4JFFE

Preservation of peptide specificity during tcr-mhc contact dominated affinity enhancement of a melanoma-specific tcr
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
245
structure length
245
Chain Sequence
MSQTIHQWPATLVQPVGSPLSLECTVEGTSNPNLYWYRQAAGRGPQLLFYWGPFGQISSEVPQNLSASRPQDRQFILSSKKLLLSDSGFYLCAWSETGLGMGGWQFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title T-cell receptor specificity maintained by altered thermodynamics.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
total genus 48
structure length 245
sequence length 245
ec nomenclature
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jffE02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jffE01
4LF3A 3D18A 2QJDA 4KJQD 4I77H 2IADA 4QHLB 3OJDB 4WUKL 5IK3A 1OGTB 3K4ZA 5IMKB 1JGVL 4D0DA 4L4TB 1A6AA 1HKFA 5FO8B 1YC8A 3K3QA 4TTDD 3F58L 4NRXA 1RUMH 5J7CC 3S36X 3OG6B 4DUXA 5HDQL 4TPRL 2VDMH 4YGAB 3T0EC 1Z3GL 3P4NA 3LKNB 2WWMD 1TJGL 4WFED 1S8DB 4HX1B 1NCDL 2LTQC 1LO0L 3BKCH 1J1OH 2QQKH 1UWEL 3IXAB 4ZPVA 5KZCB 5F7DA 1KBGL 2YWZA 1T21B 2X4NA 1UZ6F 1LK2A 4PV9B 4GKOA 2KDGA 2WWMC 1CFVH 3HG1A 1D6VL 2Y4SA 3OB0K 3Q6GL 1HHJA 5SWQA 4K2UL 4QXUH 4TRPH 1N6QL 2PO6C 2XA8L 4FQPA 4M3KB 3BIAX 3E8UL 2F8VA 3IDGA 1DBBL 1VESA 1M71A 2EDNA 4N0CD 4AG4L 1XZ0A 3SE3C 4JN1L 1DBML 1AGBA 1NL0L 2BVPA 3VXNA 3KYMA 5DS8A 5KW9H 3LN9A 1OSZB 3KR3H 4JY5H 1ZT1B 1LE5A 4PD4K 1OTTC 1OB1B 3SJVD 5C2UB 1AR1D 1H15B 1X5GA 1MCLA 4HJJH 1MRCH 4KZDH 3MRPB 4HFUH 4J3XA 3DIFB 4OB5L 1VKXB 3L3DB 3BW9A 4E41B 1GC1L 1NGQH 5T1LD 1LK2B 4DUWA 5MENA 1UEMA 2AKRB 4OI7A 4BFIA 2EKJA 1BWMA 4U49A 3QA3B 4EXPX 2X4OB 3PXJA 3BE1H 5H2BB 3ARGA 3MRJA 1RPQA 2HT2C 5T3XL 1I3VA 1TLKA 1DL7H 3VFPB 1RUQH 4BYHA 4JR9H 3MLWH 2ZNXA 4F7EA 2VMFA 4HJGA 3QNZA 1FZKB 2AERT 4JY4B 1ED3A 3MTRA 3HMXL 1S78C 3WSQH 1U8HB 5HYSA 3U79A 5LBSH 3DX9A 2WAHA 5C07E 2B1AL 1FRGH 3OKYA 1P2CB 4HLJA 1IJ9A 2FECI 2D7QA 1S3KL 3QIBB 3RWFB 1HN1A 3WS3A 3FQUB 5DD0L 1IAKB 5TH2A 3MA7B 1KC5L 4LLWB 1NCWL 3AU1A 4F9PC 1CLOL 2GTWB 3GKWL 3B43A 1UADC 3P4NB 2JCCF 3HE6D 2QKIA 4OM1L 3ZDYF 2KPNA 2H2PD 2R0KL 4NFCA 3ARZA 1VENA 3NOIA 4NRXB 3C5JA 2EC9T 2WQRA 5IQ9B 1XF3B 1J5OH 3C09B 5AD0A 1CGUA 5INDB 3VGDA 1W72L 4XP9H 4OGAD 3DGGB 4Y4KD 2W1NA 4J8RA 3OJDA 5JA9A 1FPTH 2MHAA 2ARWA 1KJMB 1UJ3C 4UV7H 1AGFB 4XCCH 2BVYA 5FECA 1PD6A 3L3GB 3RIFF 4JO4L 1EUUA 1ZVHA 1J86A 4KRPB 1T89A 2V5SA 1I9IH 4P4KD 4LCIH 4KJWC 1XGUB 5B39G 1WIUA 5C08A 4J3UA 3ARFA 4NNYB 3W39B 2DQIL 2WBWB 1RZ7L 4MNQE 3EOTL 4KK6C 1JVKA 4LLVB 3WHXA 5EBLA 4ZXBC 4CNIB 5JHLH 3WFDL 1KEGL 3MCLL 1L9MA 3OHXA 3L3OB 3MRQA 4YHOH 1MLCA 1MWAH 4XNZB 3SKMA 1RIVL 1INDH 3QDGD 3SE9H 5IHZB 1RZIB 1UYWH 3SKJH 4PJBE 1U8PA 3LS5L 1FH5L 2CKBL 2MOVA 1JV5A 5IVOA 5T1LB 3EYUL 3HS0B 2YUVA 4X7SH 3T0VA 4UT7L 2AK4A 2IBZY 1LO3H 3BPCB 4NHUA 1Q9LB 3NCYS 4HCRL 1JZ5A 5HGHA 3L5WA 3QRFM 2ITCB 5MEOB 1JGEB 1XIWA 2QQNL 5CMAB 4HG4J 1T83C 3BPOC 2JJSC 2F53A 3HAEB 4H1LH 1JZ3A 1BIIA 4OKVB 5LXGL 4ERSH 1NC2D 1TQCC 1DVFB 1S7SA 2WBJA 3H42L 4O00A 5GPRA 4RGOH 3LAFA 3EYSL 1G9MC 2EDWA 4P57B 5TQ2H 1Q38A 4Q58C 5KSBE 1UVQA 3UTSB 3QUYD 3CMOL 1YZZA 4PRNA 3N06B 4AZ8A 3WL9B 1QLEL 1UM4H 2V7HB 4DGYH 4PRIA 3KXFD 4L1DA 1KLUB 4NN6B 4WGVB 3HUJA 4QCIA 4MGXA 3UTTA 3I6LD 1E4KA 1IQDB 3WIFA 2ITDA 4HZLA 4D3CH 4FQCL 1MCKA 3VDCA 3BEWB 3CVIH 4PJCE 1NBQA 4IOIB 5JORB 4G42A 4NO0B 4NNXA 3HNSL 2P5WD 3PL6A 1OAKL 4PRAB 5CUSH 4GLRI 4ERSL 1MJ7H 3WUZA 4Y5VB 5IR1A 1J8HB 3I2CL 1GGUA 2EE9A 4JZNA 2AW2A 1RZJC 5DRXA 4MZ2A 3WFHA 4OV5B 4O2CB 5HYEA 4UTAH 1YN6A 2VLRD 3V6OC 2BNQB 3SE8H 3U46B 1TNMA 3NACH 2O5YL 4OCYL 4M43H 1M7DB 4JZJC 4HLZH 3OGOE 4GAGL 3QDJA 1ZVSA 5DA0B 4X8JB 2VL5B 4PBWD 1IEAB 1W2KT 1QSVA 1WIOA 2JK5A 3QFJE 4Y1AE 3LVEA 4ZFFA 2DKMA 4BM7A 4E41D 1JZ8A 3SE9L 3IDXH 3LPGA 4UUJA 2VDQL 4JCLA 5GS1C 3BEWA 4XBGB 3UTZA 1EHNA 3DX9B 5FGBA 5JIIA 4X6EB 5LGJA 1EGJA 5HPMB 5D93C 4F7CB 1RZ7H 2ZUSA 5FK9A 4FQIH 1GIGL 4ZSOE 1NUGA 3V4VH 1J18A 4DEPB 2EKSA 4HWEL 3W81A 4M62L 5D5ME 1JGUH 2NQCA 2LU3A 1SJHB 4H26A 5IJKA 5TE6L 3MJ9A 2DAVA 1W72B 3IRZA 5LQBL 4PRNB 3MBED 5JW4N 3CCHB 3KYNA 4XNQB 5IJVB 4XC1L 3Q0HA 4WFGD 4WY7H 3MYJB 4NNPL 2AQ3A 2JIXA 3K8MA 4LCUA 5HDOA 3WJJA 5I76A 3BT2L 3O8XD 3MFFB 1FZJB 4CAGA 4E41A 1DCLA 4ZUVB 3QJHA 1TCRB 5CS7A 5I15H 3TO2B 5CP7B 3MRPA 3W11C 4KVNL 5EOTB 1FFPB 4KHTH 1DEEA 3G6JE 1CLOH 1TDQA 2B2XH 2CMRL 1IZKA 1NCWH 3SDAD 1RUKL 2JJUA 4DJMA 5HHPB 4YC2C 3IJYA 2YD1A 5B3JE 4URTB 5D5MF 5K9OB 1WTGT 1QNZL 4OF0A 1KIQB 3QUYB 4HHAB 2IMNA 3ECBB 1MQKL 5EU5A 4MXQC 3MO1A 1LEIB 1MFBH 2DIAA 2X4SA 4KROD 1ZLVH 1DN0A 1VACA 5DSCB 3O2WH 3L3HB 1UACH 3A6BH 4XBPA 3BZEA 1SJEA 4RWHA 1U3ZA 4APQA 5GRVL 5IKCA 2MNUA 5D1QA 4LCWA 2FIKA 4JFZH 3MUZ1 1INEL 3U7AA 4JZOB 5A2FA 1PYWA 5F7DB 2YC1B 2W0LA 5I1CL 3BE1L 3I75A 1T1XA 2F53E 4I13B 4NWTH 1I9RH 1H8NA 3QO0A 3D9AH 1QBAA 2Q6WA 1ZLUK 3REVB 4OLWH 1CICB 4I18A 3ZKNC 3OKNA 1Y0LA 2FWOA 4GLRH 4NZRL 3SCMC 3ZT5A 3HE6C 2X4RA 5HGBB 3E3QC 4QHMB 4X8XA 3IETA 2DLHA 5JW4M 3TH3T 5M94B 2FDBP 4F3FB 3JTTA 3WFBL 5CAYB 4Q74A 4WHTA 5D8JH 2IPKB 5IEKA 3SKNA 3OKDA 4N90D 2NW3A 2X7LB 4I5BB 1NKRA 4ZOCA 3WFEL 4EBQH 1QRNE 2YPKB 5CGYD 4X4ZA 4JPVL 4Z7NE 3MJ9H 