4JDEB

Crystal structure of pud-1/pud-2 heterodimer
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
146
structure length
143
Chain Sequence
SGVTEQWAKVDIENKSDHVFKFQVLHQYTGNALEASKWVKLEPNQSAQILEKVHYNTGPFTTGTDNWKVHGIKQIETNLDDVVDGKVRILGEAWRSGHPDGADWKKHTLRVEDHAQTTVIKVLEKEVQFVSKSGTSTTDFYRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of PUD-1 and PUD-2, two proteins up-regulated in a long-lived daf-2 mutant.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Unknown function
molecule keywords Protein F15E11.13
total genus 34
structure length 143
sequence length 146
ec nomenclature
pdb deposition date 2013-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF18457 PUD1_2 Up-Regulated in long-lived daf-2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3820 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4jdeB01
4JDEB 4JDEA
chains in the Genus database with same CATH superfamily
2KDYA 1QLEB 2IXQA 4QXUL 3BW9B 4B6ZA 1IAIH 4P2OC 5HGAB 5KSAD 1JV2A 2ENSA 4X80H 2Z92A 3F3HA 4KY1H 3FUHA 2R69A 1E90A 2DQFB 3BW9A 4J3UA 3CH8A 1BQSA 3UO1H 1A7RH 3CPLA 2HPTA 5HVWA 4S0TD 2P52A 4S10A 3ULVF 3OKMB 1XR8A 4JFED 2YSSA 2GJZA 4MDJB 5CWSA 4FD0A 2DLTA 2P43B 3QEQB 3WFHA 3NCYS 3F85A 3IMUA 1E5CA 4PRIB 3IDYB 1TEGA 3J27A 4NQCB 1OARH 3VWJC 4BYHA 3UMNA 3MSPA 4O02B 1TEYA 1JHKH 3TESA 4Y19B 4FABH 4LIQL 2AKRA 3BP4A 2UWEF 5F1OB 3RDTC 2GI7A 3WY3A 4U1SB 5CINL 5LAXA 2QR0B 3AITA 3P02A 2VM9A 3QZOA 2XV2A 1YMMD 4N8PA 4W9JC 4GXVL 2FSEB 3VCLA 3GIVB 4W6YB 4LSRL 3Q3GA 1HL5A 5IEKA 1FE8L 3HNTH 3PP4H 3F5WA 1ZV9A 2V9UA 5D4IA 5KBNC 4YAQA 3WV0A 3ZE0E 5EPMA 1A66A 2FAUA 3MRKA 1OTSC 3VD7A 1UH2A 4WHDA 5I0XA 2BDNL 1WDAA 2ICEC 3AQYA 4MJ4A 2YKLL 3KPMB 4IRJB 1RZKC 2YC1B 2FCBA 5DJDB 4FMVA 3GBLA 3W9DB 4DIXA 1OPGH 2HTKD 1VDGA 2J44A 2YZ8A 3W2DH 3WNKA 2YD7A 1DBBL 1ZE3C 2NY6C 2YUXA 3FTXA 1KPUB 4P5SA 4C56A 5ERWA 1WQVT 4FQXD 1DSYA 4MQSB 1VA9A 1RZIA 2EIEA 4PW4A 7PAZA 3AXIA 3OR6A 3BN3B 1P9MC 1D6EB 3JTSA 4H4NA 5D1ZD 4O58L 3G08A 4XCCH 4AH2A 5ICZA 1Q90A 3OGOE 4HWBH 4UAOC 1T21B 4JFZL 4CBZA 4XCYA 2NY2D 2AVGA 4Y5XC 4RGND 4D9QE 3RIFF 2XIBA 4Y19D 4LEOB 2EDYA 1QHPA 2OZ4L 4JPKL 3I2CL 3VFVB 4FYTA 3F7KA 1S7TA 3F83A 2W88A 3ESPA 4HC1L 3NSYA 1XL4A 3BVVA 4LARL 5DJDA 2ODHA 1YCSA 1FBIL 4ODSL 3DX7A 2YOCA 1ZANL 3O3BB 4CBPA 3RVWC 1AGDB 1AS8A 4AW4A 3ULUH 2QV4A 4DZBA 3OKDB 1DFBL 4Z7VA 3TO2B 4MDRA 3NSJA 2J56A 5T1LB 2GJ6E 1U3NA 2D3NA 1BQLH 3HC3H 1OAZL 2WTPA 3WFDH 1AQKL 1G6VK 2YK1L 1TJIH 3QK0A 4HQQH 5CSGA 3ZTEA 1DO6A 1TQTA 3GTTA 1WF5A 1G5GA 4OCYL 1SY6L 4PGCA 5IBUB 4DNLA 5I5RA 2WUBH 3P9LB 3VFWB 4LRNL 4KX7A 5T1LD 2WVUA 1J9CT 32C2B 1OP9A 3U83A 4MA1B 4OZGE 1MNNA 1WZ1L 1Z5HA 3DTDA 3FYIB 3TWCL 2HVKB 3VXTA 4JJOA 3K6OA 1V55B 1D7FA 3CLEL 1FCGA 4TNWK 1ZHLA 4LP5A 3ZL4L 1SBSL 4PJIB 3BP4B 1XAKA 3NGBB 3SE3A 4O02A 1U33A 1P84K 2ZUQB 3SE8H 3SGKA 3WGVB 1XF2A 3HG4A 1AC0A 4X7TB 3QE5A 1HHKA 2ORBL 1EFXA 3D07A 5DMIH 3ARWA 4XGZA 4OLZH 5EZOH 1WISA 4PWGA 3ZT5A 3IDNA 4ALAH 2DN7A 1FAKT 2VDQL 2D7TH 2F53B 5IQNA 3CN1A 2IF7A 5DUBA 5FK9B 4ZMVA 2NMSA 4YUEH 3R4DA 1E6JH 2H3NB 2XTJB 4FQQA 3UAJA 5A3ID 5KYWA 5E8DH 2AV1B 4QRRD 4HX1A 2HTLD 2IG2L 3CBJB 3TYFB 4BQCA 1YQ2A 4JGUA 4QCIA 3P4OB 4ZO6A 4Y4HD 4EEEA 5L9DL 1HNFA 4HP5A 1HWWA 3FT2A 1FGNL 3ALWA 4MFHA 3QFDB 3QYMA 4PLKD 3CFDB 2F61A 3O2VL 4HJIA 1HNYA 1HINH 1JYNA 1QBLL 2YEZB 5D7HA 4EI6A 4V1DA 1JHTA 3V6FB 1X9LA 4MMZC 5IROD 1J9RA 2PPFA 5C6PB 4X9GA 4JDZA 2WXIA 2NY7L 4BQ9A 3LZOA 2QQQA 4FXKA 3UO8B 5BVJA 3H85A 3DYPA 3CHSA 4XBGB 3EZJB 5D1XC 4HCFA 1SYVB 4GKZB 3S3CB 3CU1A 2VSMB 4PHXA 1GJWA 4W4NA 1BXVA 1CYWA 3GMQA 3D12B 2VSKB 4QUOA 4LLQA 3DJTA 2Z35B 3ISRA 4HKJB 4D3CH 2V2TA 1TXKA 3MA7A 3MCG1 4M43L 3UTTA 1FN4B 2ADYA 5GGTL 1CQYA 2HJFA 1SXAA 3P4MA 4L8SB 2CO2A 3RPIA 1ZHNB 5IWLA 4LCIL 1XH2A 3F8UB 1IGYA 5FGBC 1WBYB 5C86A 1L7IL 1HOCB 2LQRA 1ROWA 4OZIF 3DBSA 2BRRL 2EEXA 3HE7A 3CFEA 3OSVA 4BK8A 1G6RA 1U8HB 1VFAA 1KNOA 2Z1PA 4GJTB 1QA9A 3WO4B 4HJUA 3UZVA 1N0LB 2JJUA 2OMXA 5C8JA 4RFNC 4JFOA 5E5MA 2BRRH 4Q58C 1G6RL 5IY5B 1E4XH 2QL1A 1OB1A 1YPZE 1JXJA 1KBGL 5IVZA 1NCBH 5BW7C 2AK4D 1UM4H 1U36A 4DPCX 2EVHA 3APMA 2LHAA 2WYIA 3CDGA 2FZ3A 1RLWA 1W80A 4ISVB 1KIRA 3MACH 3PHQA 3C08L 1WFUA 1H8LA 3FW6A 4JO2H 4KZDL 2R1YA 4CKVX 4M5YH 5E6ZA 3VFWA 2W80C 3FQTA 2GJ6D 1RKRA 1AI1H 5A2CA 2DQUH 5CJQL 1SFDA 2XQYK 3LMJH 3AY4C 2IQ9L 2ZUWA 4P2RB 2HG5A 4KXCA 5INCA 3TT1L 5KN5A 3JSSA 5CEYA 2A73A 5FDWB 3MCYA 1R1CA 4DP4X 3VI3A 3KMDA 3ECBA 5F21B 3DUUB 1J8HE 5AW2B 1AZUA 3IAQA 1QA9B 2AAVA 3IGAA 3FU0A 4BUGA 2Z65C 2Y7OA 4IBLT 5F89A 1JGVL 2MPVA 4D7PA 1WZLA 1K8IB 2HP4A 4MA7H 3V6OE 4B9PA 1YRKA 3LPWA 4DCQB 1CD8A 3LEYL 4X0NA 3QJFA 4QRPD 4GG6B 1DANT 2IAMA 2DYRB 5L6YH 2VB5A 5E9DE 4IK6A 4L8CB 4TNVK 1TCMA 3P40A 4NI3A 5H4YA 3IJYB 3CFIC 5IK3A 4HFUL 5JYMA 3SQRA 3VGGA 1D9KC 1QLRB 4Z7IA 1AQ8A 4BH8A 3FUJA 1GS7A 3FL7A 2BWDA 3RIAK 1NOAA 4KGLA 3RQ3A 4IGBC 2FBJH 1H3XA 4DERA 5C09D 4G6AD 5L0QC 4DFIA 3L3HB 5ENWA 4NN6C 4B7IA 3DO3A 2LR4A 2ZUUA 4GBXA 2CO7B 3ZSSA 1PLAA 1SHSA 2EC8A 2F15A 4WTZA 5J7CC 4PR5A 2FEEL 2E47A 4BXVA 4UM8B 3REVA 5ESQB 3RP1A 3VXOB 2ZXQA 3JWDH 1VADB 3WFEH 3N41F 3SQOL 5K9KB 3QIWC 3PCYA 4YDIH 4HW6A 4PJXB 2PYFA 