3WJLC

Crystal structure of iib selective fc variant, fc(v12), in complex with fcgriib
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
168
structure length
160
Chain Sequence
PKAVLKLEPQWINVLQEDSVTLTCRSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig gamma-1 chain C region
publication title Engineered antibody Fc variant with selectively enhanced Fc gamma RIIb binding over both Fc gamma RIIaR131 and Fc gamma RIIaH131.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 29
structure length 160
sequence length 168
ec nomenclature
pdb deposition date 2013-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wjlC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wjlC02
2DF3A 1MCKA 5EPMB 4M7JH 3BPCA 5JW5B 4G6AC 1QPPA 1AGBA 4U1KA 2FR4B 2IH3B 4MNGB 3PL6C 1JGVH 4O00A 3LKSB 4GAYB 5GSVB 4OZGE 2UV3A 1JWSB 4GAFB 1DQJB 2PKDA 4WWKB 3BZEB 2XZQL 1K4DB 3FCTB 3MLRH 4HH9A 2BDNH 1JNLL 4X9HA 2XQYK 1UJ3A 1JF1B 1QD0A 4XWGL 5I19L 5J6HA 1QSVA 3WNKA 3ARFA 4D0BA 3ES6A 5D6CA 3DX7A 5DFWH 2R2EB 1G7IA 4JHAH 5E56A 3RI5K 3ARBA 4I0KA 2G75B 3WO4B 2CXKA 3R06A 1N7ML 4Q97A 1CZ8L 5ILTL 1HCVA 2VXSH 4WUUD 2X4TA 2HA1A 3MOAL 2JELL 3QJFB 4Q6IC 2VZUA 2X4QA 1BD2E 2XWJA 4PV9B 4HAGA 4OCXL 4PGZA 3FQXA 2IANA 3SKNA 2LE9A 1H8NA 3O8XC 3MRGB 3GSNB 5CEYA 4R4BA 3WUWG 4O2CB 1EHAA 1QKZH 1A6WL 3MV8E 3RVUD 5CD5C 4UAOC 1WV7T 1KT2A 2BNRE 2ED8A 5EULV 4HEME 1AE6L 3HKFA 5FUZL 5KSBB 1YUHB 3V7AE 1G7QA 3QFJD 2MKWA 2XPGA 4MMXC 4KROB 3PF2A 3LRGA 1KLGA 5IB4B 5KVGH 1EJOL 1ZK9A 4AEIH 1J11A 4HEPG 2OK0H 4P23C 1Q1JH 1T7XA 3WNMA 2BY0A 4XNXL 4AJ0A 4BH7A 1P2CB 1N6VA 3SBWA 2QLVB 2H9GB 2DQFB 2OQJA 4D0DA 4GAGH 4ENEC 3HPLA 1HZHL 3WXVH 3V5HB 3T0EE 4C54A 5JORB 1IAOA 4XMKH 2AXFB 4RQQA 4MWFA 3QDJA 5FYJH 5EZOL 3RVXD 5INDB 1UM4L 2VLKB 1KPUB 2VSCA 1TNMA 2A6KB 2BSRB 1ZOXA 3BH8B 4JFXA 4L8BA 4OF0A 4OI8A 3QZWG 1T1YA 3D9AL 1FL3A 4KJYB 4CVZA 5B3NA 3VI3E 3JV0A 1LO4H 1KC5H 4F2MA 1QFWI 2Y5EA 1FYTB 4YDLB 1X4YA 4NKDB 3GRWH 3DVNB 4OD2A 1U3HC 2EO1A 1NUGA 4HV8B 3P4NA 4JO4L 2HTLC 3IDNB 1AD0A 3LDBC 1HQ4A 5BZDA 4YFLF 4M7LH 3MUJA 4OZGB 2PXYC 5FYJU 1INQA 3WKMH 3K46A 4E0RB 1QBLL 3CUPA 3VGHA 2GJ6B 1A6TA 3FO0H 2CLRB 4G80B 1G7PB 2Q7YA 3BDYH 3TZVB 4KK5C 2C26A 3TT3L 5I1DA 3RNQB 2ATKA 3O6KH 3GJEA 5CMAB 1MFCH 3CMGA 4H20L 4U3CA 4Z7QE 1IARB 2O5YH 5HDBE 2GSGA 4Y2DB 4ZOAA 2NZ9D 3PHQA 4PFEA 4O4YH 1DN0B 2BOCA 2DL9A 4RAVB 1A3RH 5C0IA 4NZJA 3I9GL 5TF1H 2JCCE 1AJ7L 2ESVE 5D7LD 3O4OC 4QHMA 1QSZA 4DKFL 1BD2B 2OL3L 3REWB 1F3DJ 1NGXA 3JTTB 5CBEB 4CBPA 3HI5H 3M07A 4KDWA 1NAMA 4UT6H 3VFSB 4PP2B 2IH1A 1MHHB 1OB1A 4UTBL 5HHVL 3ELAT 4J8RA 3TNNA 2IAND 1RZJL 3EOAB 3TA3A 1W0YT 2RQ8A 3MV8B 5JXAL 5DJXA 2VRAA 4LKXB 3U7WL 3RFZC 3MYJB 5EZIL 4F58L 1QHPA 1U6AL 4JHBA 2BNRB 3WS6C 3HC4L 3CZJA 4M43L 5F1IB 3BP7A 5T1KA 4LFHD 5DVMA 2KH2B 2VXVL 1GC1L 5LQBL 2H32B 1R3HA 4MNHA 1P53A 1S7VB 5J9PB 4O58L 3FONB 3FFCD 3KS0H 4S1DC 4NNPL 3I3DA 1ZKAA 3BP4B 1SVZA 4LEXL 3GSOA 1T3FA 2B1AL 2YPLE 5SX5K 4HXAL 3VH8G 1JI1A 4XP5L 1J8HD 3T0EB 3RL1A 2FH8A 2J1KA 2HAZA 3MRJA 5HVGB 5CZKA 4UU9B 5C09E 2B2XL 5EU3B 1I8MA 3QQ4B 2M8XA 3F6IA 5D96C 5CGYD 3FOMB 1NFDB 2ADFH 3EYQC 4OZ4B 1PZ5B 4WW2C 3IFOA 2VISB 5AWNH 4AH2A 3CC5B 2A9ML 2R0ZL 3S35L 3I6KB 2OYPA 3QDJD 4F33A 4Y4KC 5HYIA 4X7SL 4QRSB 1A6ZA 4JPIB 3F7YB 4QNPF 1OTTD 1Q9WB 1YQVH 4IRSC 4GG6B 5FGCE 2L7UA 3VJ6A 4CMHC 5J13B 1L7IL 1PW3A 4NQDA 5DC9B 1JNNL 2MPAL 1HHHB 5CJXA 3U0PA 4G6AD 4JPWL 1M7DB 3PL6D 1GOHA 2PYFA 1HHIB 1N5YH 1C7SA 3LKOA 5I1IH 2WP3T 4Y19B 1FLRH 3MZGB 3P9LB 5INCA 1D9KA 4TUOB 1XCTA 3AU1A 4HDIB 4P4KA 1P6FA 3O3EB 1IGCL 4WEUD 3M1BA 2GIYA 3FB7A 2XN9E 3ZTNL 5DRWA 4EKXA 2HKHL 1AI1H 3WNLA 3QEGH 1N5AB 2VLJE 3G5ZB 5GSRA 1W72H 2ESVB 1WZ1L 4KTDL 3M45A 3N1MC 3QUKA 1Z9MA 4RISL 1FG9C 1I9RL 2YBRA 3WN5A 5DTFA 3VXSD 2OSLB 1LP9F 1T7WA 4DGYL 3KGRA 2DBLL 2CIIB 4ZSOE 2CK0L 4EBQH 1IEHA 2CIKB 3O8XD 3RJQB 4RRPG 4KHXH 4NQCD 1QZ1A 1R3LB 4PG9B 4TSAH 3TBYA 4NZTH 1YPZF 4RAHA 4JZOA 1IT9H 4PUBH 4WNQA 3UTZB 3QQ9C 1YQ2A 3CVHL 1RULL 4PJEA 4KK6C 5IFHH 2HT2D 3DX8B 3UPRA 1S5IL 4UUJA 1R3JB 3ARGA 3NPSC 4IDLA 2R0KL 2ZOKA 4YHKL 2FHBA 4QRUB 3P77A 4OCYL 4OLXH 2C9AA 3PHOB 3BP5B 2HJFB 3V2AR 5T1KD 1Q94A 5GS1A 2XOTA 3ZMRA 2XZAH 3BUYA 3EOBA 3P9WB 1QLEL 4P23D 4Z0BH 3KWWB 8FABA 2IJ0C 1UACH 2C5DC 1HEZA 4N68A 4CMMA 2P24A 1YJDH 2YPLB 2RCSH 2ZUTA 1EO8L 1Q0YL 4ZOEA 4PJFB 2ENYA 5E8OB 3Q6GH 5C0CB 1R3IH 4LLDB 2R9HC 1G9EA 3WFEL 2X1OA 1RJLB 5C09B 4ENED 4Y88A 1FBIL 4JFQA 5ERWA 1EVTC 3D87B 3QAZB 2FO4B 1P4BH 3BZFB 3TYGL 3L3IB 1J05A 3T8XB 3VRJA 1IGJB 4MDIA 2PR4H 5LKNA 3DVGB 3LKNA 2Z91B 2ITDB 4NGHH 1CTOA 1JGDB 35C8H 3FB5A 3W11C 3MV7A 4RFEA 4U1IB 2EH8L 3MZTA 4N8CH 3LCYA 5CIPH 3AM8A 1ND0B 4NRYA 1MCSA 4UV4H 2KQNA 2VZOA 5HI4D 1S8DA 3K2UL 4M6NH 4QRQA 5FGCB 4QCIA 4U1HB 1W0VA 1YA5A 3V0VA 1GGCH 3BRGC 1MRCH 3MRIA 4OCSH 4FP8H 4R97C 1U3HD 3S5LA 