4JFFE

Preservation of peptide specificity during tcr-mhc contact dominated affinity enhancement of a melanoma-specific tcr
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
245
structure length
245
Chain Sequence
b'MSQTIHQWPATLVQPVGSPLSLECTVEGTSNPNLYWYRQAAGRGPQLLFYWGPFGQISSEVPQNLSASRPQDRQFILSSKKLLLSDSGFYLCAWSETGLGMGGWQFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
molecule tags Immune system
source organism Homo sapiens
publication title T-cell receptor specificity maintained by altered thermodynamics.
pubmed doi rcsb
total genus 48
structure length 245
sequence length 245
ec nomenclature
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jffE02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jffE01
5CIPA 4FP8L 4BA8A 4HS6B 4PJXE 3EDEA 3RWFA 4L5FL 2VXSL 4PRHB 4IIQB 1OAXL 1ULVA 4XNQA 4KZEL 1LQSR 3TBWB 3MOAH 3WIIH 5DRXA 1V8HA 3N85H 5K9JH 5L9DL 1BD2D 4EDWL 4XVUC 3C5ZA 3QG6A 3ZDYE 5CKGA 4PG2A 3HZYA 2EEAA 1EFXB 4DQOL 2W60A 3ARDD 1RUPH 3QZWB 5IESL 3T4YA 3KNBB 2QQNH 4NWTL 2VLMD 3BXNA 3UTTD 4Z76A 3HZVB 1QP1A 2V2TB 4WO4C 1A7OL 4WIQA 4J12A 1RUAH 1X7QA 2KZ1B 5ICXB 5HYSA 4JPIB 1ZLVH 2QHRL 2CK2A 1RZ8A 5IVXA 3G04B 4C4KT 3TF7C 4K23L 1F4WL 3SDDD 1TDQA 4IIQA 3UTZB 1XGRB 5L0QB 1A7PH 2YK1H 1U93B 5C8JB 4XMPL 1TLKA 1QQDA 5F7NC 4IEFB 3DLQR 3DGGA 3KXFA 4QHNA 3TWCH 4YFEA 5IEKA 1EFXD 2HMID 5IB3A 5INCB 1PYWA 5DWUH 5B21A 1YEHH 3Q5OA 4WJ5B 1BQHG 1HHKB 4XNZC 1X5YA 3PQYB 4XWOC 5F7DB 1HDMB 3MRJA 4OAWA 5I1DA 3WLBB 2PCPB 4FRWA 3X3FH 1E4WL 4LPTA 1U8LB 4FQJL 4NIKB 4ZNCD 1DQTA 2ESVD 3DX7B 4U3HA 4JCMA 4ZO7A 1DBBH 4CMHB 2EYRB 4MHHI 4G7VL 4EVNA 2FIKB 4UINL 5DJYB 1HYSC 5JPNA 1DQDH 2YPKB 1U8IB 3IJHA 3STZB 1RIVH 3U0WH 3C8DA 2DWDB 2Y72A 3TPUB 2NY1D 5IBTH 4UNVA 1GC1L 3WLWC 5BV7B 1B0WA 3QXDB 2M1KA 4RQQA 5A3ID 4HIXL 3MLYH 4X6DB 1WZMA 3LOWA 3QEQA 2ITDB 3C6LC 3QEHB 4X6BA 3RIAK 5DGQA 1D3CA 4LLUA 3AMLA 4F8TA 3W0WB 2F53D 4GAJL 1VADA 2XY1A 1HIML 3GFUA 4YNYB 5F21B 3GIZH 2NLJB 2PR4L 2Z31C 4PG9B 3NPSB 4K55A 4QRRE 2DQHL 5E1AA 1FQ9C 3VGFA 3WNOA 5E8NA 1BMGA 4JPWH 4Z77B 2L0DA 1V7NH 2ITDA 4I2XA 1O0VA 4R3SA 2R0ZH 4YJZL 5DHVH 5GGTA 2OR9L 5EZOH 5BXFB 1OTSC 5EULV 5FUZH 2FATH 1F4XH 3OKDA 4HKBB 4KROD 5I2IB 1C5DB 2IPTH 1H3WM 4YXKL 4A2LA 2NY5L 2EXYC 1DBKL 4JY5L 4YHOL 5DHXB 2HAZA 2X70B 4G5ZH 3RGVC 2YKLL 1K3ZA 4X7SH 5L6YL 4NO0D 2WINB 4PFEA 5C0BE 1T1XB 1NGYB 3ROOB 2NXYD 1GHFH 3KPLA 4YHYC 4MD0A 4PLKD 3PWPE 4I3SH 4TNVF 5FF6A 5ESQB 4NQDB 1UH4A 1CXEA 3BVNB 4QF1A 1R3HB 4MNQB 2EC9U 5JOPE 4U1KB 3C6SA 4QYOA 3VXSA 4Y1AD 3U4AA 5HYSB 2X44D 3IU4H 1CU4H 5BV7L 4R0LA 4PRIE 2H2SC 12E8H 2BX5A 4FZ8L 2VLRB 4U0QB 5HDQL 1F6LL 3E0GA 3U9PL 1T0MB 1OAXH 4FMKA 2VLLA 4YH6A 4JM4L 1FYTE 4POUB 5GGSA 2F8XC 4YIQA 1IJ9A 2CUIA 5DDHA 2R2BB 5GRWA 2BSTB 4WV1C 2AERT 4KJPC 3MGOB 2VQ1A 3MRHB 2YZ8A 1EHXA 3F8UB 1S7QB 4FTVA 1IQWH 1G1YA 3AM8C 3ARED 1L9MA 3BKML 4Y1AE 3AU1A 1A6PA 2H32B 1JGEB 4P59L 3RVUC 4LGRB 3ULVL 4LCYB 1KB5B 5F6HI 2X1QA 4M6OH 5HHME 1IGFL 3E6HA 2FHFA 2NPLX 3DBXB 3KNBA 1MHHA 2V2XA 4X0KA 1T5WB 2F19L 5DA0B 4YBQD 3O3DA 5IKCA 1CL7L 3BN3B 4P2QD 5IG7B 3MV01 1KGCD 1N5YH 5MERA 2ATPB 1NBZA 3IDGB 2HTKC 4KVNL 3RGHA 3FAXA 4QXTA 3FO0L 1DQMH 2GUOB 2HLAB 3MZGB 1FNSL 5B39B 2W59A 4N8PA 1G7PA 1LO0H 1QBBA 4U1NA 2Z93B 4JM2F 4XP5H 1BWWA 3RQ3A 4HJGA 4HMEA 2B2XL 3IXAB 5CJBA 1ETZB 3QDGB 1T1ZA 3WEXA 4O2EB 1NC2A 5D2LA 1OLLA 4LSRL 5DJ0B 1HI6B 4S10A 1H3XA 4Z7UB 1UEYA 2DDQL 1TTGA 4XPBH 1NGXA 4U1IB 1N5YL 1ZHKB 5D7SL 2K3TA 2J5LC 5GRXG 1N6QH 5ESVA 3WDIA 5JZ7D 5TE7H 4FP8H 2NW2B 5DK2A 1KELH 3B9KD 4FFVD 2ZSVA 3D85B 3V4PH 4R26L 4XBPA 5AZEH 4LKXB 5IIEB 1G0XA 1MUJB 5FO7A 3V9FA 3WLBA 4F58L 5CUSL 5ANMB 3PGFL 4G6AC 3W11C 1DP0A 4F37F 4C4KO 1LHZA 3D2UD 4NQSB 3MLXL 3DMMB 2VMFA 25C8L 3PGDB 3IRZA 4MZ3A 3K3QA 4RDQF 4ENED 4RFNC 2A74A 1GZQA 4DGVH 3SGDH 2HG5A 1X4YA 3DURA 1DFBH 1JUFB 2F54B 3X12B 3EZJB 4RA3A 1JZ3A 2OLDA 4TUJB 1OT2A 4KKBD 2QQNL 4ZUUA 2BY3A 3O6LL 3D0VB 2CDFA 4OV5A 4YUEH 4HWZB 2NR6D 5CZXD 4HIHA 2B5IB 5I66B 2C4FT 8FABA 1DDHB 2E9WA 3H9ZA 5IB5A 1DVFA 2AEWA 3VFUB 1IAOB 2J88H 4YLQT 2NW3B 5GS2D 4XGZA 2ICEB 5IMOB 2IALB 2D3VA 5TFSL 3GK8L 1AXSB 1NCTA 3ZKXC 5CP3A 4IOSD 5BJTB 3EGSA 2NY6D 4KTYA 2ARJQ 2YD4A 2DLTA 4YR6A 5GRZA 1T03H 5IFHH 5C07A 3AS2A 4Q9RL 1OP3H 3QB7C 4JG1L 2CIKB 2V5TA 1I7ZB 4OF5A 1G9MH 1U3JA 3ULSB 3MRCB 1K85A 2W60B 4KK9D 1R5IB 2J8UB 5E2WL 2LQRA 3PWJB 1T89C 2APVA 4AIZA 4EDWH 4FQ2H 4Y4KA 4RAHA 2AS5M 4KKCD 1NDGB 2EE3A 4Y4FB 2DIJA 3NIGF 1DQML 4G7YH 4X4YA 3HZYB 1A3QA 4LPWA 2FHBA 2P7TB 1CICB 4ZSOE 1F3JA 1RZJL 3CFBA 5L2KE 1Q94A 1IGMH 4FQXA 3QDJA 1WAAF 2NX5D 5TH2B 2B20A 1EHAA 4KJYB 3BDBA 5JOEA 1SYSA 4ZTPH 4U33A 1XCQB 1L0XA 3HHRB 3EAKA 4PGCB 4DUXA 3A67L 3BYTA 3DJ9A 1KCKA 3CX5J 3U7YH 4XP6H 5ID0A 1GGYA 2WUCL 1OAUH 3GNML 1RULL 5ID0B 3WJLA 2YR3A 5AZEL 3C6LB 1RPQA 5LQBH 2O5YL 4ETQA 5T1LA 1OP3K 3TYFB 3JTSA 2W1NA 3SKNB 1KFAH 3HE6B 3IVKA 4M5ZH 4WUUD 5CSBA 4LCCB 2CR6A 1U8JA 2QQKH 5D7LE 1CDYA 2IEPA 4RBPK 3RBGA 3L9RB 5HYJE 2JIXD 4KJPD 4R3SB 3WUZA 4ZXBA 3SKOA 4MQTB 4PJFA 5LJYH 5EU6A 2AI0L 4ZXBB 1OTTD 5GZOD 3FOMB 4OZGB 5KBNC 3SCMD 5IM7B 3ZMRA 1FYHB 5MHSD 2VQUA 2DLEA 1UCBL 4PY7A 