2Q86B 4ZMPA 2EVGA 1N59B 3MRDA 4J3OC 4TMPA 4PBVC 3H7BA 3KYNB 4YHOL 1MLCB 2DLEA 4UQDA 2OSLA 2WY3B 4S1DC 2Z91B 4P46C 2XG4B 3VSVA 3MA9H 4JFFA 4F58H 1VZHA 1WCBA 2NDGA 4L4VE 3MUUA 5J3HD 5I17B 1UA3A 1YY8B 5HI4D 2M8XA 3HHRB 4JFEB 1YYMH 4FE9A 3D85A 1ADQA 1I3GH 2WBJC 5IR1A 3L1OH 1AAJA 2DI9A 4JE0A 4EAEA 2YXFA 3NAAH 1ETB1 1DVTA 5GS3A 3T3ME 5DDHA 3DOSA 5HTSA 4B9IA 1MJUL 4WV1B 4PJEE 1TU2A 3RWEB 2NY0B 2LT9A 4JDTL 1YEDA 3VMPA 1DQIA 4XP4L 3WEXB 5SWZE 4H8QA 4UT6L 1V10A 3GJFB 3BUPA 5C0BE 4TTDD 3PWLA 5JXEC 3LRSB 1E27B 3KPNB 3WN5B 1FL5A 1P1VA 5KAQG 4UTCA 4XP4H 3O3EA 5A2LH 2ADGA 2NY5C 4KRPD 4RAVB 4LT7A 4JFFB 2ICWB 3AU0A 1CDHA 3QIWA 4OD1L 5KVFL 1F1GA 5B3JE 1HXMA 3C8KB 4KXAA 2IOMA 1WZMA 5GQBA 3CXFA 5EOCH 4W9LC 4R6UA 2ED9A 3A6BL 2AVFA 2VLRE 3ELAT 3LEXB 1J8KA 1A6ZB 2V5SA 4HUCA 3EYOB 2W5PA 4RMTA 1I1YA 3DX7B 5KVFH 3VXOA 1G1OA 4MMZA 1Q0YL 1FYTA 3EYFB 5TQ0H 3IDJB 2CKBA 2IGFH 3IRPX 4Q74A 1Z6JT 3WIFA 2PXYC 4JRWA 4FXGC 2YD4A 3TCLB 2P28B 3D2UA 2VO8A 1QBBA 1D6VL 5BQ7B 1WTLA 3MLVH 1M1XB 3AREC 2P24B 4ZOBA 3GKZA 3CQPA 2XWCA 2YHGA 1EDQA 3K2IA 2XC8A 3S8WA 3WLBB 4N0CD 1IC4L 1I7RA 2K7QA 2J7LA 4R26L 1KXTA 5CUSL 3ULUD 5CO1A 3VXNA 3LHPH 3B7YA 4NKIH 4UMGA 5DZNA 1FHNA 2K4AA 2ZICA 5J1AA 2GB2A 3PQYB 4NYLB 4DPBX 4X50A 4FOMA 4L29A 2DIJA 4JQXC 5JHDE 4LNVA 4X8XA 4F7EB 1BCIA 2OQJA 2FB4L 2P9RA 4ALAC 5F7NC 3SDYH 2RAMA 3M07A 4Y2OA 3QORA 2XKNB 2YQ2A 2WLZA 1A1OB 3NH7H 3RWJB 2VLKB 3L7EB 5HVFB 4U3SA 1AGFB 3NIGF 2AHIA 3WG7B 4FXTA 5CIPB 1RIHL 2BINA 4XVTL 1XCQB 5KN5B 2MKWA 1UOKA 2Z7UA 4MAUH 3OC5A 1DQDL 3T0BA 5A7BA 1MFEL 3BAIA 3GHBH 4YSUA 4OGXL 5FXCH 2XPYA 4LIQH 1ZK5A 4NKOA 2X41A 4QXGL 4ONGH 1V3KA 3CVBA 3ULVD 4IJ3B 2Q8AH 4CDGC 3OAUL 4I0PA 1IQWH 2GJPA 1QACA 4LASH 1MCBA 3CCHA 3MGTB 1AJ7H 2FSDA 4WUUB 1OWWA 3GSNA 3VG9C 1WAAF 3OAYK 4YZFE 3VNZA 4MMXA 5C0BA 3HFMH 2IH3B 3C6EA 4MA3A 4WKZB 5AB2A 1N9PA 2NY0C 3EFFB 2NX5D 4R5TA 2ATAA 4LVEA 4A63A 3NEOA 1CU4H 2F1EA 4JRXA 4LSSL 3HZMA 2VXUL 1T5WB 5CGTA 2WBXA 1DQJA 2VM4A 3FUMA 4NNPL 4P57B 3R8QA 3UAFA 1MFAH 1AGEB 1FL5B 2OI9C 5JHLH 3BZ4B 3DOHA 3RURA 3MRIB 5ABAA 3S2CA 2RFXA 4AENB 3ULUC 1TR7A 1ZTXL 2J4WL 2ZCLL 4PJHF 2BZ7A 1R33A 5FB8B 4J3XA 4CU6A 5KYNA 3WUWB 5DLMH 5HDBB 5KW9H 3QPQC 5D4JA 2GVYA 3FTGA 2R0WL 4FFZH 5HHPA 1HYRC 4POZD 4YIQB 1LE5B 1A4BA 3FFDB 4AKPA 4AXWB 5L88H 3LKOA 1T20B 3ZO9A 2EKSB 5T5NG 1U4FA 2R2CA 1U92B 4F20A 2CM5A 3CE1A 2VQUA 1VLXA 5HHVL 5IIEB 5IFJB 3HMXH 1C8PA 4EDXB 1P1ZB 4WSJA 4AYID 2FK9A 4NPJA 4XNYH 2ZWYA 4G8IB 4JFDE 5T1KD 3UTZB 1DVZA 3QHZH 2GY7B 4LVNB 4KK6C 3QEHB 3MV7B 5CR1A 1A6TB 3LB6C 2QKIB 2ZUSA 3QFGA 4HIXH 1O9VA 4ODTH 3GMPB 4PW3A 4XHJC 4LU5H 1GC1L 1DVFD 5HJBA 4JG0H 1FBIH 2A6JA 2AJ3B 4ODSH 5C0AD 1YA5A 4G1EB 4NGHL 4P4KA 4B60A 1QMUA 2CHXA 5J9PA 4Y19E 2Y72A 5ICYB 4DP8X 4PRBB 4QHNA 1Z9SB 3IPEA 3O0RL 4DZ8B 3W38A 3QXAB 3PWJA 3LPPA 5AVSB 5TF0A 1XF2B 3SBWA 1M56B 2YAQA 3CXHK 2QVKA 4BZ2L 1IEAB 4LCWB 3FU7A 2VUOA 2V7HB 3CFTA 2PWDA 1WFMA 2BOLA 4M29A 4OIIH 4OQTL 2NOYA 5EFIA 4EPSA 1XMWA 4ZAKD 1NMBL 2JKRM 4P23D 3AVEA 4PJAA 3IJYA 2VSCA 4WEEA 1SBSH 2XV3A 4HIEA 2A7BA 4O4YH 3SPVB 1TTUA 4ZRGA 5I23A 4PVBA 1KCUL 4XNBA 4UMSA 2IWEA 5EUOA 2HT3D 4YDJA 4XWOD 2X9YA 4Z8FL 1RIUL 3Q6FA 1NOFA 3VTAA 2DQGH 3DXAA 2OJ1A 2VUKA 1TFHA 5I17A 2F08A 4Z0BH 1U6AL 4RH4A 4MGXA 2GI0A 1MFEH 1OB0A 5GGTA 3RLSA 1NANI 3GDCA 3ZTNL 4OFYA 4GSUA 2QEJA 25C8H 1D9KA 2ADFH 3S48A 4HGKC 2PO6D 3QDGA 4YUEL 5C0FB 4H2AA 3DX3A 4XPHH 1IB5A 1XL6A 1RUKH 2PYFB 3N40P 4N2LA 3LNHA 2FJFB 4RFNB 1DVYA 3L9BA 1TCRB 1EJ6A 4U1MA 2ZXEB 2I07A 2V7NB 1NJ9A 2YLHA 4HHAA 2J2ZB 4NSKB 3TBWB 2ZAGA 4MXVF 3RFZA 1IGCL 4CNIB 1BAFL 5EOTB 2RIKA 4IU3B 4PVMA 4HKJA 5K59F 1T2QH 3KYMA 4DTGL 4YSSA 1KFGA 1CZ8H 4YEEA 1Q0YH 2VLME 3BZFB 1DJXA 1XD1A 5KS9F 2EYSB 2GBTA 2WOYA 1FV1A 3WO3B 1U8QB 1ADQH 3BPLC 1W0VB 3QQXA 1GGYA 1X5ZA 1TJMA 4Q6IC 1LXMA 1FORH 2AEQH 2OULB 1HSAA 4WO4C 4IGBA 3WXVL 4BFIB 3BZFA 3TPUA 4C47A 4GKOA 5JHMA 5L8LB 2DJ4A 2EO9A 3U7YH 1XTLA 3B8YA 3OG4B 2X6BA 3ARGA 3DDGA 3C8DA 1LP9F 2NY4B 2IANE 3CLWA 4UB0L 5DRNA 2Q6WB 3O8XC 2FYVA 4MMZB 5KG9A 5I5MA 5F3BB 5FA4A 2KL6A 5E1IA 3IFOB 1CC3A 1ZA6B 2WUCL 4HXAL 4AYGA 1NC4D 1WAEA 3BGFB 2APFA 4HGMA 4X4XB 5DC0A 1U8JA 3CLEH 1IVLA 3T4AB 4ACTA 2K0RA 4XMKL 3VD4A 4GW4B 5C2UB 3NYKA 3WFCH 4U1IA 3A4DA 2MH4A 2X88A 3N2JA 1EO5A 1A7BA 5K1JA 5EUKB 5CJBA 3HE7C 2JK5B 1EDHA 4NPYA 1T1ZB 2DQTH 3C5ZB 4PWIA 2VWEC 4XNZB 2FHFA 4G6JL 1CXEA 4K7PX 4TLUA 4FKHA 3BUYA 4JZJB 1ZY9A 3U0PB 3U9PH 2B0SH 4KUZH 5CJOH 4D0CA 1DHKA 5IREA 4ZMZA 4OU3A 3P30H 5L2JB 4PJAE 2OYLA 3ZMRA 1TO5A 4EDWL 3FQNB 3BZEB 3BUYB 5BW7A 1I1AD 3Q2WA 1IZJA 2WIMA 3HZKB 4HZLA 5JXEA 4F3FA 4TLSA 1Z5LB 2XZAH 1WWAX 2J57A 1ITCA 5CJXC 4GSRA 5DD3L 3V0HA 4P2YA 2C3VA 3ME0B 3FO0L 4QNPF 2CGYA 4QRTB 4NJAH 1I1FB 3WCYA 3GT6A 3ZDZE 3SPJA 3DXAE 1QWNA 3OMNB 3KGTA 3V52L 3NFPA 1NMBH 1UENA 3PGDA 1U8JB 4X8JA 5B8CC 5ALCH 4Y2DB 2NYYC 4OZIE 1EZLA 3HI1A 4HK3N 3P77A 1BVZA 5I1GH 4HA1A 1XF4A 4L3CA 5E6RB 4NQDA 1TQVA 2DQDL 5D6CB 1UWFA 3K2UL 5KG9B 2B3RA 3QI9D 4UM8A 4ZX5A 1BVLA 5C0RL 3QDGD 4FULA 5IMKB 3R18A 4KKLC 3O9WB 3T2PA 4J8RA 3B9KD 1M4KA 1U8NB 1H0DB 1QD0A 4IGBB 1PIGA 1Q9OA 4XB3A 2HN7B 4NZJA 1U8QA 4DGIH 3F6JA 4DP2X 5DMKA 1GAFL 4APXA 