4JFFE

Preservation of peptide specificity during tcr-mhc contact dominated affinity enhancement of a melanoma-specific tcr
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
245
structure length
245
Chain Sequence
MSQTIHQWPATLVQPVGSPLSLECTVEGTSNPNLYWYRQAAGRGPQLLFYWGPFGQISSEVPQNLSASRPQDRQFILSSKKLLLSDSGFYLCAWSETGLGMGGWQFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title T-cell receptor specificity maintained by altered thermodynamics.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
total genus 48
structure length 245
sequence length 245
ec nomenclature
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jffE02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jffE01
4G9DB 3LMJH 3MLZL 4DGYH 5T1KD 1KXQE 1ZWIB 1OSZB 2HP4A 4HV8A 3WNNA 3EYOB 2EEDA 1E6JH 5FO8A 5DT1L 3U7WL 4GKSB 3RZCA 4ONOA 3MO1B 1W8NA 3FCTB 2UZXB 5EO0B 1BZ7B 2EEBA 4UINH 4FXGB 3SGDH 4URTB 4KJWD 4KI5D 4Q7DA 3T2NH 3QDMD 3FT2A 3JV6A 3Q48A 1A64A 5ICXB 2VITA 3CLEH 4WO4A 2YUXA 3P4OA 4WO4D 1IEAA 3Q6FA 3U0WH 3DETD 4CJ0A 2YWZA 1U8NB 3WN5C 4JHAH 3ULUF 3P4NB 1T0MA 3CFCL 2EKJA 2QHRH 1F4XL 3IF1A 3LKNA 4RWYH 4LVHC 4K94L 3V7MA 2YMXH 2R8SL 1HOCA 1XR8A 1FC2D 1LO3H 2FD6H 3NAAH 3BKMH 4JE4B 3EDEA 3U46A 2D7MA 1KULA 1NBVL 1QR1B 2NY1D 1RU9H 3K3QA 5I71B 1W72B 1JYVA 3A67H 3FT3B 1WZ1L 4M02A 2FJHA 1NGYA 4Q97A 3WHXB 2DLGA 2QQNL 1RVFL 5AWNH 3IAPA 3KJ6L 4NRYA 3O81A 1MRCH 3S36L 1U58B 3WUWB 1MCJA 1A0QL 1PX3A 2R1XB 4X6EB 2Y36H 5DO2C 3VFPA 4GUPB 4YX2L 4OT1H 2DM7A 5CFHA 3X13A 4JM2C 3G6JA 1BREA 5J9PB 4O5LL 5D70H 1P4IH 3LD8C 3NIDF 2R1XA 1KJ3H 5T3XH 1PBYA 4IHOB 1KC5L 4D9RE 2D4FA 5DTFB 3D5OF 4PBXA 2DQCL 4DN3H 1I8KB 1QSVA 4YFLI 3ARGB 4W6WB 1LQSR 3BHBA 1J1OL 1GZQB 4Y0GA 1FZOA 5DD1L 2AEQL 4G7YL 4H88H 5ISZE 1T83C 3OHXA 1QFWH 4KVNL 2R69L 1QFUL 2VDOH 3W39B 5CUSL 4LSPL 3KYKL 4XC1L 3SCMA 4OGAC 5DJ6A 2GJ6A 1UA6L 5E2UL 1EHNA 3MJ7A 5HGHB 2C4FT 4AZ8A 5C0JB 2NYYD 6FABL 4TN9A 4MNHB 4ELMB 4TNVK 2ADJB 2ITCB 2XFXA 4BM7A 4POYA 4PJHF 3F7YB 1I1CA 3TN0C 4LFHD 4RGOH 1A4KB 4GRMA 3FMGL 2Y5TB 4OLYL 2OR9L 1OAUL 4RAVB 1JHTA 4HJGB 4KI5E 4C56E 1QKZL 1AIFA 1FYHB 4OT1L 5IVXF 1IARB 5DI8A 1II4E 1LP9F 4FTVB 4O5LH 4PRBA 5D70L 1YEKH 3H9SB 1AFVH 2X05A 4JM2F 4XCYA 5CHNB 2E3VA 4F7EA 3FOMA 1RFDH 2DOCA 2JB6B 3IFNH 1OW0A 5DD0L 4UZGA 5E8NB 3QXAA 1FNGA 4QHMB 4ZFZB 5HYJA 2BVUA 4U0RB 4NWTL 3P0YL 5I16B 4OCNC 1MCQA 5CGYC 5DHVH 43CAB 5E7FA 3ZTJH 4QOKD 4MD0B 4ODVH 4JG1H 2GJ6E 4OUUB 2BNRE 4U6YA 4QF1B 2E7MA 3G5YB 4X7DC 1X7QB 3WDJA 1R3LB 2IBGA 3PL6A 4DUWA 5LXGH 2HKHL 3PL6D 4ZS7L 3P30H 4LLMA 3VXPA 4M1CD 3AM8C 3GK8L 5L9DL 4JFOB 4OCMC 1EMTH 5CP7B 1NCBH 1MUJA 4HFWA 5F7EH 1GPOL 2GQHA 3EDDA 1LO0L 1DN2A 2CDEA 1KIUA 2EZ0D 3B2UD 3WN5B 4L4TD 3RIAF 3QQ4B 3ARXA 2ZCLH 1MCDA 2EDDA 5CJXA 1RUML 3SDAC 4YDVB 4E9LA 4FTVE 4ZNEA 5L2JB 3EOBB 3MA7B 1D6VL 2DJ4A 4OCWL 3VD9A 5IHUL 3MMEB 3R1GH 2NLJB 4MJ2A 2IH3A 1IRAY 5I1LB 1YN7A 4BSJA 4EKXA 5IHZA 4KTDH 1ZHKA 1EEUA 5KVGL 1Q9OA 2DI9A 3O2VL 4WUKH 3WMSA 5L2KE 4LLVA 1BQUA 4O58H 5TDNB 3CDFA 1AO7D 5F89B 3ILPB 1BAFH 1HI6A 1JPTL 4XWGL 5CP3A 1QSFA 4O2FB 5J7CC 3Q6GH 4EDXB 1ZANH 2FR4A 1FFQA 5CLTA 4JG0H 4NPYB 4YHLH 4OM1L 2VDPL 3IJYA 3QXDA 1AD0A 2B7DT 3LKRA 4NQDD 1NCBL 3GBNH 2Z8WC 2E7LC 3WSQL 4S10A 1FNEA 2NTFA 1BOGA 5I1JH 1U91B 4PJIB 2HFEA 4JZJC 3V4VL 3CSYB 3ZKND 4KKLD 3R0NA 4MCYB 4HUWB 4HSQA 4OM0H 2H2PC 2J8UA 4I48B 1DZBA 3FL7A 1RZJC 4ENEC 3V0AC 4HJ0D 4N0CC 3OKNB 4X4MA 5FOBA 5T1LD 1BX2A 4Y5XB 2R23A 2YPLA 1AHWC 5KVDH 4JFDE 4QGYA 4LLQA 3DV4B 4P2YA 2MJWA 4G9DA 2M8XA 5H35A 2VLJB 2WQRA 1N6QH 5I8OL 2BXYA 3QDJD 3BIKA 4NZRL 4ERSL 5CEZE 5M94B 4E41D 3OKOA 3MRHA 1CFTB 4OIIL 2DQHH 4QHUB 4P5KA 5C08B 5IESL 1LD9B 3J7HA 3BKCH 1IM3B 1RZKH 3B3IB 3KG5A 3QWQB 5F7NC 2P8PB 2WK2A 1JRHL 3Q1SH 2EZ0C 4OZIF 3C2SA 2HAZA 3FO9A 2A6JA 3RBSA 4EI5B 5EUOA 3I6GA 5GS0D 1UACH 2A0LD 4AIZA 3P11H 1AXTL 5JXAL 3GIZH 1H5BB 3ZKQD 2AJ3A 4M7JH 3N85L 2ZUQC 2WUCH 4PGBA 5EWIH 5TDPB 3ULVD 3OR6B 5C0EA 1XGUA 4M93C 3PWUB 3SDDD 3GMOA 1ZMYA 3BO8B 3FB7A 3IJYB 43C9A 4L3EA 1C5CL 1GHFH 5JIHA 5HTSA 1DQJB 3S36X 4DQOL 2PN5A 4MAUH 5DC9B 5KVEL 4XP1L 5BJTA 3ILPA 5JIIA 5ID1A 3DSFH 1BIHA 1A9EB 3RVVD 4MA1B 5F6IB 2EDQA 3NFNA 1IQDA 3QI9A 1FZKA 1A3RL 5GS2H 3CMGA 1S9YA 4UDUB 3WL9B 5D96B 3RIFK 1HHIA 1MQ8A 1PG7H 3B83A 1GGIL 4F2MA 1RIUH 1QA9A 3K81A 5A43C 1ACYL 4R96A 4OFPA 3JWOC 5ESAB 4POZC 3HB3C 4ELKA 5F7UA 4PLJC 1FFPB 5T1MB 5DYOA 4RQQA 5HYJD 3VFWB 5F9AC 4R4NC 1AH1A 1TZIA 1EFXB 5AYQA 3SDYL 4L8SA 2VN4A 2Y25A 4HKJA 1J0IA 3RU8L 4IOIA 4BFIA 4MX7B 1T7WA 2N4IA 4JEGB 3V5HB 5I9QB 1HCFX 3O4LB 1NBYA 1QRNE 3E0GA 3KYNB 4WY7H 3IS0X 4GOSA 4FG6C 2C3XA 4YHNB 4JFDD 5DLML 1NC2B 3NCJH 1KYOK 4P2OB 4Q9RL 1NCTA 1AO7A 4KRPC 1TJHH 4X5WA 5E8OB 1NC4B 2ESVE 5MERB 1LE5B 5DDHA 5C7XH 3IAGC 3OAYH 2IALB 1JGLL 4RX4D 4NFDA 4Z0XA 2JB5H 1R3KB 3T0ED 5IHUH 5L2KB 1CDBA 1NUDA 2QSVA 1KPUA 2ZOKA 3KHQA 2X1PA 4WI9A 4MZ2A 3H9SA 2LV4A 2AJYH 1UWEL 2APWA 3SOBL 2XN9B 2EH7L 2R2BB 2OZ4L 4X80H 4Q9QL 1MFEH 3HUJE 3O4LE 2OLDA 3MSPA 2PYEA 2JJTA 1D5BB 3ISWA 4NO3B 1BD2A 2VIRA 3G5ZB 4M1DL 3V0WL 4GRMB 3QXUA 5I0DA 2VZ1A 5I1HL 1X6NA 1KENL 1AGDB 4TUKH 3QRGH 1S78C 4NQXB 3DX7B 3H7BA 