3WJLC

Crystal structure of iib selective fc variant, fc(v12), in complex with fcgriib
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
168
structure length
160
Chain Sequence
b'PKAVLKLEPQWINVLQEDSVTLTCRSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig gamma-1 chain C region
publication title Engineered antibody Fc variant with selectively enhanced Fc gamma RIIb binding over both Fc gamma RIIaR131 and Fc gamma RIIaH131.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 29
structure length 160
sequence length 168
ec nomenclature
pdb deposition date 2013-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wjlC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wjlC02
4D0DA 2X6MA 4PIRF 3IFPA 1EZVX 4QHMB 2AGJL 1FL3B 2VITA 2YPLB 4CU8A 3NIDE 3QEQD 1YPZA 4OLXH 4M61A 1U8MA 3D2UD 1ZT4A 1T0PB 3M1BA 4JO3H 4JN1H 3RWGA 4ZFGL 4PJCB 1U0QA 4NQSA 3OG6B 4AL8L 4ZAKD 4U7MA 2F54A 3SE8H 5CSZA 4LARL 2I9LA 2YA1A 4ZUUB 2BJMH 4YH6A 4WWID 5GGUA 4K2UH 4NCDA 5ITFB 3F7VA 4FTVE 2VZ3A 4GO6B 2VL5A 1CFQB 3VRLF 3VFNA 4PV9A 2A6DB 3DLQR 3CFCL 4PRHA 3C08H 4KKLD 2Z31D 3U48A 1TNNA 3GSXA 4OGZA 5HI4D 3HZYB 4N8VB 1FZMA 3CLEH 3QUXD 3O4OC 1A64A 2WIMA 4PJFB 4XBEL 5IROA 4YXHL 5CP7A 3SBWA 4X4ZA 3S88H 3V9FA 5L9DL 4H1LG 2E3VA 1H15A 5E6IB 2GFBA 2GTWB 2XY1A 1HOCB 2LQRA 3RNQA 1S8DA 4LFHG 2C1OA 3THML 4XGZB 5B4MD 3W39A 4Z7OE 3OG4B 2ZP0T 5F9JB 4A6YL 2YOCA 1YNTA 1ZLWK 4K7PX 3TVMB 4I0KA 5GZNC 2R0ZH 4KHTL 3MR9B 3SDDA 8FABB 2J8UF 5ILTH 1W72H 4LPCA 5CEZL 3W9DB 2BX5A 4Z0BH 4FZ8L 3A67L 1KTKE 5K9OB 4L4TA 3IDGB 3L6FB 3B9KB 2L7JA 2LABA 4WENB 2AW2A 4CNIB 3BJ91 3RX5A 1JPGB 3V6OA 1OSPL 3I84A 1FL6B 3HE7D 3LIZH 2FD6L 2M2DA 5CBEA 3BO8B 3NCYS 1FDLL 4YK4C 4AK1A 2BVOB 2PTUA 4IHOA 2GI7A 1YUHB 4ZFOB 5ICZB 4FG6C 4YQXH 3B2VL 3CZFB 3WFEL 5E9DA 3IKCB 2V5MA 2HLFD 1WF5A 1TQCB 2WUBL 5HHME 5IWLA 1L7TH 3WS3A 2JTDA 5I1HL 2NR6C 4AY0A 1BQHG 3GHEL 4EI5D 4Y5VA 1QSFB 1CD8A 4D3CL 5GGSB 2NZ9D 2IFGA 3DIFA 3L5IA 2YD9A 3BEWA 3NIGE 4K23L 4NQVA 3RU8H 3UDWA 5E5UB 3R4DA 1YNKH 1EMTL 1KJ2L 2CMRL 1G7IA 2NY5C 5HHPA 1J1PH 1X5AA 2E9BA 3QJFB 4ZUSB 4LLUB 4TUJB 5FUOH 3WLBB 3DXAD 1A7OH 4JZOA 2QHRL 4OBSA 4W6WB 3PWUA 1YZZA 1J1OL 4LIQH 3PGDB 3LDBC 4PJ9C 1K4DB 2YXMA 4HF5L 5TFSH 4OGAC 3CXDH 2HRLA 4FRWA 4HZAA 3NIDF 3VXUE 4FQ2L 3GI8L 3HCVA 3PF2A 4FNLL 2VWEC 3CCHB 3IDNA 3WKNA 2UWEF 3ZT6A 4AEIL 1KIPB 3QULA 3MLRL 3TWCH 1R0AL 4BQCA 4E0RA 1T7WA 3ARFA 4MLIA 4JRXD 4LLMB 4PY8I 4HPYH 3VWKD 4YDVA 1IT9H 5E1HB 5C86A 4M7KL 1N26A 3B9DA 3NTCL 4MNHA 5LBSL 4KTEL 3VXMA 1PKQB 1CBVH 3MLPA 1N3NB 1T2JA 3TT1H 3NFNA 4HG4J 4ZAKC 4APQA 3OXRB 5D5MA 3DURA 2CLRB 2Y1VA 3G08A 5F1IB 5F88B 4OFKA 4M43H 4Y5XA 1P5UA 2VDOH 3D87B 3RVUD 4KKLC 2Z31C 1YEHL 4MB3A 5HI4C 1WBZB 4I2XA 3F12B 3MRFB 3GSWB 3QUXC 4YHYB 5CKAA 4JM2C 4MAYD 4P59L 4J8RA 3MFFA 4ONGH 2RJMA 3KYNA 4HUUA 4Z7OF 5J6GA 5I2IA 4YHNB 1XGYH 4RBPK 1CYGA 1CICD 4OZHF 3LEYH 2JJWA 3DRQA 4R97C 2FJFB 2M26A 4NQCE 1NMCB 5BRZD 5L2KE 5BS0B 2EDRA 4C59B 5FGBA 3HNVH 1BQLL 2R2BB 4FTVB 1JK8A 1QRND 4YHLL 3ROOB 4BUHA 4YXKH 5IR1A 3AXLB 4WI6A 4Z77B 3V6ZB 2LTQC 1G7QA 1UENA 4RMQA 2RCSL 5E2UH 3GMRB 2O61A 2MNUA 2BOCB 4POZD 2RR3A 1IRAY 5EZJA 1P7HL 3R1GL 4EQ3A 3VFMB 3NCFB 3F5WA 1K2DA 2YC1A 3MCKA 4LSQL 5IB4A 1ZSDB 2BNRB 3OWEA 3RNKA 5DJDB 5IG7A 5JMRA 1T22A 4FQIH 3L95A 4MYWB 2RFXB 1MOEA 2H8PA 2F19L 4YBLB 2C4FT 3U1SL 2OTWB 3BPNC 1ERNA 3VXQA 5CLWA 3NIGF 3UAJD 1S5HA 3ARGB 2HLFC 1FN4A 5HYSB 1YY8B 4YHIA 3RQ3A 3NN8A 4EI5C 4O9HH 3ES6B 2NZ9C 4RIRB 2ITCA 2Q86A 2EYTB 3LPFA 2W65A 4FP8L 4KFZC 3QO0A 3GSNA 3VCLB 1VA9A 2PYEE 3A6BL 5DLML 1FAIL 4IMKC 5EU3B 3OHXA 2Z8RA 1VFBA 5TDNB 4XCYA 1G7PA 1NC2B 4GKNA 1KENL 1QSVA 2CGRL 4BFIA 3X11B 5F7YC 1T3FA 3TYFA 2H26A 4N0UA 4P5MB 3SE9H 1BQSA 1ZTXL 5FUCE 3S37L 4S2SA 2FIKA 5H2BA 5ISZD 3HUJE 1PZ5B 5HHMB 3EO1B 1KCVH 1HSBA 4LLDA 5DFVD 3PXHA 1G7MB 1KGCD 3QQ9C 4OD3L 2HLAA 3SDCB 3IJSB 4L8DA 3CXHK 4BYHA 4PJ7B 1DBML 3DUUB 3X12B 1J5OL 5IW3A 4B7IA 1T0NA 2O5YH 1BVLB 4PRIE 4WI8A 1E4XL 1YEFH 2JF1A 5DMGD 3FFCE 4OZIE 4C83B 5DMYA 3VWKC 35C8H 3AB0C 1JJUA 4HBCH 1MJ7L 4J1UA 4P2QA 1DVFD 5KAQF 3GFUA 1IKFH 1M4KA 2EIZA 3DO3A 2ZOLA 3GRWA 1JE6A 3ILPA 3UPAA 3QDMB 3UTSA 2NY3B 1JPTL 1U58A 3MBXH 3SKNB 4C4KT 1JTOA 1IC4H 2Y25A 3QNXB 1S7QA 2C3GA 1MQKL 3QISA 4JO2L 1KCRL 4MZ3A 4H0HB 3D9AL 5IV2B 3KR3H 1Q0YL 4KJWC 3VWJA 2HWZH 3TZVB 3PHOA 4JPWH 5C71A 3RVUC 4NDMB 5IHUH 3K8LA 3MLSL 3G6JE 1T1YB 1EXUB 4MZ2A 3STLB 4NO0B 4EI6B 1HSAB 1JUFA 5MEND 4X6FA 1K6QH 4MAYC 4NN5C 2AJUH 4K9EC 1JNHA 3RIFF 3FO1B 5KANI 3DX7A 1CICC 5BV7H 3K0WA 1CQYA 4DZBA 2WNGA 3QQ3B 2R69L 1S9XA 3VXPB 5T33H 2IC2A 3BP4B 3RAJH 5FA3A 5D2LA 3JWOC 5BV7B 4GAFB 4ZNCD 3MJ8B 3P0YL 4V1DB 4LEXH 1KN4L 5IVXE 2R4RL 5C0JB 2WWKO 5JO5A 4XWGH 1S7TB 4FQQB 32C2B 4POZC 2ADJA 4P9HC 1R5IB 4JAMB 1XCTB 4XCNA 3AM8A 3QIBA 3BRDA 5FFLA 1IBGL 3L3JA 3QIUA 5DK3A 1FL5B 2AQ2A 3O4LA 3UBXI 1K5NA 3WD5H 4MHHI 3AU1A 3HR5B 5E1AA 3GMLA 4HC1A 3CFEA 3VFUB 1AGEA 4NRYA 3LS5H 2JJSA 3K3QA 4N90D 3BPCA 4HK3N 4FABL 4K3EL 2P4AB 1XH3B 4WHYG 3HHRB 1BFVL 4JDZA 3MRMA 5I75B 5J13C 3VA6A 2AJXH 2VLKB 3HAEH 4IRSD 5JZ7D 2R9HD 1D5IL 4MA7L 4OD2A 3MRQA 3JXAA 1AE6H 1HI6B 