3IDGB

Crystal structure of the hiv-1 cross neutralizing monoclonal antibody 2f5 in complex with gp41 peptide aldkwd
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
235
structure length
227
Chain Sequence
RITLKESGPPLVKPTQTLTLTCSFSGFSLSDFGVGVGWIRQPPGKALEWLAIIYSDDDKRYSPSLNTRLTITKDTSKNQVVLVMTRVSPVDTATYFCAHRRGPTTLFGVPIARGPVNAMDVWGQGITVTISSTSTKGPSVFPLAPGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLQTYTCNVNHKPSNTKVDKRVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords 2F5 Fab light chain
publication title Crystallographic definition of the epitope promiscuity of the broadly neutralizing anti-human immunodeficiency virus type 1 antibody 2F5: vaccine design implications.
pubmed doi rcsb
total genus 39
structure length 227
sequence length 235
ec nomenclature
pdb deposition date 2009-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3idgB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3idgB01
4DN3L 1F4XL 2E3VA 5E24E 2F53E 4OLUH 5HYQA 1MCQA 1A6TB 4YHYB 5E4IA 1FG2A 4JDVA 1JTOA 1CXIA 2CDFB 4M9PA 2X9YA 4K9EL 4XVSL 1FGVL 1Y6NR 1MNUL 3P4OA 4HHAB 4E9LA 4OKVA 3FONA 3V52L 5I75C 5DQJA 4WFFE 1NGXA 4LSQH 1ZT7A 5BJTA 1J0IA 1F8TL 3VGFA 3MRCA 3ES6B 5DEGB 4Q2ZA 4O5LH 1IZJA 3HC3H 4JKWA 4D9QE 2E6QA 5JA8B 3V5DA 2HG5A 2X40A 4LLVB 1NBYB 1DP0A 2D4FA 4TQEH 3RNKA 4M6MH 1HKFA 5DJCA 3PV6B 5TDPB 3CJJA 5FM4A 4GKNB 2W65A 1T6WA 4S1SL 5E1AB 2AJZB 3WFHA 1SVZA 3H42L 4AQOA 5DK3A 4KUZH 1J18A 3BH9A 3D0LA 5EOQH 4S2SA 4NDMB 3T0EC 4PRPE 3CMOH 2ADJB 3MGOB 4HXAL 3T0DA 3T8XA 1B6UA 2P7TA 5D2NC 3KPSB 4S10A 3FQTA 5CIPA 5FYKU 5DFWH 5L88H 2C5DC 5F88A 1A14H 2OL3H 3INUL 4L5FH 3BQUD 3QQ4B 4LVHC 3PIQB 4EI6A 5ETUA 1YEHL 3FO1A 4KJWC 3ZKXB 1PZ5B 4UOW1 1BLNB 4J7RA 4KY1L 4FOMA 1MCNA 4KJQD 5J56B 4FQCH 1UM5L 5JO5B 4Z77B 1AFVH 1HSAB 2DBJA 4QHMA 1TETH 4X80L 2RAMA 4ZS6D 3ZT7A 1JWMA 3TNNA 4HCRA 4OCYH 2BNRB 4JCMA 2E8YA 2J7LA 2UWEF 1V3MA 3IDJA 4OF0A 5DMGC 4I0PD 5C0BE 2YPLD 5KS9B 5GGUA 4WVRA 4Z7QF 5MERB 2FO4A 1TZIB 1JNHA 3OTTA 3PQYB 1RHHA 2ERJB 4NO3A 3RPIB 5KANG 2YD7A 4PJ7F 1VADA 4PLKD 3RTQC 4NPYA 4F80A 1JRHL 5IF0A 3S98A 3AC0A 3CX2A 2GK2A 4EVNA 5IW6B 3DROA 4I4WA 4GAJL 3SDAA 1S7SA 3FFDA 3DPBA 5BRZD 1UWXK 5EO9B 4BK4A 1EZVX 3AB0C 4U3CA 4B7LA 4H0HB 4HPYH 5FYKD 3JTSA 2GQHA 3KR3L 5E2WH 4NKMB 4TVSa 2IPUK 1MJ7L 5EIQA 5IEHB 3OR6A 1R0AH 1QFWI 7FABL 5GSRA 3VWJC 5A3IC 1AGEA 5IB5B 2Q7NA 5I1EH 2EC9T 4XPFL 5EU6E 3KLHC 1F6AA 1TCMA 4OI9A 5EO1A 1I3RA 4P2OA 2BVPB 1QYGH 1H0DB 5JZ7D 2C4XA 4P23B 3EDEA 4YNYA 2E9IA 4P3CH 3QFJE 1B6DA 5DI8A 5IHZB 4AT6B 1F13A 1P9MC 4M5YL 4Z95L 3X12B 1KGCE 1A6WL 3HPJB 5LXGL 2HT2D 4NN5B 2IGFH 3O4LE 3BXNA 2OBGA 4FQJL 2UVEA 2YMXL 1PKOA 1M7DA 2W60B 3FJTA 5D7LA 4IOSD 5JXEA 1A22B 5EUOE 4AH2B 1C16A 2QKIA 2JJVA 4QRPD 4OZFG 2A6IA 1CE6A 4PGCA 4JQXA 1EMTL 1L0XA 3EYUH 1OP3K 1EVTC 1ORQA 1AY1L 5H35B 5ID0A 4GAYA 1TNNA 2IC2A 2X1QA 5C09D 3MMEA 1U8NA 4YDVA 4O2FA 5C0GA 3H9YA 2IH1B 5L8JB 1U42A 4LCYB 4JFFB 2DD8H 3AMKA 5JHDB 2VH5L 5D70L 2VUOA 2IBGA 3CLFL 4YAQA 3ZDYF 5H94A 1NGQH 4P9MH 5J11C 3BGFC 1H15A 4BFEA 2V17L 2P5ED 4MS8C 4LSUH 4NNYA 5ID1A 4QY8A 1P69B 4OZIF 1CK0L 1V7NH 3WNMA 3MUJA 3FFCD 5GGVH 1YEGH 1IFHH 1JPSH 4WU5A 3Q6GL 4MD4A 4X4ME 3S4SB 4F58H 4HK3N 4Y16B 5T1DH 2OLDA 2VLKA 4AG4H 4XRCB 1ZA6A 2ORBH 2XKNA 3EDFA 4PJ5E 4KK9C 3BPNC 3EFDH 5KW9H 3T0WA 1IJ9A 5T33L 4BH7B 3PP4H 1K6QH 2Q76B 5K9OA 1Q94B 4P5KB 5GHWL 2XZQH 4HMCA 2DIJA 4M62L 2VXSH 4NQCD 3T3MF 3RNQB 3VXRB 3BMWA 4JGMA 5C0CB 2FHCA 5I8OL 4F7EA 3QR2A 1X7QA 3BGAA 1HCVA 1AO7A 5I71B 2ICWI 1FZJA 3TZVA 3T2OA 1ZLVH 3B3IA 2G9HB 1K3IA 3MRNA 2D7TL 3X3FH 1RK1B 4OAWB 3CH1B 3QNZB 3IKCB 4NUJA 3RPKA 1JWUB 1X3DA 4XXDB 3CPLB 3MJ7A 3ECBA 2DJUA 3IJYA 3LY6A 5E99H 1LP9F 1S9XB 4JM4L 5EO0A 5SX5H 4JZOB 5I0DA 1MCBA 3QI9A 2NY4B 1ES0B 4OQTA 4U1SB 1F90L 3LKQA 3JUYA 3CFEB 4O9HL 5KN5A 5I8KH 4F7CB 3F6LA 3QCUH 2NYYD 1P53A 2EIZA 3QFDA 1TZHA 4JFYB 1B3JA 4F37K 2AS5M 3A6BL 2LTQB 4R8WL 2VLME 3GSOA 2CUMA 3VD9A 1UJ3B 1Y0LA 2QQNL 2H6PA 3N06B 3PDDA 2YEZB 1CLYH 3M1BB 2RB8A 1ZGLM 2VABA 3IU4H 2R56H 5EN2A 3UC0L 3KJ6H 4HPOH 3MXVH 1T4KA 4P5TD 1NCTA 1A7RL 3MRPB 6FABL 4ZXBA 3SCMA 4U6TA 1G9NC 5K93A 4X0KB 2ZSWB 4X9IA 1RI8A 1KYOJ 5I6XC 3C6LB 4RRPA 4YUEL 2PCPA 4CMHB 2Y07H 1T89A 1NLBL 1HYSC 2D3VA 3LMJL 5HGBB 1MCHA 4W4OC 2HVJA 4GBXB 4PRIE 4IMLB 4NJAH 4RMQA 5IB1B 4YXLL 1PY4A 3W5NA 1OT1A 1M7XA 1NGPH 3J7HA 4MNHB 1L7TH 5CCKH 3MCKB 4L8DA 4FXGB 3L7FB 4H5SA 2VDRH 1CDCA 5AAMA 2IPTH 3FN9A 1UVQB 2AK4D 1TQCB 4YK4C 4A6YL 1CCZA 2R1YA 2JCCB 2EDDA 1WBZA 3NPZB 4O2CB 1HZHL 2P8MA 1T1ZA 3HMXH 2FEEI 5EPMB 4G9DB 3ZYJA 3OKMA 3BP4B 4YHOH 1MAKA 5JW3L 4ORGA 1IC5L 4W70A 3NGBB 4U6HA 4Y8AA 4G6KL 2G60H 1BVLA 1UH4A 2CIKA 1BBDL 4PRAA 1NKOA 1U3HA 4AJ0A 2MQ0A 4OCRH 5IFAH 5B3JE 1SM3H 3HI1B 4HUWA 1NBZB 3MRLB 4AEHL 1A5FL 4DW2H 5B39B 3RGVB 2QQLL 5EFIB 3GI9L 2LE9A 3L3KB 4OZIA 2D7QA 3TBYA 3DYPA 4GG6E 4I13B 1VGKB 1F58L 1RZ8B 3C2SA 1X4ZA 3MGTB 2I5YH 5DJ0B 4YHIA 5J6HA 3O9WD 1T22A 2G75A 1XZ0A 3OJ2C 4OV5B 3BQUA 3S5LA 2PO6C 1JPFB 3LQAL 2Q6WA 3D6GA 2FJHA 5TH2A 4FABH 1Z3GH 5C6TL 3GJEB 3HC4H 3G08B 3HMWH 5C0AD 2I25N 3QXAA 1UQSA 5IGXL 1MJ8L 2FWOB 2HA1A 1R5IA 1IQDB 1ZGLB 4LNRB 3N1FC 