2ERJB 2YUXA 3SGEH 3BGFB 4WTZA 5TQ0H 1G1YA 2GJZB 5HGAB 4X0KA 3VFUA 2RBLA 1DQLH 1ZTXL 1ODAA 3QXWA 4OCNC 5C08E 5JMRA 4NBXB 2BHUA 3KJ4B 3CZFA 1MFEH 4TRPL 3STLB 1N6QH 2CPCA 3CU7A 4DCQB 1M7IA 2K3TA 2EH7L 5KVGH 4NKOA 3G6DH 1Q9WA 1NDMB 2R2BA 5JORA 1LNUB 4IMLA 3ZL4L 1U3HD 2EIZB 2QSQA 4G6AC 5EN2A 5HYJE 2X4RB 5HGBA 4Z7VE 2BSED 5DQDL 5JW5A 3ME0A 4OT1H 4GRWH 3WLWD 3QO0B 4FQJH 5FOBB 1LO0H 3BKCL 4ZUSB 1TXKA 4M48H 4TOYH 4OT1L 1FGVH 5C0IB 4NPYB 1VGEH 1NANI 1K9TA 2LU7A 1U2HA 3O3BA 5IHLB 3DMMD 1IT9H 1MI5A 4YDIL 4M7LT 5C6PB 1FL3A 4GKSB 4R0LA 1T2QL 3IYLW 4QRRA 3F58H 3KJ6H 2RIKA 3ALXA 3IDMA 4FZ8L 3F12B 2EH7H 3A6OA 2AAVA 1CF8H 1E27A 2VXVH 1RUPL 4Y19A 2C4FT 4ZAKC 4OKVA 3ECBA 4HJGB 4BK5A 4PG2C 2P46B 1E4JA 2KH2B 2FHBA 3B9KA 4L29B 4WW2C 4HS3B 1C12B 4P3WA 2E27L 2IC2A 4L9LC 3PWLB 5ESAB 4YDKH 1KACB 5T3XD 2C9AA 2CKBB 2ESVD 4WNQB 2F19H 4TVPH 4JPVH 2VQ1B 1GOGA 2XXMB 4WI8A 3FAWA 1KCSL 5C70A 4JRWA 1ZWIB 1A6PA 43CAA 3NZ8A 3DWTA 4NUGH 1JV5B 2Y7QA 2IEPA 3FZUD 5CHNA 4AY0A 1OHQA 2X09A 2AJ3B 5D2LF 4CDGC 5AAWA 4TSCL 4F8QA 3DX7A 3S96A 4TULL 3R06A 2ADFL 1PFCA 2VDPL 3W2DH 1JUFA 2UYLB 1A6WL 4HUNB 5FKAB 3HR6A 4IRZL 4N0UE 4NN5B 5SWZD 1ETZB 3KLDA 2Z91A 1HHKB 4JFOA 4FABH 2A6IB 2IBZX 3GSXA 1SY6L 2PTUA 4GG6E 1S7XA 3GJEA 2NR6C 5H37G 3BQUA 3QH3B 3QXUA 4QXWA 4NIKB 4JFZL 4NOBA 2RQ8A 4JHZA 1NFIA 3U30C 5CD3B 5IVZB 3WIHL 2BNRB 3QIWC 3EJYD 1T3FA 1LDSA 5C9KA 4HG4K 4MS8D 5ISZD 3KHOA 4DKDC 1MQKH 2C4XA 4M1DL 4FRWA 3STLA 3CNKA 3U1SL 4ELKA 4TQEH 5ACZA 3DBXA 4FXLA 4JFDA 5C0BB 4UT6L 3IDJB 5KSBF 5JIKA 3I3EA 2MPAL 5KANG 3U36A 5A3ID 5C8JB 1D6EA 4S11A 2CJUL 3EOAB 2NX5E 1BJ1H 2Z4QB 1MFAH 5DJAA 5JW5B 4XH2B 4XWGH 4D9LL 2NX5A 3FT2B 1KV3A 5TH2B 2BNQA 4HH9A 3E2HB 3ZHLA 2NYYC 1MAKA 1JTOA 2A9ML 2W07A 4ODTH 3M17A 1P6FA 5KBNC 1CI5A 5T33H 3AAZA 2V2TA 3HB3D 3TBVA 4KI5D 4F37K 5T1MB 4WGWB 2X4PA 4G8IA 5JQ6H 1BIHA 4PJXE 3OXSB 2Z35A 1GAFL 4B7IA 4H20H 1NAMH 1CU4L 3LD8C 5CD5C 3BKYL 5JR1H 5F1SA 1HILA 4M62H 4QTIL 1EBPA 4ZS7H 3UJIL 3QSKB 4PJDF 5EBWA 3C8KB 1F8TL 3B6SB 5HJ3A 3OR7B 4YBQD 1BZ7A 1ETZA 1XGPB 3FFDA 5IROC 1OTSC 5BZWA 4U1KB 1MHHB 4Y0GA 4AYFA 4ENEC 3ILPA 3A0OA 2X4UA 4LGSB 5MI0C 2O93L 2BDNH 5E24E 1NBVL 3O6LL 2Z31A 1BZ9A 1J10A 2ESVB 4LSUL 3IDXL 1ONQB 3BJ91 1V3JA 4XC3L 1NLBH 2HKHH 4MHHG 1S7QB 3PGCB 2B4CC 1XMWA 5D7JD 4ZTOL 1FAIH 1QUNA 2Y1VA 4HLZG 3RWJB 4JN2B 1EEZB 1ACZA 1HH9A 3CFEB 2A6JA 3TYGH 5SX4H 4J6RL 4ODVH 3VFTB 5EO9B 3D69B 1MUJB 2CIKA 4LIQH 2EKSB 4JM4H 4KUZL 3I2CH 1K4DB 4ZAKD 4PJHB 3BQUC 3CZJA 5F7LB 5GZND 3BGMA 1YEKL 4F9LA 3SKOB 4LARL 4HQQL 5DD1L 1TZHA 4RMRA 4JB9H 1JYWA 2VR5A 5EO1B 4ODWB 1NSNL 4NJAL 4OD3H 1LE9B 1HQRA 2FEEI 3UTQA 5HHXL 1KNOA 4PRHD 4YO0A 4JRXA 3HMWL 2ENSA 3GBNH 4FQ2L 1PQZA 2P24A 4Y2DA 4YXHH 3T0EE 1IGJB 2Q3AA 1TMCB 1OAUH 2FJHB 3SDDA 5E99H 1SMOA 1UM4L 4RFNC 4WU5A 4ZSOB 4F7CA 3VFOA 3QO1B 4HUVB 1HSBA 1EFXA 4FFWD 4S2SA 2FR4A 1OAQH 3MFFA 1DBKL 1YN7B 2FATH 1KN2H 4O02L 2PYFA 3NCBB 1M7IB 1RZKC 3GSNA 2VZVA 4NQSB 1IL1B 4U33A 4U4BA 4M1GH 3BZ4A 3QCVH 4M1CD 2FJGB 4KRPC 5E8PB 4I9WD 2DQUH 3FT4A 5HHMB 3QIUB 1WQVT 1QD0A 4DW2L 1BEYL 4C4KO 3CFBA 3QCTL 1RAMA 2P5WE 5I6XB 2HWZH 4Z7VF 3FRPG 4HCRH 4WHYH 5LGHH 1HKLL 3AY4C 1DE4B 2W0PA 4TSBH 3C6LA 3OPZH 2HJLB 4JRXB 3OZ9H 5F7KC 2CKBH 4X7DC 4OTXH 3G6AA 3SKJL 1N2RA 3KLAB 4HPYL 5GSVB 4TUKL 1INDL 4F8TA 3MCLH 4QT5B 1KEGH 3K2UL 4ZO9A 4JO3H 1K8IB 4ZD3H 1DVFA 2WBJB 3MXWL 5C7XH 5B21A 3BGMB 3KNBA 1CLCA 4HC1H 4NQCA 4U1IA 4K23H 1I8KA 3BH8B 5DC4B 3UZVB 1I3GH 4Z7WB 4EDXA 1X5FA 3VG0H 3ULVC 1R3HA 5D6CA 2NMSA 1J8HA 3BH9A 1MJ8H 3MACH 1RULH 3LKPA 5J9PA 2OZ4A 1I1YA 3MNVA 3OKOB 2DMBA 1A1MA 3U0PA 4HKJB 5EUKB 3PQYA 4LCCA 1U8OA 2VTFA 2EDHA 4NC1C 4ZOBA 3ZE1E 1RJYB 3G5YA 4B50A 4ACPA 4XCNA 2AJYH 4K7FA 4MJ5B 4NYLB 2ITDB 1ZT7B 3V52L 4IS6A 2VC2L 1FV1A 3MLSL 4LSSL 4E9LA 4Z77A 3MRNA 3TBWA 1GZQA 1U8NA 2B5IC 1F3JA 2QADD 1WWWX 2YUWA 1YEJH 1JPFA 1DQDH 1OAXH 3HS0A 3LQZA 4Z0BH 1NMAL 4YHLL 5CZVH 4HV8B 2A0LC 3S35H 4YBHA 5D7IE 4WIQA 3T1WA 4J2XA 4MVBC 1S3KH 3D39A 1FRGL 2B1AH 1ADQH 5EA0L 1JHTA 1FFOA 1KCVH 4HIEA 1HXMA 3QQ4A 4Y5VC 3MYJA 4OAWB 4DKFH 5I17A 3OKOA 2QHLA 4MA1B 1BZ9B 3DGGA 4XNQA 2V9TA 5FM5O 1UM6H 5INDA 1DBJH 4GBXA 4EI5B 3LV3A 4XNXL 4FQHB 1AGEB 4XWOD 4BQCA 1KG0A 3PP3K 1DL7L 1A6VL 2HT4C 3SDXB 3BWUC 3H2WA 4H8WH 3QR2A 3TN0D 5IT2L 1KYOK 5C8JA 5EOQL 1HI6A 1G0DA 2R4RH 1T0MB 3NAAL 3DUSB 4YNYB 3UO1H 1NGQL 3GSVB 5AYUH 2H26B 2YK1L 4BZ1L 5C09D 2VXTH 5BS0D 3LRSB 1IGML 1HYRC 3QDMD 5EZLA 1WGOA 3JWDH 4XPHH 5DJ8A 2CSPA 1TTFA 1T89C 4HS6A 4JO1L 5CD3A 4P4RA 5KW9L 1EJOL 4EOWL 4NQDA 3HPJA 3GBMH 5D7LE 4WW2F 2VYRE 3PJSB 5DJZA 3GMRA 1DFBH 4PJEB 4Z7WF 2MHAB 5CJXC 4GG6F 5ADOH 2BXYA 1HIMH 4H0GA 3QA3A 4U6XA 4QXUL 4HBQA 1LO2H 4HIXL 3K74B 4M1CC 1FN4A 1EMTH 4BK4A 1I7ZA 4YHIB 5E95B 1TETH 5BXFA 5DWUL 1U95B 4QKXB 1D6VH 1F6FB 4LLDB 4Y2OA 2VXUL 4QHMA 1Z0NA 3GSVA 4HKZA 1JNNL 4BZ2L 5KVEH 3DIFA 3IAPA 1VKXA 3MGOB 3OKNB 3QDMA 1NCUA 4K3DL 2R9HD 5DRWA 3MGTB 3RKDD 3W0WD 3X11B 4PRBA 1ORSA 3RUGE 4HGWB 3L6FA 4GAYA 3STZB 3TBTB 4S1SH 1G6RL 1GYAA 1U8QA 3TWCL 2GYSA 3KPPB 4L8SA 2XOTA 2F8OA 1HHGA 2NNAA 3E6HA 4NHCH 1XF1A 1C08A 1ADQA 4B5EA 1A6ZA 5CP3H 1BX2B 4OJFL 4JHWH 1A7RL 