4FTVE 5MENB 5KS9F 5IQ7L 4JKKA 4OM1H 4QOKE 5ILTH 3QUZA 3N9GH 3O3UN 1IEAB 1NBZB 3HI1B 4HFWA 4PJ8D 1IAIH 4G7VH 4F7MA 3I6LD 3UTQA 3I2CL 5JTWA 4BFGA 4RISL 1YEFH 1KIPB 3HLAB 1S5HA 1YN6B 2BSRB 2OXGA 3T77A 1GJIA 2BDNH 3OX8B 4QHLA 3L6FB 4F2MB 4H1LH 3EZ8A 3MLSH 2R9HC 4Y4FC 2VDRH 4C59B 2W38A 3KYNA 4XPGH 1T2QL 1MIML 9CGTA 2OQJB 3VXME 1V05A 4G8IB 2PCPA 1IM9D 3FT4B 4UAOC 4YO0A 3PWPA 3D18A 3GUTA 4YDLC 1CZ8H 1XAUA 3VRLF 3IDIB 4V2CB 2C1OB 3EJYC 3RZCA 5D1QB 4KJWD 4PJ9D 4Y5XA 4XCYB 3MV9D 2IBZY 4PREA 3F65A 4O9HL 4GXVL 1VESA 1IQWL 3SY0A 2AEIT 4UUJA 3SY0B 2WMPA 5GS0L 5D9SB 4U1HA 4Z0XA 1MWAL 5C0ND 3RBSA 3QIUC 3CU7A 3RAJH 4XNXL 5L9DH 4MJIB 1R24B 3O9WD 5KOMC 2Y1VA 4R6UA 3A6BH 5SV3A 1GPOH 2EDLA 4JM2D 2Y06H 3MV9E 1BFOB 1NAMB 4U0RC 4GKZB 4HC1A 2YPVL 3SDAC 4NCDA 5D96C 5T5NF 4DKFL 5GXBB 1MI5D 4TUKH 4YEEA 5IVZA 4TQEL 1MCJA 4DN3L 4FNLH 1DANT 1I7UB 3EGSB 5KSBB 5GRVL 1F6FB 4J7RA 2HKFL 3ARSA 3FAWA 3WEXB 4NQEB 3DXAB 2Q76A 2AQ2A 4UOW1 4RGNE 3DPBA 1KTKE 5FOBA 4XNUL 4HV8A 3S7GA 2CRIA 2XT1B 5EN2B 4K7PH 2E6QA 2XTJC 2NZ9D 4Y88A 4OZIB 4OCNC 5FUZL 1XR9B 3LRSA 1CK0L 4XMLL 5SWSB 4OZIA 4XPAH 3SJVA 4YFLI 5AZ2L 5JIPA 1EV2E 1HIMH 1FO0A 3WFHB 2OZ4H 4UILL 3LRGA 5IKCB 4MJID 4K3HA 3ETBF 1I9IL 1UKQA 1S7SA 4LP5A 4UT9H 4GRWF 5C3LD 5K9KA 2Q8AH 1KB5A 3SE4A 4NKOA 5DVMA 4DOHE 2VDML 5HGHA 5CD5D 4L4VD 1ADQL 1IZKA 3VXSD 2A77L 2GSGA 2Y36L 4MQ7A 3JV0A 4RGND 4FQCH 4HGKC 3OKKB 3QHZH 3S3PA 4XPAL 3RX5A 1U3ZA 4LDLB 1KJMB 5MEPA 5FV2A 2DKSA 4KUCF 4AMKH 4QTHB 3Q48A 1AR2A 3UP1A 2O5ZL 2VZUA 5E6ZA 3B8YA 4AEFA 3W0WA 4U1IA 5EFIB 5KOVC 3O6MH 2XN9B 3D0LA 2JCCA 5EUOB 3LRHA 1MNUH 1P4IH 5FFLA 1BQLH 4RGMB 5FUOH 4O2EA 4IRJC 2Q7NA 5HI3D 4C56D 1ITCA 3U7AA 2ADFL 1QO3A 5TF0A 3PE9A 5MP6L 1D5BA 2R2CA 1S9YB 3QCTH 3AAZB 4U2YA 5E8PB 1FG2A 1MFEL 4TTDD 3VJ6B 2DMKA 4AQOA 4P5TA 2JELH 4JHZA 2EDJA 4HCRA 4QT5A 5CZXC 4P2OD 5GRUH 1QD0A 3CJJA 1RURL 4IMLA 5C3TA 3ARVA 3MREB 4JEGB 1JNLL 1I9JL 3PQYA 5F7DA 1S9KC 2VE6A 1IAKB 3UTSA 2BY1A 2RB8A 3DHJA 3GJEB 1I3VA 3CD4A 2XRAL 1S9YA 4HEME 1CVRA 3MCG1 1DFBL 4X5XA 2FGZA 1HYSD 5GS2H 1A7PL 1F3JB 4IM8A 3ES6A 2BHUA 4HKXA 4DW2H 2DQCH 5GS1C 4YXHL 3LIZH 2JCCB 1P7QB 5KVFH 2CIIA 3ARFB 1OAYL 3JTTB 4K7PL 4P4RB 1JBJA 3LMJH 1PX4A 1HOCA 4LLAA 1D5BB 1GRWA 1D5MA 3O41A 1H8SA 1U36A 4ODVL 4MQSB 2VO5A 4BFBD 3RJQB 1JTTA 1G9NL 2VWEE 3BZ4A 1DTUA 1UH2A 2WM0A 4X6EA 1KXTB 5TE6H 3SGDI 2EXWC 2HG5B 1TJGL 3O3BB 1E6JL 1JYNA 5E2UL 4WGVB 5T3ZD 4UV4H 3KPSA 3CVHH 5HHPB 3DSFL 5T1KA 4M62L 1DJSA 3LDBB 3H9HA 4Z18A 1OM3H 2MFNA 1OD9A 2HKHH 3HI5L 2FWOB 3SCMA 4QLRA 3D3VB 5GRJH 1YEIH 1QR4A 1VGEL 5HHNB 1EGJA 5IQ7H 2IANB 4M1GH 3IDYC 4OFYD 1NANI 3K1DA 3GB7A 2HWZL 4GRWB 3CNKA 3IDUA 3GHBH 2IQ9H 2JJWA 4H88H 1QR1A 3MLRH 3GSQB 1YN6A 1QLRB 2R9HD 5J1AB 2H32H 1UT9A 1G9NC 4FG6C 3IF1A 1QLRA 4JQIH 3SQOL 4AL8L 1ZGLM 2AJ3A 4N0UE 3TYFA 1JJUA 5C0JA 1VFMA 4QRTB 1DL7H 4Z7WB 2EIZA 1ZXQA 5D1XA 3QUMA 1U8KA 3QI9A 4KI5F 4LQFH 2NX5E 2ZUQC 3GNMH 2HFEA 5T3XH 4XP9L 1JGDA 3VMOA 5BVJB 3F7QA 1QNZH 1OSZA 5DC0A 4JM4H 2X4OB 2BCKB 4KUZH 3CFJB 2DAVA 4LLMA 1BIIA 2HJLB 1AFVH 4DZ8A 1J0IA 3KPOA 1NGZB 3NTCH 5AD0B 1GC1C 2VZTA 1NAML 1BPVA 1RJYA 2FRGP 5BV7H 4PUBH 3EKCA 2GT9A 3OKYA 2QADC 1I1AB 1MCPL 3MRLA 5GS1A 4DK6A 1T03L 3GBNH 1R6VA 1GGTA 4Z7OF 3KPMA 1T04B 2OL3A 3ARGC 1IL1A 3GJFB 2YD7A 5HHMD 3N9GL 4OZ4B 2NX5A 2F9BT 2ICWB 1I1RA 1MF2H 3JWDH 4XVJL 1J05A 1EGJH 3BE1L 1JRHH 1I8KB 5DMGD 3QQ4B 3RVTD 3ZE1F 3A6BL 4M6NH 1ZA3B 3JWNC 1AO7D 3LKPA 4KDWA 2AAVA 2VL5B 5CJOH 1K8IB 5EZJB 1CXKA 5C86A 1MCOH 2CXKA 3RY4A 2JJTC 4HUNB 2DQEH 3QHTC 3SO3C 3EO1B 3WFBL 4PJ7B 3HFML 1I7RA 4Q9QH 2ZSWB 4HKBA 2UZIL 4NN7B 5FGCE 1CD0A 2VDQH 4NN6C 4W4NA 1N0XH 4ERSL 1DQLL 3OGCA 1ZHNB 4GW4A 3TFKC 2VQ1B 3BO8A 5L8KB 3V6FA 1S7WA 4LOUC 1I1FB 2VDNL 1J1PH 2XA3A 3R1GL 5GGQL 4U1HB 5HGHB 1G7LA 2CKBA 4RMVA 3D48R 3V4PL 5KJRL 2R8SH 4TSBH 4DN4H 3PDOB 1W72A 1U3HC 4QRSB 2FSEA 1FL5B 5I0DA 3MBEC 5J12B 2PXYB 1ZK9A 4WCYL 1DE4B 3FOLB 4G3YL 3MLWH 2R0KL 1TNNA 4QHKJ 4AEHL 2A6DA 2XWJA 3E2HB 5C1MB 2P5EA 3LZFL 4YHKH 4H20H 4U7MA 2DDQH 5C09A 3DRTB 5I16A 5KVMC 3REWB 4RZCB 1W0YT 4U7SA 2VDRL 4KK8C 5HD8C 15C8L 3I6GB 1W2KT 1PSKH 3DVNB 5DSCA 4LSUH 5CJQL 4HWEL 5DA4A 5BW7C 1ORSA 1ZHKA 2GI7A 4QGYA 3D6GA 4DN3H 5I1KL 5FYLD 3ULVC 1HWGB 1LO4H 2ERJB 1D9KC 2O5XH 3KDMB 5E5MA 1NDMB 5HYSG 2IAMB 3H3BC 3HNTL 3MJ8B 4ZO9A 3D39A 3BT2L 3QNXB 4UT6H 4YHPB 3O2VL 5FEBA 3FL7A 1Y18A 3RNQB 4HQQH 2VLJD 3N1PC 5FYKE 3K4ZA 2CMRL 1HK6A 2DI8A 1KNOB 1FVEB 5GS0H 3C8KA 1XCTA 5JQ6H 1MCBA 1QEWA 1ZT7B 2YMXL 3T1FB 2JB6A 4M02A 2WUBL 4JPKH 3CLFL 5E70A 5AG9A 3QPQC 1YQVH 4NQEA 4WY7L 4HIJA 4ZUTA 5A1AA 5E08L 1DBMH 3IFPB 4UOJA 2EDYA 4K7PX 5EC1A 4HQQL 4DKFH 3M1BA 3L3KB 3VFRA 4PJ7A 1K8DB 4HX1B 3U4EA 4WW2C 2NY4D 2BSTA 2VABB 5CZKA 3DX8B 4WHYH 5D1QC 4MNGE 3RZCC 1MSPA 1NCWL 1KLFA 5HHPA 4LPXA 1I85A 1A1NA 1CGTA 1QSFB 3T0AA 1UVQA 4Z7OE 5D7LA 4I9WE 2I9TA 5CILL 3R8BB 3UTPE 3L3IB 4HUUA 4PV8B 3V4VL 3O6FD 4AG4L 4TOYH 5EORL 4ZS7H 4BJLA 3FQRB 1BVKB 2CK0H 4YXKH 1I3UA 5L6YH 3MREA 2DQGH 4HUKB 4QHUA 5DJAA 4P23A 1ZWIA 4Z7VA 4G5ZL 3MRLB 4DJMA 2VJXA 3SDCD 4OTXL 2WP3T 4GG8B 4LRIA 3DMMD 4Q74A 4Y4FA 5ESQA 1QPXA 3GMOB 3MLWL 5DQ9B 1WFNA 1A2YA 