ9B 4V11A 1YY9D 4Y5VA 2H8PA 2ZWLT 3AT8A 3G5ZA 1X4ZA 4I48B 4YHYC 3UYPB 1FNGA 1ACXA 4ZX5A 5DI8B 4XP1L 1KFGA 1JI2A 4JZJC 2ZG2A 3NSYA 1FC2D 1B3IA 5EF1A 1YQVL 5B8CB 2R2EA 3X3GH 1FWXA 3LEVL 2X2HA 3O8XC 4FN0A 3IAQA 1LVEA 1CGXA 1OALA 2EDXA 2W07B 2W5PA 4XVSL 5FUZH 5C0AE 1ULVA 4HS3A 1S9WB 5GJSH 3DI3B 3G3LA 1HYRC 1KYOJ 1LO2L 5F96H 1IBBA 4C55A 3UADA 1JJUA 3ZVVA 3DECA 3PWVB 2XTJB 4XAWL 3ZLQC 4X50A 1P5VA 3FQYA 4W9DC 1RZJH 4PRPB 3U9PH 4AIZB 1LEGA 1E4XH 1QSED 5JQHC 4LSPL 2CK0H 4Y4HB 1FZOA 1DJXA 3NN8B 5ALCH 3DLQR 3T6VA 3ZRFC 3TF4A 3K2MC 1DL7L 4Q0XL 5IMMA 4HKZA 5JOPE 4X80H 3M17A 3VFVA 1N5YH 2GBUA 2IH1B 4JDEB 2F5AL 3FN3A 3GT6A 3FT4A 4U0RB 4PGBA 3V6ZB 2X6AA 2NPLX 3A67L 2ZYHA 3VDBA 5DFVD 3SKOA 5I76A 4W68A 3F7VA 3T9WA 1HXMA 2F53A 2C4XA 4CA4A 2D0HA 4L2LA 3CDYA 3RPIB 2I07A 1NAKL 2OBGA 3OKMA 3AXIA 2EILB 4MDIB 5FYJU 4YDLC 2CUMA 1I1FB 3ZRCC 4E41D 5LJYH 4P5RA 4APQD 1FZKA 4QXUH 1QLRB 5F1SA 4RETB 2R1WA 1RHHB 2EE9A 1IC0A 4KUCD 3ZDXF 5EFIA 5JHLH 3L3HA 2BNRE 2WXHA 5C0ND 3WXWH 1JGVH 8CGTA 3KGTA 1VADA 2BNRA 3F7YB 4G72B 4XC3H 4V1DA 1BVLB 1BHGA 1AP2B 4MS8C 1IKOP 1ORSA 3SJVD 4FQIH 2C9QA 3B5HA 2APVA 1YZZA 3ARGD 2VXUL 1FO0A 3C60C 4GG6F 1N6VA 3OZLA 2EDQA 4Z6AT 3QDJB 3KH4A 2DMKA 4Z7AA 5IY5B 3IU4H 1U92B 1T3FA 3GSUB 4XCFL 3I6GA 5E5MA 1OTUD 5DVNA 1BF5A 2EDHA 3U0TA 5FX3A 1YAZA 2GK0B 2ZP8A 2NY6B 3LN5A 2XLLA 4HHGA 4AL8H 1GHFH 4OD2A 2ITCB 4S1SH 4QTHB 1UD8A 5E9DE 4GRWF 2A0LC 2ZKWA 5C0FB 4PI0A 4KQ4L 2E59A 2W9EH 3PNRB 4Z0BH 5L7XH 3IDJA 3BVUA 4L29B 1RJZA 3C5JB 2IC2A 4PJ7F 3PAVA 2VLJB 3ZE1E 1N0LA 3ABGA 3D2UB 4OIIH 5E5LA 5INCB 1PZ3A 1UJ3B 3U1SL 4PBVC 3TJEL 2Y1YA 4LHUD 1BM3H 4JG0H 4LF3B 2AK1H 2OXHB 4OI8A 3W3BA 5FB8A 1F56A 1UZGA 4GO8A 1WEJL 2PNDA 1LO4L 1KCSH 2K4AA 4LPXA 4M8QB 3RKPA 2ODIA 2AXGA 4FQ2L 1RD6A 5DJDA 2GI0A 1N64L 3EYUL 5CU9A 3VCLB 1A64A 4OSUL 1KTJA 1P7QA 2B4CH 2XV0A 4HZ1A 2Z31A 4JFXA 4PP2A 3ZMNA 1P1ZA 5G4MA 4AYEC 3HE7A 1Q1PA 3QK0A 1RZFH 1B0GA 1JI1A 1CL7H 3N1MC 4PREA 3VFUA 5A2BA 2DW5A 2A6DB 4X6DB 2ESVE 3BEWB 1KLGB 3APNA 5KS9F 1R4XA 2HUHA 2EINB 2LLGA 5DRXB 5I6LA 1UD4A 2G9KA 3TNMA 1BSIA 1S8DB 5LQBH 3ULUH 5BVJB 1AGFB 2NY0C 2F18A 1A5FL 2Y2YA 3RA7L 1KB5A 4HZLB 4DPBX 1GKOA 2QLYA 4WGWB 1RY7B 2E5EA 3ALXA 4LXFA 5F6HI 5A2CA 3PL6B 3K80A 4PIBA 4JHBA 1FI8C 4C54A 4X5XB 2EQDA 1DO6A 3QC6X 1KCBA 1KZQA 3PXHA 3IVKA 4XXDB 3SBWA 4WTZG 4ZMNA 1PJWA 1W0YT 4UNIA 1GZHA 4WDIA 3U2JA 