3WJLC

Crystal structure of iib selective fc variant, fc(v12), in complex with fcgriib
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
168
structure length
160
Chain Sequence
PKAVLKLEPQWINVLQEDSVTLTCRSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig gamma-1 chain C region
publication title Engineered antibody Fc variant with selectively enhanced Fc gamma RIIb binding over both Fc gamma RIIaR131 and Fc gamma RIIaH131.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 29
structure length 160
sequence length 168
ec nomenclature
pdb deposition date 2013-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wjlC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wjlC02
4R97B 3S3SA 2BFVH 4TQEL 2FSEA 4X6BA 1VFAB 2YKLL 1T21B 5F1NA 1ZT1B 4X4XA 4Y16D 2YN3A 2KDGA 2KPNA 3SCMA 4W6WB 3HI6H 4G9DB 2VXUH 2YRLA 3SDCA 5FYLL 3RNKA 5E8OB 4M8QB 5L2KA 1BAFH 1F58L 4PJ5E 3BOVA 1D5IH 3AU1A 1EK3A 4IMLB 3OB0H 1KCUL 2GSIB 3ULVH 1HXMA 3S88H 3WFZA 2IMNA 4YHPB 3TBVB 2VLLA 1KEGL 3QUYB 4K55A 1A1MA 6CGTA 3F65A 4L4VA 4Y2DC 3LQMA 5E1AA 3FT4B 2ID5A 1Z0MA 5CJBA 5E4EC 3N85H 4F7EA 1A3LL 3BDBA 2F8VA 5C0GB 4KAQL 4PY8J 3BUYB 5ACZB 3EUUA 3DV6A 3WUWA 4X6DE 4I48B 4JY5H 2DOCA 2M26A 1DDHA 1MHEB 3IJYA 1WIUA 3DURB 3D0VB 3BI9X 4YPGA 2VLJB 3ARBA 5ADOL 5HI5D 2A1WH 3MYZA 5GGSY 3TPUA 1MI5E 2FECL 1MPAL 1BFVL 5EZIH 4PRNA 3BIKA 3AMLA 3HE6A 1GC1C 1NLBL 1RUAH 2NR6D 2WBJC 4F15C 3FN0H 2CJUH 3HI5H 1LDPH 4KY1L 1NDGB 5J13C 3LSOB 4Y5YC 5C0ND 5IV2A 2OJZL 1DCLA 2GY7B 5BZWA 5IFJB 4KJQC 5I1LB 1XR8A 2B8OT 5I8CA 2W60A 2I07B 3TZVA 1IBGL 4M7LT 1TJGH 1OM3H 1T22A 3BZ4B 4ORGA 1CK0H 4IJ3B 4MA1C 3B2UD 4HXAL 2XTJB 1CFSA 4CMMA 1TITA 3Q5TA 2BNQD 1U8KA 5ISZE 4QLRA 4UILH 3U7AA 4HMEA 1U8MB 4XC3L 1ZEAL 5BV7L 3N1GC 4Q9RL 5FYJL 1I1AC 1NCBH 2X4TB 4EBQH 1OLLA 3UJIL 3OAUH 3O6MH 1I3GL 5CMAA 4K3JH 1BIIA 5FYKE 4DUXA 4ZPVA 1RK0A 2CXKA 1QFUH 4NBZB 5GJSH 3SKOB 1M7IA 2COQA 4H26B 2R8SL 2UZIH 2CKBL 1ADQA 2Z8SA 4OZHF 4PRIA 3MODH 4FOMA 4I0PC 1O5DT 5HYJD 5IESH 3STBA 2X4RA 3L3OA 4LBEB 3S37X 5JPNB 1YJDL 1A3RH 1XGRB 1E4KC 1A6TB 3GBNH 2DMBA 3DSFH 4YK4C 2G60H 4LMQI 1NFIA 2EICA 4D2NA 3VMPA 4HK3J 4NC0B 4PG9A 1WT5C 5T5NF 2WWKO 4APQA 4YHYB 1KTLA 3F6LA 2X4UB 2DM4A 1RZKH 3O41B 4I18B 4LSSH 1RU9H 1MRCL 4J6RH 1L0YA 3TVMA 3LEVH 1UKSA 3SO3B 1RZJH 4L1HA 1HQ4A 4PJ5A 3L5XH 5LBSL 4R26L 1KENL 4YHZH 3UPRB 4ODSH 3P77A 5IVXE 2FB4H 5E94A 1WCQA 1NBVL 5TE4L 2GJZA 2RGSA 5T1MB 3V52L 3MV8B 1AD0A 1C7SA 2KQNA 2VNCA 5JLZB 2D7MA 1JZ6A 1PJ9A 3GJFA 2JF1A 1T1XB 3FQRA 4GKNB 3FMGH 2YUZA 5JDSB 2YK1H 4KTEH 3FB6B 1ODAA 2N4IA 5L2JA 1TJHL 2ADJB 2AJZB 5A2LH 1A6VH 5CBAA 3L7FB 3CVHA 3IFNH 1X4YA 4PJBB 4O2CA 3MZTA 1A7OH 4W4OC 5LCVH 4KROB 5D5MF 3VW3L 4H1LG 2YOCA 4WGWB 3DX7A 1MCCA 4IOIA 3D2UA 4NQED 1EGJA 3GSRA 1K2DB 4ELME 3CMGA 5DRZB 4HDIB 3V6BR 1V3JA 1SYVB 1WK0A 1C5DB 1ETZA 5JW4Q 3FT3A 3KWWA 4LVHB 1GGUA 5FM4A 2A9NL 2AXGB 3S5LG 1W2KT 5IHZB 3MFGB 1E4XL 5DD5H 2ZSWA 1BP3B 1TZGH 4HBCL 1SQ2N 4BK4A 5ERWA 1IAIH 4LLUB 5DTFA 4F9PA 1SM3H 1CF8H 3RDTD 2JCCF 5BQ7B 4X9FA 5GS1C 3T2NL 4TNWK 3IDYC 1XGTA 3Q6FB 4I13B 1BQSA 3I6KA 3HC4L 3Q0HA 3Q48A 2UZXB 4LSUL 2CRIA 1M7IB 3WHE0 4OGYL 3JWDL 2OXHA 3CK0L 1R3HB 2BERA 2W9LA 1UGNA 2R1YA 3STLA 3GMPA 4FQCH 4Y8DC 1FNLA 4YBLC 4GG8B 4OLVL 4TVSa 5GZNC 4HKJB 1NEZB 2B5IC 3QYCA 3W0WB 5I2IA 3T3PF 1QSFD 3OZ9L 3PWPD 3KPQB 1WISA 2JKXA 5FECB 4KHTL 1CU4L 4RWYL 4IS6B 1BZ7B 1B0GB 2EE6A 3ZYJA 4LCYA 3B9AA 5KTEL 4Z7UA 3B43A 5J89A 4N8VB 2MHAB 3BT2L 4PLKC 2CLRB 1NSNH 4H5SA 1QRNA 4YC2B 1I3VA 2EDRA 2NZ9D 1J1OL 4LEOB 2I5YH 2V17H 4NHCH 2DQCH 4K71B 1I8MA 4EKXA 1ZAGA 2VL5B 3DUSB 4AENB 2ED7A 1T5XB 3A6CH 3T0XA 1I75A 1U9KA 1IEAB 3MJGX 4ERSL 3J8F7 4PRHB 3RVTC 4U3HA 2C26A 2J2ZA 1UB5B 1BJMA 1F11B 4ZUTB 4JFYB 4WWKD 4GRWH 3UBXA 4O2CB 5KBNC 3PQYE 4LGSB 2GJ6D 1YEIH 3SO5A 4Y19A 3CXDH 4R7DA 1D7FA 5HHOE 5IB4B 4GOSA 5E56A 1FPTL 3IFOA 5E8DL 1VGEH 1ZWIA 2FX7H 4L4TD 2DQFB 4OF5A 5GRXG 3MQIA 3BQUA 5D70L 2UYLB 2C7UA 2HG5B 4IDJL 5CD5C 1A0QL 1F00I 5INDA 2PO6B 3VXNB 1EJOH 4ZSOB 1RZKC 4LCWD 4JFDD 1JZ7A 3M8OH 1JVKA 2VDQH 3U9PH 4PGJA 3DIFB 15C8H 1T7WA 3QIBD 5E2WH 1LEIB 1OW0A 1WBXA 3TNMA 3MFFB 1RZJC 2WIMA 5K33A 4MJ6A 3PWLA 4MHHI 4GBXC 2FWOB 1OVZA 3RAJH 1KIRA 3NIDF 1FBIH 4P9HC 3Q6GL 5DRNA 5A16B 5J9PA 1UEMA 2XFXA 3VWKC 1ORSB 4LP5A 3LN4B 2DBLL 2F19H 3DO7A 2XWTA 1ZGLA 1JK8B 1IM3A 3X17A 3FOLB 3WS6A 2H32H 3QUZB 3QT2A 3V4VH 3UC0H 1OLZA 3IKCA 4HIJB 2P49B 5ICYB 3G6AB 3ZSSA 3LPFA 4UV7H 4HLJA 4XC1L 2GIYA 3DMMB 1DBML 2EDDA 4L3CA 1DQLL 2ICEB 2EE9A 2FECI 5EIIA 1E0OB 1YN7B 1U3HB 4OCYH 1N64L 3I3EA 2GSGB 2O5ZH 4NDMA 4O00A 3GIVA 3BZEB 4JM2C 3RQ3A 5HI4C 4EI5A 3QEQB 1II4E 3QP3A 3W82A 5E6IA 1F4YH 1QR1B 2ZPKL 1Y18A 2GCYB 3HKFA 4OBRA 3BRGC 2ZOKA 3F12A 4RGNB 3ZDXE 4HUVB 4GS7C 3RPIB 4WUUD 1BF8A 1TZIA 3EO9H 2ZUVA 1XGUA 1ZHBB 3PG2A 1G6RL 3K4AA 2VDLL 4K9EL 4M48L 4JCMA 1GIGL 1RIHL 2DLEA 4PJ8B 3IDXL 3QCTH 2V2XB 3KNBA 5FUOH 5HDQH 4MSWA 1HSAA 4MXVE 4XMKH 1BVKA 1PG7W 3TP4A 3WO4B 4NRYA 1TJIL 4O2EB 2XICA 2IAMC 1S9YA 4JDVA 4NQXA 4H0GA 4N0YH 2DQHL 3HLAA 5C0AB 2P48B 3EW3B 4YE4L 5MI0B 1JJUA 1SMOA 4Q2ZB 1T1YB 1HWGB 3P0VL 2IMMA 4OFIA 4UDUA 3W9EA 