4HIEB 3RDTB 4A6YB 5MEOB 4CBPA 1PKQA 1LE5A 4LAQL 4WHYG 2J7LA 4OZFB 2B0SL 2P49B 1EX0A 2GJ6B 1M4KA 4V1DE 3I02B 4QHNA 3LQZB 1XF3A 5B22A 2FYYA 5I2IB 1IC5H 1T7VA 1F6FB 2NXYC 1FZOB 4OI9A 3BHBB 2X42A 4AIOA 3GSXA 5CKAA 4PREA 5IQ9A 3I50H 2X4RA 5JHDD 2QEJA 1PGRB 3KPSA 12E8H 4TOYH 4F7TB 3LDBC 4UI2A 5D93B 1M05B 3VW3L 1FNAA 4LNVA 1NANH 5HYJE 1BQHA 3RKDD 1IGJA 2F5AH 5T1DL 4IDLA 4YHML 1V05A 1UM5L 5ESAA 1G9NL 3T0WA 4PB0H 4KY1H 1U58A 4F9LA 2VLMD 2C4FU 1EXUA 5FCSH 2BHYA 3O4OC 4Z77A 2YOCA 3QFJE 5GGUA 4H8WC 4YHIA 3REWB 2AK4A 3PDOA 1L0QA 1P4IL 3RWHB 2ADIA 4GW1B 5ADOH 1R0AH 2GYSA 1G6RH 5IW6B 4BYHA 1MFCL 2XG4A 3HZKA 1HQRB 2VDQL 1GGTA 5D7KE 2B20A 1HK6A 5CSGA 1IKNA 4Q2ZB 1Q9KB 4K9EC 5GGVH 2DB8A 1XCTA 1S7SA 2AQ2A 4R3SB 3G04B 4YK4B 2QQLL 2B4CC 2IMNA 2XQYG 4XNZC 2YA1A 2F8OA 2F53A 4ZFGL 3OB0K 1OF2B 4GMTL 4PJXF 3S98A 4JB9L 1U8NA 4I18B 3I2CH 3DSFL 2F54A 1FG9C 1RHFA 4M8QA 3Q6FB 4NFCA 1BFOA 3CH8A 3HC0A 4G43B 3H9HB 3FAWA 2FGWH 4BH8A 4NBXB 4PLKC 3L9RB 4NQEB 3OKLB 5J3HD 2YD6A 2A77L 1L7IH 4UNVA 1T22B 2D7OA 4I4WA 2HKFL 4QXTB 1QLRB 3QPQC 1WEJL 2P8PA 1QTYT 3ZE0F 4NKMB 2BXZA 1CFVH 2YN3A 5TF0A 4N9GA 4XHJC 5I66A 4X6BB 4R2GB 3RDTD 1U92A 2O93L 1Z9MA 1MAJA 2XI9A 5DK0B 1H3XA 1U6AL 4JQXA 2FB4L 1OSPL 4I3GA 5MI0B 4AEHH 2H8PA 2ID5A 2AXGA 3OJDB 4XVSL 1KUMA 5CKGA 2A2QT 1A2YB 2OR7A 1A4JB 5J12C 3S5LB 2COQA 1OARH 4NJ9L 4Y5XA 3O11A 4RMTA 1INQB 3BN9D 3B4NA 2APFA 3MV8A 4YDLC 2PW2B 5K9OB 4XNMA 3DX9A 4R0LC 1NCCH 2OK0L 2J5LC 4ZYKB 3IDIA 2DL9A 1GGBH 1HXYA 5BRZA 1P84K 1FDLL 2YRPA 1XH3B 4N0CD 2E7LA 5HVGB 4PRIB 4W70A 3O8XB 3VDCA 5D1XC 5EOCL 5F6HI 1W0YT 1UB6B 4LKXB 3N9GL 3B2UC 4JFYB 2NTSP 4YWGH 2Z31B 1E4XL 2V6HA 3JBG7 4OFYA 3CGTA 3STLB 4NZJA 4MJ6A 4IRSD 4LEXH 1T1WA 2AJZA 1QLRA 3UTSE 3MV7A 3ZE2E 1R5WA 5GGQH 3NZHL 2V2XA 4XPHL 2ZJSH 3O6FC 2CDGB 1FL3B 4AT6B 1EA9C 4JY6B 5FUZL 4JHAL 1CDUA 5GGTH 4LASL 2NLJA 1YEHH 2ZUSA 4WNQA 5DMKA 2FH8A 4IRJB 4RA3A 4Y4HB 3SJVD 4FQIH 3T08A 4L9DA 1WFTA 1FNHA 3P4MA 5KTEH 1QBMH 4XPAH 4JJ5B 4NCC2 5B8CB 2Y72A 1UXSB 3TYGL 3BH9B 4TTDC 1KPRA 4KRLB 5CP3H 1UJ3C 5F9DC 4CADA 4Z76A 1A5FL 3GMRA 3TBVB 2AJSL 3P73B 1TZGL 4RDQF 1P7QA 3MRBB 4QRTA 1A3LH 4HEPG 3CCHB 4W4NA 4IIQB 3ARBA 4WW1A 4LDEB 1IGTB 1F2XK 4MGXA 2BSRA 4OZHA 4GRWF 2R2CA 2V9RA 3BESR 3ZYIA 3MV01 1WT5C 3QG7L 4QF1A 1OT1A 4KV5F 4TUOA 1CLOH 4P4KB 4HH9B 3BXNB 5C0AB 1A21A 4N8CL 4P2QE 2F5AL 2IANB 1F3DJ 4MXWL 1UENA 5GGSY 3FRUA 4XB7A 4NUGH 3ZT6A 2JB6A 4RFEB 3DWTA 2Y1VA 1HYSC 2YS4A 1JWMA 2M26A 4AMKL 4JPKH 1XIWC 4S11A 1EBPA 1MAKA 4YO0A 3TJHD 4CU7A 5JO5A 4Z5RA 1JNNL 2GFBA 1CICC 4JREB 5HHVL 1QNZL 1ZAGA 2AJVL 3AM8A 3OPZL 3WE6B 4P46A 1LO5A 4HHAB 2HN7B 5IMKA 3ARDB 2AK4D 2LVEA 3QFJA 3RWGA 3BN9C 3BUTA 5IESH 4PV8A 3NPSB 1MFDH 2EDLA 4S1QH 1AQDB 1JFQH 1QD0A 3MACH 4X5LA 4F7CB 3L3HB 2PO6C 3OXSB 4TVSa 4M7LT 1TITA 5DHVA 5EFIB 1LEKB 4A2LA 2B2XL 2PYFB 4PG9A 5D6CB 4JFFD 4G6FB 4PV8B 3SDAA 2ENYA 3DI2B 1VACB 3VH8G 1X5KA 5IMKB 2J8OA 3G5ZA 1ZK9A 1Z5LB 1I9RL 2VIRB 2XTJB 1KG0B 2OR9H 5DEGB 1UVQA 1U8LA 3VXMB 1IEBB 4G8IB 1OAZH 2RIKA 4YDLB 3JTSB 3W5NA 3MYJA 2C9AA 3LS4L 3L3KB 3KHOA 1OP9A 3QDHA 5D7IE 4Z5RB 4NDMA 5EZJB 4PJ9A 4TUJA 3FO2B 1TPXC 2XV6B 3MV8D 4O4YL 3B8SA 3OX8B 4ZUSA 2CLZB 3N06B 4DW2L 5DMIL 3SJVE 5FYLL 2Y36L 4Q0XH 2Y07L 3FO1B 4G6KH 1AO7B 4GRWB 4NN7B 1O0VA 3SDDA 3QIBA 1LO2L 3JV4A 5JNYA 2NCMA 1HSBA 5KS9F 4WDIA 3GSUA 1HHJB 4KKCC 3HC3L 5KVMC 1G9MC 1IGYA 2X89A 1B3JA 3HNSH 3FRPA 2ZCHH 1QSED 3PWJA 4HWBL 4ZNCD 3PWLA 1OP5H 4C56B 2XN9D 1XT5A 3GK8H 2AEPH 3BAEL 4YHLL 3KPTA 5C09E 1WTGT 5GGSB 5I76B 1FO0A 3MRDB 1S9WA 4D9LL 4O51A 4N8VB 3MRJB 1MCOH 2XZCH 1S7RA 1VFUA 3OXRA 4YK4C 3Q2CA 4WWID 4P9HH 1RULL 4ZFFB 4OFDA 1I7UA 4PP2B 5LBSH 4D3CL 4PJ8C 1Y0LA 3IRZA 4R96B 4D0BA 3IETB 3STBA 4B41A 1NLDH 1U8QB 4EN3A 5GRJH 1JYWA 5I15H 2FO4B 1NEZA 1B0GB 5E94A 4GMTH 4ETQB 5GQBA 5JQHC 4YBQC 5DS8A 1I7TB 1A1MB 3P4OB 5D8JH 2VOTA 1BD2E 4JDVB 3CVHH 3JWOH 2WMPA 4PYGA 3CFBB 4MJ6B 1FIGL 1SEBB 3D85B 4UMGA 4JFED 5ICYB 4F9LC 4EQ2A 5ACZB 3G6AA 3OB8A 3SE9L 1K8IB 1OSPH 3ES6B 1FNSH 3MBEC 1QLEH 3C60B 4ZXBD 5CZVH 5DURB 4CVWA 5JPMB 2ED9A 3O8XA 3ARDD 1KJMA 4YDIL 5IB1A 5CGMA 4Y5YA 2VDKL 4G8GE 1A7QL 2IJ0C 5C09B 4G6AD 1BM3L 1JN6B 4X5XA 1NUGA 2FECI 3EOTH 2EKSA 4UOW1 4WI6A 5FYLD 4ZTOH 3GSNA 5EU4B 2AV1A 5CEXA 5L88H 4OFIA 3GO1L 1JPGA 4XNMB 4HAFA 5JW4R 3SDXA 3CFDB 2DWEA 3GJEB 3LPWA 4KUZH 5KSAA 2UUDH 2QBWA 1FVCA 4GKNB 3VG0H 4HMDA 2J8HA 4HUKB 5FYJE 4P59L 5C0AD 5SX5H 3UZVB 4P9MH 3T3ME 3WFHB 4M9OA 2V17H 3BW9A 5DK2B 1IGFL 1HZHH 2EDNA 1A3RH 1N6QL 4ALAH 3PWPB 1TZHB 1MREH 2D2OA 1VCAA 3QQNA 2D7TL 2VDNL 4QLRA 5EO9A 1BIIB 3MZTA 1OTTC 2B8OT 3FMGH 4NYLA 1EUUA 1YEFH 3DMMB 5I1CL 2XXMB 4N5ED 5BO1H 2DQJL 4KI5F 3OKLA 1UH2A 4BH8B 1U91A 1BOGB 1F45A 3DBXB 2EDBA 3GSVB 1E4KC 1CE6A 4ETQA 32C2A 3U7WH 3AC0A 3TM6A 4PS4H 3LRGA 5IJVA 1Q0YL 1YPZA 3K1KC 3TO2A 1X4XA 5EU6B 2FR4B 4OGZA 5BS0E 1WWCA 2AEQH 2I26N 4G7YH 4FQ2H 4UOW0 2Q6WB 3B9EA 4PBWD 1CE6B 3D85D 4Z95H 1JGUL 1A1NB 3D3VB 4QCIA 3IDMB 4P4RA 3WO4B 4LCWB 4UTBL 2V2WB 2V7NB 2Z35A 3WUZA 3QZWA 4JKLA 2OXGA 4M6OL 1ETZB 3HCVA 3GB7A 3VU2A 4OQTA 2VWEC 3BKML 1YY9D 2HT3C 1I85C 4MMZC 5C0BD 1KSRA 2J88H 3I2CL 2P48B 3BPOC 