5KBPA 1ZE3C 1RURL 3CMGA 2O72A 4B96A 1ZT4A 3JWNC 3HC3H 5GGQL 3UTPD 4WQOA 1U3HA 4AZ8A 4JRYE 3MRHB 4HT1H 4U1MA 3MLUH 4CVUA 4Z7OF 1UM5L 4JRYA 3I9GH 5GRVL 3FSOA 3ZDYB 3BDXA 4GSXA 4WRLA 5FYLD 3WTXA 1HKFA 3KBFA 4AENB 3FS9A 5AAWC 2PXYC 3H3PH 5EWIH 1WRFA 2VMCA 5AWNH 5JA8B 3ATAA 3FF7A 1XO8A 1BVKB 4FQJH 1OP3K 3WJLC 3C8HA 3JWNG 1RU9L 4OZGE 1MH5B 1BXAA 5ESAA 4OZGA 4U49A 5C0RL 1WA0X 4L4VA 1CBJA 2DI7A 3T4AB 1JF5A 5B7MA 1ZVNA 2Z34A 2HB0A 3EDFA 1UD5A 3BP6A 3FQUA 1G9EA 3SOBH 1UB5B 4OUOA 4DAGL 4PJHF 1IQDA 3QWRD 2FK9A 4LSUL 4WO4C 2V2XA 4LCUA 4MQ7A 1A6PA 4PWJA 2X1QA 4YN3A 2MJWA 2VNCA 1T0MB 2YD2A 3GMPA 3ERXA 3NABL 5GRUL 3ARFA 1QLEB 4K5NA 3S4SA 4Q56A 2X4TB 2ED7A 4PJXA 1F6AA 1PQZB 1WO2A 1SVCP 3GIZH 2ZF8A 4WSGA 1Q9OA 4N0CC 4LVOC 1OWWA 3LPOA 2H41A 4TOYH 2CLRA 4DWHA 3IJYB 5T8IA 1TEYA 2VSCA 3TVMA 1NLBH 3O6FD 2R0WL 2RCSL 3WEXA 1CLYH 2Y07L 4X7TA 4MQTB 2BNUB 2F15A 4MXWH 5IVNA 3QULA 3L3DB 1A02N 2OKMA 1X5XA 4N5UA 1GC1H 5DZLA 3WXVL 2M83A 5EZIH 4F7EA 5I6PA 4G83A 3PAUA 5DYOA 1RHFA 3E8UH 3V2AR 3LXUX 4M6NH 3PWNA 4KMQA 3I3EA 2DBLL 5DHXB 4MWFA 5B3JE 4X9IA 2E4FA 3ES6A 2OMVB 4P5KA 4Y5XA 1XF5B 3SKMB 5CGTA 3PY9A 4XVUC 3ATEA 1BLNA 1N4XL 1E40A 2ZOKA 3TNNA 3IDMA 1CFMA 3LQAC 4FL4B 5DZOA 1W2KT 3WS3B 2FHFA 1E3FA 5FYJH 3VFTB 1TVBA 4JRXA 4YSAA 3TT3L 1SYSA 2OP4H 5F44A 3D09A 2YARA 1P0SE 4FHJA 1QWNA 2JTYA 2AF2A 2UYLB 2ZYRA 5BV7L 3R1GH 2GYSA 2DYPB 3H56A 3OC8A 5LAXB 4FFTA 3RPKA 2D2OA 2Z93A 2P8LB 4RDQF 3K74B 1H15B 1QASA 3UACA 4U1SB 3V0EA 3EIFA 5D6DC 5D7HA 1L9PA 1JPST 3KPQB 2ARJB 3GI8H 3I9PA 1U30A 2BCKB 2VL5B 1CD8A 1JF6A 4ZBJA 1GZPB 3VI4E 5F7EH 4EN3C 3RFZC 3HJEA 3O0LA 3MBWA 2GSGA 4UB0H 1GA2A 2E0PA 1V7ML 3DMMC 6FABL 4APQB 1TQWA 3WTTA 3BGMA 1FFNB 5DMIH 4P9HH 2IOOA 3D85D 5EC2B 2KYIA 2AQ2A 4QUOA 4TNWF 3QUKA 5JOEA 2EE0A 2Y36H 2BZDA 1UZ8B 1Z5LB 2IDSA 3N41B 5AVXB 1OTTC 4GAGH 4N20A 5IT2L 1MPAH 1Z5YD 1R6VA 1YVLA 3T3PE 4F7CA 1QR1A 2J5LB 3GXMA 5D7SL 1GW0A 4FNRA 3WKQA 1IFRA 2WLNA 4Z7VF 4XMZA 2PN5A 4ZO7A 2XA3A 2IBZY 5AB2A 1DQVA 2HSIA 1IZKA 4U1IB 3UTQB 4APXA 1LDPH 4HIIB 5CEZE 1SM3L 1JIBA 3IGAA 5TTRA 1TTAA 5C6WH 3O6MH 2HWZH 1KYOK 1FZJA 4KK6C 4ZPTB 4AXWB 1GW6A 2VDOB 3QDGE 3MHZA 3SPIA 3OAWA 1IFHL 1MOEA 4YSCA 5I71B 3BH8A 3CDGA 4P23B 4Z7UB 4IKJA 2G3MA 3FCTA 3M45A 2DI8A 3P40A 4JB9L 1YUHB 1EXUA 2VN4A 2X0VA 4G8GB 3V7AG 4M6MH 5FW6A 2QKIC 3OKNA 4O58L 3GMQB 1NUNB 4LHUB 3LB6D 4MS6A 5ENWB 1IM9A 