4PJ5E 4YBQC 1I8LA 1K2DA 5T3XE 5EZOL 5TF1L 3TP4A 1CK0L 4EIGB 2CRIA 1AIFB 3VXUE 3H6JA 3NVQA 1OB1A 1O5DT 3CLEH 2X2YA 1IAIH 2YPVH 4PP2B 1QFUL 1DQQA 2BOCA 4QRRB 3RDTD 1MCNA 1UM5H 1I7TB 3ORJA 3P4MA 1PVHA 4I0PD 1LEGB 1N7ML 4GQ9H 3UEZA 4K7PY 4JKLA 4ZDHA 3IAQA 3L7FB 3CDCA 4LFHD 2VH5L 4E42B 1DEEB 2AKRA 1AP2B 2BNUA 3O6KL 1F3JB 1C12A 1S8DA 1I3RB 5E56A 5DZLA 5TGBB 1MEXH 1QSFE 3MLRH 4H5SB 2AXFA 3MOBL 2FD6H 4F33A 5HYIA 5CWSA 5C0RH 5K59E 2R23B 4OLXH 4BFEA 3F12A 3KXFE 2AEPL 4LRNH 1RK0B 4XNUL 3F65A 5TE4L 3PIQB 3LS4H 1D9KC 1PKOA 5HHMD 4QHNA 1R5VA 5MP6H 2YEZA 5KS9E 2BNQD 4R8WL 2A2QT 2R56H 3K2MC 4PGEB 3HI1B 2E9IA 1GZPA 3AM8A 3D39E 3MRKB 2MQCA 4OBRA 3X11A 1FG2B 2NY1B 3BZDA 4D8PA 1SYVB 3LH2L 3GNMH 2BJMH 4GRLC 4G9DA 4NQCD 4QRTB 3PV7A 2XFXB 2CUIA 4M6AA 2E7LC 3IETB 2V5MA 4BH8A 2RGSA 1N2RB 3KLAA 4FFYL 3VGHA 2FB4H 5JIHA 3GB7A 1EHLH 3S5LG 4PJ8A 4DVBB 1ITBB 3C6LB 1CT8A 4ZXBA 1JF1A 1XGTA 5BV7C 3U4EB 2EYSB 4HWUA 2HFEB 4Y1AD 1AY1L 2OSLA 1WC7A 1NAKH 2EE2A 3CFBB 3RIAF 3H7LA 2NY7H 1P4BH 3C60D 5MEPA 3FFCA 3Q3GB 4X4XB 1K6QL 1AD9A 4AH2B 4AEIH 5IMLB 5LCVH 1W0VA 3GI8L 4DAGL 1QKZH 4ZNEA 2DQGL 3KS0J 1FNAA 2J12B 5EU7C 1UB5A 2Q8BL 5IVZA 3RWIA 4D8PB 3ARUA 1RZGB 2J8HA 5DVOA 1UT9A 4DZ8B 4CVWA 5HI5D 1JHTB 1CE6B 1O7SA 1U93A 4YUEL 5J12B 3C5SA 4PGEA 4HMDA 5JDSA 2AK1L 4PRDB 4GG6B 1EK3A 5FO7B 2YR3A 1U8IA 2DQCL 1MH5A 1T22B 4L4VE 2W0FA 4KI5E 2XIDA 4AQ1B 4G9FE 3T0BA 2E7CA 4HK3N 2NW2A 1HHKA 4JFOB 3WJLC 3BISA 2YC1A 1NC4B 1C1EL 3D2UB 3G6JF 2J7LA 3ROLA 1DBAH 4IRSD 5I16A 3CVHB 3DMMC 5E5RB 3SDYH 4HEME 1T5XA 4IHOA 1E4XH 1W0WB 1JK8A 4FN0A 4JPIB 1J12A 3MNZA 1W8NA 3IJHB 4S0SD 4KV5E 4KJYA 4P59L 4U0QB 3VWKB 5SWSE 4ONOA 1OD9A 1A8JH 1MAML 1I1YB 4N9GA 5TDOB 4ENED 1AO7D 1RVFL 3RWHB 3L3JA 5ITBL 4MLIA 1Q9OB 5DTFB 5EZIL 1V3MA 1J0IA 1R3IH 3AGVA 2WP3T 3RL1B 3ZTJG 3RPKA 3L5XH 1Q9OA 5E00A 2XZCH 1EEZA 3RWJA 4HT1L 1CFTB 3KPSD 1BQHG 1MPAH 1ZHNB 5ESVB 3RWEB 2FX7H 2IFFH 1GCFA 2IQ9L 1D7FA 1BX2A 1WBXA 1JZ2A 1BBJA 1CD0A 5IHUL 1J1XH 1GOFA 2CK0H 2LE9A 1I7RB 4LEXL 2X44D 2R8SL 3BDXA 1OD7A 2OR9H 3VXME 5L88H 5FA4A 3F7RA 4KMTL 2YKLH 3G5XA 1C5BL 1YEDB 4RISL 2E7LA 2MQ0A 3JWOL 3C6LD 3MRBA 5CFHA 4O51B 2OX5A 4RIRA 2I07A 3WKMH 1XGYH 2QHRH 2NLJB 4LL9A 1A3RH 3D85A 4JFQA 5E1HB 4HF5H 2VITB 4Q2ZB 5ITFA 1VFAB 1G9NL 4G6FB 1H3VA 4IMKA 3B2VH 5GRYA 5JPNB 5E2VH 1WK0A 1GSMA 2XWJB 2VWEC 1KCUL 4JJ5B 5K9JL 5FCSH 1UJTA 4ZS6C 3LHPL 5H35A 2XN9D 4A6YA 1IGFL 1CVRA 3SGDI 4MD0A 5D2LB 1YN7A 3FO0H 1KN4L 1F6LL 2L7UA 3F62A 3FN9A 3WLBB 4LEOA 1QFPA 4FTVD 3IRPX 3OKMB 3ULUH 1IAII 5EIIB 4YHNB 4OUOA 1RQ5A 3GB7B 4I9WE 1T80A 1G7QB 4PYHA 4J4PA 5SV4A 4JRYD 3QWRD 4OCRL 5IVXA 2XV6B 1U8JB 1T20A 1MIEL 2O61B 3AFLA 4QRRE 1CDYA 5E08L 3O3UN 2Z9TA 2GK2A 3DMMA 3B9KC 3LQAC 5A40E 4QHUA 3SCMD 4G42B 2BNRA 1CBVL 1WEJL 1JL8A 5KSAB 4XP4H 5GGSA 1M6OB 4RAVB 1P4LB 3MLPA 3D85B 3O6FD 5B3NA 5FYLL 3VWJD 2DM4A 3MRIA 4S0TD 4JG0L 2RAMA 1S9KC 2HJFB 5IB2B 5DHVA 1UGNA 3GJEB 3T4AA 3SQOH 4YO0B 1HEZB 3BPCA 4NHUB 1JPGA 4H88L 3HAEH 3AS0A 5I30L 1QA9B 3WL9A 2P48B 4CN1A 1I1RA 43C9B 3DECA 1A7PH 5DJCA 2CLZB 1YQVL 5L2JB 1MJUL 2ZNWA 3R0NA 1VADA 3WXVL 5C0GA 4LQFH 5KJRH 2AXGA 1OSPH 3LSOB 1T5WB 3QNYA 4PR5B 4HWZB 5IMMB 5I75B 5IOPA 2BOBB 2QR0B 4KPHH 5JUEL 1BVKA 1AI1L 4FQXA 3RVWD 1JP5A 4YXKH 4GRWE 4QYOA 3NIDF 3IDIB 1FL6A 3O2DH 2BCKB 3ARDA 3PHQA 4NGHL 5EU6B 4E42A 4I18C 4CADA 3X12B 3NCJH 1N8ZA 2VDRH 2FX9L 4PJAB 5EOTA 4OZGE 1PLGL 5C92A 1U8IB 3NFSH 3HAEG 4YWGL 3RNQA 4OZHA 3MR9A 1BZQK 1JYXA 1QHPA 3MLUH 4GAYB 5ERWB 1IMHC 2QADC 2NTSP 1EV2E 5IVNA 1P1ZB 4YDVB 2PW1A 1AD0B 4HKJA 1QEWA 2HA1A 3EBAA 4IMKC 3RI5K 3QZWG 1U6AH 5CSZB 1MCRA 5HY9A 3V6OE 2VZOA 3V7AG 5C0AE 5IFHL 5JPMA 2IAND 1EAPA 12E8H 3DO7B 5J1AA 2P47B 3RUGB 2X1XR 1YEEH 4OZIE 1KB5L 1NGXA 5KSBA 1KCRH 4C4KT 5JW3H 5I8EA 4WDIA 2WLYA 4WI3A 1KT2A 1VDGA 2QQLH 3WXWH 3TC9A 2IG2L 1WJ3A 3D87B 5IESH 1NCAL 1FVCB 4JDZA 4X6DF 3W5NA 1ED3B 3EUUA 3JWNC 2HVJB 5DQ9A 5C2BH 1ZANH 4P4KA 5EWIH 3GBLA 5D1XC 4I3SL 3IAGC 2OSLB 3U7YL 4KAQH 3D1MC 3LKQA 1CDBA 1M05B 2I9LB 5ILTH 2ZJSL 4R0LC 3MLZH 2R1WA 1A3LL 1LD9A 4GSDH 5F89B 3IDYC 3EJJX 5BS0B 1JHKL 3GO1L 4EUPH 5F9DC 3MA7A 5KSVB 3FO9B 1CR9L 1TZIB 5IMOB 3BHBB 1GH7A 2VDLH 5JOFA 4M9OA 4MB5A 3S4SA 2CRZA 4J7RA 3QDGA 4U1HB 4LOUD 1KIPB 4M03A 2YSSA 1GPOL 1UXWB 4XVSL 2ICCA 4QWWD 4N9OB 4NM8L 3S96B 4V1DD 1Y0LB 3SE4A 4Z7VA 1HXMB 3QQ4B 4XBEH 2ZPKH 2ZUYA 1INQA 4P2QA 1IKNA 1NUFA 4PREB 1S7RB 5FEBA 2A74A 3QFJA 1KNOB 4XVTL 3BP6B 2W9LA 3T2NL 4DFHA 1FIGH 5FYJH 4WUUA 3QDHA 4GXUM 4HZAA 5F7NC 1IGCH 5CEYA 1S7VB 1T0PB 3O3EA 4P2OD 4U6VL 1BP3B 4YE4H 1RU9L 1A0QH 1ZA6B 5L2KA 1JPFB 1EX0A 1IEBA 1SBSL 5ESQA 4F58H 2DLGA 4LLMA 3QWOB 4EVNB 3VXRA 1DDHB 3ARVA 5CINH 1ACYL 1HWHB 3ZE0F 4KVCH 3U9PH 1SJVA 4J3WA 3D69A 2X89D 2UVFA 4OZFH 3TT1H 4JFED 1KPVB 5SX4I 2DIBA 5C0GB 1YNTA 3L5WB 5BOZG 5L9DL 5DZNA 4N1EA 4JPKL 2VOTA 2YD8A 5F1NB 1HE7A 2DF3A 2ZKHL 2IAMC 5A16A 4OGXL 1FYTD 2EIBA 1NC2B 3BUYA 1RZFL 3PWNA 3Q6FB 4PY7A 1FFPA 1NUDA 1CXIA 1M71B 3MGTA 1T83A 3T08A 1I8KB 2A6DB 4UIKL 5GSRB 4TNWK 1UB6B 4KRLB 4R7DB 5BV7H 3GMNB 4XMKH 1RMFH 3CVHA 3WV0A 5C3LD 5EBLB 1JZ6A 4G6ML 3HZVB 5IUSA 1TZIA 1AC6A 4WW1B 3U6RA 3O9WD 