4V2BA 2ZCKL 3UTTD 5C7XL 4IRJB 4I3GA 3HAEB 4P48A 4RAVA 2R0WL 5E03A 4OM0H 2X4NA 4GKSA 2A73B 3B9VA 2X44D 3P77A 1I1AA 3RGHA 4RFNB 5D2NC 4YFEA 4TUOB 1OTSD 1S7WA 1OARH 5HGBB 5C0BE 2VDMH 3ZMRA 3WJJC 3FJTA 5DFVC 4P9ML 1NCAH 4AEEA 3MXVH 2IAMB 2X2YA 5I9QC 4Z7WF 5I1EH 1U8PA 4XAWH 1V3JA 1D5ZA 2PYEB 5I1AB 1BECA 2ID5A 5D1ZA 5FCUH 4PBXA 4YZFE 4D9RE 2IWGA 3DX8B 3FMGL 3PP3K 5DMGC 2C4XA 2YA2A 4HCRA 2CD0A 4ODHL 2GY5A 4GMSL 1FZKA 4UUJA 5ALBH 3B5GA 3GGWB 7FABH 2NY0B 5AAWA 4CUCA 1PG7L 1SJEB 3EFFA 4KMTH 4ODSL 3HUJB 1ZLWH 1VSCA 1F58H 5H94B 4FQJH 3UYOD 1ZA3A 4LFHD 5AYUL 3WL9B 3WFDH 5AWNH 4W4NA 4FXKA 1NAKL 4O58H 5DD3L 5E8NA 4XNQB 4OCYH 5DVNA 1T2XA 1WWBX 5CJ5A 2ADIA 1A1NA 3FFCB 5F8QC 4OZIB 1O7SA 3TBTB 4XXDB 4EUPA 1H0DB 2EO1A 4MCYB 5GGVY 5C0CA 5DMKB 1CLCA 2P5EE 1M6OA 4XP1L 2C3HA 1FP5A 2B39A 4HIHB 3WFBH 1LO3H 4ZYKA 1Q94B 3U0TB 2APVA 2HFEA 4HDIA 5ALCL 3CVHL 1HHIA 5INDB 3EOTL 1QYGH 1S9WB 3CU7A 1U6AL 2J88L 3SO3C 2QV2A 4B7LA 2X89D 1MFCL 3G6JB 1CU4H 2AKRA 3M8OH 4KY1H 2QR0A 5FHAH 4I48A 4QRPA 5B38G 5B8CB 4KKAD 1SYSB 3BI9X 4JB9H 3RBGA 2AXGA 1DQQB 3NGBC 4PJGB 1CGYA 5I1CL 3K8MA 1UVQA 4NBYB 3BIKA 5TF1L 2XNAA 4BJLA 4KK5D 4O2CA 5I19H 1QFWL 1TETL 3VFRB 1UKTA 5ITBL 2R56H 3LKSB 1CIUA 1KCSL 5IVXB 4X6EA 1UCTA 4LAQH 2WIIB 5D96C 2XQBH 5FYLL 4IRSC 4PGJA 1J0ZA 1BLNB 1ED3B 5JZ7C 5FYJL 2E27H 1EIBA 3ALWA 4D9LL 1C1EL 2R9HC 4W4OA 4BQ6A 1RZIB 4MD0A 3OR6A 1ZLVK 4KU1A 4MMZC 3SKUD 4PJAE 4F7TA 1IM9A 5C8JB 2BERA 5D72L 4RMSA 5BZWA 1X5LA 5TGBB 3PWLA 3H42H 1PG7W 2WLYA 4P4RA 3BDBA 4XH2B 1YN7A 4X83A 4PRHD 2KL6A 5E24E 5K93A 3RVXD 3AMLA 1A6WL 3T77A 3LKQA 4YZFF 3AREB 1JNJA 2J4WL 2NTFA 1QO3B 3ECBB 1J11A 3TA3B 3CIQA 3QWQB 3TO4A 3TM6A 1HXYB 4JPKL 3P0VH 4OIIH 4UIMA 3OKKB 4ZXBA 5T5FH 3IRPX 3EO0B 3ZE2E 1GC1L 3VH8A 1QBAA 1BZ7B 3QUKB 2B0SL 1NEZB 4RBPH 4WUUA 3ULVD 3QEHB 1F3RB 4BKLB 5KSAB 3FO9A 1AGBB 3EOAB 4PGDB 1A7PL 3KPOB 5DQDL 4WHTA 3RVWD 1F90L 3OKMA 3QXDA 3SDDD 1UFUA 4YX2H 1OAYL 5A3IC 1SVCP 3PHSA 1X5HA 4ONFH 4EUPG 1JPFA 5C0BB 1IQDB 5JW3L 2HJKB 3ARZA 2VNCA 3MA7A 4L4TD 2CUMA 3D0LB 5H35B 3DUSA 3E6HB 4O4YH 5FYKL 2F5BL 2P46B 4DVRL 3MC0A 4NKQB 5KZCD 1P4LA 4YNYB 4BZ1H 5E9DD 1LO5B 3EHBD 3WDIA 2QTEA 3PGCB 2CJUL 3REWA 5FDWB 3ZHLA 4R7DB 4JJ5A 4MNGE 4OV5A 3IU4L 2H45A 4NZTH 2K1MA 5HYIA 3FT2B 3KPRA 5DQ9A 5EO9A 4BSJA 3CFDA 4M1DH 2ICWJ 4KJYA 1MCPL 2CRMA 5DJZB 1H8NA 5J1AA 5C0AE 2Z92B 1DQML 3SY0A 1TNMA 1CK0L 3S4SA 5J11C 4JFZH 3OKEA 2XA8H 1TTUA 2X70A 1UM5L 4KVCH 1NL0H 4HGWA 1MVUB 4Q6IB 3GMOB 1JRHL 3LKRA 3SDCD 5F3HA 3MUZ1 1AKJA 1I8KA 3L7EB 5BW7A 1NBZB 3LAFA 4I9WE 4KKAC 1R3LB 4MCZB 2P5EB 4CADA 1OGTB 2IGFH 4PUBH 1UXWA 2QEJA 3WSQH 3PQYA 2EIEA 4XPFL 1DBKL 2UVFA 3QNZB 5IB1A 1CT8B 1MF2L 4XP6H 3ZKMD 3T04D 4KK5C 4LASH 4U1MB 3UX9B 2Y36H 1U91B 2D31A 5IMMB 3NFPA 3ARFD 1BEYL 1A9EB 1A47A 2I07A 3CC5A 4PJAF 2XFXA 1KB5L 2NXZC 3OF6A 1AQKH 2BSRA 3VXMD 4YHKH 4GAJL 4DKEL 1CTNA 5I8CB 2NX5E 1F2XK 2DJUA 2MQ3A 5F7FA 4APQD 1U3HB 3TZVD 4FMFA 1VACA 3L3KB 3ARQA 2HMID 4HFWB 1RUKL 5F7LB 3OKNB 1YYMH 4X6BB 5EZIL 3MLUL 5F7EL 1DDHA 1TZGH 3DWTA 5E56A 1YEDB 4NKMA 4PTTB 5D6CA 5B21A 3VH8G 3WNLA 1JCKA 3A6CH 2Z35B 4FQHA 3R8QA 4LKCB 1V05A 3RVXC 2OJZL 2W60A 5I71B 1OM3H 5HVWA 3WIHA 4PJIE 4WW2B 2AJZB 2E7HA 2LU7A 2R39A 3IDYB 4AJ0A 5IROC 4ZTPL 3TH2T 3SBWC 1T1ZA 3V8OA 1GZQA 4YR6B 2FCBA 1AQDB 1DLFH 4R3SB 4UDTA 4HS3B 4KHXL 1OAZL 3VE0B 4JFQB 3ULVC 2MSPA 5GS0D 1WFUA 5INCB 3UJTL 1QTYT 3U2SB 4MDIB 4S1DD 4D8PB 1XGUA 3RVWC 4X7DC 3SPVA 5GS2H 4TQEH 1EHLL 4LNRA 3SDDC 4NC2B 1H3WM 2HT2D 4B50A 1VPOL 5FUZL 4XHJC 3DETD 4EDWH 3HZMB 5SX4H 2FEDD 2WBKA 3V6OC 1OF2B 1Y18A 4JY6A 4J2XA 2F74B 1BGXL 2J6EL 5ADOH 1A6ZA 4ELKA 2BFVL 3MRLB 4LLWA 4ZUTA 1E6OL 3RWHB 1I4FB 4WNQA 3TNMA 4GMTH 3HI5L 1ZGLP 1LMKA 3EHBC 5IWLC 1G7JB 3HG1A 5DJAA 5CEZE 2EE9A 1L0XA 3H3PL 3HI6H 4R8WL 4Y5VC 1JNNL 1EERB 1KTLA 5BZDA 2ICWI 1CWVA 2HG5A 4WCYH 4IDLA 1WSST 5IEKA 3UDWC 1B4JH 3JZ7A 3HS0A 1T04A 1RUAH 1L0QA 3GK8H 4PJ5A 5CEXB 5AZEH 1JF6A 1TPXC 3ZKQD 4F57H 4ZQKA 4LCYB 1R3HA 1XF3B 3V95A 1BOGA 2NPLX 2AJ3B 5JXAH 1G6RA 4UNTA 2H1PL 1QSEE 4NO3B 1NFDE 2IAMD 3QZWB 4LQFH 1XGQA 1FYTE 1NJ9B 2YK1L 3LD8C 5I73C 1JMZA 3EYQC 4MNGB 4R4NC 1U8OB 4Q6YA 1R5VA 4X5LA 1WFTA 1KEGL 2FRGP 4CVXA 3ZKMC 2GK0A 1YNLL 2YEZA 3GEWB 1U8JA 2AV1B 3SDXA 3ARFC 5C08E 4WTXA 2VXQL 3O45B 4TSBL 5HYJA 2D03H 1QNZH 5D7JC 4UMGA 4P2QD 3PP3H 4F58L 2XY2A 4YBQC 1LWRA 4N8CL 3O6MH 3UTSD 1YECL 4APQC 3IXTA 2V2TB 1PLGL 2VLJB 4ODBD 5EA0L 2HMIC 1QBLH 3RIAK 1AXSB 5DA0B 4Y5XC 4D0BA 3VWJD 4ZOAA 4QHUA 2JELH 3OJ2C 2R23A 3HC0A 3IDXH 4HK3J 5DJYA 3G04A 3VXNA 1GGIH 4CL7A 5K9JL 1T4KB 5IB5A 1JWUA 4ZUWA 3NOIA 3VFSB 2R0LL 1CE1L 4QXTB 4W68A 1UZ8B 4LPVA 3SE3A 1AI1L 4KRLB 2F58H 2NX5B 4B41A 2AGJH 5DD6B 5IHZA 3O9WB 5FGBC 1N8ZA 1VB9A 1INDL 1NBVL 3W0WA 1N5AA 4ZFGH 4S1DC 1BIIA 4HIIA 1IC5H 1KNOA 4AL8H 3FOMB 1IAOA 2CDFA 4LARH 4AH2B 4KTDL 5FM4A 3ARXA 4JREC 2V7NA 5HBBA 4P2OA 3RBSA 2HT2C 2I5YL 2DM4A 4PJIB 4NHUB 3DETC 1A22B 1XR9A 5D7KE 2OTUA 1MHPL 3QIBD 4RX4A 4U4BA 5BXFA 3QIUD 3CU1A 2FEDC 3U36A 3P40A 4X6DA 3O4LD 4H8WC 3HR6A 4NP4L 1DCLA 2CXGA 5EIIA 2MQCA 4XBEH 5IKCB 4YXHH 4P3CL 3U82B 1TQBC 4OT1L 2YD6A 1I3RB 3MJ7A 5L9DH 5EO1B 