2X6MA 5F7HA 3MLZH 5DMKA 1G7QB 5DUBB 4IRSB 3GSWA 4F7TB 2FEDC 4NBYB 5HJ3B 4BM7A 2VE6B 1JF1A 3UTSB 3PIQA 1XF4B 5I8OH 4MB3A 4BFEA 2XG4A 3GRWL 1KC5H 1FDLH 1DLHB 1U3HB 1HH9A 4Y4HC 4LLWB 3CMOL 4I2XB 1BJMA 5FYKL 3BP5B 3DOSA 4LP4A 3S35H 5IFAH 1IEBA 5BVJA 4F7EA 5TQ2L 1C1EL 1DVFD 3SPVB 1GGIH 2NTFB 3TESA 3BKJH 1AE6L 3QIBD 1AC0A 4LLVA 2X05A 3MLUH 4XNQB 4Y89A 5DFTA 5HGGS 1DLFH 4A6YA 1QO3B 2AEPL 4TPRH 1CGVA 1A1MB 3WJLC 5FGBA 4DCQA 4NJAL 2ZUWA 2PO6A 4HWUA 5DHVA 1WC7B 5DUMH 1YUHB 5EIVA 3RUGA 2CDEB 1LP9E 3V79C 2LU4A 1P4IL 3THMH 2UY6A 4UDUA 3HNSL 1MCFA 1VACA 2GSIB 3BP6B 5ETUA 4G42A 4HKZB 1IC5L 2GJJA 2FL5A 3HN3A 4YZFE 4UDUB 5EBMA 3RWEA 3O2DA 4RFNB 1QFWH 2XWJB 3ZDXE 5K9OB 4KFZC 4LSUL 5CJQH 2HFTA 3ARBC 4NQXB 4LLQB 1HQ4B 1F45A 4LEXL 4YIQB 1KTDB 4LLDB 4YQXL 5IB3B 1WF5A 1U8NB 3RPIA 5JORB 4PRPD 1U8HA 3RY5A 4RRPG 1LP9F 3FB6B 3KYKH 3DIFB 5IOPA 4LLVB 2WIIA 1FCGA 2XWBA 1FNGA 4DKDC 4JZJB 3DARA 2F5AL 2DD8L 3MRRB 3WKMH 4XB7A 1HSBB 5B38G 4O2CA 3QUYA 1JWSA 5CEZL 5HYQA 1WTGT 1JPGA 1RUQH 4M7JL 4NZUL 1D6VH 3WNLA 4D9QD 3QI9C 1RD6A 2H1PL 3LIZL 4YAQA 4MJIA 2DL2A 4Y4KB 3WS3A 1MLBB 4WI9A 3V0WL 5C0EB 4HEPG 1JGLL 4XHJD 1Z9OA 1GOGA 1KF9B 2HTLD 1A7OH 4ZG1A 2A6JA 3TCLA 3QH3A 3VXRB 1CFSA 1G7QA 5MEND 1NLDL 1R3KB 1F11B 3ZO0A 1OAKH 4WFHD 5BRZE 1A22B 5MP6H 1NGPH 2XPGB 1J9CT 4M7LT 1BBJB 5I73C 5BZDB 1INQB 2AJYH 4HXBL 5F70A 1TZIB 1DBBL 2BNQE 1FO0L 4G9FB 4K9EH 3VXNB 5I8KL 1CTOA 2FX7L 1ZLUK 1RMFH 1S7TA 4ZFOL 3ARTA 5AWNH 5EB9A 1ACYH 2PW2A 1YEJH 3OAYH 1BLNB 4P9HH 1RVFH 3HC0A 1X5XA 4ZNEE 4YHLH 1Q72L 3I50L 2OR7A 4GXVH 4X7TB 2HT3C 4PRPA 2F74B 3VWKB 3QP3A 1JP5A 4V1DB 3KPQB 4YAQB 4ELME 5TF1H 5DJDA 4YHPA 2NXZD 3BQUC 2PTTA 3G5XA 4MGXA 1WZKA 4WDIA 5GS1B 2XN9A 1IM9A 3D0LB 5EUOA 5HHOB 1QSFD 1F5WA 1S7XA 3VGBA 6FABH 1BVKA 3C60D 1NDMA 5F7EH 3C6SB 5D8JL 5I76B 1FVEA 5EOCJ 3AXLA 1AD9A 2R23B 1JWUB 3QWQB 1F4XL 2O61A 5M95B 4WU7A 4Z8FH 3S98A 4DTGL 2PTVA 4FS0A 4IS6A 2C7UA 5FO8A 3M8OL 5F9DC 2CRZA 1RZJH 4X8XA 3ZKND 4YHIB 1VHPA 3V6OA 4PGEB 4GRLA 3U0TB 3L6FA 5AAWA 1IMHC 2H6PA 5IB2A 3CUPB 4XPTH 3MUHL 1K4CB 3QDGA 4PTTA 2NCMA 3BKYL 1K4CA 4BSVB 2XQYG 4JN2A 5KVGH 1F90L 3BP5A 4HUMB 4NC2B 1S9WB 4ZOCA 1AQDB 1GH7A 3W0WE 3RHWK 4OLUH 4ENEC 3X14B 5D96B 3ARUA 2VXSH 1NCAH 2UV3A 3UTSE 3WXVL 2IWGA 2QADD 5DEGB 3DMMC 1A3LL 3I9GL 1ZE3C 1FFPB 4F3FB 4GKNA 3UC0H 4BSVA 4Z76B 1BFVL 1WGOA 2AI0H 2XTLA 3LMJL 4H1LA 4AY0A 4APQC 3A0OA 2A73B 5I1IL 1PG7L 1J86A 4P57A 3QQ3B 3LY6A 2G75B 1TVDA 4LASL 4K23H 1J0JA 3LEXA 4N9GB 1MCQA 4PJHE 4I13B 4JN1L 1MH5A 2DLFL 3UTTA 4JJ5B 2AQ1A 3QQ9D 4LRNH 2CLZB 4QRSA 2XZAL 2YD9A 3ES6B 1L7TH 5I66A 1EAPA 4NZJA 2VB5A 5F7UA 4E41A 3ARBA 1OAYH 2QV2A 3GMRB 4Q2ZA 2ICWA 4B50A 2W07A 1CF8H 2CIIB 4HS6A 4HK0B 1A1OB 2SEBA 4GKOA 2VABA 2P1YA 1CD8A 1KCVH 3BHBA 3LEYH 3LSOA 5CEZH 3KPNA 3S5LB 4G8IA 1CIDA 3IDYB 5F3HA 2YPLA 4YC2C 3IJSB 1M7IA 3B3IB 4MD4B 4OFPA 4PP2A 4U49A 4XX1G 3TVMB 1YEEH 1WZLA 5L2JA 1YMMB 3DUSA 3KLDA 4GT7A 5D7LB 4D8PB 5HDLA 4YHYB 1YYML 4C83A 3MRCA 2EDQA 1I9JH 5FKAB 5DRWA 1MCHA 1YA5A 5CGTA 5GISL 3FB7B 1J8HE 5I1AA 4DQOH 3DO3A 3VWKC 4HFWB 2AEPH 4OCYH 5E7BA 3WFDH 1IZJA 4EN3D 4MXWH 4NRYA 5IB5B 1BEYL 3MRMB 1BM3H 4OZFH 2J7LA 3RHWF 2VDOL 2VZOA 2X9YA 4XCNA 2GYSA 1X5LA 5H94B 4K8RH 5JMOC 1MAMH 4PGZA 1Z3GH 3BZEB 4ZUUB 1PG7X 3PJSA 3QIUA 2WBJB 4U6HB 4OQTL 3ZT7A 3C09C 1G7JB 1TENA 5I8OL 2X40A 3VGEA 3GZKA 3W39B 4LEXH 2NNAA 2P44B 1MJJB 3ARFD 1MQKL 1RIHH 3VFTA 5GIRB 6FABL 5E94B 4W70A 1PAMA 3EO9H 4QEGA 4G6FB 4PGCA 3AREA 4YBLB 2VDOH 5C07E 1KUMA 4KI5D 2E7LA 5T1KB 2WV3A 5H8DA 4MDJB 4XNYL 1CK0H 3QHFH 4WWKC 2PO6B 3DTXA 1FSKB 4PJ7E 4OZIF 1YDPA 2BC4A 2DQDL 1KB5L 1ZGLB 4R97B 1NBYB 1N3NB 4EI5A 4HWEH 12E8L 4WU7B 3DYPA 2CXGA 3C5JB 4NFDA 1EGJL 1Z9SA 2HFEB 3BXNB 4JPVH 4JR9H 5CP7A 2J8HA 5F9WC 2NY4C 3I84A 1RIVL 5TPWL 4ELKB 3K0WA 4Z95L 1A6TA 2WBJD 3KYOA 4AYFA 4FXGB 3BP4B 4B7LA 4FXGA 1JPSH 2YPVH 3OG6B 4ODSH 1BBJA 2EO1A 1V5JA 1FNEB 4XI5C 4ZFGL 4JFYB 4G6FD 3ULUD 3TPKA 4NDMB 2HFFB 5JIKA 5ANME 3RWFB 1A21A 3EOAA 3FN0L 3MGAA 1TVHA 4WEMB 3SEPA 1WZ1L 4ZXBC 1T6WA 4G8GD 5HVHB 3TT1L 3N1MC 4NP4H 5TDPA 3ZE0E 1U2HA 4R0LB 3QIBA 2QSCH 4F7PB 2E7CA 5C0GA 4UQ2A 4HXAH 2FECL 4NRZB 1U6AL 2H2PD 4U1JB 5DURB 4NRZA 4P57B 4BH7B 2R1XA 1WT5A 1BREA 4JRXD 3UTQB 5I18L 4D0CA 4MD0B 2WW8A 4JE4B 1MFEH 4WWKD 5DI8A 4OD3H 1JPTH 3VG9B 2RFXB 3OZ9H 3K2UH 5KAQF 4GMSL 3O9WB 1ZEAH 2NY3C 4A6YL 5DHYB 4GG8A 2WWKT 3IU4L 4X80H 3DI3B 3EHBD 5IK3B 1EEZA 2G5RA 3GMLA 2CSPA 5F8RC 3VWJC 1KJ2L 1WCBB 5IVXF 4X6DE 5DD3H 2R2EA 4FG6D 2BFVH 3TH3T 4ZUVA 2MNUA 1Q0XL 3VFOA 3FCTB 1I8MB 2E6PA 1I75A 1A7RL 3QT2A 4ODBD 3RFZC 1LO4L 3LAFA 5EO0A 5JORA 1CFVL 3BRGC 3MQIA 3BH8B 1FN4B 2AK4E 4L4TE 2EIEA 2N1KA 2IBBA 5KS9B 4OM0L 4XNYH 5E5MB 4HX1A 1K8DA 1JFQL 1MQ8A 5FKAA 5KS9A 2EDNA 3DTXB 5SWSA 4P5TB 3LKSA 4EQ3A 1JZ2A 5J6GA 1FGVL 1PY9A 3KPRE 1IGFH 1N64L 5FYLE 4TVSa 5J12C 3OL2A 4G6KH 1Y18B 3D1MC 1JYXA 4NN7C 3HPLB 3MJ8A 1FVCA 1K2DB 1ZHBB 1MEXH 3UPAA 5F7EL 5GJSH 3QFJD 3IETA 5KSUA 3MLTB 5FECB 1HE7A 3SJVB 1ZT4B 2GUOA 4PBWD 4JAMA 4UV7H 4OQ1A 4HFUL 2X09A 3LKSB 2WUCH 3ESVF 3UZVB 5F1IB 5IW1B 4KJQD 4HH9A 1OSPH 4R7DB 4HF5L 3FQNA 1DQJB 4XPFH 2GW5A 1FNAA 4FFWD 4W4OC 