5CEYB 6CGTA 5E6IB 2HT4D 4Q9RL 1DLHA 3ZKXC 2ICES 1YYLH 3MV9B 5F7HA 2AXJA 1RIHH 4P4KC 2ZCHH 1BJ8A 1OP5K 1HDMB 1MHCB 3IFLL 3K4AA 2OL3L 1EGJL 4MXWH 1B4RA 25C8H 4ZUTA 1PBYA 4I4WA 4MX7A 4K7PL 1WV7T 1RUAH 4L8CB 4WHTB 5GGRA 4OUUB 3R0MA 5D2LA 4Y4HA 2DS4A 5EFIA 3VH8B 3PL6C 3S4SB 4M93B 4DGIH 5GZOD 4EN3C 3HFMH 4XVJL 1R3JB 1FBIL 1WZ1L 3DVNA 5HHOE 5C0CB 1L6XA 2E9BA 1EHAA 4G7VH 1YEHH 3GJFB 3L7EB 2XNAA 1UWGH 3KPMB 3WIHA 4NZTH 4WI2A 3DHJA 1WWAX 3GJFA 3NGBB 4NWUL 5CZKA 4DN4H 4YHML 1A14L 5DD6B 1YQ2A 4IM8A 4JFDB 4N8PA 5LWYL 3OF6A 4R3SB 4LSQL 2CH8A 3QG6A 3QEGH 1ZHKB 4FFZH 4CDHA 1CG9A 1QRNA 3PV6A 1NKOA 1JFQH 1FG9C 2D0HA 1VPOH 4UOW0 4P46C 2NTFB 5I8EB 4NN5C 5ALBH 4UQ2B 4OCSL 3VXOA 4YNYA 1N4XH 3H3KA 2OJEA 4Y8DC 1U0QA 1FGNL 4RBPH 3MBEA 4RZCA 1NCCH 3O0RH 3UPAA 4WWKA 3RNKB 1I8MB 1JCKA 1OQXA 2YXMA 4YGVA 4OCMC 2D9QB 5CGYC 1JN6A 1L0YA 1W0YT 2BZDA 3RVXD 1FCCA 2ORBL 2ENYA 3QXVA 3GSWA 5DQJB 2V5TA 4KJQC 3UBXA 3ARGC 1FE8L 3MRNB 5IKCB 3OF6D 1NMCC 3HC4H 5HVHC 2EYRA 1G7PA 2ZUQB 4C56A 1FORL 4QNPF 2QTEA 3HZMB 4Y4FB 3BDBA 2B4CH 4KTEL 3SDDC 4X4YB 3QXAB 4QRPE 3GHBL 3FTGB 1OP3H 4OCLC 5FA3A 2ITCA 4Y4FD 7FABH 5CJBA 5E9DD 3ARDB 1X4ZA 1MWAA 5F9OL 1OLLA 1GOHA 4XNMB 4MCZB 4WV1C 5C0DB 5EIVA 4OZIA 5LGJB 5MI0B 4UINL 3PHOB 1I7UA 4MA3B 2CGRL 3MXVL 2DQJL 3GUTA 2R1YA 3FRPA 3D85D 3JWDC 3RU8H 4QXGH 3FONB 4ZUWB 4EKXA 4Y4HC 2V5YA 1U3YA 5C08B 4U2YA 4JRXE 4PRBB 4JAMB 2BSSA 1PKQA 3W11D 4ODUB 5CJXA 3BYYA 4ODHL 3MGOA 5BZDB 4NQCB 1L7TH 3EFDH 3U82B 5DJAB 1QTYT 1F6AA 2E8YA 3UBXI 2G60H 1CQYA 3H7BB 3CC5A 3TN0C 2YD5A 1CDCA 4OF7A 3HE6A 3ROOB 4LMQI 2P49B 4UUJB 2DKUA 5E8EB 4R9HA 1RFDH 3H3PH 5JHDD 2M2DA 2PYFB 4ZFFB 4RMVA 1PG7L 5I1IL 3MOQA 4Y4KB 2OBGA 2B1HL 1NGXB 5KSBB 1MREH 4LHUB 4P46A 3C5ZC 3RY4A 3RBSA 1K85A 3TO4B 1A7OH 4U1MA 4PJGB 5B8CB 2X1PA 3PGDB 3EDJA 2HRPL 4HKXB 1I1AA 2H3NA 4UQ3A 4HS6B 1LEKA 4N0YL 2DYPB 1DSFL 2DL9A 1RSFA 4G6KL 3WNMA 3WLBA 3BQUB 4O2CA 5DD3H 1MI5D 4JM2A 5FYKU 1A7BA 2APVA 3TEUA 1MHPH 4XPBH 4FTVE 3C6SB 3ZDZE 3MV11 3R1GL 3O3DA 1G0YR 1Q1JH 3HRPA 4JCMA 5BMFH 2X1QA 4CU7A 1L9NA 3QEQD 4V2CB 1CICA 4I18B 4HS8H 2WBJC 4QTHA 4HAFA 4YHKH 1RURH 3FOLB 3LKOA 3O9WB 4LOUC 5ADPH 5CJQH 1EVTC 3RL2A 5IIEB 1IC7L 1WZKA 1CE1L 3MJ8A 1U3HA 1J11A 1SVCP 3OX8B 1UJ3B 2ZSVA 4PJDB 2CRMA 3GZKA 3BDYL 2HH0H 3V6BR 2AEIT 3CFEA 1UKQA 3MOAL 3O45A 1Y6KR 2XWBB 5JW4Q 1G6RB 5E5MA 5I75C 3WNPA 3O6FC 1CDJA 3ZTNH 4RMSA 4MLSA 4KJPD 1B90A 3B9KB 2DQTH 4Z7UF 4OZIB 2IJ0C 1X5HA 2WIIB 2NY0C 1J88A 3V6FA 4ZAKA 2ZCLH 5ANME 5J1SC 3QWOA 4EVNA 2F5AH 1MFNA 5D7JC 4ZMAT 2AJXH 1K2DB 1G7MA 4AIZA 3DUHA 1T03H 3QRGH 1UH2A 1MRDH 5LJYH 5TFSL 3VFRA 1GZQB 5I0ZA 1T0NB 3HCVA 2YPLB 3L9RB 3MRFB 2H41A 2QLVB 5D5MB 5EUOE 1D5MA 4GG6A 4JN2A 3QHFH 4NN6C 1NMBH 2VDOH 3HNVH 3EIFA 3BOVA 3KPLB 3WNNA 1VSCA 4G5ZH 4LNRB 5SWZB 1IGIH 2OXGA 5DJCB 4UILL 5J9PB 4U7SA 4P5MB 1MCHA 1NPUA 3IJSA 4OSUL 4TUOB 1JZ4A 3UZEA 3QBTB 5CEZD 5IB5A 5JO5A 1DQJA 4OZ4A 3IDYB 1P5VA 3OB0H 4RAUB 3EO0A 2DBLH 3A6CL 3CDFA 1MVUB 3H9YA 4NT6B 1UC6A 4MD5A 4OI9A 4OIBA 2NZ9D 4LMQE 1HCVA 3DETC 3BAEH 1CIUA 3KPMA 4NQCE 4LEOB 3DURA 3FO1B 1FNLA 3DX6B 1QLRA 4K3EL 5DURB 2J5LB 4NQDB 3J8F7 1DQTA 2FSEB 1I1AC 3BIKA 3MMEB 1JYNA 3G04A 3ARBC 3EDKA 4LPVA 4JM2C 2PXYA 3IFNL 3KPOA 4DCQA 1JNLL 4M7ZC 2B20A 4PJXA 3W82A 4AH2A 2LABA 2OS7A 5I8KH 3PDOB 3UC0H 3PHSA 1IC5H 1BF2A 1F97A 2XPGB 4KRNA 4DUVA 2PCPA 5D71H 1HZHL 2P1YA 4M7ZB 5DRZB 5J6GB 4M7LL 4XP1L 5E8PA 2ZCKH 5F6IB 3WE6A 3VI3F 3GSXB 1AJ7L 3SDXA 3RVXC 5ICYA 5FKAA 3IGAB 2C1OB 4OZGB 4WEBL 5CILL 4HIJB 3WIFB 5AG8A 2MJWA 2GI7A 5GS0D 3D2UD 4JQXC 1F4XH 3B5GA 1XGQA 5BW7A 5ALCH 4WFGE 2AGJL 2Y5TB 3OGCB 4PB0L 4OFIA 3IDNB 4QRPA 4BFGA 4F2MA 1AH1A 4GAJL 3MLYL 4X99A 5D1QC 5D2NE 5D7JA 5CBEA 4Z78B 5FA3B 1OPGH 1I7RA 3TPKA 1A6UH 4G8GB 5F7EL 4CU8A 4YJZL 5IFAL 1MCDA 4UB0L 1RZJH 5CCKL 3ESUF 2HLAB 3ILQD 4K3JL 3HE7A 5SWSD 6FABH 3UPRB 3V2AR 1NEZG 1QPXA 4RCAA 3CVHL 1AO7B 3RWDB 3VXUA 5I1HH 2HFFA 2OYPA 1IM9D 3UBXG 1BVZA 4IHOB 4GKSA 4R0LB 5SX5K 1KEMH 4YIQA 3OR6A 1OAYH 2FZ3A 3JUYA 1GXEA 3VXMA 2ICEA 4JG1L 4LPWA 3SDCA 4P5TC 3RGVB 3T3PE 1CLYH 5CD5D 1S5IL 4P2QB 4PREA 1LEGA 1X6NA 2FBJH 2Y5TA 4MQ7A 4KZEL 1KLGA 1MCWW 3PGCA 1YUHA 2GTZA 4HS3A 4JFEE 3TV3L 5I74C 3NMEA 4NO3A 4FQQA 3KJ4C 2GW5A 3LIZH 5DK2B 3MCKB 2R0WH 3UTTE 1I9JH 4JFPA 1KULA 3W9DA 5I2IA 4FMFA 2FGWL 4MMXC 4P2RE 2F5BL 1C16A 1I85C 4FHBD 4IRSC 2F53D 3BEVA 2GJ6D 4X98A 5ANMA 1XCTA 2XWTB 3UPRA 1IKFH 2BVOB 4XP5H 4PB9H 1A6ZB 2ZOLA 3DRTB 3QG7L 4WFHE 4F7PB 2XYCA 3C8KA 4FQLH 4LAJH 5E2UL 4NJ9L 3UDWA 1BFOA 4BZYA 5KANI 4X7TA 1ZSDB 4UDTA 5HI4D 3HI5L 2KQMA 1GGCL 3IXAA 5GS0L 5IWLA 4IOFD 4ALAL 4LQ1A 1G7LA 3BWAB 4XPAL 3C5ZD 1WAAE 5GISH 2CLVA 2D7NA 3OKMA 5GGUB 4XP6H 2XN9B 3TO4A 2OMBA 3HRZA 3B5HA 2Q86A 2EIEA 4PJAF 2J88H 1JWSB 5E6IC 2C1PA 5FO9A 4OD1H 1UQSB 5ICYB 5TPWH 1KFAH 1SQ2N 1BREA 4ZS6D 1GGBH 5I74B 3JV0A 4KQ3L 4ZFZB 5DJ6B 4NBZB 3VW3H 2D4FA 4JRYE 1AE6L 3GI9H 5HD8C 1E4WL 1QSEE 5DMIH 4XPGH 2AJVL 4QRRD 2B0SL 4BH8B 1F45A 4L9LA 9CGTA 1FZMB 2PYED 1PQZB 4Y2DB 1N5YH 3GMOA 4LSPL 5INCA 3DTXA 3DXAA 1VCAA 1MCJA 3X3GH 1QVOB 3MZTA 2AV7B 3PL6B 4PJ7E 1ZGLB 3DNKA 5HDBE 1CFBA 1VFOA 1X7QB 4BSWA 1C8PA 4P57A 