4HWNA 4PRHD 1MFEL 2BP8A 3SCMB 5IMLB 3MN8A 3L3JA 1AOHA 3ME0B 1FNEA 1T1WA 2Y1ZA 3FU3A 3BSZA 4L8SB 3GK8H 5CJQH 1BQUA 5DEGA 5EC1B 5HDWA 5LGHL 2ITFA 4BKSC 3AM8A 3BKYH 2AV7A 3KLAA 2CRZA 1CZ8L 2DQJH 3DIFA 1VZGA 3QPQC 4IU3B 4OTXL 4JKPL 5F71A 1GZQB 3MRCA 2JVUA 1A8ZA 1D5MB 1U8QB 4HV8A 3UEQA 2MQGA 3SE4A 3S8WA 2ILLA 1FGVH 4RDQG 3G6AB 3UTTE 3B83A 3UTTA 3HS0B 2A6KB 2DKUA 1R19A 4HIHA 3BCFA 4QHKI 4F57L 1B4TA 3VFNB 5F2FA 3UTSA 1JNNL 1DJZA 1J8HD 1T5XA 1A47A 1OP4A 3WIHL 4BZYA 4BGLA 1AOZA 3K6SB 3SDYL 1QLFA 1NGPH 3KDPB 4YDVA 3O3BB 3QWOA 4DKAA 2VR7A 1U4EA 2K8QA 3A4AA 4UU9B 3PV6B 4BZ1H 3ZHLA 1E30A 2CJUL 1MCFA 1E28A 3T1FB 1DANT 5SWQA 1H3VA 1SF3A 4G42B 3U6RB 3BH9A 5E2VL 1NL0L 4GQZA 3AY4C 2YEZB 1SXNA 1Q8MA 1Z9NA 2YPKB 2NY5C 2QPSA 3LDBC 5LLIC 1Q9LB 3DO3A 4UQIM 3RWDA 4HW6A 1YN6B 2XWCA 3FBKA 4PV9B 4OCNC 2O5YH 3A4DA 3DNKA 3MGTA 4MAYC 5DMGC 4CL7A 5KSBE 2IANA 1F58H 4JJHA 5KSBA 4BK5C 2WOBA 4G9FD 3RVTD 5FF6A 3VJ6A 4DKTA 5DS2A 4KJWD 2VTFA 4NBXB 3C5ZD 2KH2B 4UT7H 2P43B 4PGZA 4QHNB 3E38A 3RI5K 4CADA 1ILSA 2AJ3B 4HUKB 5EEZA 1J48A 1MJJB 3FRUA 3MRMA 1GGCL 3N9GH 2DV6A 5BV7B 3D2TA 4UT9H 4UF7C 4NWUL 4KHTH 3RWEA 2BNQB 3OVUB 3LXAA 5D1XE 4Q9RL 1KJ3L 5I8CB 2YK1L 1Z1WA 3STBA 3C5XA 2EVJA 2VJ0A 4QOKA 3B2DC 1RZ7H 2PMZA 3JTSA 3NJJA 3DO7A 4D9LL 4IEFB 3MNVB 3U9WA 1A4KA 5KW9L 4G8IB 5CCKH 1J10A 2NSQA 4J1UB 1HHHB 2VDNH 4I3RH 4AQAA 4E0RA 3ECWA 1WC7A 2I5YL 2PO6A 4KK8D 3EBGA 3APDA 1TTCA 4W9JC 4X98A 5GS0L 4FFYL 4K3DL 1S7XB 1CFVH 4N28A 2H32B 4D0CA 1BEYH 2F58H 2LVCA 5J11B 3WTUA 4E9YA 1A4BA 2B0SH 2D7TH 2WC7A 1AIFA 3I02B 4FD0A 2BWQA 2E7LA 1YPZB 2B8OT 3ZTJH 4MJIE 3P3UA 4MJIA 4PIRF 4ZUWB 1F1DA 1I1YB 3D34A 4AW4A 2BIPA 4HC1H 2WXPA 3FB6B 4I0KA 4R7NA 2SEBB 4GW5A 3RIKA 2G2NA 3S37L 3B7RL 3WNLA 5L4MA 5IFJA 2FT8A 3KJ4B 3ULVF 1XH3A 5E7BA 3QISA 5D9SA 4I5BA 4LLAA 2F5BL 1BZDA 4TQPA 4TSAL 4ZFFB 2IPUG 4BZ1A 4DSYA 3TO4B 1A7NH 1ZVYA 4N2CA 3ZL4H 3QZNA 1TVDA 2BSEA 5D7JA 3FW6A 4DHLA 4M56A 3NYKA 4X6CB 1UTDA 3CZEA 2YD7A 3N2JA 3FNKA 5FS5A 4DZBB 1CS6A 2LFEA 4Y2LA 3O0RH 1V05A 3S98A 3VSUA 4P46C 3FO1B 2QT6A 4J7RA 5CLZA 3SDXB 3VXME 2DEXX 2Q6WB 5AVWB 3ZT6A 2HFGH 1RUMH 4XGZB 5EU4A 2KLTA 2B08A 3T04D 4L9LB 3IPBA 4ZO6A 2OMBA 4I9WE 3AUWB 2XA8H 4AGMA 4KKBC 4NWTH 3NIGB 4Y4KA 1G0XA 1PJ9A 4F2EA 1ES0B 3RTLA 3KWWA 3SPJA 3VWKC 4ZAKD 3ZOAA 3US1A 4GPVA 4PYHA 2ADJA 4IMLA 1A7OL 1OTSC 1NIBA 4RZCA 5D55A 2IH3A 2NUTB 3S8GB 