3IDGB

Crystal structure of the hiv-1 cross neutralizing monoclonal antibody 2f5 in complex with gp41 peptide aldkwd
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
235
structure length
227
Chain Sequence
RITLKESGPPLVKPTQTLTLTCSFSGFSLSDFGVGVGWIRQPPGKALEWLAIIYSDDDKRYSPSLNTRLTITKDTSKNQVVLVMTRVSPVDTATYFCAHRRGPTTLFGVPIARGPVNAMDVWGQGITVTISSTSTKGPSVFPLAPGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLQTYTCNVNHKPSNTKVDKRVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic definition of the epitope promiscuity of the broadly neutralizing anti-human immunodeficiency virus type 1 antibody 2F5: vaccine design implications.
pubmed doi rcsb
molecule tags Immune system
molecule keywords 2F5 Fab light chain
total genus 39
structure length 227
sequence length 235
ec nomenclature
pdb deposition date 2009-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3idgB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3idgB01
4JPWL 3B9DA 3HFMH 5IVZA 3QQ4B 4I0CC 3MZTA 2ERJC 5JXAH 4FQLH 5D6DC 2Y7QB 4JANB 4OD3H 1NBQA 1ZANL 1JCKA 3T0WA 5A2KH 1RJLA 1C8PA 3RWGB 4B41A 4GS7C 2GAZB 3RVXD 3SDDB 3ZDYE 4GKZB 1OTSC 4L29A 4AEHH 1GAFH 5I1EL 3WJJA 4H1LA 3FQXB 4NO5B 3UTTD 3KJ4B 1DUZB 5CCKH 2IMNA 2WWKO 4QXWA 4QOKA 4RWYL 4YNYB 4J1UA 2NTSP 3FT3A 1V7MH 4Z77A 3C6SA 1VENA 4KZDL 5IUSA 3I6GB 1CXEA 3U36B 3ESUF 4DK6A 2K1MA 5CGYC 5FDYA 2CPCA 4R96A 1KB5B 2FHFA 4GKSB 2Y1VA 2X44D 2XN9A 5CINL 1VGKA 1RIUL 5JNYB 5D6CA 4NQVA 1QNZH 5C09B 3H8NA 1L6XA 4HWZB 1WEJH 1RI8A 2VAJA 1UJTA 2WUCH 2BCKB 1D6EB 2LFGA 3EO9L 4HKZA 4HCRA 3PWVB 4HV8A 3GO1L 3V5KB 2XZAL 3MV9A 1KACB 5BO1H 4MAYB 3T1FB 1EERB 3EDJA 3GJEA 43CAA 1YEDA 3MBXL 4PJ9D 3HCVB 2ZUQB 4DKFL 1CK0H 3VXOB 2ADFL 1BEYL 2IADA 2DQDL 4PLKC 5DHVA 1FH5L 4I48B 2DI8A 3QDJA 4UV7L 3OJDB 1NMBH 3NABL 3UTTB 3SOBH 3U7YH 4K94H 4BH7A 2IH3B 3OKOB 3V0AC 4YHIA 1QYGL 2MPAL 1KTDA 5DFWH 1HQ4B 3NCYS 2JE8A 4X6EA 1ZLUH 4F7PB 5E7BA 4OCXH 3DYOA 2CLVB 5IJKC 4KRLB 5HVHC 3KYMA 2F74B 3RI5F 3CSBA 3P9LA 1CXIA 3DWTA 4I0PD 4JQIH 3ARUA 2AJXH 5C07D 4YGAB 1U58A 3ZE2F 1RUML 3UDWC 2BVOB 4WCYH 1YYML 4M48H 3O4OB 5HPOA 1RUAH 2XNAA 4OD2B 4RGNE 1E6JL 1E0OB 1NKRA 2VYRE 5C92A 3DROB 3ILQC 4KQ3L 2FATH 2BSTA 3P4NB 2GJZB 2W07A 4L9DA 3IS1X 3MRCB 3F6LA 2MSPA 4U6TA 4DW2H 3WXWH 1R3JB 1U8IA 4QHMB 1D5ZB 5FO7A 1ZA6A 2ESVA 4UOJA 4L9LA 4RRPG 5E8NA 1FORL 4LSTH 4KRPC 1KCRH 3BPNC 1DQQB 3LDBB 4MXWL 1VHPA 4UZGA 2JCCB 1OAYH 4IS6B 4CW1A 1J8HB 1GZPA 2VDML 4IRJC 1OB1B 1XIWC 1DVFA 2YZ1A 5DUBB 3ARDA 1K85A 1J0KA 1YJDL 4P5KA 3TA3C 3ZZ1A 1K4DB 2H2PC 2PXYC 3MUZ1 2H41A 5DQDL 4JHAH 2FATL 4KGLA 3F12A 5F9DC 5KBNC 3IJHA 3RNKA 4YBQC 4JFYB 1FFPB 4OKVA 5FAAA 3BW9B 4XBGB 4DZBA 2OJZL 5IIEB 3E2HB 4OCNC 4HGWA 1T66C 5AG8A 1YEJH 4NWTH 4DCQA 1G7PA 4G6FD 3IVKA 1F11B 5HDBF 2EDNA 2FSEB 1A1NB 3ALWA 4JAMB 4MNHA 5ANMB 1F58L 3ILQD 3UJIL 5HI4C 2UUDK 2EDWA 3WLBB 5BW7C 1N4XH 3MCLL 4OZHE 1XZ0B 4JM2D 3P9MB 1HN1A 3P0GB 5C3TA 4MA8H 3DRTA 3R8BB 2NY0C 4K07A 3CXHJ 3ZHLA 5KSVB 2VIRA 2CDEB 2A9NL 1ES0A 4XAWL 2WBJC 4FFZH 5J1AA 3HB3D 4UQ3B 5TDOA 3E8UH 4OI8A 4Q97A 3SE3C 1H3GA 1S7SA 2XKNB 1BQSA 4G8FB 4KMTH 5C9JB 5F8QC 3EOBA 3TN0B 3G6JA 1HHKB 4LVOB 3BISA 3FB5A 4C83A 2ZCLL 2NX5D 1P84J 5IP4A 4TVPH 5DMJB 3D0LB 3OJ2C 2LU7A 4Z7UB 5EB9A 1AR1D 4NHCH 1CLZH 1MY7A 4K7PL 4PJEE 3MRKB 4O58L 5DUML 1CFQB 3QUXD 1Q94B 35C8H 4ZS6C 4FNLL 2IPTH 3IF1B 3FMGH 5J57B 5F71A 3VD7A 3VXQB 1UVQA 4LCWA 4Q2ZB 1KLUA 3MJ9A 5DJDA 3N1QC 4LSQL 4XNUL 4DKEH 4WFGD 5HD8C 3DX7B 2WUCL 1IARB 1SY6H 1DBKL 1MRDL 4LRIC 4GUPB 4TULH 5EZLB 5T1LB 3SGEI 3BE1L 5KSAC 1FG2A 2BXYA 3HE6D 5E08L 1D5MB 3PL6C 4EDWH 1I3GL 5SWSB 1V7ML 4MAUL 5DI8B 1V05A 1S7RB 3ARTA 4X4ME 4OB5H 2VDQL 1S9XB 1SMAA 2PO6C 5I75C 5K93A 2DWEA 3OGOE 1CTOA 1TVHA 3FZUD 3I75B 3BRDA 3JWOC 1PLGL 1SY6A 1YMME 1BX2B 3GMMB 5BQ7A 3MREB 2WLZA 4NYLA 4XP4H 5IEKB 2ATPA 5DWUH 3O2VH 4ODWA 4PGZA 1T22B 3KXFA 1YYLL 5B3NA 1MSPA 3QBTB 4OD1L 3BW9A 3S3JA 3QI9A 1BBJA 3INUL 1GPOL 5F9JA 2QLVB 3Q1SL 3S97C 4HIHA 3TFKC 4K2UH 4PJ7A 4K3JH 4MNQA 2F58L 2AABL 2A9NH 1KEML 1CU4H 2QR0A 4YK4C 1X7QA 4APQA 2OR7A 5IHZB 5EZOH 4KQ4L 4CVXB 1FDLH 2PTUA 1CFVL 3BP4A 1MCOL 5FYJL 1J8HE 1OPGH 4P5TD 3BIAX 2MQ3A 1RZKC 4MSWA 2DQCH 1A6PA 2R1XB 2FWOA 3EAKA 1PYWB 3GMLA 3QIWD 1WZ1H 4PJDE 4F33B 4E41E 4KDTA 4FQIL 2Y36H 1J05A 4OZFG 1NGQH 2FDBP 1LD9A 1EAPB 4KU1A 3OAZK 3HC0B 5B39A 1RAMA 4JCMA 1I7UA 4RAUA 3MRCA 2BSRA 1I1AC 1BZQK 1SM3L 3O3DB 4PS4H 1XCTA 5E8EB 3MGAA 4PYHA 2NY1D 4I5BB 4LLYA 5DTFB 4JPIB 5LBSH 2OQJB 2P49B 3GHBH 3GSXB 5FA4B 5CKGA 1PKQB 1BFVL 2HRPH 4G42A 2Y6SD 3C6LD 3R0MA 4X6EB 4S1DD 1KNOA 2OZ4H 1K4CB 4QT5A 1VEPA 1SJHA 1FNHA 1I1CA 4G7YL 4I8DA 3S37L 1R3IH 4FXKA 3QDGB 3DXAB 1EAJA 1DBAH 4HF5H 4RAHA 1G9ML 4HIHB 3BP7A 4FZEH 3FT2B 5EZLA 3O3EA 5JOPE 5SWZD 4Z0XA 3HMXA 1IAIH 4G43A 4RZCA 3CDFA 3DX7A 1IE5A 4J23A 3ARBC 1DL7H 3WHXB 4CAGA 3BI9X 2VLKD 1NBYB 4DN4L 1NSNH 4OLVL 5H2BA 2P45B 5FYJE 1DEEB 1R5IA 1Q72L 1U8OB 2EICA 3UJIH 4XPAH 2JIXB 4U1NB 3GBNH 1X3DA 5GS0H 2DS4A 4QKXB 1IAII 5CSBA 4I9WE 5D1XA 5E99H 1HSAA 2HFEA 4ERSH 2IANA 3GJFH 2IMMA 4Y4FB 1YPZE 3EDDA 4JHAL 1I85C 3FQNB 1N7MH 4FRWA 2AK4B 4ODXA 1UJ3C 1A6AA 4JPIA 1CLCA 3N06B 5IFHH 5CD3A 