4MSWB 5I6XB 1MCSA 5HPOA 1I7ZB 3S96A 3TEUA 2MKWA 3H9ZA 5E8OB 5GRZA 4XGZA 3THMH 3O3AB 5JNYA 1JGDA 1I7UA 4HMEA 5F9JA 4X4YA 3DX9B 4HBQA 1NFDF 4A6YH 4FFWD 1XGPB 5F7HA 4KHTH 4DKFH 1A5FL 1RULL 5CEZH 3G9AB 5K59E 4FZ8H 3V5DB 1U93A 5IOPB 1LD9B 4GRLB 4PV8B 3B9KA 4A6YB 5EU6A 2AABL 4YHZL 43C9B 4C56A 1W72A 2I25N 3LY6A 1OSPH 3BH9A 1I1AD 1J8HA 2FD6H 1LE9A 5C70A 1FDLH 1TXKA 1JWMB 2BVOA 1FE8L 2VXTL 5E8EB 3NIFF 5SX5K 4QRUB 5HGHB 4X7EC 3B2VH 1GGTA 3WFEH 3BPOB 1CFSA 3CSGA 2WUBH 3CK0L 3L3HA 3QH3B 5I1HH 5D1ZD 1LGVA 3GHEH 1SY6L 1MLBA 3BEVB 4D3CH 1TJGL 1M71A 3O8XA 1BQUA 5J9PA 1SHMA 3QPXL 3U7WH 2V7HB 4K23H 2WUCL 1HHJB 3NPSC 5ID1B 1EMTH 1KJ2H 2A38A 2CMRH 4JGJA 1FYTB 2J8UA 4GT7A 3VGAB 1W0VA 3IJYA 2V17L 4R4FL 5T1DL 1RURH 2YRLA 4KQ3L 3NZ8B 1SJVA 2QHRH 2BXZA 1BBJA 1HXMA 1J1OH 1KJ2B 1U8LB 1CFBA 3MRCB 3P9MB 4HAFA 4N68A 2O5ZL 2HT4D 5C0IA 3VWJC 1GSMA 2IMNA 3PV6A 4L8BB 2D7MA 4HF5H 5DZOA 2B5IC 2IBZY 2N4IA 2D0HA 1OAUL 3V6FB 1IKNA 1CFVL 3QFDB 4FQ2H 3GI8H 3F58L 4KGJA 4AEIH 5GRVL 3AS1A 1A3LL 1R0AH 3MLRH 2EDNA 4HKJA 4LEOB 5J12B 3G5YA 4K94L 2ZG1A 5JXEA 3T0EB 2EDQA 2Q20A 2BHYA 4NM4L 1KPUB 2YPVL 3LN5A 2WWMC 3BKYL 4M7KH 3VDCA 2AP2A 3VMNA 4PRNA 4WFED 5LBSH 4KTEH 4G80B 5DEGA 1JYVA 1NKRA 2R1XA 1HQRA 1UM4L 5KVGL 1A4JB 1J1XL 2WZPD 3DECA 5F89A 3VDAA 1RUQL 2BC4A 2VTFA 4XPTL 4NC1C 3AM8C 3QIBC 3GM8A 3QIUC 4QRPD 1X5XA 5IMLA 2ARWA 1YEHH 3QCUL 3ARSA 4UT9L 1M05A 4JRYA 4IOIB 1Q9WA 5LWYH 1GGUA 3ZO0A 5EOTB 3NCEB 1JZ2A 3C09B 4P59H 4NZRH 1FIEA 2UWEA 3DHJA 5EUKB 2JJSC 2YS4A 2IQAB 5GISL 4PR5B 5JLZB 3D69A 3JV6B 2KKQA 3K8KA 5GGRY 2HP4A 4NYLB 2NTSP 4QTIL 5I1DA 1BQLH 1FFRA 1A6TA 1ONQB 4KUZL 4YHLH 4ZOEA 4X4ME 3E8UH 2X4RA 1MEXL 3DTXA 3FFDB 4FFWC 4P2RE 3WFCL 3TC9A 4J6RL 1V3LA 3QXWA 1SJHB 2HJLB 1IM9D 2X4TA 3V0VA 3KYMA 3QFJA 1MRDH 3O6LH 3R1GH 4RGNB 5GHWH 4FQ1L 3KLAA 4DFIA 5DJDA 4LSQH 4E41A 4G8FB 1I1AC 1S7RA 3PWPE 2F19H 3NZHL 1X5YA 5FECA 3GSVA 4UAOC 3U1SH 4Y1AB 4B0MM 3PWVA 3TO4D 3Q48A 3RPIA 3C9NA 4OGYL 1FGNL 2FX9L 2XICA 4FXGA 1YY8A 4YPGA 4Z7UE 4OZHA 4ZXBD 5GS1A 1ZS8A 5D1ZC 2O5XH 4UV7L 4DZ8B 1JYXA 4U6YB 3GO1L 4WUUD 4X6CE 1QKZL 3OKOB 4XZUB 1G1CA 1QBML 1Y0LB 4FP8H 3LPWA 3RL1A 5DLMH 1FAIH 4YDLB 5JHDE 3R0NA 1UH4A 3K1DA 3U7AA 1KENH 2ERJC 2I26N 2BOBA 4H0GA 2CGRH 2Y07L 5E5RB 1JN6A 3NACL 1YMME 1ZTXH 3S37H 2HT4C 4DOHE 3I02A 2V5TA 4PFEA 5JPNB 1G7MA 1BZQK 2Z93B 2CQVA 1QA9A 4U7KA 1A3RL 3C8DA 4QWWC 1DBMH 3P30L 1J5OH 2W91A 5GJTL 2RHEA 2WBWB 5IGXL 5J3HD 2Q76A 2XKUA 1NCBL 1E4XH 1SMAA 2EE2A 3KPRD 3MROA 4LLVB 1BIHA 1MJ7H 2E6JA 4UOW1 4P5TA 5EO0B 3JWDC 4Y16A 1NMBL 1JPTH 1IAIM 1FVDB 1PZUB 4XNZC 1MCOH 2HFFB 4RAUA 3MO1A 4GXUN 1L4IA 4NHCL 4OB5L 1MQKH 4JO2H 3VXUA 1KCRH 1AKJD 4IS6B 2ATKB 4XVSH 5DQJB 1Q0YH 4YJZL 2WM0A 3QIWA 2IPUK 5CGYD 5DUPL 4LBEB 4PP1D 2FATL 1NAMA 3MLSH 2E7LA 5EU4A 5B3NA 2G60L 3QQNA 1A7QL 3PQYD 2D4DA 4BA8A 4OZFH 5I66A 3RWCB 4BQBA 5EC2A 3FQUA 4XNMB 1WCBA 2V2XA 4K8RD 4OLYH 3RIAF 1HQ4A 2BVEA 1BFSA 5JQ6L 4PRDA 5CIPB 2FO4B 2R69H 5E8PB 4GW1B 3EGSB 4ODXA 5E94A 5HHVL 3OF6D 2X05A 1I75A 2H3NB 2WLZA 3P0YH 5TH2A 4W4OC 1EHXA 5CKGA 2BHZA 1TVBB 2VQ1A 1KN4H 2V9QA 2W0FB 2R4RH 1CD1A 1KG0A 2BSTB 4ORGA 1I8MB 1ITCA 4LVNC 4RMTA 2ZSWB 5KVEL 4ISVB 1IBGH 4KRPD 1CL7L 5HJ3B 5TJWK 2EXWD 5E00A 4NQCA 3T65B 1JYNA 5FYLE 3O3DB 5L2KA 2ATPA 1HHHA 1ZT7A 2NW3A 4X6CF 5FYJE 3LQZA 4ZPTA 3AS2A 1L9NA 3TO4C 3EYFB 3N50A 3V5HB 5ACZA 5T3XD 4H25A 4WFHD 4ZXBC 4P2RB 3BQUA 4FABH 5DSCA 4K3EH 3RP1A 3KPPA 5EBWB 1JYWA 1BFVH 3VXTB 3OR7A 3ZTNL 1YMHB 2P7TB 3LKOA 4JFXA 1FG9C 4Z76B 5C09E 4MXVF 2CIKB 3FL7A 1D5IH 4MA7H 1IEHA 4Z95L 4I0PB 2FYYB 12E8L 2ZCKH 3T8XB 1NLBL 3G5VA 3HAEA 3PWPB 4P46B 5C7XH 1OWWA 3RFZC 2R0WH 2RAMA 3F7RA 4PB9L 3ELAT 1NUDA 4HJGB 1AO7E 1F3DJ 4Z7UB 2BXYA 4CN4A 2XN9E 3RTQB 1QPPA 4Z5RB 3B8YA 3RWFB 2DWDA 3VGHA 1UG9A 4OBRA 4NQEE 3ARDB 5A2FA 2FL5B 2JJTA 3HG1D 4MHHG 2GSGB 5J3HC 3FMGH 1JMXA 5HDOA 1LILA 3D85B 3TV3L 4NBZB 4ODHH 3RDTB 5T1MA 4CN1A 4GMSH 3BUYB 2D7OA 5FYKE 2DN7A 1NDGA 4RMUA 5GZOD 1YMMB 4PJ5D 2DIJA 2A6JA 3PHQB 3WXWL 4DOHB 1PG7H 1Z5LA 4ODSH 1NGWB 3BRFA 3C60B 4KZEL 2IANE 1CR9L 2DQFB 2OJEA 1KB9J 3BP6B 4ZS7L 1GGYA 3VFOB 1QLRB 4OM1L 1AIFB 2VH5L 4HT1L 5ESQA 1A7RL 5ENWA 4KMLB 5BW7C 5AYUH 4ODVL 5CGYC 3RUGF 4PP1C 3PL6B 2VIRA 4PPTA 4TUKL 1NAKH 5DD3H 2FJGA 4QF1A 5KAQG 3UBXB 4PRIA 1LP9E 1QEWB 2MJWA 3LQAL 3DX6A 5DVOA 5EH1A 5HPMB 4Z7WA 4KRNA 5FGRA 4K8RC 4QTHB 1OWRM 1PYWA 4BFGA 2XTJB 5SX5H 4K71B 1HKLH 4XP1H 1I8IB 1F3DH 1I7TB 4PJ8A 3MRHA 3SE4A 3Q3GA 5HYJD 2DTSA 1Q94A 1INQA 5ALCH 4LHUB 3CVHH 3VXOA 2IFFL 4WGWB 3EOTH 4QHKJ 5CBAB 1U6AH 2J88H 1EFXA 1D5XA 1VFMA 2IADA 4N9GB 3WNNA 2N56A 3AS3A 1ROWA 1GOHA 3H9YA 1IGIL 5B8CA 1TZIA 3P4OB 4KRPC 4MD4B 2WWKT 5IW1B 2EXWC 4NPYA 5E2TL 1MQ8A 4JQIL 4HFUL 3V79C 4PRPB 5FK9B 5I1CH 1D5MB 1RZ8B 3QDGB 5TF1H 3HZKA 3BSZH 2GJZB 4M03A 2X41A 1QFWH 2YSSA 3HAEG 1TETH 5EG6C 5FCSH 1NGPL 4GBXA 5ITBH 5CP3H 4HH9B 1KCSH 3V4UH 3IF1B 2X4SB 4NWUL 3VGDA 1GGBL 4PGBA 4QHNB 3W0WD 1EHNA 5DD5L 2EYRA 3UPCA 1Q9KB 3OGCA 5FYJH 3H0TB 2JIXA 4D9LH 1C1EH 2Y7QA 3WNKA 1P1ZB 1ZLUK 1KTDB 4KRMB 4X0KA 1XCQA 3B6SA 5T3ZL 5J7CC 3MODL 5EIQA 4P2OD 5D72H 2YUZA 1NGYB 1XR8A 5GJSL 2J1KA 5TGBA 3S98A 