4JFFE

Preservation of peptide specificity during tcr-mhc contact dominated affinity enhancement of a melanoma-specific tcr
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
245
structure length
245
Chain Sequence
MSQTIHQWPATLVQPVGSPLSLECTVEGTSNPNLYWYRQAAGRGPQLLFYWGPFGQISSEVPQNLSASRPQDRQFILSSKKLLLSDSGFYLCAWSETGLGMGGWQFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title T-cell receptor specificity maintained by altered thermodynamics.
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 245
sequence length 245
ec nomenclature
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jffE02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jffE01
3JSSA 1VFUA 5DFVC 4L4TA 4PUBL 1VKXA 2N7BA 1J86A 2PF6A 3WIIH 4YC2B 5HYJB 1FE8L 4MQ7B 5T1LB 5L2JB 1CFSA 4HCRH 4J3WA 3IXTB 3RA7H 4P2RA 1NPUA 4MVBD 3EO0B 3LY6A 2A6JB 1T21B 2NYYC 4YFDB 4I5BB 2GK0A 1DFBH 1BVKA 3KXFB 4PYHA 4R2GB 4DKFL 1P7KA 4PGBA 5MERA 1MCLA 4JLRB 3EGSB 3MRCA 5DXWA 4AMKL 1G9EA 4CNIA 4I0PB 5F88A 3QXVA 4L3AA 5EPMA 4HIIA 1J1OL 3MMEA 4HS6A 5EU6E 4L4TB 2PR4H 1VKXB 2CQVA 1DBBH 3RY4A 4HCRL 4MD5A 3RA7L 4LOUD 3S35X 2MCPH 1CFSB 1MI5D 2DLHA 4P2RB 3KHQA 1DFBL 4XVSH 3EYQD 2GK0B 3LEYH 1BVKB 4L8SC 3B2VL 1P7KB 1RZ7H 2FSEA 5MERB 3RL1A 25C8L 2WUBH 3GIZH 3MRCB 5INDA 4RISH 3AUVA 4CNIB 1EAPA 1YUHA 3EIFA 5F88B 3TWCH 4HIIB 3UTSA 3D39D 5T1DH 3MMEB 4AENB 4KQ4H 4PS4L 5FYKU 2I26N 1DBBL 4HS6B 1FNEB 3QRFM 2EDRA 2MCPL 3O81A 4MD5B 4K9EL 4NCC1 1AGCA 1EJ6A 1PDKA 5SWSE 1N5YH 4NQDA 4XVSL 4JFFD 1OD9A 5DEFA 3LEYL 1B9ZA 3C8DA 2UVEA 2WUBL 2OZ4H 3RL1B 2FSEB 3PXHA 1P69B 4HXAH 5INDB 4YGVA 5T1DL 3QG6A 1EAPB 1YUHB 3DMMA 4OB5L 4P2YA 4NDMA 5E4EC 5DC4B 3CPLA 4L4VD 1ZLVK 3UTSB 5F9DC 1YPZF 5BRZA 4Q9CA 4R3SA 4S1RL 3LQAH 4ELMF 1A7BA 1DQML 5IEHA 3EDFA 1S5IL 3IT8D 3VXUD 1AGCB 5FGCE 4LQ1A 4F7CA 3LIZH 1ZAGA 5DMGC 5DEFB 5I8KH 2EECA 4HS3A 1N0LA 1HE7A 3ME0A 1Z6JT 2X10A 3HPJA 5GSVA 1WIPA 4FOMA 1KTKE 4YGVB 3ARRA 3QG6B 4ODXA 1KCLA 3DMMB 3EJZC 2LE9A 4NDMB 3UTZA 3CPLB 5BRZB 4R3SB 4WY7L 2H9GA 5CEXA 1L4IA 5CD5D 4OZGE 3MUZ1 5IEHB 1WJ3A 3LIZL 2NY3D 5I8KL 5DZNA 3O2VL 5GGVH 4F7CB 5IQ7H 4LAQH 5DD3H 4OM1H 2NZ9C 1I3VA 2W0FA 4HS3B 3NACL 1Z0MA 5D7LE 4O9HL 3HPJB 1HHJA 1MWAH 2EEAA 4M7KH 5GSVB 2NY6B 1CU4H 3THMH 4NPYA 4ODXB 5I17A 3L7FA 3RGVA 4KRMB 3UTZB 1F11A 1IGFH 4HIXH 4OCWH 5CEXB 2H9GB 4M6NH 4L5FH 1PG7W 2EDYA 2VABA 1I9IH 1NC2D 5GGVL 4YBLB 1X4YA 5IQ7L 3O8XD 4APQC 3MPCA 3NVQA 5DD3L 4EI5D 4OM1L 3U0PA 4Z7OE 4Z77A 1OGAA 4DVBA 5L2KE 3RY6C 2QQQA 1A7RL 4XVUC 2W0FB 4Q9QL 1BREA 2M1KA 4LGRB 4QHUA 1MWAL 4X4YA 4M7KL 1CU4L 1HHJB 3QXWA 3A67H 3O11A 4UAOC 4NPYB 1IGFL 1QBML 3L7FB 2GSIA 4HIXL 4OCWL 3RGVB 3RWCA 3V6OE 3WUWG 2FECL 1U93A 1F11B 2VDPH 1X4XA 1NBZA 2FLRT 4LSUL 2BSED 2VABB 4KRPD 1JMZA 3KLHC 2VLKE 3ARDD 4PD4J 4HH8A 3ZLQC 4AEHL 4NKQB 3U0PB 2M2DA 1X5AA 1OGAB 4RMSA 4DVBB 4BK5A 1BWMA 5C07B 5SX5H 4KC3B 1PY9A 5JXEA 5SV3A 3QRGH 3O11B 1A6UH 4LFHD 5C0RH 5E2JA 1ZT1B 2GSIB 3RWCB 1U93B 1NBZB 4OUOA 2CR3A 3JV5A 4KDTA 4K3HA 1EZVY 1T22A 3P4MA 4RQQA 4UIMA 2FIRT 2W91A 1VEMA 1XF5A 1T83C 2QHLA 3QQ9C 4OQTL 4LSPL 4PLKC 1CD1A 4BK4A 4MD0A 2AI0H 4WW2F 3KYKH 3RWHA 2CO6B 5E6ID 1LK3H 1A6UL 4Y16A 3OF6A 4GRWH 5C0RL 4ONGH 3S4SG 1JCKA 2X1PA 3MRRA 1X44A 1KCSH 2GKIA 2FB4H 2Q6WA 1GH7A 4NQSA 1KB5A 3AREC 4A6YA 1ZWIA 4LPCA 1JF5A 5ESVA 5BV7H 1UG9A 5MP6L 1T22B 3P4MB 4RQQB 3ULUF 3D3VE 4UIMB 5AAMA 5EOTA 4G80A 1XF5B 2VUOA 5DO2C 2QTEA 1YA5A 1U8IA 1QQDB 2MMXA 3UO1H 1CD1B 4DQOL 5DRNB 4MD0B 5L6YL 3ULVD 4OF8A 3RWHB 4TVPE 4ONGL 4JFOB 4MNHA 4Y16B 3OXSA 5IMOA 1F42A 1KCSL 3BKCH 2FB4L 5E08H 3IETA 3MRRB 5C7XH 3CCHA 2Q6WB 5BV7L 1CDBA 1OTUD 4NQSB 2BNQA 1KB5B 4JANA 4A6YB 4V1DA 1FNGA 1U8NA 1ZWIB 5ESVB 5GGTA 3RDTC 3FQWB 1KB9K 3MJ6A 5EOTB 3WFDH 4G80B 1YPZE 4OCNC 1CICD 3SKOA 3GMOA 5DA4A 1BQUA 3Q1SH 3KPNA 3VXRD 1JYWA 2XQBH 1OVZA 1U8IB 3FQTA 5GZND 4ELME 3FFCA 3DXAD 5D7IF 4XP9L 5LAXA 4PY8J 4HKBA 4MAYC 5F7KC 1T4KA 1IGJA 1GGYA 4MNHB 3BKCL 3OXSB 5C7XL 4S1SH 5H2BA 4WFEE 3VD9A 2CKBH 4PTTA 3WUWA 3L5HA 3CCHB 4KMLB 2FJFA 4PJAA 2BNQB 2E9BA 2VTFA 4JANB 4V1DB 3OSKA 1S9XA 1FNGB 4DZBA 1U8NB 5J3HC 3WFDL 4KAQH 1IAMA 3BPCA 3QAZC 2F8XC 3CSBA 3GJFA 4DUWA 3SKOB 3GMOB 3NBNA 5DVKA 3KPNB 3B9AA 4OF3A 2EXYC 3L3GA 3FQTB 4XZUA 5HI3C 3WEXA 3FFCB 3QJFA 1XR8A 4NYLA 4PJ5A 4ZUTB 5LAXB 4HKBB 2OTWB 4D9QE 2VSDA 2VLRE 2YPLD 1T4KB 2VAJA 4S1SL 1IGJB 1FFQA 2P5WD 1W0VA 3SDDD 2CKBL 5H2BB 4EXPX 4PTTB 3WUWB 3EO1A 4ZQKA 2FJFB 4PJAB 2PTTA 5C08A 4EOWH 4KAQL 5ISZA 3QDJA 4ORGA 1JRHI 3GMLA 3KXFE 4HJJH 4CN6A 3BPCB 3MLYL 3VWKD 3GJFB 5DVMA 4BZ1H 5LXGH 5F9JA 1KUMA 2UUDH 4OAWA 3L3GB 1F4HA 4XZUB 3WEXB 1QG3A 3QJFB 1XR8B 4NYLB 4PJ5B 2VC2H 1R0AL 4L4TE 1P1ZA 4YAQA 3QUXA 1TJGH 4L8CA 3B6SB 1W0VB 1ORQA 2BSSA 3HPLA 3S4SA 3T77A 4EOWL 3EO1B 4ZQKB 1EV2E 5C08B 2PTTB 5ISZB 4ORGB 3GMLB 1XF3A 5LXGL 2CLVA 4L8DA 3A0OA 4U1JA 5F9JB 1IAIH 3I6LD 5F1NA 3TFKD 1P6AB 2VC2L 1JNNH 3QULA 4OAWB 4Y4KA 1JV5A 1M05A 5C0IA 1TJGL 4NUGH 3V8OA 2X4SA 1P1ZB 4YAQB 4DGVH 5KAQG 3QUXB 1FPTL 1DQQA 2GFBA 1KJMA 4L8CB 1ORQB 2BSSB 3HPLB 3S4SB 4OGXH 3T77B 3EKCA 4KI5F 3BWUC 5A3ID 1E4WH 4HK3N 4N0RA 4MDJA 4HJ0D 4PLJC 5SWZD 1XF3B 