3EIFA 5IEHA 2ZP0T 5J11C 3N85H 4G6ML 2BC4B 1U8NA 2NMSA 5A43C 5AD0A 2Q8BH 1CXEA 5F7HA 5CWSA 2YWZA 4HC1A 2QSTA 4OSUH 3G9AB 1YPZA 4N1EA 1MJ7L 4Y4HB 3VGAB 5F8RC 3WFHA 5TJWK 3LN5A 5GHWH 3LZFL 3S3SA 5ADPL 4GW1A 1CFVL 4XAWH 4CDHA 5HBBA 5JNYB 4F15C 5LGKA 2XN9B 5ICXA 2HWZH 2YD1A 4JM4L 4YR6A 2DAVA 5EO0B 4HFUH 4E41E 5E2VH 3OZ9L 3R1GL 5DFTA 2VLJB 3VXPA 1A6AB 2P8LB 4KJWC 5E5RB 3KPOA 2QHRL 4TYUA 5DD6A 5TFSH 5JDJA 1LEIA 4XPAH 1Q72L 5E94A 2XY2A 4LCYB 4NNXB 5HYJE 2A6IA 3JWDH 5JZ7C 1R0AL 4DN4L 2IBZX 3PWJA 3CH1A 4JRXD 4HCRA 3MGTB 4JO2L 1T89C 4QY8B 3G08A 1OAKH 4YHML 3WEXA 3R0NA 2AJZB 5FM4A 3AROA 3ZHDA 2P5EA 2WUCL 2EICA 4TSCH 3GSVB 4UMGA 3U36A 1ZEAH 3SJVD 5JW4Q 4PPTA 1X5YA 3HI1A 4KY1L 2UWEF 4BQ9A 3KVQA 3VXMD 4CRPA 5FYKE 4H25B 5D7SL 4CU6A 3CDGA 2MOVA 1KG0B 3IDJB 4M5YL 1ZHLB 5E95B 5J12C 2P49B 3RL2B 4JCLA 3D3VE 1L0XA 2WIMA 2XY1A 5D72L 1GVIA 4M5ZL 2NW3A 1BQLH 5TE7L 3ZE0F 1L6XA 3KR3L 5MHSD 4P2CG 1S7WB 3L3KA 3O45B 4PY8J 2AJVL 5J7CC 4V1DE 3KPQB 1T66C 4HUVA 3G9VA 3MRLA 3WHXA 4KKBD 5I66A 3G5VA 1KJ3L 2R1XB 1P7QB 4HZLB 3EYQD 1JUFB 4XP1L 3LAFA 1CXIA 5MEOB 2V2XB 2FIKB 4OF6A 5A3IC 3QEQE 5F72S 1LO0L 1CF8H 3KYOB 1T0MA 3NN8B 4Y4KD 3RWDB 1QR1B 4CKVX 1H0DA 3BDXA 4X80H 4EIGB 2ZG2A 4HS6A 1F58H 5FO9A 5KS9E 4IRSD 1CBVH 3DUSA 5GGTH 1AIFA 5FA4B 3MRKA 5ESAB 4JFYB 3ALPA 2DLFL 3MLZH 2FJGA 2DWDA 4FMKA 4D9QE 1KCRL 2AXGB 4OKVB 5AYUL 3BAEH 3EYUL 5HGBB 3VXTB 2VH5L 3TESA 4C4KO 4YBQC 1JPGB 3T65A 4XXCC 4MB4A 2KUTA 3T0XA 3MXVH 3O2VH 4DW2H 4OZIF 5E4EC 5IG7A 3VFNB 4N9GB 3DRQA 5KVDL 5JHLL 4TOYH 1U58B 4NHUA 1GPOL 3ULVE 4IRJA 4KHTH 3CFIC 3QUYC 4DAGH 1NMAH 4L3CB 3ZKSD 4E41B 3CLFH 3BT2L 5TE4L 4KGJA 2B8OT 1HSBA 2B39A 4NQEE 3CX5K 3HG1A 4OQTL 4OCLC 1ZSDB 2XG5A 4YIQA 5HYJB 5BV7B 2QQQA 1QEWB 5E08H 3RY6A 1Z6JT 3QCTH 1WIUA 2IQAA 2CRZA 2PTVA 2WUBL 3CFBA 1OQOA 5M7QA 4TVPE 2CKBH 4CW1B 1CU4L 5GGSB 3STBA 1R24A 1IKNC 5BRZD 3BXNB 3UTTE 1KYOK 1P5VA 3HCVA 1MRDH 5IJVA 1MHCA 4QWWC 4ELMA 4KZEL 1U93B 2A6JA 4KK6D 2XWTA 3Q1SL 1FVCB 1YNKH 3MTRA 5DZNA 3QQNA 3KLAB 2BHUA 2AAVA 4P57B 1Q0XH 2NYYC 4R4ND 1CWVA 2NLJB 5EOCH 1AGDB 5DO2C 1WBXA 5BVPH 5T33L 4U1MB 4LQFL 1DL7H 3D3VB 4XCEB 4UIMB 2EE6A 5LCVH 3L95A 1JK8A 3QPXL 4Z0XB 5EU4A 1IGML 1A6VL 5F9WB 5E7BA 5FIEA 2R9HD 3U83A 5DGQA 4V1DB 2J6EH 2APVA 4GKNB 3FFDA 1NCDH 5EIIA 1D5BB 3AXLA 3FRUA 5C08E 1LO2H 3QO0A 3QBTB 1OL0A 3QA3A 1JJUA 1XT5A 4OZIA 1KIQA 2APWA 1SJEA 4U05A 1W0WA 3PDGA 2DQIH 1TNNA 3DGGA 4L8DB 3W11D 3KYMB 1HXMA 3QEQB 4HS3B 2C7UA 2ADJA 3X14B 1DUZA 4PRBA 1D6EA 2W0FA 5ABDE 1TCRA 4NO3A 3O2WH 1FPTH 5L0QB 3SDXA 2IQ9L 1BZ9B 3RNKA 1A0QH 5KS9B 2PCPA 3JWOH 3RIFK 3U82B 4H1LG 3UTOA 3N1FC 5DJ2A 4Z76A 1TVHB 3SPVA 2R23B 2FO1A 3RY4A 2NY1C 4CNIB 1LILA 5HHNA 3EJYC 5FA3B 1BREA 4WHDA 1CICA 2VDQL 4J7RA 5ADOH 2UYLA 3W9EA 1QFUH 2GFBB 4PB9L 3O9WB 4I8DA 3FN0H 1UB6B 1CFQA 1OSZA 1D3CA 4OUUB 3QEHA 3UYRL 5AZ2H 1FNSL 4G6KH 4Q0XH 3Q5YA 1D5MB 4GO6B 1Q8MA 2W0LA 5A2LH 4FQXB 3B6SA 1TJIH 1EXUB 3SE9L 1IFHL 4M7KL 5JOFA 1R3KB 2BVEA 3PHSA 3EGSA 4IRJD 1X5GA 4NQEB 5T5NF 4G9DB 4PJHE 1S9XA 1VGEL 4I1NB 4OBSA 4KJWD 4P9MH 3U7YL 3PWPA 1XGPA 4OJFH 5HJ3B 3SGDI 5EIQA 3S88L 3EJZD 1HKLL 3RTQC 3HG1D 4GRMB 4QOKD 1MWAL 3U0WL 4XMLH 5JZ7D 1D5ZA 4I5BA 2W9EL 3NIDE 4N5UA 4FXGA 1ZHBA 1WLHA 4JFED 2YUVA 2DQGL 2DQEL 5EU7E 3UTTB 1DBMH 1SBSL 2YMXL 3KPPA 1BIIA 4PJ9A 1HDMB 4FTVD 1E4KC 4LU5H 1KJ2A 3B9KB 4HC1L 4P2QB 1G6RA 2DICA 5F9JA 4NP4H 1ZT4A 1EA9C 1GAFH 2E7CA 3Q6FB 3VFGH 4F37F 3VGEA 2AJSH 2FX9H 1KB5B 1ES0A 4LGSB 1Q9OA 3D85A 3BN9C 3WUWB 3D5OF 3HHRB 2QR0A 4MJ4A 1WWBX 3VXRE 3SDAC 1E4XH 1ZS8A 4W4NA 4EI5A 3OG4B 4JFDD 4LLQB 2V7NB 1LMKA 3K2MC 1OAZH 4HAFA 1IAIH 4Z78A 2BNQE 5IFJB 2Z31B 5CINL 4WVRA 4LIQH 3H9HA 4JN1H 4NM4H 4U6XA 3U7AA 5DHVH 3RWIB 3STLB 2Y7QA 5DWUH 4GSDL 5BJTA 5I8KL 4WWKC 5C92A 1EVUA 4DK6A 1K2DB 2EDKA 3D2UA 5I1EL 5ALCL 4CVXB 2YKLL 1A4JB 3CFEB 2BCKB 1TVDA 4FFYL 3H3KA 2F9BT 1AQDB 1JYXA 3TH4T 4G8IB 4HXBL 1T7VA 3O4LE 4QF1B 4QHLB 4KV5F 4U2YA 5FUOL 4KTYA 2YC1B 2QQLH 4L4TE 4HBQA 4M93B 3MLWL 3LD8B 1OTSD 3HZVA 2YD7A 4WFHD 3V0WL 4LCIH 3WE6A 1LO5B 4ALAH 5ETUB 4C56B 4FQLL 1ZWIA 3QISA 3WO4C 2W0PA 2E7LC 1QLRA 4IJ3B 3GM8A 3NFSL 5ESQA 1YEIL 2IBBA 1YEDA 5C07D 3BESR 12E8L 1F97A 3QZWB 3B43A 1TJGH 4BM7A 4YBQD 2RFXB 5IWLC 5B8CA 3RGVA 4MXWL 2BVUA 4DKEH 3Q2CA 1RIUH 4M6OH 2EYTB 1AFVL 5CJOH 5T1LD 2UZXB 1U8LA 3T0WA 4LVHC 1S9YB 4CAGA 1Z5LA 3SY0B 3QHZL 3QUYD 4LHUD 3L5WB 4PJHB 5JUEH 4L9LA 1J0IA 4KROC 1YEKL 4XPBL 2C4FT 2Y4SA 1VEOA 3L7EA 3LEXA 4TQEH 3A6CH 5FHAH 3EFDH 1MRFL 3U6RB 4X4YB 3ZTJH 3KXFA 5KAQF 1G9NC 4GW5A 3PWPD 2N4IA 1U3JA 1IQDA 3LH2L 5GRUL 4U0RB 5IIEB 1UFUA 5KSUA 3PQYE 3DOSA 2HVKA 4XP6L 1JE6A 2DQUL 3AY4A 3MROB 2WNGA 3S4SA 4WJ5B 4NBXB 3SO3B 4QWWD 3N9GL 2GSIA 1FO0B 3BEVB 4XBEL 1S9VA 4HQQH 5DQ9B 4AIXA 5JIPA 4PTUB 1XR8B 2DM4A 2NYYD 4UILL 1B0WA 5F3HA 1JNHB 3JTSB 1BAFL 4M61B 5T1DL 5HD8D 