1IGFH 1MHEB 1VCAA 3HUJA 1REIA 3TF4A 1U2HA 4JPIA 5AALA 1NFIB 1VGKA 5F9OH 1KBWA 1W8NA 5CXPA 1XGZA 3L4ZA 3BAKA 2H3NA 3KE0A 5JLZA 3KS0H 5DJ0A 4OCWL 1BZQK 2VDQB 2XWBB 4JFZH 1I7TA 4QRRE 2VERA 3LN9A 3NZSA 4IKIA 5DEFA 4F58L 4MNGA 3MI6A 2BK8A 1WZKA 1WFNA 2OZ4H 3C12A 4L37B 3S34L 4U1IB 1KJ2A 4I0PC 3DX0A 1CR9H 1DR9A 5L2KE 3H53A 4UNUA 4BWUA 5DHXB 5LBSH 5K9OB 4FXGB 1N8ZA 1UXLA 4CADA 4GW1A 4P4KD 2ATPA 1J5HA 4M4RB 1E8WA 4YDJB 4ANWA 4L23A 3U0PA 4LHQB 3CCHB 4P46B 2P42B 2IAAC 2EIMB 1UFUA 5E1AA 3QHTC 4XO8A 1T0MA 3ULUE 1F4YH 1IAIL 3CZNA 5KSBB 3D39A 1T7XA 1DBBH 2R1WB 5IJDC 3LS5H 4GEJA 2BC4B 1P84J 2CA4A 3BIKA 5G55A 4KNUA 2RALA 2ROYA 1P6AB 3U0WH 2KBGA 1IAKB 3UC2A 3GSWB 4X7SH 1EX0A 1OAUH 1DQMH 4Q0XL 5CBAB 3BH4A 1SJHB 4ICWA 3QHZL 3QULB 4PGBB 4K7FB 3PWJB 3U0WL 4HMCA 3AM8A 2PWFA 1MRDH 2ZJSL 5IQ7L 4KPHH 4DP1X 1PZ5B 3BX7C 5FHBL 2Z31C 4YNYB 1NFDA 4LVOC 3ZR5A 3L3JA 4Y7MA 1UGKA 3VX0A 1ZDQA 2EDFA 4LPWA 5BRZD 1IL1B 2IDSA 3UG4A 1DE4B 5KS9B 1Q9WA 4LSUL 4UUJA 3ZJAA 3UGEA 4BD4A 3MRHA 3NEEA 5J1AB 3IFPA 3KPOA 3JBG7 4PY7B 3KPRA 4H44C 4YO0A 1OK8A 4HAGA 1S5IH 4HU2A 1LO2L 3HS8A 1E50A 4LAQH 3SKNA 1QTYT 3DX8B 1OAZH 1UGNA 4PS7A 5FM5M 3MJ9L 5GPRA 3D25A 4LAJH 5KYUA 4PS4L 1UVQB 4KI5D 4TUKL 5EBMB 1FGNH 2WHVA 2MSPA 4J1UA 1ZVYA 4RGMC 1NUFA 3CFBB 4ODVH 5DA0B 4XMUA 2A83A 3QYNA 4V1DD 5IROA 4LGPB 1TETL 2B39A 3HE6B 3QQ3A 4EMZA 5EU6D 3ULVH 3HUJE 1KBVA 1XB6A 4N1HB 5FLUA 1H15A 2BNQD 3NRQA 3K6DA 3EJPA 5HHOE 4BQ8A 1J05A 5IOPA 2F0CA 2IO5A 1ZT1A 4FLOA 1FVEB 4ZOEA 5JHDA 3GXNA 3DX6B 3DUHA 1TF4A 1SXBA 3TNNB 1B9KA 4ALAL 5EO1A 4XMLL 3VRIB 5GGTH 5K1VA 2Y06L 4OLWH 4Q9QL 2VZTA 1ZT1B 1AMYA 2ESVE 2IH3A 4IMKC 5SWSE 2BS9A 4BEIA 5L2KA 2XT1B 4GRWF 4I2XA 3HZKA 4HZLB 3RZCC 3ZYZA 3FYEB 3FXIC 3AXHA 3E8VA 4YL4A 3HBQA 5LJYH 2LVEA 3CDYA 4ODXA 2CHDA 3UDWC 4RAHA 2HVKA 3VXTB 5CJXA 1IGTB 1F4WH 5CNHA 1BJ8A 4G5AA 4LVHB 3LKQB 2X12A 1CL7H 4OUOA 5TDPB 4AY0A 5H94B 1HFUA 2OK0H 2A9AA 3S34H 1QBLH 5LGKA 3DJSA 1ZVSB 2WXPA 5FYLE 3MOBL 3DIFB 4YHPA 4GXUN 4YX2L 5FGCB 3QRLA 3QUXC 4E9SA 3FBKA 3GS7A 5CLYA 1J0JA 3ABKB 4N1CA 4MCYB 4P5TD 4LCWE 2WANA 3LKOB 2FGWL 5D72H 5I71C 4LQFH 2AMGA 1KJ3H 5HYSA 1KCSL 1WBXA 3BIBX 1S9KC 3MUHL 2ZCLH 1DQKA 4OJYA 3NJKA 3S37X 4EZMA 5EORL 2G5BB 5DWUL 4IKKA 4JL1A 3I75B 3TURA 3UX9B 1IBBA 4PJGB 4FXLA 3EFOB 2YMXH 4QAWA 4UDUA 4LL1A 2WP3O 2C9PA 1OAXH 5HYIA 1JGEA 2H2SC 5LGJA 1BGXH 2F5BL 3OBAA 2UZIL 4GBXB 4Y4FD 3TBYB 3KPSE 1QSZA 5EZJB 5GISL 2C1PA 3TPUB 1OP5K 4GT0A 5DRWB 4I9XA 3RB5A 4N5UA 2QHRL 4Z0XB 4YSAA 4KJPD 3SDAD 3BUIA 4ZPTA 1QSVA 1KBGH 5CZVL 3VQMA 2DDQH 4QRPA 4ZPVB 4WKXA 2CJUL 1KYFA 3APDA 2P24A 4JJ5A 3MGTA 3FOMA 4NB7A 4HIXL 5DRWA 2VDQH 1EQWA 3LY6A 1KPUA 2BSSA 3KYMB 1T1XB 2DWEB 2GSIA 3PIQB 5AZ2L 3VI3F 3MRMB 2AK4E 4B9CA 2MEJB 2K78A 4AEFA 4EBQL 5MEPB 3THML 1GW0A 3RKDD 4X4ME 3P4LA 1GOGA 1ASPA 3CC1A 3CZKA 4QOKE 3HRPA 2J5WA 4U6YB 3BP5B 3KCPA 3PXHA 5CEZH 3GUTA 2IMNA 3BYTA 1XIWC 3IGAB 3SCMA 2K45A 3ZQ9A 2IPKA 4GAYB 2GJRA 3H56A 3MGOA 4QOKD 2CDGB 3AU1A 1PY4A 3IS0X 4GRWB 5AL0A 3MNZA 3MNVA 1VACA 4MCYA 5ESAB 2FO1A 2OP4H 5FKPB 4I1RA 4JKKA 5F8RC 3L5XL 4X5RA 2G2NA 4KZEL 4FMKA 3I85A 3RWCB 1T1XA 3PIQA 3FUKA 1QZ1A 3WEXA 5TDPA 5A6LA 4PV8A 3ZZLA 4FADA 2WO2B 5D70H 4EI0A 2Q8BH 4B9KC 2IV8A 3FU9A 2W9EL 4YZFF 2WBJA 5MI0B 4XNUL 4EO5A 2R69L 3KPQB 3OKEA 3K6SA 1QSEE 1MHCB 1RK7A 1Q9KB 2LFGA 4Q9QH 5DVLA 5JMOC 1VB9A 4Z7VE 1MCPL 4AVIA 3LRGA 1AR2A 5EUOE 2ZX5A 4JGJA 3QXWA 5DJ8A 3VFSA 2X4RA 3WFBH 1ILUA 5EF1A 3CBKB 4OF5A 2VR6A 3TCLA 4PRNA 3FT3B 4MTMA 4PRHB 5F96L 3H7BB 2IAMD 1MI5B 1P6WA 1BD2A 2O6FA 4LCWD 1R75A 1EO8L 4JN1H 4XI5C 3SDCC 2NNCA 4WEMB 1S3RA 3U30C 2HRPH 3UPAA 1PYWA 2CPUA 3B2XA 2EH7H 1VADA 4HWBA 1N70A 4AI7A 1NM9A 2FNBA 1DBMH 4QTHB 4YHIA 2EXTA 1W15A 1R5WA 4HUXA 1UT2A 3CLFL 1BM3L 3GZOA 1A3ZA 2BNRB 4KI5C 2AK1H 3WKYA 3CVHH 3WFDL 4Y1SA 3CHRA 4YL9A 1OCOB 4POYA 1BFOB 3DLQR 3CSTA 5CD5C 5EHFA 1EAPB 3VMOA 1UKQA 4MS6A 1XB3A 2PTTA 1BVLB 3CHPA 3KH4A 3LKNA 3MUY1 2CALA 1PLCA 2BX5A 3OLDA 1RUPH 1E4HA 2DMGA 4N0YL 3FFCA 4MQ7A 5EU3B 1QSFA 1ZK9A 2B14A 3RGVB 3AT9A 3QUXD 1BD2D 1TNMA 3LZLA 4N0UA 4MJIB 2R4RH 4QR7A 1LP9B 5IQ9B 1KGUA 4NXSA 5LQBL 5JTWA 3GZKA 2AK4A 3F12A 4N0YH 4X6CA 4CC4A 1NCIA 4P9ML 5KBDA 1CIDA 1PG7X 2IANA 4TTGA 1BAGA 4P2RE 4HCGA 1I8MB 5EIIB 3QG6A 3NCYP 2CRZA 1A7RL 5C0EA 5B7FA 2YBRA 1YNLL 4NZRL 2XN9A 1K5NA 1DQLH 3OM3B 3PLYA 4JZNA 1GCFA 1XF3A 2XX0A 1S9XB 1P5UB 1KCKA 2IPKB 5CP3A 2GSMB 1DVQA 3NJVA 5CU9A 2Z64C 2WBWB 2CGRH 2QQNH 3CVHA 4Z7NB 3GSNB 1NC4A 1X7QA 4GPVA 4IKLA 4KVNL 4P3WA 4RSYA 3V5HA 5I0YA 3RJDA 4R90L 1KCVH 1OTUD 3TEZA 4RQQB 5EBGA 1NUGA 4ABUA 5F7DB 1AXTL 2JCCF 3QI9A 4OGXH 1CXLA 3EUUA 4LSDA 1UXWB 3LXCA 4KVNH 4EZLA 4MAYC 4NKOB 4YS4A 4LSRH 3MFFA 4H88H 1FAIL 3LNEA 3L3HA 3N41B 4LLUB 5IVZB 1ZGLM 4R2GB 2H2PC 4BUHA 3EGSB 2YUZA 3VFRA 5JW4Q 3SDDC 4WLCA 3DMMB 3T0WA 1XWVA 3UZVB 4KVPA 3I6SA 3OXSA 5DJZB 4JY4B 1A9VA 1D5BB 5F2FA 3FB8A 1JGEB 3DVGB 5HJGA 1BLIA 1IUZA 5C0AE 2OQJB 4GRLB 1YPZA 1NCTA 4FG4A 2ARJA 3EYQC 4LQFL 4DVBA 2MMXA 2N0KA 1DLHA 2NY1C 2YSTA 2J71A 1FC1A 1TQBB 2BIPA 1I1AA 1U95A 3FB8B 3NABL 4X6BA 3F2LA 3SDYL 4BFBD 1WBZB 2ITDA 1KIPB 1BD2E 1CVRA 3CK0L 3RWFA 1VGKB 1WK0A 3N1QC 5DI8B 1EIBA 1GZPA 3WL9A 