4Y19E 25C8L 1E27B 2NPLX 2IAMD 4OF3A 4K94C 4FFWD 3ECBA 4WI7A 3MLTB 4X80L 3KPRA 4X7TB 4Q9QH 3CAFA 3B9KB 4BJLA 3O6LH 4JFPA 2PYEE 2R4SL 1AGFB 3LH2L 4O9HL 5CBAA 3EFDH 2MFNA 4ZFOA 1J5OL 3GJFH 5BW7A 2G2RB 1K5NB 3NCCB 5E95B 3CFCH 1R3IH 4PREB 5IQ9B 3QHTC 5HI3C 3KLSA 1ZA3A 3L5XH 1JGEB 4OCYH 3MV9D 2R8SH 3D25B 5ICZB 4X6FB 5CLWA 3JTSA 2ADFL 5FAAA 1WWWX 4ELME 5JORB 2OJZH 2CXGA 1EO7A 2OTUA 2PO6D 1HE7A 1G0YR 3HFML 5KN5A 1E28A 2XKNB 1B0RA 2E8YA 3MRMA 5F9WB 1TJHL 4ISVA 3MLRH 1JVKA 2XG5A 4HIEA 1S7VA 4LF3A 3H0TA 3GBLA 3Q0HA 4E42A 2DQTH 3T0EC 5AAMA 4KH2A 2RFXB 4F7PA 5C0BB 4YFEA 4FFVC 4XBGA 1T21A 3VGEA 2VL5A 4KC3B 3BP5B 3RVWD 5LCVH 1TVBB 5CZKA 3CVIL 4PRNA 1OHQA 4LGPB 4NKOB 4HIJB 3MBXL 3G9AB 3DRTB 1UZ6F 5E4IA 4JO2H 5D7LA 4KZEL 5H37H 5L2KA 1U8KB 1VADB 3WLBB 4LSVL 4WFED 2IQ9L 5MENB 4MNQE 3KXFD 3NVQA 2XFXB 1OAUH 2YXMA 3BKYL 5D5MA 1CXIA 5BS0D 1CN4A 3VE0A 3MNWB 4WCYH 3QEQD 2VLRD 4HCRL 4Y2DB 5HI5C 3TZVC 1CICA 3WYRA 2W0LA 2ZUTA 5IKCB 1MIEH 2MCPH 4R8WH 3QUML 3GI8L 1MF2H 1GC1C 4ZXBA 1CDIA 4DN4H 3X3GL 2X89D 2NMSA 2VDQH 4OD1L 4X6DF 3BDYH 1V3JA 4RGMC 3BT2L 5BRZD 5DJDB 3PWPE 3I9GH 1B2WL 4ZO9A 2PO6A 3EIFA 1ZHBB 4YDJA 1CIUA 1SEQH 2V2WA 4TRPL 3EOAB 3CDCA 4S1DC 3DVNB 4NBZB 1S9KC 4GLRH 3MCLH 4CGTA 1F3DH 1K2DA 1MCLA 1T1YB 3V52H 1MFBL 3G6JB 5MHSE 5ITBL 4NO0B 3PDDA 1TCRA 3B6SB 4ZPVB 4YZFE 3DO7B 2NNAA 3NPSC 3O3EA 2WM0A 3ZO0A 3UO1H 2CXKA 2VDNH 4F58H 4M9PA 2EO1A 2Q20A 4FQCL 4J8RB 4RZCA 3HR6A 4N8VG 5F1SA 3FFCD 1SBSH 1H9VA 5DRWA 2CMRH 1A0QH 2H1PL 4Y5XC 3BKYH 3CX5J 5E8PB 2L7UA 1MCPL 4FQXA 2BVOB 4D0DA 4BQCA 5DJZA 3VFVA 4QRRA 4DVBB 4X9FA 4PRHD 4N8CH 5CIPB 3AREA 1R5VB 3KS0H 3RHWF 2L4OA 4NYLB 1N5YH 5F7KC 3STZA 1W0WA 3T0DA 8FABB 5D71H 2DWDA 4GBXD 3NA9H 5F21B 1S7XB 3I84A 1QLEL 4HKBA 5I9QC 4J3UA 4HCRA 5GRWA 1RJZA 1U95B 1G7IA 4IRJD 5L8LB 4JLRA 3GZKA 3WFHA 4LAQH 3ZE1E 3RL1A 1BM3H 3E3QC 2WQ8A 3TO4D 4BQ6A 3TCLB 3HC4H 1ZSDA 1FAIL 3MNZB 3AFLA 4KJYA 1IEAB 3QUZB 4HUNB 2VE6B 4H8WL 2R0WH 3N1MC 3LKPA 1GIGL 4WJ5A 5TQ0H 1V8HA 2W91A 4OGXL 1YEDA 5JO5B 2N7AA 3D9AL 5DMGD 5D2LB 1JWMB 4E0RB 1NGQL 3QQ9C 2R39A 1LD9A 2R0LL 4Y4KA 1G9MH 1RMFH 5TDOA 3TBWB 2WNGA 5HJ3B 3V2AR 2EKSB 2DQGL 2DD8L 3X12A 2KPNA 1AGFA 1J0JA 3MV11 5I1JL 1IM9A 3OG4B 2JELL 4GH7B 1KIQA 1ODAA 2JTDA 4Y19A 2BC4A 3TF7C 3O9WD 3E6HB 3O45A 3HLAB 4PB0L 3TBWA 3O4LD 2LQRA 1JNLH 3C5ZD 3L3DA 1NAMB 5GJTL 2YA2A 5H94B 5C6TH 3PGCB 4TSAH 1MVFA 3ZMRA 3TZVD 3K74B 4CNIA 3LKPB 5CIPH 3FONB 5I75C 2O61B 2CIKA 3P73A 1WCBB 5C3LD 5TQ2L 3SKJH 1XF2B 2NY6B 2LAGB 4AEEA 4RNRB 5IVZA 1T1ZB 4NWUH 1WT5A 2LABA 5IB4A 1N4XH 5T1KB 5MHSD 5JUEH 5DRXA 5FEBA 5JA8B 3FKUS 3JVGA 2W07A 4YXLL 4KKBC 4GG6F 2Q8AL 1CD9B 1NGQH 2PTTB 3JTTA 5HYEA 1GPOH 1IAKB 2I24N 3OXRB 4FZ8H 5D1ZA 1CTOA 4J3XA 3RQ3A 1MAML 2CDFB 5I1IH 5HY9A 2YC1B 4HFUL 4U1MB 4UV7L 3HI6L 1RUMH 2ZSWB 3UTTE 3MBEB 4PV9A 4MXVE 3BPOB 1JK8A 1KLFA 4U1IB 4CU8A 2Z31A 3TO4C 3TH4T 5ERWB 1MLCA 2NZ9C 4GAGL 1T3FB 3RWIA 1FE8L 2NNAB 3O3EB 3U7YH 4Y19B 3NCFB 5GIRA 4WENB 1J12A 4NO0A 2EDXA 3V9FA 5HHVH 3VG9B 3JXAA 1UM5H 2YA0A 1ZLVK 1AGEA 5A2FA 5DJ2B 5HHXL 1W0VA 4XGZB 5FB8A 2HLFC 4YDJB 3QDGD 4PR5B 1JNJA 3L7FA 2HTLD 4WI5A 2N1KA 2FDBP 4GMSL 1AE6L 3GIVB 4WHTB 3B5GA 5C08D 1I3RA 2VRAA 2EYSB 2VXTL 1TQBC 1RUAH 3VXTA 1AGCB 2YEZA 2P5WB 3ARTA 3Q5TA 2BDNH 3GSWB 5EBLA 2N56A 4LDLB 3SDXF 3BRGC 1ADQA 1KG0A 1FDLH 1EH9A 3OL2A 3I02A 4HWUA 3KLAB 3MGTA 4PJCE 3D0LA 4OUUA 4JLRB 2QQQA 4IMLA 5B4MD 4HS6A 4FQ1H 4LPYA 2RB8A 2DL2A 4PRAA 1V3LA 1I9IL 4CMHB 4F7CA 2GTWB 3HMXL 3HAEH 3DX7A 2FBJH 1YYLH 5IK3A 4LSTL 1EEYA 2J2ZA 4O4YH 5I66B 2UYLA 5I1AA 2XKUA 3KXFB 4XNUH 1A9BB 3QG6B 3LKQA 3FFDA 4ODHH 4ZD3L 3CSGA 3UBXA 1R5VA 4GJTB 2H1PH 3ULUH 3VWKA 4GQ9H 4GS7C 3RJQB 2HFFA 1FRGL 2X4OB 4XRCB 1HKLL 1F2QA 3X11A 2A77H 4G43A 1WC7A 4PJHB 3RFZC 4O02H 1SY6H 1RZFL 1MIMH 3QUYB 4KKBD 5HI4D 1GCFA 4HQQH 1PAMA 3K4AA 4MSWB 3T77A 1T7ZA 3T3MF 3UPCA 2FO4A 1MJUL 2VZTA 1U8QA 5FV1L 4NC0B 3RTQD 4XVUD 5GPRA 4GRWH 4YX2H 1JRHH 1HH6B 4IMLB 1AI1L 4L4VA 1P2CB 5E9DD 1PG7W 1LVEA 4PJ8A 4OLWH 1WFOA 2G60H 4RMWA 4EN3C 4FABH 2A9NH 1CGVA 4PTUA 3FAXA 1CL7L 1T6WA 2VAAB 3VXTB 1T4KA 4OD1H 4J3SA 2J8UE 5EDXA 5IT2L 4JJHA 4RIRA 2OI9C 3D69A 4PJHE 4OGXH 1GZPA 4YUEH 1ZLUH 3R4DA 1D5ZA 1KTDA 1D9KB 4HUXA 4Q6YA 3ROOA 4Z7VB 5ABDE 1A7BA 1V3KA 4PTUB 1HEZA 4XAWL 5E2UH 1KJVB 3IXAB 3ULUL 2YD3A 3KPQB 4JFXB 3P2TA 2BNUA 2VB5A 1EO5A 1ZT4B 2VLJE 3NH7H 1A6VH 3X13B 4YGVB 1RD6A 4I3SH 4PP1D 5KZCD 4J4PA 2D03H 1HH6A 2ZG2A 3A0OA 4QEGA 1NC2D 3O8XC 1MLCB 2BVYA 4YWGL 1CFVL 4K7PH 4WNQB 2EE6A 5JXEA 3UJJH 4W68A 2Y5EA 3V6FA 4MB3A 4XMLH 4H0GA 3VXSA 1REIA 3QEUA 4PJFB 4PJ7B 1OAYH 4WHCA 1R5IA 3FFCB 3WBDA 3MOQA 4F7MA 3DUHA 5EH1A 3D6GA 1IL1B 4QHNB 5J1AA 5DHXB 1QP1A 3E3QE 3GSNH 4MDIB 3VGFA 2QR0A 5J12B 2CUMA 2P5ED 3MRNA 5F70A 1UM4L 4RDQG 5LWYL 1KCKA 2R1WB 2CKNA 1OB1B 1LEKA 1TQBB 3QUMA 1AJ7L 2R29H 4EBQH 4NC1E 2UY6A 4LOUC 2OI9B 4N5UA 4ODVL 1QFWL 3TYGH 4R97B 1N5AB 3GI9L 3MA9L 4EIGB 2W0FB 1R0AL 1CWVA 1JWSB 1G6RL 1P4LA 2P5WD 1YNLH 3OTTA 1CQYA 2YKLH 1XGYH 4KHTL 4OCXH 4EI5A 1MI5D 4XNQB 5IW3A 2FBOJ 1A6VL 5LGHL 4QHLA 3GIVA 4WHTA 3QB7C 5BV7L 5HPOA 4R4ND 4ALAL 5C7XL 3DMMA 3D39E 1KT2A 2RBLA 3ZDXF 