1KJ3H 1M71A 3AY4C 4J12A 5K9KA 1ZHNA 4ZQKB 5E24E 5IOPA 4ZAKA 2XQBL 3LD8B 3PQYA 4NSKA 5EUKA 3GBML 5DO2C 4DQOL 1YEDA 2Q8BH 1U58B 1CICC 3MJ7A 3MJ8B 1EX0A 4MJIB 2AW2A 2W91A 3QUKB 4YO0A 1J1PH 1EIBA 2J6EL 5DJ8B 1G6RB 2N1KA 5CAYB 3P40A 1WGOA 4Y2OA 3HNVL 3QO1B 3T0WA 4POUB 3V7AE 3VE0B 3SDDB 1T4KB 4OIAA 4FZ8L 1AO7A 1AKJA 4NFBA 4QOKE 5GGUB 1DBJH 1T03H 5CGTA 3OKMA 1I7UB 1OGTA 2P8MB 5DD3H 1HI6A 3CDYA 1RZ8A 3BXNA 4P23B 5HTSA 4YHMH 2XFXB 3KPSB 2CRYA 3MRRB 2XWTB 4QO1A 3T2OA 4MXWL 3FB5A 5EOQH 2B1HH 1OGAB 3PDOB 5INCB 4NKMB 2CLVA 3WDIA 2XY1A 1YDPB 3JZ7A 3NABL 2YEZA 2IADA 1RAMA 4EZMA 2W38A 3U30C 4QXUH 3DUUA 5J11C 3D9AL 1QFHA 2VABA 4U1IA 1W0VA 3L5WB 5J3HD 4D9LL 4RDQG 5DUMH 5IW6A 2LTQC 2XZQL 1HZHL 2YXFA 1SEQL 4YHOH 4YBQD 2YD5A 1JYNA 1A4JA 5FOBB 1KN2L 2KKQA 2EXWD 5DVOA 3W39A 4QWWD 3F7VB 5B21A 2Q1EA 4HHAA 1XIWA 1JNLL 5IROA 5MEPA 4R2GB 1QRKA 1RD6A 2ICWA 4KI5D 1E4XI 2AK4B 3OQ3B 2AEQH 1GJIA 2YA1A 2FCBA 4GRLC 4KPHH 3HLAB 1CGVA 1JPGA 1RZIA 4HUXA 5C6TH 3NTCL 4XVUC 4Z0BL 4WW1A 4AK1A 3UAJC 4EJ1C 1Q72H 2VLME 1WV7T 4YNYA 1W72B 3BWUC 2UWEB 1C16B 4E41E 3U7YL 4AM0A 4KVNL 4GO6B 5J12C 5KN5B 3GB7A 4Z7QF 4O51A 5C8JB 1MFAL 3CDGB 1CI5A 4L8SA 4LRNH 5DMKB 5JOPD 4FN0A 5T3XE 4S1QH 3LRHA 1YZZA 2X4NB 4UB0L 4W70A 1K8IB 5DA0B 5C92A 4N5UA 5DJYA 4N0UB 3ES6B 5DRWA 4LMQE 1TZHB 5T3ZD 2F54E 2CD0A 2E7LA 5F9OL 3MGAA 4GW4B 4X6CA 1N5YL 5LGHL 3VCLA 1MLCA 2AXFB 2OJEA 5CZKA 3VXUB 2PYEB 3DXAD 3FZUC 1RUPL 3VXTA 1DN0A 1R3KB 3HHRB 4D0DB 3RY5A 4BJLA 2EIZB 3P73B 4PV8B 2HYMA 5EC2A 4H1LB 4BZ2H 1IGIL 2EDLA 2NYYD 1LE5A 5MEQA 5DR5H 2NXYC 3REWA 5E2VH 4QOKA 2H41A 4GG6F 3MLXH 2UVEA 2QKIA 1P9MC 4F80A 4PV9B 1RI8A 5TQ2H 3WLBB 4U6HA 1EO8H 5TFSL 3WIIL 4MAYC 1HXYB 3AGVA 2IFGA 4XMPL 1UA6L 2DJSA 3IU3A 5EFIB 2QHRL 3TIDA 1WZKA 1WWAX 3CPLA 3OKEA 2E6QA 2XIDA 3S5LB 1HHJB 1ZA3B 5TE7L 1L9MA 2Z35A 3R8QA 1NLDH 2E3VA 2HJKB 3CSGA 4PJFE 3W2DH 1QLRB 3EYFA 3CVHH 3D39A 3HG1B 3Q3GA 4YHLL 3IDJA 3SGEI 2CDGA 3MLRL 2EDEA 3SKNA 3MRHA 4GAFB 5DD1H 5JPMB 1K3ZA 2ZUQB 3MC0A 1MFBH 4MHHG 4LASH 3C5ZB 3KPNB 1LO5A 3OSKA 8FABA 4PBWD 1U42A 3SCMC 2YPLA 4JANB 4P3DB 3E1F1 5GSRB 4K94H 2VN7A 2CIKB 4FQXA 1YQ2A 3FHQA 3QCVH 2HFEA 2HN7B 4M5YL 4F8QA 3EZJB 3MBXL 3TNNB 4QXGH 1SMAA 4NO0A 3UYPA 4MGXA 2ENYA 1INQB 4Z7VA 3LEXA 5JHDB 2JK5A 3L3HB 1JYXA 4N9OB 4LAQL 1HNFA 3IKKA 1QEWB 5ESVB 1IGYB 4F3FB 1H15B 3FTGA 1WLHA 1AE6H 1U8LB 1ZS8A 1A9BA 4WI6A 2C4XA 1QFOA 1RULL 4YGVA 2LQRA 4PRAA 5DI8A 4AM0B 4JO2H 3QI9B 5JUEL 3EDDA 5J6GA 5CWSB 1FFRA 3MBEA 3NA9H 4UQ2A 3C6SA 1F2QA 4NQDA 2ZUTA 3ULUL 1F4AA 2ARWA 5KZCD 3ARBC 1T1ZB 4RGMC 5FYKH 5E0QA 5EO1A 5DUBA 3QXUA 5C0JA 1JWMB 1E28A 1NGWB 4PGZA 1FYTB 2R0KH 4QNPF 5DRWB 4JFEA 4YXLL 2OCFD 2E9BA 2NXZD 1WAAE 3QWOA 5DHVB 3X3GL 3O3BA 4KZEL 3MMEA 1R24A 4Z7NE 1MLCB 1X9QA 2R56L 5ICXA 1OAXH 3FB7A 5IMLB 4PJGA 3PE9A 3VGHA 4N9GB 4GW5A 2F54A 4A6YL 2P8PA 5CS7A 1FFOB 3VFVB 2A83B 2VC2H 1EAJA 3RY4A 4JN1H 2VR4A 4HIIA 1ZHKA 1D6EB 2E6JA 4DKDC 4POZC 2NY1D 4LKCA 5KANG 3SQOL 3RWCB 1KLUA 3TZVC 1EMTL 1XCQA 4ODHL 5SWZD 1PDKA 2WQ8A 5BZDA 4XNXH 4OLYL 4Y4HB 1IGFH 1CLZL 2EKSA 3QUML 3KGRA 5CIPB 1EZVY 3GJEB 4HC1A 2HTKC 4FXLA 4KV5F 3OPZH 4C54A 3NFNB 1VB9A 1B6UA 1FVEA 1MCPL 2NTSP 5DDHB 1FCCA 5BS0D 2A0LC 2NX5D 1D5XA 1QVOA 1IGML 3H9HA 4BKLA 1OOAA 1BWWA 5IM7B 5DGQA 4ODWA 1WQVT 2FGWL 2CDGB 1KJ2B 1U93A 1I8IA 3QDJA 2RB8A 3H7LA 4PJCE 5TH2B 3IDUA 5CJXA 1CFTB 5IF0B 4GMTL 4LIQE 4XZUB 1PX3A 4FMKA 4MXQC 3VFTA 4MQ7A 4UZGA 1AXSA 1EHXA 4OM1L 5F3HB 1WBYA 1FHGA 3OXRB 4S1SH 4KKBC 1IC7H 4NO0B 4YHNB 3QFDB 3U36B 1PY4A 5DT1H 3ULVD 3SQBA 4UIKL 5FYLE 2PW1B 3T4YA 4APQC 4PGBB 1SBSH 3HS0B 1EEQA 1MUJB 3E6HA 4CGTA 5D2LE 4V1DB 1KCSL 1OARH 3IJHA 4NC2B 1MCIA 5TF1H 4TUJB 4YXHH 3TVMC 4EEEA 3RGVD 3WL9A 5F93C 5TDOA 3FQNA 4WI2A 4YGVB 4EDXB 1VEPA 2DDQH 4U7SA 2HRLA 3EOTL 4Y5XA 2IPKB 1LEKA 4LGRB 2Y36L 1E4WH 4QRPD 1VEMA 4G80B 2IQ9L 3O6FA 3T3ME 2J8UF 3RU8L 3S34H 3QNZB 3SDAD 4ALAL 1NC2D 2YUVA 2GAZA 3TO2B 3QWRD 4PJHF 3NOIA 4GLRI 2AJXL 2NY4C 5I76B 1QSEA 2ARJA 1FFNA 3QA3A 2P5EA 3S4SG 1I85A 3UJJH 4UQ3B 2XTJE 1OAUH 3F58H 1CLYL 4S1RL 1BBJB 3OAZK 4YIQA 3MRQB 4MB4A 5I6XB 1S78C 4XRCB 2A6KB 4J8RA 2VIRA 2BXYA 3FB7B 1PSKL 4N1CA 1UWEH 1UXWA 4KH2A 4GW5B 4PLKD 1HQRB 5CLWA 2NNAB 4K94C 4OGAC 4F7MA 1WAAA 4Z7WA 1IE5A 3RZWA 4JDTH 5SWSE 1A9EA 4ONHB 2A6DA 3MACH 2LE9A 5IB2A 5IUSA 4E0RB 4LLAA 1U8JB 2P1YA 4NWUH 4LVNC 1R0AL 2DQIH 3MRDA 4XTRC 1JV5A 3D18A 2BXZA 3TT1L 5DJ6B 1ULVA 1UC6A 4LLMA 4XMLL 3DX8B 4FQHB 1RZFL 1YECL 5D96C 5DEGA 5B8CA 1FN4A 1JP5A 5FYJE 1DVFB 2BVQA 1Y6MR 2X6MA 3L7EA 2C3XA 5FO8A 3OHXA 4MB5A 2CIIA 2Q20A 4OZIF 4P5KA 1C5CH 1QACA 3QDJB 4XAWL 1QSZA 3OJDB 4OGZA 5FDYA 4NKDB 1A6AB 2Q6WA 5E08H 4ZUWA 4M43L 3FQTB 4ZNEE 3ZTJH 1KPVB 1FH5H 3P4NA 3VXMA 1JF5A 3O8XB 1F3DJ 1LO4L 3OKOB 4F57H 5CD5D 5BMFL 4RX4A 4PJCA 2JIXB 2H8PA 4TSCH 3TBSA 4WV1C 3MV8E 3IDGA 2H9GB 2QQLL 3NPZB 3RUGA 1NCCH 3LKNB 4XWOD 2DYPA 2AK1L 5EOTA 1N6QL 1JI2A 4JLRB 2J88H 3E6HB 2FX8L 3DBXB 4YDKL 4HQQH 5F6IB 4PJBE 1HHHB 3QFJA 5LJYH 3BPOC 3DRTB 3HA0A 5KSAC 3FQNB 4G3YL 3I6LD 4ZTPH 4TRPL 2PYFA 3L3DB 4NO5B 3WNOA 3EYVB 4FQIH 5D2LA 3MROA 5E5MA 3VWKD 2I9LA 3P4OB 4HJ0D 3E8UL 4WW2F 1DQML 4LPWA 