5DMJB 4H88L 3RKPA 1QLRB 2YWZA 2DQTL 2IAMD 1XF2A 3PWPB 5EZIL 2Z92A 4I0PA 3D39D 1DUYA 9CGTA 4F57H 2YPLA 4Z5RA 1P5UA 4JO2L 4UT9H 2EDTA 2EICA 5MP6H 2KUTA 3VGHA 3L3DB 4IRZH 3PE9A 3TNMA 4ONGH 3VI4E 2ADGA 4PLNC 2VDLH 4HX1B 5EU7C 1FVEA 5GZOC 5L2KD 3ZE1E 5C08B 1LP9A 4MAYD 1VPOL 3ZE2E 3P4MB 3TC9A 2GIYA 2OR9H 3LOWA 5FKPA 5BRZA 3ULUE 4UNVA 5FUCC 3ARZA 4BZ2L 3PWNA 3I6GB 2YRLA 2M1KA 3KPSE 4LSSH 1MFEH 5EIIA 3DARA 3P2TA 3MR9B 4S1QH 4X6CB 3KPNB 2OQJA 3GIVA 3WNNA 1OY3B 2AEPH 5DZLA 4GKZA 3LS5L 3TFKD 3BKML 4G7YH 4RMSA 3D1MC 5E6YA 4MJ5A 4AEIH 4ZNCD 4F9PA 3GSRA 3BUYA 1AQKH 2JB6B 1EFXB 1BQLL 2XZAH 5CEXB 4JKPH 1I1FA 5ADOL 4DKEH 4IBLT 5L0QB 2E7CA 5DVKA 5HGHA 1KN4H 3JWDC 3RWJB 1BQHB 2Q1EA 3LDBB 4PBXA 4YEEA 1KJVB 3KDMB 5FGCB 2HTKD 2BNRE 4Z0BH 3S7GA 2V2WB 4U1MB 2HFEB 3OQ3B 4IIQA 5AG8A 4P5MA 4JFXB 2I9LB 3DGGB 3V4PH 4G8FA 5KS9E 5LGKA 2BVEA 1UB6B 1HKLL 1QBML 1C1EL 2HJKB 2IQAB 3HNTL 4ZOBA 3L1OH 3VXSB 2Z31C 2BSED 2GUOB 3PQYE 4K2UH 5JDJA 1R3JA 32C2A 1AJ7L 3V6OA 3U48A 4K94C 4MHHI 5JMOC 1AGBB 1HXMA 3BEVB 1YECH 5I1JL 1XIWB 3BVNA 3EYVA 1KIPB 4WTZA 3TF7C 5ALCL 1NANI 1FVCB 3FQXA 2FECL 2VXVH 3UDWA 1CL7H 4U1NA 1WBXA 4NC2B 5C09A 1HIML 4PJCB 2PYEB 2FGZA 4U7KA 1NC4D 4OSUL 5J3HC 4I2XA 3QWRD 2W07A 3UBXG 3Q48A 2EIDA 4RA0C 1EH9A 1H5BB 2AEWA 1NEZB 2JJTA 2QTEA 4ZTPH 2M26A 4UTAL 4JANA 1EEUA 1YEDA 2A6KA 2P5EA 2B20A 1WVZA 3BPCA 1LE9B 2R0ZH 1R3LB 4JEGB 3WBDA 5CJXC 3RX7A 3RIAF 3B2UC 4CU8A 1U36A 3IYLW 4XMPH 3RZCC 4RGNB 3FT3A 3SDXB 4LGSB 3PWUB 3GJFB 2XIDA 5FOBA 5FV1L 5IMMB 5IB2A 3MLWL 3DX7A 3QDGD 4OLYL 4PUBH 5F3HB 4XPHL 4XCEB 4HKBA 3G5VA 1A6PA 2GCYA 2Z91A 4CN1A 3QG7L 1J8HB 3BEWA 4NQCA 3QQ3B 4Q9RL 2ATKB 3BUTA 3FZUC 5FDYA 1DBAH 4E5XA 4Z78A 4XI5D 4GMSL 5GGTH 5KSUB 3PHQA 1D3CA 2DQHL 3T4AB 2D7NA 4HK3J 1CU4H 1ADQL 1U9KA 3S36X 1FLRL 1NCUA 4IS6B 5DVOA 3FRUA 5EBWB 5CD3A 3G6DH 5HDLA 5B4MD 4JFFE 1HHKB 2W9EH 2CRZA 5EOCL 5JHDE 5IHUL 4XC1H 4PV8A 5I18L 1GCFA 4ODUB 5E2TH 5JLZA 3CFJB 4BZ1H 1U8MA 1N5YH 3V6ZB 1CGSH 2O5YH 1QLFB 1YY9C 4J12A 3X14A 5IG7B 1MCIA 2BCKB 4CN6A 4R4FH 2E7MA 1MSPA 3EUUA 3IAQA 5IJKA 3VFVB 5BVJA 2A2QT 3MBXH 3H3PH 4I0CC 4XCYA 5TFSH 4LKXB 1KXVC 4JDZA 3S34H 1UM4L 4NQSA 2CJUH 4I1NB 3MRDA 4JO1H 4YBQC 1GC1C 4NO0D 3CC5A 3Q1SH 4HGMA 1CTNA 2F54D 4HUXB 5D5MF 4WFHD 3C08H 4YO0B 4P5TA 1IE5A 1J0YA 1RJLA 5FUOL 2AXGB 4HIEB 2E6JA 2C4FU 2E5EA 3EOYG 2X05A 1KLUB 3DSFH 3VXRE 2R2EA 5C0CE 4F7MA 5A2JH 4N0UB 1R3HB 4HCRL 2PXYA 5LAXB 5KVGH 2VDOH 4QXUL 4PS4H 1S9YA 5KSAB 4NUGH 1GZQA 2B7DT 3CVHB 4NZUL 4CMMA 2FATL 4Y5YC 1P7HL 1X6NA 5JOPD 1JNLL 3VXTA 2W0LA 3ZYZA 4C83A 1CDYA 3QUML 4FQHB 4LRNH 1KCRL 1Q8MA 2IPKB 5F1NA 4TPRH 3RDTD 2BVUA 4MHHG 1KC5H 3DV4B 2BY3A 2AK4A 5HYIA 1VA9A 3QCTH 1EFQA 1MJJA 3EOTH 3PL6B 4HIHB 3ARRA 2OSLB 3PWJB 3BD5A 3C5JB 3U1SH 4PJEF 4JM2B 4YHLL 1S7VA 2IG2L 4PYGA 1QPXA 3VA6A 4JJ5B 4YFEA 1T80A 4HQQH 5F1SA 1XEDA 3M45A 3QB7C 1MQKL 4G6MH 3JWOL 1RQ5A 3HC0B 2GK0A 1MVUB 5D7JD 4BJLA 3BH8B 1NANH 1Y18A 4ALAL 2KL6A 3U83A 3CFKA 4Z8FL 4NT6B 1IGML 4NKDA 4HWEH 3X11A 2YKLL 5KVMC 4TVPD 1DBJL 1EO8L 2IF7A 5IQ9B 5AEAA 3L5IA 5B8CC 2GFBB 1I7ZB 3B9KD 3GKZA 1BJ1J 1C5DA 1HH9A 3C5ZD 2JIXB 2J1KA 3FB6B 3U0WH 5T1MA 3WFEL 3O9WA 1DE4B 5MI0B 2H26A 2JJWA 2W1NA 1IMHC 1IT9L 4S0TD 4M7LL 1HDMA 1YYLL 4XHJD 5C0AA 5E2VL 4UDTA 3HZVA 2B0SL 3OF6A 3WJJC 1J1XH 1U2HA 2V2XB 2JCCE 1D5MB 3VXPA 4U1LA 5DTFA 5D4QA 5E4EC 5BV7H 5BXFB 4K3JH 2IAMA 1YN7A 3L3IA 5B38B 3D39A 1I85A 3NPSC 4GAGH 5C8JB 4PB9H 5GGQH 1R3KA 1S8DA 3ZLQC 3ZL4L 3SE4A 4PTUA 3BN9C 4EZMA 3FQUA 1VFAB 5C0DA 2Z93A 3E6FA 5C71A 4OLXH 1H3PH 4OQ1A 3WIIH 4LCCB 1CFQB 5E2JA 5L2KA 4J1UA 4NGHH 4P3WA 1FC2D 5INDB 4MAYA 2EH7L 4LLWA 4IHOB 3FN3A 4RZCB 1DUZA 1E6JL 1CD0A 1U0QA 1KIQA 4G8IB 3GUTA 4JQVA 3AXLA 1KPUA 3DBXB 1C12B 3OAYH 3MROB 1K4DB 3CGTA 5H2BB 4D94A 4YQXL 1S7RB 1NAMH 3WD5H 5D5MA 4ZFGL 1I7TB 1CT8A 3IFOB 1UG9A 5HVHC 2H32A 4OCXH 3K81A 5FK9A 3SKJL 4JAMB 4LQFH 5HI3C 5LGJA 4BSWB 4FQXB 2BXYA 4CDHA 5J0BA 3EFFB 4JN1L 4NHCL 3D2UB 1BZ7A 1AGCA 4NC1E 4G6JL 3SGKC 1CFSB 2NPLX 5CSGA 4ZO6A 2WLZA 2C3XA 3HE6B 3PWPE 3VFRB 1T7XA 1VENA 4LLDA 2NW2B 2C3WA 5I1HH 2C7UB 3MRJB 5C0JB 5HTSA 3OKLA 3LEYH 1S5HB 4JN2A 5I15H 4P99A 1DBKL 1WFNA 5I1KL 3U36A 1X5ZA 3ILQD 1IAIM 4YC2C 1QFUH 4Y4KD 4JRYB 5C08E 1E6OH 3ULVE 4WW1A 4KK6D 1XF3A 1ITCA 5F7FA 4K23L 3P9MB 2V9QA 3TGXA 5IT2H 4PJEA 4H25B 5T1KD 3KPRD 4N9GA 3VW3H 4N1HB 2NY5L 1ZT4B 1CFNB 4W81A 5CHNA 2F5AH 3O6ML 4YDLB 2K7PA 2KH2B 2DBLL 3D25A 3BESR 3C8KA 4X6CE 5CP7A 1NC4A 5IB4B 1RUKH 3L5XL 4M1GL 1HHIA 1B0GA 4WHYG 5JHLH 3QWRA 2C3VA 3QAZB 3TT1H 3U9PL 3GI8H 2XTJD 4GG6F 1U8JB 4HF5H 4FTVD 4OB5H 1IGJA 43CAB 3IS0X 1SBBA 3CMGA 1JV5B 1CICD 3BT2H 3EIFA 1G7PB 1F3JA 4QXTA 5FGCE 1MWAL 2X4RA 4WHYH 1G0YR 3A6CH 3W9EB 3RWCA 4XMLH 2BK8A 1D9KB 1S3KH 1MUJB 1T5WB 4V1DB 1MFCL 1JYVA 4TNWF 2AJXL 3VFGH 1CVRA 4ZFOB 1GGBL 2XPGB 3QDGA 3VXSE 3P3YA 4LVEA 1EHNA 1L6ZA 1IGTB 2OK0H 1TVBA 4QHUB 2X5PA 1F4YH 2CLRB 3LN9A 1BZ9A 4Q74A 4ZOAA 1HNGA 1OAZH 4MD5A 2ZKHL 1BD2D 1RUMH 1BREA 1OSZB 3I50H 4XAKD 2KQNA 4JFQB 3TT3H 1NGZB 1CXFA 3KVQA 5C2UB 3NABH 4PJCE 5DUPH 1RK0A 1YQ2A 2PYEE 5E6IC 3ZE1F 2XG5A 5GS0D 1YEEL 3AS3A 2R8SH 2PTVA 4U6VL 3ZE2F 4C56D 1JGUL 1MHPL 4Y1AD 1BGXH 3WKMH 4RFNC 