3DHMA 4HEME 2DYPA 2DQDL 1FVCA 4RX4D 1FV1B 1W0WA 2XA3A 3FQWA 3R8BB 2ESVA 2DICA 2VISA 4UU9B 3U6RB 1A6WH 1LDPL 3AREA 5DJ8A 5HHOE 4HKZA 2K3TA 3D18B 2J4WH 1HN1A 4PJHF 1RZGB 2QSTA 3QQ4B 1VEOA 4ODTL 2GW5A 4JPKH 3EKCA 1WK0A 3N1PC 2OSLA 3DGGB 4OZGE 3C5SB 3KYAA 4G7YL 1GC1H 5HGAA 5DURD 1A3QA 1RIHL 2YMXL 4R2GB 1FYHB 1K9TA 4G9FA 1A7PH 3MNVA 5DQDH 2VYRE 1E27A 5GZOC 2VABB 3CFBA 1F90H 4CAGA 1OAYH 1AO7B 1FSKC 2XN9B 3LRSA 4LRIA 1DBBH 4HKXB 5ESVB 3HTLX 1LP9F 3L5HA 3LEXB 5JW3H 3MBEB 1K8DB 5EU6D 4Y4FB 4C56D 3LEVL 1A4KB 4NQEB 1J0KA 5M95B 4XAKD 2PW1A 3MCG1 1A6VL 4JN2A 1J8HD 2OQJB 5FYKH 2F5BH 4OKVA 4Y0GA 4DVRH 1T5WA 2ARJB 3QUZA 5GRVK 5I8OL 1MHHB 5D7IE 3FZUD 4XPGL 1EUTA 1FZJA 1FFNB 4R7DA 1Z3GL 2CJUH 4XVTL 2VLRE 5F1NA 1GZPB 1JWSB 1QFUL 3IU4H 3O8XD 1NEUA 4QHKI 4W6XB 2GIYA 2NY4B 1NGXB 1MCPH 1DQMH 1MCNA 4KK6D 3LMJL 3FQNA 2FEEL 5CGTA 3LV3A 3BZDA 5GSRB 1UM5H 4G6FB 5FIEA 2I60L 2YD8A 2ICCA 1JRHH 2IPKB 5DEFB 2EDBA 1J87A 1UKSA 3E2HC 1P53A 2BVPA 1WBYA 3BKCH 5I30L 2F8OA 1OLZA 3BKJL 5KVDL 4K7FA 2R29L 3T4YB 5IQ9A 3ZTJG 5M7QA 4M3JA 1PX3A 3I3EA 2Y06H 4MNQA 4XPFH 4HZLA 1DBKH 1MF2H 2X4UB 3WHE1 1EAPB 2Q3ZA 4FFVD 3U4EA 5T5NF 1ZA6A 2NY6B 2XG5A 3SE3C 4U1JA 4MA3A 4LSVL 2W1NA 4J4PA 1HDMA 5EUOE 3VFPA 5JXED 3TCLB 3VD4A 1KB5H 1DLHA 3OXSB 3KPMB 1Q1JL 4N0FA 1B9ZA 2D4FA 3JWOL 4KH2A 4GAJH 4F37K 2NLJB 3GSQB 4DKEH 1U3HA 5DJCA 3IS0X 3MLTA 3R06A 2FR4A 3EYUL 1HHGB 3GB7B 3WJLA 1JZ5A 3KXFE 4P2OC 3PABB 1RUKH 2IBBA 5DDHB 4UDUB 4X7CC 3ZT5A 5EZIH 3MLUH 5F7EH 3SDYH 2DQCL 4JFHD 3ZDYE 4OLWL 4H5SA 2V2WA 4HKBA 5F9OL 4OZGF 3RY6A 4ETQB 4F15C 5I0ZA 4I1NB 2IBGA 2OJZH 4JRYD 1ETZB 1MJJA 5IVNA 4XC3L 2ICWA 3FB5B 4U7SA 4M62L 3SKMB 3RKDD 1KIRB 3T1FB 4U1SB 1U36A 4P2YA 5GQBA 4EVNA 1WZ1L 4GXVL 4PJAA 1OAZH 5BJTA 4NKDB 1FBIL 1G9ML 4OLUL 5DJXA 4F33A 3F6IA 3UJTH 2R2EA 4DWHA 3FCTB 1EHLH 5DRNA 4HIJB 4QRQB 4WU5B 5MI0B 3IJHA 5BVPL 1MIML 4LGPB 2WINA 3QFJD 5HHOB 2CDGB 5FUZH 3B9KC 5FF6A 3QHZL 2HKFL 1V3KA 1DQJA 4E41D 1IL1B 1MWAL 3SJVE 4JLRB 3C2SA 3ARBB 1PQZA 3ARUA 1G7HA 1CXHA 2JCCF 1G7LB 1CI5A 2J6EH 2BFVH 4ZDHB 1E6OH 5GRWA 4HUXA 1HILA 3VD7A 5HSFA 5J56B 4X5WB 2OR8A 4LCWE 4RNRB 3HI5H 3FZUC 1KN2L 2VJXA 4KXZH 4BFBD 5DJ2A 2UZYB 3FQTA 4TTDC 2Q6WB 3N1GC 5B3JE 3INUL 3TESA 2OXHA 3H3PH 5L2JB 1JNNH 3GSOA 3O8XC 5F1SA 3RA7L 3WBDA 1GIGL 4HWUA 4LK4A 2PKDA 3UTZA 3BYTA 5ELIA 5T1LA 5FB8B 2LFGA 1EEUA 3QUYA 2FH8A 4KK6C 1NGQH 3LKNB 5DK2A 2OM5A 4NO5B 5J4MA 1KTRL 2H1PH 3H7BA 2KBGA 2MWCA 5D7IB 5HYQA 3MRNB 4ZUVA 4HULB 4QCIA 4F7EB 1U8HA 2BY2A 2YK1H 3PJSA 1WT5A 2VLRB 3G6AA 4M48L 1FVEA 4I3SL 4MQ7B 1IKNC 5EUOF 1DFBL 2P24B 2X4PA 3QG6A 4QYOA 4G6AD 4JKPL 2AXFA 4LCIL 2AV1A 1EO8L 2EECA 1YNLH 2GY7B 1T20B 4DN3L 4FFVC 2J5LB 5C0AA 1N4XL 3KNBB 2VKWA 3TIEB 3L3DA 3S35X 2VXQH 5JXEC 1CN4A 4TSBH 5HVFB 3HPLA 4PLJD 2BDNL 2P8MB 4F58H 3OJMB 3FRUB 2ZSVB 4P5TD 3ZDYF 4N8CH 1CXEA 4P4KB 4Y16D 1GPOL 4QOKB 1YECH 1MCFA 1PLGH 2R1YB 4GG6E 4MDJA 5EA0H 4KXZI 4K55A 1YEJL 4HXBL 3EAKA 3VXUD 1M1SA 5FA4B 3NCMA 4K7PL 3VXRE 5BCAA 2F8VA 1UJ3B 3QIWD 5DXWA 3STBA 1DUYB 3V8CA 1M7IB 3KPNA 1DL7L 2OL3A 3S5LA 3IYLW 2QSQA 4R4BA 5SWZB 1K3ZA 3CDCA 4H26B 3UTPD 2VXVL 5SV4A 3GSRA 3RKDC 2R0LH 2F53E 3CUPB 1CE1H 2XKNB 4JG0L 1TZHB 4I18A 4RFEB 4MJ6A 4DGIL 4YGAB 3WE6B 1AI1H 1SJXA 2W9EL 2HN7A 1R5WB 4GUPB 1DSFL 4P3DB 4X4XA 1INDH 1NBVH 1KBGL 1UB5B 5IF0A 3ZDZF 4C58B 3MLZL 5JW5B 3Q5OA 4JDVB 4KTDH 3X13B 2VDLL 1A6PA 1XF5A 4KTYA 3OJDB 3EDJA 3LOWA 5LAXB 4PJDF 4PRPD 5DS8B 3TT3L 2I5YH 4WWKA 1FFOA 3CSYB 3JTTB 4Q2ZB 5AUMB 3MRBA 1MHPH 5EBLA 5I1JL 2G5BA 4MJ5B 4QY8A 4TYUA 4YEFA 4LPWA 4NQCD 3WHXA 5L2KD 4NP4H 2RGSA 4XVJL 1OGAA 1LE5B 1S7SB 3K4AA 4P3CH 5CJXA 3VG9B 4OT1H 3MRRA 3HE6A 3P2TA 1DQTA 5GS1C 1S9VB 3BQUD 3B83A 4YHPA 4TOYL 1JZ3A 2H2SD 1V5JA 3LB6D 2MHAA 5DFTA 3NA9L 1A1OB 2Y5TA 1FCCA 4U6XA 4QHLA 5I1GL 3NBNA 3TBSA 2A83A 3VXSE 2HRPL 5F97E 1A5FH 1RULH 1ZHLA 1MCHA 1ZLUH 2CLZB 3FT4A 2CO6B 2AABH 4YHZH 1MHEB 4LCWB 3LPGA 1OD9A 1MREH 4JQXA 2VDRL 2DTML 2UY6A 4YHOH 4XBGA 2YD4A 3PWNA 1FE8H 2P48B 4LHJB 5E8EA 2VXTH 4G6AC 1XGTA 4L29B 1ZANL 1IEAA 4BSVB 2IPTL 1HCFX 1DN0B 1WVZA 2ORBL 3JV5A 5H37H 3CK0H 3IAQA 4QRSB 2B8OT 1CVRA 2OI9C 4BH7B 2L7UA 1SY6H 4G8GE 3KPSE 4GG6F 5DHVH 1TJGH 5I8EA 1B2WL 4PLJC 2WUCH 1QSEA 3S5LG 3L3GA 1NFDA 2Z9TA 4P5TC 2NY3C 4Y16C 1FYTA 4YUEL 2GT9B 5D5MF 4NUJB 5SWSE 4JKKA 2V17H 3PWJA 5T1DH 1LEKB 2V6HA 4ZFZA 4KQ3H 3WYRA 4Y5YA 4LVHB 1J7VR 4L8CB 2O5ZH 3QIWC 3VD9A 5DJ6B 3WUWA 4KI5E 2E7LC 1T21A 5FKAB 5C08A 5IBUB 3QBTB 1OAUH 3F58H 3JUZA 4D9QD 4HUKB 3AMKA 4Y2DB 1A3LH 4L3AA 3UYPA 3VMPA 3KYOA 3MGTB 1RU9L 3P73B 1MCIA 4U1LA 3RZCB 3C8KB 2HVKA 1GGCL 4C4KO 3VGFA 4NM4H 3BZEA 1CLYL 2YPVH 3BKYH 3X14B 1EAJA 3TP4A 1FIGL 5FO9A 4PGCA 4Z9KB 3VXRB 5HHQB 4F7PB 1FZOA 1YEIL 1UM4H 5KVGH 1EFXD 3F7YA 4MAUL 1J1XH 4WVRA 1MCEA 4K07A 1ZVSB 4MXWL 5IMKB 5F9WC 1RUQH 4XPTH 1QR4A 3RVTD 2NXYB 1ACZA 5B39B 3WXVL 3IVKB 5HVHC 5EN2A 4F37F 4QXWA 3AVEA 5F3BA 3QCUH 3L3IA 4UT9H 2CDEB 4HJJL 5FO8A 2DQEL 1KPVA 1GAFL 3QCVL 4M02A 2EKSB 4JANA 5C07B 5IFHL 1P7QA 3KPLB 5CCKL 3F62A 3K7UA 3QG7L 3MRJB 5GISH 3GBNL 3BQUC 4GBXD 2X1PA 3QWOB 3LB6C 5DJ0B 3Q5TA 5E5MA 3OAUL 4QTIH 4XBPB 1A21A 1EVUA 4KUZH 