5DK2A 2PR4L 5JLZA 3ARDC 4HPOH 4YR6B 3BKJH 4LVNB 1R6VA 2W9DH 4MXVE 3R8QA 3LMJH 4XVUD 5HHPA 4KQ4L 5CEZL 1MCBA 1IAIM 1NBYA 3FO2B 5DJXB 3O2VL 3ULUD 3EDFA 4PPTA 3VG9B 1QR1A 3VXMB 1RK0A 4XI5C 2IPUG 3V95A 4FQHA 4HBCH 4AIZB 2P8MA 3T3MF 2J4WL 5J11B 4JJHA 3MRMA 5DTFA 5FYKH 3O41B 2HFFB 4PGJA 1T7YA 3R06B 3N85L 4D2NA 3IKCB 3BPNB 4NKMA 4G6JL 2ESVE 4MQXD 5I1GL 1DJSA 4LCCC 2YD9A 3FL7A 3EGSA 4UT9L 4LNRA 4BQBA 4XGZB 5GGQH 4KKCC 1HQ4A 5F88A 4PJXF 3DV4B 4A6YH 4LVHC 1G7PB 5F21B 1YDPB 4FZEH 3RZWA 3FQRB 1OARH 4WFFE 4P5KA 4AL8L 3B3IB 4AEHL 1CFNA 4Z8FL 3BGAA 4KRPD 3NZHH 3UDWC 2WLZA 3UJJL 5MEND 3G08A 3BD5A 4Z77B 4HD9A 2RB8A 4GG8A 3QZWA 4I0PB 3T0AA 3VGEA 3P0YL 1H0DA 4RSVA 1UXSB 5IHZA 4RWYL 4EN3B 5GHWH 4Y4FC 3V5HA 3VCLB 2EDDA 2P8PB 3NTCL 3TO4C 1MCWM 15C8H 1HCFX 4J8RB 5C0AD 3MQIA 3KPRD 5EOCJ 5IMOA 2W60A 4C83A 3G6AB 5D1XA 2DLFL 1CD8A 2W65B 3UYRL 4JGUA 4DN3L 3BH9B 3RY6C 2XQYG 5I1AB 5C0BD 5I19H 2EXWD 5D4QA 5FCUH 4P9HL 4MJIB 2C3WA 2XACC 3INUH 2EDRA 1AHWA 5DR5H 1A3QA 3P0VH 3FOLA 3ZT6A 3E0GA 3V0WH 2FO1A 2DI8A 4N90E 4G9FA 1NDMA 4O5LL 4WHDA 2OTUA 3UROR 4DVRH 4L4TA 2PXYB 3KPOB 4NQSA 1WISA 1YECH 3VFWA 3P30H 5GSVA 1LP9B 4U6HA 4PG9A 4XNYH 2PO6D 3K81A 2YPLD 3DX6A 3F7VA 5E2TL 1N59A 1F11B 1UFUA 2ED8A 3RIAK 1JBJA 2WWKT 4RFOH 5DXWA 1ZK9A 4CVUA 3PWUB 1WZMA 5CJOL 5D1ZA 3DGCR 1DUYA 1I9EA 4F7EB 1YEDA 3G5XB 4K8RL 5FA4B 5EC1A 5DC0A 3TNNA 2DTMH 3JTTB 4P2CG 4HUUB 4ONHB 4RX4A 5CZXD 4RA0C 2NZIA 3IJSB 4OM0H 2FL5B 5EO1A 1LGVA 1U42A 3TH4T 4OAWA 5I17B 3BP7A 1FNSL 5J06A 4OFPA 2VIRA 4MCZA 5C0DA 4F9LC 3HZYB 2Q7YB 3QPXL 1ZHNA 2F54B 4XTRC 2N56A 3K8KA 1QYGL 5BQ7A 5TE7H 4KMQA 5GRVK 3ISWA 1OP5H 2LAAA 1EO8L 1OGAA 3QEQE 4CMMA 2X9XA 5CJOH 3WJJC 3RGVA 3FONA 4ZUWA 5C6TL 4K3HA 4PRIE 4W6WB 5F1NA 5GGSY 3BPLC 2DDQL 4WHCA 5L0QC 3GSUA 2VSCA 5EU5B 3C2SA 5T3ZH 3EO9H 1SY6A 5F9WC 1RZIA 4MJ5A 3RWGB 4FOMA 4KI5C 3PWPB 4KHXL 4ZODA 3FB7B 3ZDXE 3EYFB 1U92A 43C9A 1GC1C 2NY4B 1E28B 4HDIB 3ETBF 2F58H 2D7TL 4CBPA 2CLRB 2FO4B 5DO2D 4Q6IA 5CBAB 4R26L 5HJ3B 3O6FB 2EDYA 5DR5L 3UAJD 4RQQB 4NZJA 5T5FH 3RVVD 3DLQR 3INUL 2R9HC 3FTGA 1TIUA 2XA3A 5FO7A 4BQ8A 3I3DA 2EEBA 5FCUL 4UTBH 3ZE2E 3FQRA 5I19L 4JLRA 4OGZA 1Z9LA 3RY6A 1AXSB 1FL5A 3LKOB 3O9WA 3IDNA 3L3KB 3CIQA 1YEGL 2UZIH 2JJVA 4XAWH 5I1DA 2IH3A 4GMSL 2IFGA 5D70H 3TBYA 4GKNB 1RZGA 4DZ8A 3PQYB 5JOPD 4N68A 3T0ED 1RIUL 2AJUL 3T09A 4PGBB 15C8L 1YY9C 1BLNB 3AROA 3GK8L 2C1PB 5FO9B 2JELL 3ULVH 2R29H 3MV8B 1SM3H 2W9EH 3FFCB 2ZUVA 3LEVL 1XR8B 4X5XA 2G5BB 1O0VA 1RJLB 3D25A 4W6YB 1F42A 4M6OL 3KDMA 2IH1B 2O5ZH 4X9GA 1QZ1A 4MVBD 1YJDL 1ZLSH 3BP5A 4PJGE 3VH8G 1JMZA 2A6KB 4WWKB 4HWBL 5HD8D 1CLZH 1LP9A 4U6HB 2X70B 4JFDD 5DUML 4G80A 2Y06H 3DXAB 3GSNB 2OQJB 1D5BA 1AXIB 3MREB 5JZ7C 3O6MH 3P2TA 1DQMH 1FFNA 5FUZH 3QNXB 3MMEA 5KAQF 2Q86B 1U58A 1KXVC 2DQHL 1WC7B 1LO5B 4NQUA 4RRPA 2QKIB 3LEYL 1EAJA 1FQ9C 1PW3A 4XH2A 4KJWD 2GTWA 3C08H 3CFDB 5K33A 5J6HA 5H2BA 3O2VH 4X9IA 3L7EA 5MHSD 3WN5A 1YEFL 3LMJL 1Z9OA 1CFQA 1A2YA 3GJFK 5FHAH 2OP4H 3V0VA 5K9KB 4LHUD 1XCTB 2XWTA 3S36H 3SEPA 3VA2C 3S98A 1J8HE 2FRGP 1V05A 3MA9L 4HK3J 4YDJB 1ZHBB 2ZOLB 3DRTA 4RDQG 4ZUUA 4U1SB 1WBYA 2DN7A 5IEHB 5BVJB 2NY3C 4LSDA 1A1OB 5GSRA 3HLAA 3RWEA 4B0MM 4NKIL 4NRYA 1OLZA 1J1PH 2IGFH 4HXBH 2YOCA 4LSPH 4HJ0D 4PJCB 3ARFD 2DI7A 3M1BB 5F97E 4NBYB 4HK0B 4N8CH 5EO9A 1Q0YH 1T4KB 5IQ7L 1HSAA 1C5CL 4LCYB 5CIPB 4D9RD 1G9NC 1E4WH 1S7XB 3VXRD 3LQMA 4KTDL 3RPIA 4OLZH 32C2A 4PGCA 4KQ3H 2XTJE 1ZS8B 3FB5A 4PRHB 4JREC 4HEPG 1F4WL 3V6ZB 4KJYB 4NCDA 1KFAL 4G6AD 4PRPD 2WNGA 4IS6B 1NCNA 4MA8H 4ONGH 1TCRA 3ZE2F 4C56E 4NYLA 3ZTJH 5LAXA 3TZVD 1G7JA 2J88L 2HLAA 3SO3B 1WVZA 3EJZC 5GRJL 1WUNT 4QOKE 1VADB 3U4BH 5ID0A 4K8RC 1T21A 3WDHA 2VDNH 4M6MH 3CFKA 4K7PX 1DANT 1HK6A 3SDDD 3GRWL 2CXGA 2GJ6E 1CL7L 3EOBA 3NCYP 4RGNC 1FLRL 2GKIA 1T4KA 2PCPB 3MODH 3MJ8B 3CH8A 5CLTA 4P2OB 4OLYL 3IF1B 1X7QA 2JTDA 2FLBT 4Y19B 1QQDB 4E5XB 1WBZA 3NA9H 4IMLB 4PRHE 3ARGD 4F37F 1MCEA 4G3YL 3C8DA 2ILLA 3I6KA 3IU3A 1W8OA 4G3YH 5T1KB 2V2TB 3DRQB 4WENB 5DO2C 5K93A 3NA9L 1IEBB 4JRXD 3TCLB 4M7JL 5L2KB 2D03H 3VGBA 1I9JL 4L1HA 4OZGA 4P9HC 5KSVA 1EXUB 3C5ZA 3WLWC 4OLYH 1F4YL 3GIVA 4ZTPH 3M07A 2AI0L 1FC1A 2NY6B 2C3VB 4ZPVB 1FLRH 4ZUSA 3U0TB 2NX5B 5DGQA 3D3VA 1CLYL 3GRWH 3H9SE 5BRZE 2P8LB 5DUPH 5DJ6A 2C5DC 1KB9K 3QQ9C 3U0WH 4OFYD 4U1MB 5B8CA 4JGMA 4PJ5B 3OAYK 4Q9QL 4YXLH 2BVEA 2EIZA 3MC0A 4U0RB 3W5MA 1CDHA 4GKZA 4JFHE 2FEDD 4MJID 1QSED 4NC2B 1FNFA 1LK3H 1BQSA 1BF8A 1TJIL 2RCSL 1I8LC 2IPTL 5F3HB 4UBDC 2DQEH 4MNHA 3GMQA 2ADJA 4JM2F 2A1WL 3QDJD 3CSYB 3WYRA 2WZPD 1RZKL 2CDGB 2G9HB 5LG1A 5EU4A 1E6OL 4HUVA 2XZZA 1A6UL 5AUMA 3BD4A 3SN6N 2HG5B 5HDBF 4PB0H 5I1AA 4ONFL 3O6FA 5IVXF 3MRBB 1MVUA 5KN5B 2G75A 5DJDA 3FCTB 2CKNA 4LPUA 4POZD 3VXTB 2I27N 2I25N 3SGJC 1JWMB 1U3JA 4K9EL 4ODWA 3N9GL 5C07B 1QBMH 3QUMB 3DUSA 3ARXA 3W9EA 3QCUH 4M6NH 4OLUL 5FYKE 4D0BA 4UDUA 2OTPA 4UNVA 4YQXL 3WO4C 4QNPE 5JIPA 5FDWA 2C3XA 4MSWB 4OF6A 3PNWB 5F1IA 4MJ6B 2CKBA 2NYYD 4TSAH 5HY9B 3WFCL 2FZ3B 1QBLH 1PEZA 2H32B 2WUBL 3H0TB 4Q6IB 1LP9F 5LAXB 3PDDA 3O4LB 4HCRA 2VXQH 3QJHB 1FNGB 5KAQG 2R39A 4XCNB 3S3JA 2D31B 4G43A 4PJBB 2GAZA 1NGPL 2LTQB 3P73A 