2PKDA 1FFRA 2AV7B 4PFEA 1T0MB 4HBCL 4HT1L 3ESVF 4L8BA 2HT4D 1XGUA 5JW4Q 2LAAA 15C8L 4OZFA 5E08H 4NSKA 4B7IA 1OF2B 4RQQA 3QXDB 2H1PH 4WV1A 1DL7H 4MJ6A 1KLGB 5FAAA 5L9DH 4RSVA 1ZVSB 3S36H 5CD5C 1T7VA 3P0GB 1ZXQA 3QDMB 1KCKA 4RGNE 3SDXE 1IGFH 3QH3A 1KPRA 1EO5A 2BC4A 3UJJL 1FNSH 5L7XH 3ZZ1A 4DOHB 4NO0A 2HN7A 1GL4B 4KV5E 3QIBC 2F54A 2XQBL 3PABA 4RWYL 1KCUH 1MEXL 5BO1L 1CGVA 4WWID 2YD4A 3F7YB 5FHBH 1OGTA 2VTFA 1J8HE 3LQAC 1CFTB 5DWUL 1G6RA 1S7QB 5ADPL 5C6PB 4HKXA 1C08A 3EOAB 1AD0A 1KB5H 4XB8A 3ARGD 3SBWC 4M6OH 2ICES 1AXTL 2EC9U 1JHKL 1I4FB 2CRIA 4Y8DC 4WUKL 2VLRD 4P2YA 5F6IC 3F58H 1FHGA 1HI6A 5HVWA 5MEOB 3U7WL 4F8QA 4N0YL 5C0ND 3ELAT 3IDIA 3DWTA 1R5WB 3P0YH 5DLMH 5LCVL 4YDKH 3RDTA 2J8UB 3BKJH 3SGDH 4OBSA 3HAEG 4M5ZH 5E8EB 1IC4L 4XP5H 5C0FB 1KT2B 3C09C 1BIIB 5EU5B 4QHKJ 1IAOA 2IFFH 5D1QB 4KI5D 4OF3A 1DN2A 1QRNB 1SY6L 2BZDA 4K7FA 1T5XB 4L4TB 4NM8H 2FO1A 2ZUUA 3PG2A 1NMCB 3DRQA 2CLZA 1I8MB 3GMNB 1GAFL 1GGIH 1HHJA 2HLAA 5EA0H 2J5LC 5DRXB 3QPXL 5F1IA 1ONQA 3GSWB 4CNIB 4MWFA 1NCCH 2VNCA 3T3PF 3VGBA 1KCLA 1S7UB 5D7JA 3O3AB 4M8QB 1AE6L 1A6UH 1IBGH 1EK3A 2RCSL 4JHWH 2UZXB 3AFLA 3P9WB 3BJ91 4FNLH 3UTZB 4RBPH 1Q9WB 3LZFL 3GSXA 2CKBL 4N0UE 4PJIF 2GY7B 3DMMC 4PG9B 4XMKL 3V6FA 1FZOB 3B9KA 1KPVB 5AZ2L 2AK1L 3C5ZA 3NCCB 4X83A 5FKAA 3QRGH 3SEPA 3RU8H 1N5AB 1HHHB 1IGYB 3RAJH 2G2RB 5D8JL 3QNYA 1OTTD 5DFTA 4JKKA 4APQB 3CK0H 4Y4HC 1Q9OB 2GSGA 3FQNB 4KUCD 3TIEB 1E4JA 1EAPB 1OAYL 2BXZA 4FXKA 1YDPA 3Q6FB 3V7AE 3FT4A 2VXQL 5IVZB 5LWYH 5E94A 3U7AA 1W72H 1I75A 1T1WB 5GGSA 1PKQB 2WWKO 1RUQL 1XCTA 3O6LH 1FRGH 4HW6A 1MREL 1XR9A 2YD2A 4ELKA 4P9HL 1FPTL 1N3NA 2J6EA 5DURD 3I84A 3MUY1 4LHUB 3TCLA 2MHAA 3GMRB 5DJZA 5E9DB 3I3EA 4LLUB 5FO9A 5HI5D 1KTKE 2NY1C 4PJXF 3SKNA 2EKSA 1LO3H 4PPTA 4RX4D 3RJQB 3QULA 3HMXA 4NO5A 2Y7QA 1XGPA 3WUWB 2F5BL 3NZHH 4HMDA 1KF9B 1WWAX 2E27H 4MQ7B 3EO0A 4GKOA 3ME0A 3MOBL 2F74A 4JY4B 4M7ZB 5ESAB 4HC1H 2H3NA 4Q7DA 4XH2A 5CZVL 1ORSA 3QUKA 3LSOA 3WNKA 1VFBB 5TE6L 4RAUB 2YC1A 3U6RB 3GHEL 4L9LA 4X5WB 1ZANL 3DETD 2Y25A 1E4XL 3UTQB 3ZTJG 2HJLB 4YXHL 4KTDL 2YUZA 4XB7A 1VCAA 2E7LC 5HHQB 5HDQL 4PJ9C 3VXMB 1AXSB 4YDJB 2SEBB 3KYNB 3PV7A 3UTSD 4NBZB 3NIFE 5K59E 3CZFB 3BOVA 4HFUL 1FVDB 3WLBB 3MV01 4NQDD 4PP2A 2PW1B 2X4TB 1CYGA 4I5BB 4OLVL 2XRAH 4DGVH 1X5AA 3LN4A 3VFPA 4MJ4A 2R1XA 4NZTH 2FGWH 2JJSC 1BBJB 1JF5A 4PJ8C 2W0PA 1G9MH 5DUML 5I1AA 4P2RB 1LO4L 5E8OA 5DGQA 4Y4KA 2ZJSL 4FFVC 2D0FA 5ITBL 1GIGH 1NL0L 4P4KB 3LEVL 1J05B 3ARFB 3T0ED 4ZS7L 4WWKD 2CXKA 1IZKA 2OZ4L 4KI5F 5T1KA 2OTUA 5I17A 3GMMB 1RFDL 3QO0A 5KOVC 2W9DH 1M71A 2P8LB 4LDLB 1ZA3A 2ICWA 3RWIB 1AHWC 1I3GH 4WI4A 3QG6B 3JWDH 3W39B 1OCWL 4FQQA 4BFIA 1RZJH 3NIDE 4KJWD 1T2JA 4MQXC 2XWJB 5CP3H 2CK2A 1D5XB 4R0LA 3TESA 4QNPF 3SE9L 4FTVA 4JFDD 3D18A 4PJIA 4HJJL 3MPCA 4OD2B 1CICA 2BVTA 1T1XB 5DUBA 4UIKH 1FNEA 2JF1A 3P73A 4EUPG 4B41A 5EZJA 1LVEA 5DMGD 1SYVA 2B4CL 4ONOA 2XQYK 3JV6B 4BKLA 4P2QB 4LDOB 4XZUB 1WTLA 4ZPVB 2HJFA 3TVMB 4TRPH 3U0PA 1QSFB 2DICA 2JCCF 1I9RH 2VMFA 1WCBA 4KUCF 4EUPH 1EXUB 4UINH 4JRYE 4NRZB 5F70A 3RTQD 4NCC1 4HJGB 4XBGB 5FYJU 3A67L 1ETZB 3SDDB 1BD2A 1N0LA 3MRMA 2NW3A 2BSTB 1FCGA 1NUDA 3KS0J 2NTFA 2HFFA 1QEWB 1I9JL 5HJ3A 4PJXA 3FN0L 5D7KE 5ACMA 5KSVA 3IF1A 4MQSB 1LO5A 3CSYB 3MNZB 4POUB 5A2IH 1UM6L 1NCNA 3BRGC 1JF1B 1B0WA 4I9WE 1VDGA 4C56A 3VWJD 4Y1AA 2DIAA 2N7BA 3VMOA 4HK0B 3JWOC 2VZ1A 4JY6B 4L4VD 4QHNB 3VFSB 3BPLB 3KLHD 5IVOA 1GGCH 1OW0C 1MIEH 3AUVA 1WAAE 3ILPB 1LO2H 2AEIT 1MFDL 4LDEB 4XNMA 2OMBA 1I1YB 2VDKL 3IDGB 1MRDH 4V1DE 4BQ6A 1WCQA 2GTZB 4U1JA 4JFPA 5DVLA 3BP7A 4XP6L 5ICZA 5IESL 5AD0A 4JPKL 3ARDB 2EYRB 3LHPL 4I77H 3UBXA 1MCOL 4JHAL 1IKFH 5T5NG 5A16A 5L8LB 4KVNH 3ZT5A 1MLBB 1ZHBB 4HWNA 3KS0H 3R0MA 1N59B 4LSPH 3HG1B 3ROOA 2VOTA 2FNBA 5FYJD 5LKNA 3U4BL 3I6KB 4HWBA 5CJOL 5BVPL 5BOZG 2X1PA 3OKKB 3OKDB 3OR7B 1KEGH 1EERB 3NA4A 2A1WH 2PR4H 3C6SA 1WITA 3ARGA 4OLUL 4OTXH 5D1ZB 3M17B 4MZ3A 3KPMB 2VLRA 4WJ5B 5JDSB 1RJYA 4AMKH 3MRKA 2PW2B 3VWKD 3K8MA 5D6CA 5DJAB 4ONFH 5C86A 3OGCB 1HE7A 2AEQL 4LSQL 1MI5B 4PY8I 1PQZB 3QXUA 4MLSA 1R5VA 4O5LL 4DCQA 5SX4I 3HC3L 4HG4K 3H0TA 3CLEH 4KKAC 4NHUB 1K8DA 4MS8D 5D7IB 4TQEL 4M6ML 1RZKC 4KMQA 5CEZD 1GC1H 1TCRA 1BVZA 4KMLB 2ED8A 5HGDA 4KUZL 3BZFB 5EOQL 3QDME 3R8QA 1GZPB 4X98A 3MQIA 3CMOL 4RGOH 2VDPH 1W0VB 1DDHA 1SMAA 1MAMH 4KK9D 4DOHE 4PGZA 1BX2B 5L88L 3PWLA 4NJ9H 3O3UN 3VJ6B 2FR4A 3WL9A 1A14L 3MV9D 3VRJA 2OL3L 4L5FL 1T7ZA 3DUUA 3DVGB 3SO3B 1Z9MA 5J6GA 4WNQA 5K9KA 2UYLA 5JPMB 3ULUH 1RJZA 4S1DC 3QUYC 4MXVE 4FQCL 5SWSB 1AFVL 1HSBA 1TETL 1IM3A 5EU3B 4P49A 4OCYL 3RUGB 3MLYH 5J06A 1B9ZA 4KRPC 1EIBA 1WT5A 1HHGB 4ZYKB 4WW2C 3P9LA 4NKQB 4M00A 2R9HD 5BZDB 2J8UE 2OS7A 1XCQA 5JPNB 2H41A 1G7LB 3DIFB 1A3QA 5TDOA 1G7HA 4WHTB 3RBGA 4QF1B 1NFKA 1QRNE 4PJCF 4U6YB 2GAZB 4L4TE 2A77H 4MB4A 5I8EB 4S11A 4R4NC 5GRVL 3PHOA 3BZEA 5I1LB 2X4NB 4JFHE 4LKCA 5GGRY 3QDAA 3VRIB 4N0FA 5DRZB 3WIFA 4DTGH 3L3HB 4NFCA 4GG8A 4RX4A 3DNKA 5ANMA 2NY5C 3HUJF 4C55A 5DD0H 5C0BD 5I0ZA 2A0LC 2MCPH 3DVNA 4HPYL 2FYYA 5DRWA 2NY0B 4KZEH 4LLMA 3K74B 5E2WL 2WW8A 3SY0A 5JNYB 2IJ0C 2V9RA 1AR1C 5DQ9B 3SDXF 1R0AL 4MNQB 4JO3H 4DVRH 1YQVH 3VXUD 1FL3A 3MV8B 3NCBB 1HYSD 