4BQ9A 2WLZA 4RFEB 4BSWA 1RJYB 5I9QC 4ZPTB 1YPZA 1WCBB 3UTTD 3ZYZA 4DOHB 3V6FA 2I9TA 3QXDB 1GHFL 3WNKA 1RFDL 1XFPA 3RWFB 5B22A 3RVVD 3WLWD 4ZYKA 1KJMA 5LWYL 3K1DA 3C6LD 5D1XD 3LQAL 3WN5B 4L5FH 4QT5A 3WFDH 4IHOB 3OAYH 4JHAH 5EUOE 1CYGA 3CC5B 3U0TB 1FNHA 4K3EH 1T20B 3V6ZA 1IAIM 1CT8A 3FO1A 5HHMB 1AIFA 2Q8AH 5EBMA 1MIEL 4JM2D 1CG9A 1J8HB 2EIDA 4PJAF 2V6HA 4H25B 4NM4L 4NUJA 5T1DL 3MSPA 5GHWH 4PREB 1CVSC 4P46D 2BC4B 3F7YA 1X5IA 3BQUC 2XXMB 4WU7A 4J3UA 3ULSB 5I1HH 2EZ0C 1MAML 3D48R 3HUJA 2GI7A 5K59E 1OAKL 1LO3L 3JXAA 5C07A 5TJWK 5T3ZL 4CN1A 4YR6A 4ODBD 1PZ5B 3AM8A 3NIGF 2OL3H 4MD5B 4KRPC 3OG6B 2A77H 1ZVYA 4XHQA 4NNYA 3LIZH 4D0BB 1HN1A 3NCCB 5SWSA 3N9GH 3GIZH 1OW0C 2L7UA 5C0DA 3TA3D 2JB6A 3GEWB 4ZNCD 4HPOL 4KDVA 4WJ5A 4M03A 4D3CL 2BSSB 3OGCB 2VN4A 4Q58C 3W0WE 4G5ZH 3PF2A 2ZZUT 1NGYB 2XA8H 5B8CB 2YD9A 5D93C 5CEYB 2HT3C 1S8DB 4LKXA 3MCKA 3BPCB 2BOCB 1BQLL 2YD4A 4G8EB 4KQ4L 5C0EA 3OHXB 4PJ7B 1WUNT 2D7QA 1AP2A 5F3BB 3IFPA 4FQQA 5ILTH 2NY5C 3QO0A 4J7RA 1CD0A 3CZFA 4CVZA 3ILQC 4DFHA 1HSBB 5E2JA 3WS6C 1YMHB 4U6XA 5D1ZD 4HXBH 1EEYB 5D71L 1YYMH 1AHWB 2EYRA 4YDJA 3IXAB 3ARZA 1JF6A 3WS3B 2NW2B 2EYTB 2AJUL 2CKBA 1MF2H 3WCYA 3QPQD 2X7LA 2O61B 4XCNB 5D72L 2B2XL 3GMNA 2BHYA 1IZKA 4FP8L 4EI5C 1J87A 1B4RA 1VCAA 1ZKAA 3KPPB 5JW3L 3O9WB 5E6IC 5AG9A 4P4KA 4WEBH 3FFDB 2AABH 2PYFB 3WFBH 2VE6B 4HPYL 3AS2A 3H3BC 3FRUB 4DN4H 2E7MA 5BRZA 5TPWL 1W0WA 1ED3A 3O3EB 3KPRA 3RTQA 5T5NG 4X7FC 2BCKA 2NTFA 3MNVA 3D0LA 5CILH 1JTPA 3EDKA 2BHZA 4PPTA 5DMYA 4OB5H 2O5XH 4G8FB 5C6PB 3K2UL 5I19H 3UJTH 4ZSOE 1AXTL 4MNHB 1KGCE 2AQ1A 4XCEA 3U79A 1E6JH 4LQFH 5GPRA 2GUOB 4JFQA 5D7JA 5D7IB 3WFCL 4GKSB 1YNLL 3MLYH 2CR6A 3I6GB 4HGKC 5F7WC 3L9RB 1S7QB 2E8YA 1LP9E 3BFOA 3MGOA 4ZAKC 5D1QD 3FFCE 2HKFL 3VFSA 1BBDH 3OR6B 1U8PB 3UO1H 4ODUA 3F7YB 4JFFE 4U1SA 4J4PA 5K9OB 4L8CB 4NCC1 1IGJA 5FYKU 2WINA 5DJDA 3MNZA 3PGCA 3GKWH 1I9RL 3MRLB 4ONFH 1AR1C 4NO2B 5HHXL 1QLEL 3V5DA 4G7YL 1MY7A 4DZBB 4JRXB 4Y5VC 2VZOA 1FAIH 1WZ1L 4EOWL 3H9ZA 4PLJC 3VG0H 1D9KD 1JWUB 3S4SA 1V7NL 4DKAA 4GRMA 4LCUB 2A38A 2OQJA 2WIIA 4JDZA 4JR9H 4G6JL 1OPGH 3CDFA 4FTVD 3EYOB 4MZ2A 3SE9H 4KK6C 3GMLA 2CMRH 4M6MH 2DQUH 1OTTD 5E99H 3LRSB 4HMDA 5KVEL 2BVOB 4OGXH 2IC2A 4RGNE 4Y1AB 2R0ZH 5DJAB 1GVIA 1JZ4A 1A47A 1RIVL 1NFDA 3S36X 4K23H 2K3TA 3PABB 5I16B 4MA8H 1DLHB 5KOMC 4OI9A 3FO9A 2BFVL 2EYRB 5EU6D 5HHQA 4LGPB 3QCUL 3MZGB 4K7PH 3TBWA 4M00A 3LPWA 4Y0GA 1WFNA 1MH5B 3A6BH 5LG1A 5SX4I 1XF5B 5ETUA 3ZSTA 4LLDB 1Q1JH 3EHBC 3H9SB 4PGCB 5C0AE 4KMQA 2JELL 2VXUL 3DETC 5FGCB 2DQDH 4P59H 3OKKB 1J5OL 4X5XB 2HFGL 1ZLWH 1BAFL 5FO9B 2O5YH 4NNPL 1X6NA 4IRJB 4HK0A 4G6AD 2NXYD 4XAKE 4WO4B 2R2CA 3V4UH 4PFEA 1LO0H 2XOTA 3KXFD 1GRWA 3IDNB 5FOJA 2YWYA 2O26U 3VXSB 4DEPC 3ULVL 2IAND 1F4WL 3JV6B 3MNVB 4KKCD 3MXWL 2DWEB 4MJIE 4UIMB 1XIWC 5IROC 2D9CA 3P11L 1XR9B 1N0XH 4LAJH 1YUHB 1MWAA 2NY6C 5C09B 4J3WA 1U8HB 1Z5LA 3DVGA 2I26N 1KJVA 3VXOB 4NUGH 2RFXA 3UMTA 4JFOA 2UVFA 1EO7A 3SJVB 3VFOA 2A1WL 1DE4A 4N90D 5CZXC 3BSZH 3P9MA 1KB5A 3DGGA 5EZJB 1TQBB 2VLKA 1LNUB 5ANMB 5GGSB 5D7KD 3TYFA 5KVFH 1G7JA 1MIML 2HLFD 2Z91B 4ORZC 3KPSE 1CDUA 1LP9A 3KPMB 5DQDL 5DJDB 4L8SC 3FN0L 2CJUL 2FO1A 4D0CA 5KVGH 3HI5L 4M3JA 43CAB 5JOFA 1N6VA 2VDRH 5D2NB 1CD9B 2FJFB 3TT3L 1OP9A 2EH8H 2Q86A 3IS0X 2E7LC 1HCVA 3D87B 3QB7C 3TO4A 3T0DA 3S4SB 1CFVL 1TJGL 2PUQT 1QBLH 4ZXBD 2XQYK 2XWJB 1NC4A 1BM3L 2WIIB 5B38A 1E6OL 2BY2A 3I3BA 3V0WH 5DWUL 3GSWB 1NANI 4IRSB 3CLFH 1U8OA 4DN3H 1WC7B 4JHWL 5H37H 2VDKH 5FGBA 3IVKB 5JNYA 1MCFA 1BJ1J 4TPRH 1UKTA 3OAUL 1OD9A 3O6ML 3T4AA 3ESVF 2VUOA 4U6VH 3HE7D 3ZE0F 3T0ED 2BNQE 5K93A 4I3RH 1KXQE 5CSBA 1DLFH 4HIHA 2NY3D 4TOYL 4XNUH 4HKZB 3LQZB 4QRSA 1HEZB 3ET9F 5IESL 2AK4E 2QSQA 1P7QA 5GIRB 1WIOA 3VRIB 1KC5H 1UB6B 3GBNL 4XX1G 1A21A 4CVUA 3DSFL 3QJFA 5F7UA 3HC3H 1T1WB 2G60L 3JVGA 3HMWH 2J3SA 3BEVB 3ECBB 2BNRD 4NQCD 3VJ6A 3G5VB 1H5BC 5HYJE 1MCNA 2EDFA 3WDJA 1B4JL 3CFJB 3ARFD 3CFBA 1SJHA 4NWTL 5FM5M 4LSSL 4XCCH 1BQHG 4FQXC 4KVCH 4CU6A 1IKNA 4Z76A 2D2OA 1RJCA 2FBJH 5C0BB 3LEVL 2MKLC 4QRUB 3WBDA 4Y16A 1EO5A 3C2AL 3L5XL 2HJLA 2DM3A 1MWAB 4LEXL 4BH7B 5IVZA 4LQ1A 2ZSVA 2W07A 5ACMA 1T66C 2FB4L 1FJ1A 3O6KH 1PG7L 4YDVA 5DXWA 1K8DA 4PJDE 4O2FA 4TUKL 4MCZB 1JHKH 3KR3L 3HAEA 1DE4B 4OUUB 1FIEA 3VXUE 4ONGH 3S96A 4Y4KD 2DM2A 4LLWA 4HJJH 3MYJA 5AZ2L 1A6VL 3MBEC 4BUGA 3T1FB 4MXQD 5LCVL 3O3AA 5HGGS 5JQHC 4OLXL 3NCEB 5F7NC 5TQ0H 1UQSB 1RUQH 3OB0K 2KZWA 1IM9D 3MLWH 2I60H 1LQSR 3SKJH 4UBDC 4M8VA 2MQCA 4L4JA 5KVDH 3NACH 5E8PA 4QHLA 4FQ1L 4LIQH 2I25N 2Q86B 4JY6A 4MWFB 2AXHA 5SX5H 4WUKH 3HNTH 4NQVA 1Y0LB 1VPOH 3C60C 5TDPB 3WXWL 2BVEA 4TQEH 5HYQB 5H2BA 4NCDA 2QR0A 2YKLH 3QEHB 1UVQA 3LKRB 3HG1E 4OZFG 4G9FB 1G7MA 1TVBA 1JZ5A 1TZGL 3BWAA 1HYSC 1SM3L 1ERNA 4HX1B 1HH6B 1CTNA 3BUTA 4LHUD 5EU3A 1BZ9A 1F58H 4NT6B 5A2KH 4K7FA 3VRLE 4L29A 1PKOA 3BE1L 1KCUH 4P2OB 3DX9B 4HIHB 3ALWA 5EO0A 4R8WH 5J6HA 4QRSB 4K7PX 2YPKB 4LSTH 3O4LB 1FYHB 1DP0A 3WIFB 2BNQA 1R3JA 1S78D 3MA7A 1AH1A 3QDMB 4RGOH 1A3LH 5GS0C 1MI5D 2LFGA 3QNXA 4Q6IB 3QEUB 5IFHH 2ADGA 4HH9A 5CJXC 1YY9C 3VJ6B 1CFNB 1RZGB 2XA3A 4KZDL 3UTSB 1NGQL 4V2CB 1MPAH 4IMKA 1RMFL 