4NNPH 2AQ1A 1MEXH 1KPRB 2JIXD 3MLYL 3WFCH 3ZL4L 4J6RH 2C7UA 3AROA 3IDJA 2V5SA 4LNVA 2H6PB 2H32H 4HWZA 1CF8L 1GRWA 2KDGA 2FJHB 5CJOL 2DYPD 1CDBA 3LRGA 1P9MA 4FQ1H 2XXMB 1JTPA 4KQ4L 3JWNC 2ESVD 1F00I 1IC7L 2ZWLT 4HIEB 2AEWA 4OLEA 2ZPKL 4MMXC 3NZHH 2H32B 4NIKB 4PTUB 4F7CA 1TTFA 3P3YA 3SEPA 3KHOA 3OPZL 5KSUB 4OGYH 1FGNH 2FX9H 3T2NH 2JJTC 3EOBB 1CZ8L 1IGYB 5J1TC 3U46A 2XZQL 1NMAL 4UV7H 1T6VN 2OBGA 3GO1H 4NSKA 3GBML 3VXSB 3S36H 3U9PL 5DUBA 1QKZH 4PLKD 3WUWG 3RGVA 3S3SA 4G9FD 2XIDA 1QBMH 5HVGB 1IE5A 1G0XA 1XF4B 4Y4HA 2CXKA 4QEGA 5IK3B 3QO1B 4LLQA 3RJQB 1MAML 2PCPB 2ITDB 2D7PA 5KJRL 5HY9B 1YJDL 4EIGB 2R1WA 2Y07H 3NACH 4JFEB 5ADPL 1G0YR 5FM5O 2DM7A 1MI5B 2UY7A 1JPST 1NKOA 1A1MA 4HK0B 3MUHL 4WJ5B 1JZ4A 5E99L 4LPXA 3IXAB 2BNQE 2HAZA 4LU5L 3QUZD 3H9HA 2FO1A 4GG8B 3RWJB 3FO2B 3MNZB 2EH7H 3FHQA 1A3RH 1MFBL 5BQ7B 3MRPA 5ERWA 3GM0A 3P30H 5L8LB 3BP5B 1G1YA 4AT6A 5GJTH 1I1YA 4PJ8C 5IGXH 4HMCA 1IFHH 3SE4C 3QEUA 4YDKL 5SWSB 3W11D 3Q1SL 1ITBB 3MRIA 5C1MB 3M17B 3QDJE 1KJVB 4JM4L 1SVZA 1CDCA 1NMBH 3HFML 1S7VA 5L0QB 1AD9B 2VSDA 3DMMB 3I75B 4Q74A 3G5XA 4PG9B 4L3EE 4U1HA 4OB5H 4G9DA 1OAKL 5DQJA 4HQQL 4R0LB 1Q72L 3RVTC 3DRTB 5EU5B 4NBXB 5B8CC 4EIZC 2FBOJ 1BPVA 5E6ZA 4EZMA 5DUPH 1A9BA 3QEQE 1SEBA 1URLA 1D5BB 2FATH 3IFOB 5HHNA 1S78D 4GFTB 2G60H 5GGRA 3REVA 1A7QH 3TH3T 4MNQD 4O2EB 3MLWL 3MUGA 5HDQL 1IM3A 1MCJA 4GBXC 4JDTH 2JB5L 5JQ6H 3CDFA 4OZFA 4Z7VB 4J4PD 4AG4H 5GS0L 4LF3A 3EGSA 4I4WA 1IGJA 1NC4A 2BY0A 5HHVH 2G75A 2B4CL 4ZODA 1EEZB 1F4YL 2GUOB 3O3EB 3RHWK 5CMAA 4LPUA 2NY2D 3H3KA 2C5DC 3GJEA 5KS9E 3MMEB 2A2QT 5ID0B 1JF1A 1C08A 3E0GA 1MAKA 4KAQL 5IVZB 3DVNB 5KVEH 2XKSA 1C12B 1CL7H 1T5XA 4X9IA 1X7QA 3AREC 3F7PC 2E9IA 4NZDA 4XPBL 2NNAB 5ETUB 1IAMA 2BRRL 1JNLL 4P0DA 5GSVB 5T3ZE 5CD3B 3HI1A 2MPAH 5LQBL 3N1FC 3W5NA 2BMKB 2VDKL 4PGEA 5CEYA 2SEBB 3HPJB 3O4OB 4B53A 1ZHNB 4PLKC 3I50L 1A7NL 4ZOCA 3ZTNH 5FOBB 3I9GL 3SN6N 4L8SA 1TCRB 1KIUA 3KLSA 2ZJSL 3GJFK 2YBRA 2X1XR 1D9KA 12E8H 2PW2A 3PWPA 4ZPVA 1KYOJ 3LHPL 5BOPA 1KCKA 4LRIC 1NLBH 5IB3B 3WIFA 1QLFA 1AGCB 1XIWA 1WISA 3MV7E 1U8KB 1UWGL 1R3JB 5MERA 2APBA 5CSGA 4PB9H 1A6AB 3NABH 2VMFA 2DWEA 1ZGLB 2EXYD 4XP4L 2NW2B 3QUZC 4X6CA 2PO6D 5LKNA 4G8IA 2DKMA 3C6LA 3CMGA 4UOW0 4JRWA 1F6AA 3WS6A 3MV9B 4X80H 2P49B 4JGMA 1RV6X 4YK4B 1JGEA 5JHDA 2Z91A 3HMXL 4FFZL 4BUGA 4NRZB 4HXAL 2I9TA 3W11C 4ONOA 2P43B 3TV3H 1CL7I 1I1FB 2HTKD 5T1LD 3UTQB 3QUYD 2QADD 3KS0J 4ELME 3QXUA 3GSUB 5ICYB 3HMWL 4TVSa 3WXWH 2LVCA 3BP7B 2ICEB 2UYLB 4I77L 4O02H 5JA9A 2A77L 2DQFA 5CJBA 2MQ0A 2C3VA 4KZEH 3BGFC 1CR9H 3L5WB 3O6FA 2BNQB 3CH1A 4OM1H 2VH5H 4HT1H 2I27N 3UYRL 1A7RH 2VQTA 3RWIB 5C0FA 4OZFG 4M6NL 4ODVH 4JRXE 5C0GB 5F96L 2HJFA 1Q9LB 4IMLB 4TUKH 4YO0B 5IVOA 1KLUA 3D5OF 1S78C 1BJ1J 1QHOA 3LQAH 1HH9A 3LDBB 1MJ8L 4PJ9B 4RZCB 2ZUXA 3SKOB 1JTTA 4LSSL 5C0AD 5C0DB 3O0RL 1FNGB 3UPRB 4ZFFB 4J4PC 2IBZX 5KS9F 5MEOA 2L0DA 3FT3A 2DI8A 4ZTOL 4OQTA 2ZNWA 5E4EC 1CD0A 1DTUA 1LEGA 3DO7B 2H41A 3N9GL 2P5WE 1LNUB 3TBVA 2IFFH 5TPWL 2NY1D 1U3HC 5BVJA 3KYKL 3HC3L 4NOBA 1AD0B 4QT5B 1F8TL 3MGOA 3QEQB 3WLWD 4NZUL 3WJLC 3T0AA 3OKLA 3D2UB 3PNWA 3CVHA 3L5XL 1MHCB 2V5YA 3WUZA 3QNYB 4NO2A 1IQWL 4HPOH 5KSVA 2ZNXA 2Q7YA 4J3WA 4U0RC 5EC1B 2PTTB 1F3JA 1IGIH 3KS0H 4ZAKB 3RUGA 1JI1A 3RY6C 5DF0A 5E2TH 4JQIH 2Z4QA 1D5MA 1QRNE 2VZSA 4HC1L 3GMMB 1KT2A 4S1RL 4AIZB 3BW9B 5KSBE 4U6VL 3S97C 3P4MB 5DRWB 1EFQA 3BISA 1KJMB 2Z31B 2XWJA 4WY7L 3QUXB 1X44A 4NWUH 4JM2B 1BJ1H 1GGBH 2BK8A 3KHQA 5C92A 1R3KB 3X3GL 1JIBA 5DD5H 1CXIA 2BSSB 2IH1A 5A16B 1UB6B 5CP3A 1GVIA 3RWEB 4I5BA 4R97B 4F3FA 5LGJB 5T3ZH 4M7LL 1RJZA 3MODH 4R26L 1CG9A 2AS5M 3QJHB 5GJSH 3D25A 1RK1A 3HLAA 3KPQA 4WWKD 2DQDH 2B1HL 3ETBF 3MYJB 1MCLA 3IETA 3QI9A 1NANH 4UU9A 5EORL 2LTQB 3KLDA 5J06A 1ZWIB 1RUML 2EXYC 1LDPH 3RI5F 5HI3D 1OGAD 3BZFB 4ZOBA 1Y6KR 5FO7A 3QQ4A 1FJ1B 3ZHDA 1P4IL 4ODTH 4ELMF 5C09A 3HE6D 4BQ8A 4G7YH 1HCVA 2EYSB 4XVUD 2YD2A 3OV6A 4RWYH 1CDGA 1OB1A 3BPNB 3KWWA 1U95B 1RIHH 2CKBL 2YMXH 4R7NB 4HCRL 4WI4A 2HTKC 5ISZE 3QUYC 2QADC 4HUMB 5IMOB 4EI5B 5T1KA 1KGCE 1K4CA 3TBWB 4CRPA 1UZ6E 4X8JB 2FLRT 4P49A 3O2VL 5JOEA 3LEVH 1EEYB 4L4VA 2HT3D 1A6VH 3RL2B 2WW8A 1WT5C 2BNUB 3DXAB 3IU3B 5D1QA 3STZA 4K3DL 4ZNEE 3UEZA 1CGXA 4PJHA 5I8OH 4XP5L 4YAQA 3TIDB 1PJ9A 4XPGH 5D6DA 1J18A 2YN3A 4EBQL 4NQXB 1GZPA 4KK9D 1Z3GH 1P84J 3D6GA 1QFUH 4KKBD 4LSTL 2DMBA 5MEQA 2IANA 4PRBA 2OLDA 1QSED 1LK2A 2DKSA 1NFIB 3ZE0E 43CAB 2NY1C 4HWNA 4JRXB 4WTZA 1A2YB 3LMJH 3LSOB 4J12A 3WLWC 3VWKB 3AB0B 1LP9A 1WFNA 1NBQA 4XNYH 2I60H 3L9RA 2GCYB 2D7QA 2DLIA 4CW1A 4M4RA 1WZLA 5KSBF 1RHHA 1HHKA 3CDGB 5I30H 1WBXA 4IDJL 5CHNA 3BKJH 5DR5L 5KVDH 2R29H 4LMQE 5JIPA 4YGVB 1C16B 3HRPA 4IM8A 3TPUA 2OR9L 3I6KA 1J05A 5D7SL 4RQQA 5D7LE 2PYFB 4I18C 4NRXA 4GS7C 5TDOA 1Q0XL 3PIQB 2A6IB 4MAYB 2ZUUA 3OQ3B 4G8EA 4NN5B 3E3QC 1UM6L 4YIQB 5D1XA 2DLHA 4JFOB 3JWOH 3MREB 1CICB 3FQRB 4WU7B 4AENA 2YPLE 5BRZB 1AP2A 1KB5A 2Y23A 2YD1A 3EYUH 2RIKA 1HH6B 3ET9F 3D3VA 1QRNB 5GRYA 3P4NA 4PJCE 4WWKC 3GIZL 4WFFE 4O51B 2DQCH 3FAWA 4X9HA 3F65A 4OF8A 1J0IA 4PJEE 1JVKA 3RHWF 2IEPA 3P0GB 2W38A 4MQTB 5HGDA 1ND0A 3OKDB 4TRPL 5HI3C 3I3DA 4XC3H 