5I1EL 4OD3H 3BZ4A 1S9WA 2VDQH 1RAMA 4Y7MA 4MCZB 1TTGA 3Q3GB 2CDEA 2ED7A 1QYGL 5DHYB 2D31A 1QKZH 4G6FD 3VXNB 4KROB 3PXJA 4P3CL 1P4LA 1MLCA 5C0EA 4Y5XC 5HY9B 1G7QB 2EEBA 3QWOA 3UTSA 1HWHB 4MA3A 1PKQE 4PRDA 1DLFH 5ITFA 4MB5A 3HLAB 2FH6A 1CDUA 2IGFL 5TGBA 1YUHB 1L4IA 4NQDA 3V4UH 4TTDC 5FA3B 1CE1L 4N68A 4DVBA 3I75B 5E9DE 4Q58C 3MFFA 4JRXD 4PJDA 3EYUL 1OB1A 3V0VA 1E27A 2EDFA 2GT9A 1JF6A 5HVFB 4AIZA 3ALWA 5SWQA 1LEGA 3LKSA 5ESQB 4JFEB 5IMOA 4XGZB 4GMTH 2FH8A 4YWGH 1TPXB 3T0EA 5DVMA 4G9FD 4I3GA 3H8NA 2FJFB 1F6FB 3DJ9A 4X5XB 5EZLB 3FO9B 5CGTA 1AQDB 5SX4H 1NGQL 5D2NA 4P9ML 2BVQB 1U93A 1UADC 2VQ1A 4N8VG 5C9JA 4LL9A 4LSUL 4EN3B 5E56A 4LF3B 1BEYH 1HOCA 1U8QA 4GUPA 5IEKA 2PO6D 1CFVH 1V7NL 2HTLC 3VXME 3HCVB 5GGVL 1YEGL 1IFHL 1JPSL 4QWWC 1ZEAH 4F58L 4ZPTB 3DVFA 1Q9LA 4JFDA 1A7QH 4AG4L 2H9GB 2ORBL 1NAMA 4Z7OE 3EFDL 5KW9L 1D6VH 1SJXA 4HH8A 4KGLA 4M9OA 3PP4L 1U8HB 1K6QL 5D96C 1BFOA 1VKXB 3WE6A 4X6DA 4Z0XB 5M7QA 2XZQL 2VXSL 4K07A 5GS3A 4JVPA 3T09A 1INEH 3K80A 2F58H 5HYQB 5FO7A 1N8ZA 1FG2B 2EYTA 4JDVB 5E7BA 3STZA 4P2RE 3TYFA 3SGJC 1A6ZA 5GZOD 1MIMH 3R4DA 4M7JH 3P4OB 4JM2F 5E8PA 4U0RB 3RTQA 4OKVB 3FONB 3K8LA 3WO4B 3PGCA 1NAKH 5DQJB 1NGXB 4KDWA 1ZT7B 5BJTB 4AK1A 2DMKA 3MRCB 4ELMA 1I8IA 3L6FA 5HHMD 4Q2ZB 3X3FL 5KTEH 3HA0A 1AI1H 1T21A 8CGTA 3V5DB 4YBLB 2HG5B 2CKNA 4ZD3H 1IGCH 4U1IA 3RNKB 1KSRA 1UZ8A 5DJCB 1T0PB 3JVGC 5E99L 2W65B 3HUJA 4ORZC 4G8GA 3WFHB 3KHQA 5I8KL 4YPJA 3QCUL 3VWJA 4ZDHA 3BH9B 3D0LB 4H1LG 4S2SB 5KZCB 4FQLH 2DM3A 4PREA 4L4VA 2NY7H 3DO3A 3U0TA 4XBPA 3ZMRA 1CLYL 3T8XB 2P7TB 3IU4L 2R56L 3FQTB 5CIPB 3QEQD 3KJ6L 5C0RH 5F88B 2F8VA 4HPOL 3MXVL 1L0QA 3WHE1 1XR8A 2XZCH 1EEYA 4H1LH 5J13C 2P1YA 4EI6B 1P9MA 5ETUB 3FO1B 2ITCA 4P2QE 1J9CT 4YX2H 3NIFF 5K59F 1DZBA 1QSFE 2Y07L 2Z31D 4KPHH 1JK8A 3DYMA 4QHMB 3QYCA 1RZ7H 1JWMB 4NJAL 3TNNB 3DOSA 1U8KA 5K9QI 1P2CA 1NGPL 2M8XA 2NY2B 3IDJB 5DHXB 4AIXA 1L7TL 5CCKL 5GGUB 2VDRL 1B2WH 2W38A 2FO4B 1JNHB 2IPTL 4RFEA 3BWAA 3SO5A 4X9BA 3ZTNH 4MA8H 3RIFF 1RHHB 4YLQT 3MZGB 4UB0H 4UQ3A 4NO3B 4P9HC 3KLSA 4KDVA 3HMXL 1NCWH 1VADB 1T2XA 4NPYB 5IF0B 1ZMYA 1C5CH 4YHOL 1HEZA 4EVNB 3OXRA 3DROB 4I4WB 4UUJA 3SDAB 1S7SB 3FFDB 2Z9TA 4PJGF 1KFAH 5A2LH 2G60L 3UTPE 1CD8A 4FQ2H 1KULA 4OBRA 2HAZA 4F7PA 4OCRL 5IFAL 4LCIH 3B2UD 1SM3L 1E4KC 3RZCD 3JTSB 1P6AB 1P7QD 4DW2L 3NIDF 4MNGA 3OR6B 4HS6A 5AWNH 4LPWA 5GSRB 2H45A 5FECA 1AGEB 1FV1A 3GMPA 1ZE3C 5GS1C 2I5YL 1F6AB 2NXZC 1JUFA 5EO1B 3LVEA 1I3RB 3MV9A 4P2OB 3S35X 2FD6H 4WIQA 5KSBF 3HG1E 2R2BA 3VD7A 4YNYB 4PRBA 3FZUD 4HKJA 3B43A 4FABL 1Z3GL 5I16A 5DI8B 5JQ6H 3HC4L 1P5VA 2Q8AH 3HZKA 3MRGA 3HMWL 4F3FA 3KYOA 2GSIA 3QJFA 1PLGH 4ODVH 4Q6IC 3BXNB 4J8RA 3TH3T 1M7DB 1MI5E 5D7LB 1C16B 2QKIB 4OUOA 2A6IB 4F57L 1CE6B 4DUWA 4PGCB 1QR1A 1AH1A 3H3BC 3S37X 1EGJH 4UT9L 3W0WA 5MP6L 3L3JA 1ORQB 1YY9D 4CVWA 4IRZL 4CW1A 3E3QC 5IBLC 5D7IE 1A7OH 3OAUL 4ONGL 5ID0B 4GAYB 2VDLL 5TQ0H 3MMEB 1U8NB 4YDVB 4O2FB 5C0GB 1WISA 5FGRA 3EYSH 2NY3B 5EUKA 3VG9B 1ITBB 2OR9L 5TF1H 4YAQB 5H94B 4YBQD 3K0WA 1OP5K 1H15B 4I0KA 1AC0A 4LSSL 1MFEL 4NNYB 3ULVH 4S1QL 3HAEA 5D1XC 5ID1B 4QY8B 2AEPL 4G7YL 2NXYB 2VXTH 5CWSA 3CXHK 3U2SA 4AEIL 1AQKL 3VXUA 1TJIH 4WU5B 3OB8A 4MD4B 2XZAL 3JBG7 4W68A 4JKPL 4D8PA 1UB5A 4DKEL 5SWSE 2VLKB 3RWDA 3U82B 1ZA6B 3MRHA 2XKNB 4W4OA 1KN4L 4ODSH 4FZ8H 1KTLA 3RUGE 4Z0BL 5K9OB 2R4RH 3CCHA 4U1GB 2B4CC 1S7WA 3V4PL 4F7EB 4LVOB 5KVEH 4XP9H 3W11D 1X7QB 2YXMA 3L1OL 5EG6C 1AO7B 4K2UL 3VFTA 1DQQA 3MJ9H 2CSPA 5LGHH 1FZJB 3TZVB 4LLQA 1K8IA 2AP2A 2I26N 5J12B 1KJ3H 3C60C 3B3IB 4NKOA 2D03H 1YECL 4JRXA 3MRNB 5T3XE 1KJ2A 1CFBA 4NUJB 2VXVL 3V0AC 1CL7L 3U30C 3MJ7B 3ECBB 1MCRA 3IJYB 2NZ9C 4PJGA 3MGAA 3WXVH 5EO0B 1QR4A 4KMTH 5EBLA 1FN4A 3QI9B 4M8VA 3PXHA 4WFGD 4XAWH 4PJFA 5KN5B 3LKQB 4G9FA 2EIZB 3QFDB 4MNQE 1TZHB 5GGVY 3DYOA 3CFDA 4OGZA 4GJTB 3IGAA 1NEZG 3MV8E 2HKHH 3CH8A 3GSOB 3NFPA 4ZTPL 1Y0LB 2H6PB 2X41A 2VABB 1ZHKA 5EN2B 3IETA 1N4XH 2R0ZL 1T4KB 2PO6A 1N6QH 3WNPA 1Z6JT 4XMPL 4ZXBB 3F7VA 3SCMB 5KVFH 5KSBA 3IVKA 4S1RH 1Q0YH 2OI9B 5D93B 1U41A 4MXVF 4Q6YA 1OTUC 1GOHA 4X6EA 1FSKB 2PCPB 3QXVA 2DN7A 4PUBL 2BDNH 1D5BA 3REVA 2HVJB 2ICEA 4ZNEE 5FOJA 1J11A 2ED9A 2AV1A 4GQ9H 2V5RA 1REIA 3DUSA 2X09A 1JCKA 3GJFH 4L8DB 3BN9D 1DBAL 2DRUA 3BN3B 4H5SB 3HZMA 4JFZH 4IOIA 5HPMA 1OAUH 5GGTL 5CBAA 5DF0A 5AG9A 1Z0NA 1IKNC 4MDJA 4JFEE 2R1YB 1CU4L 4OCLC 3VGAC 1WBZB 4PLOB 5T5NF 4TNWK 2P8MB 1T1ZB 2YA2A 3UO1H 4M4PA 2H2PC 3G6DL 3ORJA 3OKMB 1S9KC 2W9EL 4HFWA 4XC1L 1P1ZA 3JV4A 4ORGB 5E2TL 4U6HB 4BZ1L 1BVLB 1N5YL 4CVZA 1CGSL 2O5YL 1JGDA 4MDIA 1UH2A 1AC6A 1JGVH 2CIKB 1H8NA 4PRAB 1DCLA 1U3HB 3HNVH 3PJSA 4P46C 4CKVX 4UDUA 4HUWB 4R4FL 3LV3A 5F7WC 4WY7H 4JJHA 3MBXL 3H3PL 4XPBL 1IILE 5TFSL 4I3RH 5T1LD 5HI3D 4FFZH 2UZIH 3S34L 4OZIB 2W59A 3TBYB 4R96A 2DI7A 2CJUL 4P2CG 1QHPA 3ZO0A 1LEKA 4JO1L 1F3RB 4Z7UA 3Q1SL 3QEQA 4YHIB 4M1CC 2XXCB 5J6HB 3C08L 3GRWH 1T22B 2G75B 1XZ0B 3MJGX 2ZUQC 3BQUB 2GY5A 3S5LB 4GKSA 3DSFL 5FXCH 2Q6WB 2A73A 2FJHB 5TH2B 3T1FA 5EOTA 2AJUH 5KVGL 1DTUA 4GS7C 2VDOL 3QXAB 3I3DA 3WIHA 4PS4L 2Z31A 1QSVA 1UQSB 3EBAA 3TPUA 2ZCKH 3GBLA 3MOAH 4NUGL 4M6NH 4LVNB 4DUVA 2DYPD 1R5IB 2VJXA 3UJTH 2VE6A 1JZ4A 2VZUA 3WNOA 