4NFDA 3ZE2E 3H9SE 3D0VB 1REIA 4PJIB 3GEWB 1F3RB 2P48B 1EX0A 1KPRB 2BNQB 4Y0GA 4GAYA 4R96A 2BY2A 3TIDB 3G04A 5MERA 1DQJA 3D25B 5E6ZA 3A6OA 3W9DA 4ZPTA 1KEGH 1K4DA 2VDOL 3L6FB 4QXGL 2DQJL 4Q9RL 4HWEH 2EKJA 3TCLA 5GZOD 3K1KC 3GJFK 4URTB 3DUUA 3QWOA 5CCKL 3TZVC 1BZ7A 4GUPA 3D2UD 1GGBL 3VH8B 1QRNE 3DIFA 2HYMA 5CKAA 4L4TB 1MI5D 4MNQB 3EOTL 3EZJB 1I3RA 1ZGLP 1MEXL 4I48B 4Y2DC 4WFEE 3M8OH 4WDIA 3AS2A 5E2UH 4FZ8L 3S37H 1NKOA 5IQ7H 2W91A 3EJYD 2DDQH 3QJFA 4PV9A 4KQ3H 2IAMB 2UUDH 4O5LH 3V5KA 2CRYA 1ZXQA 3MRGA 1IC4H 5EO1B 1A4KB 1LNUA 4UNUA 4O2CA 3DROB 5CBAA 1NLDL 1U8HA 2XACC 1OSPH 4D3CL 4WGWB 3GMRB 2CRMA 4KK9C 4X6CF 4HIEB 1WISA 3MNWB 2IGFH 1N4XH 3EJJX 4LF3A 4JDVB 4ZDHB 4NDMB 1MREL 2VXUH 3I6LE 5C0BE 3KNBB 4HKJB 5TDNA 2HMIC 4HKXB 2ZNWA 3NCCB 3NA9H 1NAKL 1PSKH 1CIDA 3L3GA 4FQIH 5FHBH 1CDHA 4PB0L 2WLZA 4X9GA 1UQSB 5JHDD 1J1PH 1MQKL 2X10A 5DUBB 1NGYA 3RTQD 3T2OA 3T3ME 1QFWL 5IBTH 1IM9B 3V5HA 3PQYB 1R5IA 3T0EC 3BKMH 3TO2B 5H2BB 2I25N 2AXFA 4G8GB 2ZUWA 4MD0A 2FBOJ 2ICWA 2KZ1B 3MOBH 5INDA 3WFDL 3O6LH 2D03L 5IR1B 2VLKA 4Y1AD 3DHMA 4RMQA 3AGVA 4X5XA 5DJ8B 2A73B 4K71C 5F6IC 4TNVF 1OHQA 1NL0L 4JFFE 1BQSA 2AQ3A 3BEWA 3MSPA 3LV3A 4QTIH 4GMSH 2V17H 4OTXL 3V4PH 4GRWE 1YEGH 2A1WH 3BN9D 3QIBC 3H2WA 3H9SB 4NKDA 2IADA 3GIVB 4PJXE 5J13C 1C8PA 5C6TH 1SJXA 3KPSE 5I1HH 1OM3H 5E0QA 3U30C 4LASL 3VFUA 1OD7A 2B1HH 4MJIB 4E0RA 5DD1L 1L9NA 4DZ8B 3BGFB 2GJ6A 3U9UA 3VW3L 2CLRA 3C8HA 1G7PA 5B21A 4WWKD 3RX7A 5CEZD 1A7OL 1T1WA 5FOJA 2YWYA 4O2FB 2I9LB 5LG1A 3KPLB 5FGBC 3PDDA 4FQHA 1DBBH 5AZEL 1ZGLM 2JK5B 1HXYA 1S7XA 1DN0A 4RAVA 5CUSH 1P9MA 2DM2A 2ZCHL 2IEPA 1JZ7A 4P9HC 1KJ2L 1M05B 4B0MM 4NZDA 1G6RL 1X4XA 4FQQB 4Q9BA 3C5ZA 3REWA 3TN0A 3JTTA 5DC0A 2WIIB 2C3GA 3QJHB 5IGXH 5DJYB 1KTDA 4M7LT 3FN9A 3EOAA 2GITB 4WTWA 4LKXA 1KSRA 5FF6B 4NPYA 3IF1A 3FO2A 1QUNA 5EU6E 4LVNB 3MBEB 3IDXH 3MNZB 4NKOB 1PBYA 1JGUH 1EEYA 3G5XB 4MSWB 1OCWL 1IGYA 2JE8A 5L9DH 1T1XB 4LSSH 5HHQB 5C0BB 3K74B 2EC8A 1WSST 2H32A 1G1CA 3FAWA 5GS0C 4HS8L 1K8IA 1OAYH 3DYPA 4KROD 4XH2A 4ZFOB 2MHAA 3UXFA 4OM1H 1JZ8A 5F9DC 1CFSA 3PGDA 4Y2OA 1FVDB 4ODBD 1G6VK 4EN3A 2XA8L 5F96L 4F9PC 3D18A 3EYSL 1PLGH 4WU7A 2B4CH 1A7RH 5C8JB 3O11B 1IGTB 4QRPA 1RIVL 2O5ZH 2P8PB 2FX7H 3ZT7A 4BZ2L 4F7EA 1UG9A 3ULUE 2ATPB 3QAZC 1NFDA 1PZ5A 3HFML 1IVLA 1K5NB 4P5KB 3I6KA 4I2XA 2YPVH 5LBSH 5E7FA 4JFFB 3QRGH 3RWFB 2VLKD 2C1OB 4PJ8B 1HIMH 5AUMA 3F7YA 1JNJA 5HDLA 4GRWB 4BA8A 3F62A 4AT6A 1Q9WA 4ODTH 1FH5H 3UTPE 4GG6A 1SEBB 4UQ3A 2R4SH 4GQ9L 4MB3A 3MREA 5D8JL 3GSXB 3ULVD 1MCPH 4JG0H 4PJXB 2EDXA 1ADQL 1EFXB 1DBKL 1FYTD 1KXTB 3KPSB 2OZ4L 4O9HL 3TGXA 2D31B 2X9XA 2GI7A 1PKQB 4NOBA 1O0VA 2K3TA 4LCCA 4O2EA 1NUDA 4HPYL 4RGMC 4LAQH 3WDJA 3ARRA 3ILPA 5GGQH 1X5ZA 4RGOH 5EUKB 4Y19A 3P9LA 4ZODA 3JXAA 2GJ6D 1J88A 3SDCC 5T1MA 2VQUA 3O6FA 2R2CA 1E6JL 4LLUA 3TZVD 2AEWA 1WUNT 4NZRL 1BVKB 4R7DB 4OGAC 3QWRD 4M6MH 1PZUB 4EXPX 1RMFL 3S96B 2DL2A 4UT9L 4Y2DD 4HW6A 1N5AA 3G5ZA 3WYRA 2BVTA 2XFXB 4HK0A 1IEBA 1UWEH 2OSLA 1RSFA 3DETD 5GRWA 5EUOE 3MJ7B 1BD2D 1EDQA 2CIIA 5E9DE 5IMLA 3UJIH 2VN4A 2WLYA 4EDXB 2XZQH 2DQHL 1X44A 1JNLH 4PG9A 2YOCA 4KUCF 1IC7L 3WXWL 4PGCA 4XWGH 3MV8D 1MQ8A 1XF2A 2HRPL 3L7FA 5CEZL 4KK9D 2FL5B 1R3JA 3O2DL 4X6BB 4V2BA 2BNRD 4JZJB 4GS7B 4QRUA 2SEBA 4EQ2A 2WAHA 4HIJA 2CGRL 3TPUB 2HMID 3S9DB 4U33A 3IXAB 3P0GB 4ODXB 1RY7B 3NGBC 3RVWD 3TWCL 1N7MH 1CZ8H 5I2IB 5ILTH 1CCZA 3RGHA 4KDTC 4NO2B 3DMMB 4YHZL 3KLHC 1YMHA 3AAZB 3MOAH 2JELH 4PJFA 5F1KC 1XR9B 5C0CA 3GIZH 4LLDA 4DGIL 5T3ZH 1RJLA 2OJEB 1RHFA 3DO7B 3T0ED 2FO4A 1M71A 4L4VE 1QO3A 3Q0HA 4YK4C 1IGJA 2C1PB 2AV1B 1A6WH 3EDDA 2Z91A 2ITDA 3UTQA 3OJDB 4Y5YB 1QNZL 3GSNL 4QEGA 4JY5L 4F9LA 3DGCR 1ND0A 1D5IL 2X70B 4HGMA 4PJ7A 3SO5A 4PGJA 1VHPA 1DQTA 3H0TA 4G3YH 3QIUB 5H8DA 4U1HA 4R4FH 4LEOA 5IESL 3W0WA 3RRQA 4LRIC 4ZMAT 5LGHL 4WW2F 3LPFA 4XNXH 1LHZA 4PJGE 4JKLA 3MBXL 3L5IA 1D6VL 1HZHH 2J8HA 4NZUL 3QHFL 1T4KB 5KANG 2YN3A 3IGAA 1G9NL 4GKSB 4IOFC 4Y4HA 1TCMA 1HE7A 3BI9X 3O81A 5F7UA 1KENL 3TBVB 5EZOH 1UM4H 2AABL 2BFVH 4Y19D 1I9EA 4AL8H 3OMZA 2Z8SA 2PW2A 1GSMA 3ZDYE 5EZJB 3CFJA 4P5TC 3D9AH 2EKSB 2JJUA 2UZIL 1B90A 1YECL 4NSKB 1A6AA 5DK2A 1F13A 4HGWA 3BP6B 2VZVA 3GBNL 1CDCA 4XI5D 2PYEA 1MVUA 4Q2ZA 4LCYA 2PW1B 2ESVD 4JO4H 3ULVL 4P3DB 3IDUA 5J89A 1K4CA 5HHOE 1L9MA 4R0LB 4J3TA 1P69B 5BV7C 3MGTA 3OXRB 1QBLH 2APXA 1MH5B 5CEXA 4H1LB 5BS0E 3O41A 3MMEB 5I16B 5FDWA 1NANH 4BFEA 3TT3H 3L5XL 5E1HB 2GY5A 3BHBA 4ZFFB 4B41A 5DVKA 3HNVL 5GRZA 4FRWA 4Y5VB 1RZ8B 3PABB 5SWSE 3RKDC 3DRTB 4X7DC 2DQTH 4H25A 4XP4L 4RZCB 1RURL 3S5LG 1KG0A 3I9GH 1FIEA 4K7FA 1ZHLA 4Z95L 4Z6AT 4H5SA 1PG7X 3OKLA 4NCC2 2R2BB 1AJ7H 3F7VB 2W59A 5IW3A 4DKFH 2OL3H 5KVFH 4KVCL 1EV2E 1BLNB 2YPLD 2YA1A 4HIXL 2P44B 1V3JA 4IHOA 4PP1D 1BWWA 2CDEB 3TNMB 1T83C 5F9WC 4UTBH 5HHVH 5C0CD 1DVFB 3FT3A 3V6OE 5C09D 3MLXL 1ORSA 1RZJH 