4N1EA 2CLVB 2A0LD 1IAIL 4L8DB 5KANI 1EGJA 4U7MA 2R0KH 4U1JB 3NCMA 2A77H 5F1NB 1WEJH 5GHWH 3DGGA 3QULB 4Y4KB 5AYUH 4NUGL 1M05B 1SEQH 4DGVL 4N90D 5C0IB 4NKOA 2Y06H 1JWUA 2X4SB 1ZANL 1G0XA 4OGXL 4OZIA 4TN9A 2GFBB 1DQQB 1ORSA 1KJMB 4OGYL 3WKNA 4Q9RH 1H3PL 3D2UD 4NQDE 5HHXL 4YHYC 1WTGT 1WGOA 4MDJB 2FNBA 3VH8A 2R0KL 2M26A 3U4BL 5JW4N 5FGBA 3UTQA 1AFVH 1ZGLM 1WEJL 5GHWL 5D72H 5MHSD 3MLXL 1YY9D 3SE3C 3DGGB 4JO3H 2Y06L 2IPTH 2EDTA 3ULUE 2R8SH 4NKOB 1JWUB 2ID5A 2OLDA 4OZIB 1X5ZA 4G6FB 1ORSB 3VG0H 2XA8H 4K3EH 1CVRA 3A6BH 1F90H 3QQNA 1PEZA 3BKJH 4JGUA 4ZAKD 1KIRA 4XAWH 3VH8B 1AFVL 4QCIB 5IWLC 3ZDZF 2MPAH 1A3RH 3UTQB 5KTEH 5D72L 5T1KD 3ZTNL 1MY5A 4XP5H 4JO3L 2IPTL 4J1UA 3TESA 3MV8A 1YZZA 1GHFL 4XT1C 2K7PA 1JPFA 4YBQC 3SGDH 3W2DL 1F90L 4XNYL 3KYOA 4UINH 3BKJL 5FYKE 5DHVH 2GQHA 1EK3A 1RU9H 2Q20A 1U42A 2C3GA 1KIRB 2MPAL 1A3RL 3MJ9L 3QEQD 4WI5A 4XP5L 4PYGA 4LLMA 5DVLA 3T0BA 3CZFB 5A40E 3BPOB 4J1UB 1CWVA 5CD5C 3MV8B 5EC1A 4C54A 3IDYC 1MCPL 3T0ED 2HTLD 4POUB 4QXTA 3JBG7 2CLRA 1JPFB 4UINL 1S7SA 5D7KE 2J4WH 4N9GA 3GIVA 3AGVA 2FO1A 3KYOB 4Y5XA 5DHYA 1RU9L 4R96A 3TBSA 2DBJA 1OGAE 3M8OH 3GBML 1FGVH 4NWTH 5ITBH 4NO5A 3CFEA 1OTSD 3IAQA 4LLMB 3X3FH 4KRNA 2DLIA 3EDJA 1FHGA 2E3VA 2LVEA 3QIBD 5EC1B 3OV6A 1VACA 1E4JA 3KLDA 3BKMH 4QXTB 2J4WL 2CLRB 3GSNL 1S7SB 2IBGA 3ECBA 2B7DT 3TV3L 4POYA 4N9GB 2PW2A 3GIVB 2IQ9L 4Y5XB 1ONQA 4TRPH 3KG5A 5DHYB 4GXUN 4R96B 3CFDA 3TBSB 1A8JH 1FGVL 1NMCC 1T66D 4DK3A 5ITBL 1QBAA 5E8DH 1RZIA 4NO5B 2J6EH 2XT1B 2N7AA 3CFEB 1NUFA 3V5KA 2MQCA 4BKLA 1FNLA 5CEYA 3V6BR 4KRPC 1B4JL 1VACB 3BKML 2YA0A 2BSRA 3MV01 2V5YA 4UTAH 1IAOA 2LVCA 4NGHH 3S36H 3ECBB 4TRPL 2PW2B 3BPLB 1IC5H 3DUUA 4JRXA 4XX1G 1PW3A 1ONQB 3BE1H 4OZIF 2R15A 3CFDB 1D7FA 5E8DL 3ZKQD 4YGAB 1MCSA 3VD4A 2J6EL 1U92A 5EZIL 1RZIB 4L9LC 4HFWA 3QPQC 2YPVH 4LVOC 3V5KB 4PJHF 4KI5E 4BKLB 1JGUH 3MYJA 1NCUA 5F8QC 4ZO6A 5CEYB 43C9A 4MLIA 3IGAA 1P5UA 2BSRB 2IMNA 2A9MH 3S36L 1IAOB 4FA8A 1IC5L 2AERT 2WINB 2ORBH 5HYEA 3VXNA 4JRXB 3DUUB 2IAND 2COQA 3SDXF 2Z31D 4F37F 1U92B 4HFWB 3FO0H 4A2LA 4KMTL 2HT3C 3MYJB 3OGCA 4IIQA 4F7PA 43C9B 1J11A 1KN2H 2A9ML 5C9KA 2MHAA 1EEYA 1T5WA 3IGAB 4NN6C 3VGAB 2HJLA 4L3CA 2ENYA 1MIML 2YD7A 4AY0A 4GBXC 3OZ9H 3B5HA 4FQCH 3VXNB 3B8YA 1UM6H 5H35A 5KVMC 4PP1D 3FB7A 5CS7A 3FFCE 2CDGA 3RWIA 4P4KC 2ZOLA 2C3WA 2HTKD 3FHAA 3QJHA 5B22A 4E41D 3ARQA 4IOIA 3LS5L 5FEBA 1KLUA 2DTMH 1KN2L 1U8QA 1OTUC 5F96H 3OGCB 4IIQB 3PDOA 1NFKA 3PL6A 4B7LA 1HILA 3WIHL 3TBVA 5I73B 5JA8B 5E9DD 3QR2A 2MHAB 1T5WB 3ZDZE 2NY2B 3OTTA 4JKKA 2HJLB 3IJYA 4L3CB 1AGDA 1PX4A 1UEYA 2BCKA 5GJSH 4KMQA 4FQCL 1UM6L 3P77A 3L3IA 3VFSA 4L3EE 4YHIA 4S1DC 4WGWB 2GJ6A 5DHXB 5H35B 1A5FH 2XYCA 3FB7B 2VOTA 2CDGB 4ONFL 3RWIB 2ZOLB 4OFYD 1QNZH 3VMOA 5HGDB 4IOIB 2DTML 5GGSA 1QSED 4I0CC 5EUOF 4QYOA 5F96L 4HJGA 1KLUB 1U8QB 1CFTA 3PDOB 3PL6B 1HILB 3PG2A 4J8RA 3TBVB 5BMFH 2XPGA 1NEUA 5GJSL 1VGEH 3IJYB 5ISZE 3QDJE 1AGDB 4XPGH 2BCKB 3HZMA 5DMIL 3L5XH 3P77B 4GT7A 3L3IB 3VFSB 8CGTA 4ZO7A 5GRYA 2GJ6B 4YWGH 1OAYH 1BVLA 1QNZL 3PWPA 4LSSH 4ZO8A 5GGSB 5ILTL 4QYOB 3LQAC 4HJGB 1U58A 1FYTA 1CFTB 3HG1A 3F7VA 1VGEL 4J8RB 2E8YA 4XPGL 2H26A 5A2LH 2XPGB 1TQCB 4X8XA 3GHBH 2F54A 4LCYA 3HZMB 2ZUYA 4I9WD 4M6AA 1IGTA 4JVPA 5FUZH 2FH8A 4YWGL 1OAYL 3D87B 1GCFA 2VB5A 1Q8MA 5C0FA 2OTUA 1BVLB 1FAIL 5GGQH 4C56E 5CJ5A 3BEVA 3PWPB 3GSRA 2ATPA 4HSQA 4IJ3C 1KLGA 5CZXC 4CVWA 4N5EC 1KFAH 3S35L 2V9QA 4YUEH 1U58B 3SKJH 1FYTB 2X89A 2ARJQ 2FHBA 3HG1B 3BD4A 3F7VB 3GHBL 4CKVX 3NABH 2H26B 3T2PA 4FQ2L 5FUZL 2F54B 4LCYB 4NQXA 3U0WH 4M43H 1RZKC 1XGUA 5J12C 1IGTB 4LPWA 3E6HA 5GGQL 1CFNA 5FHBH 5C0FB 1J1XH 1YEHH 4F7MA 2X42A 5HDLA 2OTUB 4NQCE 4PGZA 3WJJA 9CGTA 3BEVB 3PWVA 3GSRB 1KFAL 2ATPB 1KLGB 4YUEL 5HBBA 4UDTA 4OZIE 4F9LC 1JPGA 5DD0H 4U7KA 3NABL 2V7NA 2NY4D 5HHOA 2O61A 1CR9H 4JJHA 2PXYD 4PJHE 1XGRA 5FKPA 3ZE2F 4NQXB 4HKJA 1XGUB 5E70A 4KXZH 1YEHL 5BQ7B 3E6HB 1CFNB 4U6VH 4F7MB 5A2IH 1U3HD 3MJGX 4XBPA 1RD6A 4KK5D 3PWVB 1BZQK 2HT2C 4UDTB 1KNOA 3SDXE 4P2QA 1JPGB 1NBYA 4YDLB 1CR9L 4LCIL 4RGOL 4X6EA 2V7NB 5F7WC 5HHOB 2ADFH 3D9AH 2O61B 2R0LH 4QO1A 5T3XE 1MHEB 1I1CA 1XGRB 5FKPB 3I85A 3EJYC 4HKJB 5E99L 1CGUA 4Y19E 1UA6L 2FYYB 2YRPA 1YDPA 5JDSA 5IOPA 5CJ8A 1BHGA 4LSRH 4ZPVA 1QFWM 4WUKH 4XBPB 4JFZH 2D4FA 3VFOA 4PREA 3QDME 1KNOB 1NBQA 4P2QB 3W39A 2ADFL 1NBYB 3S34H 2QSTA 4X6EB 1T0MA 2ZJSH 5J1TC 2GJJA 1JHTA 1EHXA 2SEBA 3VGGA 4WU7A 1G1YA 5DJ6A 3WL9A 1CLYH 2A6IA 4YZFF 5DJ8A 4WI6A 4H5SA 3PGDA 1YDPB 5JDSB 5IOPB 4WUKL 3AB0C 1GJIA 4JFZL 1J18A 4ZPVB 1CXEA 3VFOB 4Y7MA 4YXHL 4EZMA 4PREB 5MEND 3S34L 3C5ZC 4XP4H 3RZCD 1ZT7A 2CJUL 2ZJSL 3W39B 4TNWF 5AZ2H 1BOGA 1T0MB 3WCYA 3QNZA 1JHTB 4P3DA 3NTCH 3D85D 1RK0A 2SEBB 3QWQB 1CLYL 4WU7B 4N9OB 5DJ6B 4YQXH 3WL9B 2A6IB 1EBAA 2WBWB 5GJTL 5DJ8B 2FDBP 3PGDB 5D7JA 5JW4M 3TT1L 4UB0H 1VFMA 4XRCA 3IS1X 1YQVH 3LN9A 2PTUA 5TF0A 5AZ2L 3MZGB 1ZT7B 1J9CT 1BJ1H 3NTCL 5IB1A 4QOKA 1BOGB 1C7TA 2APTA 2AV1A 3OL2A 3QNZB 3QUZA 2OP4H 4IM8A 4P3DB 4FMFA 1RK0B 2XTJD 1FV1A 1W8NA 3DI2B 5I71B 1MRCH 3QZWA 4IMLA 5L0QC 3MNVA 3QIBC 2E6JA 4U05A 1EHLL 3AXLA 4OV6F 4D3CH 5D7JB 1HI6A 2R0WH 1LE5A 5C0CA 