3FFCD 5CSZA 1G7HB 3I6GA 2DKUA 1H3UA 3TO2A 4EIZC 5SWZE 1KPVB 3GHBL 4ZFZB 1VB9A 1D9KB 2ZOKB 1IRAY 4JY4A 1QQDB 1GGUA 1ACYL 3OAYK 2Y23A 3ZDZF 1WAAA 4JKLA 5I76A 3L3KA 4MLIA 3VFRB 5E94A 4C55A 1FH5L 4NP4L 3QDGE 5ACZB 1UZ8B 4WU5A 2X4SA 4G7YL 2DICA 3TJHD 5F1KC 3WN5A 3RWGA 4E5XB 4P3DA 3WFEL 2DQGL 4OKVA 1S7SB 4CN4A 4Q9RH 1AY1H 5CS7A 1JGUH 2CK0L 1FSKC 4PPTA 2F58H 5ICYA 4Q6IA 5AYQA 4DEPB 2P8LB 3SJVD 1WUNT 1HXYB 2XNAB 3BPOC 1WISA 1RU9H 2JE8A 4XCEA 1GPOL 2B1HH 1I7TB 3BKCL 4PGDA 2VIRA 4OGAC 1N0LA 1I8LC 3BD5A 4LLWA 8FABB 2WWKO 1JL8A 2J12B 5SWQB 4K3EL 2XZAH 3TV3L 1FBIH 1LDPH 3PP3K 5TJWK 4TUOA 3GJEA 2ICEA 1PZUB 1X5IA 1MJJA 4AENA 1ZKAA 4U3XA 1MCOL 3JXAA 3OAUL 5E8NB 5LGJB 4L29A 2MQ0A 3O11B 5EU4B 4PJAA 1NFIA 4EUPG 3KLSA 1RJCA 3S6CA 2ZSWA 2FBJH 1URLA 3GHEH 1S9WA 1WT5C 1P7HL 2KPNA 3MUGB 4HT1L 1BHGA 3SDDB 5I75C 5HI4C 1EERB 4AIOA 5DLML 4KY1L 4LVOC 3ARXA 4XBPB 4EI5B 2Z91B 3PGFH 4QO1A 3CXDL 3HI1A 4YDIL 2PYFA 4F3FA 1NFDB 2UY7A 2GITA 3WIHL 3ALWA 4JDVA 2EZ0C 4F9PA 2A1WL 4PY7B 2JTDA 2YPKA 1HQ4A 5C6PB 4HHAB 5E00A 3WCYA 5HHNA 4DVRH 3PQYD 3V52L 3JVGC 5F9OL 3NCYS 4N5UA 3CSBA 4MMXC 1L0QA 4GKSA 4O5LH 3H0TB 1OM3L 2CUMA 4LU5H 1JMXA 4U6HA 2Z9TA 1EHLH 3P4LA 3VWJD 4BZ2L 4BZ1L 3PWNA 5GZND 5JHDB 5D7KD 4D94A 5A2JH 3S37H 1J1OL 3GSUB 4HW6A 2VXUH 4XCNB 4P9HC 2YD3A 4PJIA 1RIUL 3DVNA 5DSCB 3IFOA 4NCC2 1AGCB 2MOVA 1NC2D 1SQ2N 1PKQE 1MRDH 3CK0H 2D7MA 4FN0A 4OQTH 3VXSE 1U8KB 3QI9B 3GGWA 3RGVB 4FQIL 4QRQA 4X6FB 1ZLSH 4Q7DA 2VLJB 3BPLB 4WHYG 4HIEB 3CPLB 4LGSB 3T3PE 4H0HB 4P3CL 2ICES 3TBTB 1CZ8L 3P3YA 2VLKD 5E4IA 1MFCL 3DNKA 5KVFL 1R5IA 2J8UA 5IM7A 3L3OB 2X4PB 4GXUN 1I3GL 1TPXB 5I17A 4Z7WF 3QXTA 5DJDB 4YDKH 4IDJL 3UTTE 5IHUL 5EUKB 1K4DB 4PJ5D 5F1NA 4JO3L 4P5KA 1QVOB 2OM5A 2YRZA 1D6EA 4U1SB 4YE4L 1DEDA 3KHQA 1F13A 1LNUA 1E6JH 3KJ4B 3VXRA 3Q5TA 1QHPA 2AVGA 1LNUB 2B0SH 4XCYA 4XAKD 2OJZL 3REWA 3SDXF 2DTMH 3MROB 3O45B 1ORQB 2MTPA 2IGFH 4RAVB 2IADA 4IRJB 4ODHL 5F1NB 3FFCB 3QDMD 3BEVA 1T04A 2OL3B 3KPMB 1A9EB 2EE9A 1OQXA 4J4PA 2NW3A 1IC4H 4YHOH 5F9AC 1HSBA 4ZYKA 5DVKA 4P46C 1GYAA 2F58L 5GQBA 4PRPB 4RGOH 1WCQA 4IRZL 4KRPB 4LIQL 3KPOB 1ZSDB 3SE3C 2P45B 4P4RA 2R4RH 3S36L 3B2UC 3BEVB 4JFZL 4A6YB 4TSAL 4RNRB 3VXUD 5DJCA 3PG2A 1D5XA 2WBKA 1KLGB 2HJKB 3L3GB 3GKWH 7FABH 1UM6H 5E4EC 3RVTC 3UTSD 3ZYJA 3WUWG 4OF6A 5CUSH 1NJ9A 3RTQB 1NGZA 5AD0A 2JCCF 2IQ9L 1OPGH 3O3EA 1C5CH 3ARFC 1BFVH 4NKOB 4ZS6D 5SWZB 1TJIH 5F7YC 2R4RL 5E2VL 5IWLA 1V7NL 4GG6E 2BDNL 2GY7B 4CJ0A 2BSRA 1JK8A 3ROLB 3LN5B 4MCZB 5BZWB 3I50H 1UWXH 4U1NB 4MA1C 4RCAA 2AABH 4JFOA 3BEWB 3H7LA 3B43A 3CUPA 2IG2H 5IEHA 5D1ZD 1GOFA 1T20A 4HWZA 1PZ5A 2YPLD 4NJ9H 3IYLW 3WMSA 2XYCA 3GGWB 2I9LB 3KR3H 2JK5B 3WO4C 2M2DA 5JQHC 3LS5H 1MJ7L 5BZWA 2H9GB 4CVXB 5ESVB 1YEHL 2J8UE 5IBUB 1MHEA 3DBXA 3KPPA 3KDMA 1LO3H 4PV8A 5T3ZH 1FGNL 4C56A 1TQCB 3PDGA 4FTVD 1JZ5A 1AD9B 1PW3A 2R23A 4NHCH 3TIEA 1NFDA 3TC9A 2V9TA 1PLGL 4O02L 4P2RD 2Q86A 5IG7A 3T4AA 1G7IB 4ODWA 4FQJH 2V2TA 2DBLL 4TPRL 3L3DA 1I1FA 5IK3A 2ZSVB 4D0CB 4ESKA 3MV7A 1EBPA 1DANU 1S9XA 4ALAL 2ED7A 4P2QA 5ITFA 3QEQE 5EWIL 1F4WH 1OL0A 1KV3A 4KHXH 4P49A 2GFBA 1A6TB 2IQAA 1EO8H 3VXUE 1RZ7L 3L95A 4B0MM 4M43H 1W0VB 1QSEB 2M8XA 3HI6H 4DW2L 4E41B 5J11B 3O8XD 1B3JA 2DQFA 1J05B 1LMKA 2ZNXA 1HCVA 1L7IL 3FMGH 4HLJA 3OR7A 3V5HB 1LE9B 5DVOA 4P4KB 3SKJL 3JVGA 2D2OA 3QPQD 5LGJA 3WKML 3QEGL 3PWPB 4OKVB 1C16B 2EICA 3U82B 3QUYB 5B39G 1U8MB 3PP4L 2YUZA 4WW2F 3HG1E 1JGUL 5FM5O 5F96H 4YDLB 1NC4D 4L5FH 2J6EL 5E6IC 3WFEH 4JFDB 4D9QE 4FXKB 1AD0B 1HWHB 2K1MA 2YSSB 4GMTL 2XQBH 5HHQB 4HIJB 2XZZA 5HI5C 3OKNA 5GGUA 3HMXH 3BE1H 3ECBB 1VFAB 4JJ5A 2B0SL 3AGVA 5I9QB 2P5WB 1F2QA 3FHQA 5E99H 3GMOA 2OI9C 4MCYB 1OGTA 4Y1AA 1KIRA 5B38A 4PRPE 2EDKA 3RA7H 4W68A 5LVEA 3I6KA 3BP6A 1HEZA 1KOAA 1VDGA 5TGBA 1CFTB 3QEQB 1QOKA 4DKEL 4GQPH 4N0YH 2YMXH 3T2OA 4Y5YC 1QLEL 4Z7VE 5C0NC 2VLKE 3QDMB 2RCSL 3VG9C 4TN9A 4KUZL 3S9DB 1ZS8A 1U91A 1SJEA 3KS0H 3CLFH 3T04D 2OR9H 4EOWH 4JVWA 4MAUH 3BMWA 3JTSB 4K2UH 1P7KA 3MJ7B 2G9HB 2VZSA 1EEUA 2QEJA 1QFWM 3RA7L 5IW6A 3KGRA 4WI3A 4Y4KC 1LK3H 1TITA 1T89A 5DJCB 1HNFA 5DQ9A 5IB1A 4PJFF 3K74B 4OJFL 4CMHC 3FT2B 1X9QA 1NBVL 2HKHL 3P4MB 3X17A 5DJYA 5KVDH 1WC7A 4X99B 4BUHA 3Q6FA 2ZCHH 3L9RA 1IGYA 3RNKA 3L3JA 4FXLA 4IS6B 3O3EB 3GMMB 3C8HA 3HUJF 4OM0H 1EUUA 3ARWA 4P2CG 3OB0H 2ICWI 2L4OA 3MO1A 3O2WH 1EAPB 5B8CC 1DVFC 2VZ3A 1C7TA 1A9BA 2ZPKH 4R2GB 4CNIB 2G5BA 4MAYD 4JPIA 4JHAH 3KR3L 2HTKD 4LKCA 4Y19D 4Z0BH 4XPHH 1KB9J 1I9RH 4IBLT 3TM6A 3BKYH 1CD1B 4LLYA 4XXCC 5C6WH 1AO7A 3QUXA 1Q9LB 3T2NH 2VDKH 4FABH 1CF8L 1T7WA 3GJFK 4XCCL 4ONFH 1QG3A 3P9MA 5EBLA 2PO6C 2P24B 4L29B 3KXFD 2HRPL 2HLFC 1INEL 2O26U 1KGCE 2IH3B 5T1DH 4NYLB 1AHWA 2AV1A 1PBYA 3U79A 4BSWA 2D9CA 1OGAE 5IT2H 1R3IH 4XB8A 1Q0YL 2VN4A 3PABA 5DTFA 1RUML 3G9VA 4O51A 4G9FE 2FJHB 3D25B 5F7FA 5HVWA 2HMIC 5GGSB 3T3PF 3L5WA 1UXSA 4ONFL 4U6YB 3MV8E 4ODSL 4LDOB 3QYCA 2P8PB 1QYGL 2BVPB 5DI8B 1MH5B 3WFCL 3GMPB 3K8LA 3QUZD 1AI1L 1M7XA 1GSMA 1RY7B 2D9QB 1FFNB 4IJ3C 4X5XB 4D0BA 2R1XB 1WEJH 1YYLL 1CFVH 1Y0LB 4CGTA 1KJ2B 4NZRL 3QXWA 5KSAD 3GUTB 4KC3B 4NO3A 5IVXB 4BKLB 3OAZK 1BQSA 5HYQB 1Q9OA 3H9YA 3PWNB 1CLYL 4M7LL 