3GHBL 5C08A 3IGAA 1E4KA 3WKNA 4HEME 1DEDA 5IB3A 1FNSL 3VWJA 4BSVB 3FB6A 4HPOL 4TVPH 4PRPB 1QPPA 4P2RB 4YHPA 4U6TA 5E9DE 5HHQA 5IFAH 3QYCA 1NDMA 5D5MF 5K93A 5HYSB 3WFCH 2NY0C 5I71C 4Y5VC 4NO5A 1J10A 1SY6A 4JGMA 3BP7A 4APQC 2XRAL 3ULUD 4HUWA 2W9EL 4MX7A 4XPAL 3CPLA 1QNZH 2G5RA 2IPTL 3FT4A 4CDHA 5J11B 2CKBH 2ZNXA 1MWAL 4LLYA 4U2YA 4GG8B 1LP9E 4GXUM 1JN6A 3C2AH 4WVRA 2ZG1A 3VXUD 1I85A 3MC0A 3VFWA 1N5AA 5T1MA 2VLJD 1SHMA 3KR3L 5EU7C 3EO9H 1MHHA 7CGTA 1RULH 3HNVH 4M93B 3W5MA 5EU6A 2O5YH 4Q2ZA 5T5NF 3G6AB 4K8RC 5ACZA 3MRPB 3BP4A 5DMKB 3PXJA 4DKFH 3OV6A 4NCC1 3LN5B 2OM5A 3MRNB 2BNQD 3HHRB 1F58L 4NUJB 1DLFL 2BY0A 3AREB 4OF5A 3PWNA 1H3UA 2VH5L 1FZJB 3SGEI 15C8H 2AXHA 3REWA 3ZTJG 3Q5OA 3LN4A 1EDQA 3ROLA 1EHAA 5IHZB 1CXKA 1SJHB 2WBJC 4KKNA 3VXSB 4NUJA 4M8VA 4X4YA 5EOQH 4LSUL 4K23L 2C1OA 2DDQL 5FOJA 2XTJE 2J1KA 3UJIH 3TYFB 1KBGL 2D9CA 1XCQA 3HUJB 2YK1H 4GBXC 4XHQA 3IFOA 3OKEB 1MSPA 3UTPE 3BWAB 5FGCB 1MLBB 2WIIB 3I3DA 4F7TA 1GL4B 3VI3E 4C58B 5JOPD 2HG5B 3WFDH 5BXFA 5CMAA 3T0EA 5GRUH 1D5ZB 4DZBB 1S5HB 2ADGB 4NFBA 5HGDA 4S0SD 2KH2B 5F6IC 4OLUL 1ZT1B 2NW3B 4OAWB 4XH2B 1G7JA 3IFLL 4JDZB 4H1LH 1IMHC 1MRFH 2ICWB 3TCXA 1MPAL 4UT6H 1ZGLM 3QO0B 5IROA 5L7XH 3QBTB 3MLWL 1OAZL 1T0NB 3OKKA 2H8PB 2BOCB 2FEDC 4DGIL 4P3CL 4KUCD 1J0HA 4LLDB 4YHMH 2BNQA 3VD4A 1RK1B 1FVEB 1G7PA 4XCCH 1RUPL 4FZEL 1CG9B 5D1XD 4ZXBC 3D2UA 4KGJA 4YHKL 2YSSA 3AROA 4K23H 4MNQA 5L6YL 2F58H 2NXZB 2Z31C 1QYGH 3M17A 1PG7X 3TPUB 4ZO6A 4B7LA 3M8OL 1QG3A 4EI6A 2HVJA 4Z7UE 1BFOB 2IF7A 1UVQB 2IGFL 2FJGB 2AVGA 5DQDH 2GTZB 5E6YA 4LVEA 5TGBA 5I1AB 1EAPB 4PJEB 3H0TB 1DE4A 5A1AA 3IETA 4JPKL 3L3HA 3OXSA 2F15A 2X4PA 3SPVA 3QULB 3K4DA 2BOCA 1LDSA 1Y6NR 2QQLH 1HYRC 4LARH 1IGMH 2PR4H 3UBXG 5K59F 2OTUB 5E7BA 2VZUA 3L5IA 4HXAH 1Z9SA 3MRJA 1MCFA 3DGCR 3FQRA 2VLKB 1XGPB 2ADIB 4IRZL 4ZTOL 1MHPH 1LO5B 1RJLB 1UXWB 4HHAA 4HMEA 3THML 1TQCC 4JDZA 2JF1A 4PRPE 4YHIB 2CLRA 5JR1H 1MFDL 4N0UB 4FQXC 4ONFL 4PJ7A 5FYJD 4IMKA 4WI4A 1LEIA 5DJDA 1ZTXH 2X4QB 1ZA3B 3O2DL 4HGWA 1CT8A 3CDGA 5CGYD 1IGYB 3AREC 2FEEI 4XP1H 3EKCA 4PJEE 4PG2C 3CXDH 4RFOH 3QDME 3DMMD 2XQBH 3C60D 4ZXBB 1AGEB 3V79C 2VABB 4IOFD 3NCJL 2VLRB 4JVWA 3VXUA 3C8HA 1QSFD 4XPHH 2C3WA 5J13B 2ZCKH 4QHKJ 3QFDB 2C3GA 4G8GD 4X7CC 4PLNC 4HUXB 4UT9L 4P5TB 3HI1B 3VCLB 3K2UL 3QXWA 2HRLA 4M62L 4AEFA 3KWWA 1NGYB 2FJHB 4N0UA 1A6WL 2DM2A 1HSAB 4ZOBA 1QHPA 3BP5A 1SYVB 4R26H 2I27N 4JHBA 4HK3J 4X4ME 5ID1B 3NBNA 2YPLD 4U1GB 4NP4L 1FP5A 4O2EA 1MCSA 4Q9CA 2DN7A 1MQKH 3GO1H 5T5FL 4N0YL 4OM0L 2VC2H 4XPBH 2B1AH 4UB0H 2BP3A 1S8DB 4YDKL 4CVZA 3NAAL 3ZDYE 1GH7A 3K8LA 1CLYH 3ARQA 2C4XA 4KTYA 3GJFB 3PG2A 2E6QA 2OP4H 4XCYB 3SE8L 4KXZI 1U9KA 4MHHI 4NRXB 2VMFA 5T1LB 2AXFA 3W0WA 1PEZA 4WUUB 2GY7B 4FXGA 1LK3H 4Y1AB 5FUOL 2KUTA 1A9BA 1OGAB 3KXFA 3L3DB 1J9CT 4LSVH 2Q3ZA 5DJYB 2P24B 4JN2A 4B50A 3FRUB 5DA0B 5DDHB 4HPOH 4TVPL 1H3PH 5SX4H 4LCCC 5E99H 1KIQB 4Y4HC 1DQLL 1RZIB 4TUOB 2CO7B 3VH8A 5ESVB 5GSRB 1U8PB 1S9XB 5E8DL 1JF6A 1PZ5B 1HXYB 1MJUH 4LCYB 1FLRL 3IGAB 3QPQD 2CH8A 1I7ZA 1Z3GH 4PJBB 3WXVL 3ARVA 5C6PB 3CFDA 5ADPL 2GSGA 2CIIB 4DVRH 4I5BB 1XF1A 4FQ2L 2MQCA 2R4RL 1EFQA 1RHHB 2R1YA 3UTZA 3H7LA 3DYPA 3V4PH 3PGFL 5HYSG 1CE1L 5CMAB 4C56D 1RMFL 2HJLA 5F9OH 5IWLC 4UQ3B 4MDJA 5C0BE 3BH9A 2R0ZL 1QSFE 4S0TD 1AD0B 1FV1A 3MOBH 3RA7H 5B39A 4DWHA 1EIBA 2GITA 5DJCB 3TO2B 4FMFA 3EJYD 5FUOH 4YHYB 2JJSA 3IU4H 3TJEH 4Q58C 5GS0C 3G08A 1FSKC 1UM6H 2QV2A 2XQYK 4UILL 4WV1A 2VR5A 4ZSOE 3RNKB 4LLVB 1U36A 4B53A 1SJHA 5J1AB 4OD2B 1IAIL 4R0LB 4QXWA 5K59E 3CH1A 5CD3A 4MNQD 1QBAA 2XWBB 3KYAA 3MV7B 3MV9E 4XPTL 3U0TA 2X4SA 3F7QA 3U2SB 2FWOA 3U46B 1YYML 3FN3A 1HN1A 4L4TA 4XMPH 4ZO8A 5FHBH 2E9IA 1MHEB 1UH4A 5EO9B 1NBZB 1NFIA 1JGVL 3TFKC 4NJAL 4P2RD 4X7FC 3UX9B 5IFHL 1RI8A 5C0EB 4JFXA 5BMFH 2YBRB 5K9QI 2XICA 1P7KA 1S7QA 3P4NA 5IF0B 4M6NL 5JLZB 5BRZE 1BQLH 1V7NH 5FIEA 5C0IB 3DURB 5IB2B 3RZCD 4FP8L 2AK4B 1NFDA 3ULSB 4HKXA 5CP7A 4EIZC 4Z77B 3ZDXE 4GRLD 1GZPB 1Z6JT 4FTVD 1A6TA 1TTGA 3ALWA 3GDBA 1HHKA 4Y2OA 5EPMA 1EO8H 3MXWH 4ZOEA 3ZYJA 4V2BA 3DRQB 4JCMA 1T5WB 4E41B 1G84A 1H8OA 3ZTNH 3NIGE 5IOPB 1J8KA 3I85A 3QIUC 1QFHA 2WBWB 1L9MA 1YEFL 1OSZA 2VLKD 5CEZL 1I8LC 5HYSA 2H32A 2AERT 4PUBH 5D96C 5DURD 5IB1B 4PJ5D 1FORL 3G6DL 4PGCA 2VLRE 1ORQA 1VFBB 2O26U 1LO2H 1QVOA 3ZYZA 4JFEB 5I8KH 1MRCL 5HHXH 3RRQA 4KMQA 3N50A 2W0PA 3U82B 2AW2A 3NABL 2VNCA 4LEXL 5FHBL 1TVHB 4TUJB 2X6MA 1QYGL 4L8CB 3K2UH 3FB8B 2AABH 4OQTL 1T80A 2ZJSL 2CO6B 3RJDA 2HFFB 2X4OA 3GRWA 4XRCA 3FHAA 4KJYB 4D0CA 4MVBC 4GBXA 3Q5YA 3B2VL 3IDJB 4YHYC 1OF2A 4UDTB 4PJGF 3H8NA 4WW2F 4OZFA 3T65B 4OD3H 2C1PA 5D1XB 5DD6A 4PB9L 4MXVF 5GJSL 1AY1L 2OK0H 3RGVC 4J4PC 3BP6A 3DHMA 2DYPB 1TFHA 3LEVH 3VFTB 4KKAD 4M7LH 2AP2A 4OGYL 5KVEH 2ENSA 4Y4FC 3OB0H 5I1GH 5EBLB 1U42A 3MGAA 5FYJL 4BSWA 5F7WC 2FRGP 2CSPA 2VQ1A 1DBAH 2V17L 4NNPH 2XN9A 1HZHL 1F8TL 4BH7B 4Z7OF 1M1SA 3FZUD 1RY7B 1KTLA 2VDML 4R7NA 4RISH 1N64L 5DUPL 3PGDB 2WANA 1E6JL 5ELIA 2G2RA 3DECA 5DJXB 3WKMH 4ZUVB 2FATH 3WCYA 5F7HA 3QIWA 3ZE2F 3QFDA 1PJ9A 2EE9A 5HHNA 1ITBB 3QR2A 4R7DB 2VYRE 2FCBA 5J9PA 4XXCC 2BNUB 2CK0H 4R2GD 5AZ2H 2DJUA 1J11A 3MLTA 5F1NA 