4PRPD 4IBLT 3S5LB 5J89A 1F02I 5D96B 4PRPA 1CL7H 3CVIH 3M1BA 3BGFB 2HTKC 4IOFD 5BXFB 4CN6A 2APVA 2IQ9L 3N9GH 4E5XA 4GW1B 1VPOL 4OF5A 1JI2A 3L7FB 1CK0L 1QSEB 4MHHG 2QSVA 3NVQA 3RWCB 2C3GA 2PR4L 2WINA 2VNCA 3ARBD 5TE7L 4H8WH 1IQWL 3DMMC 1CBVH 1S7RA 1GSMA 3C8KA 5E0QA 1NCDH 3DUSA 4POUB 2A73A 5E2WH 2JK5B 4QTIL 1FVDA 3PP4H 1F13A 5IQ9B 3I9GL 1OARH 1FFOB 4KJPD 1G84A 5KG9A 1G6RA 5D7LA 5DR5H 2DQJH 2P46B 4LDEB 1A5FL 3MYJA 4LMQE 1JWUA 5H94B 3EGSB 4N0UA 3RIFF 4FQHB 2VLME 1CFNA 2ADJB 3TJEH 2OTWA 4L3EA 1LO5A 1KBGL 2FBJH 1GGCH 3KR3H 4P4KA 5F6HI 1S5HB 4CJ1A 4Z7QF 1NGZA 4L5FH 5FHBH 1VADA 4NP4H 5GRVK 1IKFH 4QRUA 5B38B 3OXSA 4TNWK 4N8CH 4C57C 3M07A 3HC3L 2XY1A 2XT1B 3MJ6A 5ISZE 4JEGB 1AGDA 5IJVB 3OMZA 3PHQB 1DBAL 1XF2A 1J1OL 3G08A 4KV5F 4LPXA 4YHPB 2JJVA 2Y7QA 1MIEL 3BWUC 3BQUD 3QDAA 1V5JA 4NKIH 2WUBL 4MJ6B 4NKMA 1J87A 3DMMD 3SO3B 4X4XA 3BDBA 3WFBH 3O6ML 1EJOL 3GSWB 3WCYA 4WW2A 4KXZH 4ISVB 5IGXH 3IKCB 1BOGB 5CJXA 4X98B 1AIFB 1MHHB 2QSTA 5CEYB 3K2UL 3U9UA 5GGUB 3VXUD 2BRQA 1C1EH 1HZHH 3KLHD 1ZE3C 5BZWA 1U8IB 2ENYA 5IHUL 3QEUB 4Y2OA 1FFOA 1I9EA 2RB8A 1M6OA 4F2MA 5F6IB 1KPUB 4BKLA 3TBTA 1FGVL 4X7EC 1AGBB 1LO0L 3F7VB 2ZNWA 3FRPG 3LPGA 5JPMA 4G6ML 4U3HA 2D7OA 3VGAB 5DGRA 3MRPB 5C0BB 2WK2A 1OTUC 3FO2A 4JRXD 4MA1B 3QEGL 5IESL 1W0YT 3IFPB 1H15A 3I2CL 4HUNB 1IM3A 2AJ3A 4OZGB 1U58B 2WIMA 4PG2C 4LAQH 3M1BB 2Y23A 5LCVH 2NW2B 2E8YA 1FNGB 1BQUA 3GMPB 4HIJA 5HGHA 5I1EH 3A6BL 1JPST 5MP6L 4QNPE 4Z9KB 3EOAA 4U4BA 4NQCD 5HI4D 4GAFB 4DAGH 4MCYB 1UEMA 1CXHA 4M43L 5H2BB 3CVHL 4Q6IA 2Z92B 4U6VH 1TZHB 4WFED 5DD1H 1TJHL 3LEYH 2J12B 3REWB 3ZYJA 5KS9F 3OGCB 4NFBA 4PS4L 4XWGH 1EHAA 3TJHD 4G6MH 3SDCA 2Z35B 1MFEL 4UBDC 4WHYG 5DJAA 3OB0K 3Q3GA 5MP6H 4Y5YB 4F9LA 2VAAA 2D3VA 2GJ6A 2MCPH 4H26A 3P9LB 2A6IB 1NL0H 1P2CA 1TETH 5F89A 5TE6H 2UVFA 1XGPA 5CIPA 3K46A 3MBEA 3K80A 1ZS8A 4M1GL 4NP4L 5CGTA 4WY7L 5HY9A 3VFSA 4I77H 2AV7B 3QDGA 1B88A 5GQBA 3VG0L 5J6HA 1UQSB 4EI6B 1CVRA 3W0WD 1N2RB 2QSCL 2DJ4A 1W0WB 4KWUA 3CZFA 3IDMB 1NFKA 5C0JA 4WHTA 4Y5XA 4K55A 3HAEB 2VXUH 3MGOB 4U2ZA 4RGMC 4LBEA 3NGBB 2I9TB 3WHXA 1UWXK 3E0GA 2P8PB 1A14H 5E1HB 3JWOL 3WFHA 2B2XH 2AKRA 4OFYA 1CXFA 1OAUL 4CJ0A 1OP3K 4GFTB 3CXDH 3IDXH 5INCB 2W0KA 3E8UL 5C0GA 3NFNB 1VKXA 4JKPH 3OAUL 1KJVA 1N64L 4PBXA 3DVNA 3X12A 4GRLB 3LQAH 2K3TA 1U8KA 1QRNA 5CEXB 2AW2A 2P5EB 1MJ7H 4MS8D 3CFBA 1XIWD 1JGDA 4YQXH 3ZHDA 2HJLA 4EOWL 2M2DA 2E7BA 3FO0H 3B3IA 1QA9A 4AM0B 3S36L 4KAQH 4JFOA 1A7NH 3I6KA 3T2PA 4O02H 3TT3L 3U0PA 2P43B 1JHKL 3HI6L 1A6ZA 3O2DL 3STZB 4G8IA 3ULSA 1EXUB 3CJJA 3DLQR 5DJ6B 3IETA 1G6RH 5IJKA 3MRRA 5H35B 5AD0B 3VXMD 5DMIH 3NPSB 4X6FA 4XNUH 4TPRH 1LE9A 3MV7B 4UIMB 4J8RA 4NQDB 2HKFL 1ZLWK 1PY4A 1F4XH 1ZSDA 2VLJE 3P0YH 4XAKD 4ZUTA 1PYWA 5F70A 3NCEB 1ZHKB 4WVRA 1SJXA 1FIEA 1Y0LB 3NCJL 4PBWD 2DM3A 4C56A 5DA0B 1RPQA 3LN4A 1CIDA 1SEQL 5C07A 1VFBB 3TN0A 3GSNH 1NANH 1S7WB 1UWEH 2CRMA 1TCRA 1TZIB 3BUYA 5DMIL 1Q9OA 4YX2L 3U9PH 5I1IL 1MQKL 4WI9A 3QEQA 2IFFL 2P5WA 1DBJL 2YPVH 4LLUA 1N6QL 1CFSA 4YFLF 2E9BA 2B5IB 1I1FA 5EUOF 1XGTA 5AG9A 1OT1A 1SYSB 4YDJB 1JGVL 4GG6A 1A7NL 4GW4B 3AGVA 5HPMB 2OR9L 1T0NB 2AQ3A 2Y06H 4HJ0C 1EUUA 4X4YB 2LAAA 3MLVL 3DTXA 4G80A 4RBPH 3TO4A 1GC1C 3QUMB 4Y1AD 3C8DA 4UOW1 2MMXA 4OZIF 4JJ5B 2AK4D 5FOBA 4HS6B 5K9KB 1GZQB 4QXTA 2HTLD 3B9KA 3BHBB 5DEGA 2EO1A 1RJZB 1F2QA 1ZWIA 1F4HA 3RY4A 4Y2DB 5T5NG 3EO0B 1GJIA 1NGQL 2OS7A 3PL6D 1Y18A 2NY5H 3PIQB 1FYTD 4F37K 2FIKB 2VXUL 3SEPA 2DQUL 4ZYKB 5JOFA 4PV8A 1D7FA 3PE9A 2ED7A 1WBXA 4JQXC 2DL2A 3QIWA 1MRCH 3DHJA 3V6FB 1MLBA 3OKEB 1D5XB 4JY6A 3NGBC 1FGNH 3SE3A 2VDLL 4JY5L 5I1JL 3AU1B 2LTQC 3VFSB 1G9NH 4MHHI 3UTSD 2FEEL 3MRLA 2ZSVA 3RWDB 2D7PA 3ULUC 4WEMB 1GPOH 1BGXH 4MXVE 5ID1B 1KJMA 1T5WB 4OZFH 5I1KL 3JV5A 2WZPD 2RR3A 5EBLA 4G43B 1F4WL 4KKAD 3PDDA 3V7MA 3Q6FB 2JJTC 4FG6C 3GGWB 4S1RH 4UI2A 4H20L 1R24B 1WWWX 4PP1D 2FH8A 4OFDA 4NQEA 3VI4F 4LDOB 4WW1A 4LPWA 1BIIA 1NBVL 4KK9C 1ZA6B 1KPRA 4LVHC 2VXTL 1TTUA 2IH1A 1CXLA 3HZMA 4WWKB 5DYOB 2BY0A 4HIEB 1KJ2H 1J0YA 5JORA 1WWCA 3PV6A 4O2EA 2D4DA 5E94A 4OLUH 3TWCL 5FYJU 4F15B 1K9TA 3KPPA 4QCIB 2X09A 4S1SL 5EPMA 4L8CA 1XH3A 2R23B 3IJHB 1OW0C 1PSKL 1CD8A 1FSKC 4P5TB 4RGNC 4PTUA 1I9RH 3B5TA 3L3KA 3V4VL 4WEBL 3QZWA 2VDRL 3RUGA 4U0QB 4KK6C 1A6TB 1WWAX 3O3EB 3IFLH 5EOQH 5TGBA 2R2BB 5T1MB 3WJLA 1L6ZA 4XX1G 2KQNA 1IC7L 2NYYC 3MBXH 4DGYH 1ZS8B 4FG6D 1F45A 2ICCA 3ARFD 1OW0A 2GY7B 1MQ8A 3QQ3B 3PJSA 2YUXA 4ENED 5LGHH 5T3ZL 3C08L 3KYAA 4PRNA 1M05A 2R9HC 4Z7OE 4LVNB 4NWUL 3EYQD 5JIIA 2EE2A 2A38A 1FIGH 4KKLC 1KGCD 1LE5B 1G7LB 3UTPE 2JIXD 4KJWD 4Q9RL 4QHNB 4P9HC 3MJ9H 1DQJA 3K1KC 2XZCH 3WFHB 4Y2DA 1LP9A 2O5XH 3QUXC 4HIIA 2OZ4L 1JF1B 4S1DC 3DGGA 2IPTL 5C0BD 4BJLA 1BJ8A 4G6JL 1OM3L 3U2SB 4OUUB 4JGJA 4FQXB 5GJTL 4O5LL 5FUZL 5JW3H 1QOKA 3HNTL 3MA9H 1KLFA 4O2EB 1I1AA 4JO2L 4HS8L 2QSQA 5DFVC 4BKLB 1GGTA 1QSFD 3KPSA 4DAGL 2Y5TA 1WFOA 4GMTH 1L0QA 3FFDA 5E8PA 4XCCL 5CMAB 5L7XL 2J8HA 4I13B 3HMWL 5DK2A 3ABZA 1J1PH 3S4SA 4BQ9A 1T0MA 1X5AA 4HD9A 3FO9A 5CHNB 1JJUA 3ARFC 3KVQA 1OLLA 4YHNB 5DS8B 1DE4B 3ZTJH 3GK8H 2H3NA 2NW2A 2IPKB 2DI9A 5BVJA 1FZOB 2H8PB 5F7NC 3BWAB 43C9B 4TOYH 1CS6A 1Z5LA 1FNFA 3ZTNL 2G2RB 1NCAH 4EEEA 