5J6GA 2VLKD 5IW1A 5HDQH 1DBML 2IBZX 5DJ6B 5JORB 1HFUA 5CP7B 2D7OA 3ZDWA 1BIIB 1DBBL 2L8AA 3EZ8A 4Z0XA 2JKJA 3KPMA 4UDTA 1VRSA 1Z66A 4NRYA 3ARDA 3FDWA 3EAKA 1MCPH 5KVEL 3C8KA 4YWGL 1J5CA 4UTCA 1DQDH 4H1LG 2HLAA 4OLXL 3FB7B 3KM2A 2XXMB 1G7PA 2Z8WC 1EANA 2Z7WA 5D5ME 4HIXH 3FHEA 5D5MA 1CTNA 5KVGE 3VXPA 4QI3A 3WUWB 4GRLC 5A3IC 5C71A 3LHAA 1U8NA 3LZFH 3ULVC 4CN4A 4A68A 1LD9A 4U1JB 1OWRM 1GPOH 4WKZB 5E6RB 3ZGHA 4L5FE 2E86A 2G5UA 3K2KA 2GG1A 4CDGC 5JHDA 3H4HA 5EMYA 1PZ5B 3TIEA 1HSBA 4K8RD 1KTLA 2H3NB 3OHXA 1ZS8B 3UO1H 3NAAH 2ALAA 3NJKA 3Q6GL 3NEOA 1CLOL 2WLKA 4NQCB 1S9XB 1QTSA 4B3EA 4IYKA 2Q8BH 2EYTA 3CNKA 3LMJL 1AKPA 1K3IA 4FNUA 2R0ZH 2YPLE 1NSNH 4BFIA 2VDRH 4XNQA 1F3DJ 2YPLA 3PCYA 4ZQKA 3OLEA 4H25B 3TOPA 3C6SB 3TYGH 1NBYA 3KS0H 3SY6A 3FFDA 3KJ6L 5E8PA 1JOIA 3ZZSA 2Q8AH 4O4YL 1A1OB 1UEYA 1RUAH 4AE1A 3ECUA 4HH8A 4ODVH 1TPXC 1YEFH 4RAHA 1FFQA 5D72H 3EOBA 2KI6A 5KSUA 3CPLA 4ZUUB 4YXLH 1BQ5A 5CKGA 1MRCL 2WQWA 4YBLC 3QQNA 3W11C 3UX9B 3ZE0E 3NZ8B 5CINL 3VFGH 3VGGA 1I3GH 4FP8L 4AH2B 4W4OA 5C6TL 3Q9QA 4E36A 2Z8RA 4MNHB 1F3RB 4BK8A 4RAVA 4KVCH 1ZD6A 1ZHKB 4N8UA 5F7KC 1Y7VA 4KI5D 4JDVB 4QCIA 1LE9B 1DSFH 1K9TA 4I8DA 1SBSL 1DQJB 2NYKA 2VQ1B 5EEXA 1URZA 5HGAB 1MFNA 2C7UA 3DX8B 3JVGC 1T66D 2IQ9L 2VH5L 3GSOB 4YXKH 3HG2A 1JRHI 4NPJA 5DQDH 4QPEA 2VQUA 1JHLL 4XVOA 1PGRB 1NFDB 3HC4L 3HNTH 3PNWB 4WU5B 5B7EA 3V6BR 2H2SC 1KGWA 4I13B 4ADGA 5MENA 1FNSL 5AVZB 3BUYA 2G5RA 5KJ4A 4EUPG 2PCXA 1KXQE 5F7WC 4KROD 5FW7A 2JELL 3SQOL 3TEWA 3QT2A 4XBPB 1D5BB 2VUOA 4BZ2L 4QTFA 1SMAA 4ZPVB 2WSPA 5KJRL 5JW3L 2WNWA 1T5WA 1FPTH 3QJHA 4JPIA 4KXBA 4MYPA 4LOUD 2FX7L 3QHZH 2V0AA 1I9JH 4LCWA 2OYPA 4E9LA 1NFIB 2EEBA 1IGMH 2NW3B 3ARBB 4JG1H 3IXAA 3HG1B 2AJYH 3EHBC 4GG8B 2WTRB 2BVOA 4N8VG 4B9CA 3KCPA 3ESPA 1F00I 5E94A 2J6EL 1NPJA 1IFGA 1O7DC 1OANA 4JM0A 1E6OL 3F5WA 5AOLA 1NBCA 3BWAB 4DKDC 1QW8A 1FFRA 1OAXH 2Z64C 5A16B 1DFBL 5TGBA 3SGEH 5TE4H 2HT2C 3STZA 3GWJA 4OLWH 1UXLA 4XBMA 4PVLA 2QBWA 1NPNA 2FHBA 2LQRA 1F5WA 4JO2H 3H2QA 2WV3A 2J2ZA 4FXKB 1E50A 4P2OA 1IBGL 4NQVB 2DIBA 4PWKA 1JN6B 1I1RA 1BD2D 1TMCB 4M1DL 5C8JA 1AO7E 5IHLB 2FYYA 5KBMA 4DP7X 3BMVA 1LEIB 2WWOA 2BVUA 3VE0A 3GBLA 4B53A 2VLRE 2BMKB 4ESKA 1SUHA 2VLRA 2XTJC 1T1ZB 2H5UA 2YLKA 5BPPA 1LE5B 4UV4L 1DR9A 3STLA 3W56A 1UM6H 3PP4L 2D03H 1E9QA 3IFLL 4LBEA 1QYGL 2CO7A 3GRWL 1OM3H 5KVDH 4QRPD 1BXVA 2R39A 3U2SB 3ZYZA 