3W9DA 1K2DB 1H0DA 3RTQB 1JE6A 5C0CA 2B1HH 5AZEH 4ERSH 2D31B 4F15B 2X9YA 3I6KB 1NSNH 4BUHA 3U4BH 1OM3H 5E4EB 3OGCB 4G9FB 2MHAB 3K7UA 2FL5A 1F90H 2HT4D 3GB7B 4P5MB 4AYFA 1P5VA 4MJIB 1ZT7A 3BKJL 2VQ1B 2HWZH 2G5BB 1ND0B 1T6VN 4JFQB 3LEVL 4WY7L 2YRZA 4JGJA 1WZKA 4LCWD 5D1ZB 1XR9A 4YBHA 3BVNA 4JGUA 3ARED 1WSST 1A3LL 5CBEA 3PDGA 4GXVH 1FYTB 1HOCB 2HT2D 1FZMB 3RUGB 5E08L 4YDKH 4QOKA 1OGAE 5HBBA 4MAUL 3N1PC 2JJWA 3L3OA 5FK9A 2WWMD 3QRFM 3PHOB 4Y5VA 5A16B 3BPNB 1NAMH 5IM7B 3P77A 1WC7B 1WAAA 1GAFH 4OSUH 1YEEL 1YDPA 5GHWH 4OZFG 2FX9H 1TVHA 1ZVHA 4MB5A 4NQED 3WNKA 3MO1A 3RZCB 3EYFB 2UYLB 2DLTA 5EOCJ 4MAYB 1PDKA 1SBSL 4K55A 5DEFA 5IK3B 3WDHA 3FB5A 3MLVH 5BZDB 1DJSA 1ORQB 1VFBA 5MP6L 3TESA 2W9EH 4M43H 3QDGE 1F4YH 4MA1C 3GM0A 1SM3L 3OKKB 1F3JA 2VKXA 2X1WL 4YPGA 3VFOB 4L3AA 3S35X 1V7NL 4HMCA 3V0VB 2PXYB 4TULH 4OFKA 1G7HA 1NBYB 3O4LA 3V7AG 3C5ZA 1BEYH 4XPGL 1ZT1A 3MTRA 1E6OL 2EO9A 1G1YA 4MYWB 3CFEB 3MRKB 2HMIC 3E8UH 4BFGA 3IDYB 3FQWA 1DDHA 3QJHB 2WBJA 4JANA 2FGZA 2Y23A 4HKJB 3P11L 1CLCA 3DURA 1FGNH 4IEFB 3VXME 4JO3L 4R90H 2E6PA 2WUCL 3IFOB 3OKEA 4C83A 5EWIL 4NZDA 2FJFB 1CD1A 4OKVA 2CK2A 5IVNA 4TNWF 3KAAA 3HUJF 5E00A 5D93C 3WUWA 4X8XA 3MJ8A 4U1IA 8FABA 2DM3A 1BVKA 2OL3L 4U6HA 4QT5B 2ILLA 3QCVL 4AT6A 3BE1H 2CDGA 2J6EA 2UWEA 3NA9L 1HHIB 2AEWA 4NWTH 1MFEL 3ZKMD 3P0YH 2Q7YB 3VI4F 3IB4A 3RVTC 2HFEB 3C09C 2OR8A 4QRRB 1ULVA 1TLKA 4XP9L 3ZL4H 4JVUA 5E8PA 1R3JA 2PW1A 3WFBL 3NCEB 5AYUH 3CDYA 3GSNL 3IDUA 4Y89A 2F53B 4KZDL 3IJSA 1VPOL 1BFSA 1GIGH 1S3KL 4MLIA 1S7UA 7FABH 2VXTH 1OWWA 3WXWH 5C9JA 2FD6L 3MCG1 1LK2A 1NCAH 4PGBB 2DQTL 5TDNA 5I8EA 3N1QC 3N85H 3SKMA 3I6LD 4WW2B 5BOZG 4WUUE 5HGAA 4OZHF 1D9KD 1NDGA 4LRIA 3HMXH 3CUPA 1F8TH 4Z18A 4NQEE 1YMMD 4LLUB 5I74B 2IH3B 3BH8B 1NLDL 2BFVH 3OBAA 5DJ8B 3O6ML 1Q9WB 3MV9B 3D0VA 5F8RC 2EIZA 5FKPA 5I8CA 3S5LA 1DSFL 1BIIA 2YRLA 5HHOA 5CEZH 3QCVH 1G7LA 1YECH 4QRSB 3BIKB 3DVGA 4V1DA 4WV1C 3S4SA 1MCPH 1KXVC 4KDTC 4ONHB 5CWSA 1OAKH 4DZ8A 4YHPB 5BV7B 4OZGB 2YK1L 1KF9B 2NX5D 3O2VH 2Z8VC 2X4TA 3B9KD 3KPSB 5D7KD 3WFDL 1A6UL 2YPLB 4HFWB 3C9NA 1KELL 5GZOC 1N0XL 2W9LA 4K3GA 4YGAB 4BQ8A 5EU6E 1U8JB 4JRYA 5IR1A 4MA3A 1VEOA 1PLGH 4IJ3C 3MYJB 1DQLH 4C54A 3PL6B 4HD9A 1BLNB 1R3LA 3VXMD 5D7LD 1FL5A 3GMPB 3V5DB 1OAQH 1KJMB 3BSZL 4J3WA 4L9LB 3MR9B 3O6KL 3V6OA 1MY7A 3CX2A 5JPMA 1I7RA 1PKQB 4S1RH 1EZVY 2XXCB 1TJGL 1C1EH 4JDTH 4JQVA 3GKWH 5EBMA 2UV3A 5JHLH 1FNGB 5HYJB 4WGWB 1OT2A 4XCCL 1XZ0A 1NBVH 3MODH 3GHEH 5IW6A 1IAII 4N5EC 1CBVH 3WEXA 3W9EB 2Q76A 5DJZB 3VFVB 1HHGA 1I7TA 3GMQB 4NKIL 3MRCA 1LO4H 4EEEA 5FA4B 4YBLB 3PHOA 5HHPA 3KYOA 4DKEH 4P5TA 3MJGX 5EOQL 3OJMB 1A7OH 2E27L 2WINB 4ZFOB 1SVZA 5GRVK 3VD3A 4HPYL 3GMNB 1LILA 5E8OA 4X5WB 5HGHA 4KJWC 2D9QB 3QQ4A 2V7HB 5I1EH 5DJ6B 2Y7QA 1G9NH 1LEGA 2ZSVB 1MIML 1IGIH 2EXWC 3GIZL 1JPFA 4G3YL 4L3CB 4JRYD 1ITCA 3NTCL 4Z7WF 3KYNA 4TUKL 3T1FB 5JR1L 3GNMH 4JFOA 2H9GB 3RUGE 3AB0C 1C1EL 3IAQA 4JDTL 2DTML 4N0FB 4Z7VF 5C8JA 1BJMA 2UVFA 1JZ8A 1ZGLP 3ARGD 2V7NA 4PIRF 1KIPA 1ZLSH 1T1XB 2K7QA 3RGVA 3SE3C 4AEIL 1PEWA 1MJJB 2BRQA 2R69H 4NQTA 2OBGA 1JPFB 1XGPA 2HT2C 4L8SB 4R97C 5INDB 2YKLL 1KJ2L 4PJ8B 5IGXL 4NQSB 1AQKH 2AKRB 2I60L 5LGHH 3DXAE 2DMBA 2V5RA 5IBLC 4JKPL 4X4ZA 1G1CA 4X7EC 4Y4FD 3TC9A 4M3JA 4F37K 4ZFGH 3F7RA 4I1NB 3LIZL 2QTEA 5HDBE 1S9YB 2XA8H 2PYEB 3QIWC 3W2DL 3NH7L 4W6YB 2NY7L 4U49A 1VGKB 4HX1A 1KEGL 2NY0D 1DBML 3RAJH 5D2NB 3SDXE 3WFEH 1KNOA 5FUZH 1ZHNB 3BIBX 3QNZB 3ZDZF 1T20A 4FMKA 1A6AB 5F1OB 3LCYA 5I17A 3F7YA 1S7TA 5DO2D 5JUEL 3QHZH 1S3KH 2JJUA 4BZYA 4PJGA 3BYYA 1QSZA 2H32H 4RGMB 1GJIA 4UDTA 4XZUB 1WISA 5JZ7C 3GBNL 3SCMB 3VG0L 4MD4A 5F7DB 4WWKA 4J7RA 5IBUB 2RGSA 5LGJB 4OF8A 1CL7I 2BJML 4YH6A 3MRLA 4YEEA 5ICZA 1YEGH 4C59B 2GFBB 1MVUB 1T83A 4EBQL 2IPKA 5J1SC 5GRVL 3CFKA 2CD0A 3FCTA 1I1AD 3PV7A 3MNVA 1U3HA 2H26B 3UTQB 1RIHH 1UGNA 4G6FD 4AM0B 4MA8L 4N90E 5C07D 1CGSH 1KIRA 4K9EL 3RVVC 5H35B 3WIHA 4R4BA 3OSKA 1H3PL 2IADA 1FRGH 3HTLX 1IZKA 3SO3B 1J18A 4Q6IC 3F7VA 4EUPA 4QTIL 1WEJH 3KJ6H 2Z93A 4MQ7B 4PJAB 1OP5K 4RMQA 4Z7NF 4OZIA 5IOPA 1T5XA 3GJFK 4HWEL 4E41A 4X4YB 4XAKD 5L6YH 1YUHB 1N0XH 5BZWB 2ZSWA 1X5FA 3QHZL 3HCVB 3LKSB 5J57B 3AUVA 4ORZC 1E4JA 4KK5C 1A6WH 1A6ZB 2DI8A 1UACL 4P2OC 4U1JB 3ZKXB 4H1LB 1I1RA 1N5YL 5I30H 4P2QD 1ZS8B 1B0GA 4M7JL 1CDCA 3FQNB 2JK5A 3V95A 4P5TD 3Q6GL 5J6GA 5C0RH 5FDWB 1KGCE 2B2XH 1UZ6E 4G80A 1YYLL 3QIWD 4PRPD 3IDGB 3DYOA 4G6AC 4DQOH 2CKBL 3TNNA 3FQNA 4NO0D 3W82A 5L7XL 2FX8L 2PW1B 4PJFF 3MBED 1NLBH 3PE9A 1Q9OB 2XWBA 4B5EA 3MROA 3U4EB 1TTFA 1J8HB 1IKFL 3EZ8A 4NKIH 4XCEB 5BOPA 3NOIA 1URLA 1MI5B 1CF8H 4OV5A 1IM3A 3B3IA 5SV3A 3J8F7 2DLHA 4MWFA 5DJ0A 2WZPD 2C5DC 3UYRL 3F7VB 1IGJB 4OKVB 4X4XA 1CXFA 1WIPA 4MJ5B 4HG4J 1GGUA 2D7NA 3HZYB 4PRIA 4XP6H 3VFUA 3PP4H 4JZJB 4JPVH 2YD8A 5ADOL 3MPCA 3QEQB 5K33A 5SWZA 1ZVSA 2Q1EA 3ZE0E 5GS0H 3IFPA 1B90A 3HRZA 3TT3L 3KYMA 3O2DA 2XNAB 3BUYA 5CJ8A 2FZ3B 2WUBL 4I3RH 4ONGH 3U48A 1ACZA 3BKCL 3IDIB 1DDHB 3OKNA 5FOBB 4PB9H 1AJ7H 1NL0L 5ALBL 2I07B 3QUKB 3EO0A 1M7IB 1YJDC 2NY1B 3TIEA 5CEXB 2R4RH 3WS3A 1FNLA 5D2LF 4PBVC 3IFPB 1XF3B 1AR1D 3LQZA 3V0VA 1FNEB 3G5YA 1F58H 3OAUH 3LHPH 