2XZZA 4S11A 4WFFD 5D7IF 1ZHKA 2OL3H 5DRNA 1TJGL 4QHUA 2APWA 3RWFA 3GEWB 4JFQB 2HVKA 4XMLL 5CP3A 3TBSB 5BV7C 5E6IA 1QLRB 5IW1A 1I9IL 2VR9A 3OXSB 1OAQH 3QUMH 3VW3L 3O3UN 3LOWA 3UTTE 5GISH 4Z7OF 5FB8A 5GIRA 4RMTA 2IFGA 3H7LA 1K4DA 3BYYA 4GRWF 2CK0L 3U4AA 3BRGC 1H8OA 5E2TH 3G04B 2DD8L 5C6PB 2OBGA 3RL1A 4KPHL 2EEDA 1EHLL 3S4SB 3RPKA 4GRLD 4X9HA 3JTSB 4YX2H 1XGRB 1XZ0A 5DZLA 3T0EA 1QHPA 1J1XL 1BD2E 1P6AB 2PYFB 4HXBL 4PY7A 1KIRB 4BH8A 3QWQB 3UBXA 2ILLA 4PP2B 3P73A 3VD5A 4KH2A 4L8SB 4BZ2L 1FORH 1OP5H 3SQBA 3I02B 3ARYA 5IHLB 1T7YA 4ZMAT 5IWLA 1YNLL 3HZYA 5K9QI 5GS1C 4YFEA 2NZ9C 4LSUH 4D2NA 1EGJA 1FNEA 4UOW0 1EGJL 3LV3A 5IVXA 1U91B 2FJHB 3A67L 3SDYL 5F1NA 3TC9A 3WFEH 3V95A 1A9EA 5K9OA 2VZSA 3BMWA 1A7RL 4P23C 4Y16C 4HUWB 4UAOB 1IQWH 2Y5TB 3L3JB 3VH8A 3UJJH 1QNZL 1P2CB 4NJ9L 1AKJB 3DETD 1TTGA 1A6TA 4S1QL 4U1KA 5MI0B 3LSOB 3T0AA 5DD6B 2AJXL 2D0FA 4H8WC 2BX5A 4PJGA 1A47A 2Y06L 2PN5A 1NAKH 5SWZB 4DVBB 3WFCL 2YA0A 5C71A 2AKRB 4EIGB 2P24B 3IU3A 2WBJD 5IVOA 1N0XL 3G6DL 4JG1L 4JQVC 1N64H 3MNVB 3SBWC 1YJDC 1F2XK 1KIQB 2IANB 3HC0A 2AJZA 2IH1B 4PR5A 5HI5C 4R4ND 3PXJA 3F6IA 2WV3A 1MCCA 4HCRH 5FKPA 5HHPB 2ZWLT 1UB6B 2AXHA 5I1CH 1K4CA 3JVGA 4QT5B 5ESAB 5KAQF 3ZLQC 3T3MF 3C5ZA 4YDKH 3QXWA 1P53A 4WV1B 1OSPH 3G9VA 4X83A 3SDCB 5CIPB 2D9CA 5E6ZA 1J11A 4JQVA 4QHKJ 5C09A 3KYOB 4BUHA 5F9OL 4NZTH 1N5AA 4LKXB 2XXCB 5D1QD 4XPHL 4BELD 4OJFH 1FLRL 1HEZB 1W0VA 3QXAA 1KJ3L 4TPRL 4GSDL 1IGFL 4LPVA 2RHEA 4H1LH 2NX5A 4IHOA 3DXAA 3KJ6H 4LOUD 4P5MB 1AO7A 1E28A 2DM4A 5JHDB 3GMOB 1J8HD 4MA3B 1J05B 2VE6B 4J2XA 4H1LB 2AJSL 4JM2A 4ODVH 1FN4B 1E4XI 2DLFH 3M8OH 4G80B 1KJ2B 5D2LB 2EYSA 4F7CA 3NH7H 4Y4KA 2DD8H 2H6PB 4Z7WF 1IC5L 4M4PA 2LU4A 2GSIB 4WWKD 4D9QE 3C87A 2OMNA 3QUYD 3DX9A 4UMGA 1L7TL 3KYKH 1CICD 4U1NA 4J3WA 3DX8A 1CL7I 3UTPD 2RJMA 3UPAA 1RVFH 1DQML 3CLFL 1NMCC 2EYTA 3SKOA 1WTGT 1Q9OB 2DF3A 5SWSE 2EKJA 4JKPL 4WRLA 5F9JB 5D2NB 5GGTL 5F21B 2DQIH 3QXDB 4JFXA 4WDIB 1GGIL 1AKJD 4UILL 4YZFE 3V4PH 2VZ3A 5J12B 5BW7A 4R4BA 4ZO9A 3A6BH 3K8MA 3MJ8B 2VL5B 3G5YB 1SJVA 4L1DA 1S9YA 2W60B 4ZTOH 3LKOA 4LCYA 4I2XA 1MAMH 3TZVC 1OPGL 4WEBH 2ICWI 2E7HA 2B0SH 3S98A 2I5YL 2HMID 3S7GA 1EFQA 3H9HA 4X80L 1IBGL 4DEPB 5C1MB 1RD6A 4XHQA 4GXVL 1EDQA 1I4FA 3VFVA 5CEYA 4WWKC 4YLQT 1U42A 2D7NA 2IBZY 3I02A 4J12A 5B3JE 4NJAH 4U33A 1OHQA 4OQTL 2DMKA 3HI5L 5D1ZA 1H3XA 2OCFD 4ZFGL 3HZYB 2CMRH 1XF5A 3PP3K 1ZWIB 3CDCA 2MJWA 1Z2KA 3FQWA 1K6QH 1FO0A 4ALAL 2A1WL 5FYKH 4U6HA 5JW5B 3CFCL 4I9WD 5JPMB 4X99A 1LO2L 1RY7B 1W8OA 1BM3H 4XNQB 1T89A 4M9PA 4Y88A 4OB5L 4ESKA 1QBMH 1OCWL 4UTBH 4OLZL 1EO5A 1JBJA 5MENE 3QEHA 1QR4A 3L1OL 2HH0L 3VXSD 1OD9A 4ZPTB 2YPLE 4NC0B 1I8IB 3IVKB 3T65B 1IC4H 5FHAL 5TDNB 1LO4L 4M8QB 2A1WH 4KTEL 1JRHH 2B1AL 2YBRB 5HGBA 1F4WH 1SYSA 4ZTPL 4QRUB 3N0PB 1BHGA 1U8JA 4PRHA 1LEIA 5MEQA 3ARVA 3NACL 1UENA 4R4FL 4KK6D 3PGCA 2W9EH 5I18H 4Y4KC 1A21A 2CDEA 1ES0B 5TFSL 2DBLH 5HVGB 4KTDH 5GRZA 2GY5A 2NYYD 3IDIA 2WP3T 3J8F7 2X4OA 3HC4H 5IB1B 1WSST 3GMNB 5IT2L 1VEOA 1BD2A 5IG7A 1S9XA 2A73B 2DICA 2X9WA 3QI9C 4HC1H 2GUOA 5DR5L 2VLKB 2P8LA 4K3JL 3W39A 4GAJH 5B4MC 5A16A 5C0ND 5C9JA 4WNQB 3AC0A 4FMKA 2EXYD 1WFNA 1VADB 2YR3A 5ILTL 1FO0B 1LHZA 1KB5H 3F12B 1QQDA 4RWHA 3EYSH 2SEBA 1LO5B 2E27H 2KQMA 1S7QA 3U0TA 4MD0B 1I8MA 3HE7C 3VXRE 3L3OB 3ARDB 3PGFL 5EBGA 4M48L 3U6RB 1WT5C 5F7DA 1S7VB 4JY4A 1NLBH 3CPLA 3GM0A 3RDTC 2BJML 3JWDH 4LP5A 4HJJH 4NOFA 1HILB 1MWAL 3KPSB 1N4XL 5ISZD 2R8SH 4FP8L 1EO8L 3PJSB 5C6TL 3U30C 3A0OA 4DCQB 2CDGA 4DFHA 4Y4KD 2D7TH 1D9KB 2LVEA 1E6OL 1FRGL 1VFOA 4CKVX 4F15C 3HG1A 1DDHA 1H8SA 3QCVL 5E00A 4HZAA 1CF8L 2XG5A 4A6YA 2CXKA 3MQIA 5E2UH 5T5FH 1XEDA 2VDNH 4OFKA 5CILL 1R5WB 3C5JB 1HHKA 1T4KA 1YEEL 5IOPA 2HFTA 4RNRA 1OSZB 3FQRB 1FZOA 2AXGB 2VZOA 5HTSA 5GS0D 4YXKL 4L8CB 1QBLL 1XH3B 2R23A 2OJEB 2HTLC 1GIGH 3VFMB 3TJEL 1CFTB 3GJFA 1OT2A 2B4CH 4ZO8A 2AGJL 1NDMB 4BFIB 4IS6A 5CP7B 1A7QL 3CSGA 4F2MB 2G5BA 4KI5D 5D93C 1ZA3B 2A2QT 2ZSWA 4HG4J 2C1PA 2YC1A 2Q76B 2F19H 2NQCA 3MRHA 3VWKD 2R1YB 1U8QB 4IRZH 1FZJB 1P7QD 2M8XA 1CF8H 4JFHD 3RDTD 3GHEH 4Y5YA 4EI5D 2VAAB 4PJGE 5JDJA 3RZWA 4WGWB 2FJFB 4IOIB 2DQTH 2PYEA 3W11D 4L3ED 5EORL 3MXWL 5F3BA 1YNLH 1U8NB 2QKIB 5FHAH 1AXIB 3SDAD 1W2KT 3RTQA 1S3KL 1ZTXL 2Q3AA 4HMCA 1JFQL 3MLSH 5KOMC 4LSSH 1I7TB 1JPTL 8CGTA 1A2YA 5I17A 4XXDA 2B4CL 1G7LA 3QPXL 1AHWC 4V1DA 1CDUA 4RMWA 4Q6IB 4GT7A 4Q0XH 4ZUUA 1DDHB 4NCC1 5ICYB 3QIUB 2VKXA 3KS0J 5FGCB 3I85A 2HKHL 2V7HB 3DRQB 1YDPB 4KJQC 3BIKA 2EDYA 3ECBA 3FT4B 3NCCB 4HWBH 3HE7A 1OGAA 3CC5A 3BKJL 1AD0B 1KTKE 3BDXA 4LF3B 2O5ZL 2AQ2A 3MLYH 4BFBD 2YOCA 1AE6H 3MOQA 3GJFB 1EEZB 3MLWL 2EDTA 3D3VE 4GKSA 1IM3B 4PLOB 3ZYIA 4ZS7L 1CFVH 1T2QL 3ZO0A 2ADIA 4X4ZA 5DGQA 5KANG 5TFSH 3K0WA 4QXGL 5FUCE 1U41A 4PJHF 3ULVL 3LKNB 5E00B 3SDDA 3RBGA 3QNXB 4GKZA 2YPLD 4L29B 5FDWA 4RQQA 4YHOH 5DSCA 1H3PH 1NPUA 4URTB 1NGYB 2V9QA 1VEMA 2HT2C 2QQLL 4JANA 4P4KC 2R0KL 5GJSH 2OI9C 4PGBB 4H0HB 1UZ8A 4GAJL 3UTTA 2CR6A 2E8ZA 1YYMH 1H3UA 4XPTH 1RK0B 3IYLW 1TNNA 1BM3L 4JQIL 3RVUD 4J1UB 2YMXL 1JWSB 4M7ZB 3MV9E 4BSVB 2PKDA 5K59F 1MIEH 3ZKSD 5I1LB 2XKSA 4JFDA 4M7JL 1I9IH 4YE4H 1MI5D 2YUVA 1U3JA 3FO1A 3I84A 3F7YB 3IGAB 4NJAL 5IJVA 