3EDEA 2YN5A 2EUZA 4PCSA 5DTFA 3EGXB 4O5LH 2A73B 4UAOB 5HP5A 4NP4H 5E2UH 2NNRA 3DVIA 4D9RD 3S88H 4QRFA 2ISDA 5DLML 1PZ2A 4HETA 4L8CA 4ZXBC 4YPGA 4YDLB 3ARDA 4A39A 2PPAA 1DZBA 2Q8AL 4JCLA 3ZLQC 3QEGL 4PN6A 3T3PB 5EEXA 2X0VA 4JO4L 2VXTH 1NC4B 1IM9D 5IZ7A 3E3QC 1EANA 3HR5B 3IDJA 3PL6D 3K3QA 4LKCB 5BZDA 3TIDB 3Q1SL 1AZVA 5HHXH 5BRQA 3QUMB 5KSUA 4NT6A 2APXA 4HWEL 4KDTC 5D7JC 2Z34A 3TJPA 3WJLA 1WEJL 4N8CL 4X6CE 1N0LA 5I75C 5L8KB 2Y3AA 1P7QB 3SDCA 1HXMB 1OWRM 3DVNA 5D7LD 1NPUA 5IJKC 3UP1A 2EYRB 4Q97A 3R1GH 1S7SB 1CGWA 1P7HL 2A6KA 3B9KB 1EEQA 3PV7A 1NSNL 4Z78A 3L4VA 2XZAL 4RCAA 4TOYL 3VFGH 1LM8V 43C9A 7TAAA 5F72S 3PHQB 3ABLB 5JOFB 3MRCB 1RK0A 2F7PA 4OJDH 4CAGA 3HMWL 3NA9L 3UTOA 2DL9A 2K8MA 1LHZA 3HA0A 2X4OA 2XIIA 3CSPA 3MRNB 5J1SC 1CXIA 4N9GA 2GUYA 2MHAA 4ONHA 2VLLB 3N0AA 1IEAA 2HLAA 3ABZA 3DO4A 1IVTA 3Q9PA 4JFOB 5E5MB 4LLWB 4JZJA 1CFSB 2FGZA 2XNAB 5GRWA 1MY5A 5IVNA 1NCNA 4NUJB 5IB5A 1FC2D 1LO3L 5DJ6A 1GY2A 4XB7A 4X4YA 3HE7B 1A64A 4M93B 5AB9A 3HMXA 3BVUA 4XN8A 1J0IA 1RVFL 1HZHL 2HJFB 4GUPA 5KYYB 3PUUA 4FABL 2VIRA 4FCHA 1DUZB 3MRQA 3HG2A 4R90H 1XZ0B 1M7IB 3X12A 3T6XA 1WBZA 2GTQA 1NFDE 1M6UA 3JWOL 4PRPD 5FYJL 4BK5C 1UH4A 4F2ME 5L9DH 3PAZA 4OF7A 5E9NA 5IB3B 2V9TA 5I1CH 2WLHA 4N85A 1G7LA 3H9SB 1NCJA 4WENB 2CBQA 1J5IA 4HWZB 1Q9KA 3WIIH 2GTZA 3IMSA 4NM8L 5MEQA 1X6LA 5CN2A 4IBYA 2ESVB 5SWSB 4ETQB 3D4GA 5FO2A 1E4XI 4AQEA 2H0EA 3U7YL 3VXRB 3RVWD 3MMEB 4NWTL 3LDBC 2ZX6A 2EICA 5L4FA 4YBLC 5A2BA 1G7IB 1RZIB 1MSPA 4UDTA 2EEFA 4DVRL 4OI7A 3E6FB 2WVTA 4K0OA 2HFTA 1N2RA 2XWJB 3TH2T 1Y07A 2JLLA 1BG1A 2ZOKB 3JVFC 2ARWA 4YGVB 1XBRA 1JUFB 4K8RL 4TTDC 2ENJA 2R69H 5MEOB 2EVIA 3TV3L 4PLNC 1AO7B 5T5FA 2R0WH 1LD9B 4FFYA 3HI5L 1RUMH 1FYTE 4FFZL 3UC0H 2DQGL 3VA6A 1L7IH 2YRPA 1TZHA 3MNZB 2W92A 5D7KE 2X4UA 2ZUQC 3NBNA 1AKJD 4NQSA 3X13B 1URZA 2NZ9C 4QY8B 2Y7QB 4K9JA 2GG1A 1AO7D 1JZFA 3ISWA 1XH3B 1CE1L 3BJ91 2DQTL 3E7JA 3OMZA 4XNYL 4W9ZA 1IC7H 3MLSL 1O7SA 4XPHL 1HILB 2YWZA 3QXDB 4TULL 1ASQA 3T3MF 2X2YA 3RFZC 5GZND 4OV5B 3AXLB 3FF7A 3VWKB 3EW3B 4OIFA 4XMKH 2V17H 1FPTL 3PAYA 3O6FC 4OH2A 5EIIG 1X4ZA 3VD1A 4G8GA 3SO5A 1DDTA 1INEH 2APBA 1G1KA 2A0LC 4HWEH 4M61A 5DVPA 1C08B 2D7OA 4CGUB 4FFVD 1XCTB 3L95A 5HDRA 1KOAA 3AAZA 1MZYA 1GR7A 3A67L 4XMVA 3WEMA 1RULH 4U3SB 5JPNA 2D2OA 3OF6D 1TJHH 1AYOA 4NO5B 2GTZB 1T0PB 1QPPA 1K3ZA 3P54A 1T3FA 3QUKA 2DLIA 2HRGA 1MJ7H 1L9SA 1NCOA 2VJ8A 5C0IA 5C92A 5C0CB 4X5XB 4JM2C 2XWBA 5C7ZA 1F4HA 5IMKA 4X99B 3QZBA 2WIIA 3V4VA 4QTHA 4YHIB 2FO8A 4JFXA 4MXWL 1BHGA 3ATDA 2XZCH 1VZGA 2YAMA 4XE0A 3MHZA 1T7VA 3NCXA 2ED7A 2NR6A 4KVCL 3SYOA 3UZQA 4F7MA 3K2MC 3RU8H 2FQFA 4N2KA 2DYPD 3MX0B 2VIRB 2W60A 5HHME 2F8IA 3TTYA 5AVQB 2XKSA 4XNZC 1HCVA 1M6OB 1J18A 1J8RA 1E4KA 4O9HH 3QUZD 1X5HA 4XXDB 3FT3A 3NABH 1OZTG 1HDMA 3BO8B 1KTBA 3OX8A 4ZXBD 4U6XA 1SQ2N 3X1GA 2Q3XA 4ZSOE 4DP5X 5EU6E 2FWUA 5CLWA 4OKVB 3NIGB 4EIUA 4G1MB 1FO0L 5I1JH 4N3UA 4FYRA 3O9WA 3VXSD 4LXFA 2W65B 4XPAH 5HYEA 1R5WB 4HUXB 5K93A 1JNLH 3CN0A 3C5JA 3RWDB 3RVTC 3IDGA 1HHIA 3D87B 4U1LB 3MBEC 1IAMA 4XOEA 1DQQA 2H1XA 2NY3B 3IDMB 4F9LC 4L4VB 1S9WA 2YO3A 3T71A 1XEDA 1RK0B 3GWJA 2OL3B 5EOCJ 1A25A 5DUPH 3O8XD 1UWGH 4GI6A 1J0KA 4JVPA 3PL6B 3HFML 3RWCA 1U9KA 3V6BR 3C60B 1U8PA 2BFGA 2OCFD 2MTAA 1UM4L 4CA4A 2W0LA 5FR3A 3EJJX 2B59A 2VXUH 2VABB 1WA2X 5CSBA 5BOZG 4Q6IB 1G9MH 4MXQC 3OMIB 2CKBH 3VGAC 1THCA 1JSYA 1H5BC 2O6CA 1BLNB 5ELIA 4PWFA 1OO2A 4LRNH 2R0KH 2PCYA 3X1NA 3LRMA 4OGAD 4W9FC 4YXHL 3P1VA 3SY0A 2P8LB 3DX4A 1EUUA 2QKIA 3QC5X 4WV1A 4E0RA 2FEJA 3GPSA 1ETZB 3Q05A 2YPLD 3KNBA 2ZPKL 1TZ8A 2BW5A 4C4KO 2KYIA 2TSBA 3CD4A 4EN3D 2XXFA 2XWTB 5J6GB 2VR4A 2CPCA 1NCCL 3D18A 4LDOB 5DHYB 4MA7L 4XRCB 1ZT7B 4I4WB 4TLTA 4BQBA 3P9LA 5KBLA 3GLDA 4M6OH 4WTQA 4M6AA 2AMUA 3NVQA 4PGEB 3OX8B 4M8QB 4Y1AB 3VXPB 4X6EA 5I66B 2JQZA 5IW6B 3MXWH 3JTTB 4KRPC 3L45A 3FTGB 3HAEB 4EXKA 4HFUH 4KRPB 1ZHBB 1XGTA 3OHMB 5LLIC 4XPFL 5GGVH 1XGQB 2QVFB 2J55A 1BDYA 3MJGX 5E4IA 4GOSA 4P2CG 2L7UA 2H6OA 3HKZA 3QZWG 4X6BB 5FIEA 1HHHA 2EIDA 3QZNA 1DE4A 3QORB 2VZOA 4PJHE 1VRSA 5D7JB 1QFUH 2VN3A 3FCSB 4AC4A 3M86A 2Q76A 2IAMB 2VDKL 5L2KD 4K71C 5GS0D 1S5HB 2PMZA 3MGAA 2YFOA 4X99A 3H6AA 4MMYA 2B5IB 1LO2H 1NFAA 2WNXA 5B38A 1QPXA 4ZNEE 5IB2A 4JRXB 2QPSA 1NLDH 2WC7A 4PIRF 4LEOA 3LKRA 1NBYB 1ET7A 2M2DA 2ZTBA 5BV7H 1TDQA 3QPXH 4AM0A 5KBKA 4E5XB 2CR0A 5E8OA 5HPMA 3SDXF 5D8JH 3VU1A 5I1CL 4F33A 3WLBA 1KPVA 1SMDA 1FLRL 3HEIB 1KG0B 3VSQA 3DRTA 1A8ZA 3G5YB 1A7OL 4ODWA 4S1DD 4XRCA 5D7SL 4A2HA 3IMBA 1J8HA 5DS8A 3GIZL 1CFVH 3G04B 3GDBA 3U36A 5I30L 3K72A 3MJ8A 1N7ML 4L8BA 1UASA 3ZZSA 4RDQF 5TE7H 3O4LE 5GXBB 4E0RB 2E7HA 3IEAA 4NM4H 3N44F 1JZ5A 1RCYA 5ITBL 1KMGA 3KWXA 4OBRA 4TV3A 2ROXA 3C6LD 3RJQB 2XXCB 5E9DA 4AKOA 1LILA 1UOWA 2IDFA 4I2XB 4APQC 1KJ2B 4GEIA 5GSVA 4K3EL 4PJGE 4P2RA 1TENA 2W8CA 3T0EA 2JI3A 3I6LD 1X5YA 2K6ZA 3FF8A 4URTB 3TASA 1DSFH 1DQDH 3D33A 4NC1E 4L3AA 1TNNA 1EHLH 2XN9E 4YHNB 1IGYB 1H8NA 2BERA 2YGOA 3BPOC 4IKNA 4ZW5A 5LN8A 4IRZL 1NFIA 3OLGA 2EZ0C 5LG1A 1EA9C 1MCJA 5CJ8A 3ZK0A 2DOCA 2F7QA 1JBJA 3X1BA 1GY1A 1HI6B 1XZWA 5AWNH 1NLBH 4I3RH 4W70A 5F7UA 1V7NH 1NANH 2OI9B 1ZJBA 2CGZA 4CU7A 2PTTB 3DURB 1JDAA 