2W0FA 2I5YH 5J11C 2HJFA 4P0DA 5EORL 4A6YA 3OKYA 5BV7H 4BQBA 1MY5A 3R06A 4GRWE 5DJYA 4H0HB 5GRJL 1CLYL 1N64H 3NN8B 1I4FA 4ORGA 5A40E 3MCKA 2X41A 5IMMB 4A2MA 3DHJA 3HG1A 2HTKD 2GY5A 3SO3C 2HN7A 5D2NA 1G6VK 4NO3A 3H3KA 3KLDA 5A2JH 1YDPB 2A9ML 1ZHKB 4K8RH 4KDTA 5JQ6L 1IQWL 1P4BL 2EDTA 4MQTB 2EIEA 1I3GL 4WU5A 1I1YB 3LAFA 4JHWH 4LSRL 2B1HL 1NEZB 1KN2H 3MMEA 4XMPL 4OIAA 5DMIH 1MHCA 4LCCB 3TLRA 3ARUA 3DUUA 3QP3A 2ESVA 1JPST 4DK3A 1KB5L 1RZ8B 3ZHDA 3WUWG 2VXUL 5C0FA 5GZOD 3HN3A 4X7SL 3C6LA 4JFDB 4NM4L 3NCYP 1ZHBA 5GGSA 3S97C 5I76A 4Z7WB 1LHZA 5IB5A 2OX5A 4WFHE 3V6OC 3LKSA 3V5HA 1Q9LB 4LLMB 3S96A 1DQDL 3T2QA 1H8NA 4DKFL 2IBZX 2W59A 4H26A 4HZLB 1MEXH 1EUTA 2PUQT 3GMRB 1HSBB 1MCOL 3I75A 4MQ7A 4P59H 4PJIE 3ZHKA 1KLGB 2GJZA 4IS6B 4RMUA 4XVJH 3C5JA 1O7VA 1BQHB 2FNBA 4X6DB 5EO1A 2IBZY 3PABB 3WNPA 2UVEA 3NIFE 1HXMA 3RX7A 5IQ7L 1JF1B 3O3BB 4HK3N 4LL9A 4NQVB 3MNWA 2RCSL 3SDCB 1S5IL 1UKTA 3HPJA 1PQZA 3I3EA 3RWDB 5GZND 4QHKI 5DJXA 3W81A 4K3JH 1JV5B 1ORSA 1VFOA 5DUML 4NRYB 4MSWA 3T77B 3KPLB 4AL8H 1JNHA 2AJYL 3DX8B 3SOBH 2V9QA 4OCYL 1IBGL 3ET9F 3U36A 3G6JE 2HWZL 4JG1L 4BSWB 2D3VA 2HMID 2R2HA 3ABZA 1YYMH 3MCKB 3DIFA 2I9TA 4E42B 1H3VA 1L6ZA 1FPTL 5HYFA 1TETH 5DHVB 3X17A 4X6CF 4RWYL 2BHUA 2PF6A 5I6XB 3UC0L 5MI0C 4UIMA 2IFFL 1DE4B 5IW1A 3EJYC 2PKDA 2CLVA 3PJSA 4L8SC 3GSRB 4OLVH 3SE3A 1KNOB 3HI5L 3FTGB 5D1QD 1KCUH 4EI6B 2MNUA 1QSEA 3BPLC 3DUSA 3TWCH 1ZOXA 3LRSA 2EYSA 1HILB 1G7QA 2VC2L 4PTTA 4XPBL 5B38G 5GXBB 1J8HE 4X9GA 1QPXA 3V6ZB 1Z9OA 4IRJC 4OIBA 4G8FA 3X14A 4ODUA 2F5BH 3O41B 1KB5A 4PJ7F 1W0VB 4XGZA 1RK1A 3P9LB 4UNUA 3ETBF 1K8DB 3ZYOA 4AL8L 3DXAA 1FGVH 1JZ3A 4NQVA 1P5UA 2Z0BA 3HAEA 1XAUA 4HH9A 4NQSA 2M1KA 2E9JA 2NY3D 1F4WL 2FECL 5E70A 2A74A 2W92A 4HUUA 2XWTA 4K7PL 3FQXB 4TNVF 1VSCA 4OZHB 4YR6B 2EDWA 5F7MC 2EICA 4DCQA 1K6QH 2LTQB 4OLEA 3H3PH 4KAQH 3O4OB 1BMGA 5BMFL 5T3XD 1P7QB 3H9HA 4L3CA 2YD2A 1GGBL 3TBVA 2EYRB 4NZTL 2F54B 3RVXC 5CUSH 3A6OA 4G3YH 1BFVH 1S7WB 1T66D 2XA3A 1NMCB 3JTTB 5D1QC 3PHQA 2R29L 2AJXL 5HYIA 3VXQA 4UQ2A 5GRZA 3SCMD 4HUVB 4PJDE 1FFRA 2Z91A 3O8XD 3MA9H 3GI9H 3L3JB 4PGJA 3V4PL 4QXUH 1DEEA 5JPNB 4R2GC 4YHKH 1P69B 3MFGB 1R3JB 4OZIE 3QPXL 5C0CE 4LU5L 2W65A 4Z7UA 3ARYA 5FF6B 5ICXA 1IAOA 2H2PD 2QQNH 2P8MB 4NOBA 2E5EA 4GRLA 1XF5A 4NZRH 1U0QA 4JAMA 2DAVA 4O58L 1XZ0B 4GAJH 3S36H 1G6RB 4JZOA 4YFDB 3VXNB 3MA7A 2H45A 1KB9J 3DETC 4Z7WE 5E1AA 5L2JA 5FGSA 3T4YA 4L3EB 1GOHA 4YDVA 2BC4B 1AP2B 2CJUH 1WITA 4NNYB 4EN3D 4OI8A 5F93C 2NY7H 2R4SH 2FJFA 1FVDB 2XPGA 1Q94B 3RHWK 4RGNE 2VXUH 1GOFA 1KC5H 5TDOB 2BNRA 1JCKA 2UZIH 1CU4L 4L5FH 3QXTA 5K9OA 3UTSA 3VXPB 2MSPA 5E2WL 4QYOB 5DGQA 3FFCE 5HHMB 5ISZD 4GSDH 5ILTH 4HJJH 5AEAA 1ZVSB 3C2AL 4P5TC 1YECL 5T3ZH 1DP0A 1HQ4A 4ZOCA 2YUZA 4PRHE 3DVIA 4M7KL 2P8LA 5I1KH 4P2RA 3FZUC 1MCIA 1DANT 1AP2A 4NN5B 1K8DA 4KRPB 4KQ3H 4MJIE 1A8JH 3EJJX 4S2SA 1NUNB 4WGVB 3NIDE 1VESA 5FKPB 5I8CB 5F1IB 5ETUB 1CVRA 3KDMB 2DBLL 4Y1AA 4QRUB 4LVOC 4HIIA 2P8MA 3VW3H 4HBQA 1TNMA 3LEXA 2EH8L 5T1DH 1A7QH 3K2MC 4KK6C 1JHTB 4HJGA 2G60L 4FABL 1JWSA 4QRPB 3A6CL 1OGTB 2CLVB 3PJSB 5I73B 1VKXB 3T09A 3IDGA 2VISB 1D5IL 1OPGH 1Z2KA 4CW1A 4S1RL 2VXQL 1S7SB 1XCTB 3RUGA 1DL7L 1I8IB 5BVJA 4Y2DD 5E2WH 3LKOA 2ERJC 4P9HC 1AHWB 4IRSA 5D7JB 4JFFA 4GG6B 3DIFB 1KTRL 4G8GA 3WLWC 1NEZG 5GS1A 1BHGA 1SYVA 5HI4C 4TULL 3S9DB 2LFGA 3BDYL 3VDBA 1LGVA 1BF8A 2WBJD 5ISZA 3C5SB 3LMJL 1Q0XH 1IGFH 2GJJA 4WEMB 5JDJA 5E08H 3DX8A 3S3SA 5DZLA 4OCRH 5HDLA 1KCSH 4YC2B 3C08L 3S37H 4G9FA 4XMKH 3AAZB 4DUVA 4OLZL 2Q8BH 4MS8D 3LIZH 2GI7A 5KS9A 2BCKA 3BZ4B 4KJQC 2DQIH 5J56B 2EDKA 4HBCH 1NAKH 4MXWH 3NZ8B 3T0XA 5F8QC 5H37G 1MFAH 3F7PC 2JKXA 1IC7L 3P9LA 4LLAA 4JVPA 4NOFA 4HH8A 2OSLA 3E6FB 2MPAL 5D9SB 3MRKA 4DTGL 4YAQA 4KJPD 2NY6D 3O6FA 3ZZ1A 4G7VH 5LAXA 4PRNB 1QSEB 1T4KB 1TVBA 4NKQB 2IGFH 4WWKB 5L2KD 4NN6B 2YWYA 2Z92A 3GMLB 3WD5L 2YN5A 4IRSB 3PP3H 4L4VB 3QDJA 5IBLD 1P6AB 2VDRH 4OLUH 5ALBH 5EBMB 1L4IA 1OLZA 2VDPH 3O9WB 1UJ3A 2JLLA 3BO8A 3FB7B 1EAPA 1MRFL 5F97E 3UAJD 1NCWL 3ULVE 4OBSA 4QRPA 3P9WB 5IMOB 3QUYA 3SGJC 2R2HB 1CDJA 4L3EE 3QDMA 1FL5B 3LN9A 4BKLB 3THMH 5C0NC 1AGBA 1JGDA 4P23D 1HWGB 2R0WL 4H8WH 4WO4B 4RAUA 1MCWW 1ZTXL 1F6AB 5DXWA 2BFVL 5IMMA 4ZQKB 1E4XH 3C9NB 3MLXH 1FFOA 2IBBA 5C0DA 2IALA 4QOKB 2XZAH 3QUXB 4UU9A 3MZGB 2BNQB 3TH2T 1JL8A 5HGGS 3NCBB 1CGTA 4LLDA 4HS6B 2QKIB 1GAFL 3KPRB 4X7TA 5IJKC 4P4KA 1P4BH 4I0PC 3BVNB 4X8JA 3QDJE 1JI1A 4I8DA 5LQBH 3MLUL 4M03A 3QO0A 4DKAA 4Y16C 5HPMB 5FGBA 1BVLA 3O6FD 1K4CA 4I2XE 1BBJB 1PSKH 3BH8A 2I07A 3K0WA 2ERJB 3QUKA 4AH2B 3HPLB 4KAQL 4P46C 2J8UB 4QKXB 5D2LE 4DGVL 4WTWA 4IOIB 5HGDB 3F65A 2HH0H 5FM5O 4QCIB 3D3VA 3QSKB 4X6CE 3ULVL 4OLYH 4RBPK 2ZSVA 3LQMA 5I8EB 3ARRA 3CZFA 1F3RB 2DQUL 5DYOB 5I6XC 5DGRA 4EUPH 1YN6A 3JWDC 4LCIH 3TYFA 5GZNC 3QEGL 5FO9B 3MRQA 1S9VB 1IVLA 3EYVA 3IFNL 1HHHA 1MELA 2HFTA 2XQBL 3WIIH 2VO5A 5M95B 4UV4H 2WV3A 4R6UA 4WCYL 3EO1B 3T2PA 3WJLC 3MRFA 1CXHA 3RKPA 3B9KC 2JIXD 1YN7B 4OD2A 4KTEL 3BPLB 1XMWA 1QR1A 4OTXH 5E00B 2L0DA 2DS4A 3PIQB 5FXCH 1G7MB 3AS1A 4M6ML 4I9WE 5DD6B 5B38A 1F5WA 1PLGL 5H2BB 3RY6C 1MHHB 2VR4A 2HTKC 4PJ5A 1S7WA 5IEKA 1WBYB 4JFHD 