3OKEA 4JJ5A 4XPHH 5JXAH 1P7QA 1U92B 1DLHA 4F58H 4CGTA 3CU7A 4Y4FB 5C0AA 3FOLB 3HC4H 4M43H 4ZQKB 1UWGL 3MA9L 2JJSA 1CLZL 3MJ9H 2EXYC 2QKIA 1U95B 3AC0A 1Z9OA 4HJJH 1GC1H 5LQBH 3TVMC 4I3RH 2W65B 3IDGA 2WWMD 5C71A 5L0QC 3C60B 1U8QB 4GRLB 5EB9A 1F00I 5HGGS 4ORGB 1F6AB 4PJGB 4KI5E 4PRIE 4DKAA 4OKVA 1N64L 1Z3GL 4HXAH 5ISZE 4XP5H 3PJSB 3MRDB 2F5AL 1BJ1H 1XGUB 1I1AA 4EOWL 4P2OA 1TQCB 3P73A 5IROC 2V9TA 3EZ8A 2V2WA 1XGYL 3O9WC 1AXSA 1FNGA 4L3AA 1A7BA 3VFRB 3FAXA 5DJDB 2UVEA 2BVQB 4K55A 4W4OC 4Y4HD 1BOGB 3VMPA 3TCXA 2R0ZH 2C3HA 2RHEA 3S35H 5I1AA 2AXJA 3CZFB 3MRHA 2CUMA 3OPZL 4OGAD 3V0AC 4FQXC 2XN9D 2I60L 2NNAA 4JKKA 5IB3B 5F44A 1KFAL 3PGCA 4LSQL 4TNWF 4PS4L 1YEFL 3C87A 3QFJE 2FYYB 1L7IH 3TIEA 4UOJA 3O6ML 1JNNH 2VLJD 2MPAH 1AGFB 1OARL 3I75A 3VWJA 5HHOB 5HVHB 4JPWH 1OW0A 5FKAB 1QEWA 3T4YA 5T3XH 1ZGLB 43CAA 1ZANL 2KDGA 1NGWA 1IAIM 4WI8A 1CQYA 4U6YB 2DI8A 2R8SL 4GLRH 1TMCB 3HAEH 5FAAA 5C0DB 3C6SB 2HJKB 5BS0B 1UXSA 4CW1A 1N2RB 5GGSA 3PWUA 5IVNA 5D5ME 3L3DA 4AG4L 3OX8B 1ULVA 4P2RA 1FVCA 5SWSB 1SEQL 2OTWB 2K7QA 4TPRL 1XGRB 1Y0LA 1B2WL 3ZTNH 5KN5A 3LEYL 1YN6A 2ID5A 2A6DA 1YEJL 2HKHH 2H1PH 5HGDB 2OLDA 3OWEA 3PDOA 1NUNB 5L8JB 1WZ1H 1OAQL 4KTDH 1J86A 3DSNA 3RIAF 2OJZL 1JPTL 3VXUA 3KLHD 4P49A 4RISH 4P9HL 1I9RH 1T5WB 5B38A 3C6LA 4I18A 5EO9B 3GB7B 3JZ7A 4X99A 4OGZA 5F7WC 3SGEH 4GKNA 5IM7B 2CK0H 5CIPB 1D5BA 4EXKA 1FQ9C 4TSBL 2G9HB 4M62L 3I6GB 4MAUH 3TYFB 1KBGL 5CSZA 1QBML 4JM2A 3QXDB 4UTAL 5C2UB 1ZT7A 3LRHA 3KYMA 5LWYL 3CVHH 1RULH 1P7QD 1IEAB 5FEBA 1G9MC 5A16A 3BWAB 1S5IH 5EORH 3ARDB 2R0KH 5FECB 5I0ZA 4WFGE 4YHKH 4Z7UA 4OLUL 4OCYH 2YK1H 1R5VB 1B88A 3BZDA 1UCTA 4M93C 1BFVH 2VIRB 2R23A 3LD8C 2H41A 4H8WC 2EYRB 2C3VB 3ISWA 4KRMB 1RJZB 3GK8H 4PRIB 4BQBA 1QLFA 1FORL 5ISZB 1EO8H 1Q0YH 1PX3A 2YSSB 3IJHB 2Z0BA 3MJ6A 4Y5XA 2X89A 3QG7L 4ISVB 3QUZC 3WFEH 4RMUA 5ITFA 1FBIH 1JHKH 3M17B 1FL5B 3L3HB 1MIEH 3B9EA 3TYGH 5JMOC 3GMOB 3SKUD 3FTGB 5E1AA 1ZT1B 1D5MA 1FYHB 2EH8H 2IANE 1T6VN 1KUMA 1U8PB 2E9IA 4F3FB 4D2NA 4TUJB 4J4PC 2R1YB 3MXWH 1EXUA 1I8IA 4NUJB 4QXTB 3SGJA 3MRPB 3K2UH 1VERA 4E41D 4IIQB 1KN4L 3HUJF 1IRAY 5HJ3A 3QIWB 5K9JH 3PXJA 1GHFL 3UC0L 4ODUA 4G6MH 1NDMB 2R1WB 4GRMA 2HT3C 5F7FA 1MFBL 3H9ZA 3MFFA 5HYJD 5JW4M 4X6DB 2O93L 5E8NB 4E5XB 1DANU 2X9YA 3UO1L 5IMMB 3SKMB 4G6JH 5TQ2H 3TF7C 4Z7NF 2GK0B 4NWTL 1QPXA 2P47B 5D5MB 5EU7C 5IQ9B 1HDMA 3NCYS 3LZFH 5IW6B 5C3TA 5ADPH 1VFAB 3TV3L 4KK8D 4M03A 3B9KA 1CFVH 4P2QA 3WL9A 1JTTA 3DBXB 4S1RL 1JBJA 2J4WH 1GH7A 3RDTB 1IAKB 1KCKA 4LPTA 3RKDD 4JM4H 4QT5B 4MQ7A 3WUWA 3ARUA 3IU3A 3OZ9H 3QDJE 1CD1B 3R1GH 5FYKD 5I74C 2I5YH 3V9FA 4JKWA 3ZHKA 2FB4L 4JFOB 2RB8A 5DRXA 4V2CB 2B20A 4LLQA 1Q72H 1ZA3A 1U91A 3D3VD 2Z31A 2QADB 1ROWA 2OI9C 1R0AH 5GGSY 4G42B 3VWKC 4DN4H 4XBGB 1VKXB 3WIHL 3STLA 4GAJL 1KULA 5EBLA 5JA8B 1F4YL 4U6VL 4V1DD 3SQOL 4YHMH 3DX6A 1AGBB 4U1KB 4HKZA 2FECI 1C5DA 1A4JA 3OKOA 3CFEA 4M7ZB 2BCKA 4WGVB 1MCOL 1EGJA 2WUCH 3GBLA 4GT7A 3QEUA 5D9SA 2JTDA 2ORBH 4EUPA 1INDL 4M48L 4HH9B 4QHLA 1OPGH 1BBDL 2YC1A 4UIKH 1KNOB 2EXYD 2XZCL 4OLYL 1EUTA 5I18L 1UJ3B 3G6DL 5D7SH 1NJ9A 4C56A 2P7TB 3ARFB 4M5YH 4D0BB 5D6CB 3RWGA 3DX7B 1C12A 3WMSA 1K3IA 4KRNA 3T0DA 5F7DA 4D9QD 5D72H 1KJVB 5TE7H 1CK0L 3ARBB 3KR3H 1KCUL 2D0HA 3T04D 2LV4A 2ITCA 4H0IA 5HHXL 2AJVH 2Q76A 3RBSA 1AGEA 2X4TB 3H3BC 3P4LA 5MEPA 3O9WD 4UBDD 1I7RA 4MHHG 2X4QB 2XWJB 1ZA6B 4XP1H 3T0VA 3FQXB 4WUKL 4WU5B 3D0LA 5CP3A 5DVLA 1S9YA 1DP0A 5CEYB 3O0RH 4OFDA 5D2NA 1LO0H 4LAJH 4FQXD 2P8MA 1FV1A 2EZ0C 1KT2B 2CKBB 4NQED 5HI3C 2NXYB 2DLFH 3KPTA 2XPGB 5TPWL 2FEEI 1I1CA 1X3DA 4ZS6C 5AYUH 1ZHKA 4WHCA 4BZYA 2VH5H 3VE0A 4YPJA 4NBYB 3CDCA 3PV7A 4FMFA 5BO1L 4JGUA 4BH7B 3B8SA 4RCAA 3MA7A 4KRPB 2L0DA 2OQJB 4D0DB 1N3NA 3MQIA 3HPLB 3UTTD 3NACL 4KMTL 5JHLH 3BEVA 2APTA 3HMWH 5T5NG 5TQ0L 1GPOH 1FAIL 5BMFL 3FB6B 1HNFA 4OZFH 2XRAH 4RQQB 4APQB 4PTUA 3B9KD 4P2QD 1DBAH 4M61A 2FZ3A 1EMTL 3BT2H 5TE4H 4KPHH 4NM8L 4HPOL 1A7NL 1PQZA 3C09B 5J1TC 4OQTH 4PJIA 4JFXB 4Y16C 4LHQB 3ZDXF 1YY9C 1T1YB 1FL3B 4AYFA 4CVZB 1TTFA 3X12A 3QG6B 2A0LD 1LDPL 5HVFB 4R2GB 5D6DA 4F2MB 3SCMA 2XV6B 2Z31D 2WUBH 1VFBB 4FFZL 9CGTA 3MCKA 2DBJA 3CNKA 4OD2B 4PREA 1M7IA 4NQDE 3F12B 5IHUL 1L0YA 1FVEB 5BV7L 1AD0B 3BGFC 1CU4H 3LN4A 1OT1A 1RZIB 4P3CL 1INQB 4D0CB 3PUCA 5DMIL 1C5CL 1F4XL 1K8DA 3Q1SH 1TQBB 3CUPB 4LLYA 3E6FB 3KYKH 4MNQA 6FABL 2Q7YB 1MAML 4I48A 3RKPA 5CP7B 1BZQK 3GJEB 4LQFH 4R26H 4PY7A 4ZAKA 3VMOA 4X98A 3UBXA 5FYKL 4C56D 2E8ZA 5CGTA 4PLOB 3QPXH 4XT1C 1IGMH 3PHQB 2BOCB 2IAMA 3PP3H 3VXQB 1BIHA 3I02A 3HI6L 1A4KA 5I76A 3S4SG 4JPKH 2G5RA 1N6QL 4OZHA 2H2PC 1NGXB 1L6ZA 4OFYA 1NAMB 1HOCA 4JVPA 4YXKL 1OB1B 4LLVA 4LVNC 4R8WH 3MBEC 3TNNB 4YHYC 4IDJL 1DSFL 3D6GA 1FRGL 1A22B 5J06A 4J4PD 3TA3B 4ZDHA 4NDMA 5DJXB 4HKJA 1XF5B 2ICEA 2IQ9H 3ZKNC 5I17A 3X11A 2FCBA 4U1NB 4PJEE 4YHOL 4ERSL 2I26N 