1CLOL 1F4YL 4PTTB 4ZS7L 5D7IA 5B3JE 2ZWLT 5IB4A 1H9VA 2DM3A 3QDGD 3HPJA 1LD9A 3MRFA 5FYJE 4HKJA 3FT3B 3NIFE 3V52H 5ILTL 3KLHD 3QBTB 3DX6B 2CUHA 3PWPD 1A6UL 1VPOL 1KG0A 4WDIB 5HHOA 3ELAT 1MI5B 3CFEB 2EC9T 1RUKH 3PWVB 5CBEB 1ZT4A 4CMMB 4EN3B 4MQXC 2F5BH 3OZ9L 3VDCA 4F33A 1YY9D 3KLHC 3PWVA 4JG0L 3WO4B 1ETZA 3QNXA 5E24E 5JIHA 3D39D 5D1QA 1XF5B 4JFDD 3D87B 3IRPX 4MS8C 4PJCF 2X5PA 3B6SA 3BUYA 2DQTL 3EYFA 5HI4D 2HVKA 4LSSL 5DJ6B 1T7VA 1ZHBA 3F7YA 3QFJE 1JNHA 1CDIA 1T3FA 2AJVL 4ZTPL 1XT5A 1QLEH 4LPYA 2P5WE 5D2NA 4GFTB 1WTLA 5SX5H 1I7UA 5GSVA 4LFHD 2V5YA 4GW1B 1INDH 1MCCA 2FJFB 4K3GA 4XCCH 2H2SD 1DBJL 4YR6B 3QDMA 4JFDE 4P4KC 2ADJA 2XWTA 1HHGB 3VE0B 2JCCE 4WI5A 3GMNB 3VH8B 1IM9B 4DUVA 5AEAA 1A5FH 5AG8A 2LTQB 5IMOA 2VXTL 3FKUS 3GSRA 5I8KH 1BJ1J 3I3BA 4Z7WA 3OSKA 4MA8H 3QUMH 4JGJA 1OB1B 5D2LE 2X89A 1LEGA 4MD5A 2CJUH 1BF8A 3BRDA 2Y25A 5FYJH 1RU9L 4LIQE 4JO2H 3E6FA 1U0QA 1P4LA 4EEEA 1Q72H 3ZHKA 1VFAA 4Y2OA 3DGGB 1YNLL 2EYTB 3HE7A 2A38A 5HVHC 2YUXA 4X6EB 3AMKA 3C5SB 4KQ3H 2EYTA 3HE7B 1EMTL 1SY6H 2N56A 1TJGH 4TNWK 2J6EH 5GHWH 1PKOA 3WS3B 4OF3A 3N1FC 3BPNC 4Y5VB 2W91A 5DMJB 4NQDA 5KG9A 5CHNA 3OF6D 1KIQA 3EYQD 4PRID 2Q20A 2XN9E 1L9NA 5EUOE 5F8QC 3KLAB 1A7BA 5F89B 5B8CA 1QHOA 3HAEG 4A6YH 2VXVL 4LSDA 1HXYA 2XNAA 2DD8H 3HRZA 1AQKH 4PRHE 2DQFB 5JOPD 1INEH 4IMKA 2VLRA 2RHEA 3GRWH 5KSVA 5F6IC 5EIQA 3TA3A 5IV2B 1JGVH 4BK5A 2GCYB 2H1PH 3WN5B 3U9PH 5E03A 1S78C 2AJXH 3E6FB 1RFDL 4UTBL 1NPUA 1LK2A 2VR9A 2ADIB 5IBTL 1S9VB 1KEML 2SEBB 2XKUA 4M9OA 3EYQC 4WWKB 1LE9A 1HHJA 1OP9A 3JV4A 4AZ8A 2DQJH 3WL9A 3TBWA 3UMTA 4X6CA 3C5JA 3WSQL 5I15L 1HHIB 2ED8A 1NCAL 3LVEA 1C7SA 5FO9A 4PJAF 2C4FU 1TCRB 2MPAH 4OLUL 1KELL 2GFBB 2IQAB 3OAZH 4Z6AT 2R56H 5E8DH 1C5DA 4M03A 3OMZA 2JJTA 4X0KB 2J8UF 5GGRB 1XGPA 2C3WA 4EKXA 2YEZB 4KRMB 4RISH 4FA8A 2IMMA 1YEDA 5D2NB 2LAGB 2AW2A 1NCNA 1UA6L 1IC5H 4HZAA 5DURD 1R3LB 1HHIA 4JRXB 4RMWA 3UO1H 5B39A 2FBJL 2P5EB 4NZDA 3DV6A 5DZNA 3SDYH 5E9DB 1XGUA 1I9EA 3MYJB 1ACZA 1FL3B 4G3YH 3SDCC 3SDAD 4OF8A 3O0RL 4PGBA 3SE9H 2IPUG 4JM2C 4O00A 4PJIB 3TWCL 4H1LG 1HDMA 2HN7A 2XG5A 5FXCH 2M26A 4KK5D 5BOPA 5JZ7C 4KJQC 5JOFB 1A1MA 1EIBA 4DTGH 3MJ9H 3OJ2C 3O41B 2FIKA 1UACH 5J6GB 4UILH 3BSZH 4LSSH 4CDGC 2C26A 5E8OB 5AZ2H 5F97E 5KS9E 1U3YA 2ITCA 2LU7A 2Y07H 3CC5B 3MLPA 4MJ2A 3O3BA 3SDDC 2AK1L 3FN9A 5IT2L 5JDJA 1KCRL 3U6RA 1QUNA 3O8XC 3FB7A 5DEZA 5EA0L 3CVIH 4NHUA 5CEZD 1ZA6A 5DO2D 4NKQB 4DEPC 3MLYL 3ARDB 4U6XB 4J2XA 1A2YB 4B53A 1XF2B 3NCBB 3ZKMD 5SWQA 3TJEL 1BVLA 3HC0B 1H3VA 4F2MA 4JANB 1AKJA 3GI9L 3IAQA 3PIQB 4OCLC 1DBAH 1OGAD 3SDXB 1BFOA 1IC4L 4PY8J 5DK0A 4HK3J 3UPRB 3I02B 2W9DL 3SHSA 4MA8L 4Z77A 1AP2A 3NIDF 3T0VA 1AC6A 3QWOA 1R3HA 4RGNC 3HMXL 1FPTH 5D93B 1IGTB 3PWLA 3GMRA 4Q2ZB 3WHXA 4DGIL 3QZWG 1A7QL 5JUEH 2BVEA 5C70A 5T5NG 2BNUA 5INDB 4HZLA 2J3SA 3M8OH 2YKLH 4UMGA 5CP7B 2I9TB 4NZUH 2NY5H 5GSRB 4GSDL 5EUKA 3PXJA 2D0GA 4KKAD 3BVNA 3MA9L 1MPAH 2H45A 1MQKH 4GLRH 3VFNB 1MVFA 4DKAA 3H9SB 3FONB 1E4JA 3INUL 2J1KA 1PDKA 2BOCA 5L88H 2X70A 1X6NA 1DQJA 1AGDA 1PZ5B 2GJZB 1ZVSB 2WK2A 1RJYB 3GMQA 5EBMB 3RWEB 4YXLH 2EIBA 2YC1B 2MHAA 4OUUB 2EDFA 2JB5L 3QO1A 2L7UA 3BI9X 4PLKC 1N2RB 1TZHB 1JHLH 3SKUD 2OS7A 1FL5A 4CU8A 4P9HL 2VH5L 3RUGF 1EHNA 3HCVA 5FA3B 1QA9B 3RIAF 1E28B 4QRPE 3OKEB 1UXWB 1F8TH 3QDHA 4OCXH 4PJBF 5CKAA 4P5TC 2N4IA 4HIEA 1R5WA 3A6CH 4GRLB 3P9WB 5CCKL 1S7RA 3HAEA 1FE8L 5K9QI 4KZEH 3ULUL 1R5VB 3EFFA 5IF0A 3TIEB 1R0AH 1G9EA 3MBXL 4C56B 3SKOB 4LSRH 3TNNA 1ONQA 5HI3C 4M61A 2BNQB 4Z5RA 5C07B 2X1WL 3WIHH 1OD7A 3P4OB 2V9RA 3FQTB 3VXOB 4HJJL 2EXWD 4I0PD 4NFCA 4OBSA 5K33A 4CADA 1F8TL 4YHKL 3RPKA 2C7UB 5DRZB 3MLTA 5FECA 3AVEA 3U30B 3PP4H 2CR3A 3LKQB 3C60A 3KLAA 5DRNB 1Z5LA 3ZE2E 3ZTJG 1UXSB 1Q9OB 1IEAA 4F7TA 4KGJA 1JZ6A 4Z7WE 3IB4A 2O5YH 4QCIB 1KPRB 4G8EA 4K7PY 1FFQA 4P23D 1BD2B 4L1DA 4WHDA 5JPMA 1N0XL 4ERSH 1ZVHA 3C2AH 5IJVB 4D0BB 2R39A 5FIEA 1L6ZA 3KYMA 3DURB 4MJ6A 5JW4Q 2EDWA 1N4XL 1ODAA 1W0VA 3BRFA 2VWEC 1A7QH 5JUEL 1HNGA 3QAZC 1BAFL 3S37L 5IGXL 2R1YB 3GO1H 3ZT6A 4NUJB 3VFOB 1M7IB 3B3IA 3IDMA 4QWWD 5EG6C 1EXUA 1VKXB 1HH6A 2C3VA 3MRFB 1RZFL 5C0CD 5F96L 3ZSTA 1FORH 4RGOL 4X5LA 2ZPKL 1CI5A 1VA9A 3O11A 3UC0L 2Y5TB 5CGMA 1WITA 3X13B 4I0PB 4AJ0A 4LNVA 3ZYIA 5JHDD 2FX8L 3U4EB 1RZKH 1DN2A 4NYLA 2ITCB 1VFBB 2GTZA 4OZFA 2AXFB 2OBGA 1PGRB 3RVVC 4GMSH 1P84K 2K7PA 1QBLH 3MYZA 2VKWA 2R0WH 1BAFH 4P5KB 5L8LB 2VC2H 5HGDB 2N7AA 3EYUH 2X9XA 1XF2A 5IHUH 1A6WH 1LP9B 1GZPA 3VDAA 3UBXB 2BVOA 3LKNA 4V1DE 1NMBL 3FRPG 4M5ZL 5I1LA 4Y5YB 3MNVB 4YE4H 1RZGA 3DUUA 4RMRA 2OJZH 4P2RE 1NAKL 5L2KA 4KHTL 1E4KC 4CBPA 5ENWB 3QEUA 2WZPD 3O45A 3MYJA 4ZSOA 3TT3L 3SKJH 5CSGA 5HYJA 1CGSL 1ZTXH 2EDDA 3ISWA 3FN3A 3SDCB 5FOJA 2V7NA 2BXZA 43CAA 1JNNH 4OIIL 1A7NH 5F44A 4NQUA 1MFDH 3UDWC 4MSWA 2Z4QA 1M7DA 4Y16A 4XC3H 2FZ3B 4LCIL 3DETC 2Z92B 2E9BA 3N50A 4CUCA 4PJCA 3TPUA 2AK4B 4L4TB 4DAGH 2PYED 2GIYA 4IRJD 4HKJB 3S97C 1YNKL 4QRPD 4KRNA 3VXRE 2JJSC 4KKCC 1FFOB 4JKMA 1DEEB 3LD8B 4GUPB 1MEXL 3JV6A 4HAFA 3F62A 1MFAL 3JV6B 1A0QH 1ZANL 3LKOA 3ILPB 1DZBA 3OPZH 6CGTA 4XPGL 3VXMB 1EJOH 4Y1AB 2XV6B 1TETL 3RUGB 1A6AB 5IW3A 4Z7NE 2IANA 3HE6C 5E7FA 