2FJGA 3ZTDC 4JN1L 4K73A 3QUYD 3SE3C 3ZHDA 2R56L 1YUKB 3B6SA 3HLAA 3FQRB 3QP3A 3QWOA 4PJ7E 5TFSH 1LVEA 1LEKB 4HPOH 3U2IA 1U8KB 4HHGA 5G2NA 3NJXA 3I3EA 4RA3A 5HHQB 3W39A 4C59B 5J11B 2BVQB 3T6VA 3TT3L 2HH0H 3TBVB 1P2CB 4UNTA 1FL3B 4JKMA 4AUJA 2EILB 3EYOA 4Z1PA 3BGMB 2XQBH 1MW3A 2AQSA 4NUMA 2K9FB 3JWNG 3L1EA 2PR9A 1RK1B 3DGDA 2Y36L 1E2ZA 4HEPG 2X4PA 3BFQG 2MTPA 3DK0A 2KERA 1QRNE 5K9KA 3X11B 3CWGA 3ZVVA 5T1KA 4JN2B 4L8DA 2IH1B 4B9JA 2EYTA 5C08A 2FJHA 1JN6A 4Q0XH 2NZ9D 2V2XB 3HS0A 4MWFA 4R96A 4JZOA 4AJYV 2XJLA 1T5WA 3NACL 5DWUH 2LOEA 5CD3B 3BZ5A 3D25B 1A6VH 2CJ3A 4LVNC 5FCSH 2NY3C 5E24E 4UQ9A 5HYJA 2B4CC 1JYVA 2O5ZL 1DFXA 1E2VA 1IM3B 3JV4B 2FJGB 4M5TA 3UPRA 3HCVB 2DEWX 1LLAA 2DD8H 3MYJA 3P30L 2YA1A 4GMSL 4DN4L 4AV4A 5DO2C 4D9RE 2CXGA 3LXBA 5CZKA 1SJEB 2ZX8A 3GMLA 1KT2A 5HYFA 4KK9C 1OSZB 4WK2B 1FRGL 5ESAA 2QGBA 1S5IL 4FFVC 3LMJL 2ETWA 1AVAA 2A6KB 3A3YB 3B9KA 4Y4KB 3SB3A 2Y2TA 1LO0H 4O2CA 4ADIA 2JKLA 4PJXF 4N2AA 5MP6H 3HG0A 3STZA 4DN3L 2OW7A 4R26H 1XCQA 4UYPA 4WV1C 4XXCA 3AS0A 3ES6B 1MRCH 3LDBB 4JMNA 3L5JA 3TBTB 3L4XA 3MRFA 4XP9L 3UZEC 1UB5B 2XZCL 3I3DA 1I3GL 3WJLC 1GZQB 2XKNA 2LAAA 2AGJH 5HDBF 1H5BA 2H8PA 3QO0A 5L4MA 1N7MH 4NC0B 3K0WA 1JFQL 3IMWA 4ZDHB 4ZUTA 3OKOA 2AJUL 3IBEA 1JUFA 2Y23A 1RH8A 5CM1A 1KGXA 3LD8B 5JLZB 3DOIA 4K4KA 4KXZI 1E8ZA 1KIRB 1NCWL 4BFIA 1MCNA 4HV8B 4JY6B 4NCDA 1G87A 2F7RA 4U1GB 2DPKA 3NT0A 3UERA 4ZFZB 1E0OB 1YVLA 4RZCB 3X14B 4QRRA 4IRSC 4TRPL 3U1PA 1OB1B 2HJLB 4DW2H 3MJ7A 1B0GB 1YAIA 4ELME 3ETSA 1SQMA 1NEZB 4E42A 3EDDA 4IU3A 1NPJA 5F7EH 1Z32X 4PRHD 3PDGA 1WFJA 5TF1H 5JA8B 3TEYA 3RI5F 3DX9A 4KK8C 4NNXB 3A6BH 4J8RB 1MQKL 4GB9A 1I82A 1S4IA 5HHVH 3GO1H 1TCRA 4M9PA 1UZ6E 3AG4B 4QF1B 3AB0B 1IAII 4Z7UE 1UWEL 3VFVA 4JAMA 1O7DC 4H1LH 4BSVA 1WWCA 4DP9X 2UX7A 3S36L 4B53A 4N2NA 2AQRA 5BRZE 5KANG 2R56H 2VDNH 3CUPA 4ZAKB 4XPTL 3VI3B 3TZVA 4ENEC 4R4BA 3NQKA 4BZYA 1I4FA 3ZT6A 1XH1A 1HZLA 1AIZA 2ZUVA 1S3KL 3EJYD 3PGDB 3W11D 4YAQB 2X1OA 3GLZA 4MKTA 4KKBD 4P3CL 4X6EB 2F58H 4O2CB 1AGBA 3L5WB 4NWTH 1MFAL 3OKKA 3MLRH 4HK0B 1XHHA 1PTZA 1FQ9C 2YA0A 1S3KH 4A6YL 4P06A 4M7LT 4YBLB 1KZYA 1KEML 1NAKL 3FJTA 5E2JA 2WWKO 1SVZA 4ES9A 1P0SE 4QHKI 1RL1A 2WVVB 1CK0H 1P6FA 7FABL 5B4MC 3LS5L 4E9VA 2C7UA 3WJMA 4RSVA 3DUSB 1QTSA 4QHMB 3AM8C 3RILA 2OW6A 3D69B 4MJJA 3MRGB 1RJLA 4HXAH 2J8UB 2XV0A 3QJRB 4WHCA 3FU8A 5C07D 5EU6B 4PP1D 1W0WA 3L3OA 3HBGA 1JTOA 2ICES 1PD6A 3HNVL 2F9BT 4XVSH 2YJLA 4ZFFB 4NN5C 1JWSA 4W9HC 3CFNA 1C5BL 2O5ZH 1HC1A 1NA8A 4N28A 4P5TC 1EXGA 4LBAA 4WHYH 4IIQB 3W57A 1WCBB 4UF7C 1PZDA 2QBWA 1ZRUA 5ESVB 4RMBA 4PV9B 3BLBA 4JFDA 5BUAA 1WAAE 3BUQA 4NDMA 3II2A 3F84A 1EJOL 4PJDE 1F11A 3LH2H 2NX5E 4XX1G 1SYVA 4NIKB 3WENA 4OFYD 5HGBB 1ITBB 1QR4A 3PWPE 4TL4A 5GRUL 2Z31B 2WWOA 2FEDC 3EO1A 1S9VB 2ZKXA 4OIAA 4MX7A 5D9SA 3REWB 3GI9H 4JHAH 4EDXA 3G5XA 1B6UA 3FQWB 4J27A 5HHOA 2IIJA 1FVCB 5EUKA 4F7CB 1IU1A 4PGCB 1T20A 5D2NA 2B7DT 1A6UH 1TTFA 2GJ6B 3VI4B 5JYLA 4PCYA 5D1XB 3DV6A 3IBOA 2CR6A 1DO5A 4U1GC 3PABB 1WG3A 4MXWH 4MJ6A 4O4YL 3SE6A 1M7XA 4LEXH 4X6FA 4J3OH 1P7KA 4P2OB 4NXKA 3V0IA 1WVZA 2AAAA 3STBA 3S3SA 4UNVA 4M6NL 1KCBA 3ZIYA 2J2ZA 1G4MA 3VUAA 1JCKA 2EDRA 3DVGA 3AUVA 3BT0A 3HZMB 5CLTA 3HI6L 1U2CA 5DQ9A 4X7TA 4AT6A 5BRZA 2WNGA 1OARL 1X5JA 1XIWD 1GGTA 1QP1A 1DBAH 1QFWI 1AR1B 4NNYA 3WO4C 1F58H 1U41A 2H32A 2IJ0C 3CU7A 3SYCA 4Z5RB 3HN5A 3T1FB 3TOPA 1G84A 4C4UA 2O5XH 4GRWH 3FNKA 4ODBD 4WNQB 1CDYA 1J1XH 3SJVD 3ETBJ 4F7TB 1E30A 1VGEL 3B37A 3ZY7A 5D7IA 2IALB 3KXFD 3L4TA 1ORSA 4J3OG 5ABDE 1EVTC 1KELH 3VU2A 5E6IB 2BSBA 1P53A 4YEFA 2FQDA 4KTDH 2ZXWB 3OAUH 5D1XE 4P59L 4NFCA 1X7QB 1WFIA 3WAJA 3VRJB 1L7TL 4KQ3H 2D9CA 4YHKH 4M4RA 5AOKA 4YK4C 3G5YA 3N1GC 4GRMA 3O11B 5CZXD 5F7BA 5IESL 1DJZA 3GXTA 3UADA 5I6LA 4I1PA 1BOGA 4AQ1B 1SDYA 1YJDH 4WNSA 4OV6F 2PXYB 2Q5BA 1BBDL 5I1LB 2B16A 1TQBC 1QG3A 3B9EA 2AEWA 4ZX6A 1WYJA 1KCSH 3ROOB 1OQOA 3DWTA 5FPIA 4HXBL 4Z7OF 3DXAB 4NKDB 4M7LL 1XIWA 1LEGB 3KLDA 4GH7B 2DWYA 4I48B 5FYKU 3UTSD 3BP5A 1U4EA 1X7TA 3WDHA 4B97A 1A9EB 2OYMA 3MLZL 1COBA 4P4KC 4DF9A 1CWVA 1I9IH 2VC2H 2WUCH 3QUXB 3S97C 5KYXA 3RE0A 3P4MB 1NPNA 4L8SA 3RPIB 4HF5H 5I6XC 2AQ3A 3EYSH 1TVDA 4JFPA 3T5WA 2F1BA 2R29L 5I6KA 4G7YL 4RAUA 5DJAB 2LABA 2E7LA 1QO3B 3PDOA 1EV2E 1Q8MA 3MMEA 5BCAA 4GW5B 3RU8L 1PEZA 3O6LL 2BP0B 4GUCA 4HUVA 5CZVH 2FECL 3LXUX 5INDB 4R4NC 1L0XA 4BKLB 5D1QB 3VXME 5DJYA 3GD1C 1NWPA 2J6WA 3HR6A 4FQIH 5AB0A 1F6FB 5TGBB 4OLYH 4OF6A 2EKSA 2CXKA 1JVLA 2B77A 4N0CC 3I75A 4XP1L 2EAEA 4P2OA 4MNQA 4A2FA 4L3CB 1A8JH 4HSCX 1SOQA 1XGUB 1RZKL 4Y4KC 4AVJA 5HYSG 4JG0L 2YEQA 4HX1B 2N7AA 3UTQA 5H2BA 3FT4B 3B9KC 2C4FT 3W0WE 1MRCL 5IMLA 2AF2A 4S2SA 3V4VH 3HB3C 4K2UL 4FXKB 4NN7C 4Y89A 4PSRA 2UUDH 3N40F 5I8KL 4C58B 2NW2A 1Z9OA 3V5DA 2BNQE 4WO4D 3CZFA 4B95C 4I13B 3QT2A 4BE5A 3PWLB 2VM3A 5F3HB 3DX1A 2XWZA 4MCNA 1PW3A 3CFKB 1NGZA 1T6WA 5EBLA 4HCRL 1XSJA 1PJWA 3BXNB 4GW5A 2CUHA 4OD3H 5K33A 2CBPA 2EDLA 1CDJA 4JHBA 3O8XB 5K5YA 4OZHF 4JFDB 2RJMA 1ZGLB 2P5WB 2WN2A 1MVUB 5E00B 4HH9A 3O2WH 3PGCB 2C3XA 2LTQB 2E86A 3BSGA 1JGLL 1WD9A 3UOAB 4U6TA 3GF8A 4DVRH 3LSOB 4FHBD 5TF1L 3KZ8A 3R4RA 5IHLB 3AMLA 4NZ8A 1JI2A 5AAMC 1AGBB 3MREA 1M1SA 