3GBDA 5D70H 3EYVB 4CMMA 3PWJB 4NKOB 4X6FB 1G7IB 5TPWH 1FORH 2J72A 1OW0C 4V2CB 5I0YA 4O2EB 4NO5A 4GKNA 3MCKA 4U0RC 2LT9A 4Y2OA 2V5YA 1EZSA 2K7QA 1BBJB 1UWGH 2G2RB 2G0KA 4IIQB 3WL9B 2BOLA 3UDWC 3H6JA 5KG9A 3P77A 1P2CA 4JFQA 2GSIA 4NN7C 4XVTH 2AXFB 3CTTA 4N0FB 5KVFE 4JE0A 4NUQA 2BW5A 2Z7UA 2L7EA 4G6FD 2BIIA 4GINA 2DI9A 2OA9A 3B3IB 2K9FB 4YVNA 4EIUA 3VDCA 1OZTG 3T65B 3CFIC 4Z3JA 4Y1AE 4BRJA 3WEAA 4X5RA 2PW1B 4Y1AA 4U4BA 3TCLB 3WHXA 5I1KH 4LKCA 1ASQA 5I66A 2L7UA 5E9AA 1MWAH 3H2PA 2BSTA 3QUXB 2IH8A 4XN2A 5IVZB 2GC4C 3QXAB 5MP6H 2P5WD 4C4KT 1E2WA 4MA1C 5IVXB 1GGIL 3BWZA 2W9DH 4NJ9H 3L4XA 2QPEB 4QYOA 5C0JA 4DIXA 5MEPB 3PP3K 2NR6C 4YX2L 1QSFE 2G30A 5L0QC 1QSFA 5CFAA 3GJFH 2FATL 3HAEG 3POHA 1DUYA 2O5XH 2ZSWA 3KPPB 3OJDB 2C3VA 4L0ZA 1CFQB 1YUKB 4TVPH 1QKZL 4LB8A 4UOQA 4HH9A 5DVOA 1MAML 2EDDA 2NY6C 2PYEA 1CG9B 3EOTH 4KX9A 5FLUA 5JW4N 1I82A 4IBQA 4HEME 2B1HH 5K1VA 5K39A 5HHXH 1U93B 1URLA 3LNDA 1N3NB 2FGZA 3JWOH 3SSGA 5I0ZA 4GSRA 2NTFB 3T2LA 2BX5A 2G9HA 3RVWC 5DGQA 1KWKA 3ZDXE 3W5MA 1CF8H 5AVQB 2NNAA 3ZDYF 2JK5A 1H3WM 1DSWA 1ZV9A 1TZGH 4R26H 2PWFA 2FX8L 1PCSA 2WKGA 2F54E 3F3HA 5C07D 3COOA 3TBSA 4DP9X 2W0KA 4HPYL 5I73C 2PABA 4TUUA 4X8GA 1WLHA 4WTZA 1OQXA 3V6FB 2ICES 1P4BH 1PAZA 1ZTXH 2FSEA 2W65A 4U6HB 2NQ3A 5HJGA 4NC1C 4JFEE 2GJ6D 4GG6E 4TRPH 4DGIL 4JFEA 4GG6A 4JFVA 4MA7L 4GEIA 3FFCB 1PG7L 4HIEA 4FJ6A 5DJ8B 1AS8A 4D9RD 3CVHL 4LVHB 1RCYA 3F12B 1RK7A 2Q2EB 1XF4B 3PU7A 1JZ2A 2V7HA 1USQA 1WS7A 3WHE0 4GRWE 3EOYG 3L81A 3OGCB 3OAUH 5J89A 2PCYA 4L1HA 3HMWH 2V2TB 3CN2A 2B5IB 3VU1A 4JUTA 4HF5H 1UKTA 2KPWA 2K6YA 2DKSA 3JWNE 2DQTL 4PJ7E 4PJFE 4BSVA 4ETYA 1IEBB 4PJ7A 4PJFA 1PCXA 3Q43A 5AVVB 1WUZA 3RUGA 2JXMA 3SKJH 5DLML 5B1JC 1CGYA 4LRNH 3MV7E 1SY6L 2QHRL 4G3YL 4TULL 4RA0C 3MV7A 4TNEA 5HHMD 3QORB 4X8CA 3LN4B 3S9DB 2WLZA 5GS3A 3CBJB 3MRGA 5F89A 4PRAA 3MV11 1FG2A 4OM1L 1C5DA 2EP6A 2BP3A 1GSKA 3ISRA 4NENA 3AQYA 3DOSA 1HTYA 2PCPB 5H2BB 3ZYIA 3UJJH 1PTZA 4N2HA 4JY5L 3F2LA 1D5RA 4G8FA 3FZUD 2DIJA 3VD1A 4MNGA 5C0BD 3IFPB 1UKQA 1J11A 3CZKA 3BPCB 4HCIA 1AFVL 4HEPG 1FFTB 2FECI 5J1AA 4HWBL 3US9A 4PJEB 1E8WA 5LUMA 4QXVA 4FYSA 3MUJA 3VI3B 5KS9E 1A7BA 4XP9H 4DERA 3DUUA 5I1GL 3GD1C 1LK2B 1MFAL 1GS7A 1MCBA 2CNYA 2GTWA 4N90D 4OJAA 3M88A 3ILQD 3OPUA 2TSAA 3P4LA 4BUHA 1NUDA 3TO2B 2APWA 4S1RH 2BXZA 3EW3B 2YUVA 4OLZL 1KSRA 1HH9A 5HD8C 3CFMA 3T4AC 3H54A 