3O4OC 2W65A 4XRCB 4LDLB 1AO7D 1FFRA 1NQBA 4XHJD 4PJEF 1P2CA 5K93A 1W72A 2KKQA 1MCFA 1TJIH 2OP4L 4QOKB 4WHYG 4FQXD 2JELL 2AV1B 4JFDD 1MRCL 4PJDA 3QUZB 5GRJL 3LN4A 1Y6MR 1FV1B 4ZUVA 4IMLB 5DQJA 3QCTH 1FC2D 4D3CL 3MNVB 2JTDA 3BIBX 2R0WL 2HAZA 3AXLB 5IVXF 2GUOA 3N1GC 1HI6B 4OZFG 4IDLA 1LE5B 5C0CB 5I0ZA 2W65B 5I76A 3QUYC 1OWWA 2ZUQB 1G6RH 4LLDA 5BS0D 1P2CB 2CRYA 1UH3A 1W72B 4APQA 1TJIL 4LKCB 3RX8A 3V4PH 1I1AD 4QRPA 4HKZB 5DFWH 1LEIA 3MV9D 3U83A 1U3YA 3HA0A 4PJDB 5FUOL 3ZHKA 3LN4B 1TETH 5F6HJ 4M7ZC 4ZUVB 5DQJB 3RI5K 4GQ9H 3WFCH 2DM3A 2DIAA 3DHMA 1U6AL 4J2XA 5ECJE 2GUOB 4KJPD 3H9ZA 5ANMA 1K3IA 1G6RL 1WFUA 2H2PD 2PTVA 3ZE2E 1UCTA 5I76B 1AGFA 3VRLF 3V0VB 3DYPA 4LLDB 3KYAA 4WRLA 2QADD 4MHHG 4NNYA 2J88H 4APQB 2O5ZH 5DS8A 5DRZA 1TETL 1LEIB 2VZ3A 4M3KB 3WFCL 3LD8B 2DQIH 1XGYL 4MQSB 1Q9KA 2F8VA 4X6BA 3MNWA 3MRNA 3IB4A 3ARSA 3PP4L 3I6KA 4D94A 4NNXA 5ANMB 2RBLA 2CUHA 3BDYH 2NTFA 1AGFB 3HR5A 3OB8A 5CKAA 4NNYB 3HI6L 1INQA 1T0PB 4YHML 1RUAH 5DRZB 2DQIL 2YWYA 3K0WA 3K4ZA 2F74A 1Q9KB 3K1KC 4X6BB 3MNWB 4F57H 3MRNB 4RMVA 5IV2A 1QBLH 3FAWA 5DJAA 3TN0D 1RIHH 1MCQA 3BDYL 3I6KB 2X09A 4NNXB 1OLZA 1QRNA 3FKUS 2IPUG 2NTFB 3IS0X 1A6VH 3HR5B 5HJ3B 4YZFE 1A22B 5EO1A 4KKLD 1BQHG 1INQB 1KGCD 2XZAL 1JL8A 3LH2H 4FP8H 1EX0A 2XA3A 4F57L 4WFFD 3EOAA 3H7BA 2F74B 1BLNA 1RQ5A 5IV2B 1RIHL 5DJAB 4MZ3A 3HB3D 4I77H 1H8NA 1G9MC 5FHAL 3TO4C 2VDOH 1QRNB 1QRKA 3VXMA 3FQNA 4BFIA 4HS8H 3MLTA 1U8MA 4OV5A 2WWKO 5JZ7D 5EO1B 2PNDA 3HAEH 1ODAA 1J1PH 3FRPG 4TVPL 4FP8L 4DJMA 1FJ1A 4FQJH 1A1OA 4PJ9D 4AM0A 3N1FC 4R97B 2H2SD 3EOAB 3H7BB 4FFYH 1BLNB 3KR3H 5C0BE 1LO5A 4HWEL 3OKMA 1KCUH 2ZCKH 2VDOL 1VSCA 4LBEA 2DICA 4U6HA 3VXMB 3PNWA 3GEWB 3FQNB 4BFIB 1P7HL 3MLTB 1U8MB 3EUUA 4OV5B 3MSPA 1AXSA 1M6OA 4FQJL 3ARGD 3BP4B 1J8HE 5B39G 4J4PC 5IB5A 5JW4Q 4G6AD 4JQIH 1JZ8A 1FJ1B 3MODL 3SJVE 1A1OB 4M02A 4PJEE 4AM0B 2K3TA 1HHKA 4MGXA 2VAAA 4PIRF 1NKOA 5FYLH 1JN6A 5JHDE 2ZCKL 1LO5B 4KUCD 3ZHLA 5JOFA 4CU7A 3OKMB 5DMKA 5IHUH 1VENA 2X05A 3AS1A 2H45A 5IK3A 1H3WM 4WTWA 5HHOE 4U6HB 3PNWB 4NKMA 1KCVL 1IGMH 1F45A 1AXSB 1M6OB 5IVXE 3QYCA 3RAJH 5IB5B 2R23B 2X1QA 3AS2A 1YJDH 3BZEA 3ZYOA 1HHKB 2VAAB 3MCG1 4Z8FH 1JN6B 1CGSL 5IHUL 3HTLX 5JOFB 5K9JH 4G7YH 5DMKB 1C08A 4P2QE 5IK3B 4Y8AA 1IGML 4UNUA 5FCUH 4NKMB 1F3JA 3Q5OA 5EU7C 1QFOA 4LCUA 4N0YL 1NEZG 1P4BH 2PCPA 3LSOA 2VLJB 3VXSB 3VRLE 2K7QA 4W6YB 3BZEB 1B0RA 1RZFL 4Z8FL 1QFPA 2JJUA 3P9MA 3MLPA 3FQRA 5K9JL 4G7YL 3LRHA 2XN9E 1EHAA 1C08B 1U8PA 1T1XA 2OX5A 3BMWA 5FCUL 32C2A 1SY6A 1G84A 3DBXA 3DETC 4TYUA 4NQED 1MCEA 2VR9A 4XGZA 1F3DJ 3EAKA 3WNNA 1F3JB 3QHFL 4UBDD 3TZVC 1B0WA 4LCUB 3FRPA 1DUZA 3EBAA 3ROOA 2PCPB 3LSOB 5FUCC 2EO9A 1B0RB 4RDQF 4YK4C 2V7HA 4JZJC 4XXCC 3P9MB 1AJ7H 4YDKL 3FQRB 1MI5A 1B4RA 3BQUC 3S88L 1U8PB 4OBSA 3MV7D 1BAFL 1T1XB 3X14A 1JRHL 4P3CL 32C2B 1IC1A 3L1OH 4Y1AE 5D5MA 3DBXB 1QR4A 1TVDA 4XGZB 1XMWA 4HC1A 1W0YT 3QUMH 4Y4FD 1A7QH 3MRBA 3D39A 4PRPD 2KPNA 1DUZB 3ROOB 4DKAA 3ULUH 2EH7H 1RJLB 2OR7A 3BIAX 5DSCA 3B9KD 4QRSA 3KPSD 1AJ7L 2JCCF 4K8RH 3I02A 2V7HB 4U1IA 3NCFB 4HWNA 1MI5B 1KPRA 1MFNA 4HWBA 1D5ZA 1QHOA 5CWSA 3X14B 2KQNA 5J13C 1VGKA 1KJ2L 2XXMB 5D5MB 3QUML 1YECL 1F97A 5F7UA 4OI7A 3MRBB 3ULUL 4OM0H 3D39B 2EH7L 4L4VA 3GKWH 4K8RL 1E0OB 1CGXA 5DSCB 4QRSB 3I02B 4JN1H 4U1IB 1OB1A 3JV0A 5C0CE 3VXUA 4OT1H 5FYKH 3C2SA 2Y72A 3P0YH 4JFFB 1N6QH 1KPRB 3N1PC 2NXZC 2Z4QA 1G7IA 2J7LA 4HPYH 1KCKA 5CWSB 4G9DA 1F3RB 5CBEA 4I2XE 1ZGLA 3QBTB 3BDBA 4OIIH 4OM0L 3SDCC 4OLXL 3BRFA 3VFVA 1DANT 2XKUA 4L4VB 5F1OB 1B3JA 3SGKA 4NKIH 4GS7B 4RGNC 4JN1L 4Z0XA 3TJEH 4LGSB 3WS6A 4OT1L 5FYKL 3P0YL 1OB1B 1RHHA 2WBJC 4MXWH 1M4KA 3VXUB 4BSVA 1QOKA 1ZVYA 2Z4QB 4HPYL 2DLFH 1G7IB 4FQXC 3GM0A 5IT2H 3CNKA 4G9DB 4QRPE 4OIIL 5CBEB 1ZGLB 5KS9F 1IARB 2VITA 5F1IA 3HRPA 2BOBA 3TJEL 1R5IA 1D5IH 1QPXA 4Z0XB 1IKNC 4NN5C 2X7LA 4MXWL 3W0WD 4IHOA 5JO5A 3P4LA 4P23D 1NC2A 2ED9A 4OLEA 1RHHB 3O8XA 4EI5A 4U0QB 4BSVB 2DLFL 2NY3B 2HRPL 4OLUL 2NW2A 5EU5A 5JOPD 4KTDL 2V2WA 2IGFH 1OSZB 3FT3A 3PWNA 3QI9C 3WHE0 1T0NA 3O0RH 2EE3A 2VITB 1D5IL 3HS0A 2IC2A 5F1IB 1S7RA 2BOBB 1S7WA 1R5IB 5D2NC 2X7LB 2XY1A 4IHOB 1ACYL 4KK8D 5JO5B 1NC2B 4XMKL 3ARDA 4E5XA 5KSBF 3O8XB 2CR6A 4JHWL 4EI5B 3VRJA 2IGFL 2NW2B 5EU5B 2ARJA 4MA7H 2D2OA 2V2WB 4W6WB 1J0YA 2ERJB 1FNAA 4R8WL 3KPPA 4I3SH 4X4XA 1RUKH 3FT3B 3PWNB 4FXGA 5C09D 2D03H 4L1DA 3O0RL 3K2UH 3HE7D 1T0NB 5D5MF 3HS0B 4HKXA 1S7WB 4A6YH 4KRPB 1IE5A 1QRNE 4XNXH 3SE9H 2J8HA 4E5XB 3ARDB 3UPRA 4MA7L 4WV1A 3BIKA 3VRJB 1J5OH 1GGCL 2ARJB 4DW2H 2X1OA 4I3SL 4TOYH 3V4VH 1RUKL 4AK1A 3KPPB 4KKBC 5E6IA 3K2UL 2A9NH 2XKSA 4X4XB 4FXGB 5HI5D 2F19L 3D0VA 1MCBA 3LRSA 4KTEL 2AGJL 3OMZA 1IT9L 1CDUA 3RNQA 4A6YL 4HKXB 3SE9L 4XNXL 2BOCA 4U3XA 1FDLH 4NHUA 1J5OL 5GGTH 4K7FA 3HMXA 3UPRB 4LF3A 4DW2L 4WV1B 1YEEH 3BIKB 4YHOH 3GI9H 4TOYL 3BXNA 1TJHL 2FEDD 3V4VL 4Z7NF 1NGZA 1FP5A 2JCCE 1I9RH 2FHCA 3H2WA 5E6IB 2EDBA 4O2CA 3D0VB 3LRSB 4MXQC 3EO9L 3MLWH 4NSKA 3RNQB 5D8JH 5BW7C 4G42A 4CVUA 2AJUL 2BOCB 1AGBA 1W2KT 1DTUA 4NN6B 5JZ7C 1YEEL 4NHUB 3SGEI 5SWQA 4YHOL 3GI9L 3B5TA 3D48R 4KUZH 4K7FB 3GJFH 3MRFA 1CICA 3EZJB 2HT4C 3HNSH 4LF3B 4F33A 