4PJDB 3MA7B 2FBOJ 1YECL 1CD9B 4P2RB 3F5WA 4HKJB 5MEOA 3B2UC 2A9MH 3C08H 4D9LH 1PG7L 4EQ3A 2QBWA 4AEFA 2YPKA 1IKFL 1I3VA 4O5LH 3ULUE 1KG0B 3RVXC 2FX7L 1T0NA 4M7KH 1CDCA 2DI7A 4NKOA 3L7EA 1VSCA 5T1KA 4HEME 4DFIA 3AS3A 4FFWD 1F97A 3DGCR 4JRYA 5LWYL 1AC6A 4GRLC 2GK2A 4PRIB 2FD6L 5IV2A 3RIAF 3T3ME 2LV4A 4K9EC 3MV8B 5D7JB 4EXKA 4DUXA 1REIA 1CT8A 4HCRL 2VIRB 3OG6B 1TETL 3HRPA 4FQPA 4ODXB 1T5XA 3IDGA 4OCLC 4ELMF 1JK8B 1C08B 3QDGE 1IGIH 4CVZB 5JZ7D 1EFXA 5IB4A 3SKJL 5E56A 4PPTA 3X13A 1W72L 3BZEB 1T7ZA 3TBYA 3GRWA 1VCAA 2AV1B 5C0IB 3QG6B 4EVNA 5IB2A 2W9DL 1MFNA 3GIVB 2R1WA 2F53E 3LEVH 4E5XB 2C4XA 3NFSL 4EDWL 5MERA 3IETB 5E08H 2DJSA 2OR8A 5GS3A 5EUKB 1CFSB 3EFDL 3MJGX 1F4YL 3TCXA 3LB6D 4X6FB 1PG7H 1HHIB 3RX8A 1X5GA 4KTYA 5F7FA 5DEZA 1A7PL 4LKXA 5E03A 2X4QB 3RPIB 5ADOH 4G9FD 4HFUH 1WAAA 4KI5E 3SE9H 3FT2A 1JN6B 1R3JA 4ZTPH 1ED3B 4X0KB 4FXGA 5HHVH 4RQQB 1DEDA 3PXHA 3CX5J 2BOBA 35C8L 5IROA 3V0WL 3SDXF 2MKLC 2GFBA 1Q72H 4YO0A 4XBPB 2XN9E 3ARGC 1LP9F 4DVRL 3D3VB 4OUUA 5DFVD 2BOCB 3QXUA 3UJTH 1BVZA 4KDWA 4ZFZB 3OGCA 1I9RL 5KS9B 4AYFA 3WO4B 5GGTA 4U7MA 3NIGF 1S7UB 1FG9C 1KXQE 1VFMA 2XA3A 3MLWH 4IRSA 1OB1A 4PG9A 1WFUA 4D0BA 3MRMB 5EU5B 1OAKL 3VRLE 1S9VA 5TPWH 1UT9A 1ZLWH 3QDMA 3C5ZB 3G9AB 4HWBL 3DETC 2YD6A 3OKMA 2A74A 4LPTA 4OKDA 3LB6C 5DJCA 2BZDA 4GAGL 1IGYB 4KY1H 3RY6A 4QGYA 3OR7A 5HVFB 4ONHA 2NY4C 3EOAB 4JFHE 1HYSD 2DOCA 4ZAKC 5E5MA 2R2BA 5I1AA 3QPXH 4N8VA 1UXWA 1U8LB 4X5WA 5JHDA 2X4UB 1ERNA 3EO0A 5D72L 3KWWB 2GT9A 1MHCA 4G9DA 3W0WB 3L95B 2OL3B 3MXWH 3BZ4A 1KN4L 1JPFA 1GOFA 2VN4A 3P4MA 2HN7B 2J6EH 1WBYB 5F93C 2DWEB 5ICXA 1DANU 3FOMA 5E94B 4AEEA 3MYZA 1GH7A 3F7VA 3F8UB 4L4TD 2FYYA 5FA3A 2O61A 5F7UA 4TOYL 4CVZA 3M17A 1E4KA 1NH6A 1DVFD 2FBJL 3TCLB 1ZEAH 4OCYH 1PKQA 4DKFH 4WV1C 5LQBH 4HJGB 4QRRD 4L8DA 4OGYL 4DOHB 2X4PB 1MUJB 4YWGH 1F4XL 5J1TC 2WSKA 1KXTB 3DARA 3EJZD 4AK1A 5BV7B 3RU8L 3AAZB 1F6FB 1X5HA 3SE8L 4Y5VA 4NRXB 1JHTB 4N0UE 1I7RA 1MPAH 3JUZA 5JA9A 1YN7B 1DBML 3LKSB 4UIKH 5F7KC 5HHXL 1DP0A 1CG9B 1A7QH 2D03H 1A0QH 3THMH 2HVKB 3TBSA 5KSAA 4GG8B 4XVSH 7FABL 2GAZA 3O2WL 4P2RD 3VRJB 1T20B 3GSRB 4U6XB 4UB0L 3W5NA 3QUYA 4N0CC 3WLWC 3QO0B 2DQHL 5BCAA 4NO3A 1IM9A 5CWSA 1I8MB 5KVGH 1JRHI 1B0RB 4JKLA 4OZFB 3VMPA 5F1IA 1ZT4A 2D9QB 3DXAD 4PJFE 3BESR 3VXUE 1GHFL 4NC1C 5HDQH 3B9KC 1OGAE 1T0MB 4HHAB 1FNAA 5DT1H 5TDNA 4N90D 4DZ8A 2F54B 3QT2A 1BZ7B 1CQYA 3ZE1F 3JXAA 2FGWL 3RZCA 2VITA 1WTLA 4XB7A 4LCCC 3STLB 3WIFB 4GBXA 3EOYG 3QWRD 4FQQA 4RAVA 5BRZA 3L7FA 1QSEA 3UTSE 2FO4B 4JJHA 1UG9A 3BQUB 1X4XA 2IPKA 4NQSB 2Q8BL 4JKWA 4NNYB 4HFWA 3O41B 5KZCD 4ZOCA 3TZVA 1WV7T 4JZNA 4CDHA 4PB0L 5JUEL 3KG5A 5LWYH 2VOTA 4YXLL 1DVFB 4YBQD 1JGDB 5KSAD 1TZGH 1KELH 2OTPA 1AI1L 4FOMA 3PWPE 32C2B 3TYFB 3PWUA 2CRZA 3LIZL 4ZTOL 3GRWL 2XZCL 4YBLB 1IGYA 5DUPL 1NJ9A 1P4BL 3CFBB 5FF6B 4D0DA 4Z7NF 3P4OA 1R0AH 1NCCH 4ZOEA 5L7XH 3FCTA 2BNRE 4Y19A 3U4BH 1JRHL 2B1AH 4D9RE 5DJZA 1QG3A 3MV7D 4HK0A 4DN3L 4IMKC 5D7SL 4WFGE 3HZVB 4OZHF 4LASH 4K7PX 4WUUA 3SDXA 1C5CL 1O5DT 1FO0L 2N4IA 2VTFA 4KKCD 4KUCD 5FOJA 1HHHA 1DQTA 4LSRH 1JYNA 3CFCH 1P7QA 4X6BA 3UTQA 4KQ4H 2W59A 4YIQB 3FRUA 5GGVL 5ITFB 5D7JD 5C8JB 3LS5L 3VFUB 4JG0H 3SJVD 2ITCB 4FQJH 4FQCH 4NWUH 1S9WA 1MWAB 3KPMB 5C0GB 2ESVE 3U82B 3WIHH 3K4ZA 5ITBL 3HMXL 1R5VB 4XAWH 2WP3O 2D31A 4LNRB 1CGXA 1TVDA 1S7UA 3RVUC 5ISZB 3PHOA 3QJHA 3T0XA 1TIUA 4TQEL 4MWFA 5IGXL 5F9OH 1RV6X 3KXFE 1K2DB 3QFDB 3VXTB 3NCBB 5IF0A 5JO5A 3KYOA 3P11H 4OF6A 3MROB 4K3DL 3BGMB 3O8XD 1ZLVK 3H9SD 2UWEF 3WSQL 4NNXA 4DUWA 4ACPA 2BNQB 2VLRE 1RVFL 2PO6B 2F53D 3UTOA 2K7QA 4TTDD 4LIQL 4YDVA 2CIIB 1SEQH 5IVXF 5F7WC 3GJFK 1OWRM 5L2KD 4LLMB 4YR6A 2XWJA 3WL9A 4MNGB 3SCMD 3FMGL 3KPPB 3DIFA 1M7DA 3NA4A 3O45B 1ZHBB 3L5JA 3THML 4LEOA 3CMOH 2NNAA 5M7QA 3LRGA 1I1RA 5EU6B 1XR9A 1U6AH 5MENA 3VFUA 4KKNA 4PJHB 4PB0H 5JUEH 1J1OH 2H2SC 2YPLA 2IBGA 3TYFA 1AY1L 4FQ1H 2ZKHL 4P2RE 1N8ZA 2RFXB 1D5XA 4JY6B 2W65A 1PKOA 5I1KH 1MLCA 2X7LA 4LARL 5FECB 3OF6D 1FLRH 4OAWA 3A67H 1PGRB 3DUUB 2YKLH 2R56L 1FJ1A 5EUKA 4X4XB 3G6JE 4R9HA 4ONGH 3RRQA 3WN5A 5C0AB 3RIFK 3IFLL 4PJXF 5I71C 3DMMA 4JRXA 4XP6L 1WITA 5HJ3A 1OGAD 2WUBH 5EBWA 3STLA 4TYUA 15C8H 3NFPA 1GZQA 3FRPA 5JDSA 3ULVC 3PP4L 1NQBA 4MJ5A 2DQUH 2VLKA 2K7PA 4FMFA 3UROR 3IDGB 1I7ZA 4C56E 5I9QC 2E6QA 4GRWE 1RMFL 3E6HB 1KPUA 1D5MA 3TWCH 2HLAB 1RZGB 4BK5A 1W72A 5JXEC 2PETA 4N8CL 1ZGLA 3ARSA 2ITDB 5DQDH 4TSCH 2Y72A 2ZUQC 4NQVB 3PWNA 15C8L 1B2WH 3OAZH 2ORBL 3PABB 2OP4H 3H7BB 2NXYC 4U6HB 3TVMC 1MWAH 1BEYH 4KMLB 4S2SB 3AREC 1F3JA 4BSWB 3BSZH 4GRWB 2APFA 1LEIB 2YHGA 3QWOB 3MNZA 1TVBB 4NT6A 5IQ7H 1JFQH 1JNNH 1R3KB 2V2WA 4NN7C 2ZOKA 2W65B 3MGTA 4HKJA 3L7EB 4V2BA 3T65A 1HIML 3P3YA 5KOVC 4IRSD 4YPGB 3TIEB 3EYSL 4Q2ZA 2W0FB 2AXFB 3VFOA 3QIBA 3EO9H 3OAYK 3PWLA 4Y4KB 3X17A 4AENB 3AREA 5INDA 2D7QA 1ZVSB 2G2RA 2PTTB 4GLRI 1PEWA 5DRXA 3RHWF 4H25A 2LVCA 4JO4L 3JBG7 5IT2H 3DOSA 3BO8B 4DUVA 1BF2A 3UJTL 3U2SA 4LBEB 1VKXB 2I9TA 4HUVA 2OSLA 2L0DA 3VJ6B 3JV0A 4MD5B 3I6LD 2W91A 4I4WA 3V0WH 2D31B 2PW2A 4XP5H 4R26L 4HXBH 3F7PC 3P0VH 1AGEB 5F7YC 4U6YB 4PJ9B 3JV4A 2FEDC 4YFDB 1P84K 1W72B 3FFDB 2R69L 1MLCB 1A4JB 3IDYB 4QO1A 4R90H 4LCYB 1IC4L 1KIPB 