3P0YH 4JKPH 3MRIA 4YPJA 4Z76B 1DQJB 1G7HA 2PTUA 1M7DA 3KYNA 1FCGA 5HYJA 4NNXB 3SEPA 3E2HB 1QSFE 1N5AB 2H6PB 1NSNL 3ARRA 1UADC 1T0MB 3QHZH 5F1IB 5I1DA 5IIEA 5EZOH 2BVPB 1T83A 1H3XA 4KY1H 4ELKA 2C3WA 1C1EL 1NCTA 2I5YL 3GSNA 5IFAH 2DQCL 2ESVB 2WK2A 3L3KB 4L9LB 5E6ZA 2OJZH 3EJZD 5DFTA 5ISZD 1IGTB 2SEBB 3ARUA 2CK2A 2CDEB 4H8WH 4Y5XC 1BX2B 4WEUD 1JGDA 1IBGH 5D4QA 4PG2A 4LVOB 4JFXB 4PJDA 3O6FC 4NN6C 2DI9A 1CE6B 4EQ2A 5FYKD 1U92A 2IBZY 2IBGA 3OG4B 3LKQA 1DEEA 3T0AA 1S9VA 5T1LB 4F9LA 4Q9RH 5FYJH 5GZOC 1D5BB 3SDXA 1PYWA 3PXJA 3ULUE 1XF4A 1A7RH 3K2MC 3R06B 1I85C 5F7YC 1CXIA 1I3GH 4HG4K 2FX7L 4JFHE 2JB5H 3FN9A 3MREB 5FA3A 1BHGA 2GJ6E 4CADA 4JG0H 4M7ZB 1F90L 4Z6AT 2WWMD 5BVJA 5FHBL 3ZE2F 4ZFOB 4AIXA 4MX7B 3QJHB 4PTUA 1UVQB 5KSAD 3TCXA 4ZOCA 5C9JB 4L4TE 1EXUA 2VDQL 4X0KA 5KAQF 1EEZB 1I1YA 4JZOA 3BP4B 5E2WL 1S7RB 3GMRB 4NQEA 4UAOC 5DMIH 1KIPA 3C8KB 3PWUB 3WEXB 4U1LB 4YFLI 1G0XA 3EDFA 4LVEA 4LNRA 1JE6A 4JRYD 1LE9A 3EBAA 3RAJL 2FO4B 2MPAL 2X44D 4PJ9D 1QO3B 1ORQB 3PL6B 2Z31D 3IF1A 4R0LB 1NFKA 5D5MB 2E9WA 3BO8B 4GAYA 4R96B 5D7LB 2N7AA 1XF3A 2BMKA 3MUJA 4LPVA 2OSLB 2XPGB 5KJRL 4WTZG 4RA0C 3UC0L 1VADA 1F4XL 5TE4H 3MRKB 3RDTA 1DQDL 4NJ9H 4DUVA 4P4RB 1GGCL 3V52H 3ZKMC 1ZT7B 3GHEL 3H0TB 5FCSH 5I75B 5B4MD 5ID0B 2VO5A 4LK4A 1Q9OA 3S3JA 1MRFH 5C71A 2CXGA 4HS6A 1ZVHA 2YA2A 1JF1B 3QUYC 1KPUA 3N1MC 4ZD3H 3AMKA 4XBGA 5IG7A 3KPOA 3G9VA 5DQ9A 1TTFA 1F4YL 3T65B 4MLIA 2DB8A 2JCCB 3O11A 2DM7A 4EI6B 1A14L 1I7TB 3TGXA 4DVBB 4C56B 3UTQB 5DHXB 3GSNB 3GRWH 4U1KB 5F1SA 1QSFA 3QCTL 3S6CA 5HDQL 1A6ZA 2EO1A 2FNBA 3GHBL 3PWPA 5J56B 5EZLA 4NKQB 2NW3B 4UT6L 5IEHA 4NYLA 1WWCA 2A9NH 5JQ6L 3SPVB 4NN5B 2X40A 5HHPA 1OQOA 2OLDA 3ILQD 3RBSA 5TE6H 4HBCH 4EXPX 5IWLC 3K4DA 2L0DA 2F8OA 4FXKB 3V8OA 4Z7UF 3K3QA 2P43B 1FFPB 1CFQB 1IL1B 5IQ7H 2VAAA 1I1RA 3KLHD 2Q8BL 3BIBX 2DQTH 4P5MA 1J0KA 4EN3D 4MD0A 5CP3A 4OGYH 3CK0H 2WUBH 5L8KB 2XTJC 4RMSA 2PXYD 4WWKA 3FQWB 4U3XA 4URTB 5GGVH 2GJ6A 2G2RB 3ROOA 2IH3A 4RAVA 2WWKT 2DI7A 2X1XR 5B39A 1QYGH 1SYSA 2DWDA 2A73A 4YBHA 3LKOB 3AM8C 4L4TA 1XGPA 1T03L 1MCHA 1EHLH 1KCVL 1S7XA 3LV3A 3VXRD 1CU4H 2P7TA 4RWYH 5DD3L 2OK0H 2VXQL 4AT6A 5KSBA 3K8LA 5HJ3A 4A6YA 5FA4B 2HVKB 4MCYB 2APWA 4RFNC 5ENWB 1XF3B 4LCWA 4JFDA 4DW2L 1G0YR 4HFWB 3G6JA 3QIBA 5JXED 5I8KL 1JNHA 1J1OH 3U4AA 3U7WH 3UZEA 3QUMA 3T77A 3AS1A 3RWIA 3GNML 1PQZB 1UENA 5BV7C 5HGBA 1OCWH 4OZFA 3DX6B 2NMSA 4QXUL 5I1AB 2BRRL 3B9KB 3FO2B 5FO7B 5HHOD 1F6LL 4J3OC 3BPLC 4KTYA 3ARYA 3QG7L 3F6IA 2DLHA 2NY2B 4XP6H 1KPUB 4AZ8A 5ITFB 5C0RH 1NL0L 1KELH 3WE6B 4Z78A 2WNGA 3PNWB 3SGEH 3BESR 2Z9TA 4C59B 1JIBA 3L3GB 3V5HB 1YEJL 1FRGL 1CLCA 1X5HA 4NFDA 3T8XB 4LFHD 1H3GA 2ADFH 1FPTH 3C5JB 3ZL4L 1YJDC 4QHKJ 4XPAH 4HKXA 5EU4B 1A6ZB 4PRPD 4P4KC 3MNWA 4U1NB 2J5LB 5LGJA 1J8HE 4S2SB 4BH8B 1JN6A 2XQYG 4IDJH 5CSZB 2AEQL 2WP3O 3GKZA 4WFEE 4KPHL 3BKML 3RTQC 4CUCA 2MMXA 3HRZA 3PGDB 5IW1A 4K07A 5KSVA 1KCKA 3FQXA 4XBPA 3RWHA 1QG3A 4X8XA 1Q72L 5IMKB 1FO0B 4RISH 3L3JA 1AQDB 1BQHB 2EYSB 2FZ3B 4WUUA 5I66A 2QL1A 3CLEL 4H88L 1A02N 1MRDL 3B83A 1JWSB 1JFQH 4XNQA 5D7JC 3TYGH 3EHBD 1MJ8L 3GK8H 3Q6GH 3VXQB 2QQKH 1EA9C 4LRNL 3DETD 3BYYA 4PUBH 4HG4J 1BGXL 1FNEB 2DBLH 4S1DC 2GITA 3L95B 2EDBA 2X1PA 4RIRA 3ARED 4JB9L 5IR1B 3LKSA 2W1NA 3GUTA 2APBA 4J4PC 4OBSA 4C83A 2CDFB 1LWRA 3HMXA 5HGHA 1DZBA 4XC1H 3KYOA 1IARB 4L1DA 1DBMH 5DFVC 5JOPE 5F9WB 2ZCLH 1DQLH 5EO9A 3STZA 4E5XB 5JIPA 1MY5A 1TCRA 4EVNB 2UWEF 2R2BA 2VSCA 1N6UA 1N64H 5JXAH 5T3ZE 1K6QH 5E8NB 5HJ3B 2NY6D 3GBLA 3DO3A 5DR5L 2ZCHL 4LHQB 5E2VL 4LOUD 1JPTL 3MLXL 1O7VA 3G5ZA 2ZPKH 2Z93B 1VGKB 5TQ2L 4HUWA 4TN9A 3MGTA 2PN5A 2UV3A 4HWEL 3QSKB 1AGFA 2Y23A 1A1NB 2Q7YA 1G6RH 3R1GL 2VDLH 1V7ML 3THMH 3HAEH 3RWIB 1NLDL 3X13A 3W2DL 4JHBA 1PEZA 4I4WB 1TJIH 1HKFA 2DQHH 4R7NA 4RNRA 4YE4H 5TF0A 1CD1B 3EYUL 3DNKA 4OT1H 1BJ8A 1Q8MA 1MFBL 3JWDC 3QIUB 4YC2C 5BJTB 1IAMA 5F9JA 1GGIL 3QDGB 1H3UA 3U6RB 2QV2A 3LB6C 4P5TD 2WAHA 3TCLB 3QCVL 2VZ3A 1RUMH 3HR5B 2XRAH 4QXGL 5FCUH 4ZFGL 3GBMH 5D7IE 4R90L 1LVEA 3UTZA 2HLAB 1NCWH 4OKDA 1PAMA 5IT2H 3FQUB 3QIWB 2J6EH 1NGZA 3TN0D 1I3RB 4WTZA 5JW4R 5D6CB 3ABZA 2D31B 4U1GB 1J11A 4KUZL 1I4FA 3U2SA 2IJ0C 2Y06L 2QSVA 3HNVH 3NFPA 1IC4H 4XH2A 3JV0A 3AAZA 3BKCL 4KJPC 3LDBC 4N0FB 4ZDHB 3AB0C 4JO2L 4OF3A 1CGWA 2DIAA 4TTDD 2DQEL 3NA9L 4YQXL 4MA3B 4GXUN 4XNQB 1KLGB 1BEYL 4ETQB 2EDWA 3VG9B 1MELA 3ARXA 2PO6C 4M5ZL 5FYKL 1UACL 3CH1B 1KTDB 2EC9U 2H2SC 1GZPB 4R3SA 2NY0D 4CMHC 5A43C 4GLRH 5C70A 1WTGT 3GUTB 3RI5F 2YSSA 4ZS7L 2DQGL 5BO1L 1FSKB 2GK0B 1JNNH 3VMNA 3JTSB 3NVQA 1SEBA 1WBZA 3KLAA 1RJZB 2EXYD 4X98A 1ES0A 3EO1B 4Y1AE 3ARWA 2X4PB 4HS3B 1FZMA 2R2HB 4HUUA 4X83A 4JN1L 1IGCL 4PJXA 1W72H 1MLBB 4D9LH 1CDGA 5A2IH 3TO4C 5FHAH 1MJUL 3JTTB 1SEQH 3S3PA 2V7HB 3CSYB 2QQQA 1NGPL 1MFEH 1XAUA 1Z0NA 5CGYC 3QZWA 3VFMB 4JZNB 5CP7A 2DJ4A 3ARDB 4QY8B 4HZLA 4JREB 3MV9B 3D25B 2ERJB 1UZ8B 3DXAA 4X6CF 1RPQA 5FGBC 5F8QC 1JNLH 4P2QD 5IQ9B 2Y5TA 1S7WB 2VLMD 3RZCB 1ZGLP 3EOAA 4ZO7A 3BN9C 4E41D 1HOCB 3MLUL 5HY9A 5GRVL 3O3DB 3VD9A 2ZKHL 4P2YA 3I3DA 4RGNC 5BS0E 1EFXB 2BOBA 5DQJA 3AS3A 3FO0L 5C09E 3B8YA 4H1LH 3C60D 5HGDB 1CFBA 4OLEA 4KVNH 1ZXQA 