1A64A 1T20A 4LEOA 4LRNL 1XF2B 4O51A 2Z92B 4I0PB 4TPRL 1DUYB 1HILA 2R2CA 5I1DA 2YPLB 1X4YA 3OV6A 4Z5RB 3IT8D 4EUPA 1B90A 1KC5L 3MLXH 4JPWH 2APWA 3QCTL 3EOTL 2FIRT 3EOBA 3TNMB 2ADGB 1FO0A 2ITDA 4JRWA 5IP4A 1VEMA 1FVEB 5EBGA 4TOYH 3U1SL 1V3LA 1LP9B 1HH6A 2F15A 3H9SD 4HQQL 3GNMH 2X2YA 4G6ML 2Y5EA 4OD1H 5BRZB 5FKPB 3VA2C 1TLKA 4DGIH 1OP9A 1UGNA 4HLZH 3PWNB 5EIIB 3I3BA 5C0IA 4RGMC 5CJXA 1NGWA 4PR5A 3RL2A 4FG6C 3RZCA 2OQJB 3GIVB 5B21A 4HWEL 4GKZB 5F7DA 3UTTD 4MJ5B 3GSRB 3BUYB 3TJEH 1YN6A 5F7YC 4H20H 4D0DA 1I1FB 1JFQH 5CKGA 3CU7A 1U8PA 5HGHB 2DJSA 3K2MC 3IFNH 1PD6A 3CFBA 3FOMA 3U0WL 5BQ7A 4HKZA 2P47B 2VAAA 4TULH 1KXTB 4X8XA 4WEBH 3SJVD 4IIQB 4P5MB 4CBPA 3RBSA 4G8FB 1UWEH 1YNTA 4EI5C 5I2IA 2Y72A 4JCLA 1J1XL 5E6ID 5M95B 1R3JB 32C2B 5BV7L 4K3JL 3S35H 1RZKH 2ARJA 1HXMB 4M02A 2YD5A 4GAGL 4GBXD 3TN0C 3BVNB 3EYVB 1WC7A 3OBAA 4PB9L 5GGQL 4D2NA 1UKSA 3FQXB 4LMQE 4U1NB 3BP6A 1WBXB 1M05A 1OLLA 4FHBD 3ALXA 4GW4A 4OLXL 5C3TA 5C09B 3WIIL 2ESVD 35C8H 4NGHL 5CD5D 3UPRA 2RGSA 4I2XB 4Z7WA 4PTTA 1RZFH 2KZ1B 2FIKA 1IAII 4YFLI 3S37H 4JANB 3QIBD 5T3ZE 4IMKC 1YEDB 2QSCH 5F97E 3VD3A 3QHFH 2A6KB 2P5EB 3BPCB 1EZVY 1ZAGA 1FFNA 4LPTA 3RWHA 3TIDA 4PIRF 3AS0A 1FIGH 1NAML 3UYRH 3WD5L 2A83A 3BYTA 3DX6A 4KJYA 1F2QA 1Z9OA 3FT3B 4OCXL 3SPVA 4AEEA 2GJ6D 5FOBB 4LQFL 4LARH 4POZC 5IB2B 3QZWG 1VFMA 4Y5YA 1KXQE 3DX7B 5IIEA 4HJ0C 4MAUH 4HKBB 2WINA 3G5VB 4RWHA 4J3OC 5ABDE 4HEPG 3WDHA 1DQTA 4QRUA 5D7LE 2GCYB 2Z91B 3ROLA 3BEWB 3LEXA 4NQCB 4ZTOH 5I1HL 4XCFH 4E5XB 4Z78B 5I66A 1ACZA 3LEYL 5I15L 5DQDH 3PHQB 3QEGH 4U1KA 5KJRH 4HAGA 1CVSC 2FHFA 2JLLA 4M43H 3AU1A 1T3FA 4LEXH 4MXWH 1QFUL 3V4VH 2NLJA 1E6OL 3FRUB 3CZJA 4YPGA 5CD3B 2XYCA 4YHZH 3X13A 4WUUD 1KACB 1M7IA 2OXHA 3QUXC 4E41D 5E5RB 4PLJC 1UWXH 5I1IH 5IT2L 4PV8B 1E0OB 4O2EA 5GS2H 3K8KA 5JLZB 3VW3L 1LK2A 1U8MB 1DSFH 2F5AL 1YY8A 3PWVA 4OFVA 3JXAA 3X14B 3MXWH 4WHCA 1B4JH 2P5WD 1G7IA 1RUKL 5JHLL 5HHNA 3TT1L 2AQ2A 5BVJB 1LGVA 3DMMD 4XCYB 3GI8L 5B8CA 4JDZB 3RHWF 1N2RA 4NQSB 4HF5L 4OB5L 4QT5A 2JKXA 3MRDB 4M7KH 2WBKA 4KHXH 5JW4M 1U92A 2VXUH 3CC5B 5IROC 3BT2L 4JZJC 1CQKA 1LE5A 1TITA 1HYRC 4QGYA 3O2DH 3ARBC 4P5TB 2BSSA 3A6CL 4Y4HD 1RJLB 3MZTA 4XMLL 3MUZ1 1S3KL 3G6JA 1CTOA 1JVKA 2R2EB 4KWUA 5F89A 4F7MB 2PXYB 4UAOC 2DI8A 3WJJA 1JYXA 2EO9A 1S9YB 3VFGL 1GZQB 4FMKA 4RCAA 1AO7E 2NMSA 4CMMB 2OK0L 3BSZH 2DF3A 4CN4A 3VXTB 3GHBH 1F4YL 4C83B 4TNVF 1NGYA 1OP3H 4XCNA 3CX5J 5F1NB 4O00A 2NY1D 1FYTD 1RUML 2Y6SD 4K71C 2Q86A 4YHNA 3I50L 4YHMH 4B0MM 4AIOA 4L8SC 3WSQH 1UKTA 2AK4B 3TT3L 4KQ4H 5LBSH 1MJJB 4OCWH 2DDQH 3NABL 4YFDB 5DUPL 1GGYA 5IHBA 2QQKH 2EIBA 3R06A 3OJDA 2R8SL 1S7VB 2B8OT 2DQEH 2I27N 1BGXL 3WKML 4XC3H 3I6LD 1MF2H 4C4KO 2GK0B 1V7MH 1XIWD 2B5IC 1Y18B 5E08L 2H1PL 2FJGA 1DL7L 3CFKB 2P48B 5L9DL 4KXZH 4HLJA 3EGSA 4NKDB 5DJXA 2P45B 2ARJQ 4PJ9D 3X11B 3S36L 2P44B 4NZDA 2GKIA 4NRXA 1MCWM 2BY0A 1D5ZA 5T1LA 4KFZC 1IGFL 3B2VL 1TJGH 2I60H 3REWA 2CIIA 3VFUA 1FNSL 5L7XL 2EEAA 2BVOA 1C5DB 1IAIH 1HH9B 4PGDA 5ACLA 3PDGA 3SGKA 1KCUL 3E6HA 3KNBA 5T1MB 3O9WB 5FHBL 2H26B 2CMRH 1I3VA 5C3LD 1HDMB 4N8VA 5F71A 5FM5O 3SDCC 1KB5L 2FLRT 4ZAKC 5C0AB 5KBNC 4PJ8D 4M6OL 4UDTB 3HZVB 4OFKA 5HYEA 2DYPA 2DQDH 3F58L 3NACH 3GSVA 4FFVD 4CJ0A 3DX8A 3VXPB 4U1LB 5DTFB 5FCSH 2XFXA 4U2ZA 1H8SA 4H26A 3QUZC 4XCCL 2IAMB 1YN7B 3L3IB 3P0YL 5DLML 4YDKL 3D39B 4EOWH 3BKJL 1CXHA 2VWEC 3GKWH 4M5ZL 1R3KB 1S8DB 4X7FC 4XP5L 4PTUB 3FQUB 2OCFD 4R7DA 2IFFL 1ZHNA 4XX1G 5C0DB 2Z93B 3E6FB 3CSPA 4UIMA 3U9UA 4NM8L 5L2KB 5MEPA 4J1UB 1F4WH 2C9AA 2B39A 1GGIL 5EA0L 4MQXD 4HH9A 2C3GA 4MAYB 1LD9A 3H9SA 4LLWB 3TPKA 4OZIE 1MFNA 3HE7C 1DUZB 5FV2A 4YGVA 1NCCL 1KIQB 5SWZD 1ZSDA 2ZOLA 3GUTB 1KG0A 3AXLB 1KPUB 2Q3ZA 1A6UL 1IBGL 5C07D 5IUSA 4JHWL 3K1KC 5EB9A 1QFOA 1DLHA 4FNLL 2HLFC 2FRGP 5D5MB 3UTTA 3MLZH 1CT8B 3ZSTA 3X3GH 2H32B 4U4BA 5FK9B 4PD4J 3TBWA 5J1TC 5LGJB 1RUPH 1CD1A 2LVEA 2NQCA 1WBYA 4D9RD 3MCLH 3JV0A 4H1LA 3QRGL 3OAZK 1BZ7B 3RU8L 1AGCB 1OARH 3RAJL 3O3DA 5HHXH 4WHDA 4CGTA 4WENB 3VGGA 3CK0L 4ZOEA 5EH1A 3SJVA 4AZ8A 4IRJC 4F15B 1MELA 4LLDB 2YPLE 2PTUA 4BFBD 1INQA 2YBRA 4PBWD 3VCLA 5LWYL 3OKLB 1W72L 4A6YA 4JN2B 1EJ6A 3MREA 2OTPA 4OGAD 3MJ8A 3O6LL 1FRGL 5FDWA 3U36B 5E6IA 3UPAA 1YYML 3O6FC 5ERWA 1FNLA 4WW1B 1XF3B 1LP9E 3GMOA 3MLSH 2QSTA 4PJEB 5DJDA 7CGTA 4L8CA 5BRZE 4N9GB 1LO3L 5TE4H 5CMAA 1P7KA 2VDMH 5CHNB 5FYKE 3NZHL 3D25B 3V0WH 3C8KB 2ESVA 2E27L 1A6VH 5EU4A 5CP7B 1NC4B 4NNPH 5ALBH 3U4EA 4UT6H 5BOPA 5BS0D 1S7XA 1HHIB 1B0GB 3E2HC 4HC1L 2C3VB 1V05A 3N0PB 5C1MB 3QHZH 4DUXA 1IGJB 4L3AA 1H8OA 3RX8A 3UAJC 3QIBA 4ZUTA 4OKDA 3C2AH 1T66D 5ESVA 1P84K 1F3JB 4QXTB 3DSNA 2X4RB 4EBQH 3EJJX 2UVFA 3RWCB 3RI5F 3J8F7 4NNXA 3VFNA 2GJ6A 3WNLA 3SBWA 1URLA 3F5WA 2X42A 4KAQH 5C9KA 1G6VK 1JL8A 3QDGB 4UOW0 3WN5C 5IWLC 1XAUA 1TVBB 3V6OE 1BZ9B 1WIOA 4Z9KB 2VIRA 2KZWA 2XRAL 4MD5B 3P4NA 4ZFZA 4H0IA 4DGVL 4WTXA 5C0NC 1E4WH 4KKAD 2YK1H 3S8WA 4NZTL 1TQBB 2FGWL 1LEIA 3OHXA 3QPQC 3L3OA 1G9ML 2CR6A 5C09E 1AGDA 1NFDF 2EE2A 3OKOA 1RK0B 5F6HJ 5FYLE 1A6WH 1GIGL 4I2XE 4OLZH 4WUUA 4DZBA 4E41A 4HS3A 4PJBA 4XNZC 4L8BB 2W9DL 1XGUB 4RNRA 4OZFB 4NSKB 2P5EE 1I3GL 4RQQB 4WV1B 4JG0H 4MJ6B 4A2LA 2P5WA 1QFWM 3JWDL 1BPVA 