3BP7B 2J88H 1OTUC 4PLJD 4RFOH 2VDQH 4XVSL 3C08L 3P0VL 2HT3D 4JJHA 3MPCA 1R3HB 5FM8A 1IKFH 4PB9H 4MNHB 2P5WA 1EBPA 3TO2A 5KSBF 1BFTA 4MD5A 3GSOB 4G8GA 1T3FB 1CDUA 3H8NA 2JJTC 3NH7H 4PJBA 2VDKL 1ZHNA 5D2LF 5EOQL 3RX5A 3RL1B 1FNSH 4HZAA 2J3SA 2AJ3A 5C1MB 5K9OB 3K8KA 3NZHH 4HFWB 1I8MB 1E4JA 4JY4B 2VJXA 4BUGA 2H2SC 5ICZA 3GMMA 4N1CA 4K2UL 4RRPA 3EO0A 1IFHH 4M7KH 3SE9H 4PJ8C 4HLZH 2R56L 5DHVB 3CMOL 3IFOB 3WJJA 4AH2B 5KAQG 5IB2A 3MV7E 1XF3A 4XBPA 5DQJA 3U7YH 4F33B 4ZUWA 1HKLH 1A6ZB 5IOPA 2HLFC 2M2DA 1MWAH 1H3PL 3U0WH 4MJIA 4FQ1L 1AQKL 2BNQD 4MA7L 3VJ6B 5DMKA 4NQDB 4I0PA 3CDFA 4J3VA 1KACB 1NCWL 2DQGH 2DQEH 4O2FA 1TTGA 2YMXH 1T0NB 4WEBL 2PYFB 1W8NA 3BRFA 1DR9A 1EUUA 2YPKA 5IMOB 4P99A 1LK3H 3VFPB 3LKOB 4YXHL 2DJSA 5D4QA 4PRNA 1YPZE 1WITA 5INCB 2ZSVA 1D9KB 4L4TD 2FWOA 4MNQD 1XCTB 4ZNEA 3AU1B 1G84A 4P4KB 2QTEA 4P5MA 4MAYA 3M1BB 1LEGA 1RZKL 1KB5L 2BSSA 4KUZL 4PJDF 5DRWB 3HRPA 5CINH 3QJHA 5DD3L 1U8MA 4AEHL 4G8EA 2IPTL 1CYGA 2IAMD 2CDGB 2WQRA 4GSDH 2BMKB 5I8KH 3LMJL 2FRGP 5I1EH 3WN5B 5D2LA 5DTFB 1PG7W 3QFDA 3IJYB 3QPQC 3MODL 5ALCH 5I6XB 4L8CA 2YKLH 2LAAA 4P46B 1MSPA 1UWXH 4FFYH 1M4KA 2AKRA 1DQQB 2AV7A 4HXBH 1OGAA 2MFNA 4S1SL 3P11L 3WLBA 3TBYB 2JJWA 4Z9KB 3MLWH 4WNQB 1G9ML 4JZJC 4JZOB 2RBLA 4GS7C 3V0WH 5JDSA 1J12A 1YYLL 1MCRA 2P5EE 5HI3D 4PRHA 1FVDA 3ARGB 3LS5L 3N0PB 5L8KB 3NFSH 1YEIH 2E27H 3DMMC 4ZS6D 1Q94B 4N0RA 5GS1B 1JGLL 2K1MA 3O11A 2VUOA 4ZXBB 2LTQB 5ANMA 3ZE1E 4N0FB 3BUYB 5GISL 3DARA 2DLTA 2CK2A 8FABB 1IM9D 3B5HA 1MJ8L 1HEZB 2CDFA 4K8RC 4CMMB 3BGAA 3PQYD 4MXWH 5CZVL 4XPFL 5L2KA 3ULUC 3PWLA 5E2WL 1V7MH 3NOIA 3CIQA 4G8GD 2EE3A 4P5KA 5GGVY 2W60A 5ERWB 1AKJA 1BM3H 4N0UA 2C1OA 1KEML 4Y5YC 5I1CL 4XMPL 1J05B 2FJFA 3JSSA 3VRJB 4NO0A 3NCJH 3IJSA 4MDIB 4HG4K 1SEBA 3LKNB 3FB5B 1MHEA 3MV7B 4RFEB 5J4MA 4XPBH 3OAYK 3QIUC 4OLWH 2ZZUT 1HHGA 3H9SD 2FSEB 4PJDA 3N50A 5I1JL 1PKQA 4WY7L 1S8DB 1ZTXH 4QRQB 5KSVA 2DKMA 3LH2H 4QCIB 5GRUH 1H8OA 1W0VB 4ZO8A 5FCUH 4EEEA 3MRIB 4MJID 3VI3F 4TN9A 5IEHB 1J0JA 1B3JA 5I71C 1A7QL 1LP9B 1U8NB 1XCQA 2ZUVA 3BW9A 4NWUH 1F3DH 5AD0B 2EDDA 3N9GH 4XNUL 4QGTA 1ITCA 4XBEH 5CZXC 1YPZB 1NGZA 3WFHB 3QUXA 3S96A 4UILH 2HFGH 2GT9A 2YD3A 3AREA 4M02A 4GW1B 1XIWA 3VD7A 1FO0L 4WFED 2XFXA 1P4LB 3IU4L 3BX7C 3UZEA 5ICXB 3HA0A 4JZNA 5C0EA 1I7ZA 4YR6B 3IXTA 2VR5A 3F7QA 1NBVH 5BCAA 5JOPE 2ZUQB 5HDBF 4HGKC 4S0SD 3VXPB 5EBMA 4R0LC 3QI9A 2JLLA 4EDXA 4XP9L 1IQWL 5DD6B 3HG1E 1P7KA 3ARTA 1LEIB 4QXGH 4Q9RH 5E94B 3ESUF 3LS4L 3ARPA 2A6IB 2W38A 2WBJC 4JFZL 2JCCF 3PWJB 1NCBL 3CH1B 5CCKH 2LU3A 1FNAA 3SGKC 1OAXH 2FL5A 4OB5H 3AS1A 3MBED 3EAKA 3G08B 4A2LA 2FBJL 1DZBA 3ABZA 5F9OH 2OTUA 3WEXB 3T08A 4Y5VC 3LIZL 2Z8RA 3ZKND 3B4NA 1MEXH 3RQ3A 3I6LD 5C0BD 2P5EB 4FS0A 3U36B 1NCNA 4FZ8H 4ELME 3RU8L 1SY6L 3HI1B 4NO2A 5GJTH 1OTUD 4W70A 5JIHA 5DURB 4PTTA 1NEUA 3WUZA 3RP1A 2V5SA 3CDGB 3BKCH 2ZUUA 4XRCA 2NY3B 1I9JL 1WICA 3MRFA 4J12A 5I75B 1DVFC 1KV3A 4F37K 4FFWC 4OF5A 2AEPL 2DB8A 2NW3B 1OQXA 4D3CH 1PX4A 3GRWA 3OJDA 3JVGA 1TZGL 3L3KB 3BSZH 1A5FL 3I3BA 1WFNA 5E6YA 4NN7B 4PJCF 4HUVB 2X70A 1NC2A 4LNVA 2H2SD 2X42A 3MRLB 3WHXB 4JFFD 3G5VB 1MREH 4OZIE 4PJ8D 1JFQL 1H5BA 4AZ8A 1ACYL 3K80A 1NAKH 3C60C 3KJ4B 4PB0H 4JQVC 3BJLA 2X4UA 5H37H 1MQKH 3RWJB 1T0MB 1RQ5A 3IRPX 4CADA 5BQ7B 2DYPA 3QYCA 5GGVL 1H0DB 4LKCB 2EDHA 1DQLL 3VRLE 2HLFD 3SDXE 1EFXD 3KPSD 4HS6B 5FO9B 2P45B 1T4KA 3DUSB 3VFWA 4Z77A 5DEGA 5SV3A 5DLMH 3MRKB 2NY2B 2GCYA 4POZC 2FJGB 3LB6C 1MCEA 2GAZA 3QSKB 1TQCC 3IDYC 5IBLC 1PY4A 4DVRL 3WFDH 2Z8WC 4RDQF 2D03H 3VFVB 2CMRL 3IFLL 3T65B 5A40E 3MUHL 1NL0H 3OAUH 4QHUA 5IG7B 4ONHA 4OZFG 3NFNB 5IW1A 1TZHA 2EH7L 1ZLUK 3SQBA 1RUML 1DBJL 2XYCA 4NHUB 4Q9QL 2PW1A 3V6ZA 3P3YA 1T03H 2DKSA 4HUWA 1AO7A 3QXVA 4LASH 4YNYB 5HVHC 2K7PA 1HI6A 1HSBB 4UV7L 3VXNB 2VLLA 1MH5A 5DD1H 1KIPA 2YZ1A 1VESA 3VW3H 3BYYA 4WTZG 1WBYA 3PWPE 1NCAL 3MMEA 1A7OH 4YFLI 1H3VA 1Q9LB 3QPQD 2IQAB 3ULSA 4PJCA 2W9DL 1XF4B 3CFBB 3DI3B 3PABA 5D7JB 4ZPVB 2G2RA 1IAII 1R24B 4RZCA 3HCVB 2ZCHH 3VMNA 4FABH 4ELMB 1M7XA 2Y07L 2IFGA 2DQCL 3FO1B 4M1CC 5BXFB 2F5BL 4GOSA 3TFKC 5DT1L 1CS6A 2GHWB 2Z35A 4LQ1A 3OBAA 4MQXC 3DMMD 2PTTA 4NN6B 5FYJD 1WBXB 3TNMA 2F53A 4XCFL 3ROOB 3H3PL 3U9PH 3V6OC 1MCJA 4K8RD 1JK8B 2YD8A 1U92A 3S3PA 2NW2B 4CVUA 3ULUD 1WJ3A 1G7JA 2ARJQ 4Y4FA 1MJUL 4LLWA 3DJ9A 5CHNA 3FFDB 1OCWH 1NCCL 3AXLB 2E7HA 5F3BA 3QA3B 5HDQL 4OZIB 1KIQB 2D3VA 1SJEB 4H26A 2KPNA 4LGPB 1HHKA 2W65A 3DYMA 3DV6B 2O5XL 1KCSL 1MLCB 3DGGB 4GRLA 3BKYL 3NBNA 1HXMB 3UTPD 1MHPL 2C7UB 5EC1A 3QIUD 2ADJB 1HHJB 1DUZB 5IK3A 4JREB 2W0FB 1ZLWK 1DQDL 4KI5C 4NO3B 3SDXB 2XA8H 3PJSA 5F96H 3RNKB 1F8TL 5FXCH 3QXUA 3MRDA 4ZFOL 4Z76B 4ZNCD 1RIVH 3NA4A 5C9KA 4BZ2H 5HHNB 1CICB 1S5HA 4KKAC 4OLZH 2VE6A 3L9RA 2UYLB 3HFMH 1YNTA 3WS3A 1W72A 4WI4A 1PD6A 4LPUA 4NQUA 3OHXA 2BY1A 4JAMA 1A7PL 2X1WL 3LEVH 4KI1A 2NTFB 2VZTA 