5E5MB 3FB5B 1AGDB 3NH7H 5DEFB 3EHBC 4NKMB 4N5EC 3AVEA 1GGIL 3SDAA 3KS0H 1JK8B 2HN7B 3ZSSA 3C6SA 2W38A 3L95B 5IB4B 4PV8B 2VR9A 3O81A 3AS1A 2VLJB 4L8SB 1B6UA 2NY5H 2XRAL 5F9JA 4GXVH 3BD3A 3TN0A 1IAOB 4L5FH 1X4XA 2Q1EA 1NBYB 1S78D 3FO2A 4KK8D 4O58H 5DJXA 4S1QH 1CQKA 2HTKC 5HSFA 4WW2B 3VFMA 4WJ5A 2R29L 2APBA 2Q7YA 2R2CA 1U95A 3PWVB 3NIFE 4LAQH 5FB8B 4G8IB 4ZFGH 2YA2A 2UWEE 2DD8H 3NABL 2ADGA 1KXTB 2HRLA 2IALB 3TIEA 1I1FA 3D0LB 4CJ1A 2X5PA 3HUJE 2DWDB 5C07D 4UTBL 3HR5B 4HGKC 2GJZA 4HH9B 1PKQE 2PW2B 3ULSA 5DD5L 5D7KE 3JV6A 3HR5A 2DQDH 4JAMA 5HGDB 3RGHA 1WWBX 1MRDL 2D7TH 2DYPD 3P9MB 3FAXA 3QRGL 1P84K 1IVLA 5FO8A 1T1WA 4UU9A 2IPKA 1Z5LA 1R5IA 3MRDB 5IW6B 1X3DA 1CFSB 3CXHK 5ACZB 2V17L 4JQXA 5B22A 3QIUD 1CXFA 4F57L 1U3HC 5IVXB 1L7IL 3MRDA 4Y88A 2OTUB 3SGJA 1AC0A 2GFBB 5GJSH 2I5YL 4OD2A 4C57C 5I1EH 2HH0L 3MRKA 3VWKC 1S9WA 2E7BA 1XR8A 1EDQA 4PD4J 4QF1A 4B53A 4L3AA 1CE1H 1BGXH 2X40A 3BPNC 3I9GL 1RI8A 2ZOKB 5FGRA 1D5IH 3FQXB 4WUUE 2A0LD 3MUGB 4L3CA 1XR9A 4Y5YB 3QPXH 1BQHB 3HZVA 4KKBD 1A1NA 1FC2D 1FFOB 1A6TB 4GW5B 4QOKB 3RDTA 4OM0L 3NBNA 2G2RB 1UZ8B 1UB6A 1H0DB 4FP8H 5IBLC 7CGTA 5I1JH 1BOYA 3IKCA 4EUPG 4XPBL 5IFJA 3QEUA 2I60L 1H3PH 5DD3L 5L2KD 4P5TA 3C9NB 2W0KA 3PGFL 3QI9D 4FXGB 4P2QE 3QPQC 2A6JB 2CLRA 4ZO7A 3ZKMD 2G5RA 4GMTL 3V7MA 3WCYA 3X14B 1U41A 1CFNB 3UTSE 4X7CC 3QUML 5H8DA 4WV1B 3GSOA 3QUKA 4Z76B 5E4IA 1SMAA 2DLEA 4GMTH 4XNYL 3QI9C 3DYPA 1FZJA 5I8CB 2NY4C 2WW8A 1WSST 3RBGA 3KGRA 3QUKB 3RZCC 1HXYB 3DSFH 1QSFA 2YZ1A 4O2EA 1UH3A 3VRIA 2JKXA 1N5AA 2B8OT 2ARJQ 4LDLB 3V0WL 1RZ8A 5GS3A 4JPWL 4KY1L 2R69L 1JIBA 4N0UA 3P0VL 2VAAA 4PYGA 4ODHH 1MNUH 1HHHB 1NANH 2HFGH 3HC3L 4CN4A 4ZUVA 3CJJA 2PXYC 5FECB 5IP4A 2DLFH 4P3DB 3GGWA 2VLKD 2XNAB 2X4PB 3MUJA 2DJUA 4XBGA 2WM0A 3UTZB 2XQYK 3PG2A 4HC1A 3GSQB 2ED9A 3HPLA 5FAAA 5GHWL 4HUUA 3HUJF 4LLDA 2W59A 2VERN 1R3LB 5GJSL 5JOFB 1JGLL 2J1KA 5JOPE 4JFDE 2NY5C 3B6SA 3ULVD 5DVMA 5DMGC 5J3HD 3UJJH 3ZKQD 2W0FB 3OG4B 5KSUB 3OKKA 5FHBH 2H9GA 1HYSC 1BD2D 5HGAA 1B2WH 4LU5H 2CDGA 2OJEB 2WK2A 3GHBH 1T6WA 2H1PH 3ABZA 3MJ7B 4I0KA 4OCWL 4P0DA 4XT1C 3SGEI 4A6YB 3ARBB 1PZ5B 4QRTA 1CYGA 4G6JH 3TYFB 5F72S 3G04B 3HC4L 3GSQA 4EI5D 4K94H 2EYTB 1KTLB 4Y4HD 4UV4H 5HXMA 1TCMA 1QOKA 1QHOA 2UUDH 2BNRD 5HHVL 3CDYA 4XXDA 1T1XB 2W65A 2ZSWB 3CK0L 2Y72A 3DVNB 2JB5L 1NJ9A 4PLJC 3LRHA 3QIBA 4KROC 3OL2A 2R1XA 2DB8A 3WMSA 3V5KB 5ALBL 1WBXB 5A2KH 3IT8D 2J6EL 4XBPB 3BZEB 4GXVL 1T3FB 3L3DA 4L4VD 3BXNA 3ZT7A 4GG8B 2OTWB 4JFPB 3S34H 2N7AA 3IF1A 4H0IA 1GHFH 4G7YH 3VJ6A 4P3CL 2JIXD 4QRUA 2HMIC 2W92A 4WWKC 5E00B 5MEOA 3L7FA 1V7ML 5KVFL 3PWLA 1M7XA 3GI9L 4YHMH 4OLVH 3VFSA 4C56D 1JNHB 5A16B 2HN7A 3OMZA 1B6DA 4LSTL 3KPSA 2VXQL 1NFDB 1INQB 4Y4FA 4TNVF 1E6JH 3WFCH 2E5EA 3ZYIA 1CD9B 3TBSA 3CSBA 5A3IC 4CMHC 2VDKH 2DL2A 2WIIA 4KJPC 1ONQA 4UI2A 3BKML 4PTUB 1R3KB 1D3CA 3H0TA 1FHGA 2C1OA 3C87A 3LZFH 3IGAA 1K4CB 4HFWB 4LASL 3VXSE 3ZKMC 3B5TA 2AK4B 4N8VA 3QUXA 3HI6H 3CAFA 2FHFA 4UIMB 3T4YA 1HEZA 1P53A 1B4JL 3DI2B 3WIIH 5GS0H 1GGCH 4UDUB 2J2ZA 4FXGA 4Q9RH 3WD5H 4UOJA 4PJEE 1V7NL 4QRPB 3TVMD 4D9QE 4H0HB 3OGCA 4XXCA 1KPUA 8CGTA 5D7LB 1EO7A 2EH8L 4ONFH 5TF0A 3QG7H 4QRSA 1MELA 5FM4A 3AB0C 2OTWA 1A6AB 1FCGA 3Q1SH 2F5BH 3W39A 1NAMA 1UENA 4XMLL 1AXTH 3LOWA 3MV8E 3DI3B 4UIKH 1T7XA 4F80A 2GK0B 3DROB 4M9PA 2AABH 2XQBH 3GMRB 1LK3L 2FBJL 3L6FB 1T7VA 4FMKA 5BS0A 1YY8B 1L6ZA 4KKAD 5JPMB 3GMLB 2VABA 4TYUA 2IPUK 1A7QH 3I02B 5DFVD 1LO5A 4LCWD 2IAMB 4DQOL 4JHAH 2PO6A 2OK0H 1N59B 2R2HA 3QDJE 3WS3B 1YN6B 1KEML 3ZDZF 4LP5A 4PJIB 5ISZB 1KIPA 3U0WL 4EIZC 2FJGA 3MGAA 3H9SD 5BRZD 4ETQA 1ACYH 3SE3A 2D7OA 4JM2D 1IL1A 3Q2CA 1SBSH 2HLFD 4ZTPL 2ERJC 4JKKA 5E2WL 5DEGB 4NQEB 5F89A 4XMLH 4G8FA 3HI1A 4KKLD 3T04D 3Q1SL 1OPGL 4JVWA 3I85A 4WU5B 4L9DA 2EZ0D 2FEEL 3KYOB 2MCPL 4YHZL 1P4IL 3M45A 1YNKH 3D25B 2FO4A 3ZKXB 4L3EB 4BFIB 1MJJB 1N64H 3P4OB 4PBVC 2Q8AL 1F4XL 1V7NH 1DVFD 1VERA 4EI6A 1BBDL 5CWSB 1B4JH 5CILH 4DWHA 4P2OA 1F3DJ 2NY3D 3O4OB 3N1QC 4Z7OF 4ZQKA 2D31A 5EORH 4E0RA 1KLFA 1TVDA 1ZT1A 4FFWC 4O9HL 2X4OA 1KPRB 1JHKH 5F7FA 3C60C 4ONGL 2DLIA 3V9FA 1P7QB 3LY6A 3G6JA 5ID0B 2O5XH 4AMKH 5HYJA 3NGBC 4MSWA 3FQNB 3C2AH 5HI3C 3OBAA 4HWZA 4HIEB 3G5YB 4KGJA 5KVFH 3VGFA 1V7MH 4U1JA 4D94A 1XF5A 5IQ7H 3GMPB 1JZ7A 1AKJA 3MRGB 1AQDB 4P3CH 1OM3L 3G5VA 1BECA 1KCRL 4K3EH 4A2MA 2UZYB 2GEEA 3HNTL 4HXAH 4NKIH 4R4NC 4XPTL 4W68A 2N7BA 12E8L 3GJFH 3MLTB 3QFDB 2DYPA 3ARED 3OXRB 4EXKA 4JKPL 5FDWB 5J12C 3V4UL 2OP4L 5CP7A 2Q8AH 5M7QA 1YEFH 2A83A 3T0XA 3CK0H 3V0AC 3L1OL 1YNKL 3LSOA 5HHVH 4OSUH 4PJGF 4U1HA 5D7SH 2ICWI 4PJFB 1T20B 3C08L 4UILH 4LCCB 3AS2A 3LKSA 4QRQB 3AS3A 2PETA 3ROOA 5D6DC 3UPCA 3LEYH 3JVGA 1JYVA 5IJVA 2FL5A 2IANE 3KPNA 4EDWH 2DQHH 1PY4A 4BJLA 2AS5M 2IANA 4CW1B 5E2WH 2YBRB 1H3WM 1JJUA 3PJSA 1KTLA 3VD5A 3WN5C 3FT2A 4H1LA 4LSRL 2HFEA 3NCJL 1T1ZB 1LO4H 1A5FL 4PJGA 4NGHH 2XKNB 3CSYA 1ZEAL 5HPMA 4MB4A 3O2DL 4LU5L 4LLWA 4YAQA 4GXUN 1H3GA 1B2WL 3CSPA 5HHNA 1KT2B 1WFUA 4LDEB 3GM0A 4F3FA 3SO5A 3B2UC 5E6ID 1NH6A 1XCQA 4N0RA 1ZLWK 3ZTNL 3RTQD 4JQVC 1UXSA 4CVXA 3DURB 3S88H 4WJ5B 2W9EL 3VGAB 3REWB 2JJSA 4O2FA 1WFTA 4U6YB 3NFNA 3ULVL 4JY4A 