4M6AA 3MUHL 2QSQA 1RZJL 2VDNH 4ZUVA 1UWGH 2EC8A 3DMMA 4WFEE 4S1DD 3QH3B 1KPRB 2BC4B 3BO8A 4IOFC 3QUYD 3O3BA 3EW3B 4N90D 1SEBA 3P30H 2F8XC 1Q38A 4NO0B 2HN7B 5IVXF 4PJAA 4M93B 1DN0A 2F54B 2J4WH 1UCBH 3PABB 4UIKL 3VDAA 2Y23A 4KRPD 4Y4HA 1OGTB 2PTTA 3O8XC 4NQCE 1G6RB 3WFDH 3O45A 4HKXB 1C08B 2YOCA 4R4BA 1AD0B 5M94B 4TRPL 3KPQA 4NQED 4WI6A 1I9RL 1HI6B 3ARQA 1FZMA 4UINL 4R4ND 2GJZA 3H3KA 4WU7A 3IDIB 1WICA 5T5FH 3QIWC 2R0KH 3RDTB 2OJEA 2K9UA 1MHEA 1FYTA 4OJFH 4DEPB 4PY7A 1ZLSH 1ACYH 3UCRA 2A0LD 3FO0H 1IAOB 4LPXA 3F7QA 5HI5C 3CFIC 4HULB 4K7FB 1FG9C 2BOCA 5HPOA 3VI3E 1X6LA 4M3KB 3DRQB 5CLWA 2CLZB 1AR1D 2HLAB 1EVUA 1HHJB 4KVCH 4GRWF 2R4SH 1IEBA 3MNWA 3EDDA 5CJ5A 4X4XA 5F1IB 3KYKH 1ONQB 3IU3A 4JRYD 4MWFB 3V95A 1WFUA 5FF6A 3G5ZA 5D7JB 3T4YA 1GGCL 2EXYC 3TA3C 1MIEL 3VE0A 3DVIA 2EDWA 1KCVH 2XTLA 2E7LA 2HRLA 4NO2A 4QOKD 1LO2L 4PJ9A 1QQDA 2BNUA 4TUJA 1A1NA 2YD6A 3CSGA 1MRDL 3GSXB 3GMLA 1U8OA 4G80A 3V6FB 2EZ0C 5FA4A 4BYHA 3B9KB 3ZYIA 4HV8A 5ACZA 5I30H 3C5ZB 4I77L 3QO1A 3BHBA 5FKAB 1IKFL 4ZFFA 4KVNL 4I18C 4TTDD 4LSPL 4XNXH 2FL5A 3QNYB 3RWFA 1S9VA 3GSNA 2GSGB 5JUEH 2XZZA 4KH2A 3FL7A 1YEIH 1KEGL 4FXKB 3W2DH 2A1WL 2PR4L 2VQTA 1YDPB 2JJSA 3FT4B 4OTXL 5EDXA 4PJ8A 1H3XA 5E94B 1KB9K 5F9AC 5GGSB 2AK4E 3DHMA 3HI5H 1A9BA 1XCTB 1ADQA 2BVYA 3LQMA 4AMKL 4ONFL 1XR9B 4ELKB 1IEAA 4RIRA 4IDJH 5BV7C 1N3NB 3RL1A 4YIQA 3TCLB 1NFDA 5GRYA 2MHAB 5DJZB 4G42A 1RVFH 5FO9B 3L5JA 1U8IA 3EHBC 3SKNB 2EKSB 3CLEL 3QULB 1AHWA 3G9AB 4WWKC 4NO5B 4QXWA 2DTSA 1XGPB 2Y7QB 4IJ3B 3WS3A 5BMFH 1X4XA 1RD6A 2ZG3A 2OR7A 1VFOA 3HR5A 2IBZX 3VGEA 1GC1L 1SJHA 2HTLD 3EO0B 3ULSA 3OL2A 2ENSA 2F74B 1MFAH 2H3NB 4QWWD 3RIFK 4XH2B 2ZUXA 1YMMD 1ORSB 3QUKB 5D6DC 3LSOB 5F9OH 2ZP0T 3QIUC 4RGOL 2VDPL 5SWZA 2Z8WC 2V9TA 1MAML 4XBEH 5C07A 2YC1B 4L9LB 5IV2A 4NJ9L 4R7NA 1UACH 4MX7A 5IVXA 1I1AC 4LIQE 2A6JA 4XTRC 5IMKA 4U0QB 3ULUL 5C0AE 4AL8H 4NN6B 1W0WA 1FFQA 4JLRA 3V6BR 3AREC 4Z18A 4WW2F 2EKJA 3QUMA 4EKXA 1TZGH 4PP2B 1NMAH 3MLYL 5F7EH 4C57C 1WZ1H 4PV9A 2R1WA 5KTEL 3D39E 1Z0MA 1EJOH 3LN4B 3VFPB 5HHVH 2R1XB 5TQ2H 1R6VA 1N6VA 5A40E 1WIPA 4A2MA 5I1AB 5E8OB 5IQ7H 2A77L 5F8QC 4Y4KB 5L2KE 2CGRH 4YE4H 4MXQC 1L0YA 4QRTA 5KAQG 4Q0XH 5DEFA 4BSJA 4U6XA 4DFHA 4DTGL 1WZKA 5T1KB 1XF5A 2OTUB 4N1EA 5I17B 1JNNH 3QO0B 1NUNB 1OW0A 1M71B 2IFGA 1ZA3B 3WFBH 2ICWB 5DD0L 2MCPL 1FQ9C 3TJHC 4KZEL 4GFTB 3MLVH 5BS0A 1CLZH 4FQQB 5D1QD 5D5ME 4BFIB 5T3XH 4JO3L 4DVRL 1YQVL 4E42A 2XTJB 4R0LB 1CQYA 4FTVB 2UZYB 4ODWA 2DLEA 1W0YT 3D18B 4OD3L 4PJIB 1NC2D 1CICB 2VDQL 5DUBB 25C8H 1FNEB 3UP1A 3P73B 3AMLA 4YXKH 1QKZL 5EZJB 4YBHA 1SYVB 2WBJC 4BKLB 2HJFB 1FDLH 2ZCLH 1JMZA 3U0PB 1DLFL 5HVGB 1BVKA 1SQ2N 3OMZA 4ZQKA 1WCBB 3MYJA 1WQVT 1JYWA 5EC2A 3V4UL 5DT1H 3VWKC 1H3UA 4GRLC 1BD2B 2EYSA 2VZVA 4PJEE 2NW3B 3MRMB 1U95A 1CXLA 3MRIA 3ZSSA 3DO7A 4UQ2A 4RMUA 2NTFB 2HFFB 5HJ3B 1KOAA 4PJXB 5KSVB 3O4OC 3IF1B 1LO5B 1D6EA 1FFPA 1BQUA 4YWGL 2YUXA 1J0HA 1UFUA 4LP5A 4C56B 5L2JA 2I07A 4LMQI 4Y1AB 2NZIA 1RJCA 4ZSOA 2VITA 1AP2A 4UT7H 2GW5A 5FB8A 2ATPA 1BWMA 1NMBH 2NXZD 4LSDA 4FA8A 3MA7A 5JMRA 4DAGH 1BIHA 1BEYL 1J86A 5E00A 3TWCH 1CFVL 3CX5K 4XNMB 3KWWA 1JHLH 3N9GH 3G5YA 4IRSC 1I9IH 4WGVB 3QUYA 4U1JB 1ZEAL 4JFPB 3ARTA 3BP7B 3R1GH 5JORA 5ICZB 5I9QC 4J3VA 4RAVA 5DZOA 5AD0B 1BMGA 1WEJH 1A7QL 5AAWA 4LASH 3QDGE 3UZEA 2MKLC 3UBXB 5A16B 1D6VL 1J1PH 3SKMA 5IBTH 2MJWA 4WW2A 2WAHA 3BIKA 3ROOB 4Y19D 1HINH 4AEFA 4JREC 4ZUSA 1NDGA 3DXAD 3BPOB 1INEL 5F9WC 5EOCJ 2UUDK 3W5MA 3C6SB 3STLA 3ARGB 2F58L 5F7HA 5IBLD 2R9HC 3VXMD 2FB4H 4NQEA 1U3YA 2VLRB 4G7VH 1RJYB 3MRKB 5D6CB 1MIML 4M7JL 3CUPA 1NAKL 1OSPH 3QZWA 3NA9H 2X4QA 4YR6A 3MCG1 2V5SA 1R5VB 4DCQB 3LS4H 2HFTA 3H0TB 1AI1L 5I8CA 2VERN 4ZD3L 1IGCL 1S7TA 1K8DB 4QTHA 5D1XD 4KJPC 3FT2A 1TCRB 1TJHH 1X5IA 1FC1A 4WCYH 4FXLA 4Y4FC 2L7UA 1OAKH 5HGDB 4FQLL 1F02I 4X98B 2NY7L 3JWNC 4ODHH 5IOPA 3VRLF 1DDHB 2Z0BA 5ICYA 4KKCC 1MWAA 3DHJA 5J8OA 2F54E 4X9GA 3PWLB 5C0RL 2FR4B 4YHPA 5DHVA 3WL9B 3P77A 4QOKA 1C7TA 1F4AA 3VRJB 2XZCL 2ZUWA 4BUHA 4OF5A 1QRKA 3DUUB 4Y5XA 5J6GB 4WNQB 3GFUA 5K9KB 3GBNH 2UYLB 4W6XB 1RJZB 4YX2L 4EIZC 3NIGF 5CIPH 1RV6X 4JGJA 1CL7I 4KPHL 1HSBB 1IM3B 3WHXA 1RZ7L 5JOPE 2PF6A 5I74B 4KRMB 3C60D 2C3HA 4HUMB 2C1OA 3P9LB 4R97C 1XCQB 3DX9A 5MHSD 4MA1C 1B2WL 1T2QH 1G7HB 5TDOB 3U4AA 2NZ9D 1J0JA 3ZTNL 4MA8L 1A2YA 4UB0L 4OCSH 1HXYA 5DURB 2HKFH 1VB9A 1NCWL 2Z8RA 3O41A 2Y36H 3PHOB 3BZEB 2RQ8A 1C5CL 2ZOKA 4LKCB 4PD4K 1A1OA 4N0FB 3WIFB 3I9GH 4G8EA 4GG8B 3BKYH 5ANMB 1KFAL 3QDHA 4WDIA 1G7JA 2DQIH 3BZDA 3SDDD 2VB5A 4FQ2L 3DVNB 4YGAB 2NNAA 2FYYB 4P0DA 5DRWB 4LCIL 1NFIA 1GJIA 3OZ9H 4LLMB 5D71H 3AM8C 4TVPE 3SY0B 5AWNL 4G6AC 2VISA 1YMMA 3MFGB 3UROR 1OTUD 2LAGB 1FL3B 2HRPH 3F7RA 3IJHA 4Y2DC 4K3EH 1F2XK 2LVCA 1YNLH 2D0HA 3BZ4B 4NWUH 1S9WB 4XP4H 1K5NA 2CDEB 1QFPA 2FD6L 3IRZA 2D31B 1BZQK 4LLYA 3EJZC 2AJ3A 4FN0A 1P4LB 1MLCB 2APVA 4F8TA 5C0EB 5JQ6L 4OM1L 3KJ4C 4HSQA 1RIVH 2Q8AL 3QWOB 3UTSB 5T3ZH 3RWGA 4MA3B 4PRDB 2MCG1 2NX5D 1DVFC 4QRSA 3SGJA 1I1RA 1PLGL 3WEXA 5DD1H 4RISH 2E9JA 5ITFB 4ODVL 4QCIA 4XP1H 2BHZA 5TGBB 5I75B 4NQDB 2H2PD 2VR9A 5E1HB 4FQ1H 4Y5VC 4DVBB 2WQRA 4X8JA 3MFFB 4WO4C 3K2UH 3LPGA 4PJDB 1EGJL 1OB1B 