4X4ME 1DUZB 4PJ8C 5F7LB 5KSUA 4S1SL 5IVNA 4F7PA 3L1OL 3GO1H 5HI3C 3SJVE 3IDIB 3JVGC 8CGTA 1MFAH 5DT1L 4IIQA 2H2PD 4GG6B 4M1GH 2FIKB 4IBLT 4ZFFB 3AXLA 3PIQA 1AGEA 1SBSL 2W65A 2R2EB 4U31A 2YUXA 1QA9A 1ZLSH 1IKNC 2X9YA 4WU5B 3VFUA 5FUCE 5F9OH 3JV5A 2CUMA 2A9MH 3AAZB 1FZKA 4BSVA 2BRQA 3X14A 4MNGB 3VFWA 2DDQL 4Z8FH 5D2NE 4XP9L 3KYAA 3P4LA 5IK3A 1F3JA 5HD8C 3LN5B 2O93L 4K9EC 2APFA 1IGIH 4NZRL 1U91A 2V7NA 1IEBA 1MVUA 4GKZB 4TVPD 4Z7VF 4TULH 1U8IB 1C7TA 4FQLL 5DJZB 1YY9D 5KS9A 2BSRA 3F58L 3B6SB 1ZT4B 4X99A 3WIIH 2VLRB 3ZKNC 3OTTA 1GXEA 2QHRH 3U0PB 3U9UA 2HMID 3DROA 5TE7H 2X5PA 5FV2A 4PP2A 5JDJA 3GSOB 4XI5C 1A64A 3BP7A 43C9A 4AMKL 1FZMB 3O0RL 3X11B 3TPKA 5IB5A 1BD2B 1P84K 5ESQA 1FZJB 5SV4A 5HI5C 1MCLA 3CCHA 4Q9BA 5FUZL 3MLRH 2ATPA 2YBRA 3V0VB 3MACL 4OI7A 2NR6C 4UI2A 5FB8B 2ATKA 1DBBL 3C09B 2MQ3A 4LDOB 1L7TH 2GY5A 3MBXH 1MHHA 3ZE1E 1JI1A 5ESAA 4Y2DB 1CE1L 3SOBH 5C0NC 1PKQB 1CTOA 3B3IA 4PJGF 4LAQH 4PBVC 5GZOD 5DHVH 4DWHA 3DHJA 2KH2B 3TIEA 4FFWD 4Z0XA 3VDAA 1B88A 2V9TA 5SWZA 2X10A 4N1HB 2V9RA 2BOBB 4JAMB 4F7CA 5JW4M 4X7CC 3N1FC 5MHSD 3FONB 1FH5L 4OLZL 3CD4A 1ZHLB 4F57L 5JUEH 3G5YA 3FOMA 2AV7A 3S36L 1N59B 1T89A 3MO1A 3JUZA 2WBJB 3OKDA 5BS0A 3VFGH 2NX5A 3ULUH 4W4OA 4UTBL 1HHIB 4F15B 4RWHA 1E27A 2Q76A 3QUXD 3VWJD 1CXEA 3AXLB 5C0CB 2QADD 5CIPH 1TVHA 4X4MA 4EIZC 1KTRL 4PB0L 5E6YA 2J88L 3IGAB 1IEHA 4M61B 4IMKC 1TETL 1SY6L 5J13B 3DLQR 4Y5YB 3MRGB 2GTWB 1JRHH 4WDIA 5E4IA 4P9ML 5B3JF 5DJCA 5JZ7D 3X3GH 1BREA 4K3DL 2R23B 1T83C 3MCLL 1KJ2H 3QHFL 5IB3A 4ZOAA 4N8PA 4MA1B 1ZA6B 5FF6A 4A6YH 3U46B 3I85A 2APVA 2ZNXA 2YMXH 3D3VB 3OR7B 1IEBB 4NFCA 1I1AB 3SQOH 4I8DA 5JMRA 4L8BA 1EMTH 5KS9B 4G9FE 4OLYH 4QYOB 3RGVA 2EDOA 1Q94B 4KUCD 5EN2B 4NHUB 3MV7B 2EIBA 3UTTE 4F9LC 1W8NA 2QJDA 3QUYD 4HKBB 4QRPA 1MCPH 4U6YB 4I0PB 3M1BA 1I7ZB 5HGAA 5GHWL 3SDAA 3RRQA 3BKYL 1NC2A 3QWRA 1WIPA 2FGWH 4HWBH 5I1HL 4M93C 1R5IA 4YK4B 2VXVH 1GGBH 2VLJD 4GMTH 3O4LE 3C8DA 1J0YA 1S7UA 2OL3L 5J4MA 3QDME 1YMMB 2DLIA 2A77L 4M1DL 3LIZL 2IQAA 1ACYH 4LARL 1TCMA 3N9GL 4OM1H 1AGBB 2J8UB 4FFYL 4Z5RB 35C8L 3P9LA 5MERB 4PJHB 4LL9A 4G5ZL 2FDBP 5LQBH 3HZYA 4HJGA 4PRDA 4UIKH 3CX5K 3DOSA 3B3IB 1M6OA 4QHUB 1K4DA 2V5RA 3U0WH 4MD4B 1WAAF 4Z7WF 4JY4A 1CL7H 5T33H 3RX5A 5LAXB 4AY0A 2DD8L 4WGVB 1CGYA 5HDBF 5C0FB 3BEWA 1XF2A 4LSRL 3RX7A 5IB1B 5T1KB 1CIDA 32C2B 3J7HA 3BD5A 2Y36H 2ESVE 3WJJC 2XTJD 5CEXB 3RDTC 1F42A 4HXBL 1JMZA 2ADIA 2IQ9H 3OKDB 4ALAH 4K7PY 2CRZA 3V95A 2RHEA 1PD6A 3G08A 4OZHE 4OCSH 2D7TH 2AJXH 5DRXB 1QBBA 3QQ3B 1L0QA 1UXSB 1NJ9A 3S97C 4S1RH 4PJ7F 4QRTA 1XEDA 1WFTA 4WEBL 5EOCJ 4D9QE 1I1FB 5DJCB 1J0ZA 1BFOB 2WSKA 3WFBL 4R4NC 1EJ6A 5F88A 4DN4L 1CR9L 3DRQB 1OSPL 5HVFB 2YD3A 5IB3B 1OF2A 2QTEA 3P4MA 3IETA 4OZIB 2MQ0A 1XH3A 5H35B 5DMGD 2W0FA 1YNTB 2F53B 5EC1B 3RUGF 4OB5L 1D3CA 2O5XL 5E03A 1RK1A 4RZCB 2QHLA 4YFDB 3KDMB 5GS1B 1P7KA 1R0AH 3IDYB 5FYJD 4QTHA 3MRBA 4XXDA 4XMLH 3MLYL 4PTTB 2PCPB 1Q0XL 1U3ZA 3VWKA 5DD6B 1YECH 3PV6B 3VI3F 2NZ9C 3EO0A 2Z0BA 3QQNA 1NCAL 1FLRL 3BMWA 3DHMA 5DFWH 3UTTA 4CW1B 4YBLB 3OKNB 5DK0A 3OJVC 4BZ1L 1LK2A 1YPZF 3MV8D 5CBEB 2EH7L 2B5IB 1LDSA 3ULUC 4Y4HC 5D7LE 4ONFL 3C6LA 1P84J 5D1XA 4M43H 1AD9A 4WWKC 2R1WA 5FAAA 4X5WA 1ZMYA 4WW2B 3VH8A 3D69B 2PKDA 3VG0L 4JM2A 5D9SA 3WUWG 1BPVA 2QQLH 2IGFH 4KROD 4P2RB 4DVRL 2IH1B 4P46A 1P7HL 4QCIB 3OAYK 1N6QH 2FX8H 4X4ZA 4JR9L 1MVFA 1OPGL 4OCXL 3SE9L 1FVCA 5LGKA 2CMRL 4TNWF 2JCCE 3GGWB 2FL5B 5L7XL 4G3YH 1NANH 2GHWB 3PXHA 1RSFA 3HUJF 4PJAB 4OGXL 1IFHH 1KG0B 4I2XB 4C56E 3QIBC 2LU4A 3TA3A 3SGJC 1TPXC 5ID1B 1WZMA 1ONQA 1Q9WB 3BHBB 5IEKA 1PZUB 3BPNC 4FTVE 4O5LH 4XNZC 5C2UB 1BOYA 2AAVA 5EDXA 4XBEL 5C08B 3UYRL 1VKXA 3PHOA 2VDML 1GHFH 4ZS6D 3AY4A 3QXTA 3PWVB 5EPMB 1NDMA 4OIIH 5LWYH 1Q1JL 5DFVD 5GSVA 3V5KA 1U8QB 3P9WB 3LQAH 1CGTA 2DQDL 3IYLW 4P59L 5TDNA 1MHPH 1FL5B 3FT2A 4HS8L 3MUY1 3FRPA 4HWZB 5ECJE 1JHLL 1QLFB 2O5YL 3ILPA 1NAML 1U8NB 4PJIA 1MIEH 5DSCA 4CDGC 1I9JH 3GMQB 5D1ZA 3V4UL 1T04B 1LO0L 2HT4D 4NM4H 1S9XB 3MRNA 4KJYA 4CDHA 3GSUA 3HPLA 2UY7A 1PVHA 1R3LB 2XXCB 2P5WB 3NGBC 2W92A 3K0WA 4UDTA 4XPHH 5GGRA 2PR4H 4JKLA 1MAMH 4DZ8B 3FCTB 3DJ9A 3W0WD 1OAKH 4OFYD 5T3ZH 1MAJA 3W5NA 4GBXB 4QRRB 3G5XA 3BDXA 4P3CL 4NUGL 4NO3A 4U1JA 5DJ2B 2VQ1A 1RIUH 3HI1B 3NCBB 4PRBA 2ZJSH 1A2YA 4HGWB 4D3CH 1G7PA 1GOFA 2A6IA 3WNNA 4TVPL 1WSST 1DUYA 5H94B 1A7NH 2D7OA 2Y7QA 4KQ4H 4O4YL 2P24B 3GMMA 4LLQB 3LB6D 3HZMB 3TV3L 1CDBA 2GT9A 1F6AA 2PF6A 4QXTA 2XZAH 2AJ3A 2VDRL 4PRHD 5D7KE 4U2ZA 5MENB 2J8OA 3GSQB 2EH8L 4HT1H 3QNYB 3SKMB 4JM2B 4YAQB 5D71H 5IJVA 5D1QA 1NUNB 1AGDB 1EPFA 1P1ZA 2VJXA 4KJPD 4GS7B 5HYEA 3KJ6L 3QXAB 5D72H 3V0WL 2B2XH 4OFPA 4U1MB 4NZTL 4WNQA 5HYSA 5JW5B 4DN3L 1Y6NR 1JZ8A 4QGTA 3MR9B 3CX5J 5DK2A 3RWEB 4UU9B 2VDKL 2YD1A 3MLVH 4OAWB 5F8RC 4Q0XH 4HPYH 5JMOC 4EUPA 4U49A 1F2XK 2PO6D 1UT9A 5DS8B 2IAMB 1D9KA 1KGCD 4I3RL 4K3HA 5CHNA 3NIDE 4PR5A 3ETBF 4QRQA 5E2TH 3IS1X 5EBWB 1MOEA 4XX1E 3ROLA 1BLNB 3K2UH 1CS6A 1UYWL 4FTVA 4G43A 4LP4A 1A6WL 1AXTH 5GSVB 3FFCD 3LRGA 3MRCB 5FDWA 1C8PA 1PW3A 3E6FB 2ITDB 2H32A 2HA1A 4JFFD 3HMWL 1CICB 3RL1A 4LF3B 5DJXA 3WFCH 1AJ7L 1G7LB 2XKNB 4KMTL 1DSFL 2OR9L 5F6HI 