4XWGL 1D5ZB 3AROA 2CGRH 2I60H 5CJXA 5K59F 3L3JB 4R4BB 4LF3A 3RX8A 2GQHA 4M8QA 2UWEA 3AS3A 1YECL 5MEOB 2P7TA 3TEUA 1JIBA 2ATKB 4OGAD 5I30L 3EYSH 1NLDH 4G9DA 5BZDA 3U7WL 1HHJB 2ARJB 3VW3H 2Z35A 5JW4R 4L3EB 2Q6WA 4FTVB 4OCMC 4QY8A 4U6VH 1G1CA 3KPQA 2BJMH 3UXFA 3VD4A 1E27B 2CKBL 4NO3B 4I4WB 3ZE1E 3OKLB 4L8SC 1UJ3A 2DWEB 2A6KA 3P73B 5GZOC 3SBWC 4D8PA 3FJTA 5FUCC 4WI6A 3WD5H 3U46B 5T1LD 4QOKA 1SJHB 4WEBL 3GSVA 4OFVA 5HHOE 1IC7H 4OZFB 1T66D 3F58H 5HI5D 4HIIA 3WNMA 1K8IA 3MRBA 4JY6A 4FQHB 3UAJC 3MV7B 4OQTA 5JW5A 4QF1B 5T3XE 2DBJA 1OAZH 2ICCA 3LEVH 2RR3A 5MEQB 3KPSE 1A6VL 3IJYA 1P1ZA 4JRYA 3RVXD 5BS0A 4F57L 2XZQL 4GBXC 4DWHA 2G2RB 3MXWL 2UYLA 3CFCL 3QXDA 3I3DA 4RQQB 4CW1B 4ODUA 1CICD 3MRDA 4Q97A 3L7FB 1SY6L 1FZJB 1EVUA 3ZKNC 3ARQA 3SJVE 4MAYB 4R4NC 5AUMB 5EO9B 2DWEA 4MAYA 2H9GA 1Q0XH 2FLBT 2X4PA 1BIHA 2OL3H 4NOFA 3VFTB 2FX8H 3QQ9C 3N85L 4M7KL 3CFKB 3HPLA 5D7KE 2OQJA 2V6HA 2V7HA 3E8UL 2GJ6E 1YMMD 5T5FL 1TJHL 1RV6X 4FFYL 3BN9C 4WFGE 4Z7QF 1HILB 5FYKU 1F6AB 1QRNA 3TVMC 4XP4L 1GGCL 1OT1A 2Q76B 3O2DL 5L0QC 1XGTB 4OF0A 3PQYE 3HG1A 1T5WA 3Q6FB 1X5FA 2VDLH 4OJFH 3BH8A 1D5ZA 3MLXH 3EO0B 3F7YB 1DBJH 5B38B 1DBML 3O4OB 3ULUF 4JFFE 5C0IB 1YEIL 4HHAA 5L2KD 3BWAB 1XGYH 3B8SA 5DMIL 5SX4I 3G5ZB 3BP7B 1WBXB 3F7PC 1MRDL 2UVFA 3QXVA 2HKFH 1T4KA 4KRPC 3S4SB 3IKCA 1BEYH 5DJ6A 1IAIM 3QO1B 1FP5A 1SJEB 4N0YL 2RGSA 3H42L 3NACH 5EN2A 3DX6A 4EN3C 1B4JL 2DI9A 1FPTL 3U83A 5KVEH 3BIKA 3MPCA 1NSNL 3QCVL 2D03H 4CVXA 1U8MA 4R7NA 4F7CA 4ZS6C 2DLGA 1HINL 3V0AC 4N1EA 2XICA 5FV1L 5KSBA 1ZVYA 4HGWB 2XZCH 3RWIB 3A6CL 4HUWA 1RZFH 3G6AA 5IFHL 3O6KL 3UJIH 2ADIA 3KJ4C 35C8H 2H32A 4RWHA 2CGRL 2I60L 5CGYD 3T0EB 1IKNA 4AEIL 3ARDC 5KW9L 3LN5A 1Q94B 3EFDH 3O6FB 1MHHB 1CDCA 5CMAA 1NCBL 5KVDL 3U36B 1ZT1A 3ZT5A 3MXWH 1BFSA 1J1PL 3R1GH 1V7MH 3INUH 3NABH 4E5XA 1MELA 5KG9B 4LHQB 2IPUK 1HH9B 3M17B 1UACL 4EI6A 1YMHB 3LQAL 2VUYA 5E1HB 5I1LB 1KACB 4GSDH 3FQRA 1SVCP 2PR4H 3DVGB 4JO1L 1OCWH 2OJEA 2X2YA 3UBXI 5CFHA 5JW3H 3NZHL 2HT2C 4XXCA 1CE1H 3SGEH 1PG7H 4JFPB 2LU3A 3W9EA 4OIIH 4K8RL 1RUQL 4M7JH 4N0UB 4CDHA 3WFBH 4ZYKB 4M1GL 1CU4L 1PJ9A 4RX4A 4PB0L 4UBDD 4D0DB 3C60B 1KENL 3QJFB 4ZPTB 2MSPA 1U8JB 2VDQL 3AM8A 4LEOA 5D72H 4XHJC 1AGBB 2I07A 1CTNA 5GRUL 2YRLA 4XNMA 3ULUE 2HA1A 3QUZB 3K7UA 3LV3B 4GRWE 1GHFL 2A0LC 3RNQA 3TNNB 4N5EC 4H26B 1DSFL 3IDXL 2Y9RT 4Y16C 3HLAA 2A1WH 2R0WL 4BK4A 3HE7D 2AQ3A 3PHOB 3VGAB 3C8KB 3MV7D 3TN0D 3DRQA 3BH9B 2VISB 3ET9F 4LCUA 3NAAL 4QT5B 1F4HA 2R0LL 1A6AA 1DQQA 3PNWB 1FE8H 1FL3A 1IAIL 3G6DH 3BQUB 3KPRD 5GSVB 1KYOK 1WK0A 3CAFA 5D72L 5H94A 4PLOB 1CD1A 3CFIC 3C9NA 3CVIL 4HWBA 4OLWL 5I8CB 5JPNB 1MCWM 3KAAA 2BVQA 3LN9A 1CGUA 3IFNH 4HGMA 3O4LB 5DHVB 5KVEL 3BW9A 4RZCA 5GS3A 1XH3A 2F5AH 1J5OL 3I6KB 2D7NA 1II4E 1MVUA 2HJFB 3E3QE 3DIFA 4NFBA 4UNUA 5IOPB 1WBYB 4MS8D 2LFGA 3NH7H 2W9EL 3EW3B 5JDSB 4WJ5A 3RGVA 3P30L 1UM6L 4LCCC 4HGWA 5J1AA 3MACH 1ZS8B 1M7DB 3V4UH 4MDJA 4ELMF 1Q9KA 3L7EA 2IAMA 3FT2A 2ZUUA 4PJDA 3MJ7A 3STZA 1JF6A 3MUJA 4QXUL 4LSVL 3BZFA 4KRLB 2YEZA 1Z3GL 3QEUB 5L8JB 5E9DE 3MROA 5T1KD 5DJZB 2VC2L 4C54A 1HXMB 3B5HA 4U1MA 5EORH 4R4ND 4XH2A 2VRAA 4N8VB 2XQYK 2P5WA 4HD9A 2BNRD 1G7JA 1WWBX 5D2NE 2Z4QB 1DUZA 4JRXE 2APBA 1RMFL 4LIQH 3CU1A 2R2HA 5GGSY 2PYEE 4PJ9B 4B5EA 2FR4A 4KJYA 1YEGH 5LBSH 1RVFL 4XTRC 4KMLB 1NAMA 4ZSOB 5I6XB 3K2UL 1FNEA 2X4RB 1PEZA 5DK0B 3UPRA 1KSRA 4KPHH 2OCFD 1EEZB 3MOBL 2E3VA 5DYOB 4MLSA 1CG9A 1HSAB 1DBKH 4XAWL 4HSQA 4FZEH 2ENYA 2IH3A 5T3XD 2NY2C 4HG4J 1UH3A 2XPGA 2BSSB 2F74A 4PY8I 4LRIC 4P9ML 2X4TA 3CFKA 4JFEA 4P23C 4V1DD 4HIIB 3IDNB 5DD5H 5E2VH 3K8KA 1QACA 2GT9B 3NCJL 2EXYD 1F00I 3B5GA 3UYRL 1GGBL 4OLVL 2PNDA 1MCDA 5HHOD 1JGDB 3WHXB 4PJEB 1KLUB 2FGWL 3VXSB 1RZ7H 1A9BB 4JAMB 7FABL 4F7PA 4O4YH 3ULVF 3NFNA 5C0AB 3QR2A 3HZMB 5ANMA 4L8BB 1G9MC 1OTUD 1QBML 3O6LH 3VFMA 5JHDE 1NEUA 4ZUTB 2RBLA 4Y2DC 5DRZA 4P46D 4NQVB 5DD5L 4NOBA 3SQOH 5FM8A 1UJ3B 2VLRE 1QFWL 3IT8D 2F54E 1JYVA 2VXUL 1J1XH 1OWWA 1WSST 3R06A 1W72L 2QJDA 5JIIA 3IFOB 3QUKB 1JV5B 5D1ZA 1BOGB 4OM1L 3MRIA 1NGWA 3BIAX 1FO0H 5EFIA 2Q3ZA 1OW0C 2FX7H 1OLZA 4NQDE 3MRRA 4D9RE 3LQAC 4I5BB 1MHPH 3QQ3A 3NACL 4WTZG 1NGQH 4TNWF 3CFDA 3ARGD 5E99L 4PJEA 1MIEL 4NQCD 5D2LB 4M1CD 4LHUD 1BQLL 1FFPA 1XGTA 3MODH 1U8OA 1G7MB 1PVHA 2NY0D 3DROA 1KN4L 1FFOA 3VRJA 1AR1D 3U6RB 1J87A 3VG0H 3HZKB 2MPAL 3CFEA 4H5SB 4QXGH 3DX9B 4PBXA 4O2FA 1AQDA 4XP5L 2V5MA 1JGEA 4OFKA 4FOMA 3CMOH 4TULL 1A64A 1LGVA 2FX9H 3CZJA 2ERJC 32C2A 4EUPH 5KTEL 3T3MF 1Q0YH 4QHUB 3IXAA 1FIEA 1P7QA 1RAMA 3SDAB 4R4FL 3UTZA 3KPNB 1TQBB 3C9NB 1H3GA 3S5LA 4X4YB 1BOGA 3GSXB 2FD6H 3ZYOA 1OHQA 5BRZB 2VLME 4QXTB 1UZ6E 4GAJH 3DUUB 2WBWB 4Z7NF 3D3VE 1J7VR 4UAOB 2YBRB 3BP7A 5C09D 4LNRA 1QLFA 4CL7A 4XWOD 5DRWB 4M6ML 4K3EH 4PB9H 2V9QA 3MBED 4Y2DB 1V3JA 3QI9D 1C08B 1NL0L 2NY0B 3GBMH 4FFVC 3F5WB 1CT8A 2Y5TA 3V7AE 4RFOH 1JI2A 3AAZA 1AGEA 3AB0C 4JO4L 2FEEI 4U1LA 3UBXA 3QJFA 1XR8A 1TXKA 5SWSD 4K8RD 4L9LA 2DMBA 1S5IL 5J0BA 4JPVL 3CXHJ 5FB8B 5I74B 4R96A 2KDGA 2IAND 4K94C 3VRIB 5K9JL 1U58B 3KVQA 3MR9A 4UV4L 1L0YA 2ESVB 3MR9B 5D2LF 5EU6D 3GEWB 2X1OA 4X6BB 2IAMC 3B2VH 4NBXB 4U2ZA 3Q6GL 1XR8B 4RFOL 