1Q9KA 5IBTL 3O11B 2XKUA 1IKNC 4PJ5A 4K3DH 4EBQL 3CSPA 1FFNB 2Q7YB 4QTHB 4NNPL 4M3KB 5FV1L 3Q48A 1V3JA 2VSCA 4TUOA 3BAEH 2OXHA 1J0IA 5ERWA 5D6DA 5ALCL 4DTGH 4ORZC 4HUUB 3P30L 3QDJE 1OWWA 1I7TA 2EE9A 4PJFA 2HLFC 3BWAA 43C9A 1YEGH 1JPGA 4OD2A 5T1DL 2XZQL 3K8LA 3VDAA 4QHKI 3LKPB 5E70A 1KULA 5IFJB 4YDVB 2CIIA 5E5MB 1JPFB 1PG7W 2EH7H 3HR5B 3BPOC 4QRTA 1QEWA 5IROC 2PCPB 4PRNB 1EBAA 2X4UA 5AZEH 4YBHA 4WFHE 4HIXH 3DSFL 3FN3A 4A6YB 3QIUD 4YXHH 4U3CA 1FZKB 4L3CA 5FKPB 5F88B 2Q7NA 4R6UA 3BP5B 5J13B 1R3IL 2QJDA 3CC5B 4ZNEE 2CLVA 3VFNA 2XZQH 3C09C 1E4WH 5C8JA 4OGAC 3RWJA 5GGRB 3C9NA 2FEDD 2FD6H 3LKRB 4CRPA 5E9DA 3GSXA 5FA4A 2IH3A 3OKOA 4Z0BL 5ALCH 25C8H 3WLWD 4TSBL 3MRNA 1MFCL 5DJ0B 4LLAA 4M43H 4ZSOB 4N9GB 4P3CL 3VGAC 3GHBL 2COQA 2FX7H 1AQKL 1X5LA 3U46B 3H2WA 3ILPB 3MBEC 3MJ9L 4JKMA 5BVPL 1CD1B 3DI3B 4Z0XB 4DGIH 1UXWB 1IGTA 4F33A 1L0YA 3MRDA 1T7VA 3VE0B 4O2CA 3MACH 1JL8A 3C5SA 3VFRB 4YE4L 4JN2A 4HDIB 2P5WD 1LD9B 5DJ8A 3UAJD 1FRGH 4ZUSB 4XP5L 3GRWH 5HHOD 3HFML 4XCFH 2C7UA 1X9QA 4NM4H 2VZVA 3EFDH 2CIKB 4XXCA 1FYTB 4G5ZL 2XQBH 3OXRB 3L5XH 4FZ8H 3KJ4C 4V1DB 1G7HB 2VLMD 4I48A 1MCBA 4LLDA 3O2DA 4PJIF 5TF0A 3KPLB 4G3YL 3FB8A 3EYVA 2FJGA 1ZHNA 3X11B 4R2GB 1MRDH 4S1RL 1OAXH 4NN5B 5L2KE 2NMSA 3IXTA 4DGIL 2ERJB 3DYPA 4ZFGH 2AJVL 5T3ZH 5HHQB 4L8BA 2NY3D 3JSSA 2I9LB 1PVHA 3TH4T 3VXUA 5MEOB 3RWEA 4ODTL 1AKJA 1U2HA 4GXVH 3AM8A 1MCJA 3OAYH 4F37F 4TUOB 3CFJB 4HKZB 2NW3B 4OZIA 3DVGA 3LMJH 1FC2D 3VXPA 3HTLX 5DLMH 3OKNB 3M45A 5T1LA 2ZOKB 1UM6L 3GBMH 1AXTH 4E42A 3MRFB 5BRZD 5JW4R 1F3DH 3G5XA 2ESVD 1UYWL 1MFBL 3MXVH 1NL0L 1FGVH 4E41A 4OTXH 4HFWB 4YHYC 4DK3A 3FHQA 4UINH 4U6XA 4RMVA 3QUZC 5DRXB 5J11B 1QVOB 4P23B 1A6VL 1IVLA 3BGAA 5IB5B 1DVFC 4XVSL 3EJYD 1CZ8H 4QLRA 4YHZL 2DLTA 7FABH 3D0LA 4C56D 1RUQH 3MNWA 3VFGH 3HPLB 4HUMB 3AU1A 5BZWB 1SEBB 5GS1B 3KYKL 1CFQA 1A5FH 3MA7A 4QGTA 1T03L 3CSYB 4FFVD 4PREA 3EW3B 9CGTA 1C5DB 1ZT4B 3NCYP 3FQUA 1N5YH 1S7XA 3HE6B 4HWEL 4LHUD 3WV0A 4OF0A 4ZPVB 4Q74A 2IPUK 3VG9C 2V17H 3LN5B 2YBRA 3PGCB 1QR1A 2MOVA 3ULVH 3TBWB 4WTZG 2R2EA 4W6WB 4PGCA 4U0RC 4C59B 2B20A 3W5MA 5ANMA 1JNNL 1YEKH 5HYJD 2BSSA 2XQYK 4PGBA 5DF0A 3T77B 3EYOB 4NN6B 4U1MB 3O3BB 3DX6B 1UM5H 3BEVA 3VXMA 4N0CD 1OF2A 3GSVB 4NQXA 2DWDB 2ZZUT 3LRSB 2JELL 1RJLB 3RVWC 1IGJA 1J1XH 3DVNB 4XNMB 3VA2C 3GBLA 2Y07H 2AJUL 5GHWH 3IXTB 1WT5A 1F3RB 1FVCA 3RUGE 3B8YA 3MOBH 4QTIH 3MV01 4KPHH 4ZQKA 3EYVB 1VACB 3I3DA 3I6LE 2R0LL 3QCUH 3CDGA 4WFHD 3TT1H 5L88H 2EYTB 4FQIH 4JFOB 4M00A 4X6CF 5IB3A 1HSBA 5D5MB 4G8IB 2V9RA 4UB0H 1VPOH 3WUWB 5HGAA 4TQEH 3W0WE 5FCUL 2WQ8A 5DJ8B 5EOCL 1T6WA 3N1PC 5DSCB 4X0KA 2D03L 5T1MA 4LHUG 1A1NA 2CLRB 4KKBD 1ETZA 4P9ML 5TDPB 1NEUA 3A6CL 1N6QH 1T1XA 4Z95L 5C0CB 5TPWL 4BFEA 4ODUB 1E28B 1DEEA 2Z8SA 2OL3L 4HF5L 4KI5F 2WMPA 5LGJA 4HLZG 2VDOL 1KIUA 3O3DA 2E7LC 1A7RH 1YEHL 4GQ9H 3RVWD 3D3VA 1CLOL 5FEBA 2BHZA 4Y5XB 3TO4D 3PGDA 4IDJH 3V9FA 2R0ZL 4A2MA 2CKBL 1YZZA 4O02L 3T8XA 4OFPA 5LQBL 3TBYB 3N1FC 5KW9L 2XWTA 3C2AH 2RQ8A 3B2VH 5FXCH 5SX5K 1C08A 3QUXA 2X4RB 2B4CC 4WU7A 4P9HH 5GRJL 2RFXA 3BRFA 4H26B 3WS6C 1CWVA 3RTQC 1ZOXA 3ULUL 4NGHL 1X5JA 4CL7A 1LQSR 1VFAA 4G42B 3ZTJG 4U1HA 3MROA 3NACH 4HIJB 5HGHB 4Y0GA 4M7JH 3QIWC 5I76B 4P2CG 1CDYA 4ZD3L 3K74B 5M95B 4KDTC 4LCWE 4NKDB 5E2VL 1HNGA 3V0VB 3BHBA 3T2QA 4IOIA 1I7UB 4RAUB 2BJMH 4BZ1L 2PO6A 4UT7L 2FX9L 1WWBX 3FAXA 5DD6A 1JZ6A 2YD7A 3UYRL 5IFHL 2QSCH 2QADC 1IFHL 1MJUL 3OKKB 3TEUA 4YGVA 5L2KB 5FYKL 1CGYA 4G8EB 1DBBL 4M62L 2J8UB 5IB4B 5IB1A 5EIVA 4NQXB 2GK0A 2Y25A 2ZOLA 5IR1B 1KB5L 1X6LA 3HI5H 1NCWH 1MIMH 1JYWA 2Z9TA 3L3OA 4H88L 2FJHA 1TJGH 4FQXD 3H3PH 4LLYB 5FM5M 3BZDA 4MD5A 4GG6E 2C9AA 3BOVA 2W0LA 3JWDC 1T1WB 4KJWC 4AMKH 3HAEG 4XPFH 2B1HL 2UZIH 4LVEA 3RX5A 5BV7L 3PQYD 4I18B 1K5NA 3MLXH 5J7CC 1T5WA 4OQTA 1P6FA 4ODHL 1KENL 3AUVA 4IEFB 1I8IA 3UYPA 4QOKD 3KPTA 1A3LL 3DURB 3SKMA 5CEZL 1VFAB 5I18L 3QG7L 1QP1A 2LAGB 2OXGA 1AGDB 3QNXA 5EU4A 4PJ5B 3BP4B 1MI5E 5D7LE 5I8CA 5MEND 1ZANH 1XCQB 4IJ3C 5BVPH 2EZ0C 1XF4A 4POYA 1EMTH 4MXQD 4LOUC 4PJBA 5DC9B 4ELKB 3V8CA 4BQCA 4K3EL 5ADOL 4JZNB 5AZ2L 3O6FB 4LPUA 3MNVA 3CLFH 2FR4B 3QP3A 1DCLA 1KPVA 2UZXB 1G1YA 4U3XA 4PJCF 1UC6A 1ULVA 3T0EC 2QQNL 4PJCE 5AWNL 5F7EL 2VQ1A 1VFBA 3WFBL 3LH2H 4Y19E 1BQLH 1XGYL 5D7LB 4HUVB 1I85A 5E6IC 3VCLB 4XNMA 2EEBA 3MOAH 1QA9B 5HYEA 1J86A 3QUML 3SO5A 2J1KA 1YY8B 2P8MA 2NLJB 3HRZA 5KSBA 4KRMB 5FF6A 1P5UA 3PWNB 4YHYB 1ND0B 1TQCC 4JDVA 4NO0B 5GS1A 3DECA 4PJDA 3CCHB 4PJDF 4QRPB 3KPQB 3T04D 3WE6B 4NKQB 1BZ7A 4Y2DC 4HX1B 4I1NB 1QRNE 3QPQC 5F1IB 3ARBA 4X80H 5GRJH 1I75A 1XAUA 3T3PF 5BXFA 3ZKMD 5T1KB 1QO3B 4K7PH 4GG6F 5FM5O 4PJ7E 4OF7A 1XR8A 4RX4A 5BOPA 2F5AH 4JE4B 4BZ1H 1DN0B 2ICWJ 1NEZG 4WENB 5HYSA 3GUTB 4NC1E 3TBVB 5KSAB 2BNUA 2ZCLH 3BEWB 3ALPA 3DYMA 3LN4B 4N5ED 1QSEE 2JCCA 4R8WL 5T5NF 3O2VL 5T5FL 4RFOH 4YGVB 2A83B 3SOBL 5TQ2H 4GG8A 1DFBL 3HN3A 4OCMC 3MO1A 3IU4H 5I73B 5GSRB 1P4BH 4L1HA 3BKML 2DQHH 2J7LA 2Q6WA 4TSAL 3BPCA 1LILA 5DQJA 5DD3L 5B8CB 4DZBB 1I3GH 3RUGF 1U8PB 1UZ6E 5CD5C 2XN9D 1MJ8L 3N1GC 4ONGL 4Y2DD 1P7KB 5SWQA 4I0KA 4NRXA 2LQRA 3A6OA 1INQA 2EDFA 4LPCA 4RMSA 4AZ8A 1YEJL 2R1YA 3ZHKA 1FIGL 3FB6A 1SBBA 1G0XA 4JFFA 1QHOA 