3VXRA 2A1WH 4MSWA 3BXNB 3DXAA 1NGZB 2H2SC 3MTRA 3JVGA 4JM2D 3MLZH 4O2CB 3FN0L 1J0IA 3MLWL 4IRJC 3BJ91 1CDIA 1KEMH 4JG0H 5D8JL 4LHJB 4NSKB 4MQXD 4PV9A 4GAYA 2WLYA 2QSVA 4G42B 1AGBB 8FABA 4MMXC 5CSGA 5SWQB 2A1WL 2NY5L 5EZOL 1CICB 3MRFB 4DAGH 4F33B 2D3VA 3FOLA 3VXRB 4MSWB 5F1SA 2YMXL 2QV2A 4U4BA 5ELIA 5F3BA 3DXAB 3RIFF 3RVWD 2VYRE 2JK5A 1OAQH 3U4EA 2YPLA 3MUJA 3BUTA 2P5WA 3SDDA 1KEML 1A7NH 4FFZH 4JG0L 4ZXBD 5HHMD 1WK0A 1X5YA 3I75A 5EN2A 3G5VA 4RX4D 3BN3B 4XCFH 3ZSSA 3NCJL 4PV9B 4C57C 4GAYB 4BH7A 2Z92A 1CT8A 1TTUA 1T03L 1TTFA 2Z93A 5KS9E 8FABB 4P46C 4DAGL 5J57B 2VQUA 3VWKA 1NAMH 4YPJA 1E6JH 5T5NG 3RWGA 2HA1A 3FOLB 2ICES 5GRVL 4AIZA 3Q6GL 5F3BB 1IQWH 4BZ2H 1A7NL 2JK5B 3U4EB 1C1EH 2YPLB 4H26A 5L7XH 1PG7H 2P5WB 3SDDB 3UJIL 1H8SA 2I27N 2JB5H 2X41A 4X9GA 4OCYH 3V9FA 3I75B 3H0TA 3G5VB 4YFLF 4RA3A 1T5XA 5DJ2A 3W5MA 3U82B 3LKNA 4BH7B 2Z92B 1CT8B 2Z93B 4NZRH 1UWEH 1VADA 1NAML 3GKZA 5DI8A 1E6JL 1GL4B 1M71A 1EGJH 3VWKB 1FVCA 1Z9OA 4M62H 3TEUA 1WLHA 3RWGB 2I5YH 1IQWL 4M1CC 1TZHA 4JR9H 4AIZB 4BZ2L 1PFCA 1BOYA 3RX7A 1F58H 5L7XL 2JB5L 4H26B 5EWIH 4XCNA 3L3KA 1JGLL 4QT5A 3V7AE 4F8TA 4FQ1L 2AQ3A 1MI5E 4TUKL 2CO7B 1PEWA 3AS0A 1RIUL 3H0TB 4F8QA 2ZUUA 1T5XB 5DJ2B 4JFED 3LKNB 15C8H 1BZ9A 4PJIA 4HZAA 5SWZA 1VADB 3Q48A 3QHZL 1N5AA 4M62L 3O6FC 4XCCH 5DI8B 5D5ME 3W9EA 5I8EB 5I19H 1M71B 4QKXB 1FVCB 5KZCD 1F58L 3MCKA 1TZHB 4PJ8D 2OXHA 5IF0A 3O6LH 1C5CH 2PW1A 3GO1H 5DK0A 3O9WD 5DDHA 4XCNB 3ULVF 2WIMA 2X5PA 3L3KB 4QT5B 3D2UA 3O3UN 2BRQA 1GC1H 5CJBA 4KROD 2V5SA 4HIEA 3QG7L 5LG1A 1UJTA 4NJAL 1MFAL 5T3XH 3S37X 5I19L 1BZ9B 4PJIB 5SWZB 1N5AB 3W9EB 1WFOA 2IADA 4QHKI 3MCKB 3O6LL 3X17A 1C5CL 3IXAA 3GO1L 5IF0B 2WIIA 1WCQA 4Z7UA 2PW1B 1OPGL 5DK0B 4KU1A 5DDHB 2DI9A 1N64H 3L95A 3VWJD 3VXUE 4Z7NE 3D2UB 4S1QL 4X7SH 1XEDA 3U4AA 4EDWL 5T3XL 4GAJH 4HIEB 5CP3A 2QKIA 1MJUL 1N6UA 1OP3H 5T1KA 5JLZA 2X40A 2IADB 3JUYA 3OBAA 3OKEA 4KVNH 4ZO9A 1S7XA 5ALCH 3IXAB 3OWEA 2V9RA 3DARA 2WIIB 2H1PH 3CC5A 4Z7UB 3HI5H 4G6JL 1N64L 1A02N 3FT4A 2MNUA 4WFGD 3L95B 5EZLA 4GAJL 2XI9A 3V52H 1CCZA 4LVHC 4PBVC 1HYSC 3RVUD 3B9DA 4ZAKB 4AT6B 3QEQA 4N0UA 5I18H 4IRZH 2QKIB 4YFLI 2A74A 5TPWH 5I1GL 5T1KB 2B1AH 5JLZB 1DSFL 1FL3A 3OKEB 5ALCL 3U7AA 2GIYA 3WLWC 3QXUA 2NPLX 1S7XB 4JKPH 4BH8A 4GAGH 3HI5L 3QCUH 3T0EA 1CTNA 3MRDA 3AB0B 3CC5B 1NGQL 2DDQH 1TITA 5BZDB 1OLLA 3FT4B 3ZHDA 3I2CH 3C6LD 3DVGA 2FX9H 4DZ8A 1K8DA 5F7HA 5EZLB 4ACPA 1JMXA 1JF1A 1YEFH 5J56B 1X5FA 4PG2A 1SJHA 4GG6F 2Q3ZA 3QEQB 1UH2A 2F15A 4N0UB 5FYJH 5TPWL 2AXJA 3TNMA 4LCWE 5FCSH 2A74B 4WO4C 1NCBH 4R4FL 4JKPL 4GAGL 4LPUA 1FL3B 1YEKH 3QIBA 3G6AA 4BH8B 2RCSL 5F1KC 1GGTA 2BVQA 1ZMYA 3T0EB 1V7MH 3MRDB 3RFZC 4IBLT 1IFHH 5CP7A 2RAMA 1YEFL 5ABDE 5CJXC 3DVGB 4G9FD 4DZ8B 1K8DB 2QSCH 1JF1B 5CZVH 2EE6A 2BERA 1CFVL 4I18C 3MZTA 1SJHB 3TNMB 4JO4H 1NCBL 5E5UB 2FCBA 3IFLL 3KYMA 1S9YA 2M8XA 4JPVH 1UM5L 3LAFA 4L1HA 3QIBB 1V7ML 1IFHL 3G6AB 4YC2C 2BVQB 1ZXQA 4RA0C 2CXKA 4XMLH 1KIUA 5CP7B 4MQTB 5BZWA 3O2WL 1JHKH 5CZVL 5KG9A 4R2GC 2WQ8A 4LRNH 3SDYH 1EEQA 4JO4L 4O58H 1R5WA 4WUUD 4I0PC 2F5BL 1N59A 3CFIC 5E8EA 3KYMB 4BQ8A 1L0YA 1YJDC 1S9YB 1QLRA 1MRDH 2R9HC 3RBSA 4XMLL 4LP4A 3GMMA 4L4JA 2JJTA 5BZWB 3MXWL 4LRNL 3KPRE 3SDYL 4DN3H 1HQRA 1GIGH 1PSKH 1V7NL 4JGMA 4KJQD 3WO3B 5KG9B 2IANA 1U36A 2Z31A 1X5GA 1UXWA 5CEZH 1OOAA 1R5WB 5ALBH 2Q76A 3QT2A 3BKYH 3ULVE 4PLOB 3UJJL 1N59B 5E8EB 5B38G 2OYPA 1MRDL 2I60H 3GHEH 1UEMA 2X2YA 5DQ9A 2BVOA 5TF1L 5BVPH 1QLRB 5FF6A 1BPVA 5C2UB 4Q7DA 4Y0GA 3GMMB 4DN3L 2APBA 1PSKL 4ODHH 1EBPA 3TA3D 4Y5VA 4FQIH 4GRWF 1P84K 2IANB 5CINL 2DKSA 3LMJH 4XHQA 5ALBL 2Z31B 3RY5A 2WP3O 3IJSA 3BKYL 3U9PH 1CXFA 1UXWB 3QIUD 3WBDA 2MTPA 4HDIA 3DXAE 4TTDC 3FONA 2Q76B 4E41A 2NXYD 3GHEL 4LGPB 5BVPL 1Z9MA 3QDGE 2CH8A 5DQ9B 2BVOB 1HOCA 5FF6B 5E9DA 1NLBL 3HC0A 4LSDA 4MNGA 1OTTD 4CMHB 3K8KA 3RRQA 5SX5K 3B9EA 4Y5VB 3U9PL 3C8HA 4JZNA 3TPUA 4JM2C 3IJSB 4JDVA 4HDIB 1CE1H 3FONB 4OFYA 4E41B 4M4RA 1CLZH 3DMMC 2CXGA 5EBMA 1QSEA 1DL7H 3I50L 3DYMA 4ZD3H 4K8RC 4X6CA 1ZLUH 5JDJA 4FS0A 5E9DB 3IVKA 3OKLA 5C0NC 1YEGL 1PBYA 2DTSA 3HC0B 3MA9L 4MNGB 3CH1A 3ZE1F 5IJVA 2UY7A 5DQDH 4JZNB 3AAZA 4KFZC 3TPUB 5E2TH 1OY3B 1FAKT 4JDVB 1CLZL 4ODSH 4R6UA 2NY6C 3R1GH 4ZXBC 4KZEL 1YYLL 1VFBA 1WV7T 1FVDA 5CLWA 1DL7L 3QCVH 5EBMB 4ZD3L 1QSEB 2CK0H 3U30B 3V5HA 1I1YA 1LNUA 5IBLD 1D9KD 2NQCA 4FMKA 4GG6E 3W9DA 2CRMA 4YBLC 3IVKB 2X4PA 3OKLB 2NY1D 4G43B 2E7CA 2W9EH 3WUZA 3CH1B 3BGFB 1PX3A 4JY6A 2DJUA 4DOHE 3QDHA 3Q5TA 3WO4B 3RWEA 1CGVA 5IJVB 3K2MC 3AAZB 4P99A 4ODSL 4Y4HD 3IAPA 4QWWC 5DUBA 4ZFGH 4J4PA 1CD0A 4UQ2A 3BW9A 4LMQI 1VFBB 1F5WA 1FVDB 3AMKA 5K33A 3RGVC 3TCXA 4X80L 5FA4A 1JVKA 3SEPA 2DQHH 3B2UC 3V5HB 1I1YB 1LNUB 3S7GA 2Y25A 4FZEH 2BDNH 3RZWA 3W9DB 5D9SA 5HHVL 1IRAY 2X4PB 3X11A 1MUJA 3ALXA 4JY6B 2X4UA 3RWEB 3FAXA 3WXVH 4RDQG 3MACH 4PJXA 3ZO0A 5DK3A 5GSRA 4UQ2B 1EFXD 3BW9B 4N90E 2ZPKH 2DQHL 2CGRL 1FO0A 4UV4L 4FZEL 5FA4B 2BDNL 1I1FA 1X5XA 4LCCA 2JIXD 3K74B 1IC4H 2EDOA 2PXYA 3X11B 5DGRA 3DTXA 1MUJB 1LEGA 5DYOA 1EAJA 1WITA 3WXVL 2X4UB 3MACL 3K46A 4C55A 2NY0D 1F4XH 4EUPA 5MHSE 5JXEC 4KH2A 4PJXB 1U3HA 5IROA 3O9WC 4G7VH 5D1ZD 5HY9A 