2HKFL 5CZXD 1J1OL 1CFQB 3FQNB 1OSZB 5KANI 4C4KT 1TVBA 1I4FB 3RVUC 4C59B 3MRNA 4NYLA 1XFPA 5M95B 4GQ9H 2FYYA 5D8JH 1AGFA 1J0ZA 3S98A 3FQTA 2OP4L 4IIQC 1E4WL 3RWHA 3B6SB 1ADQH 1YNLH 5JOFB 1DBKH 4O9HH 2OZ4H 2VDLH 1C08A 3QIWC 4RMWA 1H3XA 3EGSB 1U3YA 1FGNL 4Z5RB 2CLZA 2BDNL 5H35A 5HYFA 4YHLL 5C0DA 1YMMA 2OMNA 1IGFL 3C6SA 2HJKA 3EDKA 1XGPB 1CXLA 2F54A 3T09A 4ZTOL 5CJ5A 3KJ6L 4P48A 1F4WL 2ZSWA 3KXFE 4K94C 1D5ZB 3ARVA 2IPKA 1B6DA 1YEHL 1E6JH 4JHAL 5IF0B 3E8UH 3HC0A 4FXGB 2OR9L 2M1KA 1ZHBB 5L7XL 4L3EB 3C8DA 3MV11 1PEZA 3WCYA 3RVXC 3KPPB 1RUAH 2AP2A 1RMFH 1BIIB 4PJ9B 2VXSL 5L6YL 5HGDA 5D1QB 3CPLB 4HIIA 3UMTA 5F9JB 1ZT4B 1I1FA 1IBGL 3F7PC 1T5WA 3CK0L 4G8FB 1FFNA 4NJAH 1ES0B 3PP4H 1Q9OB 5F6HI 3D85B 2QSCL 2R39A 3AB0C 2QR0B 2XKNA 4UI2A 2X44D 3PGFH 4KKCC 4JVUA 5CIPA 1QKZL 1ZS8B 4TNVK 4EI5B 2DQHH 1CG9B 1DQML 1DVFD 4HHAB 2RR3A 1IC7H 2XTJE 4FFWD 4LK4A 1KF9B 1YC8A 3H9HB 4LP4A 2HRPH 1SYVB 4M7ZC 4U6XB 3BWAA 1G7HA 5CEZE 1JHLL 5L88L 3O2DH 1RIHH 2Y7QB 3ARDA 2FIRT 1UM6L 3E0GA 3NFPA 4UDTB 4Y4FD 2PO6A 2X1PA 1CLOL 5KVGL 4KDVA 1EIBA 2OK0L 2CGRH 1U42A 3A6BH 4NOFA 1UJ3C 4GG8A 1WFOA 2C3VA 1WGOA 1RJZA 4YBHA 2ERJB 4JQIL 5GIRA 3IAQA 3C60D 4LCUA 4J2XA 3ARFC 2P1YA 4GRLD 3ZSTA 3WFZA 5DFVC 4ISVA 3WE6B 4DGIH 3MLUL 4XMKL 3ARZA 3ARBC 4WV1A 1MCWM 1ZLSH 5FYJL 1SBBA 3OKNB 3QCVL 4POZD 3LB6D 5ESQB 5KS9F 3QB7C 4JY6A 3FTGA 5IBLD 1F42A 1I8LA 3OGCA 4K8RL 4R9HA 5TDOA 4JN2A 1QNZH 1NQBA 1U8PA 3GSNH 3QDGB 3ULUL 5B8CB 1LO4L 2CPCA 2R1YA 3RGVB 3BPLB 1D5IH 3HR6A 3MRPA 3I3EA 3N06B 1ZE3C 4LMQE 3OB0H 1RVFL 1U8LB 1SYSB 5C0RH 2IALA 5MI0C 4GW4A 5B39A 5LGHH 1OP3H 5SX4I 1Z5LB 5B38G 1CE1H 3WKML 1NDMA 5IHLB 2BJMH 4WTXA 1T04A 3MBXH 4L9LB 3R8QA 3IB4A 4X6DA 5HHOD 4E5XA 1D6VH 3W5NA 4FZEH 4NZUH 3QHFH 4U3HA 5JLZB 3BDYL 2FGWL 3L7EB 3LEXB 3SKMA 4ZG1A 1JMXA 1G9NH 4J3WA 1UH4A 1II4E 5GGUA 4BSJA 2GK0A 3GSWA 1YMMD 2MNUA 3KXFB 5BS0D 1KENH 3SBWC 4KRPC 2AABH 3B2UD 5KSUB 3NIFF 3C5JA 1IAKA 2HVKB 1DANT 4QT5A 4ODVL 1N59A 4PJ5B 5SWSD 3S4SB 4EZMA 1URLA 2UZIH 3VCLA 1YECH 3DXAA 2YRPA 2VLKE 1S9KC 1TETH 1VA9A 3FZUD 3UZVB 1S9VB 3C09C 3TFKD 2VERN 2LVCA 3ULVH 3KHQA 1NPUA 5F3HB 1VKXA 4G42A 2Q1EA 4MQXD 3KPRB 5JIIA 1MCFA 4K7PH 2R4RL 3DTXA 3I2CL 3X3GL 4YDVA 5DF0A 3RPIA 1FYTE 4R2GC 2Q8AL 3OR6A 4MD4A 2XTJB 3ZL4L 5GRVK 5GGTA 4HJGA 4N0YH 4CVWA 4R96B 3G04B 3L5XH 2R0WL 5MERB 4Z7WA 4IM8A 2D7TL 3W9DB 4ZPTB 32C2A 1MFDL 3IETA 3JV6A 4PJAF 1KNOA 2GJ6E 3TCLB 2HFEA 1F90H 2AK4A 3ARDD 3MV01 1AC6A 3DUUB 3QWOB 1XGTA 2P7TA 5TDPA 1BZ7B 1RURH 4GUPB 1LE5A 1BJMA 4P59L 5HXMA 5F6HJ 3DIFB 4Z95H 4QYOB 3TO4A 1GOFA 3V8CA 2DIJA 1XF1A 2H8PA 2YD5A 3ILQC 4CN4A 2V7HA 5ACLA 4KI5D 1KJVA 4PRID 1I3RB 4GFTB 1GZQA 4KVCH 2X4RA 4HIXH 5ISZD 2AI0L 4WDIB 5FUCE 3U4AA 1CT8B 4S10A 2FEEL 3HPJB 1AP2B 4XNMA 5DRZB 1FFRA 5J0BA 5AWNL 1LK2A 1LD9A 4KKAD 3QNXA 5T5FL 1ZA6A 3RVVD 1GL4B 1JN6A 3V52L 4WU5A 1UZ8A 3V5KB 4I3GA 5I1LB 1E0OB 1LNUB 1UWGH 4W68A 1CLZH 1TDQA 5CBAB 2X2YA 1U8HB 3TA3C 3SHSA 3HMXL 4HWBH 4RBPK 5E8DL 2HT2C 2CKBA 2KKQA 4BYHA 4JDTH 2V6HA 4HJ0D 4LF3B 2H6PA 1FNEB 1UXWA 4CU8A 5KSAA 2ZG3A 1N64H 1Z3GH 2JKXA 1JV5A 3IS0X 3QIWD 5FO7A 5TDNB 3S36X 2VL4A 4LOUD 1IMHC 4WO4A 1FLRL 4EOWH 3L3GB 4U1JB 3OQ3B 4PJHF 1NGYB 5HDOA 3P4MA 2D4DA 3TEUA 3OKMB 2ZCKL 4EUPG 3TBSA 3VFOA 1R5IB 5JXEA 4PJAA 1CGSH 1WTGT 4QRPE 3Q3GA 1NDGB 3FB6A 2NTSP 1WZKA 4APQA 2FX8L 3F8UB 4MD0B 4NO5A 3U4BL 2ICWB 3BQUA 4K3DH 2J6EA 3RDTD 1NFDE 4TULH 3ZYOA 1KFAH 5EFIB 4X5XB 1YEFH 5GGRA 3IFPA 5HYSA 2CO6B 4I2XE 4IRZL 3DXAD 1OARH 3EYOB 3BEWB 3LV3B 5HI4C 3QG6A 3CLEL 3U79A 1ZANH 4O02L 4B53A 4WIQA 4GG6E 2R8SH 2QADD 1VFBA 1MF2L 2VAJA 4KKCD 4TSAL 3PWNB 3GSQA 1RK1B 2IADB 4Y8DC 3BRDA 1IT9L 3F12A 1CD9B 1FVEA 5CJXC 1F5WA 1RZIA 3VFUB 4D0CA 4U1GC 2NXZB 4AG4H 4OLXL 3QUZA 3E6FA 3U9UB 1SEQH 3U1SL 2VQ1B 4TPRH 1T1WB 3RZCA 4Y19E 3QO1A 4WFGD 5CP7A 4LSVH 5JIKA 2EYSA 1UACL 4QXWA 1DDHA 1YEJH 1YJDL 2EDEA 3T1WA 1D9KC 4FQHB 3REVB 1SMAA 3CXDL 4YDKH 4YDIL 4CN6A 4P4KC 1R3IL 1Y18B 2RIKA 3ARFD 5J56B 2OJZH 1JPTH 1HXYB 1S7XB 1QSEA 5DFVD 4P9HH 5CJ8A 2AEQH 3VXQA 1WT5A 2QSQA 3WDHA 4R7NA 3S34L 3ARBD 3K4AA 2IMMA 2JB6B 5JW3H 3C5ZB 1EFQA 2VITB 3TN0B 2XI9A 1JPFA 1QBMH 4UTAH 3C8KB 3IDIA 3WN5C 5LWYH 1KTDB 3F6LA 5I6XC 3N1GC 1AHWA 3UTSA 2YEZA 4M6NL 1LEKA 2R0LL 4NPYB 3IF1B 4OLUH 1XF5A 3FO2B 1AR1C 4FP8L 1AGCA 1BJ8A 2MSPA 4U1NA 2FEDD 1EEYB 3R4DA 4MHHI 1IGYB 3WIIL 4LSPH 2EO9A 3ARGC 5GS0H 1VACB 2NXYD 2NY0B 4OSUL 5KSAD 1K8IB 1P1ZB 4XH2B 2MHAB 5GS1C 2GK2A 1CFSB 1NBQA 3PGDB 2LTQC 3E2HB 3WJLA 4EN3B 1X5FA 4PJFE 2X4OA 3D18B 4WRLA 4WU7B 5C0CE 1J5OL 5E2TL 4KRPD 4QRPB 3ECBA 5H94A 3L3JB 4UOW0 5K9OA 4HFWA 4F7EB 3W39A 4JY4A 1T21B 2PTUA 4KKBC 3HLAB 2MCG1 1CDIA 4X8JA 5DHVA 1RK0B 4APQD 3UBXG 5GQBA 2FJHB 1H3GA 4I2XB 1CTNA 1D7FA 3HZKA 1HINH 3RIFF 5J1AA 4WI6A 1GHFH 3UC0H 1Y6KR 5AUMB 2DM7A 1BVZA 3W81A 3V4VL 4AT6B 5HPMA 1MFBH 3AM8C 