4G8GB 4XCCL 4RAUA 4X8JB 1FL6A 3GSUB 3MLTA 1NFDF 2A6JB 5EU6A 3QUZD 2EECA 2FBJL 2BNRE 2VZ1A 3ARGB 3DMMD 4LSPH 1GZQA 5F7DB 1UJTA 2BY1A 3TBYA 4XB8A 1I9RH 1KPRB 5J3HC 5HHXH 1U3HD 5ICZA 4YBQC 5J57B 3E3QE 2DTML 4AH2B 1AFVL 3QEQD 3K1KC 2HVJB 3BMVA 3V2AR 1G7QB 1X7QB 1B0RA 4M6NH 3KXFA 4QWWC 4X7TA 2A6IB 5BVPH 2IANA 4BFEA 1OHQA 2YRZA 1QFWH 4HJJL 2LABA 4RMQA 4S0TD 1L7IL 4RGND 2VITB 3FKUS 1N3NA 2NLJB 4ZUSA 1JHTA 2CO7B 4G8IA 1X44A 4XP4L 2XN9B 2ZOLA 4C57C 4UUJB 4NKIH 4G6JH 4KI5C 5E9DB 4NJAL 4PJ8D 4FXGB 4LCCB 3U4EA 3VD7A 3PDDA 4BFIB 1U3YA 2MOVA 3PWNA 5FKPB 1XGQB 3U30B 3SKJL 4JFPA 5HPMB 5J11B 5KVDL 4A2MA 3GMOA 3NACL 1RIVH 4KRLB 5C0AD 2J7LA 2YS4A 3LQAC 3EIFA 1FV1A 3HPJB 3HNTL 4WUKL 1VPOL 4V2BA 2LTQB 1TQCC 1T6VN 2E27L 1T2QH 1FFQA 3QCUH 5GRZA 3K7UA 2FJGA 5J06A 4XAKD 5E8EA 2JELH 1UCTA 5I1EL 3CFIC 1PY9A 4QHNA 1LP9F 5HD8D 1J5OH 1OD7A 4MJID 1U3JA 2HFGH 4YZFF 3UBXG 1P4LA 4JGJA 4DCQB 4NNPH 2ENSA 3OX8A 4HIEA 4OF7A 3GM8A 4GRLB 3BH9B 1AHWC 1MFCL 1F4WH 2P8LB 2HT2D 5AD0A 3MXWH 1J05B 4R8WL 5A40E 4ZXBA 2OI9C 3SDDD 3P11H 5I8OH 2X9WA 3ZKND 4LSTL 1IQDB 4HMCA 4KTDH 4RGOL 2NYYC 5J12B 2FBOJ 1MHCA 3KYMA 1A1OB 5IFHL 4M3KB 3D85B 3O2WL 4XI5D 4P23D 1FL3B 3RX8A 2G9HA 4XP5L 4CRPA 3KPSD 5CJ5A 3SE8L 2W9EL 3U48A 3HE7A 3T0EA 1T0NB 5F9AC 2E6PA 3GSXA 2ICWJ 2V9QA 2DAVA 5I74B 3P0YL 4RAUB 4JKPL 1C12A 3PWJB 1OGAD 3BGMB 5J1AB 5EBLA 1MIMH 1NMAH 3GSVB 1YA5A 3BW9B 4IIQC 5DQDH 2DKMA 1YN6A 1ND0B 3F7RA 3F7QA 3QHZL 5EZOL 2X4OA 5ACLA 3CNKA 5IFAL 4DJMA 2BNRA 4NQCA 3TT3H 1I8KB 1MCSA 4WFGE 4OCRL 1TTUA 2FHFA 4OD1H 2NXYB 2D03L 3ARFA 4L3EB 1T3FB 4H8WL 2X4SA 1LILA 4P57A 2IANB 1CFVH 4NRZA 4R4FH 1RHHB 3O3UN 1I1CA 3IJSA 1REIA 2VZSA 4FQPA 2Z4QA 1BM3H 4MAYB 1E6OH 4LSQH 1G9NL 4U1HB 5DWUH 5IBLD 4FS0A 1NBZB 4MNQB 4FHBD 1HIMH 2X05A 1S7TB 4JHWH 1T5WB 4R2GD 3VRJB 3MRMB 5IKCA 1A7RL 2AK4D 2JTDA 3AUVA 1HILB 2EEBA 1W0YT 4Z7QE 2ORBH 2JB5L 2Y9RT 4JG0L 3MV9E 5DF0A 4Y4KA 4TUOA 4TOYH 5FKAA 3TH2T 4U3CA 3ARPA 1R5VA 2FSEB 4Z77A 4X6BB 4PJEA 5F1NB 3BZFA 4X4XB 1EHNA 1GH7A 2D7PA 3F5WA 2CLZA 3BN3B 2APTA 3SCMB 3I84A 3BGFC 3HZKA 3SDCB 2YC1A 1NGXA 3RNKB 4HV8A 1IM9A 5DMIL 5FXCH 1IAOA 4N5ED 5L2KB 3BH8A 1JL8A 2DL2A 1B4JH 4L9DA 3AU1B 4FNLH 2NXZC 4NWTH 4R4BA 1VACA 1HXMB 5BCAA 3ZTJG 1XCTA 2VLLB 4GG6E 2R4SH 1A1MB 4L4VB 5E1AB 3C2AH 4XCYA 3VXUD 4JRYE 4F7EB 2PYED 5C7XL 1QR4A 1Q9LA 4LEXH 3JV4A 4D8PA 3DV6B 2NY1C 3WUWB 5SX5K 5I1CL 4PY7A 1PG7H 2V2WA 4NJ9L 2C1PA 4HSQA 1DDHB 1JTOA 4LHUA 4F2MA 3IJYB 4TUKH 1RQ5A 4YPGB 5AAMA 4PS4L 3ARBB 4MNGE 3KR3H 1YEFH 3VFPA 5CKGA 1J10A 1DQTA 3TPUB 2VZUA 4NRXA 2AVGA 1MRFL 1TMCB 4X6DA 4FFVD 2YR3A 5AZ2H 4PRNB 1T89C 3BIKB 4ZD3L 3TM6A 1B0WA 1N2RA 3HE6B 4NPYA 1S7VA 1JPSH 2HWZL 1BECA 4OLXH 2X70A 1C08A 1MI5A 2X1OA 1KT2A 2G5RA 5AEAA 4EDWL 3C87A 3HG1D 1U2HA 3GRWL 5IV2B 1X4XA 4P99A 1KXTB 1A22B 4FQ1H 4J3SA 3LEYH 5ALCL 5BZWB 1CVRA 5HHNA 1XR8B 1TQBC 1TENA 5I8CB 2W60B 3WXWH 2X4SB 5BOPA 3TZVB 5CD3A 4NRZB 3C5ZD 4GMSH 1T22B 1XGYH 4ORGB 3KVQA 1CFSB 4CMMB 3ULVC 1U8KB 4XNMA 5TE6L 4O58L 1DL7L 3B9DA 3RY6A 4U2YA 3BKJL 4X9HA 3RWGA 4ESKA 4OV6F 5IQ7L 5JHDD 3I50H 4MS8C 5CMAB 1BIIB 1DJSA 5ISZA 5TGBA 3RGVC 4ZPVB 3BE1H 3DVNA 1RK0B 25C8H 3RWJA 3C5SA 1WVZA 3MV01 4WHYG 2DQTL 2F15A 3BRDA 4WIQA 2EE2A 2WUBL 3LH2L 1EV2E 4PRIB 1PKQE 2X4RB 3U1SL 3L3OB 1A7QH 1VFUA 5GGVL 3SDAC 3QI9D 1QQDA 4R4ND 1QYGL 1HHKA 4WV1A 2FR4A 1D5MA 1NFIB 3G9AB 1HHGA 4G42A 3SDXF 1WEJH 4PG9B 4MJ2A 4KZDH 1OB1A 1EHLL 5DUPL 4N68A 4APQB 5K9QG 1KTLB 3CXHK 2OK0L 1S5HA 1NGQH 4WCYL 2FYYA 2Y6SD 1FYTD 1RMFH 1VERA 1EGJL 2XTLA 1D6VL 2R9HC 4ZODA 3TVMB 3UPCA 4ZO6A 1JYWA 5KSAA 3ZHDA 2VH5H 1FVDA 1HQ4B 4PJ5B 5C0CE 3V0AC 1TTGA 3UZQA 4MJ5A 1S7SA 1OWWA 4BQ8A 2VYRE 4HAGA 3VXRE 3P77B 1S5IL 1OT2A 5DEZA 1C1EH 5E94B 2GJZB 3U7WL 3B9VA 1T2XA 5HVHC 5I1GH 1AD0B 3IT8D 4YDLC 3ZHKA 1LMKA 4GW1A 3GJFB 2IALA 3BP5A 4JRYA 3FQRB 1OCWL 4PJ9A 4LLYA 2NY4B 5IVXA 1UKQA 2DMKA 5L2JB 2Z31A 3ULUD 4Y4HD 5A2JH 2AV1A 5CBAB 4XP6L 3CVHB 5C0RL 4JFHD 1KELL 4ODXA 1F3DH 3D3VE 3OB8A 5DEFA 3RJDA 4OTXL 2FJHA 3V7AG 2C3VA 4JGUA 3VRLF 2XY2A 4ISVA 5DYOA 3DX7B 3LAFA 1JGLH 1NMCC 3D2UB 4IOIB 2ADFL 3GSRB 4X6FA 4MZ3A 3W9DA 1FNGA 4XPAL 1IZJA 2YD8A 3NMEA 2WUCH 1ETZB 3HCVA 3MPCA 3HC0A 1F90H 1U95A 3FT3B 3KWWB 1H3WM 5GRYA 2I27N 4ELMA 5JORA 5FHBH 2J4WH 4JN2A 4LVNB 1DANT 1JPST 2D3VA 2ZSWB 4XWOC 4OD2A 3O6LL 4PRPE 1L0XA 5ERWB 3UYOD 2OX5A 5C0IA 1IC1A 3EOBA 3H7BA 5DTFB 3MRJA 4RISL 4WFFE 5EU5A 4WI9A 1IVLA 5D96B 4EUPH 1P53A 1YMME 3IXTA 2F5AH 3UX9B 2K9UA 1FC1A 4J1UA 1XGTB 2MPAH 4UTAL 3L6FA 2J8UE 1JFQL 3WFHA 3I6KB 4JPVL 3MRFA 4V1DD 1HCFX 3TYGL 3GK8L 3QPXH 2D0FA 2QQKL 1W8OA 4QHMA 1DBKL 4PJHE 4HJ0C 4PUBL 1SJXA 4I5BA 2R1YB 1X5GA 5E00A 3STLB 4OD3L 1A4KA 3GMPB 2RJMA 1Z2KA 4KDWA 1BVLA 5KJRH 2W0KA 5DVNA 3W11D 1F4XH 1DQDH 2AP2A 3CVIL 3RVVC 3WLWC 4LLVA 1GGCH 4OCMC 2VKWA 3GHEH 3MUGA 3VU2A 2ZCLL 3C6LC 5I2IB 5D1XC 4PIRF 4NBXB 3WSQH 2B4CH 1S5HB 3ME0A 1UFUA 4EN3A 5JXAL 3OKLA 2H3NA 1K6QL 2AKRA 4GUPA 4LCYB 1OSZA 3BPOB 4Z7UB 2PXYA 1DQQA 1VFBA 5CZVH 2FEEL 4P46C 5DLML 4H5SB 3VMOA 1QRNB 1A14H 1UJ3A 2BJML 1J8KA 4RMWA 4X4YA 3EFFA 4MDIA 1OWRM 1R5WA 1PG7X 3BGAA 4MYWB 2XV6B 1I8MB 1G6VK 3THML 5I9QB 