3GI9H 3BW9B 5DJXA 5D7IF 1S7UB 2I5YH 1P6FA 4N0FB 4XP1H 1SM3H 3HS0B 4Y5VA 1A1OA 4NO5A 5IBLC 3FFCA 2NY1C 5I1JL 4X9GA 5ERWA 3VGDA 3LHPL 4QTHA 1FIGL 5DC4B 4UT9L 4I77H 2KBGA 1W8NA 3I75A 3W0WD 5BXFA 3PGCA 2F53A 2GAZB 5FGBC 3OTTA 1INDL 2X4OA 2WBJC 1UWGH 3NZHH 1P7KB 4YHMH 4ORZC 4KMQA 1RSFA 3VFVB 1YDPB 2EECA 4HIXH 4Q9CA 3U0PA 5F3BB 3VFUA 1J5OH 2Q6WB 3ESUF 3L3OA 3RL2A 4LQFL 3CK0L 4CVWA 2YPLE 4NKIH 2NY3D 1LEGB 3RKDD 3HUJA 1F3DJ 1RHHB 2BJML 4PD4K 3WJJA 1NMBH 4WWID 1AH1A 3DX9A 4EBQL 3ULVD 4R97C 4KVCL 4DVBA 3V7MA 4ZPTA 4F58H 4F9PC 4Y4HA 3GSNL 2NNAB 5EC2B 3HB3C 4HJJH 2BXYA 3TA3C 2D03L 2APWA 3RKDC 5E00B 4NO0B 4PJ9A 3BPCA 1LE5B 2FR4B 5ISZA 5EBWA 5GISH 1FAKT 2NZIA 3NIFF 5SWZA 2NXYB 3GSOA 3NZ8A 4MXQD 4OUUA 2R0LH 3FOMA 4OZGA 3WSQH 1M71A 3NFPA 3RDTB 2LTQC 4PJHA 5H37H 4P46B 4P5MB 1T3FB 5CEYB 1TZHA 2G60H 2R56L 4GRLD 5I1EH 3WIFA 5DUBA 4WCYH 1EO5A 2ARJA 3OB0K 4D9LL 2YN3A 5TQ2H 5ETUB 1PEWA 3G6JF 3SKNA 4YDIH 2J8OA 3OKEA 1X5GA 5IFAL 1OGAA 2VLRD 5GGTH 2BSED 2DMCA 1I8IB 4GKZA 1ED3B 1RK0A 3HC4L 4Z7VF 5F88B 5FGCB 3S3JA 1C16A 2ID5A 3W81A 1JWMA 4HXAL 4WFFD 1KXVC 3P0GB 4X4ME 5SWSE 5HVFB 2D7PA 3LPGA 4OCSL 1FZOB 4J3OC 3S96A 3P77B 5ABDE 3BPNB 4NGHH 4GG6B 1PYWB 3QDME 4JFDA 3TFKD 4K94L 3S96B 1IGIH 4P9MH 3F7VA 1DQLH 5CINH 4MJ5B 4F9LC 1RFDH 4UTBH 1CE6A 1QFUL 4XAKE 1JWMB 2C9AA 3IS1X 1JHTB 2OSLB 4IRSC 3RDTD 1JPGB 2VXVH 3RWDA 1T1YB 3LEXB 1JHTA 2OSLA 4UT6L 5C09E 5JXEC 2R2BA 3KYOB 4TSAH 2OR8A 3V6OE 1MFBH 3KG5A 2FSEB 4JANA 5DMGC 1LEKB 4Y8DC 5E2UH 3WN5C 4BELD 1AGDB 5I74C 3MRDB 4X4MA 3V5KA 3GM0A 2A6JB 2CKBH 2IBGA 4C58B 1RURH 2G2RA 2KL6A 1ADQA 1K5NB 2VL5A 2D7TL 4UB0H 1SHMA 2VXQH 2XXMB 5HY9A 3IDIA 3OR7B 5EU7C 4M7LH 1INQA 1JPSL 4OLYH 4KWUA 3LN4B 5E8OA 4H20L 3T2PA 3IDMB 4LK4A 2B4CL 3I02A 5EU5A 3X11A 4QRUA 2PKDA 4KTEH 1MJ8L 3B9VA 1D6VL 4UUJB 1TZGL 5DC9B 4JZJA 3EO9L 1MWAH 4K07A 4ODWB 1B0GB 1K6QH 2XTJD 3T09A 3MZTA 4KK6D 3D9AH 1LO2L 1QEWB 1ZT7A 1V3MA 4AL8H 1BBDL 4R7DA 4RMSA 4D9RD 4NO0A 4HUWB 5C0CB 1FFRA 3TIDB 3UTTB 3MNWB 1OSPL 3L5XH 4JDTL 3VXUB 2FJGB 1NMCC 3VH8A 4FQXD 5AAMA 4POYA 3FO2A 4P3CH 2DQHH 4OF7A 3ME0A 3FQNB 3RP1A 2IPKA 5HTSA 1MUJA 2FJFA 2OP4L 4YGAB 1YECH 3MRPA 1W0WB 3CCHB 1H15A 3NABL 3QUKA 4PTUA 1NC2B 5HHXL 2FYYA 1MFDL 5C0BA 4JB9L 2I9LA 1R5WB 1TCMA 4KQ4H 2HWZH 5CWSA 4BFIA 5C0IA 1MVUB 3T0BA 1BOYA 4JFOB 2DM2A 3RI5K 1FYTB 1LO0L 3ARFA 2W92A 4NT6A 3H9SA 3NCCB 2X4QA 2CPCA 2WIMA 4I3SL 4S0SD 1U93A 2HRLA 4PS4H 5C8JA 2ZCKH 2VITB 4E9LA 1I7ZA 4LSQL 4BH7A 5HGDA 4OLEA 3BMVA 3BPOB 1IVLA 5GSRA 3GSNA 1Q9WA 5IJKC 4WW1A 5MI0C 4PLJC 3UAJD 4FQXB 3UYOD 1E4XL 4P2QE 4N5ED 2D7OA 4Y4KD 3GMPA 3VRIA 1S7UA 1FO0B 4PJ8A 5KSVB 1LDPL 4L3ED 1I1YB 1T66C 4XBGB 2K9UA 1YYLH 5D93C 5GGVY 1W8OA 2W0PA 3UTPD 3WXWH 1JPTL 1XEDA 2P8MB 4YZFF 1KJ2A 5HGAB 1XIWB 1WCBA 5L2KB 5DUPH 4Y19B 3IDJA 4JDZB 1DVFB 3SDAA 4N0FA 3LQZA 3QFDA 4JFXB 2YRPA 5BCAA 1MIMH 4MWFB 4JN1H 3CGTA 1FNLA 4ODXB 4XPFL 4MWFA 5EDXA 5FHBL 3CX5K 4NGHL 5K9QG 4KDTA 3V7AG 5JXEA 3ARBB 2JELL 1IGTA 3PWLB 3ZE0F 4HPYH 4KMTL 3FN0H 1FZOA 3BESR 3TP4A 3T65A 1A4KB 2BRRL 4F9LA 2O93L 4Y2DA 3A6OA 4HUXB 3QPXH 3MUY1 4JO4H 4OUOA 4LKXA 2E6JA 5IESH 1T6VN 2R69L 3LB6D 2HRPH 3FFCE 5GHWL 1MCPH 1FGVH 3QCTL 2MCPL 3H0TA 3P4OA 3ZSSA 2HH0H 3TZVD 1UYWL 4O2FB 2NY7L 3OX8A 4MNQD 5I1KH 2AXGB 3B9AA 4I3RH 4ZODA 1JHLL 3ULUC 4N8CL 2A77H 3OWEA 1QLFB 2GEEA 4U0RB 4EJ1C 1NBQA 3G5ZA 4N0RA 4KTDL 5CD3A 5LXGH 5JDSA 3QHZL 1IT9H 2ZCHL 2AXJA 4PD4J 4X6DF 5LCVH 2R1WA 5KZCD 3DO7B 1MRFH 4NNPH 2W0LA 4FQ1H 1BECA 1N7MH 3H3PL 1QRKA 3ARBD 5C08B 5JOFA 2EH7L 5J8OA 1JWSB 5FAAA 5JXAH 1Q9KB 2Y07L 2WAHA 4OGYL 3P0VL 3GIZL 1EAJA 2YOCA 3MUGA 3SDDA 2AK4D 4L4TD 4DK3A 3U46A 2NY4B 1YN7A 2NR6C 2X4UA 4KJWC 4PJ9C 1FNGB 3TGXA 1FZKA 1SVZA 3QUZC 4XNUH 5I6XC 4LLUB 4I4WA 4I5BA 3U30C 4NHUB 3G5VB 5H35B 3D39E 1IARB 2Z92A 4KDVA 5CIPH 5E95B 2NZ9C 5IB1B 1RJZA 1ZGLP 4LLQA 2NQCA 1XH3B 3CSGA 3U0PB 3RVUD 1OAUL 3OQ3B 3CC5A 2X4TB 3MV9B 4LFHG 1S7QA 4KZDL 2QHLA 1R24A 5A2KH 3BJ91 1S7WB 3SDCA 5GRYA 1X3DA 1HHKA 5DUML 2MKWA 5CLTA 1F11A 3HMXA 4YX2H 1YPZA 4X4XB 3CH1A 5BMFH 3BWUC 4OIBA 5B3NA 2AJYL 5KANI 2EDEA 4QTIL 5EU7E 4GH7B 5D7IB 1SEQL 2BP3A 3HUJB 4FQQB 5DT1H 4JQXC 1FZJA 3LPWA 5E2WH 1E27A 3UZQA 1M4KA 4OZ4A 1BF2A 2VXQL 3W9DA 4ODVH 1C5BL 3JV5A 2AV1B 4X80L 5F6IB 2FATL 4PJCB 2BVUA 4QRPA 4U6TA 5C08E 1T0MA 2IADB 4G9FD 4HF5H 2F15A 4IRJA 1YPZE 4YPGB 5EBGA 4E0RA 1NGYA 4JY5H 4FQIH 4XMPH 3GSNB 4D2NA 1IGML 3D2UB 4GAFB 3WS6C 3K2MC 4KK9C 3C60C 4Q6IC 1NEZG 3L5WB 4ALAH 4OCWH 3VI4F 2ZG1A 3OGCB 1MJUH 2AJUH 4LKCB 4OZHB 3PABB 5DTFB 5I0ZA 1YQ2A 1WFUA 4ZTOH 1I1YA 4GO6B 3KJ6H 4PJAE 5MEPB 3RTQD 1T0PB 3V4VH 4AG4H 4L4VB 5I8CA 1KPVA 4P99A 1DBAL 5ALCH 3N0PB 4DVRL 1JI1A 5I19H 1FJ1A 3OKMB 1Q1JL 4PJ8C 3P77A 1MJ7H 2UUDK 1B4JH 1MHPL 1U8HB 4BZ1H 3GSXA 1FLTX 2D4DA 3MODL 5C0BB 4LAQH 1WBZA 3KPLB 4ZFFB 3FT3A 5IMKB 5I30H 1MIEH 4UIMA 4NKMB 3E2HC 1FLRL 1LDSA 3HE7C 4NKMA 1GOHA 4LNRB 4I48A 4S1QH 4HT1H 3FRUA 1UQSB 2O5ZH 3BEWA 4J3SA 5DK3A 3HNVH 3S35L 4Z7UA 2Z8VC 1HCFX 4K94H 1QKZH 3WNKA 2E9IA 4WV1B 4TSCL 3NTCL 1PQZB 1U92B 4JFEE 1UWGL 1PQZA 1U92A 1FNHA 2ORBL 4P2OB 1G0YR 4XP6L 2DIBA 3DV4A 1OTSD 1EVTC 3PL6C 1UQSA 5E2JA 4G8EB 