5GSRB 4NFCA 4BFGA 1HEZB 4NOFA 4P5TD 3VXOA 2GCYA 3STLA 1FO0B 1FZJA 1GAFL 1A14L 4LMQE 5IFHH 3FCTA 1BEYH 4BSWA 3DROA 3NCEB 4QHMA 4KDTC 1H3VA 5E2VH 4LCCB 2FO4A 2NY4B 1OP5H 1NSNL 2PXYB 3DTXB 1LEGB 5DYOB 2P8MB 3ZT6A 4M5YH 4H1LG 4B0MM 1L7TH 1YNTA 3UP1A 4NO0D 4G7VL 3TZVA 4EUPB 3S3SA 1U3HB 1E4XH 4Y16C 5HY9B 4XNUH 3FB6A 3VXOB 5IFHL 2GCYB 1BEYL 4KKCD 3STLB 2X4TA 4M4PA 2X4QA 1FZJB 4GRWE 1OAZH 4MWFA 3FCTB 2YN5A 5E2VL 1TZIA 4BSWB 1F4AA 2H41A 4QHMB 4QRRE 1UM4H 2FO4B 4X5WA 4MAUH 1NGXA 1H15A 1R3HA 4M5YL 4X6CF 1RVFH 5FM5M 1YNTB 3QEUA 2DM4A 5DEGA 2YD5A 1NANH 3VD7A 3HE6D 1AD9A 5C86A 1BQLH 5I1LA 5GRZA 3RVXC 5EOCL 3FB6B 4IRSD 4PP2A 4PRHD 4IOSD 2X4TB 5MENA 2X4QB 4K7PY 4MLSA 1H3TA 4MWFB 2KQMA 1UM4L 3IU4H 1TZIB 3RZCA 3GUTA 4MAUL 1IL1A 3K3QA 1P5VA 1XCQA 4X5WB 1NGXB 4AQ1B 1I8MA 1H15B 1RVFL 2FWOA 3D85A 1R3HB 5TDPA 3ESUF 4K2UH 4TUOA 3CFCL 5KSUA 4LVNB 1P4IH 5I66A 5GS3A 1JPSH 3QEUB 2VDMH 5DEGB 1CDCA 2IAMD 2FX7H 4CDHA 1WISA 1RUQH 5I1LB 2UZYB 4HH9B 4PP2B 4EIGB 5AUMA 3K8LA 3ZE1E 5MENB 2GT9B 5DJCA 4NT6A 1EO5A 1W72H 1FFOA 3RZCB 3TVMD 3GUTB 5EU6D 3LHPH 5EIQA 1A4KA 3VFNA 3H7LA 1IL1B 3HKFA 1I85A 1XCQB 4DFIA 1KENH 1I8MB 1CZ8H 3HMWH 2FWOB 3D85B 3UC0H 4G3YH 1SM3H 4OFDA 5J13B 4RMRA 1JPSL 4CN1A 4TUOB 5KSUB 1LP9A 2VDML 2VH5H 2C1OA 5I66B 4PJ7A 1AH1A 2FX7L 3ARWA 1RUQL 5EA0H 5T33H 3CLEL 4NZTL 1AO7A 5TH2A 3MBED 5ADOL 5D2LA 5AUMB 4OCXL 1W72L 2I9TA 3P0VL 3LHPL 5DJCB 4NT6B 2L7UA 1JGVL 1FFOB 2N4IA 1A4KB 1KENL 3VFNB 1GOGA 3HMWL 4G3YL 1SM3L 2WMPA 1CIUA 3GI8L 4CW1A 4FQXA 4JFDA 3F62A 3ZKXB 2XTJB 4JFXA 2VXTH 1UACH 2VH5L 1IJ9A 3F7QA 2AJXL 4H1LA 3EOTH 1LP9B 1O7SA 5EA0L 1ZHBA 2C1OB 5HD8C 4H88H 4PJ7B 5ESAA 2WAHA 5T33L 4WJ5A 1MJ8H 4XWOD 3QUXC 4I3GA 4UV7L 1KJ3L 1ROWA 3IFNH 1NUGA 1AO7B 5TH2B 3T3PF 1WWCA 5D2LB 4J3OC 4UILH 5BS0A 2I9TB 2Q86A 3QNYA 4OJFH 3CDFA 4U7SA 3MV9A 3SQOL 2VXTL 2ESVD 4FQXB 1UACL 4WI9A 4CW1B 1I3RA 4JFDB 4JFXB 4H88L 4BQ6A 4H1LB 4Y4KC 1MJ8L 4HLZH 3JV6A 1ZHBB 5HHQA 5ESAB 1MHPL 4WJ5B 5IFAL 1NCWH 3IFNL 4UILL 2EEBA 1T1WA 5IHLB 5BS0B 4OJFL 3CVHL 1JJUA 1UB5A 2Q86B 3QNYB 4KK6D 1I1AB 4PJCA 3MV9B 5C0JA 1WAAA 1I3RB 5AYQA 4YHPA 5IBUG 3KPTA 4I13B 1LO3H 4HG4K 3JV6B 5HHQB 4KHXH 4Q2ZA 4Q74A 2R0ZL 4NO2A 1W8OA 2NCMA 3BMVA 3PXJA 3SGDI 2EO1A 5D4QA 1DP0A 1JTPA 1D6EA 1T1WB 3MX0A 2QADB 1S3KH 4OZHF 1JNHA 2LU3A 4MNGE 1C8PA 4DKEH 1UB5B 4UUJA 3RUGF 3NCYP 1ZV5A 3EHBC 4F3FA 5J6GA 4PJCB 1QSFD 2NX5D 5FGBC 5C0JB 1LO2H 2VDRH 1I8LA 4YHPB 4XPAH 1LO3L 2YUXA 3LDBB 4KHXL 4GMSH 1QSEE 2YA2A 2E7LA 5J1SC 3GSXA 4Q2ZB 3O3AA 4RRPG 3WSQH 3FL7A 3EOYG 4NO2B 4OI9A 4GSDH 1B90A 4X6CE 2HFTA 2CIKA 1MIEL 1D6EB 1B6DA 1GC1C 2XZCH 4PJGA 4DKEL 5C6TH 1JNHB 1EVUA 4FG6D 1YNKH 4UUJB 3M17A 1LO2L 4F3FB 1UQSA 2VDRL 5J6GB 4XAKE 5I15L 7CGTA 3OPZH 4QHNB 3EDEA 4XI5C 4N8PA 3BPOC 1JPTL 1IGIL 2W9DH 2BZDA 1CDHA 4ZS7H 4OF0A 2QJDA 3TN0B 4E42A 1H3XA 3GSXB 3O3AB 2O93L 4ZFZA 1U8KA 1BBDH 5HI4C 1Q1JL 1LP9F 2B4CH 1GPOH 2XZCL 2CIKB 3BT2H 3OKOA 5BW7A 3B83A 4X4MA 1FLRH 4JHAH 4PJGB 3WIFA 4PRNA 3OGOE 5AAWA 1EXUA 3M17B 1FIEA 4LNVA 4PJ9A 1S9WA 3O6MH 3MO1A 3DECA 1P84J 4XPTH 2YD1A 4KHTL 4E42B 1IMHC 1QYGH 4XCYA 5I1CH 4ZFZB 1U8KB 5L9DH 1FLRL 4JHAL 1A7PH 4EI6A 3OKOB 3BZFA 4Y5XC 3WIFB 4PRNB 4OIBA 3ARGA 3R8QA 1EXUB 2FX8H 1VEOA 2GHWB 3O6ML 3OR7A 4DGIL 4MYWB 4ETQA 1CLOL 4RBPK 1RK1A 4PJ9B 1S9WB 1EIBA 2UZIH 3D3VD 4DFHA 4NO3A 3MO1B 2A6KA 3BRDA 5B4MD 1KCRH 1QYGL 2D0FA 3I3DA 5I1CL 4PGEA 2CUIA 1VFAA 5DGQA 4XCYB 1TZGH 4J3UA 4TVPD 3RVTC 2XICA 3X3GH 4O5LH 4EI6B 1KELH 3S37L 4QXUL 2FX8L 3SGEH 3WLBA 3PJSA 5IW6A 3ARGB 1HCFX 2UZIL 5EU7E 4ETQB 3T3PE 1RK1B 5IFJA 1AR1C 4NO3B 3TT3H 1DBJH 4O4YH 2YEZA 5HGHA 2A6KB 1TZGL 4PGEB 1VFAB 3LQMA 3X3GL 1KELL 3E0GA 1SY6H 3MLVH 3ZE0F 3B8SA 1O0VA 1RZGA 5D71H 4J3SA 4XNMA 1REIA 3C5JA 3SQBA 3WLBB 3PJSB 5IW6B 4NRXA 1OL0A 5D1XD 3TT3L 5A2JH 1DBJL 2P48B 5EBWA 3ILPA 3OKYA 5FUCE 2YEZB 5K59F 5HGHB 1SHMA 3S3PA 4BSJA 3VGAC 2NW3A 4ZS6D 3RX5A 5ETUA 4JQXA 2VLRD 4NQEA 4PB0H 2VKWA 1RZGB 3TBTA 4XNMB 5DT1L 4HC1H 3C5JB 3O2DL 4UIKH 4NRXB 1PGRB 1EO8H 3FQXA 5J4MA 3BH8A 2EC8A 1OQXA 2CDEA 5EBWB 3ILPB 4OZHE 1NDGA 1U91A 2IF7A 4NM8H 3D1MC 4IIQC 3RUGE 3U36A 3C09B 5I73C 1EA9C 5J7CC 3MRGA 1JYNA 1P7QD 2NY2C 3IKCA 4HWBH 4XPFH 2ZUXA 2NW3B 3MV7A 2X9WA 5JUEH 5ETUB 4Z7VF 3DX7A 5F3HA 2J5LB 4PB0L 2DQTL 1AI1H 4NQEB 4EN3D 4UIKL 3TBTB 4Y4FA 3WDIA 4PRPA 4POZD 3FN9A 3N9GH 3FQXB 3B9KA 3MQIA 3BH8B 4NM8L 2CDEB 1NDGB 1U91B 4N8CH 4JRYE 3I3EA 4WI7A 2B0SH 4HWBL 2ITDA 3PL6C 3U36B 2Z35A 1CDYA 3IRZA 3MRGB 4J3VA 3IKCB 3LQZB 4OTXL 5JUEL 3AU1A 1VERA 1S78D 3DSNA 3DRTA 3MV7B 4NUJA 3GSUA 4JM4L 1AI1L 2E6PA 4U1MA 3DX7B 5I1KH 4MS8C 5F3HB 4FFVC 4HGMA 1BD2D 1URLA 1G0YR 5J1AA 2XTJE 4Q6YA 5F7NC 1Q9LA 3TJHC 4JO2H 4Y4FB 3SOBH 4PRPB 4QRQA 1LP9E 3MBXH 1A3LH 4JY4A 3B9KB 4N8CL 3KPSB 1G7LA 5FOBA 3SCMD 2B0SL 1AO7E 3OJVC 4RGNE 2ITDB 3KPQA 2Z35B 2BMKA 2RB8A 3AU1B 1TQCC 1ZLWK 3S36X 2Q1EA 5I1KL 3DRTB 4NUJB 3GSUB 2F58L 3E2HB 4LLQA 5ICZA 4KUCF 3U0TA 4U1MB 3FOMA 2AJYH 1YYML 2HWZL 2Z8VC 3UBXA 1TFHA 5KSAD 5J1AB 4XP1H 4NQDD 1Q9LB 4YLQT 4G8GE 3MBXL 5HYSG 3UYRH 4QRQB 3ZMRA 2Z8SA 4TQEH 4TVSa 1ZA6A 3TF7C 2BX5A 4JY4B 1N26A 1G7LB 5E94A 5FOBB 3O4LD 