4KK5D 3IDMA 4H0HB 3C9NA 3HN3A 3DUHA 3GHBH 4DAGH 2YN5A 3VXRA 2QSTA 4UT6H 5DHYA 2RIKA 2YRPA 3TA3C 2G5BA 5JQ6H 5DA4A 4DKFH 4OZIE 4WI4A 4NKOA 5KSBF 3QG6A 3UBXB 4OT1L 4UNVA 2F53E 1HH9A 4Y19B 2UUDK 4R7DB 1Q9KA 5JXEA 1BOGA 1YC7A 4OZ4A 4L9LC 1GOGA 1PFCA 3IFOB 2FHBA 3G6JF 4FZEL 1DVFD 1ZWIB 1RUML 2DLFL 2XRAL 3JWNC 5FCUL 3HFML 4JKWA 3BQUB 3RKDD 3HB3D 4G6FB 1U95B 2C7UB 1NCWL 4WENB 5IT2L 5HHOA 3SDYL 5D1ZC 5INDB 1QP1A 4KRPB 1CGXA 3O8XD 4Y5VA 3PV7A 1SY6A 2JIXD 1H3PL 4OLWH 2X89D 5GGTH 1IC4L 1WBXB 3H8NA 3TNMB 3QPQC 1NAKH 3O45A 1KEML 2E9IA 4MJ6B 3PWLB 1P2CA 1OL0A 4LRIC 1KCVH 4M7ZC 3L6FB 4PRPA 3QQ4A 1KIRB 2VXQH 4KGJA 4MB3A 2ED8A 5DRNB 5J9PB 4M62H 3HTLX 4IEFB 3A6OA 3OF6D 3ZZ1A 1CBVH 1ZGLB 3DO7B 1PLGH 1IM3B 4DW2H 5I8KH 1EVTC 5D8JL 3OAZH 3IKCB 2FGZA 5DC0A 2EDJA 1JNNL 3JWOH 4L3CB 3GNMH 4PJAE 3UXFA 3HRPA 5EIIB 4S0SD 2BRRH 3LZFH 5H37G 4R0LC 4NDMB 1FO0H 3GIVB 3QG7H 3MUHL 3M17A 1W72L 4EI5B 2G75A 1NL0H 3KLSA 5FHAL 5I0DA 4DTGL 2F8XC 5E6IB 3CXHJ 1DQQB 5D1QC 5HHMD 1Y18B 2BVTA 1N8ZA 3AREA 1FIGH 1J8HD 3EKCA 3NIGE 4N0CD 1V8HA 2ZOKB 4RBPK 3F12B 1YEJH 1FRGH 1P6FA 1MFEL 2GFBA 3MOBH 4ODVH 2OL3A 4WFED 5IMOA 1TZIB 3ZL4H 1XGUB 2QQNH 1RZ7L 3L3IA 4ZFZA 4IM8A 2Q3AA 1NPUA 3KNBB 4QTIL 4MSWB 1HSAB 1UWGH 1BVKB 5JO5A 5SWQA 2YWZA 4ONOA 1ITCA 4NRYB 2PW2A 1S9YB 4OZGE 5IHLB 1G0DA 4JDVB 4NQXB 1D9KC 3BKMH 3T04D 1UZ6F 1LEGA 2VRAA 3QRGH 4UDUB 4P2QE 3W9EB 3WYRA 3REVA 1M71B 5K9KB 1H3TA 1ZHNB 2FLBT 4OF0A 3SY0A 5IOPB 3CLEH 3RHWF 4H88H 4ZAKB 3NPSB 3PQYB 5GRJH 5C2BH 4NSKB 5EUKB 3EYQD 1MRDH 1OTTC 4MA7H 3TBTA 3X12A 3GO1L 4F33A 1YEDB 3MJ7B 1RHFA 4M1GL 1MJ8H 4YO0B 1O7SA 3QH3A 1BGXH 2IFFL 2KL6A 1ZLSL 4JB9H 4FABL 2NPLX 1DANU 2OR8A 4OV5A 2A9ML 3P30L 3KPLA 1AO7B 4P5TA 1AKJB 3CFDA 4ZTOL 4AIZA 4Z8FL 4OQTH 5FK9A 3RNQA 2H1PL 3OKMB 1QNZH 5MENE 3B2VH 1OGTB 1HI6B 2JJTC 1RZ8B 1D5ZA 3BXNB 4G6AC 3TN0A 2ZCHH 7FABL 2EDNA 3O9WD 1JPTH 4M6OH 4TULL 1I9IH 1HDMA 2OR7A 1NMBH 4X6EA 3UZVB 4KKCC 4M7JH 3FB5B 2V5SA 2E5EA 2OTWA 3A67H 2CLVB 3BVNA 4O9HH 4HWEH 4Z95L 3RIAK 1F5WA 4MQTB 3R1GH 3RL2A 2D4DA 1V7MH 4TVPE 4JQVA 2YEZB 2IADB 3G04A 4GAGL 2ZG1A 3DUUB 5DURB 3UTPE 1ZSDA 2OS7A 4UMGA 1EAPA 2VABB 4U1IB 1W0VB 3F8UB 2VISA 5IW6B 3EYUH 4KI5F 4JE4B 2UZYB 4YEFA 4YHIA 1H5BA 3SBWC 1A4JB 2HLFC 4XHJD 1GGIH 2R39A 4DEPB 3W39B 5IMOB 3WHXA 3DV4A 1L7TL 2LV4A 2WP3T 1I3UA 1JUFA 2OP4L 5HBBA 4HHAB 2WM0A 4ZFGH 4M1CD 4X5LA 2OMBA 1XIWB 1A3QA 5MEPB 4R90H 1ZV5A 4DKEL 3SOBL 5MEOA 3EJYD 2ICWB 3WUZA 3K8KA 5BXFA 4XNYL 4JRXD 4KUZH 4K8RH 1AGCA 2E7CA 3ZDZE 4CBPA 1BJ1H 1JPGB 1RZIB 4HUXB 4GFTB 1KCRL 2Y06H 2QLVB 4PJXF 4YGAB 3ZKSD 1J9CT 4WW1B 1JBJA 3I02A 4QKXB 1M05A 4ZXBC 1IAKA 1SJEA 3LS5L 5AUMA 3QULA 1CXLA 3BKCH 4NGHL 4YNYB 5DZLA 1KNOA 4KK9C 4OZGA 1B2WL 2OZ4L 2ITCA 4JPIA 3LS4L 2BSTA 2CRMA 3GB7B 2DQEH 1LO2L 4YQXH 1A6UL 4O51B 4GQ9H 2R69H 4P2QA 3VFGL 2P47B 1BEYH 4U05A 1JPFA 3U82B 1ZVSA 1FNAA 2Z92A 2ZUSA 4L8SB 2Q3ZA 3BAEL 3HE7C 3QH3B 3T0EC 4E41A 5MHSE 2VMFA 4M5ZH 3K74B 1UACH 2C9AA 2NZIA 2J1KA 3NZ8A 1QFWM 4Y1AD 2NY3C 2AJYL 4JPKL 5DJYB 4OKVA 4RRPA 2HFTA 2XN9E 5CJ8A 1JRHL 4X7SL 4X80H 5E9DE 4JZJA 1NCDH 4ZS7H 1FGVH 2DQGH 4X6CB 5BO1H 3VCLB 3C60A 4M4PA 3EYSL 1F8TH 2GTZA 2OJEB 3VFNA 1FNSH 1KJ2L 5DD0L 3VXTB 1DN0B 1MCBA 1JZ2A 1P4BH 3H9SD 4JCLA 4RQQA 5ITBH 5EC2B 1IGCH 4Y89A 1F4HA 2FEEI 2R4RL 5MEQB 2YMXL 1LE5B 3ARFC 4L3AA 4ODTL 4WVRA 3REWB 4QOKB 5EORL 1VENA 1MJUH 5GGQL 2QKIB 1FGNL 12E8L 4IRJD 5ABDE 1S9WA 3MRPA 2HKHH 3OXSA 4U6HB 1NGPH 4C58B 4WO4D 4AL8L 5T5FL 5F96H 3VXSD 3DECA 3QEGL 4BA8A 3IU3B 2BZDA 3TIDB 2H45A 1OY3B 1UCBL 3CPLB 3OKEB 4JQXC 1WWBX 2OTUA 2Z35B 1MJJA 2Y72A 1LD9A 3EYFB 1X4ZA 4CN4A 5C09D 1YNKH 3D39B 1EAPB 1F45A 1BFTA 3MLUH 3Q3GB 1KN4L 4HWBL 1MREL 2I24N 3IDJB 2BNUA 2OXGA 4Y4KC 4OCWH 4ZUUA 1FAKT 3SKNB 1Z6JT 2ZKHH 3SJVD 3MRHB 2VXVL 3WXVL 1GGBL 4PJFA 1LO5B 8FABB 1YY8A 3FO0H 3GI9L 1ACYL 5KS9F 3TFKD 2YPLB 4KWUA 5HPOA 5C1MB 1CZ8H 4FQXB 2V2TA 3WNLA 2HFEB 3L1OH 1JUFB 3I75A 3LKPA 2DF3A 3PJSA 4Z7VB 2VLJE 5LQBL 5MEOB 3LEXB 4J3TA 1KIQA 4PGDA 3BD4A 2JK5B 1KULA 3WFEL 3UPAA 5HDLA 3QQ9D 5K9JH 3FTGB 3U0WL 1ZS8B 1A9BB 2ZNWA 4MS8D 1CL7L 2FH6A 5T33L 3I02B 2AJSH 1I7RA 4WFHD 4PRAB 5DI8B 3ZE0E 3H42L 2BSTB 4XP9H 5J6GB 3FHAA 5FM8A 3MBEB 4JJ5A 4UQ2B 4Z7OF 3C6SB 1QBAA 1WJ3A 2DN7A 4KHXH 4NQDB 4IRSD 4L3EE 3KYKL 1X5ZA 2PTTA 4NZRH 4OCSL 2LAAA 1ZK9A 2D7TL 4HC1L 4CNIA 5DK3A 1CWVA 5DUBB 5EO1B 5C0JB 4FQLH 1E28B 4NQSA 1DFBH 4JFEB 2F74A 4QF1A 4MNQE 3P0GB 3QWOB 3UROR 5GS0L 3O3BB 3MMEB 1R24B 5GS3A 3CU1A 4XWGH 5ICXB 2R9HD 4PJGB 4JKKA 5F1KC 1NUDA 4AMKH 2F54B 3O0RH 2P8PB 1X5AA 3PHQA 3QUXA 3VWJA 5I17A 4HIIB 1ZHKB 3O4OB 5F70A 5FUZH 4KJWC 3UTOA 5J7CC 2YHGA 4LKCB 4OF6A 1KLUB 3QHTC 4N8VG 1XCQB 5HXMA 5BZDB 4U0RC 1MCKA 5GJTL 6FABH 2EKSB 4HF5H 2DS4A 1FSKC 4MQXD 3RVUC 1DBBH 4JHZA 1A6PA 3RY6C 1VFAA 1T21A 5C0BD 1ZT1A 4CKVX 2JE8A 1FVEB 5L2KE 5CEZH 1CE1H 1D5XB 1QVOB 3H9HB 4BKLB 4G9DA 3EJZC 4ODWB 1JGVL 5E8OA 2ZWLT 4M8QA 3ULVF 4YFLF 1U93B 1I8IB 1INDL 2D0GA 4L4VE 3BDYL 4YHKL 5HVGB 4IMLA 2GSIA 3RVXC 3ARDC 4OLZH 5JIIA 3VFTB 4MQ7B 5L8LB 1AXSB 4YHPA 2ERJC 3TBVA 3QUYA 4OQ1A 1WBYB 3S36H 2K7PA 4GXVL 3FT4A 3P3YA 4PBXA 2IGFL 5M7QA 2E7HA 3S98A 