5CGTA 1A02N 4TSBL 4U1JA 2H41A 1FIEA 4U1SA 3I6GB 2FLBT 5EUOB 2R1YB 3UTZB 2A6JB 2VITB 3O9WC 5L88L 1J88A 5KBNC 3ARSA 3FT2B 4CNIB 1J1PH 3RX8A 3X3FH 4YXLH 4M6OH 4I0CC 3U9PL 1NCDL 1T89C 1INQA 3CNKA 3WJJC 1G7HB 1KV3A 2MTPA 2XKSA 1Q8MA 2P7TA 1X5JA 5L0QC 3UZEA 4K3EH 3MXVH 3VXOB 5DLMH 4G9FD 4PLOB 4X99A 3MFFB 5TE6H 2AXGB 3KPPB 3OJDA 5DC4B 3U0PA 3EHBC 4GW5A 4H20L 4MMXC 1X9QA 5J0BA 1AXSB 4Z9KB 3BD3A 2JJVA 4DKDC 3MNVB 3D85A 3T0EE 4NKMA 5I1CH 5CHNA 4LPWA 35C8H 4HPYH 2X7LA 2P43B 3NPZB 2PTVA 1AC6A 4H5SA 5I1DB 3V5KA 3P77B 2VSCA 1NMCC 5IBTH 1YNTA 4NQCA 1LE9A 2AQ3A 4X7SH 2Y5TA 5JLZA 1A4KA 2YBRA 2G75A 2BOBA 3QFJD 3WXVH 1G7IB 3QDAA 2HKHH 4G80B 3AB0B 4PP2A 4CN6A 5L8KB 5DEZA 2IQAB 4PJXB 2RR3A 5ACMA 3N9GH 4XBEH 3P0VH 5TE4H 4L4TB 1NC4D 2GSIB 2VLLB 3OMZA 1NCWH 1VFAA 3SCMC 3LV3A 1U3YA 3U9UA 2K3TA 2J4WH 3RPIA 4L29A 1JZ7A 1HDMA 3HKFA 4JFQA 2ZCLL 3U7AA 5CD3B 1UKQA 4HT1H 3IXTA 3CVHA 1CFBA 1IILE 4N90D 5C07E 3HAEG 5KJRL 4DCQB 5KSAC 5DRWB 2CKBB 3KPLA 4BELD 2V5SA 4JO2L 5C3TA 5EULV 4UILH 4O00A 1DQMH 2MKWA 4KQ4H 2GITB 5DJCA 4K9EH 3BE1L 3VFMB 1OAXL 3D3VD 3AU1B 5KVFH 4N1CA 2F53D 1HKLH 4XAKE 2ICES 1WWAX 3MLZH 4DGYL 1C16B 1U8OB 3FO1A 3WV0A 5D7JD 1M05A 4C83B 5DMJB 3EFDL 5A2KH 2Y06H 1GGIH 2X1QA 5J6HB 3ALXA 2CDEB 2IFGA 4J6RH 4Z7VA 3SQOL 1T2XA 1CLZH 1MJ8L 3S88H 3TH3T 1MQKL 3CFKB 1FPTH 3VFSA 3WFZA 3GKWL 4NJAH 3EYSH 1DQTA 4JO1H 2B1AL 4HS3B 4HWNA 4GKZA 4LCYA 4PD4K 1BQLL 5JDSA 1MFCH 4M7ZB 1LMKA 4G9FE 4MD4B 5MEQB 3PL6C 3MCLL 3AXLA 5C0FB 4YPGB 2DJSA 3RU8H 5LWYH 1YEIH 3FO0L 4PJEF 3SKNB 5I16A 2IAND 1HIMH 1I8IA 5A3ID 5BVJB 5I1IL 3DV6A 1AQDA 4CMMA 3VI4E 2JE8A 4BZ2L 1AGDA 1KLUB 3EYFA 3T65A 1U8IA 1RUPH 4FZEH 4GSDL 1T0MB 2Q86B 5EZLA 3AVEA 5CCKL 4QXGL 1CXEA 4G42B 1JIBA 5JW3L 3VD5A 5I1EL 1DUYB 2KKQA 1I3GH 4U31A 5KSBE 5CILH 4QRUA 3GJFA 2YSSB 4MNQB 3QG6A 4LKCB 1JV5A 5D71L 1S7VB 3H6JA 1E4WL 3T0VA 4JFEA 5IHBA 4UINL 3BQUD 2O5XH 4Y2DC 3QISA 1FZMA 2BNQE 4JG0L 1HH9A 3H3PL 5DVMA 5C0JA 2ED8A 4C4KT 4FQJH 4LHUA 2Z4QB 3LDBB 3K4ZA 3PABA 3GMLA 1CDYA 3JWNC 4LARL 3KLHD 2X09A 1KB5H 4KK9C 1C08A 1PYWA 3WFCL 3GGWB 5I30L 2XZCL 3QHFL 4NM4H 4QRPE 3QH3B 3ZKXC 4Q9RH 4XH2A 3V4VH 4HS3A 3O6FB 4DJMA 3FQTB 1KCVH 2GT9B 4GQPH 4LSSL 4YAQB 4J3OC 3RA7L 5JIKA 4N0UE 1IGTA 2H9GA 1LO3L 4WW1B 5JHLL 3VRJA 4LSTH 3CCHA 1MRDL 2J6EH 1YPZE 2DLEA 3LS5L 3T0EB 4PJAE 4QXUL 3MLWH 4Y7MA 1EGJA 1IC5L 2Q7NA 3C09B 1RUQH 4JZJA 1IC1A 2HRPH 1IAIH 5IV2A 1KPRB 5KSBA 1WZ1H 3HZYA 1UXSA 3VFUB 2DIBA 4PY7B 4KROC 4KHXH 5B38B 4P2OD 5HHNB 3VFPB 2H2SD 1LO4L 2IAMB 5ERWA 3T4YB 3IRPX 3RWCA 2E9BA 1OCWH 2HJKB 3AAZA 2VAJA 4TYUA 1SJEB 1KENH 5DJAA 1YMHB 4LLUA 2X4SB 4XCFL 3U0TB 3CUPB 5D72L 3W11D 1K6QL 3NMEA 1R24B 1B6DA 1TXKA 4CRPA 1KEMH 3MV8E 1L9NA 1A1NA 3B8YA 5IBTL 3EOTL 1DUZA 4ZMAT 2VWEE 4Y16D 3EYVB 4LSUH 3JUZA 3BP4B 2A6IA 4JO4L 5BQ7B 2Z91B 4I0PD 5FDWA 5JXED 1DQQB 5C2BH 3PWUA 1XGUB 1KPVA 3N0PB 5TGBB 1I8MB 2N7BA 5GGTA 5T3ZL 4X0KB 1MAMH 4LU5H 2EXYC 1DBKL 4HKZB 4X6DE 3CPLB 3HPLA 4HFUH 4UV7H 5GS2D 3MJ9L 3RIFF 2E9WA 3ULVC 5CSZB 4LQFH 5H94A 1OCWL 1NAMA 3UBXI 2JCCE 4AY0A 5EC2A 4OZIB 4KK9D 1DQML 1U8PA 3LY6A 1QVOB 3QG7H 3HE7C 4JO3H 4R90L 2ITDA 1I1AC 4GAGH 3HZVA 1ZLWK 1ZWIA 3QI9C 4YE4H 3T4AB 2ZZUT 2P8LB 4HWBA 4OSUL 1H3TA 2YD4A 2R0KH 4NM8H 1OLLA 3CFIC 1ZHLA 4LPUA 4PP1C 1KYOJ 4ETYA 4NKDB 5GRXG 3HE6A 3DJ9A 1IC4L 5C86A 3W0WD 1MI5A 5D2LA 3JUYA 3RX5A 4PJXE 5HXMA 4PLJD 5EC1A 4ZUUB 5GJSH 1VERA 4V2CB 4HKZA 3CSYA 3ULSA 5ANMA 1YNKL 4R26L 3BEVA 4U1SB 3FTGA 1IM9D 4I18A 5T3XL 3BISA 5C09A 2WUBH 4I3RL 2DLIA 5LXGL 1N4XL 4KHTH 1VPOH 5C09D 3LKRB 1YEIL 4XPGH 5EZOL 3HA0A 3O9WA 5CJOL 1DBAL 4APQB 2NY5C 1NL0H 1RVFH 2X44D 2YHGA 1QQDA 1QEWB 1T20B 5SWSA 9CGTA 4GKOA 4OFYD 3U1SH 4P4KD 5F9JA 1J8HD 4ZS6D 1YY9C 5JW5A 3V52L 5JHDB 5DHYB 4EUPG 1A6ZA 1UCBH 4OCSL 5FF6A 4Z7UB 2Q7YA 1LNUB 5HHME 4ZDHB 4XVSH 3HI6H 3JWOL 4Y4KC 5A16A 3O2DH 3LN5A 4RZCB 1M6OB 1OARL 1ORSB 3L3JA 1JPSH 4NJ9H 4ODXA 2K7PA 3PF2A 3F12B 1X44A 2NY4B 3QRGL 4OUOA 5HVHB 4RSVA 1RUKL 3LEYL 4KV5E 5ITFB 1FV1B 3C60C 2JJTC 2ZUWA 4Z7QF 3PQYD 3BZ4A 1N2RA 5CS7A 2IPTH 3IXAA 3TNMA 5E9DA 3CZFB 2VDKH 3C5JB 1QFUH 2GJZB 2VDOL 1HYSD 1MCBA 5E5RB 2RQ8A 2QQKL 1CR9L 4U6XA 5T3XE 1FL6B 1E0OB 4YHOL 1RHHA 3VRJB 3BMWA 3MRGB 3GRWH 1HWHB 1Q9LA 5C0ND 1BQSA 2XN9E 2WIMA 5K9KA 5KTEL 1UWGL 4HLJA 3GMMB 5E8EB 1KFAH 3T1FA 2FEEL 1OP3H 2E7HA 1RJLA 4ZAKD 5CZXC 1X7QA 3VH8B 4JB9H 4TOYL 2NXYD 3T3PF 1CGSL 3HNTH 1QKZH 1ED3A 1YJDH 1CICB 3BD4A 4H25A 1K4DB 3FO0H 3GMNA 1EERB 1NMAH 3CZJA 1OD7A 2NY3C 5FM4A 5INCB 4CW1B 4I0PA 1ADQL 1I1AB 1FFOB 3CIQA 4G8FB 5D1ZC 2CGRH 1TIUA 2Y6SC 5FM5M 3FO2A 4XMLL 4KXZH 5E1HB 2FJGA 3QQ9D 4LBEA 1CLOL 2G9HB 4FTVA 4ZNEE 2AQ1A 4CVXB 3B43A 4R4FL 1L7TL 3LEXB 4RAUB 1FYTE 1BD2D 3DO3A 2VDLH 4J1UB 2VL5B 1KEML 5FHAH 4R8WL 5IIEB 1BFTA 5IFJA 1VB9A 1Y18A 3WHE1 5GS0L 4Y5VB 1N8ZA 3VFTA 1BZQK 1MCHA 1QO3B 1U8IB 2BY2A 5FM8A 1E4WH 2YPKA 1WQVT 4H0IA 2I9LB 3TVMB 4JPIB 1GC1L 3OZ9H 1EJOL 4LP5A 1RIVH 4XP5L 4HS8L 4K7PY 2NXYB 4M7LL 2Z92B 5D7SL 4FA8A 5J1TC 4LLWB 1CL7H 3L3GA 4XVJL 3VFNB 3ZT7A 5FYJH 3RGVB 4K7FA 1IKNC 2C3HA 2FGWL 2G5BA 1CGUA 2AJXH 5E8EA 2I5YL 4JCLA 1GZQA 4ZAKA 2MWCA 3WJLA 4Y1AE 3QQ3A 4OQ1A 