4M62H 5CJXC 1FRGL 1P7QD 1L9MA 3HE6C 5I6XC 1LK3L 2GITB 1Z2KA 1MSPA 4U6HA 2E8ZA 5DEZA 5I17B 1K8IA 1WZ1H 4GXVH 5IIEA 4QRTB 3MJGX 3BD3A 1FBIH 1G9MH 4OLUH 1UZ6F 1IEBA 4XXCA 4TVPH 1FNEA 1ES0B 2F8XC 5J13B 2FHFA 4J3VA 2VAAB 1MIMH 3U9UB 3I6LD 4KUCF 4GAYB 4GRLC 4AM0B 3C5ZA 3DV4A 2EDOA 3QHZH 1IL1A 4LCCA 4BK5A 4PJXE 1G84A 5TF0A 2W07A 4UV4L 2XWBA 4JQXC 4OZGA 4BSWA 4GRWF 3DSFL 1ZHKA 4Q9CA 5SWQB 2UVEA 4R9HA 1J88A 2DKUA 2VB5A 2X5PA 2X7LA 3O11B 4D0CB 4WTZG 3GIVB 5E08L 1RZJL 1KN2H 1MWAB 3MNWA 5ISZB 3GUTA 5D2NB 2YPKB 3GNML 4KK9C 4JY4B 1QR1B 4KKBC 3BD4A 1GOGA 1KIQA 3RA7H 5I9QB 1GIGH 3RGVD 4UT6L 2XPGB 4OI7A 1XF2B 1VKXA 3U0PA 1T80A 4Y4HD 5FDYA 1R24A 1CFNB 1ZAGA 5CJ8A 4PJBE 3TBYB 4NNXB 4GW5B 1DVFB 3GJFH 4Y5YC 1UJTA 1U92A 1A6UL 3QRGL 1QOKA 1JV5B 3WHE0 1VFAA 2BCKB 4NN7C 1WITA 5TDPB 2JCCA 2XG4A 1F4WL 1E6JL 4M48H 1DR9A 4I3SH 3EIFA 3S6CA 5FOJA 4AIOA 1DFBH 1T1WB 3L3OA 4JKPH 2JK5A 1MJUL 1PEWA 4LCIH 1N64L 1EJOL 1EO8H 3PDOA 4K8RL 5DT1L 1I7RB 4DN3H 4G3YL 4M93C 3VGGA 1N4XH 3SGJA 1S7UB 2XWTB 5MENB 1NLDL 3O41A 2HKHL 5IW6B 3IAGC 4IJ3C 2BDNH 4N1HB 5L7XL 4PJCF 1M7DB 3SGDH 3H7LA 1GPOH 1U8IB 2C3XA 5GGSY 2D7NA 5C0EA 5T5NG 3UZQA 1YEJH 4HXBH 3OKYA 3FN3A 4J3XA 2CO7B 1DE4B 4LP4A 2IPUG 1PKQE 4K7PH 4JVUA 2OXGA 4JZNB 4WEUD 1RK0B 3SO3B 1YPZE 1B0GB 1NSNL 3UZEA 4DUXA 3SGKA 5EUOA 2ZUYA 3WIHL 1MRCL 3EJYD 4LKXA 4ZD3L 2VXVH 3C8HA 3EYVB 4PJFF 5F7DA 5EWIL 4M7LT 1IAII 5I1KH 5T3XL 4JFYA 1OD7A 4JG0H 4U49A 4ODUB 3NGBB 2W9EH 1DSFH 3KXFA 3LN4A 3V5KB 3DBXB 1NC4D 4R96A 1KBGH 1YN6A 3N06B 3EZ8A 3FB6B 5AYQA 3MUY1 2VZTA 3EYSL 4M8QB 3MLZH 4WW1A 4M8VA 4AYFA 5BS0E 2R2HB 4OF7A 4PJEB 1SEQL 2VDLH 4N8PA 4JO1L 1B0RB 5D96B 1UYWH 3BX7C 5DTFA 4IRSB 25C8L 3MX0A 4DAGL 4Q2ZA 2XI9A 4DVBA 1P9MC 2W0PA 2P8LB 2DQTL 5I1JH 5F21B 4CVZB 1FG2B 4HEPG 1C5BL 5DGRA 4CU7A 3UTTB 4LMQI 1IGTB 2DLFL 3UJJL 3L7FB 4JM2D 4P5KA 3S3JA 4U1IA 1I1CA 1KLGA 2BNRE 1QFWM 2E8YA 4WO4A 4X7TA 4JFDA 5HI5D 2DQUL 5FGCB 1N5YL 1TMCB 5I76B 4TOYH 3MLVL 3C5JA 4XC1H 3NA9H 1LEIA 4FZEL 3T4AA 1RMFL 3RGVC 3V6OE 1MFDL 3D0VA 5I1GH 4G7VL 1Y6NR 1F6LL 3SJVA 4Y4HC 5TE6L 4PJXB 5JDSA 3F6LA 2HRPH 1D9KD 1MH5A 4UQ2B 5GGQL 4AQOA 1CDUA 4PJDA 3X3FL 3MLXL 1P5VA 1MIEL 3G5ZB 4U1NA 1SYVA 2ZKHL 4Q9RL 2E5EA 1S7XB 5I15L 2VDRH 5AD0A 4A2LA 2DTMH 2VL4A 4H1LB 2FB4L 2AV7A 1T0MA 1MLCA 3PGFL 3B5TA 3HZVB 1T1XA 1T7VA 2H9GB 1TFHA 4LPTA 1ZANH 4N0RA 3C6LD 4XPAL 1UQSA 4WEMB 4FQPA 2IPTH 1TJIL 3T08A 2ORBH 1U3ZA 3FTGB 3VFVB 3RWDA 5JHDD 1AGDB 2ED9A 1B2WH 2X1WL 4PJ7E 4PJBB 1L7IL 1KC5H 5I18L 3HRZB 4MVBD 3I6GA 1SY6A 4JR9L 1RJLA 5DHVA 4YUEH 3LKPA 1BBDH 4K3HA 5E8DL 3ZDXE 3ZKXC 1DJSA 5TQ2L 5JDJA 1CE6B 4XB7A 3KDMA 5D71H 3O6FD 4JFPB 5F1KC 4YBHA 3FOLB 1KLFA 3N1QC 3QDME 2E6QA 4BM7A 3QA3A 5JQHC 5J11B 5J6HB 1T7ZA 5I16B 2GK2A 1AHWA 4GKZA 2CR6A 1HWHB 1BQHB 3QQ9D 3EJYC 5MEPA 2XZAH 4PY7B 4CN6A 5EFIA 3GMNA 1KF9B 1L6XA 1FLTX 2GSIA 4U3XA 1ZT1B 4U6TA 1IVLA 4OUUB 2BSED 1MCRA 3RZCA 5IBTL 3IDMA 1RU9H 4GG6A 1NGZA 5ACLA 1WJ3A 2GHWB 5DRZB 3QXTA 4GLRH 5D7JA 1CLYH 1CGVA 1FIGH 1BD2A 2ED8A 3CSPA 3QUMA 4YDJA 4D0DB 2A9NL 3IFPB 1JHTA 2VITB 1YEIH 4OLXL 5F7MC 1GH7A 1FC2D 1YPZB 4M61B 2NXZB 1U8MB 1RZ7L 1TVHB 3GKZA 1ZT4B 5LXGL 3M1BB 3RWGB 4MXWH 2DBLL 1SM3L 4NQSB 4KJWD 1DP0A 4V1DE 2F54B 2F53A 5CSZB 1YY9D 2I9LB 2LU4A 1WZMA 5GGUB 3CZJA 3F7VB 4O2FA 4HJJH 3U83A 4JVWA 1OSZA 2VL5B 4RGOL 2DQEH 3TNNA 1CFTA 3VFNB 4CVUA 1GAFH 4HAGA 5F9DC 3BHBA 4PV9B 3SDAA 5JORA 2BVQA 3QCVH 5IFHH 3C08L 4PRHB 1X5JA 5CCKH 5HI5C 3GSXB 3QG7H 3GBNH 1FZMB 2CH8A 3OAUH 5CP7B 4KZDL 3H9SA 1QQDA 4FQLL 1ADQL 1H15B 1YQVL 4L8SC 2C1PA 2P45B 3MLYH 3MV8A 1VEPA 2GFBB 2HH0H 4XCEA 3ZL4H 1ACYL 3W2DL 4M1GL 3RNQB 3VD3A 1D9KC 1S8DB 4KGLA 2VLKE 1L0YA 4HUVA 1FORL 3W39B 3RX7A 1CF8H 5CJOH 1XIWC 1YNTB 3MQIA 3ME0A 1UXSA 4KQ4H 1HYRC 3MACL 3SDDB 3QI9D 3SCMA 1HE7A 5KTEL 5JIIA 2D9QB 1GOFA 5H37G 2VC2L 2ZPKH 4XHQA 2VR9A 1EDQA 4L4TB 4PJ7F 3C6LC 3GMQA 5DHYA 3WS6C 4M6OH 5C09D 1CZ8H 3OJVC 3P9LA 5CBEB 4DGYL 3BESR 2GQHA 2XZQH 4FQCL 1Q38A 3SO5A 3ZDXF 1NMAH 4IHOB 3GBMH 4RAHA 1AJ7L 3U9PH 5KZCB 5E9DB 4MVBC 4NKOA 1X9QA 4JKMA 1NDMA 2GAZB 2HYMA 3WS3B 4DCQB 4YLQT 4TSCL 4Y5VB 5T1KD 4OIAA 4L3CA 5GIRA 4JPIA 1MAMH 3DIFB 3BEWB 5CUSL 3RU8L 5KJRH 4NQVB 3O6FC 2IALA 1YJDH 4S1SL 5JOFA 5ADPH 1G7IB 1TPXB 4IRZL 5HHPB 4L4VD 3ZYJA 3TO2A 3CH8A 1NH6A 4ODWA 2KZ1B 4ZSOA 3LS4L 5D1QD 3ARWA 5E99H 4G8GA 3KPSA 4JZOB 4P2QE 3PWUB 4LU5H 1QBBA 2EDJA 1BX2A 3K4ZA 4JKLA 1MFBH 4NQUA 3RJDA 5I73B 2D9CA 1QSZA 2K7PA 3RZWA 2XZZA 1KFAH 3JTSA 1U9KA 3BDYL 3HCVB 4YDKH 2IAND 3Q1SH 3IDNB 2YUVA 4UT7H 2QSVA 3QULB 3U0WL 1RZKC 5D8JL 4JM4H 4AMKL 3ARFB 3HFMH 4PRAA 1H5BA 5HYEA 2ZUQC 3GDBA 1EBAA 4MNHB 3VXMB 4HQQH 3NFNB 1Q72H 1I9EA 1FHGA 4JFFA 4APQB 1YY9C 4WUKH 5I0DA 3DURB 1HIML 1HKFA 3DV6A 4DK6A 3GMPA 3G08B 4PREA 5D2LE 3DYPA 4M43L 3L5JA 1DQLL 3IDIA 4Y5XB 4ZO8A 3MLWH 3BXNA 5IHLB 4PJGE 2JB5H 4WV1A 1CDYA 4I2XB 2FBJL 5FHBL 5GS0H 4J8RB 3MFFB 3KYNB 5D1XD 5J6GB 5I2IB 1PVHA 2B4CH 1F4YH 3B43A 2CIIB 3DRQB 1BFOA 3CPLA 1FO0A 3D3VD 2FHCA 1JK8B 8CGTA 4GXUM 2EZ0D 3IFNL 5IR1B 3T0DA 4KAQH 1B6UA 2ZCLL 4LGRB 3QI9C 2BZDA 1G7QB 1ZOXA 4JREB 5IB2A 1IGCL 1C5DA 1ZEAL 2O61B 5L6YL 5CJQL 5EZJB 5C6WH 