3EZ8A 3RHWF 1V5JA 2CMRH 2Y07H 3VCLA 5TFSH 3KPQB 5BS0E 1ZVSA 2BMKB 2BHYA 4NRYA 5MI0B 2A83A 1T6WA 3N06B 3GSOA 4LLQB 5ICZB 3U0TB 1UCBH 3ZL4L 3FOMB 3ZKNC 3UBXB 1T7WA 3UYRL 5I9QB 1DQLL 4TQEL 3T8XA 4JVWA 3WNLA 3MFGB 1INEH 1Q9WA 1ZA6B 1K6QL 3W0WA 2CMRL 5E94B 2Y07L 4P23A 2Z8WC 3HNVL 5HYQA 5TFSL 2GITA 1Y18A 1ZVHA 3VCLB 1OAUH 5DC0A 2N56A 3VW3H 4S0TD 1ZVSB 4NRYB 4YHKH 2G9HA 5K9OA 2A83B 3PGCA 1DBMH 1UCBL 3I9GH 3GSOB 5IIEA 3SE8H 3WMSA 3UPCA 5GS2H 3GNMH 1XGQB 4PR5A 5FYKD 1I75A 3T8XB 3MC0A 2FD6H 3WJJC 1GVIA 1Q9WB 4IDJH 4CAGA 3ZE0E 4PLNC 3W0WB 4WW1A 4P23B 5HYQB 4IOFC 1OAUL 3VW3L 4YDLC 1OAKH 4YHKL 2GITB 4XNZB 2J2ZA 1Y18B 3CMGA 4JHZA 5I30H 1DBML 4LLVA 3B3IA 3I9GL 2AK1L 2G9HB 3V8CA 5K9OB 1A7OL 3PGCB 4M1DH 3PDGA 5IIEB 3G6JA 5DD1L 5K59E 5C09A 4C4KO 5CIPA 3JZ7A 3HE7A 4R7DA 4PR5B 4ZOAA 2FD6L 4JRWA 1P53A 2XNAA 1V3JA 4H25A 3VFRA 4ZPTA 4OZ4A 2YD9A 4WW1B 2Y36L 5DLMH 2DKMA 5I30L 4HWZA 4R4NC 1JYXA 4AQOA 3HMXH 4LLVB 5CSZA 4ZG1A 3B3IB 4M1DL 1R3LA 2L4OA 3WN5A 3ULVH 4N0CD 4QXGL 3DX9A 5C0AE 3G6JB 5TE4H 5C09B 1MELA 4WFFE 2EYTA 5CIPB 3LS4H 3HE7B 4R7DB 4LLWA 3BO8A 4AENA 1CXIA 2XNAB 1KPUA 4H25B 4Z7VE 3WIIL 3VFRB 4ZPTB 1FNEA 2D0GA 4OZ4B 3S97C 5DLML 3CXHJ 3T0DA 1JYVA 1G7MA 1E4KA 3HMXL 3QPXH 4FG6C 4JKMA 4UTBH 4HWZB 4X4ME 3VFUA 5KOMC 1RAMA 5CSZB 1XIWD 3ULVL 1R3LB 1NJ9A 1T80A 5CLTA 3SPVA 3DVIA 5TE4L 3WN5B 4X9IA 3DX9B 3LS4L 1SYVA 3NOIA 2EYTB 4LHUG 4LLWB 3BO8B 2PR4L 4OQTA 1KPUB 1A6TA 1ND0A 1VCAA 2NMSA 4JFHD 5CZKA 2KH2B 4UTBL 1FORH 1G7MB 2NLJA 4KI5D 3VMNA 4HEME 1UVQA 4HQQH 3JV4A 3OKNA 3VFUB 1QLFA 1RZ7L 1P4LA 1KSRA 2V2TA 1DCLA 1NJ9B 3GIZL 3UAJD 3SPVB 5I71C 4JM2A 3E1F1 4RISL 5FAAA 1V3MA 1MFCH 4N1CA 1SYVB 3TWCL 4D2NA 4KQ4L 2OQJA 3LKRA 1ETZA 3BRGC 5D7JC 4LU5H 1ND0B 1A6TB 1FORL 3V4UH 1N5YL 2YUWA 1IC7H 3CLFH 5FDYA 4WFHD 2NLJB 1UVQB 3JV4B 3OKNB 4V2CB 3NCBB 3NFNA 3WNOA 4ENED 1ADQA 2RR3A 5E0QA 1QLFB 1SYSA 2OZ4L 3ET9F 4FFWD 4NP4H 3NPZB 3QUZC 4XVJH 3FRUA 1P4LB 2V2TB 4HXAL 2XACC 3MOAH 1MFCL 2D9QB 1F3DH 2ITCA 4JM2B 2O5XH 2C4FT 2XZZA 1B2WH 1RFDH 4KJWD 4K3GA 4ZXBA 4LU5L 5TQ2H 2OQJB 3LKRB 1ETZB 2WWMD 3LQAL 4RX4A 3V4UL 3VFTA 2HN7A 5K9QI 4R0LA 1IC7L 2ZUQC 2EXWC 2BK8A 5F6IC 3RU8H 4WIQA 2R29H 1H3UA 3F7PC 1MCOH 1ZHNA 2AXFA 4NP4L 1K85A 3GB7A 3NFNB 1SYSB 1RZKH 3V7MA 4P0DA 2NTSP 3FRUB 4I1NB 4HUVA 1RFDL 2ITCB 4JKLA 5GGUA 5BV7B 3E8UH 1UKTA 4PB9H 1RMFH 3K7UA 4L3ED 4NQVA 4ZXBB 5HHMB 4BYHA 5LJYH 1XT5A 1OQOA 4UMGA 5DUMH 3G6JF 1TPXC 4WVRA 4WI2A 3VFTB 2HN7B 3CDCA 4GG8A 4RNRA 2P43B 4R0LB 3RU8L 5CJOH 1UWXH 4KKNA 3DV6A 3DOSA 4ODWA 4LAQL 3HR6A 2F8OA 1ZHNB 4NQEE 2AXFB 1RZKL 3L6FA 1KXTB 3GB7B 3RNKA 4Y2OA 5L88H 2R1YA 5C07A 3LD8C 5E56A 4HUVB 3E8UL 1G6VK 2G60H 1RMFL 1R5VA 3QDJD 5GGUB 4R4BA 3THML 2W38A 2QR0A 4NQVB 1VPOH 1ZT1A 3DLQR 4M6NL 3T09A 4L5FL 3RTQD 5DURD 5CJOL 3HRZA 1I9IL 1GZPA 4GG8B 4JFEA 4RNRB 3TH3T 2ZUWA 1JNLH 1HNFA 2HMID 3DV6B 3UBXI 4ODWB 4AIOA 4HLJA 3KPOA 5E4IA 2VDKH 3KAAA 3L6FB 1YMMD 3V2AR 2LFGA 3RNKB 2G60L 4PJ8A 2R1YB 1BMGA 3QIWD 4X7TA 1GSMA 4MA1C 3RKDC 1R5VB 3OAYK 4CDGC 3A67L 4R4BB 3O9WA 3FO1A 2DWDA 2QR0B 1BX2A 2YD6A 2VDPL 3RVVD 4ODTH 1AQDA 2D7OA 2EDWA 3HRZB 2EDNA 4C56D 1GZPB 4HUNB 4JFEB 1JZ3A 5CP3H 2KL6A 3ARTA 2VDKL 2EC9U 5ERWA 5IB2A 4LSQH 3KPOB 5KZCB 1QQDA 2VISA 3L5JA 5DRNA 2FBJH 4PJ8B 3KPLA 1RSFA 5D70H 4X7TB 5IVNA 2H8PA 4GKSA 3QRGL 4JFOA 5GISH 3CD4A 3FO1B 3O9WB 2DWDB 5DMYA 1BX2B 4ODTL 3VWJA 1UFUA 4JM2F 2WW8A 1N2RA 1AQDB 3NCCB 4KROB 2A2QT 4NQCD 5FGSA 1X3DA 2HJFA 3FQWA 5A2KH 3DURA 2HYMA 2AEQH 1NCTA 3NZHH 5DR5H 5ERWB 5I6XB 5IB2B 1I7ZA 2FBJL 2AABH 2AI0L 2DOCA 5D70L 3KYKL 4NIKB 2VISB 1DZBA 3I6GA 1LK3L 3KPLB 4R97C 5GISL 3ZKMC 1QFWH 2H8PB 4GKSB 1K8IA 5F7LB 1A2YA 3W11D 3OKKA 3VWJB 2IFFH 2YRLA 1X5IA 1N2RB 1OM3H 5EO9A 1GZQA 2EZ0D 1MCCA 3DO3A 2XTLA 2AEQL 5DR5L 1A0QH 1JTTA 2HJFB 2HRLA 3DURB 3H8NA 2Y6SC 3UTTE 3IFOA 1L9MA 3UO1L 1I7ZB 1BECA 1MCHA 2ZWLT 4MB4A 1QFWL 1I8KA 4AJ0A 1T7VA 3I6GB 4ZUTA 2EE9A 2J12B 1HWHB 2OTWA 5CGYD 1EHNA 5M94B 1DEDA 1K8IB 1A2YB 4YDIH 5E08L 2AV7A 3N50A 4NFBA 1BGXH 1JZ6A 4Y19D 3C6LA 3OKKB 1OM3L 1MQ8A 3T3MF 5GS0D 2B4CC 3S5LG 1UENA 5EO9B 5JOPE 1GZQB 3HNTH 1YN7A 1A0QL 2VZTA 4AYFA 5JPMA 3RJDA 2GEEA 3Q1SL 4HBCH 3QDMD 3IFOB 2XQBL 4ZOBA 4PGDA 1Q94A 1HSAA 3WNMA 1HSBA 1FSKB 3P4NA 1I8KB 3LB6C 4HGKC 4YDIL 4W4NA 4JREB 4DEPB 3KWWA 1QA9A 2FL5A 1BGXL 3B6SA 3MJ9A 2AV7B 5HYJE 4R9HA 5FYLE 3C6LB 1SBSH 4G9FA 5LGHH 2EEDA 3HNTL 5I1AA 1YN7B 3T2QA 1HDMA 4YJZL 4KWUA 5DWUH 2XFXA 4HBCL 5JPMB 5DK2A 1IM3A 3M1BA 1DQDH 4LSTH 3G6JE 4KDWA 1I3GH 1NCAH 3ARFD 3B43A 4PGDB 1Q94B 1HSAB 4JDTH 4U6YA 1HSBB 3P4NB 1H3GA 1QA9B 2FL5B 3KWWB 5GRXG 4YXLH 5GZOC 3L5WA 3LRGA 2DKUA 4G9FB 3PABA 2R56H 5I1AB 4I3RH 2Y7QA 2NR6D 4P2RE 4UNTA 3P2TA 5DWUL 1DJSA 1P6FA 3VG9B 4HJJL 5ITFA 1HDMB 4NZUH 5F9OH 1DQDL 2XFXB 4LSTL 1LEKA 2L7JA 4BZ1L 4R7NA 5DK2B 1IM3B 3M1BB 1NCAL 2OSLA 3NA9H 3ZTJH 4P5KB 4JDTL 5CD3A 4PJFB 3GSNA 2IPUK 3IKKA 4WHTA 2UWEA 4U6YB 4YBHA 5DHVB 1S5HA 1K5NA 1AY1H 4M1GH 4MVBC 2D9CA 3WE6A 3L5WB 4I3RL 4LNRA 2D0HA 4KQ3H 3PABB 2Y7QB 4NZUL 5F9OL 3P9LA 5ITFB 4WUUB 2BVPA 1LEKB 4GAFB 4R7NB 3SDAD 5JIKA 4KK9D 2OR9H 2OSLB 5HPOA 2ZCLH 4Z0BH 5IHZB 1JNNL 5CD3B 