5E6ID 5EIQA 1QOKA 1ZLSL 4AEIH 4OGAD 4P57A 2OP4L 1ERNA 4K07A 4LEOA 2F58L 4YBLC 1MCNA 1VHPA 1HNGA 3OR7A 4JY4B 4ZODA 4GS7B 4PGEA 1ZT4A 3F6IA 1P84J 4PJ8D 3TWCL 3QIUD 1TVDA 1Z0MA 2BCKB 3LS4H 3QJFB 3ECBB 3MJ6A 4W4OA 1V7MH 5FHAL 1HINH 1KLGA 3QIWB 4V1DB 1RIUL 3O3DA 5HHOB 4Y19D 2E7BA 3ARDC 4ZUVA 3IJHB 2QADD 3IU4L 4ODTH 2XTLA 3VWKC 4OV5B 2ARJA 3VGGA 5F3BB 2DQCH 3TBTB 5FA4A 4E5XA 1M71A 4DEPC 1NDGB 3OAYK 4NQCD 3ARBB 3NFNB 2M2DA 1UXWA 5I8OH 1RK0A 4F57L 1X5GA 4LSPH 1CS6A 5SWSB 3OAZH 3MLSH 1QEWA 4BQ9A 4L5FL 3U79A 1DVFB 1JJUA 3QULA 2WLZA 3UP1A 3UCRA 2XIDA 1FQ9C 1XGTA 4U1LA 4UT7L 4X98A 4L9LA 3OR6A 1CE1H 3IKCA 1P9MC 1FL3A 4Q9BA 1LE9B 1H5BA 1MEXL 4LVNC 1XF4B 1WCBA 4PJ9D 2R0ZH 4M7KH 3X11B 5I1KL 1BJ8A 4WU7A 1GRWA 4X83A 1HIML 3RWEA 2X4NA 3GSOB 4L8CA 4KTEH 1PZUB 4WFGE 4WV1B 5IVXA 1WCQA 2VXVL 4YR6A 5F1IA 1YEHL 1RFDL 4ODHL 3FQXA 4ZD3H 5KSVB 4KRPD 5DUMH 3TVMD 1AKJB 1M7XA 2Z31D 3R06B 2ARJQ 25C8H 2X4TB 35C8L 3PXHA 5HDBF 2VLJA 3F5WA 2FHFA 2CK0L 1KEGH 2GJ6D 4GW5B 2AJVH 3G6DH 1DR9A 4XPTH 4U7SA 3MGTB 5BS0A 3KLAA 1FH5L 4BFBD 1XFPA 5JXEC 5KZCB 3HC4L 2WLYA 3U6RB 4FXKA 1KJ2A 2IH1A 4F57H 3AS2A 2AJSH 3BYTA 3AGVA 4MQSB 3D18B 4OAWA 2XRAH 3GUTA 2ZOLA 4K71B 3MRRB 1WF5A 2GKIA 4S1QL 4Y1AD 3UTSB 2DQFB 4Y8AA 1X5IA 4YDIH 2YD7A 4N1EA 2ARWA 4HXBH 5GGVY 4TTGA 4PJIA 5IB2A 1S9XA 3VWJD 3KYKH 1P4LB 2AGJH 3TCLA 2KQMA 1FVDA 5TE6L 4O2CB 4F15C 3VGHA 3NIFF 5SX5K 4FQLH 4X4XB 1DQQA 2W9DL 4L3ED 4KK6D 3VGAC 4P3CH 1NBZA 1NFIB 4PY8I 1LP9B 4FQPA 5F3HB 4NUGL 1G6RA 1SEBA 3BZEA 1UJTA 1ZE3C 2ZUVA 5DF0A 3QNZA 4D94A 2CGRL 1D5MB 4LHJB 3C6LD 2OL3H 3CFBA 1U3ZA 2CR6A 2VZVA 3VA6A 4I4WB 1IL1A 4WUUA 2O5ZH 4JQXC 5DMGC 4F7MB 5FUCE 1XIWB 3FFCA 3EO1A 3D1MC 5DRZA 1RZGA 2VL4A 5I19H 5JW4N 2HKFH 2EYTA 1CGWA 3JV0A 2FLRT 5SWZE 4ELMF 1YZZA 4RISL 1WJ3A 5DQDL 4QOKE 1SJEA 2IC2A 4CN1A 1RSFA 3MRQB 5BVPL 4HUVA 1PQZB 1I7UB 1CIDA 5HD8C 5DRXB 5E6ZA 1X5ZA 4NQDE 3EFFB 1ZGLA 1HQRA 3CFJA 3U30C 4MS8C 2YD9A 1HEZB 3ILQC 4GG8A 2QQKH 4M1GH 5C0GA 2EDFA 4YLQT 2O61A 1T1XA 1BGXL 1KIPB 1NKRA 4ZS7H 3QJHA 3FQWB 4ZS6C 1ZLVH 3MX0A 1F42A 4JRXE 4XNYH 2CIIA 5D4QA 1I9IH 5DQ9B 3JSSA 4AH2A 4KVCL 1EGJL 1OP3K 5FO7A 1FJ1A 4OCLC 3WIHL 3K46A 2A83B 2C3VB 1XGQB 5SV4A 2D31A 4KK8C 4APQD 1C08B 1PYWB 2NY5L 1Q72L 1UWEH 3BX7C 3TEUA 1N6VA 3VXUB 3MJ9A 3SGKC 4Y2DA 3DI3B 3HAEB 1L7IL 4C57C 1T2QH 1MNUH 1IM9B 2UY7A 1JUFB 5BZDA 4PRDB 3DGGB 3UO1L 4P57B 2OL3B 4RGOL 1JNLL 4ODTL 1U8KA 3OJ2C 3V6ZA 4NQDA 3EBAA 2ZCHL 1OQOA 4LGSB 1GGCL 4U1KA 4PTTB 4NDMB 1MVUA 4YE4L 2A9MH 2A1WH 4KTDL 4G42A 1JGDB 4XBPA 3VWKB 2VLKA 4X9IA 4Z8FL 5FYKL 1QRNA 5GGTL 3IDNA 1B9ZA 3TBYA 4P23C 1BFVL 1IC4H 4OFVA 1JPTH 3VDAA 1FG2B 3BSZH 4NP4H 3RWFB 4CVZB 3IKKA 4UAOC 4FQIL 3IYLW 3DVFA 4P2QB 4WRLA 4OM1H 1FNFA 3VXSE 3QUMB 1KACB 3WS6C 1F4YL 5DSCA 1FG2A 4J3VA 1IGML 2PR4L 3MODL 4QWWD 1FAIH 1Y18B 2VSDA 5DZNA 4CVUA 3MOAL 5FA3B 4Z78B 2P5WA 2NY5H 1AGCA 1TDQA 3WS3B 1N6UA 2Y6SD 3SN6N 4X6FA 4DVBA 3HNVL 5EOCH 5IR1B 4I3SL 5JIPA 3RIAK 2FL5B 1D5XA 1KPUB 3PWVA 4F33A 1YQ2A 5GS3A 5IROC 1I8KA 3HI1A 3D48R 3VCLA 1FGNL 1ZVYA 1EBAA 3KYMB 1TJIH 1NPUA 3RWDA 4PRDA 5DMYA 1TPXB 3F8UB 1B6UA 4M48H 3T2NL 3RNQA 1K4DA 4FQJL 3KPQA 3P3YA 1T0NA 3M1BB 2P46B 3QCTH 4I9WD 3MBXH 3NACH 4YNYA 3BGFB 5DJ0B 5DWUH 1EJ6A 3HS0A 3EOAA 3BZFB 1MJJA 1VFMA 2EIZB 2UUDK 2XZAL 1CT8B 5AD0B 2NW3A 2DQDH 4NN5C 2CKBA 3MBEA 3T2OA 1TNNA 4JRXD 3VRIA 4M43L 4D9QE 3OPZH 1QRND 5B3NA 4QY8A 4U6XB 1N7MH 3PGFH 4L29B 5C0IA 2ATKB 1MLBA 2WIIA 4KI1A 4HLZG 5HDQH 2NX5E 4DN4L 5D7IA 5DK3A 4YQXL 4GG6A 4IJ3B 2ESVB 3HE7A 5LG1A 2H2SC 1ZANL 3P4MB 5T5FH 2A73A 4KROD 4PJGE 2BRRL 5EU6D 3IF1B 3C08H 4PJ9C 1CQKA 2VISA 4M6AA 4EVNB 1OGTA 1VKXA 1U8HB 1CZ8L 2IQ9H 5CEZD 3TBSB 2J4WL 5DA4A 4GBXB 4QTHA 3MRCB 4R9HA 3WL9A 4CU6A 5D7LE 4KU1A 1WTLA 1LNUA 5GRYA 3QI9B 5I1DA 1QRKA 2FIRT 5F7LB 1NANI 2RCSH 1DBMH 3RAJL 3O6LL 3MUHL 4JM2B 4WO4C 4O02L 3SDDC 3HG1B 2AJUH 3QIBC 4G6JH 3ARWA 4GXUN 1D5MA 4QT5A 4W6XB 5E56A 4F58L 1D6VH 4OCWH 4AG4H 4FQCH 4GKSA 2BSSA 2FSEB 1CG9A 1BECA 3MRPA 4KI5C 1D5IH 3E6HA 3O45B 1B4JL 1VENA 4XNZB 4JY5H 5E2VH 3VMPA 2D0GA 5EN2A 4G6KL 5DK2A 3BKJH 3MR9A 4GG6E 5TDPA 5F96H 2R9HD 5JTWA 4TRPH 3X12B 3VWKD 1IGIL 1N3NA 4PGDA 3GSWA 2YEZB 2RAMA 5JORA 2H26A 3SBWA 2DICA 2WBJB 4ZPTB 3DRQA 2KL6A 1Q38A 3EO9L 3MUZ1 1CFSB 4ZUUA 2OJEB 1RZ7L 1Q1JH 3BP7B 1RUAL 4DEPB 1NCAL 4D9LH 5LGJA 1RPQA 1FSKB 4LMQE 1KJ2B 2X5PA 1HKFA 1ZHLB 3BWAA 1P9MA 1OAQL 4LQ1A 4PJ5B 5IEKB 1NDMB 1V5JA 3RDTC 2XYCA 2FX7H 4HZAA 3C60A 1KTKE 4OZFH 4LIQH 1UB5A 3RBGA 5BCAA 4JN2B 4H1LG 5LKNA 4HC1A 1OGAA 4BUGA 3STZB 4AQ1B 1BBDL 2DQGH 4GRLB 1FGVL 5MP6H 1UH3A 5B39G 3RWEB 4CMHC 3VGAB 1INEH 4WW2A 3W0WB 4NRXA 1PKOA 4X0KA 2XACC 4HW6A 4CDGC 4Y5YC 5BW7C 3S5LG 1D9KC 1KCLA 3S34L 5E94B 3IDYC 4MZ3A 1CLZL 2VN7A 4X98B 2NW2B 2V2TB 2A6DA 5DRNB 1NCNA 4KMLB 3MLRL 3WIFA 1K3IA 3DO7A 1OB1A 3B6SA 4WTXA 5EOTB 2R1WA 5TH2A 2ATPA 4NHUA 5F44A 3SDYH 3CMOH 4LLYB 3C6SB 1QFOA 4L8BA 2PO6B 2HLAA 3CVIH 1NMAL 4N0FA 5C8JB 1M71B 4MAYC 2P5WE 1EXUB 2GUOB 4KZEH 3GKZA 5IWLA 3TIDB 1AR1C 1BVLB 2OYPA 1YC8A 3IS1X 3NCMA 1MI5E 5ILTL 2X2YA 2A38A 1V3MA 5JOFB 3QEHB 2BERA 4HWZB 1BF2A 1UT9A 5F1NB 3W9DB 3KPRD 3QJFA 2OS7A