3O2DL 3IGAA 4DJMA 4XRCA 4BZ2L 2FECI 3BVNA 1U2CA 3F5WB 5E2WH 1I9IL 1K2DB 2BRRH 2X10A 2YC1B 3MCKB 4HWEL 5GSVA 1JNLH 3RNKB 5IB4B 5IG7B 3NAAH 4YFDB 1T22B 4RDQF 1K3IA 2M8XA 3L95B 3CFJA 3X17A 4JZJA 5LQBH 2H8PB 5IJVA 2VDKH 5B38A 3ULSA 3VXQB 3ZE1E 3I50H 3BH8A 1VADA 1TQBB 1S5HB 3WFHA 1FN4B 3DROA 3E6FA 1GC1C 4YHIB 5EBMA 3NN8B 4XWOD 3HUJF 5HDBE 3VGEA 3LHPH 2HVJA 2ITCB 1V7ML 2Q8BL 2Q86B 1WICA 2W65B 4XMLL 3QO0B 3ARTA 3GSNB 3C5ZD 4WHYH 4OAWA 1UWGH 3OHXB 1H3UA 2QQNL 5ICXA 1VFBB 1EVTC 1G7PB 4XCYB 4NUGL 4GKNB 3MRGA 2X4QA 1XGRA 5D1QC 3DGCR 3QPQC 4BFIB 4XP4H 6FABL 1T3FB 4X99A 2W0KA 3TYFB 4OZIF 4N0UB 4I3RL 4S2SB 2FIKB 5H2BB 1DEDA 5D6DC 3ZT7A 2EEDA 1C7TA 5ANMA 5JTWA 1UH2A 5GGTA 3QP3A 1HSBB 4LLDB 5IM7A 4L1HA 3HMXH 1EGJH 2HLAB 4HXAH 4LVEA 4HMDA 4Y4KA 4L8DB 1VHPA 4RFOL 2Q8AL 1T0NB 3DVGA 3HMWH 2DAVA 1WEJL 5A3ID 4Z0XA 4F9PA 3G6JF 4YC2C 4HBCL 4I77H 2A77H 1IKFL 2EDDA 4J1UB 4P2QB 3NPSB 1P69B 2EIZB 2IQ9L 3UYRH 2ZOLB 3BZ4A 3ILPB 3UTSB 1ZVHA 4M6NH 3OSKA 1U58B 5F96H 3QDHA 1NAML 2L4OA 4PJGF 1S7QB 4HV8A 3KR3L 3FAXA 4WFEE 4FQXA 5JUEL 3R0MA 1MJ8H 1G9NL 3VWJB 4POYA 3PHOB 4KJQD 3QDJA 1RJYA 4LSSH 2VRAA 5KVFL 2B5IB 2A6KA 3PE9A 2EKJA 1EV2E 5IVXF 1JUFB 1YDPA 3FB7A 4X6FB 3C6SA 4OZ4A 5DK0A 1HEZA 4ZTOH 4L3EA 4E42A 1JNHB 3WDJA 5D1XC 3CMOL 3DX7B 5TPWH 1DANU 3KYKH 3HC3H 4TNWK 2W9DH 4DZBB 1F8TH 3FB8A 2FZ3A 1S9XB 2DBJA 5DVKA 3D39D 4Y19A 3L5XH 5FA3B 2ZOKA 1IQWH 5KBNC 4TSAL 2EZ0C 5D2LB 2R4SL 4WDIA 4NGHL 5JO5B 2ADJB 2UUDK 4HC1H 3BAEL 3BW9A 4XCNB 3ZE1F 4S1RH 4UBDD 3QIBB 5DRXA 4MX7A 3L3JB 3QIUB 4TPRL 1PX4A 4U6VH 1Z9OA 3O4LB 2UZXB 1K5NB 4F2MA 3VRJA 2P8PA 3AU1B 2VE6A 3H6JA 3GMLB 4U05A 5E1AB 3OB8A 3TGXA 5HDBF 5KS9A 2W59A 3KXFD 3CFEB 2NXZD 5K9KA 1VERA 1XZ0A 3X3GH 1AGEB 4NRYB 2VR5A 4XXCC 1C7SA 3BPCB 1KOAA 5LGJA 2G9HA 5C0RL 2F54D 3W9EA 1FFPA 5IQ7L 1ZLSL 4XWOC 4JDZB 3BIBX 3MRMB 4M7LH 3C5ZC 4XP9L 4LCCC 2B1HH 4OD2B 3MRKA 1AE6L 1T03L 3D1MC 2FLBT 4F7MA 5EORH 4PYGA 2J8OA 2B20A 5CILL 1RUMH 5C2UB 2XZCH 4RAVB 4HS6A 4L4JA 2PETA 1X5IA 1BVKA 2X4NB 3C87A 4JY5L 4GKSB 3HE7A 1P4IH 2JB6A 3P77B 4WO4D 1D6EA 1I1AB 4JFDD 4OCSH 5F70A 1S7WB 4UAOB 2ADGA 3MXVL 5JW4N 2J2ZA 2CKBH 4HCRH 1QUNA 4NN6C 1U8PB 1LQSR 2Y4SA 1D5ZB 3MV7A 1F5WA 5D1ZB 3SJVD 2CUHA 1KCUL 2YWZA 2VZVA 2GTZA 3BT2L 2MCPL 2CKBB 4JJHA 3WN5A 3ULUL 2WBJA 4MWFA 3KG5A 2DQGL 1FZKB 4UUJB 1ORQA 4XHJD 3CDYA 3O2VH 4MJIA 3A0OA 4IIQA 3CXHJ 4KMTL 1FLRL 3EFFB 3K81A 3KPRE 4J3OC 5D9SA 2ERJB 1RFDL 5EZLA 4K3DH 1ZA3B 2ZUWA 4XP5H 3RVVD 3FONA 5BMFL 1TCMA 4O58L 4NOFA 4ELMA 4KJQC 4FXKB 3OAYK 5IEHA 4EBQH 5E8NB 4DGVL 2CRYA 3SGJC 3FQXA 2X1QA 2ADIB 1A1NB 1F02I 1MY7A 5C9KA 4EUPB 3DI3B 2FWOA 5C0CB 4HUWA 4OF0A 5JPMA 1M6OB 1DUZA 3IRZA 3WFBL 4EDXA 3LSOA 5I74C 2DLGA 4ZYKB 4LVOC 2HFEB 4HDIB 4J7RA 1HHIB 4LDEB 4BH8A 1CGSL 3IB4A 4WEBL 3MA9H 1H8SA 2VLJE 3T0VA 1H3PH 4XNZB 3KVQA 2NY7L 4IDJH 5DR5H 3EYQD 4R4ND 4MD5A 1KCLA 2IH3A 3SGKC 2AKRB 3K46A 4KROD 4WW2F 1C16A 3MRDA 2QR0B 3VRIA 2OR9H 4UBDC 4I48B 4UINL 4QRPB 1A8JH 4QGTA 2P5WA 1YYLH 4NQDA 2AXGB 2X9XA 4G43A 3JV4A 5LJYH 4U1KA 1UVQB 1BZ9A 4P23A 3MV01 3BIKB 4L9LA 2XNAB 1CGUA 2JJUA 5D7JD 1AC6A 4EKXA 4O2CB 1BD2D 4WU7A 4YBQD 2R56L 3IT8D 1JGUL 3AAZA 1PGRB 4KVNL 1D6VL 4X6EB 3ARPA 3BWAA 4QXUL 2E27L 5FKPA 1NBYA 5T3XE 4WFHE 3GIZH 4HX1A 1MUJA 3VMOA 5KSBA 3K4DA 2J8HA 2F53D 1WC7A 4MD0B 3OR6B 4GRMA 3ZE2F 1IM9B 4F7TB 5BZWB 3CFKA 2QKIA 2A74A 4TRPH 2AK4A 3PWLB 4LVNB 3SDAD 4P4RB 1Z9LA 3VFWA 3TN0A 1FRGH 4WO4C 2Q3AA 1LK3H 4PP2A 3T77B 3LKQB 2OR7A 2NTFB 2XQYK 2DL9A 2X4OA 5C3LD 3TO4B 5AAMA 4UIMB 3BMVA 3H9SD 4ZXBB 5I1LA 3S35L 3MV8D 1JGVL 2KQMA 3VH8B 5CAYB 2GYSA 4H20L 4WUUB 5J1SC 9CGTA 4FOMA 3FO9B 5C9JA 4RGMC 3DNKA 5C6TL 1NCWL 4WHTB 5GGVL 3MJ9A 4YX2L 5CZVL 3OKMB 3QXDB 4ONFL 3SCMD 4UV4H 4EOWL 2ZUSA 4NT6A 1JPFB 3CFIC 3DSFH 1P4BL 5A1AA 2B1AH 4GSDL 1IC1A 2E9WA 4OF3A 2G2RA 4X5XA 1H3VA 3MA7B 2XACC 4P57A 5EB9A 3DUSB 2QBWA 3RVVC 2Q7NA 5E08H 1RZJH 1AY1L 2YRZA 3VJ6A 2VUOA 3GNMH 4XMKL 3ZSTA 1NQBA 2FIRT 4QRRA 1KJ3L 2AJYL 5EU7C 1N2RA 1IAKA 1P4LB 2VLLA 3F8UB 3UP1A 1BF2A 4LSDA 4UT6H 5DWUL 3REWB 4JJ5B 4OV5B 1U8QA 5L8KB 3TYGL 1P2CB 1DEEA 3KPRB 5DQ9B 1ZGLM 5EO9B 4X98A 1Q9OA 1MPAL 4KJYB 4Y89A 4G42A 1A6UH 5J1AB 2X9YA 3QCTL 3EZJB 3SY0B 2DL2A 3S4SB 4HWBL 4WIQA 5HYJE 3OKEB 1AHWC 3O3BA 3GJFA 2X70B 1F4WH 4G8GD 3KPSD 4HGWB 1E6JH 4KROC 5EPMA 3LKRB 5F3HB 1AKJB 1I3GH 4U2ZA 1I8KB 3ZYIA 1QVOA 1ZHBA 1MJUH 1N64H 1EJOH 4K8RH 5DT1H 3Q6FA 4IOSD 3HC4L 3BGMA 3DPBA 4CADB 1ORSA 2EDWA 4JHBA 3BOVA 2KUTA 1AGFA 2CLVA 4LLYA 5BO1L 1UXWB 3DI2B 3RZCC 5IFJA 3VDBA 3PQYB 4LRNL 4EN3A 1NLDH 5SX4I 5IB1B 2HKHH 2DM3A 2GJ6A 4M7ZB 3QT2A 4CMMA 5HHXL 5L7XH 1UEYA 2D31B 3NFPB 4OJFL 1S9YA 2PXYA 1U8NA 2NYYD 3V7AE 2I07B 3CC5B 3T0EE 2XFXB 2C9AA 4M5ZL 4PJIF 2BSRB 4PLOB 4DN4L 4DQOL 3M07A 4JFFD 4AZ8A 4KKCD 5D7LA 3QXAA 1VACB 1ZMYA 5KG9A 1N59A 1VGKA 2RQ8A 1NSNH 3W0WE 4HG4K 4H88L 4Z78A 1DDHB 1MRCH 4ZD3H 4NKMB 2EH8L 3A6CL 5D6CB 3SDAC 4NNYA 3UMTA 1P7KA 2YKLL 1QHPA 5EWIH 4KRPB 5C3TA 4FQHB 4QHMA 1FL3A 2YPLA 2W60B 2EE3A 5CS7A 1UACL 1XT5A 1BREA 1NCDL 3H2WA 2IG2L 2WWMD 4PJCA 1T1ZB 1GZQB 4GQ9L 3A6OA 3EYSH 3VI3E 2Z8VC 3BGAA 4ZUUA 1MRFL 4UDTB 2NCMA 5ITFA 1SEQH 