3KLSA 4PJ7E 5CILL 3V5DA 4UQ3B 3MREB 1QVOA 3GNMH 4BJLA 2ZKHL 4R2GD 5GS2D 4JGJA 3W0WE 1EAPA 1BEYL 1EO7A 4NWTH 1ZEAL 1T0NA 3K81A 1DLFL 1EEZB 3ZE2F 2QEJA 2WBKA 4LCCB 4O2EB 4DKDC 1S9WB 1MCWW 3TV3H 3ILPB 5IMOA 3TLRA 3VFPA 5JOEA 2O61B 4S1RH 3T77A 4K94L 2AGJL 5CKGA 1P5UA 3BN3B 2YXMA 4Q6IB 5T1MB 4OGYL 3O6FB 3FQUA 4LLUB 5DUPL 1UZ6E 3JUYA 4PR5A 5I8EA 5DJZB 2FB4H 3KHOA 2BVYA 3ILQD 2CUIA 1NANI 4N8VA 3H7LA 5SWZA 1NEZA 1VEMA 1I1RA 3WIHH 3ZDZE 3T2PA 4P4RA 2CDGA 4GAJH 2ZUQC 3FT2B 4XCNB 2BMKA 4OV6F 4HK0B 4YX2L 1F4YH 4U6VH 1IEBB 1CL7I 2PYEE 4XAKD 3IJYA 5KBNC 5F8QC 4P46A 1MCOH 1CF8L 1WIPA 4G6FB 4OCRL 3SOBL 5IMLB 3FQRA 1DQQA 5JR1H 2Y06L 3IKCB 4JFHD 3ARWA 3K1DA 1FZJA 1MCLA 1CBVL 2XZCH 1XZ0A 3A67H 4PY8I 1VGKA 5I18H 4PGCB 3TBWA 5K9KB 2YXFA 3TA3D 4A6YH 1XF2B 3L7FB 2Y1VA 3MLPA 5CLTA 1E28B 3DX9A 4S1QL 3CSYB 2SEBB 4R4NC 1SM3L 2Y9RT 3EKCA 4HIJB 2Y25A 3KG5A 3G5YA 1CK0H 4ZXBA 1KCUH 3MXVL 4N0FA 4HG4J 1QYGL 3O2VL 4OZFB 4XXDA 5JPNB 2NY3C 1YMHB 4HMCA 4ACPA 5I75C 4Y16A 4PG2A 1V7NL 1TLKA 1NSNL 1N0XH 3H42L 4HUNB 4WFFE 2J7LA 4QHNA 3VD9A 4X7TA 3BIAX 5DMYA 3FB8A 4PRPA 5HHPB 5ESVB 1G1YA 4XCCL 1M71B 3RIAK 5HY9A 3IAGC 3T2NL 3DHJA 1QO3B 3GHEL 3CXHJ 2BHYA 3UTQB 3SDDA 1WCBA 4IEFB 2YUXA 5E03A 5C0AE 4JHZA 3LSOA 2FSEA 1RJYA 3QCTL 1I7UA 2NY6B 5F1SA 4PJ7B 3KJ4C 1VFOA 4JO3H 3H0TB 5LGJA 4OAWA 2CKBL 4XVTH 2HG5A 4LEOB 4M1GL 1VPOH 3W0WB 1FP5A 4POYA 5HTSA 4GRWF 5BO1H 4XNYL 1LP9A 4NQDD 1FCCA 3T4AB 1I1YA 4I4WA 5IVZB 3L3OA 1YNKL 4K23L 3U4EB 3C9NB 4YXLL 4PJXF 5BW7A 3NACH 1T20B 3IGAB 4AMKH 5TQ0H 1KXVC 5BMFH 2D7MA 5BVPL 3GI8L 4GBXA 1DL7L 5IFAH 2J5LC 3O4OB 4BQCA 1EMTH 4PLNC 4LMQI 1PFCA 4GLRI 1JWUA 4NM8H 2PW2B 2WANA 4HPOH 1A7NH 1D9KD 1P4LA 4X9IA 4M9OA 5SX5H 4P4KD 5D7IF 3WD5L 3CFJB 3K4DA 4IRJC 3FJTA 3LQAC 3RY5A 2YZ8A 1UA6L 1LDPH 5DK2B 2XKSA 4HGWB 3MLTA 1P84J 1X5LA 4YE4L 3IFNH 4FFZH 1CR9L 3EJZC 2PYEB 5IHUH 1MVUB 4Q2ZB 5BV7H 3CH8A 1K4CB 4RMSA 1N8ZA 2VLRA 5KJRL 2X6MA 4NJ9L 5KTEL 1C5CH 1F4XH 3RY6C 2FLRT 1J0HA 3RX8A 5CEXB 4P46D 3HE6A 3O41B 5C0JB 1AR1D 4MX7A 5FDWB 3SE8L 1MAMH 2ICWI 4ZYKB 3SGEI 1QRKA 2A9NH 3BHBB 3VA2C 1BX2A 1S7SB 4P2RE 1DE4A 1MJJA 5FYKH 3WLWC 3ARGD 2Y36L 1QFHA 1KELH 3FN0L 1A1MA 2X4SA 4K7FB 5EZLA 3HI6H 4H5SB 4QRRB 3OKLB 4BUHA 4FA8A 4ZXBD 1N6QH 2R29L 4G6KL 5E5UB 4Q0XL 3V6BR 3VXUE 5D1ZA 3HE7A 1J1XL 3TPKA 2YD2A 4IHOB 4YXKH 3OKDB 4GXVL 1S78C 3FT3B 4IDJH 1DSFH 1LDSA 2Y72A 1ORSB 3OKEB 2IPUG 5FYKU 4JJ5B 3QQ3A 4ODHH 1NAML 4HULB 1DLHB 4P9ML 3GI9L 2BSTA 4OJFL 5D1XA 1G0DA 2GY7B 5C0AB 3UAJD 3ULUF 4AIZA 4ERSH 1IL1B 4MS8C 5D7IA 5FV2A 3MV7D 1F6LL 3RWJA 5BQ7A 2QKIB 1WF5A 5ACZA 2VL5A 1OTSC 4LKCA 3O3BA 4Z7UE 3C08H 3P0VH 3IDGB 4XPGH 3WV0A 1UENA 1TTUA 1TFHA 1DBML 4JQXA 1A6UH 4AEEA 3TM6A 2CJUH 1NMBL 3O3UN 4EI6A 7FABH 1CICC 2VDKH 3VFVA 4BFBD 5EOQH 5HYEA 1KLUB 1B6UA 4U1LA 3VFGL 1I1AB 2AJSL 4PRDB 4P2OB 3P73B 1BJ1J 1JRHI 5F21B 2V2WB 2V2TA 1AXSB 3MJGX 4W81A 3WDIA 1WCQA 1FNGB 3MGOA 4TRPL 2R56H 3NFNA 5CJQL 3MR9A 3MCG1 5DDHB 2UWEA 1OAZL 1IAIL 1S3KL 5I1AB 2VXQL 2D7OA 3D69B 1U2CA 3MRHB 5DS8B 5DEZA 4JN1L 1LWRA 1BOYA 3F7RA 1AXTL 4YNYA 2PETA 2NNAB 1H3PH 5DWUL 4FQ1H 3PGCB 3VXNA 4GKZA 4XVJL 1FJ1B 4MA7H 3BPOB 1S7UA 2FDBP 3BD3A 2BHZA 3TIEB 3I75B 3VWJB 4X9BA 1NCWH 2VQTA 3NPSB 3OKKA 3T4YB 1MCNA 4Z7VF 1Q9LA 43CAB 1NGWB 4WEBH 2UY7A 4ORZC 3LOWA 1NMCB 1XF4A 4TVPH 1B0RA 5D7JA 4ZPVA 1UXSB 5EUOF 3LQZA 4ALAL 3JV5A 3NAAL 3PWUB 3D39A 3FN3A 3L3DB 4P2RB 3HB3C 4PJ9C 3FO1A 1VFMA 5BXFA 2X9WA 2P5ED 4P2QE 4B5EA 2XT1B 25C8L 1TJGL 1JF6A 4WCYL 1KB5H 1Y0LB 5HVWA 5EU5A 1NFIA 5KVMC 4KUZH 3MUGB 5KN5B 1MFNA 1YN6B 5HD8C 5DD3H 2A6DB 2C4XA 1K85A 4D9LL 5DURD 3ROOA 4AEHH 2IPTH 2NY4B 4MCYA 3PDOB 1UT9A 3V6FA 1RIUL 5CJOL 2NY3D 3LMJH 3VXUB 2NW2A 1INEL 4EI5C 4RWYH 5B38B 3C6LB 4WEMB 4I18B 1W8OA 1WEJH 1IJ9A 4X99B 3MUZ1 1FZOB 2D7QA 2ICWJ 4L29B 4Y89A 1E27A 1HNGA 5GZOC 1KIRA 4S1SH 5DQDH 5ENWA 2XNAA 3P11H 5CSZB 4JM2B 3DV6A 4R97B 5JW4N 1G9MH 1J87A 3B3IA 1MLCA 3A6CL 1ZT7B 1QSFA 3EFDL 3QRFM 1YYLH 3MLSL 4I13B 4YH6A 4H0GA 1HHJA 5A16B 5IP4A 3CDYA 3GBML 3WIFB 2B0SL 2ERJC 3LS5H 4Z7UB 3RHWK 3SKOB 4H8WH 5I8CA 1WBZB 3DWTA 2AERT 3LY6A 2Z92B 3EO9H 1VEPA 4C56E 5GISH 3GO1L 5B22A 1UCBH 3SKJL 1MJ8H 4HUUB 1QLFB 1OP5H 5CZVH 4Z7VA 4XPFH 1OLZA 3VGBA 2NY2D 2XQBL 1FIGL 4F15B 4Y5XB 5E2WH 5ITFB 2NTFA 5DRNA 5F1OB 4FQCL 2H3NA 1KEMH 3C2AL 5I1CH 1T0PB 3FQNA 4KC3B 5B8CC 4NRZB 4U6HA 3RGVC 4TTDC 3BPLC 1I4FA 4OUOA 4LLMA 4NRXA 4FXKA 5E1AB 5TH2A 1RZGB 2QQNL 4HMEA 1PG7L 3OJMB 4FHBD 3FRPA 5I1JH 1I8IB 3NABH 4ONGL 2X4NA 5D2NE 1H9VA 5D71L 4Z5RA 1OVZA 1X9QA 1ZVSB 1CFBA 4J6RH 4HWEL 5F89A 3ZDYF 2V5MA 3RVTC 4L9LC 1VSCA 5JOPD 1U2HA 5E5MB 2NQCA 1RU9L 1UKTA 5ALBL 1MOEA 3QXWA 4ODUB 4H88H 1CIUA 1OAUL 3MFFB 1KCVL 3HRZB 5IF0A 2VWEE 2K9UA 4XNUH 2AK1L 3SE3A 4L1HA 5AAWA 4JRYA 3NTCL 2ADGA 4JKPL 4L3EA 5CLWA 5J12B 1N6UA 3SDYL 3BOVA 4KKNA 1A9EA 5D7JD 