1MQKL 2AKRB 4Z7QF 3BZ4A 4EDWL 1JVOA 1XGPA 2O61A 1AGDB 3V0WL 4S0SD 4BSWA 5DHYB 1IKNA 1JNJA 4AEFA 1INDH 3RX9A 3RY5A 4WY7L 2QVMA 3GUTB 3RGVA 5G2NA 1JCVA 4Z7OE 4BFJA 1JUFB 5ID0A 1A4JB 3KXFD 4NQXB 3QRGL 4MQXD 1HHKB 1GGUA 4LLMA 1PSKH 5EPMA 3S35X 3M86A 4U31A 5DVLA 1CXLA 3JV4B 1D6EA 4I88A 4KUCF 4ALAL 4LSRH 1YY9C 2RA1A 4I2XE 3G9AB 4I2XA 3N41F 5F7MC 4X0KB 1JVLA 2C4FU 4ZS6C 4OI7A 2UXTA 3OKKB 5DMKB 1KTCA 1QNZL 3Q3GB 3D4ZA 5AKTA 4Y2DD 1CIDA 5IJKC 5GZND 4PRDB 4PJHE 4R4ND 4TSBL 2FEDD 3K8KA 2BSSB 3O11A 4PJHA 3DX4A 3UZVB 1RUQL 4DCQA 4R97B 1UGKA 3QPXL 1HDMA 1CTMA 4UT6H 3ZMRA 1VFAB 4G7YH 4XNDA 2FBRA 5KYYA 5I8EB 2ZKYA 3Q2VA 4LLDA 4FL4C 4ZFOB 3RGBA 2JIXA 4BA0A 1UUSA 4Z7UF 2OL3H 5HVFB 1BQKA 1ZLVK 2EEFA 4ZW7A 2NX5E 2A9AA 4J2QA 4LU5H 3C6LD 4QRPB 5TDNA 2YQGA 1LXMA 3KWTA 3HI6H 1SLVA 3CK0L 5E8NB 4O2CB 3QDHA 2GY7B 4FMVA 1EDQA 1ASOA 3LNFA 3LH9A 1JPEA 3IDYB 1EBAA 4PGEA 4G43B 3L6FA 1ZLUH 1A6TB 3PQYD 4P3CH 2G0LA 3VU2A 5F1KC 1J8RA 3KYNB 4GXUM 3AWFA 3V7AE 1YECH 4FFZL 3KPSD 5E8EA 2DD8L 2Y2TA 4LASH 4KKLD 3P3TA 4LE8A 3WE1A 5M94B 3EYOA 1JGEB 3P1VA 4APQC 2YEVB 1IAIL 4M4RB 3PIQB 4LLYB 2CHZA 3IN2A 3PGDB 2DH2A 2OX5A 4JFUA 1HQRB 4NUJB 2O6FA 3U79A 3QNYB 4C56D 5C0NC 1L9OA 1JMZA 1XBRA 1GY1A 1UG9A 3PFUA 4PY7A 4KZDL 3VGFA 1OE1A 4JZNB 3NSXA 1GCFA 3UZQA 2ZOLA 3VFMB 4IMKA 3ARGC 5GGRB 1VFBB 1UWEH 2KBGA 1D5ZB 4ELMB 4PJ9B 4I18A 2Q20A 3UAJD 5BVPL 1LK3H 4ICWA 4AEEA 3DXAB 2KS0A 3QGVA 1FYHB 3AWGA 2ZZUT 3GKZA 3HFML 5AOIA 4LEXH 3K5SA 1CUOA 1A7QH 4KY1L 3C5SB 1OTUC 4OZHA 4DH2A 4NERA 1ZEAL 5GRWA 4D0BB 3MV01 3A6CH 3BESR 4JFFE 3VXUA 3FT3B 1W72H 1U8MA 6CGTA 4JFFA 1G7MB 2OJZL 1AC0A 2W0FA 2AMUA 4P23C 3QQ4A 3ARUA 4M7LL 1PZBA 1S78D 3T5WA 2XZQL 4JPWH 2N1KA 4HJIA 1ETJA 4A66A 2R2BA 5IESH 4J3XA 1MCDA 3I2CH 4I87A 1DUZB 1Q1JL 1EEYA 3P4NB 2HP4A 2CJTA 4QKTA 2VDLH 1FYTB 4UT6A 2KUTA 3U46B 3HBQA 2C3WA 4XN9A 3GNMH 5I6NA 1QBMH 1XGTA 1U8HB 3VRJB 2EIDA 3T2NL 2CIIB 3W9DA 1DHKA 1QG3A 4L8SC 5DJCB 2X4UB 4Z7VE 2GJ6B 3CFCH 4Z7VA 3MX0A 1ADWA 4DK5A 5FOJA 2R7EB 4NZ8A 4JFHE 3GM0A 1O7VA 1AXSB 2HJKA 4LHUG 1S6NA 3SBQA 1OCRB 4BCYA 4N1HB 1B3JA 4K7FB 4XNYL 4JQIH 5IQOA 1OSPH 5DZ9A 4PJ5D 5GGVH 4RFNB 1MCIA 1I3UA 3U6XS 1EDYA 4J4PD 4G6ML 4M61A 1U95A 3QRFM 5F7DA 3VW3L 3CV5A 1Q38A 1HJCA 3IDIB 1VB9A 4HGKC 3K2UH 2F1BA 5DT1H 2EDMA 3QE5A 2CWRA 2VIRA 4X7SL 1PZSA 3GQFA 1YPZF 1RH8A 4P5TA 4L0PB 5DEFA 43CAA 3FQ2A 4Q4IA 5BOPA 