3I3BA 4JO1H 1CFQA 1JHKL 1IGFL 2QQKL 25C8H 2A6DA 4DAGH 1XGUB 3SPVB 3CFCH 4LNRB 4ETYA 1F97A 3SCMC 3ARYA 1C5BH 2XT1B 2AI0L 5IFAL 3HZYA 4N8VA 2AXJA 4L1DA 2DLFH 3B5HA 4RGNE 3UJJH 3Q6GL 4PJFA 2QL1A 2UUDH 4UILL 1Y18B 4JY6B 5MHSE 5E6IA 3CX2A 2GTWA 2DQUH 1A6ZB 4ELKB 1HOCA 4LLWB 4ZUTB 1N5YH 3VRLE 4Y1AE 5F7KC 4WNQB 3MLVH 3ORJA 4NJ9L 3TNMB 1MAJA 5EU6E 3V2AR 4FZEH 1RMFH 4U2YA 1MFDH 4XAKE 1JF5A 1J8HE 3HG1B 3TVMA 4G7VH 3MR9A 8FABA 4ONHB 5TE6H 5FGSA 1KTLB 5BZDB 3W9DA 3V52L 1TJHL 4XNUL 5GGQH 3T0XA 5IEKB 5K9OA 4F8TA 1FNAA 1ZLVH 3A67H 3IDGA 3X3FH 3L6FA 3HS0B 1T04B 3MLXH 5AZEL 4CMHC 4CNIA 3NCYP 1JPGA 2ZKHH 4PJ5B 4Q9RH 1FL6A 4ZQKB 3I2CL 1R3HB 3BO8A 4ALAL 5I15H 1FSKB 1BOGB 1G6RB 1YUHA 4YXLL 4ZFOA 2V9TA 5ICZA 1F11B 2EEAA 3CZFA 4J3TA 3IKCA 4XPAH 1XGQB 5JHLL 2J8UE 1TJIH 4XMPL 4URTB 2ICES 1QSFA 4MA1C 3WKML 5GGSA 1R5VB 1QP1A 3DUHA 4CVXB 2GK0B 1BJ8A 1L7IH 2YEZB 1U8JB 1MFEL 5I18H 1A0QL 1NCUA 1EBPA 3SDXB 4PYHA 3N1MC 4DEPC 2ED7A 1E28B 3QJFA 4ZUSA 4LLUA 1H5BC 4TUJA 2NYYC 5E8DH 3WLBA 1T7XA 5HYJB 5TQ2H 3PGDA 1G0DA 2OK0L 1K4DA 5FM8A 4KKCC 3IXTB 2XXCB 2OL3L 5DD1L 5K33A 2MFNA 1H8OA 4ZMAT 3RIFK 4FQXD 4FNLH 3CCHA 4JHAL 3SHSA 3E2HB 3IDUA 1B4RA 4QWWD 1KIPA 4D0BB 5C0CD 3QDJD 4QNPE 4W81A 2R23B 4WV1C 3HC0B 4LLMA 5IBTH 5DJYB 3G04B 3OAYH 3VXNB 1SBSL 4JFHE 5IB5B 4L3ED 1JWUB 1J12A 4ZUWB 3NTCH 1PKQA 1N3NA 4N8VG 1TVDA 2F58L 2A9NH 3OXRA 4JRYE 3ZKND 5IHZB 2CLRA 4YHML 1N8ZB 1TVHA 4OCWL 1N0LA 3W0WB 1RZ7H 2UWEE 1PBYA 4Y19D 5F1IA 1N5AB 1OAQL 5LXGH 4PY8J 1SBBA 5F88A 1IC5L 2VLMD 2DBLH 1BIIB 4HIIB 1SM3H 3CNKA 1KNOB 4OI9A 2DI7A 1IAOB 1TENA 2CDFB 5AG9A 1WBZA 1YEEL 2V7NB 4L5FL 4P2OB 1W8OA 3F12A 3MRFA 3GSWA 4FFYL 4QGYA 4RGOH 1WIUA 2Y6SD 4QO1A 1JFQL 1XR9B 2OTUB 5BXFB 3U36B 4YHNA 4CVWA 4X6DB 1JZ8A 4JZJC 2FJFA 4F15B 3QFJE 5BS0A 5EIIB 1L6ZA 4G6KL 4WI7A 2R2BA 2YR3A 4FTVA 5K59F 4HLZH 5D93C 4E41E 3ROOA 5DMIL 4KZDH 3MJ7B 4FQLH 3AXLA 1ADQH 1YQVH 4Z77A 3V6ZA 5DURB 3S96B 1ACYH 2EC9U 4M1GH 3W2DH 2RCSH 3GMRA 2BOCA 1WUNT 5JNYB 5D70L 5F6IC 4KI1A 1JGDB 1I7UB 4NCC1 1FORH 4X4YB 3VFMA 4OZHE 5A40E 1I9JL 1ZSDA 1FNLA 2BNRA 4DKFL 4LGSB 5T3ZD 3MACH 2RFXA 5KTEH 4ZO7A 2OTWA 2VC2H 4LP5A 4OI8A 1U93B 5EU6B 2D0FA 4C56B 3ARGA 1W72B 3B9EA 1NUFA 5HYSA 3BH9B 1J8HB 1LE9B 3ES6A 4DGYH 4FQCH 4PGZA 4RIRA 3S3PA 1OY3B 4PLNC 4Y4KC 2EYTA 4WFGE 1AJ7H 3VCLA 1TTGA 2GAZA 1CFSB 3MV7D 4POUB 1JL8A 5EU3A 4DCQA 3A6BH 3L3HB 5CSBA 5TDNA 1NC2A 4TSCH 4OD1L 1MLBB 4F9PC 1M71B 3O8XB 2X1OA 3U7WL 3QDAA 3X11A 5J9PB 2WBJD 5CUSH 4LSPL 4P5MA 1F4XL 2FX7L 4S1SH 4BQ9A 4MJID 4IRZH 2J8UB 1PZ5A 1W0VB 3IJYB 1RURL 3EO1A 3UC0L 4IBLT 4ZS6D 4QNPF 3LS4H 3LN9A 1BVZA 2DI9A 3SDCA 4RWHA 3IJSA 4OD3H 1BBJB 1HXMB 2ILLA 4FQXC 4PJ7A 5AZ2L 5C0IB 1LO2L 3DUUA 3X12A 2P1YA 3PV6B 4OF5A 4GW4B 1RHFA 1BVLA 1AXIB 3LQAC 1B6DA 4C83A 4CKVX 3BDYH 1XMWA 4JGUA 3TH4T 3PDGA 3QAZC 2XTJE 1BHGA 3DYOA 1CD9B 3N0PB 3QDMA 5D8JH 4HKJB 3U0WH 4AMKH 4XNXL 3G5YB 3SKNA 3ZKNC 4DUVA 3UTPE 3QNXA 1LVEA 3LRHA 1N0XL 1NCTA 3LN5B 5EOQL 5IV2A 4PRNB 5DEGB 1OCWL 3D9AH 5DYOB 4K3JL 4C55A 2R1XB 3TZVA 1HQRB 4NDMA 3STLA 1T1YA 1EXUA 4OFYA 4GQPH 4NO0A 4EI6A 4Z7QE 1HIMH 1HSAA 4E9LA 5F89B 5CIPH 2BC4B 3LH2L 4Z8FL 4U1GC 2Y6SC 1DQLH 2DDQL 3FO1A 1BAFL 2P5WD 5IMLB 4R90L 4NQDD 1M05B 3QQ3A 5LWYL 4PRPE 4JRYB 1Q9WB 4NCC2 2D2OA 3VXPA 4NZRL 4P23D 2A0LD 3QDGE 3BP4A 2FBJH 5FHBH 2UWEB 4UNUA 3TJHD 3MJ8A 2CIIA 4V1DA 1J10A 2LVEA 3D69B 5C0JA 1S7TA 4FQQA 32C2A 4JCMA 5B4MC 5I1DB 1R5IA 5HYSG 5IUSA 1ODAA 1A6TB 1UWEL 3E8UL 4JAMA 1XCTA 2X4RB 3IFNH 4IOFD 3DTXB 5EZOL 1E4XI 4FXLA 1FL5A 2ZCLH 7CGTA 4Z7UF 1IGCH 2X4TB 3V0VB 3HR5A 3KYMB 1MRDL 1EJ6A 1ZEAH 3WO4C 3QFJB 5L6YH 3O6LL 5CJQH 5GHWL 1X5KA 2AK4D 3O2DH 4BZ2H 3VFUA 3KLAB 1I9IH 3VW3H 4E41B 3HE7C 4OF6A 3TN0D 3E1F1 4HWEH 1E4JA 2DQJL 1S7RB 2VO5A 1ULVA 3GBLA 1XH3A 1E4WL 5K9QG 5FECB 3GSVB 3PWVB 2VLKA 5IBLD 1WTGT 3RPIB 3C9NB 1RIUL 4LLAA 4FXGB 4YPGB 1GYAA 4OZHB 2O5XL 5GS1B 1ZS8B 1HI6A 4IRJA 3HNTL 3WN5C 2WBJC 1V7MH 2Q8BH 4TVPD 5GRUL 4XMLH 5JW4Q 3RL1B 4JO4L 4MA8L 2A73A 3WIIL 2R8SL 4IIQC 2QQNH 1X6LA 3EDEA 4TUOA 3SQOL 4NUGH 4ZS6C 5HGBA 2CUIA 2BOBB 3RY4A 4P9MH 6FABH 3RKPA 2IAMA 1JN6B 4I3RH 2VDPL 1KEML 3U79A 2PYEA 5I1AA 3I02B 1MNUL 3ULUE 3DX8A 5GRJL 2YD5A 3T09A 4QRRD 3M45A 1QA9B 2R15A 3T2PA 1EUUA 4NFBA 2YD3A 3GGWA 4RFOH 1KUMA 2Q8AH 2OI9B 2NY5L 1SJEA 3HMXA 2Q76B 1EGJA 3HUJA 1KV3A 1WEJH 1F45A 3MROB 4Z7QF 4D9QE 3MZTA 5H94A 3VW3L 4KUCD 3K74B 4Z7WE 1U3YA 1QFPA 5A2KH 1CXKA 2IQ9H 4P5TB 4Y16B 2YD7A 3WL9A 1MCOL 2XYCA 3QB7C 4XNQA 4RAUB 1NAMH 3MO1B 2W9LA 4X9GA 3VXUB 3FFCA 4XVSL 4OZIA 3TBTA 4XXDA 1H0DA 2J7LA 4MCYA 5JUEH 5DMKA 3QIWB 1G9NH 4IEFB 3WFZA 5M94B 1YC7A 4LCUB 1NAMB 5EU4B 5KVFH 4HIHA 1X5ZA 5I66B 4EN3D 4P23C 2A0LC 5EC2B 4UB0L 3U0TA 4L9LC 2GJ6D 4OLYL 4AQ1B 3FQUB 3NA4A 3TJHC 1WCBB 2V2XB 5F93C 4YDIL 3KJ4C 3CMOH 1HQ4B 5INDA 1S9WA 2PXYD 4PRDB 4DUWA 2O26U 3G6JA 1MFCH 4ODXB 5E94B 4TSAH 2R4SH 3U30C 4IOFC 5TH2B 1SYSA 2VQ1B 2VN7A 5D7LD 4NGHH 1DQQA 4PJGA 1CD1B 1KG0B 1CGWA 4ORGB 4G6ML 5F9WB 3BAEH 4DW2L 2WQ8A 3ARVA 4TPRH 3TN0C 4MQSB 3VFRA 1KXTB 2BY1A 5HVHB 1OLLA 3LKSA 5E00B 2YPLD 4NQCB 5IVXA 5L2KB 2ATPB 1HHHB 2KPNA 1ZT7B 2EEBA 2NW3B 2WIIA 3LQZB