1DN0A 3GSNB 4XH2A 3K80A 4WHTB 2UWEB 3UTSE 1S5HB 1AY1L 1K5NB 4M1GL 4LOUC 1MCKA 5CHNA 4M00A 1MCWW 3WE6B 3EFDH 1MJJA 3RIAF 5IMLA 3EYQC 4LNRB 3DGCR 4GLRI 4XBGA 3TA3A 5JW3H 1E4WL 3DI3B 5AD0A 3QIUA 3P9LB 3O3EA 2ZCHH 4OLVH 4QCIA 1OP9A 2K9UA 2BVPB 2ZCLL 3DUSA 4Z0BL 1JGDA 2A77L 5A43C 1NFIA 5AYUL 1J0ZA 1DN0B 1SEQL 1VB9A 4XH2B 3MGAA 1XF2A 2AK4D 5BRZE 1T1YA 3AMLA 1D6VH 4KKAD 3DV4A 5CHNB 3MGTA 3K1DA 5JTWA 1G9MH 4Q9RL 5JW3L 1MJJB 5IMLB 4XBGB 3TA3B 1KOAA 4Y5YA 2IG2H 1ZS8A 2ZCHL 4OLVL 5AD0B 4HGWA 5D1QD 3QIUB 3O3EB 3DUSB 3SY0A 5D96B 3TO2A 2ARWA 2NXYB 1JGDB 4KRLB 4PJAF 1WTLA 3G08A 2VL5A 1NFIB 3CZFA 1KPVA 3TNNA 2XWTA 4AEFA 5HHME 2BC4A 2DQUH 4GS7C 2R8SL 1D3CA 1D6VL 1XF2B 5FV2A 3U46A 1WICA 1T1YB 1KF9B 1G9ML 3ZYIA 2B2XH 2G5RA 5I1DA 3DV4B 1RJCA 3VG0L 3MGTB 2XA8L 4K3EL 3E3QC 2BHZA 3A6BL 2IG2L 5FYJU 4OD3H 4Y5YB 4RGMB 1ZS8B 4MCYA 4XAWL 3ARBD 4JG1H 4HGWB 4P49A 5GGSY 3WIHA 5KTEL 2R1XA 3SY0B 4NBXB 3TO2B 2Y9RT 3T3ME 2DQUL 2ZNXA 1AP2A 3G08B 2VL5B 2FEEI 2VR4A 1KPVB 4OCLC 3SGKC 2XWTB 3TNNB 3D5OF 1LD9A 2BC4B 4ZUUA 1JTOA 1D9KA 2B2XL 4WWKD 3WS6C 3U46B 5L8JB 1QP1A 5I1DB 2NY3C 3MOBH 4RAUA 1J88A 4PY7A 4MZ2A 2EICA 1F13A 3ZDYF 4NFDA 3FQUA 4MCYB 2FGZA 4Y4HA 5IESH 1OSPH 2DQCH 5C07E 3G5XA 2R1XB 1A3QA 2HFGH 3FJTA 4ZUWB 1AP2B 4S0SD 4O2EA 3MLRH 1LD9B 4ZUUB 5E7BA 1D9KB 4GW1A 3MOBL 3Q3GA 5HHPA 3GJFK 4OKDA 1TLKA 1QSZA 3O8XC 2VZVA 1CVSC 4EI5C 2DQEH 4JFEE 2NY1B 1AQKH 4XVTH 4RAUB 4UT6H 4PY7B 3AM8C 2C26A 3V0WH 2ERJC 3QFJD 4OGAD 5IESL 4U0RC 1OSPL 2DQCL 3M8OL 3FQUB 4NWTL 4Y4HB 4U6TA 4EUPH 2F53D 1EFXA 3G5XB 3X3FL 2YXFA 3MLRL 1J05A 4PFEA 2BY0A 4TSAH 4O2EB 2X44D 5H8DA 2APVA 5HVWA 3UZEA 1AQKL 1H5BA 3Q3GB 4GW1B 4XVTL 5HHPB 3ARDC 3GBLA 2JIXA 3V0WL 3PDDA 3TIDA 5C0BD 5GRVK 2WINA 3L9RA 4N5UA 1NUDA 3QIWC 5J11B 2IBBA 3JUZA 4U6XA 5EBLA 5D1ZA 1EFXB 1MCJA 1TDQA 4OFPA 2V5MA 4DVRH 4TSAL 3VGBA 3WS3A 1Z3GH 1J05B 3DIFA 3LKPA 4BA8A 1J8HD 4U1HA 1K4DB 4JY5H 2QLVB 3SJVD 5DD5H 2OMBA 5FO9A 4UTAL 1H5BB 2WUCH 4NGHL 2JIXB 3UROR 4U49A 4WV1C 1I7TA 2V2XB 3TIDB 5JHDD 1HHHA 4CU6A 3BE1L 4P4RA 2WSKA 3LVEA 3L9RB 5HDQH 1NCNA 4NO0A 2NY0B 5E6IC 1ITCA 1RPQA 4GRLD 1MEXH 3IDNA 3C5SA 2YPVL 4U6XB 5D1ZB 5EBLB 4DVRL 1IEHA 1QD0A 1JGUL 4GH7B 1UT9A 4JY5L 3O41A 3DIFB 1JHLH 3WS3B 3LKPB 1MHHA 4U1LA 3CXDH 4U1HB 2QQNH 2WUCL 5FO9B 2J8OA 2BNQE 5DFVD 4V1DE 5HDQL 2ORBL 5C71A 1I7TB 2P42B 1HHHB 5DD6A 4P4RB 2OR8A 3IYLW 1ZE3C 1MEXL 3MUY1 3OG4B 3ULVC 4NO0B 4JQVC 3HE6A 3IDNB 3C5SB 1UH4A 4HT1H 3FO0L 5IP4A 2LAGB 4IRSA 4W68A 5HGDA 4PRHA 1KJVA 2QQNL 4Z7WA 3O41B 4Z76A 2VQ1A 3AROA 3QQ3A 1MHHB 4U1LB 1IQDA 3OHXA 2EDKA 4GFTB 4PJAE 3VU2A 1CTOA 3BYTA 3VXPA 1CICC 3KPMA 4MA8H 4NZDA 3OZ9L 4ONHB 2XN9D 5DD6B 5GZNC 5KAQF 1SEBA 3OAZH 3JVGC 4HT1L 4MJID 1TXKA 3HE6B 2IAMA 4G8FA 4O51A 2Y5TA 4PJ5E 4F37K 4K71B 5IJKA 4IRSB 1YQ2A 4PRHB 1KJVB 4YEFA 4Z7WB 4Z76B 3T4AA 2VQ1B 3QQ3B 4JVUA 3TVMA 1IQDB 4G9FE 5EU6A 2JJWA 2JKXA 3A6CH 4M7LT 3OHXB 4LLYA 3IAGC 1BIIA 4MA8L 5DUPH 5C08E 1S7UA 4AZ8A 3VXPB 1QVOA 3KPMB 5DTFA 4WTXA 1BFTA 3WFBH 2UVFA 2AXHA 4H1LH 1A5FL 5FOJA 1XGPA 1FCGA 1SEBB 2YUZA 2E7BA 2IAMB 4Y1AD 3SDDC 4G8FB 1C5DA 4O51B 2Y5TB 3MBEA 2W60A 3T1FA 3ZDYE 2HVKA 1XCTA 2EIDA 1A6ZA 1AKJD 3T4AB 1ES0A 5BMFL 3TVMB 5DUPL 3JWDC 5EU6B 5JPNB 1OP3K 3DWTA 3VXTA 3T0XA 4LLYB 1BIIB 3NIGF 1S7UB 3VWKC 3L5XL 3WFBL 4P2CG 1QVOB 5ACZA 5DTFB 2E27H 2CD0A 2RGSA 3PQYD 1XGPB 1UZ6F 2UWEE 5DMGD 4LSSL 1C5DB 1KB9J 3MRQA 2HVJA 3MBEB 2W60B 3T1FB 2HVKB 1E28A 1ULVA 1XCTB 3FT2B 1A6ZB 1FFNA 4PD4K 3FN3A 1ES0B 3PIQA 2CPCA 2I07A 3VXTB 3EJZD 3KLSA 2ESVA 1FZOA 1W0WA 3PHOB 2E27L 5ACZB 4QNPF 3TFKC 4R90H 4FQQA 5C0DA 1HHGA 5BQ7A 1HKLH 5HVHB 4ZTPH 5EBGA 3JWOC 1KBGH 2LQRA 2IALA 2BRRH 3SBWA 2MWCA 2NZ9D 3MRQB 2HVJB 4ZFOL 1EEUA 3SKJL 1E28B 5A3IC 1FFNB 4QTHA 4HJ0C 3PIQB 4X7FC 2I07B 2A0LC 3U0WL 2ESVB 4OUUB 1FZOB 1W0WB 1MHEA 2K1MA 3G9AB 4HUXA 4M43L 3UPAA 4R90L 2OL3A 4LPTA 1HKLL 4JN2A 1BFVH 2I9LA 4ZTPL 5FHBL 2B5IB 1J1XL 2FYYA 1KBGL 4FQQB 5C0DB 1HHGB 1Q72H 2BRRL 1F8TH 4QRPD 2IALB 3WKMH 3ROLA 1QTYT 1MCIA 1I7UA 4XVUD 4RAVA 4H0HB 1UADC 2R1WA 5B3NA 5DD0L 3BSZH 1FNFA 3M45A 3CSPA 3ELAT 4FQLH 2EIZA 4OLYH 4QTHB 4PBXA 4K7PH 4Z7WF 3D6GA 1QSFA 2NX5A 4OZGB 5IB4A 5JQ6H 4IS6A 4HUXB 2OJZH 1G6RA 4J7RA 4XTRD 2OL3B 3BISA 5TGBA 1YY9C 4JN2B 3KLHD 2I9LB 3HAEG 4U6VL 1Q72L 3QUKA 1F8TL 2FZ3A 3MV8E 1S9VA 3WJLA 3ROLB 3BSZL 1WFTA 1I7UB 1X5KA 4RAVB 3ORJA 2R1WB 4FQLL 1ZTXH 4OLYL 4K7PL 1I9EA 3D9AL 5D1QC 2R0LL 2EIZB 4ZAKC 3VGHA 3VFPA 5JQ6L 3ALWA 1QSFB 2NX5B 2OJZL 4J12A 5IB4B 4IS6B 1G6RB 3DX8B 1WZLA 5TGBB 2R2CA 2UY6A 2YD8A 3QUKB 2DMCA 5E1HB 4LSRL 1F2QA 3P11H 1PG7X 3NGBB 4HK0A 3QQ9D 2FZ3B 1NCDH 2HFFA 1TNNA 5F8RC 1S9VB 4PLKD 2WNGA 2OTPA 2HLAB 4Z78A 1CF8H 4M9PA 1WWAX 3VFPB 1ZA3A 1VHPA 3N1QC 3DYOA 4HMEA 1EZVX 2D7TH 5J06A 3ES6A 3ARED 3G6DH 4GXVH 4NBZB 4ZNCD 3P11L 1RZJH 4WWKC 1X5HA 4ZDHA 5JR1H 3T0EC 2HTLC 4HK0B 5DO2D 3T0AA 3V6FA 2HFFB 5E8OA 2YK1H 1DEEA 1LDSA 4OCMC 1CF8L 2QL1A 3GMPA 4XP4L 4Z78B 4OQ1A 2ZKHH 2P1YA 1MF2H 4PG2C 4DUVA 1NC4D 2VZ1A 5GPRA 1ZA3B 4JFPA 1OTSC 2C4XA 4YQXL 1G0DA 4ZSOA 3ES6B 5FYJE 5JXAH 2RFXA 5EFIA 2PN5A 1RZJL 3BN9D 3FMGH 5JMRA 3A6OA 3MREA 2VWEC 4PY8I 3U1SH 3RDTD 