3RP1A 3QNYA 2GTWA 2BXZA 3MBEB 1XCQA 2CUHA 5EBMB 5MEPA 4FS0A 1LK3H 3UTQB 4M1CD 4JM2F 2VXQL 4HDIA 4G8GA 4Z18A 4NSKB 3SDXB 1BPVA 2X2YA 3EYFA 4MCZA 4P3DA 2FRGP 2JJSC 4U1JA 2GJ6D 3SBWA 3EFFB 4OLEA 2XIDA 1YEKL 2FJGB 1OTSD 4A6YL 4O9HH 1IAIM 3GB7B 2ZUTA 2Z92A 5CGMA 1G9NC 4D0CA 5C0AD 4BQBA 5SX4H 3UCRA 1HINH 4ZSOA 2HT4D 3ECBB 3FT4A 1NFIA 4HFUL 5C0EA 3K4AA 3QCVH 1MRFH 3WXVL 1UA6H 5I1GH 1TQBC 5E9DB 1EHLH 4O2FA 4WI7A 2JB5H 3V5KA 5FGBA 3CVHB 3QULB 5HY9B 1YUHA 1IT9H 4XP6H 3OZ9H 4YEFA 5EN2A 3BN9C 4MA7H 2Y5EA 3IDUA 2QR0B 1CD1A 4XPAL 4NQEB 1RJYB 1TPXB 4ETYA 1S7TB 4AIZA 2VWEC 5BZDB 5GSVB 3VE0A 3PQYE 3RBSA 1VDGA 4PGJA 2J6EA 4ALAH 2KH2B 1PQZB 1X5XA 1AXSB 2X4SB 4OIBA 4F7MA 4TUKH 1XF1A 4XC1H 3KPLA 3ZKND 1MRFL 3WXVH 1MCLA 1K3IA 3WFEL 5JORB 1HDMA 2BOBB 5DD5L 3GHEL 3I75A 1T2JA 4G8GD 4HWEH 3GMNA 4N5UA 3ARRA 4WNQA 2HWZH 1AFVL 2BMKA 1BAFH 1CDGA 4YJZL 3TV3H 4TNVF 4ODSH 1FPTL 3RGHA 3T0DA 3O4OC 3V52L 3MO1B 5F1NB 4OLVH 1NC2D 4JPKL 1TLKA 4PRHE 5BS0D 1JPSL 2E6PA 4UUJB 2C3VB 1PFCA 5HYFA 3OX8B 3VFWA 3LRHA 4ZNCD 5EUOA 4D0BB 3L5HA 4K2UL 5JNYA 1R3KA 2V2WB 3V5DA 1N59B 4M8QA 5F9AC 4NHUB 3U30B 2NXZB 3U4BL 5LJYH 2ATKB 2UYLA 4K8RH 4FQLL 5E2UL 3JVGC 2X4TB 5GGTH 4D8PA 1U8JB 4PRHB 3IDJA 5FO9A 3KLDA 3RI5K 1WZLA 1QFWL 2PTTA 4DGVL 4WCYL 4U1MA 2Z93A 4BSJA 3IRPX 3VWJD 3QUMA 5HI5D 1AXTL 1QRND 4MJ4A 3RL1B 4JFPB 5ETUB 3OWEA 3S36X 1JE6A 2MFNA 1RZIB 4UT6L 2GSGA 1UM4L 5I1HH 4ZYKA 1Z5LB 3R8QA 5HGDB 2BNUB 2CRYA 1RFDH 5I2IB 4JFFE 1MAJA 1CT8B 4R96B 1KGCE 1IM9B 3PL6A 1RK1B 3PGFH 4XH2B 5E8DH 3S3PA 2BSED 2HG5B 2WWKT 2Q8BH 1CIUA 4HWZA 5JOFB 2RBLA 1KTLB 4M7LH 4MJID 1QSED 1S7WA 5GGVH 2VLJA 2Q6WB 4CVWA 4LCCA 3STZA 3WIIL 5I71B 1ZLUK 5EA0H 1NFDA 3EO1B 3FL7A 3OKDB 3BH9B 3O0RH 4XAKE 2AXFA 1SHMA 2B7DT 1P9MA 1AGFB 3TO2A 2J4WL 2GW5A 4G6KL 5MHSE 4HHAA 2AJYL 4PB9H 3UC0H 4I77L 4X4YA 4WY7H 3BKJH 1FL6A 2QHLA 5BO1L 4KTDL 4XCYA 4K7PY 3HG1D 2XFXA 1CICC 4CUCA 4UDUB 2OM5A 2P5EE 3AS1A 5J1AB 1DBBH 4UQ2A 5HDBE 2EYRB 3MFFA 1SY6L 4X5WB 1YN6A 4AEIH 1MCWW 2DN7A 3MYJB 1GCFA 1UCBL 4NFCA 4FTVA 2AEPH 1RHFA 1TZIA 4NUJB 2VQUA 5F72S 3VWJB 5GPRA 4JHWL 4NQDE 4DQOH 3HE7D 5HGDA 5DEFB 4WFFE 5EOCJ 4EUPG 1N8ZB 2VQTA 2UWEE 4D9LL 1LNUB 5CEXA 4HAFA 4HKXA 4B7IA 3EJZC 2HFGH 1LDPH 3IU4L 5AZ2H 4K3EH 5EU5A 3LQAC 2VXSL 4PD4J 5LGKA 1U2CA 2X41A 2VLJB 4L3EE 1T1ZA 5F7HA 4EKXA 4PTUB 3QWOA 1S8DB 1A6ZB 4K23H 3WNPA 3DMMB 3D48R 4NM8L 4NHUA 2OTUB 4LIQE 4PJCA 5CJOH 1YNKH 5HGGS 1MFCH 3UYRH 3HZKA 3L5IA 4KKCC 3UO1H 1SMOA 4N8VB 1U3HD 3WS3A 3MRGA 1F58H 4JO4H 4JB9L 4U1IB 1RZGA 1CYGA 3I9GH 4XI5D 2CGRL 5D2LA 1KJ2A 4M93B 4XZUB 4U7SA 4Z7VE 1TMCB 4H88H 4Y8AA 2OJZH 4LSPL 1UJ3B 1SBSH 5FKAA 3ZKXB 4KVNH 1N59A 4O4YH 5JZ7C 1MCNA 1L9MA 4G6AD 3SE4C 1Q0YH 3IFPA 1QFPA 4U6VL 3W11C 1MCPH 3QG6A 4EVNB 3T2NH 1B0WA 1ZMYA 3WKMH 3RZCD 1ZVYA 3CFKB 1EEYB 1IC1A 4S1QH 3N50A 2HT3C 4NNPH 4LSSL 3KPNB 3BGMA 4HW6A 3W82A 3O11A 3AS0A 4X5XB 1YPZA 1OAZH 2OR9H 4H5SB 2J8UF 3IAQA 4GAGH 3PWVA 4HV8B 4XBEL 2GTZA 1N3NB 3L9RB 1B6UA 5EO0A 3IAGC 1WCBB 4NKDA 3V0VA 5IV2B 5B38G 1JUFA 4YBLC 3A6CH 4K7FB 5GGUA 3QEQE 4M6NH 5CSGA 2IWGA 3L3HB 3HZKB 2GCYB 1DR9A 1J12A 2A6KA 1IQDA 1U3HA 4JFDE 4F3FB 2M1KA 4HUXB 1CFBA 2X40A 1S9WB 4WI3A 4PRIE 4HGMA 4PLJD 3X13B 3BZEA 5I6XC 3VMOA 5ITFA 1ITCA 3P77B 1T83A 2WQRA 1NJ9B 2E7LA 4NRYA 4HS3A 1MWAA 1QFHA 3KPMA 1LK3L 3V6FA 2Y4SA 4EN3D 4Z8FH 3OKDA 1JI1A 2ID5A 2I07B 5IBLC 4QTHA 4BQ8A 1HE7A 5CJ8A 4JFDB 3ES6A 1MFAL 4XNZC 4WHDA 1KN4H 3X14A 4CVXA 4KTEH 3D39A 5IHZA 1RUAL 3U48A 2XTJD 3MXVL 4MNQB 1R3LB 4ZDHA 1LEGA 2DM7A 3BSZL 3FCTB 1P1ZB 4Y19B 1D9KD 2DTMH 1X44A 3Q6FA 4Z7QE 3NMEA 4Y16B 5DJZB 5GISL 3FQXA 4QRSA 2CR3A 4GBXB 4FQQB 1X5YA 3RL2B 3RA7H 1BVKB 2YSSB 4JFPA 3DJ9A 2C3HA 3T0EB 3E6HA 2YA1A 3QDGD 5L0QC 1NBZB 4NO5A 1J8KA 3UXFA 4S10A 5GSRA 5DI8A 1Q9WB 1E6OH 5D4QA 5EO1A 5CJXC 1TXKA 3TF7C 2ZKHH 3AY4C 5IB5A 1JF1A 3ROLA 1JGUH 5C08E 1ORSA 1UKTA 3ETBF 4Y7MA 2BFVL 2F5BL 4RISL 1UZ6F 2NTFB 4LLVB 5HGBB 5DUBA 4FXLA 5CEZE 4ODTH 4M7KL 2P7TB 3D0VB 2IBBA 5GRVL 4ZPTA 3ZL4L 4N68A 2PUQT 1JHLL 5DA4A 5HHVL 4H1LG 2I26N 5H37G 2E9WA 4AIXA 4HJGA 5CAYB 3AMKA 3MRFA 1FAIH 1PDKA 1BECA 2YD1A 1QLFB 2YS4A 1UYWH 1WIOA 4HC1A 1Y6NR 1YN7A 1IQDB 1L7TH 1QVOA 4Y16A 3DIFB 1NCBH 3NFPB 2JJWA 4XCNB 4UTAL 3OHXA 5L2JB 3H6JA 4WFEE 1LE5A 3G6JF 1MVUB 2EDKA 1UH2A 1AD0A 4YHZH 2H2SD 3LQZA 3CAFA 4L4TA 3KLAB 3FTGA 1A6AB 4XCEA 5TQ0L 3MFGB 3Q2CA 3I6KB 3HPLA 4MQXC 2H32A 1DQLH 3VMNA 5I30H 5D1QC 2AS5M 3D85D 1SJHB 2EH7L 3MTRA 5DUMH 1RZJL 4LKCB 4UTBL 3E6FA 2WBJB 5HYIA 2NY4B 2V5TA 4L4VB 4FZ8L 2B0SL 1F6AB 1ZGLP 4PRPB 1N26A 3CFKA 3MLTB 1AI1H 2R15A 1KELL 1ODAA 5I1CL 3W0WA 3ARXA 1BZ9B 1F4AA 1AXSA 1JGEB 1NC4B 4RZCB 1R5WA 2NR6C 1IILE 3HLAB 1MCEA 1U8LA 4OQTH 2GQHA 2JJSA 2O5ZH 3D85B 2XICA 4QRQB 1URLA 4MXVF 4OLUL 1DQQA 2HFEB 2EYSB 1A6WH 4I2XE 4F7CB 3BP5A 4Y5XC 4I0PA 2R4SL 2VR4A 4XP4L 5I8KL 4XZUA 3QUXB 4WU7B 5DZOA 5GGRA 1KXVC 3AFLA 1XIWB 4X6DB 1NBVH 4KHXL 4I3SL 3MSPA 3HS0B 1U3YA 2AI0H 1KB9K 4NBZB 1IC5H 1WCQA 2P47B 3QXDA 2JF1A 1UCBH 1NCNA 1E4JA 3F62A 2CMRL 4WV1A 4N9GA 1J7VR 3V6OE 2EIZB 2YUWA 2R69H 1J18A 1FFNA 4OV5A 4KUZL 5K9KA 1QFWM 2KDGA 2HJKA 1DQMH 4MVBC 4LSQH 4JPVH 1RHHA 3IFOA 1AP2A 4PG2A 2F54E 3VFOB 1BFOA 