1HDMB 2G3MA 4NKDA 4UZUA 2Q2LA 1R3LA 3PL6A 2DM7A 4FLHA 4XX1E 2CIIA 3GO1L 1NQBA 1BZ9B 1HWGB 3FB5A 3UTQB 3AB0C 4NRZB 3B7UX 1HSBA 1H9DA 3HI5H 2UZYA 1QFWM 4CILA 4DT2A 5D71H 3HAEG 3TZVD 2OLDA 2PXYA 5C71A 5I73B 1C5BH 2Q3ZA 3KCPB 1Z9MA 3ZE1F 3D30A 2C7UB 1M53A 1SJXA 3C5JB 2FIKA 4HIJB 2B5IC 4Y2LA 2Y4SA 4KKQA 1EHAA 5LB1A 2EE9A 1T0OA 2OXGB 3QEQE 4P23A 5EOQH 2QZQA 5T3ZL 3WKNA 4IQHA 4M8UA 2I5YL 3GMNA 5IV2A 4YE0A 1IEBB 35C8H 2VMFA 4RIRA 1A9BB 2GK0B 4EXPX 4UINH 2K4WA 2NQCA 4FL4B 3Q5YA 3S4SG 3ARQA 3MLVL 2X70A 1MFCL 2EIJB 2V17L 3CH1B 3EYQD 3K1DA 3J7HA 1E7VA 4TVSa 2KPWA 4XMXA 3E9TA 4Y88A 3LN5A 4IS6A 2VLKA 1CXHA 2PPCA 3UZQB 1CFTB 2WUBL 4HUUB 4LAQL 1OANA 4AT6B 5EZIL 1JF6A 4MAZA 3QDMB 2Y1AA 4BZ1A 3U4EA 3VH8A 1HKLL 3RWGA 1DVFA 3TVMB 2NT1A 4ZUTB 2XKUA 3S7GA 1VENA 2E7CA 3UXFA 2FIKB 3ILQC 1FYTB 3EYFA 3LEYH 3TO4B 5JNYA 2I25N 1NFDB 1D7CA 4WNJA 4OAWA 1MI5E 3V0AC 1N26A 4V2BA 4HMDA 1KWGA 1P69B 1EGJA 3U4KA 1R3HA 5EU7C 5IVXE 3ARSA 4QT5A 1KIQA 3UO1L 1ZHKB 1R4XA 4NQSB 1JD7A 4KVCH 4L5FE 2FLMA 1U3HA 3VRJA 1ZPLA 3KVDD 5DD0H 2GK0A 1E4KC 4G8GB 1UM5H 1FYHB 2BSTB 2GSGB 5CJQH 3F62A 3R7RA 2A77L 1CLZL 4ISVA 3DJ9A 3MLXL 5HYJE 1F18A 4S1QL 1DSFL 3BE1H 5TH2A 1ZGLA 1HEJC 5HGDB 3QXUA 4HCIA 1UJ3A 4G9FD 2X6UA 1AXSA 3ULVE 1XR9A 4JPVH 4M48H 5B7EA 2HLEB 3WUZA 3QJZA 5E8PB 4KRLB 3LEXA 5ES4B 1HQRB 1PKQE 2OZ4A 4QRUB 2DKSA 2HKAA 4NQCA 2C3HA 4OM0H 4ZFOL 5LDUA 5FLVA 1QW9A 4TYUA 1I3UA 2X0WA 4NUQA 2WTOA 3TNNA 3MV11 1VKXA 1N64L 5TTRA 1AHMA 1OOWA 2UUDK 2XG5A 1IX2A 3IGFA 3KWVA 4NUPA 3OWRA 2CK0H 5IOPB 4NZUL 3TC9A 3VCLB 3NJNA 2MPAL 3TA3C 4M6NH 4GAGL 3L5XH 3DGGA 3CQQA 1W0WB 3L3OB 4H8WC 1AQDB 4E5XG 5E5UB 2CDEB 1CFQA 2YKLH 5FW8A 3FCBA 4Q14A 2OJEA 1AANA 1WTGT 4F8QA 1T7WA 1A1MB 1QSFB 1S7WB 2NLJA 1BYPA 3OTTA 4Z7AA 4M7ZB 3LKNB 1P4UA 1WA0X 3AG1B 1TSRA 1N5AA 5BZWB 4YC2B 1T22B 2P5WE 1SJVA 4UU9B 4GAFB 2BP5M 3OKMA 1YMHB 2XACC 5JR1H 4OZIB 4C54A 3P73A 3MRPA 1F3RB 5AZEL 3M45A 3VG9B 4Y16A 2BNRA 3QORD 3IU3B 5C3LD 1KTRL 4KXBA 2BVYA 1YY9C 2HVBA 3Q7JA 3NFNA 4DSYA 2NX5B 2ZWSA 4KXDA 4Y9GA 4ATWA 3BRFA 2AV1A 2P49B 2ZWLT 1SVBA 4LDLB 3OG6B 1ZE3H 5F96H 2ODIA 1YNKH 1ET5A 5J57B 5F9OL 2V4LA 2QMJA 5B1KA 4E2OA 1U58A 3MXWL 3WEOA 2ZUXA 3TBVA 1T83C 3UG3A 4PTTA 3LZPA 5LVEA 3IVKA 4K55A 4WEBL 4G43B 1UZ8A 5CGYD 3E0GA 4FG2A 4ANUA 1H6EA 1N18A 1I53A 4NHCH 3O4OB 1XIWB 5F89B 4QJ5B 2V5MA 3A67H 1JMZA 1MXDA 1CR9L 1T3FB 1MHCA 4L4TD 2WINB 1KEMH 1OV8A 3UBHA 3IXTB 3FBQA 2HT2D 2B1HL 4DN3H 3GXFA 4RGMB 1CUOA 1QASA 5T3XH 5HPOA 3HR5A 5TE7L 3NMEA 1VERA 4XZ4A 3IJ7A 4JQVC 3VDCA 3A6CH 4AQ8C 2ZCKL 2NSMA 4H1LG 4LOFA 3C6LB 1AZNA 3TBSA 1CE6A 1IM9B 1A7OH 4OUUA 2WMPA 5BMFL 3MV9A 2V9RA 2WPGA 4RLDA 3B9DA 3WJJA 1IJNA 3ZL4H 1F90L 8FABA 3T9WA 3PXJA 3WOVA 5C0AB 4ODHH 4KNQA 1FG2A 5CILH 4UBDD 1AY1H 3IWUA 5K9JH 1L6XA 5DI8A 1EHLL 2QGCA 3KBPA 1YEEH 4PJXE 3J2PA 1KTJA 2ZJSH 4G59C 5IQ7H 4HD9A 1HESA 1KNOB 3NP3A 4GRMB 1NGWA 1RD6A 3MJWA 4JM2A 1RJZB 3QHFL 1OD9A 4DKTA 1EJOH 4AE1A 1U30A 1HIML 1VFMA 2BVEA 3KLKA 5G4OA 4B96A 4KGJA 4UTBA 1WBYA 2GEEA 3KLAB 1V7NL 3A24A 4YWGL 4HJGB 5CP7A 4RFEB 5J13B 1FO0B 3GI9L 1KCRL 4GS7C 5MENE 3KJ6L 3M17B 2R23B 5HGGS 1YEKL 5C07A 2SEBB 3LHPL 3U0TB 2UX6A 3P69A 4ZPTB 1RFDH 3EGSA 4GQZA 4Y1AA 1FV1B 3WKMH 1CLOL 5ACZB 1FORL 2AEQL 1KPRB 4NZDA 2IQAA 4OCRH 1MWAA 1WP6A 3CFJA 3D3VA 5JORB 4WFED 3V6OC 2OBGA 4RQQA 4JN2A 4L8DB 2LU5A 2CNYA 3UPCA 1H5BB 2H8PB 2IH9A 4U1MB 4M3KB 2G3XA 1BW8A 2WLJA 2ZYHA 3B2MA 3GMQB 5B8CA 3IETB 4BELD 5C0JB 3ES6A 3NFNB 1FYTD 1FVDB 1M57B 3SD5A 4GBXD 1MG3C 3STLB 3S5LG 4KFZC 4ZYKA 4EQ3A 1T04A 4JX0A 3G5VB 4BSWB 2RR3A 4DEPC 2QSQA 3JVGC 3MFFB 8FABB 2AXHA 4G6FB 3RTLA 4L1DA 4A7TA 1F4XH 2AJYH 3S88L 4UIMA 5GZNC 5EUOB 15C8L 3OZKA 5E1QA 1ULVA 2KUTA 1W72A 2O1AA 2YBGA 3HG1D 4GIAA 1ND0B 2Z31A 4ZTOL 2J21A 1UZ6F 4Z7UF 4DO6A 3JQOB 3CVIH 5IF0B 4G82A 2V8MA 5ISZB 4MCZB 2NSQA 4EI5A 4N0UB 4WWKC 1TU2B 3RWHB 1MCCA 5BS0D 5F9DC 3NN8A 1UB6A 4XAKD 1IIKA 3HBPA 3BUDA 2BVUA 5T1MB 3LIZL 4OZGB 5ESVA 3VFMA 3MRCA 4JG1L 1OVZA 1D6VH 3RUGF 4PTUA 4M5YL 5IB4B 2BMKB 3KPSB 4NPKA 3QQ9C 4W1TA 2BOCB 2VMJA 4G8FA 3CSYB 1MCWW 5DR5H 2A74A 4BGDA 2F6AA 2C1OA 2NY2C 4MDIA 2VAJA 3CXDH 3K6NA 1CDGA 4HS8L 5FW7A 3ZIMA 4JR9H 5GGUB 4BZ1L 5JHDB 2VTFA 5EU6A 1IE4A 2PYED 1FVDA 1ZCRA 1N3NB 1ZLWH 4H88L 5CJ5A 3ESMA 2Q86A 1LNUA 4PJXA 3GYRA 4PJIA 2BVOA 4FQXC 1EERB 2VKXA 3VDBA 4BZ1H 1T2XA 2F74A 2FX9L 3CQFA 4WTZG 5DS1A 3UYOD 4CN6A 4HFWB 4PJBA 1J9TA 2VWEE 3GSUA 1SN2A 4YFLF 3D4ZA 3GB7A 4Y16B 4QRAA 3IDXL 4Z3GA 3BUBA 1OPGL 1KXQA 1ZLUH 3MLUL 3MTRA 1GTNA 4MB1A 3T3MB 4ZUVB 4XCFH 4WWID 1J8SA 3ZHFA 3HLAB 1P1ZA 2JCCA 1CFTA 3W3BA 4Y1TA 2H1LM 1GPOL 1IT9L 3DMMD 2VDMB 5IHZB 4ZX3A 3OPZL 5I16A 1LEIA 4YSPA 2BOBA 4BDVA 1M6OA 2M1KA 2NT0A 3ZDWA 1YMMA 5AW7B 1QFHA 4JG5A 4L48A 5E4AA 5I8CB 1GAFH 3ZTNH 1Q1JH 1ZIBA 3H9ZA 2H32H 1JHLL 3GM8A 3VXMA 4JAMB 2VYRE 2L0DA 1MRFL 2AJVH 1PLBA 4K9EH 3ARBB 4RMWA 3TL5A 4OGQC 1A7QH 2H2PD 5BNXD 4PV1C 5ISZE 3NIFE 2COQA 5IB1B 4HUMB 4ILDA 1AGCA 5CLXA 1VSCA 2UY7B 4YBHA 4K9EL 4XCYB 5F0MB 5DFVC 3FN0L 2DIBA 3WHE0 2YZ1A 3QQDA 2Z0BA 3HRZA 4KQ3L 1MAML 3WIAA 1UWEH 5IMOB 3DA0A 3EJYC 2RD0A 2LU3A 1EZVX 4HCRH 1D6EA 3JTSB 1I8UA 1MCKA 3P9WB 5G4NA 1UD5A 1GC1C 3D39D 