1KPRA 2V2WA 3BQUA 5C0AE 4XMLH 4DKEH 2H6PB 2F8VA 5SV4A 5LQBL 1DUYA 1WAAE 1RQ5A 4GKSB 5B22A 5J56B 1KPUB 1FAIL 3R0MA 1P9MC 2GTWB 2DM7A 5E4EB 4MJIE 4YK4C 2Q8AL 2BVQB 3STBA 3LPFA 1F42A 1IGJB 5IMKA 3BISA 1O5DT 1NEZA 1T22A 4OCRL 3G08A 1G6RA 4E42B 4YGVB 2DQIL 3QDAA 4HH8A 3VGHA 1PY4A 3QO0A 3WE6A 3LH2H 4GW1A 5B4MD 4WO4D 1E4XI 1PSKL 2CH8A 2PETA 2BNUB 4MA1B 3LQMA 1KJVA 3X11B 3IDNA 4IRZH 5FHAH 1BJ1H 4FQLH 3LS4L 3O6FC 4QRRA 4OTXH 4YBHA 5HYIA 4MCYA 1Y6NR 2OL3L 2K7QA 3U4BH 4P2YA 4F15C 4JFQA 5I1IH 3S37X 1AGBA 2D7QA 2I07B 4XVUD 4BH8B 4NUJA 3OKNB 3FO1B 1KJVB 4U3CA 5ICZA 2R8SL 5ID1B 4CRPA 5ICZB 4I0PA 4M5YL 2YC1A 1YJDL 3BX7C 4EUPA 5FA4A 2GTZB 4AM0A 2YUVA 3G08B 3LHPH 3HRZB 1IQDA 2IALA 4QGTA 1HKFA 3HMWL 1ORQA 1WWWX 1UB6B 4C56E 4WY7H 3G9AB 4X7FC 5TQ0H 1AP2B 1JNLH 1I3GH 1MCEA 3FQUA 4X7DC 4YHNB 1IEHA 1D5IL 1NQBA 1OARL 1X44A 4P5MA 4NN5C 2QR0A 2ADJB 2XIDA 4A2MA 1BGXL 5BQ7A 3C08H 3NH7L 4NC1E 3HI6L 5ICYB 3X14A 4PIRF 2X7LA 3CDGB 2NYYC 3K8MA 1AGCA 4TSCH 5CMAB 4G6AD 4MHHG 2AGJL 2QLVB 4LU5L 3EDFA 3NGBB 1I7TA 5T3ZL 1BP3B 5GJSL 3C5ZD 4UT7L 1UC6A 4DVBB 2HLFD 2Q8BH 3VH8G 2UZXB 3PXHA 2C1PA 1ZLWH 4YFLF 1N6QL 5T1MA 2ORBH 4WWKA 3BT2H 3RDTC 3U7WH 5F7LB 2DBLH 1B6UA 1E4XH 2G9HA 2VUOA 2VXTH 3TBVA 3GMMA 4XT1C 3CVHL 3I6LE 1B0RB 3CMGA 1FNFA 4R4BA 1EEYB 1OF2A 2H3NB 1WEJL 1ED3A 1RK0B 4JM2B 2W0KA 3MCLL 3I2CH 2AJZA 2Z31A 4JO2L 4PBVC 2ZG3A 3AUVA 1NCCH 2BCKA 3VXMA 2Q8BL 4FHBD 4L8SA 2X4NA 3CFBB 5IMLB 1MRCH 3GHEL 3S34H 3DI2B 3W39A 1YNTA 1MY7A 4XMKH 1H0DB 3WL9B 1FNSH 4UIMB 1CFBA 5D1XB 3K80A 1KFAL 4CVZB 4HS8L 1X6LA 1ZLVK 1A02N 4JLRA 3DVIA 1I7RB 1RUAL 1YJDC 4J4PD 4JZNA 3V8OA 3KXFB 4QHNB 4PJXA 5TH2A 3OKOA 5BV7C 2P8PA 4RWYH 3VWKA 3SOBL 5JHLL 2LE9A 4DFHA 5C0CE 4S1RH 1YZZA 2ESVA 1MJ8H 1JCKA 1U95B 3VFPB 3DETD 3AB0B 3OKLA 4I3GA 1ZA6B 3L7FA 1Z9LA 4KK6C 5BRZD 4WFHE 2EYRA 1MPAL 2EE2A 4LSPH 4ZUWA 3SCMB 4Y5YA 1JK8B 4OV6F 4LHUB 4LPVA 4RFEB 4ZUWB 3ROLA 3WDJA 4UB0L 3V5KB 4XVSH 1U41A 1Z2KA 4FQPA 2B4CH 1LEKA 1CR9L 5BMFL 5T5FH 3RJDA 1KTLA 1X5JA 3V5DB 3GDBA 3MLVH 3VGAC 4PUBL 4LQ1A 3RVWC 4TQEH 1CIUA 3VFGL 2QQLL 4ZUVB 1XZ0B 4PRBA 1XF3A 5DJ8A 2HH0L 3QDJD 3EOAB 3LQZB 4ZAKD 3RKPA 3RZCB 5EU5B 4P4KA 2XFXA 4ORGB 3CSYA 4PJIE 3RIFK 1CT8B 2DTML 3T0XA 5LBSL 4NPYB 3W9EB 4QRRB 2BK8A 3GK8H 2UWEE 4UT7H 4X6FA 2WWMC 5TDNB 2BMKB 3D85A 3EOTH 4KQ4L 1EO8L 2ICWJ 3GO1L 1DUZB 3FO9A 1L4IA 2IAMD 2MJWA 3MMEB 1BVLB 2EO9A 4I0PC 5T1DL 4QWWC 4JKPH 4MYWB 4BUGA 4PP1C 3RX7A 2DLFH 3IGAA 1NBVH 1ONQB 3TCXA 5FKPB 4WHTB 1WFTA 3DMMA 4M7ZB 4B7IA 4I0KA 3VXPB 4PP1D 3D5OF 2R0ZL 2FJGA 3D18B 3IFPA 4JQIL 4NUGL 4QKXB 2EC8A 1DN0B 2ZOKA 5DRNA 1DL7L 3NCEB 4HCRH 5E5RB 4CNIA 4BKLA 1HQRA 2VR4A 3Q6GH 1NUNB 5ACMA 2QQQA 3RVXC 2APFA 1P7QD 3PV6B 3P30H 1KC5L 4J3XA 4YBQC 2YA0A 5DQJA 3S4SA 1QA9A 3FZUD 5C2BL 5KN5A 2FYYB 4M7KH 3G6JA 4ONHB 5HHMB 5DD0H 4OI9A 5GGTL 1MI5A 1I9RL 4JZNB 4W6WB 3MFGB 1WBYA 4OI8A 5IEHB 5D70L 2YD8A 5DJ2B 5CEXB 1S8DA 4WTWA 2EKSB 2FBOJ 3IKCB 3S88H 3DUHA 3IXTA 1EPFA 4MDIB 5FUCE 1EJ6A 3MNWA 2Y6SD 1Q38A 3H7BA 4KKNA 2PTTB 3G5XB 4LVEA 4RMUA 4S1DD 3FMGL 2XA8L 1I4FA 2VH5H 1T1WB 1C5CL 2V2XB 2ZUVA 4BQCA 3VI4E 1J0ZA 3KPSB 1CR9H 2ZCLH 4MXVE 4R0LC 3P11H 2R69H 5FM5M 3UX9B 4NO5B 3MV7E 3MRIB 1MCIA 1F02I 5D7JB 5T3XL 4PB0H 4QNPE 4NWTH 1FAIH 3GMLB 5IWLC 3MTRA 4MNQE 2KZWA 5DVNA 4KHTH 2YA2A 3OJMB 5E6YA 4PRHD 4P23B 4I2XE 1OAQL 4JFPA 2NTSP 2XFXB 3QULA 1U3HD 3U2SB 5TQ0L 5C0DA 2VDNH 3O9WC 3EYVA 3L95B 5BOZG 2VDKL 4KHXL 3ILQC 3TO4D 5F89A 2F53B 3PGCB 2FIRT 5ISZE 4PJXB 1AGEB 4GS7C 4URTB 1NFDF 4S1QL 1VCAA 2LAAA 3EFFB 5IF0B 1IAKA 4WTXA 4GG6F 3MOAL 3D69A 3QRFM 1JPST 3AY4C 1JRHL 5KANG 3FB8B 4GKNB 5EA0H 3X13A 1JTPA 1NL0H 3EIFA 4MA3A 4MQXD 3FB5B 4J4PC 5L7XH 1M71B 3NFPB 4BQ6A 3QUYC 5MENA 1CDBA 1BZ9A 1TETH 1XCTB 4P2OA 4KK5C 1S7VA 2Z8SA 4TVPL 3BPCB 1LE5A 5A43C 2XKNB 2DYPB 1ZAGA 3BGFB 4M43L 2VERN 1LEIA 5C9KA 4G6ML 4MA7L 5CSZB 4LF3B 3OJDA 2D0HA 3NCFB 4LLYB 4L3EA 5DMYA 3W5NA 1IGCH 3TBYA 5ITFB 4GJTB 1OAZL 3LEVL 5IJVA 5CD5C 5DZLA 5DO2C 2G5BB 3BIKB 3MRQB 4YDJB 4JFHE 2ZUYA 3MV11 1AHWB 1I1AC 2W65A 5JO5A 1FV1B 3Q0HA 1P4BH 4JZOA 1WBZB 3QEHA 2BERA 3RWGB 4X4ZA 4LCWB 3P9MB 2GAZA 5EBLB 4OLZL 3TN0C 4W6XB 5CBEA 1QVOA 5JQ6L 2WWMD 1NUFA 1G6RL 4TULH 4S0TD 2F8OA 1OTTC 3FRUB 2A9ML 2ZCKL 4QRTA 5F7WC 1VGKA 4M3KB 1RK1B 4Q6YA 3T2NL 1FV1A 1GAFH 2BVPA 2ZJSL 3JUZA 4BQ8A 1FLRH 1CLOH 1F4YH 4ZQKB 2HVKB 2P49B 1JN6B 4OFDA 4PGDB 4OCYL 43CAB 1D5MB 5E6IA 4AQ1B 3G5VA 5T1MB 2HVJA 5MI0B 1DQDL 4QTIH 2GK0A 1GXEA 5F9JB 3G6DL 2EDRA 4OD2A 1G7LB 2CKBB 3HNVL 4ZOEA 4JGUA 5IBUG 3MNVA 3SDXA 3VFVA 4TUOB 3GSUA 2OJEB 1MLCA 4YHZH 5KN5B 2FEEL 4PJ5B 1CBVL 3GB7B 5H2BA 3MRKB 4HBCL 3QIUD 1DEEA 5C9JB 5HPMA 4MZ2A 2HLAA 4X9IA 1CLCA 4KV5F 3UBXG 3FQXA 2X42A 5EU4A 5AUMA 1ZLWK 2IG2L 2OK0H 4WFEE 4APQA 3VDBA 2XTJE 5TE4L 4PRAB 2HJKA 1FVDB 2NY1B 3N1GC 1JGVL 4U4BA 4ORGA 3T65B 3LKRB 5EOTB 4PRAA 3MMEA 1VEPA 1NMAH 4ZFFA 4Z7QE 1KCSH 1TPXC 2WANA 3NCJH 5A40E 4ELMA 2JKXA 3S36H 1U95A 2APTA 3STLA 3OAUH 5J9PA 2GITB 1K4DA 1B0GA 5FDWB 3C5SA 4NQVA 4PJBB 3D85D 3DSNA 1NC4B 4G8GE 4ZD3H 1BGXH 4PJEE 4QHMB 1UB5A 4L3EE 2FH8A 2ZG2A 3F6LA 3L5JA 3TBSA 4RA0C 1SEBA 1I85C 4ZFGH 5MEQA 4U1JA 5I75<