2YXMA 4ZDHB 4UB0L 3NIGE 2YK1L 4JPKH 3QFDB 1U8JA 2R4RH 3V6FB 4P57A 5E8OB 4DK6A 5LGKA 4TNVF 1YQVL 2VXQH 1DEEB 2ZKHL 1OCWH 2FBOJ 2WK2A 4DWHA 3DO7A 3GMPB 4OGAC 3UYPA 4MAYD 1UZ6E 1T66C 4LKCA 4FNLH 4JRXE 4HKZA 4TNWK 2MSPA 5JXAL 2DLGA 1SQ2N 3D25A 1IM9D 2FJGA 4JFPB 4U1NA 3D69A 4ZSOB 3D3VB 5E7FA 4H20H 4KY1H 5F9WB 2RFXB 5EFIB 1ZLUK 3U1SL 1YPZA 2HJKA 4AG4H 5J3HD 3MREB 3HAEA 4ELMA 4WDIA 1Q38A 3REWA 2EIBA 2GJZA 1BFSA 1U8JB 4P57B 1OCWL 2EXYD 4QNPE 5HI3D 4U2YA 3V0VA 4D8PA 1WUNT 3DO7B 5F6IB 4FNLL 3SGJA 5LWYH 5F89A 4RMUA 3IDGB 3ARVA 5D1XA 3GDBA 4BUGA 1JWSA 4KY1L 2GI7A 3D25B 2FJGB 2E6QA 4U1NB 3D69B 2F5AH 3QCTL 2DQDH 4OLWH 1YPZB 2HJKB 4WENB 1OAXH 4UOW1 4ZUSB 1P9MA 3HAEB 4ELMB 4WDIB 3MRJA 3SO5A 35C8H 3REWB 4HXBH 1J12A 1G9NH 2GJZB 1TPXB 2AEPH 2JJTC 2VLME 3LV3B 2VLRA 3EDKA 4D8PB 3DNKA 1ACZA 5LWYL 3RWJB 5D93B 2Z31C 3V4PL 5F89B 3K4AA 3ARYA 3Q6FB 1CQKA 1VEPA 4OKVB 1IAKA 3M07A 5D1XB 2F5AL 1BF8A 1JWSB 2DQDL 5CEZE 1PZUB 3KJ4B 4GQ9L 2YD4A 1OAXL 4GXUM 2VLLA 35C8L 3BPNB 1H0DA 5KANG 4HXBL 2BNRD 3GJEA 4Z7WE 1P7QA 3MRJB 4AMKH 5FXCH 4C58B 1J1OH 1UC6A 3H9SD 4LAJH 3ESVF 2VLRB 4CMHC 5HJ3A 4EN3A 2J88L 4DN4H 4Y5VC 1BJ8A 1KIPA 3HZKA 2O5ZL 1HXYA 3RJQB 4PP1C 3T2OA 1IAKB 2GJ6E 2HTKC 1I7RA 2DIBA 2MFNA 3PWLA 4MA1B 3B2VH 3KNBA 25C8H 2VLLB 4PLJD 4CJ0A 4LVEA 1H0DB 1CFBA 5H37H 3GJEB 4WU5A 4J23A 1P7QB 4GKZA 4Y2DD 1UKQA 4GKOA 4DN4L 4H8WH 3NIDF 4PS4H 1YEIH 1BD2A 4OIAA 4EN3B 1LO4H 5IUSA 1GOFA 1KIPB 3HZKB 1HXYB 1RUAL 4K9EH 3U79A 5JMOC 3VMPA 4TPRH 4XX1E 1PAMA 2XQYK 1FGNH 1EJOH 1I7RB 4YR6A 1FQ9C 4PGBB 3SCMA 3U30C 2IQAA 1QBLL 1MHCA 3W5NA 3PWLB 3PWPE 4HAGA 3RPIA 1J0KA 3KNBB 1OP5K 3CJJA 4RAHA 4D9RD 5EPMB 4WU5B 1Z9SA 4GKZB 1CGTA 3OQ3B 4H8WL 1FYTE 4X9BA 4OB5H 1YEIL 4OZFA 3HG1E 1A6VL 4QEGA 1LO4L 3BGFC 4S1RH 4JB9H 1IILE 1BD2B 5C3LD 5EC2A 5CKGA 3WO4C 3VI3F 4OGZA 1DQMH 5KSAA 2F54E 4TPRL 4WW2A 3ZKSD 3BP4A 1S5IH 1FN4A 2VO5A 3LH2L 4ODUA 1FGNL 4XB7A 1EJOL 4JKWA 4B5EA 2KDGA 4YR6B 2IFGA 3O4LA 3SCMB 2MOVA 2GK2A 2IQAB 3O3BA 4JPWH 1MHCB 5FO8A 1KJ2A 3RPIB 3SO3B 3QUMA 3J8F7 4PJDF 4I77L 3AFLA 2DQGH 4FN0A 1TCMA 4HS8L 4JB9L 4M03A 4OZFB 1TVBA 5E95B 1MOEA 2WWKT 4WY7H 2ESVE 5EC2B 1J1PL 5KSAB 1JZ4A 2EDQA 3N0PB 4WW2B 4NQDB 4MB3A 4YBQD 1IBGH 1LE9A 1FN4B 4ODUB 1KEGH 2R23A 1TVHA 4Z5RA 3O2VH 2DIJA 4FFYL 3IF1A 5B8CA 4JPWL 2N1KA 1JF6A 4AEEA 3O4LB 3KR3L 3NACH 4OD1H 2BNUA 3O3BB 5FO8B 1KJ2B 2KUTA 4O9HH 1KCUL 2DQGL 3QUMB 1AXTH 1NH6A 3HN3A 5GS1A 3VGDA 2VN4A 1CD8A 1OF2A 1TVBB 3PV7A 1JGEA 4UOJA 5TDNA 1IBGL 5CIPH 1KEGL 1A6PA 5D7IA 4M8QA 2F9BT 4JQIL 1LE9B 3VD5A 1HIMH 2VLJA 1E4XI 1TVHB 3VXSA 4Z5RB 2IJ0C 3WV0A 3IF1B 4U3CA 5B8CB 4OD1L 5FYLL 1A7RH 3BH9A 4Q9QH 1WT5A 1C5BH 2EDEA 2BNUB 1AXTL 1RULH 4RWHA 4LCCC 2NY4C 5CGMA 1MVFA 5E6ZA 5GS1B 1L9NA 2PXYC 1QBMH 1HK6A 1OF2B 1NLDH 2OK0H 4XB8A 1JGEB 1QSFE 2NX5E 5TDNB 4LSUH 3RAJL 1HIML 1BQHA 1HH6A 2E7MA 4M8QB 5D7IB 4X5XA 5F7YC 1U9KA 1NANI 1YJDL 1KLFA 5IROC 1ED3A 1U3HC 4GKNA 5CSBA 4AEHH 2IWGA 1NCCH 4KK5C 1C5BL 4LCWD 3EJJX 1EFQA 1RULL 3BH9B 5T3ZE 1QR1A 4M6MH 2YOCA 2Q8AH 1UJ3A 1D5BA 2XKNA 4XMPH 1NLDL 2MQ3A 2OK0L 5GGRY 4JAMA 4XTRC 1O5DT 2P8LA 3H9YA 3C60D 1ZT4A 1P4BL 1WWWX 3HZVA 1BQHB 1HH6B 1NCCL 4X5XB 4XC3H 4HPOH 4Z77B 1ED3B 4GKNB 3ALPA 1RJLA 4OQTH 4LSPH 4K94H 4QHUB 4X4YB 4M6ML 2Q8AL 5GS2D 5J8OA 1QR1B 2RJMA 4RMWA 4IMKA 4XMPL 1UJ3B 3QPQD 2XZQH 1D5BB 1XIWA 2XKNB 1QLEH 4JAMB 3H3BC 3AVEA 1MAJA 2P8LB 4LVNC 3G5ZA 1ZT4B 4X0KA 4XC3L 4HPOL 5MP6H 3HZVB 5I74B 1QFHA 3ULSA 5L8KB 5B39A 2OS7A 3ZT5A 4K94L 1RUPH 3NIDE 4HW6A 4HIJA 1J87A 2C1PA 1WQVT 4DQOH 5DRXA 5L6YH 4WTZG 2XZQL 3RZCC 4CADA 5C0GA 4JFFA 2VDNH 1QLEL 2LV4A 5EZJA 1XZ0A 1MH5A 1ADQH 1XIWB 3L1OL 2P7TA 3QXTA 2HT3D 2DS4A 4B50A 4KI1A 4QOKE 1A7QL 1CLCA 3G5ZB 4ZSOE 3KPRD 2YBRA 4X0KB 5C0EA 1BQSA 1RUPL 3ULSB 5B39B 2YWZA 5KOVC 2IH1A 4GBXD 3U7WH 4HIJB 3HLAA 2C1PB 3AY4A 3VI3E 1HHIA 4NQTA 5LVEA 2VDNL 2X1WL 5DRXB 3EW3B 4XP9H 4P4KD 4CADB 1KT2A 2EDDA 4QTIH 5C0GB 5I75B 1ADQL 5EZJB 1I85C 1XZ0B 1MH5B 4GLRH 4XPHH 2P7TB 3ZKXC 2XTJC 2D31A 5JW5A 3BN9C 2FRGP 4PJDE 1KYOK 3MRPA 5C0EB 2YBRB 2X4RA 3GKWL 1SVCP 1NEZA 4ESKA 3U7WL 3PHQA 1NBVH 2C4FU 1Y0LA 4G8EA 2IH1B 3G9VA 4RFOH 4XHJC 3HLAB 4S1DD 1FZMA 1HHIB 4QTIL 3QEGH 4L9DA 5SX4H 1N6QL 1QPPA 2EE2A 4FZ8H 3QDGD 1KT2B 5IMOB 4XPHL 2AAVA 3QNXA 3RGHA 2PUQT 3IETB 5HTSA 1JBJA 1VA9A 2D31B 4HEPG 5JW5B 1OSZA 3VH8G 1HYRC 3MRPB 4L3EA 4PRAA 2X4RB 1NBVL 4NKIL 1NEZB 1O7VA 5I16A 4RFOL 3MLYH 3PHQB 1Y0LB 4G8EB 4LEXH 3QEGL 1CGYA 5ANME 4FZ8L 1FZMB 1R0AH 5C1MB 1I1AC 3AM8A 5IT2L 3QNXB 5F7MC 3MUHL 3SKUD 3Q0HA 1G7QA 4YDJA 1J10A 1S9XB 4DZBB 5F9AC 2BHUA 4L3EB 4PRAB 2RQ8A 3T08A 4LEXL 5GRWA 4KJPC 3QEHA 4Y89A 3RTQA 5I16B 2H2PC 3HHRB 3BZDA 3KYNA 4PGJA 4RIRA 2QADC 3GFUA 4WTZA 4OCSH 1YMMA 1FPTH 4HK3J 3VXQA 4XC1H 5CZXD 2QBWA 4N5ED 3QIWA 4WNQA 2Z0BA 4U0RB 3BJLA 4HAFA 1G7QB 4FXKA 3QDJB 4YDJB 3LDBC 5GGRA 2IEPA 1QACA 1U2HA 3L3JA 2Y23A 4HD9A 2FEEL 1NAMA 4FABH 2X4NA 1CE6A 3QEHB 4P9MH 3RTQB 5DURB 5I1JH 3ZDXF 4BQ9A 4C56A 4CRPA 3KYNB 2VUYA 1KB5H 1IGCH 4OCSL 4RIRB 5DMJB 4MHHI 5IBTH 4LRIA 1BD2E 4XC1L 5F93C 1ZANH 1YMMB 3VXQB 4OGYH 3QIWB 1I8LC 1H3PH 4WNQB 2ZNWA 2D03L 5HHXH 4FXKB 2FGWH