3GYRA 3PUUA 1J0JA 1AQDB 3N85H 4WF7A 2EUXA 4H26A 3GMLA 4J3SA 4PR5B 2FD6L 4HK0A 5C09A 1CYGA 4YUEH 2X5PA 4P2QD 4J8RB 3VQ1C 4PP1D 2YC1A 3IDXL 1S5IH 2PCFB 3EOAB 2Y1VA 2LU5A 3RAJL 5BZZA 2A74B 1BJ1J 1ZS2A 1OE3A 4IRSB 1I1AA 3BUBA 5AZUA 5A2FA 3RP1A 4ZFZB 5F3BA 1GAFL 3CC5A 1ZJBA 2NZIA 1KPRA 5SWZB 2HVJA 3AU1A 5JDSA 5FGCE 4YZFF 3UABA 5CSZA 1XCWA 1W72A 2A1WH 2R29H 3SDXF 2GC7C 4LSTH 3WN6A 4EI0A 5BXFB 2F7QA 2X4RB 5FUOH 5BV7C 4MCZB 4WK2B 3P4OB 3QIWD 2J57A 4XX1G 4QHUB 2Q76B 4ONHB 3D1MC 3HLKA 1X6LA 3DGGA 3VSTA 4U6VH 1M2VA 1U8IB 3LS4L 3P0GB 4HUCA 4F5CE 1CD0A 5IW6B 4KTEH 4F5CA 3HZKB 1WHPA 3VMNA 2YRPA 1WCBA 1BQHB 3OG6B 5T1KA 1BAWA 4JY6A 3G08B 1COBA 4LHQB 5AB9A 5IG7A 5MEOB 1EV2E 1H0DB 3FB5B 3PRZA 1SBBA 1JGDA 4ODXA 1GOHA 2BP5M 4MCMA 4LIQE 3G5WA 3SDDB 3QXDB 1RFDL 5A7EA 1S7TA 4B60A 3BHBA 1M05B 1T7VA 4BINA 4XWOD 3MU3A 1DVFB 3SDCA 3QQDB 4Q6YA 1SN2A 2DDQH 1J86A 4HSQA 1JYVA 3MRLB 2VDPH 4MGXA 2WPGA 4H8HA 4OM0L 5C0DA 3T8VA 4MZRA 4P2RE 5ADOL 2DM3A 3WNMA 5DQ9A 4OQTL 1PAMA 4Z95H 5LXGH 1QRNE 3I9AA 3MUUA 5KN5B 1QRNA 2Z0BA 3FTZA 2OK0L 4GI9A 1YO4A 4UTAL 2ZXEB 2AEQH 3GBMH 2K9UA 4P4RA 1BDYA 4H44C 4ISVB 3U0WH 1EAQA 3LEYH 4NUGL 3JWDH 3GBEA 5JYLA 1ZT7A 2N4IA 5ITBH 2AAAA 1W0VB 4YZWA 3EYFB 2UWEB 3O9WD 1CF1A 2NSMA 3C9NB 3QHTC 2OQJB 3C08L 5PAZA 3RL2A 2FWOB 4Z1PA 2RFXA 2UX7A 4BK4A 3P9LB 4S0HA 4LGRB 2MEJB 2ZAHA 4ZI8A 4EI6A 2ZCLH 4Y19E 1WSST 3I9IA 3RZWA 4Y19A 3OZ9L 5ICXB 1CB4A 1HHJA 1JRHH 3RZCD 4IU2B 4IRJA 1FBIH 1WV7T 4L9LC 5IQLA 5DTFA 2C1PB 4U1KB 5DHVH 3ULVE 1XXFC 4DW2L 2HTKD 1M7DB 1WZMA 4PG9A 1B0RB 1J1OH 1KN2L 2EC9U 4TTGA 4WI3A 5T3XE 2JI3A 1T4KA 3RNKA 3MJ9A 3AGWA 3MBXL 1CDGA 1ZMYA 3BXNA 3HRZB 4M7KH 4NNXA 5CSGA 1NMAL 3KWXA 5H37H 1AXTL 2HFEA 2ISDA 2CUAA 5IHUH 3L5XL 1MVFA 5D8JH 3W0WB 3KPSB 1DQQB 2F8OA 3T0EB 4NKIL 4DOHE 4U1LB 1DJIA 1E9OB 4AT6B 2WP3T 2XRAH 5L8LB 1AQMA 1QX1A 2C9AA 3LNEA 3CZFB 4PUBH 4NP9A 5L9DL 1EEZA 4QJ4B 2AJUH 2XVBA 5IQMA 1F11B 3UPCA 2YOAA 1MZZA 1TNMA 2UZYB 2Q1EA 1TJHH 2IWKA 1PLGH 4ZUTB 3EJSA 3QDMD 3JXAA 5MI0B 4CRPA 4B50A 2GAZB 1KB9J 1JYXA 1QPXA 3C2AH 3AS2A 5FHBH 4KQ3L 4W6WB 3UPRA 5EN2B 1IC4L 2LGNA 2E7BA 5DUBA 2G5BA 4RRPA 5JO5A 2F53D 2X3BA 4LCYB 4TPRH 1ICTA 5DZJA 3WUWG 2MPVA 4KMLB 2XPZA 4AQ1B 1FE8L 2DQFA 5GSRA 5IHBA 3LKPB 1YYLH 2GFBA 1WZKA 3RL1B 2KMWA 2FJHA 3ARWA 1RMFH 2VERA 3LZLA 5I6MA 1U8PB 2VO5A 1A1MB 3O6LH 3QZBA 2ZWYA 3LZQA 1IVTA 2YGPA 4RWYL 