3QG7L 4G9DA 3A0OA 1KEGH 3C6LC 1PEWA 1UJ3B 5FWRA 5IHBA 1YYML 2DJUA 3ZUNC 2FLRT 4FQXB 4G7QB 1K2DA 3QEUA 4YSDA 1UA6L 2A9NH 8CGTA 1MFVA 4A6YB 5FYJE 1NMAH 2ZKHL 2J6EA 4YGVA 2YGVA 2D3JA 3DJRA 4RMQA 1NBCA 5ALBH 5FKPA 1KGWA 3L4CA 3V5HB 4F33B 4UV7L 4GG6E 3HHMA 2FR4A 1I31A 4WDIA 1IAIM 3LEVL 3M1BB 1DQML 1Y1UA 4Z76B 5DRXA 1ZLSL 1IZKA 5CIPA 2H9GB 2AJXH 2J3SA 4W68A 1IGML 5IHUH 3GHEL 1MCPH 1SZNA 4URKA 1QEXA 3CZSA 3HG1B 3RWJA 3ZRCC 2HX8A 5DJ2A 5GGVY 1F00I 3MLSH 2FX7L 5IT2H 3ARFD 4HLEA 3D06A 3VGHA 1ZANH 2WO4A 3EHBD 3RNQB 1U0QA 2DH2A 2X10A 5J06A 3V0DA 1MJJB 3F04A 3VXMB 5I74C 4LSUH 1R3IL 4XC1H 4Y9FA 3GMOA 2WB7A 4PJIE 2P5EB 4BFJA 1JV2B 3VFOB 3HUJB 4XNQA 4JHAL 3UTTD 1KJ2L 3DRQB 3CBRA 4PCKA 3CMOH 2AQ2A 2XOTA 1J9QA 1A6UL 3PNWB 4X4YB 2KQNA 3V7AG 4BH7B 3T0VA 2LVCA 5C08D 3ECWA 2JCCE 3AREA 3VTMA 3NGBC 1JPSL 4OT1H 3VSUA 1BF8A 2VW4A 4Y16C 1H3PH 2WGNB 2XWEA 1XX9C 4ODUB 3WNPA 2NUTA 1PDKA 4JS7A 3T6WA 4C8XA 1XZ0A 1TETH 2QFRA 3SBRA 1MJJA 5IBTH 1E9QA 1AHKA 4PJ9C 3QZWA 4UQCA 2IBGA 4Z77B 5FOBA 2AP2A 2X4RB 2X2JA 3LS4L 4MXVE 3A22A 4PSPA 1QBAA 5ANMB 1OAJA 5HDBE 2BFVH 2NQDA 1HIMH 2UZXA 1J1XL 4BHUA 1CD9B 2Y06H 4OLWL 4U31A 3KCWA 3LRSA 3KDMB 5F70A 1S8DB 2R2BB 3WNJA 3APNA 4NO5A 3RNKB 3VSTA 4RFOL 1J0YA 1FG9C 1UXSB 4ELDA 1YEJL 2XI9A 4FG6D 4LKXB 2NUPA 4E36A 3UBFA 4WY7L 1C7TA 1BAWA 2W0FB 5AWNL 2OTWB 3I6KB 4R4FL 2PP7A 2X89D 4PEEA 2HTKC 3ZHKA 1CE1H 1F3DJ 5H37H 4WWKB 3AT0A 2Q0ZX 1LO4H 3S36H 4AIOA 1RUAH 3DROB 4IU2B 5B4MD 4PJCF 3TGXA 4UTAA 3V5KB 5TK2A 1CN4A 2VERN 1MLBB 1IIIA 4CVWA 4F15B 2Q87A 1E6OH 1UJ3C 3JZ7A 4R4ND 4E41B 1VACB 4AEIH 3ROOA 2YAFA 3C60D 4WW2B 3RKDC 1A3QA 5BRPA 3V2AR 1SHWA 1A6WH 1E9QB 1XAUA 3B34A 4BFKA 5IUSA 3BP7B 5ECGA 1A1OA 1JF1A 3X2QB 1I9IL 1UWXK 4EOWL 3PG2A 4AQ1A 2QVIA 3EGDB 4NX0A 3X13A 4OZHE 4GKNB 4P3DB 3TVMC 2BXZA 3MLYH 1I3VA 2P8MA 2X4TB 3GBDA 1JGVH 2AQQA 2XFXA 3ARBD 3PV6A 4LDCA 1KF9B 3NJGA 2EDEA 4L29B 3AWEA 5FO7A 1GZHA 4OJCA 5L4JA 2EDOA 5DYOA 5GRYA 3RYMA 1JI1A 3AUWB 5A2JH 3RHWF 2WZ6A 4FAAB 5DT1H 4X6FB 1G6RH 1ESOA 3V7MA 5I8CA 3JZYA 4RRPM 1DBAL 4LSPL 4E68A 4HOWA 2CO3A 1XT5A 4HUVB 1XGRB 2H47C 2DQMA 2KQMA 3L95B 3QSKB 2X9WA 3QUHA 4DEUA 3QFJB 1PLGL 4N5ED 1BM7A 1U91A 3VXRA 4M8QA 3VXPA 3MLUH 1TQCB 4IHOB 4L1BA 4UAHA 1JE6A 1AR1D 4M61B 4AMXA 2DQCL 3SE4C 3LKRB 3VACA 4DPRA 4AGQA 3QJOA 5E4OA 3FC8A 1MCQA 5EC2B 3QFJD 2NXZB 2PF6A 4Y9BA 3WIFB 1V27A 1V54B 2EXYC 1HYSD 3B1TA 5GZOC 4FQXA 2Q76B 2BY0A 3WIHA 3F7LA 2NXYB 3FT1A 2AEOA 2FJFA 4XT1C 4ANVA 1ZWIA 1KTLB 1OOAA 4G80A 3DO7B 1ZVHA 1T66C 1OP3H 1MRFH 2AJVL 4NRZA 4HOZA 5HY9A 3C87A 2Y7QA 5HBBA 3KL5A 1C8QA 3CV5A 3L16A 2A74C 2PXYD 3E1ZA 1V3LA 2ITCB 1NCDL 2EIZB 3CSGA 4E41A 4NOFA 1JXKA 2NPLX 2OXHA 2AGJL 3DBXA 1E27A 5T33L 1BIIA 3D7PA 5BS0E 2UZPA 3N43B 3U48A 4TSBL 4XN5A 3BI9X 2W1NA 2WK2A 1IM3D 1N64H 5T1MA 4GP5B 1CICD 4WWKA 5D2LA 3O2WL 1CFNA 4GG8A 4WK0B 3IK2A 4L4VA 2X4NB 3L81A 3QIBB 1MW1A 3TEUA 1VEMA 1RPUA 1T1YB 1ZS8B 2GHWB 5C0RH 5DCCA 1F90H 2BHUA 3R06B 5I8EB 3QW9A 5FX3A 1S9YB 3PWNB 4YXKH 1GH7A 2ZAIA 3ESUF 4IGBD 5L2KB 2YPVH 4FFZA 3H54A 2X1XR 4NWUL 5BV7C 5I1KL 3CSFA 2A6IB 4HKXB 5C2BH 3NCBB 3QJVB 4YVNA 5A6MA 3U6RB 2G4EA 4IKJA 4R9HA 5IB3A 2EUWA 1E28A 5IQLA 1A4JB 5J9PB 2CDFB 1PD0A 4ENZA 4NZTL 3TLRA 1R3JB 2Y22A 2ZSWA 4HIHA 4WO4A 1E9OB 1QBML 1CMOA 4HWBL 5CSZA 3T6ZA 1OF2B 2AXFB 2Z7ZA 2W07A 3VWKD 5EOCL 5EOQL 2YXMA 3QUMA 4WIQA 1ED3A 4WFEE 1XXFC 3QWQB 1ET8A 2WGXA 2MOGA 3QYCA 4JLRA 1E9PB 1G4RA 4KHTL 2NUTB 1JDCA 5KVDE 2ZQKA 4JPQA 2NNXA 2UWEB 4OCWH 5EEVA 5JW3H 1Y0LA 1IC0A 1EHKB 1F6AB 1J87A 4BWTA 3DPBB 3LQAH 5I26A 4DP6X 2BCKA 2OTUB 3GRWH 3MUJA 3ZX1A 5GRVK 4A68A 5B39B 1URLA 1R3IH 2BNUA 1U8NA 1QFUL 1PNCA 1KPRA 4KHXH 3CSYA 4TQ8A 4LLWA 2ZF9A 4LP8A 4XODA 4XWOC 5IIEA 2QKSA 5IOKA 1FNAA 4WI4A 2A99A 4JDTH 4PB9H 1SYSA 1NBVH 4NLAA 4ZW8A 4CN4A 4ZQTA 4LNRA 4GT7A 1T7YA 2BY1A 1LWJA 3TZVB 5EU5B 3BVNB 5TE6L 4E9LA 3KPOB 4N2DA 5IM7A 5IFHH 1JIBA 2FE0A 1KB3A 2XXMB 5F7KC 2AABL 1WV7T 4LLAA 2BM3A 2X42A 3DTUB 5JOPD 5E08H 5I0WA 3BAYA 2DWTA 2VXVL 4P8QA 3KWUA 5I8OH 2XTJD 5DJ8B 3IE9A 1DDHA 2L04A 4XN4A 3NRFA 1MUJA 3MO1A 5EA0H 3ZT7A 2HKFL 4XPBH 2XN2A 5AW9B 3WS6A 2CLVA 3MRBB 2YGQA 4L1LA 5CEYB 5HHOD 1OSPH 1C9SA 1RJLB 4Y5XB 3T08A 4FQJH 4XZUA 3SQBB 3VFRB 3LPOA 2H45A 1PG7L 5GS1A 4M56A 4DOHE 4KI5E 3T1WA 3U36B 4K3EH 4U0RB 5F6IB 3BRDA 5G5DB 2V3FA 5H37A 3V9FA 4X98A 1H3TA 2Y6SC 4EKJA 1B0WA 4BRVA 1UWYA 4KK6D 1DBKL 2V3DA 1RERA 2WW8A 2DKUA 1WSST 4OM0L 4HK0A 3BT2H 4U7KA 5D1ZC 1KTDB 3MRJA 2JJTA 4LDEB 2PCXA 4APQD 3KXFA 4K7PH 3U7AA 4PJBF 3R19A 4X9IA 4H8HA 3FRPB 5BXFB 2ZWKA 4CKQA 3RWFB 3E9UA 5CKAA 3SKJL 3HUJF 5K9QI 3TA4D 4YHYB 3ZL1A 1IFHH 2XN0A 2ZD0A 5H8DA 2C4FU 2MJWA 5CGMA 4QRQA 4YHZL 3MV8A 4LEXL 1N12A 1NAMA 4PTTB 1MN4A 5T3XE 3H4FA 1M7UA 1MW0A 2HMIC 2VLKD 3FRUB 3MFGB 4OD3L 3QIBD 4YHLH 4F27A 3U1SL 5EC2A 5FYKD 3P11H 1BXUA 3UIYA 1MELA 5DRZA 1J86A 1ZS2A 3ZKMC 5DC9B 4JANA 1RIHH 3PABA 1ZTXH 2J4WH 4G8EA 1OCRB 4PBXA 5D1XA 3V0EA 3V0VA 4PJ9A 1HX0A 4ZBJA 1J12A 3D50A 4YHLL 1GXEA 2GBAA 2HT4D 4MQXD 3EJZC 5JR1L 3EJQA 4ZUUA 2ZAHA 5D2NB 4B3VA 3LZNA 4HISA 4K23L 4LLUA 4OLXH 1GIGH 3RGBA 1UD8A 4NQCD 1Q9OB 1W16A 4I8DA 4DFHA 5SWZB 1DUYB 5B39A 1HK6A 1JHLH 3QFDA 