1PZ5A 2E6JA 2EIEA 5GRYA 2FIKA 4J4PA 4WW1B 5D1ZD 1C5BH 1CU4L 4PJIB 2PCPA 1K8IB 2CJUH 2XWTB 3OJDA 2CRIA 1FBIL 3D85A 3JV4B 4M6MH 2UUDH 3CDGB 5DD5H 1MELA 2PXYD 4P2OB 1HHGA 4YEEA 1BJ1H 3K2MC 2XA8H 1YEEH 1T22A 4D3CL 3KXFB 4IMLB 1NGWA 2XPGB 1Z6JT 5TQ0H 4F58H 5IBUB 4GAYB 4X7SL 3W9EB 3C9NB 3GMMA 2C4FU 5BQ7B 1V8HA 5E2TL 3ZMRA 3CLEH 4JREC 3PWUB 4XVTL 1UKQA 4OGYH 5GZOC 1OSPL 1QSFB 4MA8L 2VDKH 3MRKA 2Z31A 4JR9L 3WEXB 3ULUD 1ORQB 3QQNA 3QQ9D 4O4YL 5F9WC 1NKOA 1RIVL 4JDZB 5HDQL 3BH8B 1VB9A 4BZYA 5DD3H 1EBPA 1ED3A 4MVBD 5A1AA 4ETQA 3M8OL 2VDPH 5FGBC 5MEQB 3S6CA 3WFDL 2YKLL 3PF2A 2XV6B 2EYRA 1NGXB 4MJ6A 5DMGD 2R2CA 3CH1B 4JDTH 4LFHG 2V7NB 4MAYC 5JPNB 2Z8VC 5IMLA 1FYTE 1RZIA 4ERSL 1EFXB 3PWPD 1FBIH 4PJAE 3QB7C 3QR2A 5T3ZE 2NY0D 4F57H 3QO1A 1BBDH 2AGJH 1NBZA 4O58H 4OCRL 5SWSA 4OBRA 5KSBB 5KW9H 4IRJA 1JZ2A 2H32B 4P0DA 4IRJD 4PTTA 1KN2L 2A6DA 2OI9B 3LS4H 1DL7L 3TN0D 1GVIA 1RZ7H 4WHCA 1A4KB 1YMHA 5DO2C 1X7QB 4APQB 4NO2A 5I15H 4WDIA 2E3VA 1EXUA 5HD8D 1B6DA 1R3HA 3QEQD 3PWPB 3AXLA 1TENA 3MRIA 5B3JF 1QO3A 3IB4A 1EGJH 5JLZB 5C0JB 4QOKE 5GGVY 1IEAA 1QKZH 5H8DA 5J56B 1YEIH 4FTVE 2Z31B 1M7XA 3CMOL 3TO2B 3TPUA 4I2XB 4WO4A 5CJBA 5EU4B 4NN5C 2O5XL 3RAJL 3BXNB 1MJ7L 2F8VA 1L7IL 1Q1JL 4HT1H 2J2ZA 5FFLA 2FECI 4NJ9H 3T2OA 3VXSE 4EBQH 4QHUB 4Y5VC 3HUJF 4FQXA 5D7JA 3B43A 2DQGH 1S7SB 2IEPA 1DTUA 2JB5L 3QAZB 2EECA 1T6VN 4S0SD 3RY5A 3UPCA 1JGLL 5KS9E 4JLRA 5GZND 4N0UB 2CJUL 4N0FA 5D2NA 3IJYB 5C0CE 3RVTC 3S5LA 3FQUB 1U6AL 1ZGLB 1YUHB 4N8VG 4XB8A 5FECA 1KCRL 2DQDH 3NAAH 4HWUA 2HJLB 5FM8A 2A6IA 1V3KA 3OKMB 2ADGB 3R0NA 4HZLA 2NW3A 4ZG1A 4DN3H 1FC1A 4HXAH 2OZ4A 3SGEH 3O8XC 3WNLA 5EIIA 5DJYA 3MZGB 1NAML 4NC2B 2OL3A 4PJ8B 3W81A 3O8XB 2DQFA 3WJLC 3VXRA 1WK0A 3BD4A 5HHNA 4PRPE 2Q3ZA 5KSUA 2EDQA 4HPOH 4PJXA 4PJEF 3TO4C 3K2UH 2NY1C 1KCKA 1QBBA 5C86A 1KCSH 4KJPC 1WEJL 1CLYL 2DRUA 3GB7A 5LGJB 2IPUG 1KOAA 2XYCA 3V4UL 3S88L 5CEZD 4RNRB 4OI9A 2F53B 3VWKB 2FX9H 3KYNB 4L4TE 3L5XL 3RNQA 2KPNA 2BVPA 2AK4A 4LASL 4YDIH 5FO7B 4LLDB 3KYMB 1KT2B 2IQAB 2C1PB 3TNNA 1B90A 1HSAB 4P2OC 4F7TA 1XGPB 3KLSA 4ORGA 4UV4L 4BFIA 3WUWA 4HS3B 1YECH 3RJQB 4IRSB 1VGEL 1INQB 1HXMB 4JQXA 1DBKH 3HKFA 4LCUA 4P2YA 4LLQA 5IB3B 1VERA 3QDMB 2ZUVA 4Y1AA 4JFFB 5SWZE 2VZUA 1ACYL 3QPQD 2W1NA 3LKQB 2HT3D 1QSZA 4P99A 2FHCA 1M71B 4NKMB 4N0YL 4N1CA 2QQKL 1GGCL 1HKFA 1U95A 3ZT6A 2H32H 4ZOBA 1RUPL 4PJ9C 3MPCA 3WHE0 5F3BB 3GK8L 25C8L 3IAPA 2VLRA 1J5OL 2ICWB 3QHZH 4HSQA 4JRYE 3I50H 1MH5A 1PY9A 4IDJL 3BUTA 1DZBA 1CE1L 2UWEA 4GO6B 5L6YH 2FNBA 1BD2B 3V4PL 1TPXC 3IKCA 4KK9D 4ZUUB 1NGZB 4U6YA 3CFDA 4GRMB 4PJ9A 1IFHH 1MJUH 4N0FB 3OHXB 5L2JA 3VRIB 1CFNB 3O3AB 1IAMA 1RIHL 3VFTA 2ARJA 2NZ9D 3MA9L 2ICES 2H45A 5IFAL 2BDNH 4PLNC 3MJ7A 3KGRA 4O51A 5F44A 5JOPD 2SEBB 4MAUH 2EDBA 5ID1A 4OCSL 3FN9A 4TUJA 2FLRT 4WU5A 4AT6A 2YMXH 1I3RB 2DYPA 2VDKL 3B2UD 3K8KA 2N7BA 3MRPA 3RQ3A 3CVHH 1QKZL 1YMHB 5FYJD 3H42L 1WFTA 3T3PE 5MEPB 4FA8A 2VSDA 1AD9B 3DNKA 1Y6KR 4GQPH 2WM0A 3PHQA 4B7LA 1I9JL 3GSNB 2CDGB 2I27N 3ZE0E 1X5ZA 1H3TA 1INEL 1IEBA 4M1DL 3BYTA 1JNHA 4CBPA 3X3GH 2IAND 1MCQA 4P2QD 4DGYL 4MX7A 3T0ED 3BZFB 4W4OA 5I1JH 3GSWA 2V7NA 4JVPA 4K9EH 4OCRH 4Z0BH 3S88H 5F6IC 1SQ2N 4ZNEA 3TVMD 1TZGL 5EU6E 5F3HA 5CJ5A 5IBLD 3SQOL 4AMKL 1G7MB 3S3SA 5FO8B 3TJHC 4M6NL 1M6OB 5T3ZD 4M61A 1A9BA 5DQ9B 1G7IA 2NY5L 2GI7A 5KVGL 5CKAA 3QIBD 1G9MH 2ARJQ 5I1LA 1DQDL 1G7PB 5E4EC 2F54D 4PLJC 2NLJA 1A4JA 2Z8RA 2W60A 4ONFH 5JR1H 2NY3C 4D8PB 3LS4L 1AH1A 1CXKA 3MLZH 5IHBA 4EDXA 1U8HB 1CGUA 5EU7C 3MCKA 5I73C 5FUOL 4MNQE 3QFJE 5KSVA 1S78D 5JLZA 4Z7VB 2H8PA 4YH6A 1GC1H 1MVFA 3DV6B 1ZV5A 1IJ9A 5DVOA 4NKOB 3BKYL 3MV9D 3TT1L 4NKIL 2GSGB 2DIAA 5IW6A 1Z3GL 5J12C 1XF4B 12E8H 3D87B 1SBSL 1MAKA 1D5IH 3ZDXE 3QISA 3HB3C 5M94B 4MB5A 3QA3A 4Z7WE 2X89D 2DB8A 3QFJA 5JHLH 3MODL 4KV5E 2F19L 1FH5H 5TH2A 1KCLA 3B9VA 3ZTNH 1ND0A 4R4BB 4LCCB 4L3EB 3O2WH 3SKNB 4JPKH 1UWXH 1K5NB 1H8NA 1ZHNB 3X11A 3L3KB 3U46A 2X10A 1MFDL 1MHEB 3TV3L 3U0PB 5EORH 1ZHLB 5HXMA 2ZUSA 4EUPH 4OAWB 4M3JA 2ZNXA 5HHME 3X3GL 1DQLL 5SX4I 5I8CB 4OZ4A 3W2DL 3Q0HA 4PRDB 2A0LC 4FFWC 4C55A 3ULVD 3GSNA 2FWOB 4JZJA 1RULL 2AV7A 5J6HB 2NY2C 4CMMA 4N90E 3WS3B 1AD9A 1ORQA 1C7SA 5GS2H 3LKNA 2AAVA 5JHDD 1XGQB 1KLGB 4J3UA 2AQ1A 3QYCA 3O6FC 3QH3B 3SDCC 5IQ7L 2VMFA 2QEJA 1U95B 4X6DF 3HPJA 4UT9L 3HNTH 1BQHG 3CK0L 3IT8D 4J8RB 4MNGA 2CQVA 2VLRB 2H26A 3C5ZD 5DMGC 4KRPD 1WC7A 3ARED 2AEPL 1QPXA 4L9LC 5LAXA 4ONFL 2ARJB 5JR1L 4QHNA 1QD0A 1R5VA 1A6WL 2CKNA 3HS0A 1TZHA 5JQ6H 4S0TD 4NQDD 3V5HB 5BMFH 4RFOL 2N56A 3DVFA 1F8TL 1BVLB 2IQAA 1KCVH 3CVHA 2YRLA 2QV2A 3T1FA 1NDMA 3SHSA 3VXTA 1KNOB 1HILA 4NQTA 3LEVL 1IC7H 4NQCE 4CNIB 1RURL 1YPZF 2WIIB 3UTSB 4NHCL 3NCFB 1RUPH 4BYHA 3P4NA 3P0YL 5EA0L 3V7AG 4OV5B 5ENWA 4DVBA 1IGML 4GMSH 3BT2H 5D70L 5IBUG 5ACZA 3FQRA 3FFCD 3UMTA 3W9DB 2J5LC 2BNQA 4KXZI 2BK8A 5DRZA 4KJYA 5CBEB 1MCFA 5DEFA 4QY8A 3EYFB 5TH2B 1KIRA 4BH8B 6CGTA 5FUZH 1A9BB 1IGJB 3QIWB 4M7LT 5DQ9A 5JW3L 5ESAA 3QA3B 3ZKXC 3UBXG 1QFOA 1Q9LB 1JK8A 5B39G 5K9OB 5AYUH 2HRPL 4QWWD 3SGJC 2JCCF 5EU3A 1CFTA 1HSBB 2YD3A 4TNVK 4FABL 3VFGL 5BJTB 1GYAA 4DGVH 5C2UB 3LV3B 5C0DA 5DJAB 5DD0L 1FZMB 5DZNA 1GAFL 1KCSL 3AM8C 5A43C 3S34H 