2A9NL 4R4FL 4F7MB 2FX8H 2P24B 5DA4A 4JFQB 4E41E 4JG0H 4XZUA 2GSIA 3FQTB 4NZDA 2VLKB 5D70L 3MV7A 3EOBB 3F5WB 4GMSH 5ADPL 3B3IA 1D5ZB 1MY5A 1NGWA 4YHKL 5H35B 5KG9A 2M1KA 1X6LA 1WBZB 1ZOXA 2YXFA 1MIEH 2AEQL 2F58L 3UTSD 4OCRH 3LRGA 4Y7MA 4XRCA 2UY7A 4FQQB 3DSNA 3RTQA 2Q3ZA 4QHKI 3TZVB 3LZFL 3HE7D 3OB8A 4F9PA 3HN3A 3D2UA 1NFDA 3BZFA 4DOHB 1A4KA 3OKLB 5J57B 1CVSC 1F00I 5D7IB 5IB4A 4QRPD 3TVMB 3MRCA 3VGAC 2WV3A 5I1IH 3HE7C 5D2NB 5E7BA 5ENWB 4JFEA 4UAOB 5EBGA 3MNZB 4Q0XH 1TZHB 2FCBA 3H3PL 3HC0B 3VXOB 4OLVL 1EO8H 3D3VD 2JJWA 3V8CA 4X4ME 1H3PL 2GT9B 3ARBD 1NCBL 3PV6B 3P9LB 2B39A 2R2EA 4JFXA 3THML 3HG1B 2VLKE 1GHFL 4G7YL 3S35X 2HJFA 2VLKA 5DT1H 4HIIA 3WUWA 1F2XK 2CK2A 1MH5B 1A3RL 1NJ9B 5DD6A 3ARFC 2DI9A 3EKCA 1ZLUH 3O3AA 1QSZA 4XPFH 1QG3A 5EH1A 4GUPA 3RU8L 4OGYL 1YYMH 2VISA 4GH7B 2AQ1A 3CX5K 2CGRH 4RRPG 2ZOKA 4RFNB 2R2BB 1UWXH 3WHXB 2FX7L 1XH3B 4HW6A 3AXLA 2K7QA 1MPAL 3S5LB 1ZVSB 5I1KH 2NW2B 3QEHB 4BKLB 2CLVB 1CGXA 4JQVA 3L5XL 7FABL 2XT1B 4XAKD 4ODSH 4JRYA 4WI4A 1GZPB 5I71C 4BSVB 3RWCA 4JDTH 3BIBX 4O5LH 2YBRA 1BOGA 2ADJB 1BFOB 1QRND 5ICXB 5E8EA 2WANA 4NQED 3UAJC 1JWUA 4JDTL 3IU4L 5DD5H 4Z7QF 1BD2B 5FHBL 3NFPB 5ETUB 5IVXE 2KUTA 4KK6D 2VE6B 5FUCE 4PLOB 3OAUL 2XY2A 3SDYL 1DTUA 3FZUC 3HRZB 4ZYKB 1J8KA 2GITB 2E6JA 4R6UA 1YA5A 3REVA 1IGTB 3O11B 4JKWA 5J1AB 5JXAH 3KVQA 5E8OA 2DMCA 4CMHB 2C26A 2UWEF 4XHQA 3B2UD 2AK1H 4IOFC 2VAAB 1KTDA 4S1QL 3ZYOA 4G9DB 1PY9A 5DFTA 4TUOA 2FYYA 3B8SA 4WEMB 2NR6D 5DSCA 1JFQL 3DV6A 5DT1L 1AR2A 3T77B 1CFTA 4FS0A 4NN7B 2R69H 3QUXD 4JPWH 1VEMA 3HAEA 3THMH 1LE5B 1MUJA 3GI8H 5IBLD 3PF2A 5C1MB 3ZLQC 1YPZB 1KCLA 2NY7L 2J8UE 3L9RA 3MRFA 1AY1H 1A14H 5GGQL 3Q6FA 4FNLH 4FQXD 3SDCB 1DN2A 3G5VB 5I1GH 3MSPA 4FG6C 1Y6NR 1PEWA 1QP1A 5CIPH 2O26U 2J4WH 4R4BA 1DUZB 4XVJH 5EO0B 3HFML 1SEBA 2FJFA 3OAZK 3V6FB 1G84A 3FHQA 3VXUB 4OIIL 1P7QD 4K7FB 1CDUA 1DDHA 1LP9E 1MF2H 5DF0A 3VXPB 5HYJB 2QADB 5T1DH 3BKJL 1XGPA 3FFDB 4UOW1 4Y5XB 4I0CC 2OM5A 2AEQH 3LPFA 1QBML 3HTLX 3NIGE 3ARDD 5EC1B 3TNNB 2R56L 1JI2A 5TDNA 8FABB 3NN8A 5DJZB 4PP2A 4GQPH 1F58L 4YEFA 1KJ2L 4BSWB 1MCIA 3DV6B 1BGXL 2AV7A 2B0SH 5MERA 4QHUB 1UCBH 3HA0A 1CG9B 1QRNB 1K5NA 2P5EE 4DFIA 1JWUB 4Z0XB 2E7HA 4K55A 2A9NH 1MRFH 3MLVH 4NFBA 4R4FH 2A1WH 2IADB 4QHLA 3RAJL 5C0NC 3QUZD 3A67L 3S88L 4M61B 3O6KH 1KB9J 1T7WA 3V8OA 3VFGL 5BW7C 3ESVF 4HGWA 2VH5H 4OGXH 2XKNA 1EAPB 2V17H 4CU6A 2R1WB 5EBMA 5T1KD 2YS4A 4P9MH 3FMGH 1TVBA 3MV8D 4JPKH 3JZ7A 1N7MH 1Q94A 1RJLA 2Y36H 1ZEAH 3KG5A 2YPVL 4PG9B 3H9HA 3JV5A 4MD0B 1I7ZB 2EEAA 5C0JA 4LSRH 3RDTC 4S1DD 2NX5D 3DVFA 4PGBA 4F58L 5HHQB 1II4E 4ZPTB 5F7WC 2H2PC 1F4YH 3TFKD 1KCKA 1A0QL 4FQLL 4UNTA 2KQNA 1T6VN 4LDOB 2NXYC 2EC8A 4LNVA 3CSGA 1OGAD 3HPJB 1TJHL 1S7UB 4S1DC 3T2NH 1G6RH 2YPLA 2FGWH 4K3GA 4HV8A 3VE0A 1G9MH 4YK4C 3G08B 5DRNB 1S9YB 3HMXA 3RVTD 5D1QB 3L1OH 2X7LA 4I5BA 2FIRT 3OKDB 3UYPA 2V9QA 3MODL 3L3HA 4K3DH 2VKWA 3SCMA 3V4UH 3BEVB 3DUUA 3RZCA 1YMHB 4LLYB 4KZEH 4HKBA 4X5WB 4ZAKB 1FFQA 2R1YB 4XVSH 2VXUH 5L2KE 4P5MA 5D7LA 1F2QA 4FQXB 3HC0A 1KPUB 4P2QD 1PSKH 2XRAH 4GKNA 4WEUD 3LCYA 4M6ML 2VDNL 4XPTH 2VDLL 3SO3C 4BA8A 3OTTA 2LVCA 1CZ8L 5GRJH 1B0WA 4PJHA 2DWEA 1C7TA 4LPYA 2SEBA 1WCBB 1Y6MR 1D5MB 3LDBC 1MCQA 3VXUD 4GSDL 3S37L 3B83A 4WCYL 4RGNB 3RL1A 3GBML 1F4WH 2ZG3A 4IBLT 1VHPA 2BK8A 4P5TB 5EWIL 3RGVC 3MRRA 4MJ6A 1SJEB 3O4OC 5IWLC 4X83A 4X6CF 3JWDL 4OLZL 1WAAA 1QBLL 1HQ4B 5F88B 2K9UA 2V5RA 5CSGA 1B0RA 2FBOJ 1ZT7A 3U9UA 1H5BB 5IOPB 3SQBA 5CZXC 4C56B 4L8DB 2RR3A 5BVPL 5D2NA 5DZOA 3AREA 3CD4A 2R1XB 2BRRH 2YA1A 1TENA 3RRQA 3Q48A 1JWMA 3NAAH 5KTEH 5D9SA 4K8RD 5CBEB 1KELL 3FQTA 3O45B 4BQ9A 2F74A 2A74B 1PX4A 1AFVH 1B0GB 4YHNA 5J56B 1AFVL 4K9EH 3E6FB 3MA9H 3ZDXF 1FYTA 1N6VA 2GITA 4AEFA 1KELH 3RHWF 3REWA 3QPQD 4U1IB 1N64L 1WBYB 1OWWA 5FYLE 1R5WB 4LBEB 1P4IH 5FKPB 2PXYD 4LRIC 4CUCA 5T1MA 4PG2A 3LKPB 1RZKH 5EU7E 2NY1C 2OCFD 4PY8J 4R97B 3NIFF 1TVHB 4OQTL 4ZO8A 5J6GA 4YFLI 4WU7A 2DQEL 3MRHA 2FGZA 2IPTH 4BSVA 3IFNH 4WCYH 2XN9A 2Z31C 5IM7A 3PWUA 3SDDB 4EEEA 2BVTA 3IFPA 1YY8A 1K8IA 4JQIH 1ZA3A 2NY1D 4X6EA 1CZ8H 1I1CA 3TO4D 5IBUB 3EAKA 3EZ8A 1A7QL 5EUOF 5JNYB 1PSKL 5IG7A 3V52H 1ZLSL 1YJDH 5GRXG 4MAUL 1N6UA 2P44B 5T5NG 5JNYA 4MZ3A 1R5IB 1NFKA 1CGWA 2AABL 2YD3A 2VL5A 1IQDA 3GGWB 2P45B 4WRLA 3S3PA 3H3BC 1AXTL 2D0GA 3SQOL 2UVEA 1JE6A 3BWAA 4NT6A 4X80H 3U48A 1EPFA 4LVNC 1K8DA 3VG0L 5AG9A 1TJHH 3VFTA 5D2LE 5L8LB 1ND0B 3MRHB 1YUHB 5FYLH 4MCYA 3L95A 3HNVL 5EC2B 4APQB 2A6IA 4F7TA 1YEGH 2UZIL 3QUXB 3VD7A 4YLQT 1OT1A 1NUNB 4PJ9C 1J0YA 4JEGB 3CH1A 3G5ZA 3DXAD 4YIQB 2R23A 4UZGA 4Y2DC 1SYSB 4R26H 3RIFK 3HI6L 2BSTA 3QO1A 3GSOB 4MHHI 5M95B 1YMMA 5KS9F 2A6DA 2AJXL 4RGMC 4Z95L 2GY5A 2MSPA 1I3RA 4MMZC 3OZ9L 1KLGB 3FMGL 2E3VA 2GHWB 1P6AB 4P9ML 4P23D 2XKUA 5CBAA 1OTSD 3ULUL 5C9JB 2VLJE 3M8OL 4WHYG 2VLJA 3VFGH 1F3RB 1QFWH 3TF7C 4PRPB 2DWEB 3QCTH 4EJ1C 3A67H 4AM0B 4QGTA 3OJ2C 1EH9A 1WT5C 1CXEA 4HK0A 3RWGA 1MRFL 3MLVL 4M1GL 3HZMA 2NTFA 1U8KB 1UCBL 4HKBB 4DKAA 5MENE 4MAYD 5KG9B 4U7MA 1HHJB 1KCUH 5B39B 1BQHA 3TA3C 2PNDA 3C6LC 3DTXB 5CJQL 3B2VL 2HFTA 3CCHA 3UYOD 1F58H 3L5JA 1FO0B 3VXSA 2VLME 4U1KA 1UJ3A 3SPVA 3CXHJ 