4PJGA 1SOKA 3LKQA 4ELMB 3T0EE 2DWXA 2O5NA 4HIEB 3SPVA 1RJZA 4KHTH 4BA0A 2D0HA 5DC2A 3IDIA 2SODB 2W94A 3QO0B 4KTGA 3RUGA 4NC1C 5KTEH 1YDPA 3T3PF 1MWAH 1QFOA 1BLNA 1NL0L 1E5AA 4NCC1 1NLDL 4CC0A 4WW2A 1RZGA 2GBVA 1IE5A 1W6LA 3C2AL 4J3TA 4FCAA 2ERJB 2OR9H 4Y5YA 1F97A 4FTVB 4EVNB 3FAWA 4KROB 5CFAA 1GGIH 2CBMA 2XTSA 4QRTA 2QZ5A 3N55A 4JG1H 2R0ZH 3S3DB 1SLUA 1ICTA 2HT4C 5IB4A 1IILE 3T4AC 4G1EA 4D8PB 2WXQA 4PG2A 1UFGA 4QXTA 3K4DA 1MCDA 1Q38A 3KBFA 4HF5L 1R47A 2ICWJ 2R27A 1YG9A 2R1XB 5I19H 1ZHLB 3TWYA 2JKXA 1DL7H 3C9NB 3QDMD 2JF1A 1EXHA 1ODUA 4PV8B 3U1QA 5I24A 4XE5B 3ZQWA 1ASOA 3LZFL 3SO3B 4UIKH 2CM6A 3QXAA 4YFEA 5KVDL 3MRPB 1NCCH 4OZFG 4WI7A 3L6FA 1EGJH 3L5WA 3DPBA 1PX4A 4PP1C 5F9WB 3N44B 3DVNB 3T2LA 5T3ZD 1WIOA 1ES0A 1T04B 3WLWC 4KUCD 5IP4A 5I1EH 1JS4A 4YN3A 1G7JB 5LN4A 3MUZ1 4LFHD 5HHPB 4G6FD 1Z9NA 4KMQA 2XJKA 1KB5A 5C0JA 3NCCB 4O51A 2ERJC 4P0DA 4ABVA 5B8CB 4TRPH 1QLEH 1N59A 3LQMA 1M9WA 4PRPE 1H6FA 3H2QA 4M5ZL 4UYQA 1U3JA 3CVHL 2GCYB 2WQAA 2XA3A 3ZE2E 1IGIH 2QQNL 4GQRA 5A2AA 3GLAA 4IMLB 3P3YA 3MAWA 3EJRA 1NBQA 1PGRB 2B1AL 1PS3A 3L3IB 4P5RA 4WUUE 2EECA 3PU7A 3MV8B 3T0EC 4I9WD 5GJSH 1E6JL 3VI3E 3ZXAC 3QUYC 4OGZA 1L9QA 1MIMH 1HHHB 4J23A 1M71A 3QC6X 4OIIL 4XBPA 2OAAA 1UADC 4IRJC 5BV7L 3BAWA 3MJ7B 1MPAH 1JV5A 4BJLA 5ACZA 5JW3L 2WXJA 3SDDB 3SKNB 2GIXA 2B4CL 4WI2A 5LCVL 2B1HH 3VXUA 1OGPA 4GLRI 2OJZL 4HV8A 4JY6A 4MBRA 5AW6B 4ESKA 4GQ9L 4MJ2A 2FR4B 1BP3B 2O93L 1KCLA 1HHGB 5D7SH 3X3GL 1AIFA 1I7ZB 5I71B 5SX4I 1C5CL 3S98A 4OCLC 4QHUB 1DVXA 3V6ZB 3NJHA 5DEJA 2NY7H 2H26A 1G7MA 1L9TA 4ODVL 3ZDZF 4LHUA 1YPZB 5DYOB 3EFOA 5AKTA 5AW5B 3TV3H 2XVBA 3QWNA 5BMFH 5AZUA 1S7XB 1ZXKA 2HT3C 5TE6H 5SV4A 3OGCA 1PVHA 4APQB 4GUQA 3GSVB 4QGYA 5DHVH 3RUGE 4N2IA 1LEGA 3JT2A 5HI3C 2CU9A 3KYOA 3FH5A 4ODHL 43CAB 1RZFH 4W9GC 3HAEA 5F1IB 4ELKA 1PX3A 5E94B 1A0QH 3KWTA 4MHHG 4AJWA 4JFFD 4APQA 1PZ3A 3K80A 4DKFL 3GSWA 4XO4A 2UY7A 4AYEC 3BWUF 3TO4A 4LFHG 2E9IA 2AJXL 2DW5A 3FONA 3Q44A 4HS6B 4UT9A 3NCEB 4KMLB 1JPGB 2AZUA 1IBZA 1VGEH 4YJZL 5A2IH 2VT0A 1FIGH 2WSPA 2XWJA 1N2RB 4RDQG 1I9EA 1PAMA 1IQDA 1RZ8B 2HT2C 2R4SL 5JQ6L 3D52A 1T80A 3K8KA 3WTXA 1XO8A 3F00A 1HJCA 3S5LB 3VXQA 3DK2A 4XNAA 3ZE2B 5F7YC 2YD3A 4PJEB 1BM3H 5IESH 5EEYA 1MJ8H 4LMQE 4YHML 2AANA 2GITB 3EIFA 3IM1A 4HS8H 4XBPB 4ATTA 1Z7JA 2XPGA 2B9BA 1EZVY 4I18C 1MHHB 1OIOA 4XB8A 3AS1A 3V95A 5BS0B 2OMZB 3QDAA 1A9BA 1MH5B 5E95B 5DD3H 3SYAA 1G6RB 1NAKH 1U8HA 1JK8B 1MJ7L 2EIKB 2GIMA 4R97B 5FF6B 5HI3D 3CPLB 1D7DA 2YMTA 3DX6A 4XPGL 5BUPA 4A66A 1OPOA 2VDKB 2VXVH 4HIJA 2FX9H 5CIPH 3UJTH 4NQEB 2UWEA 3N04A 2O6PA 3JWNE 4Y5YC 4A2GA 2IPTL 3WD5L 4AV5A 1WBXB 1QATA 3RG1C 3FO9A 1ZLVH 1MFNA 3S96A 3GMPA 3N5AA 4U1LA 3FTYA 3GTNA 2CIIB 2YMOA 4OFIA 5J3HC 1S7QA 2LGNA 2IBZX 3N42B 1WCQA 4LLMB 4PBWD 4DKEH 4QOKB 4PGEA 5I66A 3D51A 1MHPH 1I1FA 1ZLEA 1F4XL 2AJYL 1KLUB 2CA3A 4FNSA 3WELA 1BVNP 1URIA 2B8OT 4JHVA 5BQ7A 4UV4H 5K9JL 2FEEI 3NZ8A 1VIWA 4AQOA 1K8DB 4P9HC 5AD0A 2MOQA 3K6SB 1FZJA 3GZPA 2CQVA 4X9BA 1CG9B 3S4SA 4I1NB 3SDXA 5ITFA 4UTBH 3ZYIA 1K6QH 2X7LA 3C8HA 3PFQA 4D8PA 1XF5A 1EEYA 4FFWD 1S8DA 4UILH 3V4UH 3TN0B 2BO0A 3UTSE 1IQDB 4HVBA 3UBXB 1KJVB 1AXTH 1RIVL 4WJKB 2XA8L 3HZVA 4N26A 3O0RH 1JZ6A 3NFSH 4JKPL 5C0CA 4HALA 2YGPA 5KTEL 1JPTL 3TEWA 3BKYH 4MZIA 1G9NC 4KY2A 1PZ5A 2OJZH 2CK0L 3QJHA 3PP3K 4OFKA 1U8CA 1P5VB 3MVSA 4PRAB 4UTAH 2BHYA 1GCYA 3GJFA 4FQ1L 3FFOA 1MNUL 3AWGA 3L4WA 2ADIA 3ARRA 2JTDA 4K7FA 3OQ3B 3JV6A 3FUEA 2X05A 5JOPE 4WDIB 4E41E 1JPFB 4MCZA 1WUNT 3ERXA 1AXSB 9PCYA 1EZSA 4EUPG 4HKBA 4WHTB 4HIIB 4F57H 1JMXA 1OGTA 4O2EA 4U1JA 5CZXC 1KTCA 1WD8A 3LEVH 4PMFA 3FONB 3MLYL 3UROR 2JV6A 1OD7A 4E41D 2I69A 1MQ8A 2G9KA 3O3AB 4CVUA 3ETBF 4TVPL 4MASA 5I1AA 4S2SB 4TUOB 1OGAB 4DKFH 1N8ZB 4NO0B 1MLCA 2PYEA 5TD4A 1TQWA 4LSVH 1KIPA 5EZJA 2WYHA 1MCIA 2JB6A 4FQ2H 1QFPA 1YUHB 1LE9A 2NNAB 4DGVH 4QTIL 4TUJA 1E5BA 5FHBH 5KYXB 5IB1A 4KTYA 4MLSA 4GAJL 3ATBA 4GRWE 3LH2L 3L17A 4KDTA 4YHOH 5D7JA 1YUHA 1LE9B 3U7WL 2DWEA 2GSIB 2NXYC 4MJ5A 4RGOL 4DGYL 4HG4K 1RURH 2R2HA 35C8L 3KLHC 4XPTH 4JRXE 4TSCH 3ZDXB 1GYCA 1M2VA 1R3KB 1YECL 1A21A 1QO3A 1EFXD 3LZQA 3PDOB 4C56D 5KYYA 3MQIA 3AAZB 4JM0A 1TTAA 5INCB 2EXYD 5I16B 3EYUL 5DZJA 3JV5A 4K8RH 4DK6A 4ZXBA 3RZCD 1BX2B 1KLFB 1YC8A 4P2AA 2NY1D 3CDZB 3SN6N 1N8OE 4K5NA 4G83A 2V37A 2JSFA 2XWTA 4JPWH 3MRRB 1JF5A 12E8H 3EHBB 4RVBA 4W9DC 5B22A 3TBCA 3MTXA 5E6IA 1ZEAH 3D9AH 3KPRE 4LQ1A 1ETZA 5LCVH 2OXGA 4RISL 5KEZA 3BDYH 3VG0L 4GKNA 4P3DA 1JGDB 4XZUB 4ZUWA 3SQBA 4R7XA 3W9DA 1JVOA 5TK4A 4Q7DA 5D4HA 1G7HA 3H9YA 3HI1B 4DWHA 1VFOA 3RNKA 3RGVD 4Y8AA 2R0LH 3VFNA 1HCFX 4AK2A 2F53E 1KFAL 5C07E 3EOBA 4XNMA 5A16A 3NP4A 2FB4H 3MNWA 5DZPA 1PIFA 1YNLH 1U8PB 5D6DC 3AS2A 1A1NB 2EDTA 4WK4B 2I7OA 3MCKA 5GGQH 5BPPA 3RB7A 1BWMA 1CLCA 4M00A 2H3KA 1M3JA 1RZGB 4U1HA 3ISYA 1XGYL 4Z95L 4AL8C 4RBPK 1EXUA 3F58L 4JRLA 3CZGA 2OFQA 2FH8A 4Q4IA 4U6HA 1T03L 2X4OB 3RUGB 4LKCA 5BZDB 1ZTXE 2WVVA 3L2LA 4Y19A 1ETA1 4KKCC 3ZDXF 4D0CB 4DKDC 3CIQA 1QR1A 2ZNXA 4XAKE 2BPBA 5A2FA 5I1IL 4AEIL 5TPWL 1BFVH 2P5PA 4H8PA 3W37A 3MODL 1PKQB 1PNDA 4YPGB 4GO9A 2DH3A 2IFGA 4OIBA 1FAIH 2LAGB 5IBUG 3UJJL 1KDJA 2EUVA 2EYTB 1G9NL 3U9UB 1MF2H