1UVQB 4LCWB 4PREB 2J6EL 3IXAA 1UACL 3FONA 2BRRL 3L6FA 4P57B 2NY2B 4KGJA 2R4RL 4UILH 3VFPA 1S7XB 3HE6A 4ZAKA 5B22A 1BGXL 5FHBL 3WIFA 1F6LL 4F8TA 4FFYL 2BNRB 1YEDB 3UP1A 3KPSE 4FQ2L 4H25B 5F1KC 2PXYA 2ADGA 3VXMB 1OF2B 2CKBH 4KK8D 5EU7E 5EBMA 1J9CT 2BSSB 5BV7H 1U8MA 1T21A 4RIRB 4Z5RB 2L4OA 1KIQA 3FFCB 1YEHH 4GQ9L 4WW2B 4XI5C 1MNUH 3G6AB 1VACA 1VGKB 4C54A 1DJSA 3SDAA 1AIFA 3GNML 4LEXL 4Z76B 2VUYA 1U91A 4H8WL 3WMSA 3PABA 4PRID 1ORSB 2P5ED 2ATPB 3U83A 3PDOA 4OD1H 1CCZA 4QWWC 1IGFH 1MHPL 3QO0A 4GSDH 5EUOB 1MJJB 1F3JB 4XWGL 3RY6C 5EU6D 3D2UD 4DOHE 3KPOB 2X7LB 2I5YH 5I0DA 3JV6A 3D2UA 2MQ0A 3CFEA 4F7EA 3QHTC 2FSEA 3RVVC 3SCMB 2CUIA 3T2NL 1I8LA 2C5DC 3FO1B 2CSPA 4HLZH 4HUWA 1FFPA 4MNHB 4OKVB 3QIBB 4U1GB 5GRXG 5KZCB 1A1MA 2XTJE 2NY6B 5FYLE 3SGKA 4NFDA 1YY9D 3D0VA 2GJZA 4JRXB 3HUJB 3VXSA 3HAEH 2AP2A 1NFDF 3BE1H 4ZAKD 2Q8AL 5E8OA 4KK8C 5J4MA 3MV7A 5HHMD 5E4EB 5F7LB 5GHWL 1HH9A 4HUXA 3VDBA 5TE4H 1NMBL 5DS8A 5CSZA 4CN4A 3QUYB 1U9KA 2BY2A 5I16B 1HXYB 3LCYA 3DX8B 1JV5A 5ID0B 4LAQL 1DQJB 4GJTB 5D7JC 3DXAE 3RAJH 3FB8B 1E4KC 4NO3B 1D5ZA 4MQ7B 1AQKH 1NSNL 4PJAB 1JZ4A 3TN0C 2J8UA 5JA8B 4E41D 3CK0H 3WO3B 4P46A 1Q9WA 4PBVC 1FL5A 4F57L 2GITA 1LK2B 4LGSB 4LQFL 2MQCA 3BX7C 4N0RA 4JFQA 2BC4A 3H3PL 4L4VE 1JGLH 5IIEA 1W8NA 1JMZA 2NY0B 1MFAH 2UYLB 1JNJA 5E9DE 1B0RA 1IGTB 2H9GB 2HFFA 3OPZH 1EPFA 1MUJA 3GMRA 3SY0A 1N5AB 3V5DB 4YWGL 4J7RA 2CLZB 3O8XA 5JTWA 4NDMB 1JZ7A 3WNMA 2R29H 1MCPL 3QZWG 3RWHA 1NAKL 3MUGA 5D2LE 1FYTA 1JPTH 1UFUA 2PW1B 4EN3A 1FSKB 4P5TC 1ZLSL 1X6NA 3O9WA 2EXYC 1MF2H 4ZUSA 1ZVHA 2F53A 4PY8I 5EZJA 5DHYB 2P4AB 2H6PA 3H0TB 5D1XB 1UADC 1JZ8A 3QUKA 2VUOA 2DLEA 3BD5A 5JQ6L 3HC3H 4MDJB 3O4LA 3WFDH 4OD3L 4ZOAA 1LP9E 3RA7L 3VWKA 5I15L 3MOBL 2X1PA 4JO1H 4U49A 5L9DH 3WL9B 3QNZA 5ALBL 4MJIB 4YHLL 4O9HL 1EUTA 4LK4A 2BOCA 3CFDB 4GRMA 5DLML 1UJ3A 1YQ2A 2VDMH 4RMUA 3MLRH 5EOTA 2XTLA 3CVIL 5EPMB 1T1ZB 3MRQB 3RZCC 3NBNA 5ERWB 1AR2A 4LSVL 4NM8H 1DLHA 2FL5B 4QF1B 5E8PB 2VH5H 4NRZB 3LAFA 1D9KA 3IFOB 1N3NA 3GO1H 3UZVB 3IDIB 5BS0E 1WZKA 4XP9L 3D25B 3HLAA 3QFDA 5IF0B 5JO5B 3SE8H 1OAKH 4X6BB 2X4QA 4YHOL 3BD3A 4MMXC 4PP1C 5I16A 4KQ3H 1KC5L 5F8RC 1UXSA 4N1HB 2VDQH 5HVWA 3GSUB 5HVHB 1T03H 1RIVH 3FO0L 4LSRL 4I5BA 3UO1L 4JN1H 1AO7E 3LKRA 4NM4L 3UBXB 4NSKA 3FOLA 1EEUA 5C0IA 2QQNH 3FN0H 4XPGL 4PTTB 1RUQL 4ELMA 5CFHA 5D7KD 2DAVA 3SPVA 2DQEL 4QYOB 3AS2A 4LCIH 3STBA 1QACA 4R4FH 4AEHL 2ZG2A 1NC2B 5I8OH 3SCMA 4CMHB 2FEEI 4X7SH 1MY5A 4P2QA 5JW4M 5ESVA 1YY8A 3OQ3B 3UPRA 5C08A 5JHDE 1HH6A 4NQEE 1T3FB 3SE9L 2FX8H 3CPLB 3QDHA 3U7YL 2VLRD 2KKQA 3BP6A 4LMQI 4PD4K 1RZ8B 4NDMA 4FABH 1P7KA 5SWQB 2YUZA 3O0RL 1DN0A 1C12A 3MC0A 5T3XH 3O9WC 1A1MB 2MHAB 5JOEA 2CKBA 1LO3H 5DJXA 5J6GA 3GJEB 43CAB 1HCFX 2B5IC 3JTSA 3FKUS 4XGZA 3EIFA 2GUOB 5INDB 1ZVSA 1ZKAA 2J88H 3ZYZA 1AC0A 2D0GA 1BFTA 5JDSB 4HPYL 3QFJB 5GXBB 2UY7A 4HMEA 4RFNC 5ILTH 3QAZC 4F80A 4P23A 4IMLA 4JFEA 1TCMA 4HWNA 1S7QB 3U0TB 3SDAB 3QHZL 2HH0H 4R2GD 1A3RL 3L1OH 4PJ7B 4OZGE 4H0GA 1QLEH 4ONOA 1C5DA 3ME0A 1TCRB 3BUYB 3IDYC 4R7NB 4N1EA 1O7VA 4N0YH 4PJXE 3RDTB 3V4VH 3WEXA 5GIRB 1UCTA 1Z0MA 3B6SB 2A9ML 3DTXB 4P4KD 4S1SH 1NCCL 2WINB 3WN5C 4HS6A 4PLKD 1E4XL 3O9WD 4R3SA 4KK5D 2XY2A 4DKEL 3EYOA 1INDL 5DUPH 3FN0L 4MJ5B 1IEAB 2ZUUA 1JHLH 3PWLB 4XWOD 4PGCB 5IMLB 4ZFOL 4FP8H 2EC9U 3T0VA 3V52H 2CDFB 3O6LL 3CH1A 2B1HH 2EC8A 2UZIL 3QIUC 5D71L 4UT9H 3G6JB 4DKAA 4AH2A 1G1CA 1FNSL 1JWSA 3EDEA 3VFVB 1JMXA 5HHMB 5J8OA 4FHBD 1RZFH 2V2TA 4H20H 5BS0B 5KG9B 4BQ6A 4X9IA 3Q5OA 5DK0A 2E27L 3D6GA 2C3VA 4TVSa 2HLAA 1LEKB 4HPOL 3UPRB 5C08B 2V7HA 1YDPA 2JLLA 3S4SG 3IDNA 1CBVL 2ITDA 3LPWA 1QSFA 3KPSD 2YEZB 3ZYOA 4D9QD 4PGDB 1HOCA 2AJYH 1S9YB 4AY0A 5IMKB 8FABA 3SKMB 2ATKA 4ZUWA 1SYVA 2P42B 5EOQL 3U7AA 4RBPK 3PUCA 2VXTH 3GMOA 3QZWB 4MA3A 3RUGB 4M1CC 1MEXL 4UT6H 2CKBB 1BP3B 2CK2A 4ZD3H 2FO1A 4XVJL 4OZGF 1LGVA 1W0VB 3QXAB 1LEGB 3MLTA 3MGOA 4M7LL 1NMAH 4X9BA 5C0CA 5KJRL 5E8DL 2I60L 2UV3A 2ZOLB 3GMLB 4UV7H 1U36A 4WJ5A 5I66B 3BIKB 3PDGA 5DHYA 5EWIL 3U1SL 4GRLA 4QRQA 4F9PA 2NPLX 4GOSA 4LCIL 3N85H 1O7SA 1YMMA 2F5AL 5EDXA 4G7VH 2DKSA 4NBYB 5FYKE 3V6BR 4J3TA 5C09D 2DKMA 4RISH 5J0BA 5B8CC 1YNTA 3F58H 3LQZB 4L4TB 2FHBA 3GSQB 4NIKB 1GGYA 2EH8L 4AT6B 3UJJL 3VDCA 1Q0XL 2W92A 2EIBA 4KROB 4X4MA 3QSKB 4R4NC 3MRNB 4LNRA 5E24E 5HI3C 3ULSB 2R2HB 3K7UA 1U8NA 2IG2H 3DSFH 4PYGA 2QADB 1N2RA 3RU8H 5CJQL 5IMMB 4PJFF 4U1HB 1P5VA 5IMKA 1HINL 2H2PD 5TE7H 2BY1A 3KDMA 3SDCD 4TUKL 4EQ2A 2WBJA 5JIKA 4FXKB 5D2LF 1RHHB 1T7WA 4WWID 4U1KB 5EO9A 3P40A 4LHJB 4Z7UE 1OAZL 4Z7WA 1NMCB 1OVZA 3SJVE 1FCGA 4X7TB 3D18B 2IBZX 1AO7B 3QIUA 1MREL 4PUBH 1MRCL 3F58L 4JFFD 2N7AA 4FTVB 2OLDA 4LNVA 5IFJA 5E5RB 4MA7L 4JZJC 3RNQB 2P24A 3IU3B 3NIDF 2ORBH 3OJVC 2HKFH 5SWSD 5DXWA 4OLWL 4OGXH 1CDBA 4GXUM 1MOEA 3VJ6A 4OUOA 1TQCB 2MPAH 1BBJB 4YNYA 1Z3GH 2X1OA 5MERB 5T1LD 1G9EA 2IJ0C 1NANI 5F6HJ 1MFBH 3P11L 2NY4D 5E6IB 1UWGH 1AGBA 1BX2A 4PJ5D 3TT3H 1NCAL 1Z9LA 4YHML 2G9HA 1MF2L 2AV1A 3HI1A 5D7IE 5HHOE 2CUMA 4AG4H 4JB9H 5HI3D 1KFAH 1PZUB 4A6YH 3TZVD 5KSBE 4PUBL 1WAAF 1ZA3A 3UEZA 2D7MA 2G75A 1IT9L 2P7TA 1CGVA 3TIDB 4HKBA 1RZKL 2IAMA 4Z7VA 1NC4A 3VXNB 3GUTA 4ISVA 5HYJB 1DN2A 1UA6L 4AQOA