4GBXB 3F62A 4WWKB 4L48A 1HXYA 1W8NA 2EH7L 3B9VA 1XF3A 1PZ2A 2DLTA 2OI9B 3LB6C 2XSKA 3LKOB 4V1DD 3LOWA 3ZZ1A 4TF4A 1YC8A 3RRQA 3MYJA 3QP3A 2X42A 1HEHC 2Q86A 5DRNB 2WMPB 3DIVA 3S96B 3CFKB 1BA9A 1JZFA 1NANI 2LOEA 2COVD 3RKDD 3FMGH 2NY3D 2H6UA 4N2NA 5DD0L 4MMYB 4FCAA 4M1CC 3RVUD 2FUTA 2VZ3A 4L4TB 3GLEA 3B9KA 4MXVF 5DHVA 5FKPB 3WSQL 2GEEA 4KO6A 2UZPA 3QCTL 3KPNA 5F72S 1AGCA 1I53A 2W1NA 3FRPG 4N22A 4IDJL 4KDTC 3K4AA 4OLYH 3O4LB 4EN2A 4ZMOA 3H9YA 4OCYL 5GS0C 1J0YA 4H8WH 4XMPL 1O7DE 4JPQA 4CC1A 3QFJD 3VD9A 35C8H 3MR9A 5SX5H 4M7ZB 4JZOB 2YZ8A 1MLCB 4HPOH 3RJDA 4UM9A 1KIUA 1OF0A 1P84K 1F1GA 2DJMA 3QQ3B 5GJTH 4K94L 2WINA 1MDTA 4HETA 3OAYK 3SE3A 1LLAA 2VXQL 4UNTA 2JB6B 2W88A 5DJAA 5DUJA 3OKLB 4P59L 1JS4A 4M48L 1N5AA 4FKKA 2DRUA 1U8OB 1ETB1 2EXWD 2VISA 4I0PD 4OBSA 5CEZH 1XF2B 1J7VR 1SQMA 4Z18A 3G5XB 4OLVL 4XRCA 3RGHA 3RB7A 4F37K 4P2QB 3DVGA 1I8MA 2F19L 4F80A 4OR1A 4ODBD 2DBJA 2Q3AA 2VXSH 3L2NA 5IGXL 4LSSL 3BKJH 2ZCZA 5FECA 1XGYH 4OF7A 3HE7D 4BM7A 1SDYA 3V5KB 2VC2L 5SV4A 1QATA 2YR3A 4EOWH 4ZQTA 5IFHH 1UH2A 4S1DD 3UGXA 5BQ7A 5T5FH 3I6KB 5I19H 4GQRA 3NCJL 5DD1H 3RVTC 3WKPA 5IK3B 4CVZB 1NEZB 4XT1C 4KJWC 1AGBA 1MSPA 3B2PA 1X5AA 4JHWH 4W9FC 3VRLF 4XOAA 4RRPM 3AVEA 4AX3A 4YL4A 1YEJL 2V7NA 4AC2A 5HHQB 1ETA1 4ODHL 1AQKL 1WICA 3NQKA 4H5SA 5CBEA 3KYOA 2WLLA 4YDKL 1DBAH 1TJGH 3PDOB 4N68A 1C12B 5LCVL 1XD0A 2BDNH 3QIWB 3H9SD 1KACB 4Y1TA 2AZUA 3H9ZA 1ZHBB 3RU8L 1FO0L 3QIBA 4OAWA 5C0CE 4WFFE 1PD6A 4EVNA 3O81A 5BRZE 5C0CA 5IB3A 5IKCA 3RLSA 1T20A 5CEYA 4P4KA 1M71A 4QRSA 5B22A 3ZSSA 1OP9A 2IADA 3RIAK 4ZX3A 3QZWA 3MTXA 5G4NA 2Y7QA 1I85A 4AY0A 3T2QA 1R3IH 5EUOA 4O00A 4PJ8A 4KK8C 5E5RB 4GJTB 1MRDL 3SO5A 1AE6L 1WVZA 2QELA 5KSAB 1CGWA 3GMOA 5I0XA 5FUZL 3B34A 2GEQA 2FBJL 1I3RB 2YSSA 1T21B 4X7DC 4YPGA 3VRIB 2BS8A 5GJSL 3NH7H 1CGSH 5F96L 2H0EA 5IF0B 4KV5F 4JO3H 5IB2A 2Y7SA 3L9RA 3OXRB 1R5WA 3FSZA 5CMAB 3GS7A 1H3UA 1TUPA 5I15L 2IOIA 1RZJL 3NDYE 1E4XL 1UXSB 2M2DA 3T77A 4L4VD 3EO1A 4ELKA 1WFJA 4Y8AA 3QO0B 4TLSA 1IARB 4XZUA 3BQUA 4X80L 1E2ZA 3IE4A 1N5YL 1XZ0A 1K6QL 3KE0A 4P57A 3VTAA 2B7DT 4LSQH 3ZT5A 1FF5A 5DJ0B 5LBSA 4XPBL 2G3ZA 1KCRH 3P2DA 4Z77A 1P4LB 2CO6B 4FKEA 4P9ML 3KHOA 4O02B 3RWFB 3MLTB 4HD5A 3QUXC 5JW5A 3WFHB 3TN0B 4UIMA 2D0GA 4AKQA 3ARFD 5C0EA 3EXLA 2NXZD 4RFEB 1F1AA 5JXEC 1YEHL 1KPVB 3QG7L 4PJAB 3S6CA 1J1XH 3SKUD 4ZDHB 2J55A 1KB5L 2CXKA 3RZCB