4UTBH 5C0GA 5ACZA 3T4YB 4XPTL 4I48A 4PB0H 2IPTH 3OMZA 1TETH 2WWMC 1N26A 1SY6H 1MHEA 2AQ2A 3DURA 3IJHB 3D0VA 2VLJA 3K4ZA 4U0QB 4P9MH 3WL9B 5TDOB 1IFHL 5HHVH 4K3DH 1X5YA 4Y5XB 4DGYH 3I9GH 1LEKB 3MCLH 2EDQA 1X3DA 2C5DC 3QHFH 2JJUA 4G9FD 4O5LL 5HDOA 3O6FB 4NN6B 5AZEL 1AC6A 5LXGL 3EJJX 5IWLA 3E0GA 3OV6A 2GAZB 3DI2B 4PJ9C 1NDGA 1QSEB 2ARJB 1VHPA 3LSOA 4OIIL 1FFNB 2VKXA 3CIQA 3QA3B 2P5EB 5JR1L 2AI0L 2Z31C 1EZVX 5IFJA 1MHPL 4YIQB 4P2OD 5I1LA 5B38G 3KLDA 4NQTA 2I07A 1XF1A 2Y5EA 3BZ4A 5ELIA 1I9JL 3ORJA 4J8RB 2VIRB 3O4LD 3ZHLA 3ZDYF 4P49A 1UXWB 3QDMD 4MVBD 3BKYH 1U8MA 5B4MC 3T2PA 4F7MB 4WI5A 1BQUA 4KDTA 4XPHL 3T0VA 4Z7WB 1T80A 1FE8L 2X4TA 3GM0A 2PR4L 1OP3K 2P46B 2MTPA 4UAOB 1A9EB 3UTSD 2A6DB 4LU5L 5IB2B 2HTLD 3PP3H 4M1DH 3MRDB 4WEMB 1JV5B 1P5VA 3D18B 3SKOA 4LARH 4H26A 4LLMB 1RIUL 4FFYH 35C8H 2ZJSL 1HWHB 4CVWA 3V9FA 2AGJH 4LBEA 5GQBA 5JPNA 5DEGB 1XGRA 5DZNA 1FN4B 3HR6A 5KG9A 2YD2A 1A6TA 2BVQB 1IT9H 2MCG1 1A7NL 5F7MC 5GRUH 3L7EB 5CINL 5FO8B 2ESVD 2VZVA 2CIIB 2DBJA 4P5KB 4K2UH 1RVFL 1JMXA 1OTUD 4KQ3L 2DD8H 2Q6WB 2X4UA 4ZUWB 5I71C 3O41A 2XZAL 4I18A 4RMVA 3P4NB 3C09C 3CMOH 3VXMB 4LSRH 3NCJL 1MCDA 4HT1L 4PJCB 2H8PB 3JSSA 3CH8A 3TBSB 3IDGB 3RHWK 3RUGB 4OUOA 5T1LD 4ZNEA 4D9QD 3ZE2E 3UPRA 3KLHC 2DYPB 5EOTB 1MFDL 4PRHE 4DK3A 3HAEG 1JRHI 1QHPA 5T1MA 4EN3C 4WHTA 2EDTA 4N0RA 3MV8A 5JLZA 3M45A 3RVWD 4LPTA 3QFJB 1T1XA 5CUSL 1J88A 1IRAY 4GKNA 2PXYC 5L6YH 5JDSA 1OP5K 3MLVL 4UV4L 3FB6A 3ALPA 4Q0XL 2ADJA 2AJZA 1DN2A 1UJ3C 5D2LB 3MROB 1CR9H 3L7FA 5E5MB 1OSPH 2I9LB 1CGUA 4PJBA 5DJ0A 4BSWB 4JM2F 1YPZB 4X9GA 3V6FB 5E2TL 2I9TB 1K2DA 3O81A 5DRZA 4ZYKB 1KJMB 4HDIA 3CZJA 1SYVA 1C5DA 5E5RB 4QT5B 3PL6D 3V6ZB 3QAZC 1CT8B 3FO1B 1V5JA 1AIFB 2AXGA 3D1MC 1Q0XH 5EBMB 1CG9B 5JXEC 5IHZA 2VXTH 3VD4A 5D7LD 4NUJB 1FDLL 1NCAH 5EUOA 4LLUA 5KW9H 1FLRH 1OAZH 1T0PB 4WU7B 3NIFE 5BQ7A 4PLOB 3C08L 2IG2H 4PYGA 1J1XL 2FH8A 4LSPL 4BZ1H 2EH7H 3HUJB 2FEDD 4C4KO 5C07B 5CJOH 1YEEL 4YR6B 3Q6FA 5IBTL 5ADPL 3VGDA 4FA8A 4NNYB 1QBMH 5F7EH 3AC0A 5SWSB 1R3HA 5C0DB 2JB6B 4LPYA 3GRWA 4NM8H 4DFIA 4WJ5B 2NY7L 4M6NL 4PJIF 4HULB 4RFNB 5BVPL 2Y1VA 4DVRH 3KPTA 1QFWL 4MMZC 4GG8A 5KG9B 1FC2D 5L0QC 4LKXB 3MCKB 4C56D 2FATH 1CL7I 4HKJA 1NEZA 3KHOA 5C0EB 4NKIL 3QEQE 4OCXH 3W0WA 1AP2B 1P5UA 1AY1L 4OFYA 4Z7UE 3IFPB 4FQQB 3KPQA 5L7XH 3CJJA 5FECA 5BV7B 2VXSH 1QRNE 3QO0B 1BZQK 2X09A 4IS6A 4RFOL 4YXKL 3CZFB 2DKUA 1BZ7A 4CVZB 4EXKA 2HRPL 1B0GA 5C86A 1G84A 4HFUL 3NCYP 4U6XB 3BPLB 4DGVL 4LPCA 4N8VA 2MHAA 2CLRA 4I77H 4YDJB 4XBEH 3UYRH 1T2QL 2VDMH 4ZOBA 2CKBB 3CGTA 4LEOA 1FP5A 1GYAA 2X7LB 5F97E 4P9HH 4WHTB 2VL5A 3DUSA 4AENA 3GMNB 4WY7H 4KRMB 1T5XA 2ARJQ 4CU7A 4B7IA 3RA7L 3R8BB 1A5FL 3GI8H 4GRWF 4DGIH 4Y19E 4HS8H 4P4KB 1IEAA 3AREC 3ZT6A 4PRHA 1JHLH 4M7KL 2C1OA 1NAMH 1UB5A 5BRZB 1F11A 3VGAC 4ZUTA 4JFYA 4JQIH 4NIKB 1W0WB 1ED3B 3KPRB 3RTQB 5DJ0B 2BCKB 1GPOH 4KFZC 2NTFB 3FJTA 3D0LB 4RA3A 2LVEA 5I8OL 5IB4A 5BOZG 3V4PL 4KTDL 5L8JB 2DQFA 4HD9A 5IBUG 3TF7C 4LOUC 5CCKL 4XCEB 2UYLA 4LNVA 4P3CH 2HG5A 4JFQB 5D7JB 3K81A 5EULV 3WNMA 2HFFA 3H3PH 2PO6A 3VXNA 3B4NA 3MGOB 4ZSOA 3FAWA 4LSVL 3VFSB 3X3FL 3DIFA 5EUOB 4TVPH 1LEIA 4ODUB 1GCFA 1UWXK 1NMAL 4U1SB 3MFFA 3S35H 1J0JA 2DLGA 5F89A 4O4YH 1IGJB 2WINB 3MNZB 3TV3H 3PGCB 1KF9B 2FWOA 2ZG3A 3FFCA 1QKZL 1HINH 3ARTA 4LCIL 3V5DB 4PD4K 3B9KD 4JFFA 1OGAE 5I18H 4JO4H 5A16A 2NY2D 1ORSA 3LN4A 4OD1L 1JK8A 3S9DB 2WW8A 3MJ9L 4P5TC 4DK6A 1CCZA 3FOLA 5EA0L 3VFRA 3UDWA 4R4FL 4GRMB 3HNSL 3QUZA 1LGVA 4F7TA 1MJ7L 2OQJB 4HIJA 5ICYA 3G6AA 3KJ6H 4JDZB 4KK9D 3Q1SL 4LSQL 3DMMA 4ENEC 3QRFM 2ICEA 1OT1A 4NZTH 3TN0C 1HIML 3GMLB 1P6AB 5GISL 1M1SA 2WBWB 1YN7A 4WW2C 1U3HA 3KS0H 2DL9A 4G6KL 2GSGA 3BZEA 4G6ML 2ORBL 1NFDB 3QEQA 5A3ID 1FORL 1QR1A 1MWAL 2GCYA 3FO9B 4JQVC 5HHQB 2CUIA 3O2VL 4HUVA 4TTDC 3TBWB 2VDPH 1EVUA 3RPIA 5MP6L 5ETUB 1ZHBA 4B7LA 4Y4FC 1UYWH 1A6WH 2X41A 4PJ8A 4MQSB 2V2XA 2VB5A 1KB5L 1UM5L 2LAGB 2NY0C 4YX2L 7CGTA 4O2EA 1AJ7H 1P4IL 2C1OB 1TXKA 4KMTH 2UWEE 4HK0B 1DSFH 2OR9H 5C0AA 4FNLL 5GGRY 3KJ4C 1ZLVH 5I73C 4Q2ZA 1T1YA 2OYPA 4OLUL 2EXYC 1CQYA 2R4SL 2HH0L 4ZQKA 1K9TA 4OJFH 3LDBB 3AB0B 4JM4L 5L9DL 3VI4F 2WV3A 1Z5LB 3ALXA 1U58A 3DVGB 3MJ8A 1IC5H 3BJ91 4GQPH 4KK8D 4N0UE 4YH6A 1KJVB 3WDHA 3ZKXB 2AEPH 3DWTA 4MJIA 1IKFL 2WANA 3QUKA 2RFXB 4JFOB 2DTMH 5DJ8A 1G6RA 1AFVH 2HFFB 1AO7E 3VFOB 1YEFL 5B39G 4XPBL 2PYEE 1YEKL 3P9MB 1KB5B 1WFOA 3DGGB 1VFOA 3QO1A 4OM0L 1L7IH 2VOTA 4CMHB 2VLKB 3TYFB 1G7JB 3VE0A 3SDDA 1T4KA 4XP4H 5F89B 1JPSL 1LP9B 2ILLA 4NJAH 5GGUA 1LK3H 4D0CB 4AYFA 3FFCB 4RMTA 4D9RD 3MOAH 1I7UA 2P8MA 3PHSA 2V5MA 4MDJA 5JOFB 4JFFB 4YUEL 3NA4A 4P23A 1ZOXA 3KPSA 5I0ZA 1CN4A 2CK0L 3O2DL 4Q7DA 3LEYL 4BQ6A 4JZJC 3EDJA 3MRRA 1IQWL 1MQKH 3TO4B 1HNGA 1SVCP 2E27H 3QIUD 3VFRB 4GMSL 4NOBA 1XGYL 3WNPA 1OGAA 2J6EA 3PDOA 3QDGD 4NKMA 5INCA 4F7TB 1NC4B 5B38B 2H2PC 1YDPA 5M94B 1U8OB 5I1EH 1FQ9C 4JO1L 1KLFA 5JNYB 5JW4N 2X9XA 3QIWD 4HZAA 3T4AB 1MCRA 3I50L 3NFSH 3CSBA 3L5WA 3ZKQD 25C8L 3NCMA 1MFCH 5CJQH 2F58H 1SJVA 3BISA 4HWUA 4HCRH 5FOBA 3VXPA 5JHDE 1L6ZA 1P7QB 1A7QL 4X9IA 3F7VA 1J7VR 1ROWA 2KUTA 4JFZH 4YLQT 3QJFB 1KB9K 1UEYA 3O2WH 4WWID 1AQKL 2AK4A