1I8IA 1OAUL 5IFJB 4R2GD 1JRHI 3D3VE 4PS4L 1RJZA 1JTTA 3D5OF 5IB1A 5IROA 3NFNB 4NQEA 5LGKA 3OJMB 4JO2H 4MNHB 5JDSB 4OD3L 5T1DL 4NO5A 4G6KH 1NSNH 3WUWG 2BMKA 1MF2L 4UQ2A 3HHRB 4GRLD 4NCC1 4Z7NF 4U3XA 5HTSA 3VH8A 2ATKA 4OIIH 4EI6B 2IQ9H 4UV4L 3GKZA 2Z8WC 1YEKH 5A2LH 1PDKA 1JNJA 1IEAA 4K94L 3P0GB 4NZUL 1KTKE 3ELAT 3HB3C 4HKXA 3IFPB 1PG7H 1AD9B 4LIQL 5HYSG 5EBMB 5FUZL 1RFDL 1G7LB 35C8L 4FNLL 4RMWA 3MV9A 3TYGL 2Y06L 2YPLE 5EZIH 3DROA 1FP5A 1IAKA 5DUMH 2G60L 5B8CC 3QEHA 4BKLA 2VN7A 2H1PL 1AGCA 2FLRT 1FAIL 3FB8A 3EFDL 4OCWH 1L7TL 3RKPA 1R3JA 4P59H 2NW3B 2HT3D 1VGKB 3RVWC 2EECA 5ANMB 4XC3H 1OP3K 4ELME 3EYVA 2CO6B 5DDHA 5J1TC 1PZUB 3ET9F 3VA6A 3VFOB 4JY6B 2AVGA 4QXGL 3UTTB 1DBAL 4MJIA 1SM3L 1S7WB 3NN8B 3BVNA 2DWDA 1EHXA 5E03A 4MQ7B 2OXHA 1JGDA 3L3KA 5JXAL 1H8SA 2HTLD 2C3VA 1LE9A 3MV9D 4H25B 4J1UA 1CU4H 1NAML 4KKAC 1E4KC 1WFNA 1P9MA 2A73A 3O9WC 5JQ6L 3BW9B 2HFGL 4CVZB 2V7NA 1EZVY 1MNUL 1AD0A 3NCFB 3IU4H 1WT5A 4PRID 5T5FL 2AJ3A 4AL8H 3KWWA 3DX7B 1KYOJ 4ODTL 5LCVL 2A9MH 4KXZI 4X6BB 5I71B 2DBJA 3LEXA 1IARB 5DS8B 1P4BL 4KKNA 4XXCC 3EYQC 2MQ3A 1QSFD 2WSKA 35C8H 4ODSL 3T65B 4X99B 4TTDC 5D7JB 4Z78A 3V6OA 3ZMRA 2SEBB 2BRQA 3N85H 3PL6D 1C7SA 2VZSA 3KYAA 5T1LA 5GZOC 3EO9L 4HGMA 4NZUH 5T3ZL 3O8XC 2UYLA 4D0BB 1U8NB 4POYA 1N0LA 4UT6H 1FNEA 3T1FA 2DDQH 2PYEB 4MA1C 2VZ1A 5D6DA 3LKRA 1QO3A 5CJ5A 4HULB 2CO7B 4M1DH 2BJML 3UZQA 3MNWB 5IMMA 1AIFA 1X44A 3V7AE 1DVFC 4LHJB 3SDCC 2H32A 4OGYH 2Y7QB 1KTDB 3O3BB 2I60H 3EYOB 4JO2L 2PR4H 1FGNH 4XPFL 4YHPA 2NNAB 4PS4H 4JM2B 1CXHA 3X3GL 2BHYA 4H8WC 1SY6H 3QEGL 2Z35B 3ZE1F 4HMEA 1D5IL 4MAYC 4F7MA 2HVJA 5TE4H 4LSQH 4NFDA 4IRZH 1ZXQA 1A6WH 1A1OA 4WTWA 1S9XB 3MREA 5C0AB 3W2DL 4KUCF 3F7VB 4AK1A 3PWJA 3E1F1 5I1EL 4GKZB 3MLRL 1MEXL 5KS9A 3D39D 2I5YH 1UG9A 1YEHL 2P42B 4G7VL 1AR1C 5E2TH 3OKEB 3U83A 3FHAA 1QFWL 3EJYC 4HWBA 5DMGD 1EERB 4OD1L 4DGIL 3P9MA 1I1AB 3P30L 3M8OH 4F57H 1F6AB 1U91A 1LD9B 1U2CA 1S7WA 4QEGA 4K7PH 4GQ9L 1ZV5A 2XTJC 4Z95H 4NKQB 5C0BA 3IFOA 25C8L 4XP6L 5IEKB 4P4RB 3SKUD 1QFUH 1WCQA 1XF4B 4OUUA 4OF5A 4PGDB 1ES0B 4PJAE 3NIGF 3GMMB 5MHSE 4G9FD 1OGTA 1PGRB 1U8MA 1P9MC 3TBYB 4NJ9H 5J13B 5E2UH 3L5HA 4Z5RA 2FWOB 4NHCL 1T0MA 1IT9L 4HZLB 2DD8L 2C7UA 2YRPA 1HH6B 4ZFGL 2IQAB 1RMFL 3TWCH 4M48L 4S1SL 4Z9KB 3WUWB 1DZBA 4X80L 5BV7L 4NRZB 1ZE3C 4JFFA 1XFPA 1OVZA 5FF6B 2V2XA 1VFMA 3K7UA 5F9AC 5DQDH 2FEDC 3DX8B 2FIKB 4QYOB 3FB7A 2XY1A 5GQBA 4F33B 3GUTB 3ZL4H 1QEWB 1X5ZA 2VISB 4MAUH 1C5DB 4JG1H 3TBSB 4PBXA 5KZCD 5E4EB 2Q6WB 5HI4C 3AM8C 5CHNB 3T2QA 4Z8FH 1BJ1J 2CLZA 1AP2A 1OARL 4JQIL 1GGIH 4Y2DD 1B9ZA 1OWRM 1DFBL 1NBZB 1JNHA 1UH4A 1NGPH 4YK4B 5HGGS 1OL0A 3T4AB 3QDGE 5GS1A 3LPWA 3VRLF 3O4LD 2Y25A 4UT9H 1PAMA 3QAZB 3MJ9L 1FO0A 1DQQB 2BOCB 4QOKD 4OQTH 5IV2A 4K3JH 2Q20A 1RU9H 2BCKA 3S7GA 5FYKL 1PG7X 1J87A 5GGSB 3LN4B 3VU2A 1AO7E 2WBKA 1U8KA 1X5IA 2WUBH 4EDWL 1IGCL 4FFVD 4HBCL 4PJ8C 1BVKB 4GAJH 3QAZC 3V5KA 1RHHA 4HUWA 5AYUL 1GGTA 2AGJH 4XBEL 4X4MA 3WNKA 4PJ7F 4YQXH 3V79C 4G8GE 1Y18B 5EOQH 4LCYA 5CIPA 4LVOC 3G9AB 5IT2H 2CDFA 4W4NA 2ZSWA 2V2XB 4NO2B 2GUOA 5E5UB 1S9WB 1GPOH 3JV4B 3N9GH 4X9HA 1M7DA 1Q9KB 3P9WB 1WWCA 5FK9B 2K7PA 4OKDA 5DHXB 4HXAL 2L4OA 2F54E 5KTEL 1QSEA 1G0XA 2OI9C 2VO5A 1DBJL 5DYOB 1OM3H 2BRRL 5AEAA 4QOKA 3RDTB 1NC4D 2ZCKL 1ZHBA 2YRLA 3A6BL 2GQHA 4BSJA 2FECL 5BVPH 3TIDB 1HZHH 2AJVH 3PUCA 2KBGA 1T66C 5F3HA 1KCVL 1PX3A 1ADQL 3I6LE 4ETQB 2XWJA 3ALWA 3VW3L 5FKPA 3BRDA 5EB9A 1AHWC 3CFDA 4KK9C 2RCSH 1TJIH 3IFOB 2IG2H 3MRLA 5CZVL 4XHJD 3KLHD 3S37H 3ZHDA 3OQ3B 3WXWL 5DJYB 2I07B 1Z9SA 4WU7B 1YEJL 1B0GA 2WWKO 3TJHD 4NO2A 5FYJU 1BJMA 2M8XA 5EORL 2H2SC 5SX5H 4JZNB 3IDJA 5D96B 3UMTA 5JXED 4OZGF 5DUPL 4XX1E 4ALAH 4ISVA 1BBDH 1NAMB 2X4TB 4PGZA 2BVOA 3MUY1 3TNMA 1T1WB 3TIDA 4E5XA 3NPSB 1FZKA 4MD5B 1EVUA 1G9ML 3U46A 4YHZH 5FGSA 1D9KB 1KGCD 4HSQA 4NSKA 3B9DA 4G5ZL 2ZUQC 4LCWB 5L8JB 1EEQA 4HC1L 4C54A 1NEZA 2F9BT 1A4JB 2R0WL 3HG1E 3MLUL 3QHFL 2AJZA 1B88A 4TN9A 1JMXA 3VWJA 1WICA 2DQFB 4L4VB 3VDBA 3ZYZA 2Q87A 3EGSB 5I8CA 4TUJA 3PHOA 5JXEA 3D39B 4HIHA 3VXRE 3QIWB 3RX8A 4RNRB 4J23A 2MKLC 4I2XA 5F7YC 5BV7B 1JGEA 5CMAA 2OK0L 2Y36L 3U4BL 1MHHA 2ZCLL 4LLMB 5D96C 1P7QA 2DQTL 4HUKB 5F1IB 4Y16A 2FH6A 1WCBA 4OBSA 5DK0B 1S7VA 3FN3A 2XQBL 4XRCB 1YNTB 1A7PL 4ESKA 1A47A 5HBBA 4YPGA 3RAJH 5CCKH 1WZLA 5IFAH 4X6CB 3F6LA 1CD1A 4P23C 3BDYH 4AQOA 5D1XD 5E9DE 4KTDH 2C4FU 4Q6IC 4LGPB 1C5CH 4YBLB 3MLYH 2CUHA 3FQNA 1Q0YL 3GFUA 4HIJA 4F7TB 2EDLA 4RFEA 2EH8H 1KJ2H 4X5WA 4MNQB 4NQDD 4HXBL 1OGAB 5ALCL 1J1PL 2QQQA 4CNIA 3Q3GA 4X4XA 5IMLA 2BY1A 3KYOA 3WD5L 2VUYA 1U3HB 4MJ2A 4BFBD 5KSAD 1LMKA 3QUXC 4X7FC 3WIIL 3WN5B 3PP3H 2A38A 3WE6B 4WEBH 4I3GA 3MJ6A 1WAAF 3S36L 2P5ED 4PRDA 1ZT4B 2EICA 4QT5A 5H94B 4LASH 3NPZB 5FHAL 4TNVK 4I48A 3CMOH 1AJ7H 4PJ7B 2WIMA 1CTNA 5TQ2L 3PE9A 5KS9B 4NQXB 4M7LH 3BKMH 4AT6B 3H42H 3D0VB 4KDVA 5C0AA 5C0JB 5C08D 4PGDA 5MERB 2CDEB 4PTTA 4KUZH 4JM4L 3LD8B 2VABB 2CIIB 3ILQC 1DQML 4N1HB 4XNZC 1K3ZA 5EU3B 3O6ML 4LGRB 4JFHD 4ZO6A 3QUZC 4K71C 3U4AA 5B38A 3LHPH 3H9SA 1U9KA 5BRZA 1VFBB 4PIRF 4L4TD 5CEXB 3WFHB 4OV5A 4UT7H 3WNOA 3DO7A 1G7IA 3QYCA 4X7SL 1G9NH 1TNNA 3D6GA 3QISA