3V0VB 4OM0H 2H2SC 1E27B 2GT9B 3KYMA 2VZSA 4AIZB 3JVGA 5SWQB 1SY6A 1LEGB 3LKSB 1A7OL 1G9MC 5IMOB 4P46D 3LD8C 1PX3A 1FLTX 3O11A 5TQ0L 3VI3F 5HBBA 2YA0A 3VG0H 4URTB 3EYSL 4NQVA 3CAFA 3T0EB 4O58H 5GQBA 2E7HA 5F96H 5IJVA 2AXFA 4MSWA 5IW3A 5TF1L 3SDYH 4HBQA 4WEUD 3NFNA 5D2NB 3U79A 5IK3A 1U93B 4M1CD 2VQ1B 4DN4H 5C9JB 3ULVL 3MJ6A 1DANU 1HOCB 1U8QB 4GUPB 5IEKB 4LVHB 4H8WH 1RZJC 2CKBA 1YPZF 2VXTL 4R2GC 5KG9A 1Z9LA 3LH2H 3BWUC 5CUSH 3UXFA 4BSVA 4N5EC 1BF2A 1TJIL 2APTA 4QLRA 4C59B 3TH4T 1Q9LB 3H9HA 4JFDB 3M8OH 1NAMB 5HHOD 1F3DJ 1NC2A 4ODSL 4XNUH 1CLOH 1KIRA 2APFA 4FZ8L 2AJSH 1BFOB 3TO4C 3WE6B 3D0VA 2R4RL 4X6DB 1MCKA 3O3EA 1NSNH 2EDOA 2QR0A 2X7LA 2NY6C 2QSVA 4YQXH 2ZCHH 1INDH 1IAMA 3BYYA 4QRPA 5KVEL 4XP9L 2VO5A 3VDCA 5FO7B 1N8ZB 2EYTB 1VEOA 3GIZH 5HDOA 3STZB 2DLIA 3TYFB 1A6ZB 3K1DA 3MJ9L 5GRUH 5LGHL 1I8KA 3RTQB 1JBJA 5E8PB 3PGCB 1AXIB 1KJ3L 2R0LH 2D03L 3EYOA 4ELMB 1I8IB 3L6FB 2I9TA 1T21B 2AKRA 4G3YH 3AB0B 2UY7A 1RIUH 4U1IB 1UZ8B 4FG6D 4OGXH 1E4KA 3T3PE 3WXVL 4KMTL 2ZUYA 3HUJB 4KU1A 5EZOH 4G8GB 1F3DH 5IVNA 2EDJA 3F7PC 3MO1A 4XAWL 5GGRA 4YZFF 4KGJA 3VWJB 4ZDHB 1JZ7A 1MCSA 2EDKA 1YEFH 2XTJE 4PREB 5GS1A 5I1GH 2HKHL 3FFCA 4FTVE 4L4VB 3U0TB 4MCYA 1T1YA 4XBPB 5AUMA 5L8KB 4PJIE 4R6UA 3H7LA 4OQTH 4Z7NF 1N4XL 3CIQA 4RMRA 1N6QL 1XR8B 2IAND 1EEYB 1JMXA 4C58B 3MRBA 5KVFL 2HH0H 2ITCB 4QTIH 4C54A 1OGAD 1Q0YL 4S1RL 2CUIA 1KTRL 4EI5D 3GSNL 1DBMH 3NCMA 4Q6IA 3HFMH 1JK8B 2QJDA 2BDNL 4UTBH 2P49B 3RHWK 3PNWA 4V2BA 1U8KB 2QADC 3TBSA 4GQ9L 3MBEC 1P2CB 2RJMA 4Y19A 5F7LB 2B1AH 3TN0D 3MLRH 3DXAA 3RVUC 1BD2E 4DKFH 3UMTA 2DLFH 4U1HA 4XAKE 1UC6A 3CDGA 3IDYC 4JFZL 1OAUL 4NN7C 5I19H 4RFEB 3UZQA 3BWAB 2VQUA 4PJXE 1B0RA 4UQ3B 3D85D 5JW4N 1RURH 5HD8C 2AJXH 3UO1L 1DQLL 1MH5A 4C56E 2OZ4A 4Y1AE 1HEZB 2W91A 3OXRB 3LB6C 4YHYC 4UUJB 5J89A 5J11B 3BGFB 4TNVK 2YD3A 3NH7H 4HIXH 1JGVL 4QRQA 4F7PB 5D1XA 1A8JH 2P42B 3HNVL 3LQZA 2BSRA 4X7EC 1II4E 4MNGB 3TEUA 3WCYA 4HS6B 4WY7L 4D3CH 5MEND 1H3WM 4I3RL 1JHTA 3BDYH 5FECB 4FFZL 2UZIL 4P59H 1YPZA 4POZD 2E8ZA 1FV1B 3GMPB 1JGUH 3BPNB 4HJ0D 3RY6C 1QLEH 1JUFB 1QG3A 3MV9B 1KNOA 3GRWL 2R2BB 3ZHKA 4PRBB 3KPPA 3ARWA 4HKJB 5I16B 3ULUC 3HZKB 3MRGB 4F3FB 3KYOB 1D5IH 2GSIB 2QEJA 2ZCKL 3MOAL 2VLRE 3QJFB 4M6NL 3RZWA 3UJTL 4X4YA 3W11C 1LWRA 4J8RB 3C60A 3ZKXC 3QUXD 4UBDC 1RPQA 3H2WA 4PLJD 3QA3A 4PGJA 5E03A 4PYHA 5GZNC 5HYJD 1FNHA 1A7BA 1OPGH 1QR1B 1KEMH 2CO7B 2P8PA 3W0WB 3ZHLA 1AKJD 3F12A 3L3JB 3MLXL 4JPWL 4GH7B 3FO2A 4CW1B 4KI5E 2FSEA 4XPAH 2R0WH 1PY9A 2A38A 4TOYL 3MV7D 1EA9C 2BX5A 1FNFA 2JTDA 2ZNWA 4JPVH 5EUKB 3GNML 4OD1L 4DGIL 5GJTH 5LCVH 4JZNA 2ERJC 2JK5A 4QNPE 4HG4J 3H6JA 3ARBD 3HAEB 2ZUVA 5ICXA 1QZ1A 3AS2A 5CWSB 3CVIH 3U2SB 5TDNA 5KAQF 3VXUB 3TJEL 5I6XB 4OCNC 2ZG1A 1N0XH 1A4KA 4H20L 3BDBA 4ZUUA 1ZGLP 4D8PB 3SE3C 1UB5B 1JFQL 3RWDB 5FYKH 2VLLA 3MRHB 3O2VH 3IDXH 1FAKT 3TP4A 3IFNL 5EWIH 4YH6A 5CSZA 1KTLB 4TULL 4G6FB 2E9WA 3CCHB 1RZIA 4WEBL 2YRZA 5DRNA 1PVHA 2GI7A 1JZ3A 1S7WB 3FCTA 1IKNA 4FRWA 3B5HA 3FAXA 1UWEL 4YK4B 3WXWH 2NX5A 2ENYA 1T83C 2O5ZH 4X7SL 3VFTB 1DQQB 2F8OA 2QL1A 2GEEA 4P23C 1JGLH 3GMQA 1QFHA 3L7EA 4LLQB 1K8IB 2P43B 1RZKL 2HFGH 3S35L 3DRTA 4NKOB 1BJ1H 1SYSA 2EDXA 4JRXB 1TTFA 1KJ2B 4JKLA 1IC7H 5ANME 5D9SA 4NN5C 2IEPA 3PHSA 3B5TA 4P46A 4PJGB 35C8L 5EBLB 1FN4B 1F4HA 1MPAH 3QDJD 3G6AA 4PJFB 1YJDH 4MQTB 4G9FB 1MFBH 1HN1A 3CFDB 1RZFL 4OZHF 3IGAB 1G0XA 3NFPB 4EXPX 2A74A 3S37L 1XGTA 2QSCL 5FYLH 3QHFL 1ZHKB 3FB8A 1NLDH 3IETB 3NFSH 2OL3A 5GRXG 2PO6B 3TV3H 1FIGL 5DC9B 1Z2KA 3A6OA 3F7VB 3UYRL 5LVEA 3SDCD 2J8HA 1PBYA 3HHRB 4ZAKD 5C7XH 3WJLC 5KSBB 3IVKB 3SGDI 2E9BA 3UTSE 2BP3A 4X6EB 2C4FT 4LARL 5CJBA 5HHOA 3L95A 5DJ8A 4MAUL 1D5BB 3REVB 2ICEB 4NQDE 2WP3T 3QUZD 3AS1A 1UENA 2AV1B 1PGRB 2EO1A 4UMGA 2CUHA 3DUSB 4Y16C 4XT1C 5HDBF 2D0GA 4P57A 4PJDE 4ZTOL 4XCFL 1Q72H 3HZMB 1DR9A 4FQPA 4IOIB 5E7FA 3SE8H 5HPMB 4R3SA 5CBAB 3RI5K 5DQDL 3QEGL 4MDJB 5KJRL 4M43L 5LQBH 3OWEA 4LEXL 4MXWL 3V4VL 1A0QH 5FUZH 4YHZL 1W8OA 3T0EE 3KGRA 4QGTA 3HE7D 5DFVC 5HHMB 3TCXA 3IDMA 5I1IL 4HFWB 1P1ZB 1VGEH 3JV4B 3SKUD 1FZKA 3HS0A 1G9EA 1T7YA 2CO6B 5I71C 5D2NE 1DSFL 3HNSH 4CVZB 5DR5H 1JGDB 4MDIB 3FKUS 1ZT1A 1A7NH 3LCYA 4WRLA 3MXWL 3OKEA 3PJSB 1B4JL 4QHKI 5H37H 4UDUB 2HLFD 3THMH 3VXOA 3WV0A 4OT1H 2R69H 3LV3B 4QRRD 3IJSA 4PRHD 4F7TA 1DFBH 3MA9L 1QSED 2HWZH 1YEJH 1DJSA 1W2KT 1A3LH 2DS4A 4R96B 4JFDE 4LRIC 1LEKB 4NBXB 1AIFA 4M7KL 4KHXL 5F9DC 4Z7UB 2BY1A 2VXUL 2NY4C 3QEQB 5CSBA 3EDKA 2Z8SA 4JDTH 2WSKA 3O2DL 3QT2A 2IANA 4X6DE 4IRJD 2LTQC 4GKSB 2A73B 2LU4A 3T1FB 1OGAA 1UJ3C 1BM3H 5EOTB 4EI5A 3ARVA 1RIHH 1OTSC 2Z31B 4V2CB 3TPUB 1IM9D 3D69A 5DD3H 4HIIA 3O6FD 4XPTH 3DI3B 3BSZL 2CDGA 2VE6B 3TBTA 2RHEA 3GHBL 3MNVA 1EUTA 3BW9A 1T20B 4LEOB 3TN0A 1MY5A 4O51B 4ELME 3D9AH 1HILB 5I1DB 3C6LC 4RMWA 2V6HA 3T77A 4CMHC 4EUPB 4XWOC 4ZFOL 4YHML 2WLYA 3WSQL 2VYRE 4WI2A 4GBXC 3ZHDA 5LBSL 1UXSA 3EOBB 3KLAA 4OCWL 1FO0B 2DDQL 3BJLA 3FQRA 4R90H 2ITDB 3D85A 3HUJE 2QQKL 4G8GE 5HYSG 2IWGA 2OJZH 1HH6B 2AXHA 3EZJB 2DQEL 4TSAH 4CU6A 2DL9A 4JHBA 4XC3L 4L4VE 1MF2L 3UAJD 3HTLX 1TQCC 1CGUA 4XVTH 1T7WA 4IMKA 4HGWA 1V7ML 4OZHA 4I48A 1TMCB 4GLRH 4OZGA 1U91A 5C0IB 3I2CH 1JTPA 1NGWB 4PR5B 3RL2B 3RZCB 1XGRA 2EDHA 4OV6F 3ZKQD 5F7DB 5MENA 3NGBC 1GGUA 1FJ1A 2Z4QA 1YN6B 1B88A 1WV7T 1TJGL 2I60L 4J23A 4U33A 4JFOA 4D0DB 4TUKH 5TPWH 1IAIL 3MRFA 3U46A 5FM8A 1OWWA 1U8PB 4CADA 3CU1A 3CFBB 3FOMB 3RGVC 5BQ7B 4HKZB 2VAAB 4HUNB 2CMRL 1A6AA 5FYJE 5GSVA 1WIUA 3QPQD 2DJ4A 2VDKH 1YNTB 3FAWA 5I2IB 2DQDL 3NACL 1LDPH 3FHAA 4NRYA 2YSSA 4LIQH 1TXKA 5E95B 4KRNA 3QUXA 3N85H 2ARJB 2WIMA 5HYJA 2FZ3A 4EOWL 4F2MA 1CR9H 1YMHA 4AYFA 1ND0A 4Z7VF 1WC7B 1RZGA 3GKWL 5IMLA 1AKJA 1FCCA 5FO8A 3WDIA 1I7UA 1LNUA 3BP6B 1M05B 4GW4B 4NC1C 4PJHF 4NCDA 2VN4A 1WZLA 5CEZE 4OFPA 2XA8H 3MV7A 1ZWIA 4F9LC 1F4WL 4MNGE 4L3ED 3UPRB 4BQ9A 1FP5A 4Z7WB 4IOFD 3MTRA 4PTTB 5GRJH 2FHBA 2AEQH 3BD3A 1U8LA 2FIKB 4X6FA 2PETA 1A7PH 5IROA 4JZJA 3ARBA 4X99A 4CAGA 3ULVC 3MV9E 1FFNB 3TBVA 3RWHB 3TIDB 5C2BH 3O8XD 2DIBA 2O61A 3VH8G 3MLZL 1U3HD 2A83B 3DX6B 4KJYB 3VFWA 3X3GL 4HUKB 3OG6B 3SPVB 3F62A 1RUPL 2V5YA 1U6AH 4Y5YB 3MCLL 3ALPA 5IIEB 2WINB 5A2FA 1R3IH 1OARL 5HHXL 3MRRA 1O5DT 2MMXA 4QRUB 3QIWD 2H32H 1K4CA 3MACH 3ROLB 3LEXB 43C9A 5L0QC 3OPZH 4L8SA 3D5OF 4LPUA 3W0WE 5I66B 2DI9A 1KJMA 3T2NH 3LDBC 1LK3H 2X44D 4U1KB 2Y6SC 3AU1B 2HMIC 3GBMH 4TTGA 3CXDH 3JTTA 1T3FB 3SQOH 3BGMA 5IKCA 3L5WA 4K3DH 2V2TA 2NLJB 2VL5A 4YPGB 2IMMA 3X13B 1A4JA 1M7IB 3I02A 2F9BT 3VFMA 1NBVH 1MRFH 3MLSL 4LSVH 1SJEA 4O2EB 1LK2B 5TE4L 5ISZD 3P0VH 2EXYD 3TA3D 4G5ZH 2VDML 3RVVC 1YY8B 3PWVB 3V0WL 1A6VL 3EO1A 1G7IB 3QDJA 4NNPL 2WNGA 5ALBL 1MCWW 4P4RA 1XIWC 4UT6L 1SJVA 2ARWA 1OHQA 5HHNB 3DTXA 1NH6A 3VXUE 5HI4C 5B8CB 3QHZL 2EZ0D 1N2RB 4QT5B 1VSCA 4NFBA 2AQ1A 4MJID 3HRZA 1U92B 3C2AL 2FEDC 1LE5B 4EBQL 1CGYA 2BSSB 4FZEH 3NCFB 3DV6A 2EECA 5DC4B 4M1DH 3SDCA 1H5BC 3G6JB 4ZAKA 5F89B 2YUVA 4KTEH 3A0OA 4KAQL 4U3HA 1J8KA 3FOLA 3CXHJ 3TLRA 5INCA 1K85A 2G5BA 2IQ9H 3QRFM 1KELH 5E4EB 4AM0A 3QUZA 2DM2A 5F3BA 2ICCA 1JYNA 2VLJD 4NZRH 4RGNC 3NPSB 1NGYB 4XCNB 4JRXE 3EHBD 4FP8H 2ZZUT 5F21B 1E4WL 2NTSP 2YK1L 2Q86B 4YHNB 1CLCA 3T2PA 3KPRA 4RDQG 2Y5TA 4Z7VA 1BAFH 2VL4A 1IGIH 5JIKA 4PJGE 3UPCA 3FMGH 4J3SA 1CXEA 4IDLA 4NBYB 3R06B 3OJDB 2RFXA 4PJFE 4PJHA 4BQ8A 4OLZL 4G9FE 1KENH 4KZDH 2KDGA 1U2CA 2EE3A 3HE7A 1EUUA 3KXFD 1OP5H 3QIUD 1BOYA 2ADIA 4EJ1C 1CE1H 1JNJA 2FX8H 2ZG2A 4X4ZA 1EHXA 3BP5A 1EPFA 1HCFX 3WS6C 4CVXA 2DKUA 2FBJH 2FJGB 4JG0L 4BQBA 1I1AD 2EE6A 5IBUB 3EGSB 5DJXB 5DD6A 3C5SA 4XTRD 4QRRA 5HVHB 1ZV5A 4LSRH 4ERSH 2VDNL 4PRHA 4NRXB 1UWGL 4GRMA 1EHAA 1QSEA 1D5ZB 5T1LB 5KSBE 1GGTA 5FYLD 3VXQA 3REWB 2CIIB 3VFUB 4OI7A 3FB5A 2BOBA 1YEKH 3P30L 3ARED 4OZFH 4D9LH 2BVOB 5GISH 4PGDB 2IALA 1WWWX 2J4WL 1UCBL 4HUVA 4ISVA 2BJMH 3E6HB 3KNBB 1F11A 4IRJA 4QHLA 4BZYA 1J10A 5GXBB 5JOFA 2A6DA 3LKNA 4N8VB 3WFDL 5JIPA 4JY5H 5CJQH 2R2HA 3KG5A 2H8PA 2X70A 1IM9A 3BD4A 4WFED 2DYPB 4YC2B 5EU7E 1IAKA 1P4IH 3GSVB 4YHKH 3Q0HA 3O6FA 4M3JA 4ONHA 1MCDA 4MXQD 3DX8B 4OGAC 2XFXB 1G6RH 4H26B 5T5FL 2BNQD 4HWZA 1DBBH 5JW5A 2R0KL 5HHME 4OJFL 5FUCE 5KSAC 1XGYH 5H8DA 1Q0XH 5I1CH 1ZLSL 1XF1A 1ACYL 4R7DB 3FO0L 1ZHNB 4OF7A 4UIMB 1X5FA 2Z35A 3TJHD 3U9UB 4DQOH 2GITA 3ZE0F 2UWEA 5MEPB 3TYGH 2DQUH 4HUUA 2Q3AA 3DURA 1ZS8A 4KVCL 4HH9B 1GHFH 2R4SL 1LD9B 4X9FA 5DJ2A 3H9SB 5ENWA 2IH3A 1LILA 3KYKL 1T0NA 1HQ4A 5JR1H 4YGVB 4LHQB 3LKPA 5FIEA 3PL6C 5EC1A 5FCUH 1ZSDB 2ZOLB 1KG0B 4DKDC 3IXAA 2OX5A 4Z7UE 3HN3A 2XN9D 3QEQE 4PJ7A 1C5BH 3RVTC 3PP3K 4JM2C 1KCVL 5IW1A 1JZ6A 1DLHB 1MCPH 1RU9H 1T66C 2WBJD 3UTTB 5DS8A 2P24A 5ECJE 1CGXA 3V79C 3O0RH 3TBWB 1GOGA 1CD1B 1UT9A 4KKBC 3WN5A 1CI5A 3H7BA 1WBYB 4N0CD 5I30L 2YD9A 4L4JA 5IWLA 4H1LB 5K33A 3B5GA 3JZ7A 4LCWD 4TVPH 2AQ3A 3O3DB 2NCMA 4XNXL 4LNVA 2D4DA 1U3JA 4GRLD 1FNGA 3GB7A 3R0NA 3SJVB 3KPOA 5JUEL 4PJDF 1YEIL 3W2DL 5GGTA 4XVUC 1INQB 2YBRB 3VCLB 1MHHA 5GIRA 3R8BB 4A6YB 3E0GA 3MREB 3HI5L 3CDYA 3MJ8B 1AGFA 3D3VD 5FDWB 5E6IB 4EQ3A 2PXYD 1QFWH 5MI0C 4X9HA 2B1HH 2WUBH 4IDJL 2K1MA 5ERWB 2R39A 2F53D 1QBAA 3GMOB 5B3NA 4RFNB 1RVFL 4KRLB 1FFOA 5DJDB 4L8CB 2MNUA 4AENA 1UYWH 1G84A 1P4BH 1DEEA 5CMAB 1P7KB 1A3RH 1OQXA 5BMFL 4WFFD 2CQVA 2J6EH 2ESVB 3S3PA 2BERA 1ZLWK 5EU4B 1J87A 3TO2A 1ZTXH 3U4EB 4L3EA 4D9QD 1S7XB 4IRSD 1MFAL 4K7PX 4XXCC 1MRCH 2DWDA 1CN4A 5F9OL 4JHZA 3EDJA 4KKNA 1MCCA 3T65A 4HDIA 4ODXA 4XPGH 4XBEL 3ARPA 3QIBB 4BQCA 4ZUTB 4LCCC 4Q97A 1YNKH 4MMXC 5ESVB 5JTWA 4DGYH 4GAFB 4KDTC 2V7NA 3QQ9C 4X6DF 4LBEA 1UACL 5KVDH 3O8XA 3HKFA 1CBVH 4ODTH 1QP1A 4X7DC 2AJYH 4PRPD 5J1AA 1FH5H 2DWEA 4NNXB 3VFNB 2GJ6B 4U2YA 3UBXI 3WHE0 1J5OH 4KQ3H 3F5WB 4AL8L 1NCAH 4RMVA 5F6IB 3L3GA 3LKOA 3EYFA 5EBMA 1TZGL 1NMAL 1XH3A 3QIWA 2JELH 5F7EL 1WZ1L 4IM8A 5DD5H 2VIRB 1XGQA 1A9EA 2ICWJ 4ZFZB 4ELMF 3P4NB 3ZDXF 1EJOL 4FQXC 5DA4A 2X4UA 3C09B 4WI5A 1XF4A 5HHVL 5TJWK 2R29H 4J6RH 4Y88A 4Y89A 5TQ2L 4LCUA 3PGDA 1LEIB 3OHXB 3L3OB 4KJPD 1WZMA 5D2LF 1AGDB 5IQ7L 3OKOB 4Y4FD 1J0KA 3HE6C 2CGRL 2J5LB 3IRPX 4YE4L 3OF6D 2VR4A 4Q0XL 4WUUB 4Z7WE 3VFOA 4DZBB 4E41B 2D7OA 3W9DA 4HS3B 2OM5A 4PJBB 3IAPA 2YPKA 3ZT6A 1EBPA 3BIAX 1KN2H 1JNNL 1X5KA 4KKCD 5ISZA 3TA3A 3WFBL 3V5KA 4RNRB 2WIIA 1C7SA 2P5WB 2O26U 2MOVA 3MLVL 1CLZL 3MLTA 1CG9A 3OAUH 3IFPA 4ZUVB 5T3XL 5E8NA 3DMMB 2OP4H 1OAQH 5DO2C 3BO8B 1HQRA 3O3BB 3RKDC 1SEBB 4U7MA 4YDLC 1FBIH 4MJIA 2XWTA 4I18A 3K7UA 4PJAB 1UH3A