5MEQA 3AY4C 3GKWL 5D1QA 5LAXB 3CPLA 2F8OA 3BISA 1FO0H 4QTHA 3WL9B 1OP3K 3IU4H 2OCFD 3MRCA 4G8FA 3WLWD 1IC4L 4MQ7B 3AMKA 3IU3B 4XCYA 1JP5A 4KAQH 4NHCL 1JHTB 4OFIA 2DTML 43C9A 4XP9H 4YAQA 1IQWH 5DRXB 1ONQB 1CG9A 3MV9A 4IBLT 4PJIE 5FDYA 4HHAA 1ZA3B 1U91B 3LS4H 4LCWA 3DECA 4EDWH 2D9QB 1DUYA 4CN1A 2Z9TA 2XTJC 1N4XL 4JFZH 3FO9B 1H3TA 1NCBH 4K9EC 1SYVA 2F19H 2AJXL 2J8OA 1S78D 4DWHA 4G7YL 4UDTA 5EBLB 2FBJH 5FGRA 3WO3B 4JDZA 1R6VA 3DX6B 4LBEA 3GMPA 1KN2H 4HKZB 4MXQC 1C5DB 3LIZH 2HP4A 4HCRL 3OKOB 3VA6A 4NKIH 3BGMA 5TGBA 3H6JA 5FB8A 4QXUL 4PGEA 3QEUB 1HH6A 1BQHG 1XGQB 2OXGA 5D9SB 4QO1A 5BVJA 3RU8H 1SY6H 4EUPB 4MS8D 4MNQE 1WWWX 5JA9A 4KGLA 3BKML 1A02N 1NJ9B 5E4EB 4G9FB 1KJMB 1JZ2A 1I9JH 2EDQA 3RWGB 1C12B 4YDJA 1O7VA 3O6LL 3OKNA 4U6TA 3WNPA 5F7DB 4XHQA 1G0YR 2AEPH 2IC2A 3B2VL 1CICD 2DIAA 1H3WM 4G7VH 1HILA 1HQRA 2AXHA 1TZGH 3QDGA 2ITCB 4KI5F 3VDCA 1A5FH 1MAJA 3CFDA 4QTIL 2Q76B 5C2BL 3U2SB 3V4PL 3GMLA 3F58L 4CU7A 1AGEB 5MEPB 2COQA 1I7RB 4OZHE 2WWKO 3FMGH 4ZO7A 4KTEL 1SYSA 1ACYH 3D0LB 2HFFB 5C6TL 4X6EA 2L7JA 1UM5L 5D2NB 4UB0L 1JPSL 2F58L 5GGVH 4POUB 1DQLH 1FDLL 2P8MB 1FV1B 2NR6C 5JLZA 5DJCA 5E6IA 5I73B 1DBBL 3QDMB 1ZHKB 1KXQE 2UZYB 5C3LD 2EDLA 1Z0MA 3VE0B 2CMRH 1U8OA 2IMNA 5JO5A 2IPUK 3IFLH 4BFIA 1LO3L 2P5WE 2OL3A 3LKPA 5CUSL 1PYWA 4BZ1L 4OT1H 4RSVA 4PJ5A 4BELD 4G8GE 4NQSA 3MA7B 2ED9A 1CE6A 4TUKL 5DYOA 2HH0L 5GJSH 1XH3A 1N3NB 4L3ED 4PJBE 3QUMH 5T3ZD 1GGIL 2EH7H 3HB3D 1T1ZB 4PJ9D 5E4IA 2LABA 1RUMH 1DBJH 5D1QD 5D5MF 4Q9QH 3KPRA 2FZ3B 3UX9B 3ULVC 3MJ9A 4NBZB 1PQZB 3D85D 5B3JE 3LQAL 4WI9A 4YDLC 2EXWC 1NCAH 4FG6C 3X12B 3ZYIA 4EI5D 3HTLX 1F4HA 5DA4A 1QOKA 5AG8A 5L9DL 4F57L 3WKNA 4MJIE 3SCMB 3DLQR 3BKJL 2FHFA 2W9DH 3MCKB 5DJ6A 2NXZC 3KPMA 4PREB 1M7IB 2HVJA 4F7PA 2NY1B 4WUUA 4IMKC 1OAYL 3LN4B 1F11A 5B39G 4BQ8A 1GJIA 3EOYG 5A2JH 3E6HB 1HYRC 1K8DB 4QYOA 2Y07H 2XWBA 2DQCH 2FATL 4LLYB 2F5BH 1A1NA 3PIQA 5DT1H 5I15L 2BY3A 2FX7L 1I9IL 1CT8A 3CCHA 1I85A 1P9MC 4OFPA 5DVOA 4TVSa 5FUCC 4ZNEE 4PY7B 4ZAKB 3HPJA 4XCFH 4FXLA 4X98B 4XC1L 1AP2A 3UBXB 5DRZA 3H3PH 1EERB 3QXTA 2E6PA 3MRMB 5MENB 3DETC 3C5ZC 2HT4C 2V5YA 5ID0A 3QRGL 3TN0C 3T3PF 2AJUL 3I02B 5I1LA 5I76B 3LQMA 1I3UA 1JF5A 4OZHB 3QDGD 3RGVD 1EHLL 1A6PA 4TTDD 5DSCA 3HAEA 4JG0L 4DGVH 5D2LE 1HOCB 2O5XH 1BVLA 3NCFB 1L7TH 4LLVB 4YGVA 1DFBL 1MHPH 3LHPH 2GW5A 4Y8AA 1FNEA 4HT1L 3UEZA 2PF6A 4KZDH 3VU2A 1S7RA 1OGAE 2E6QA 5C0FA 2IFFH 3WSQL 2ICEB 5J6GB 5GGQL 3VG0L 1F8TH 1JCKA 2N56A 5I17B 3X11B 4QGYA 4RGOL 3RVWC 1SJHA 3UZQA 1WWAX 3RVTD 4W6XB 2NY0C 4DCQA 5IMKB 4OD1L 2NX5B 4U1JA 4PRHE 1BBJA 1NGPL 5C6WH 3E2HC 3OKMA 4EN3C 3SE4A 3BFOA 2O26U 3SN6N 2P5WB 3KXFD 3QULA 1A7PH 3CFCL 4M6ML 5FM5O 4MA3A 5ANME 1NDGA 3ROLB 2VABA 1X6LA 4MD5B 3UPAA 5FYLE 3SDAB 2HKFH 3IKKA 4PJBB 3B8YA 5L2KE 5DHYA 1ZHNB 4KMQA 5EFIA 4PJ5D 2AJ3B 2V5TA 5M94B 2X1QA 3UDWA 1UWEL 1WIOA 3C2SA 4N0UE 1WC7A 4YHIA 3EYOA 2OP4H 4HKBA 1I3GL 3GMMB 1E4WH 5ICZB 2BVOB 4GRWH 3EO0B 3CVHA 3UJIL 1FGNH 4M4PA 4MXVF 4YHLH 3PWNA 1IGFH 1RK1A 5IB2B 1XF3B 3KPRD 2F15A 3L1OL 4XBPB 5DQJB 2R69H 3LPWA 4ZTOH 4ZUWB 4PJDE 5K59E 5IOPB 3KJ6H 4KKLC 1F4WH 1PKQE 4BSVA 2XTJD 2KBGA 1YEHH 5HGHB 4LCCC 5DMKB 1DTUA 5C0GA 2VR4A 2OR9H 4I0PB 2VQ1A 5L7XH 5D7LA 2I24N 3WNOA 4MXQD 4X6CA 4N8PA 1VADA 3G6JF 5I8OH 5L6YH 3REVA 4OM0H 2YPKB 2MJWA 3O6FC 1JWMA 3GIZL 1Y18A 3PWVA 5T3ZL 4YHNA 1IBGH 1I7TA 1XAUA 3CK0H 3ARXA 4PRNB 3MNVA 2ZSVB 2FWOB 4ZD3L 2Q7NA 2QSCH 2VDNH 4X0KA 2CUHA 4YQXL 2UY6A 3NIGE 5J1SC 2JB6A 2EDTA 4XI5C 5F7YC 4P5MB 2APBA 4MAYB 1LEGB 2VITA 7CGTA 1PGRB 3DO3A 4LVHB 1DQMH 2WBWB 2BSSB 4YZFF 3VDAA 3C8KA 1EHNA 1KPVA 1FZMA 2Q3ZA 1WVZA 1U8MB 2CR3A 4G8EB 2X09A 5L88H 2KQMA 1JHLH 1YN7B 5JTWA 1UM6H 4G3YL 3FFCA 2EE9A 1CLOH 4R4FL 1X7QB 5D2LB 3QFDB 5HYSG 5T3XD 4OCMC 4L8CB 4OBRA 2X7LA 4L1DA 1J8HA 2AKRB 3S8WA 2Z8VC 4JQIH 2AV7B 2WK2A 1OGAB 5IJKA 1U8IB 4HIHA 4X4MA 1CLYL 1VACA 4ZS7H 3WLBB 1PKOA 5JDSB 2QJDA 3MLUH 1P1ZA 4IS6A 2NR6D 4R3SA 3AVEA 4PRHB 2VC2H 2D0FA 3GJFH 4L8SA 1ZMYA 4HMDA 2BFVL 2EIDA 3QCVH 5FYJE 4AL8L 3ZT6A 1LE9A 2GJZA 2C3WA 3P4OB 4KJPD 4PP1C 3OSKA 5FKPA 4K8RH 3L3JA 1C5BL 5ANMB 3ULUH 1T21A 1IZJA 2CDFB 3HLAA 3TH3T 5L2KB 3PWLB 3G6JA 1RK0A 2DRUA 4EVNB 2FJHA 3PL6A 5TE6L 1RVFH 1YEEL 2W60B 1PAMA 1AKJB 4N0UB 1MUJA 4MJ6A 2FJFB 1EH9A 2ZPKL 4NO0B 4F9LC 3IJSB 2WWMC 1RUPL 2NY6C 3MACH 1T22B 1MHEB 1MFEH 2FGWH 1HHGB 5HHMD 4PJDB 1J0YA 2EXWD 2A83A 4FG6D 1Q9KA 1EEZA 3I84A 1FZKB 1S9WA 5KSVB 2ZJSL 1S7QA 3INUH 4NIKB 4HBCH 2O61A 3IDMA 1CL7L 3HZYA 2DQTL 2WSKA 2NXZD 3K7UA 2H26B 1M6OA 4ODVH 1ETZA 1OD9A 4Y4HC 4Q6IA 3TJEH 3VGAC 1XCQB 3VXSA 3BW9B 4U3XA 3MJ8B 5DJZA 5KVFL 1DN2A 4NQVA 3O8XA 1VFUA 4NQCA 3P9MA 2QHLA 1NGZB 3QUXB 2GT9B 1CXFA 1SQ2N 3K8MA 1I8KB 5AEAA 3AREB 2R4RH 1XIWB 2OTPA 3I2CH 3X3GH 4XPHL 4DQOL 3FT4A 2MQCA 3FT2A 2DMBA 4WI5A 4XCNA 4Z7OE 4KRLB 2Q8AH 5JMRA 5C0EB 4JZNB 3ZL4H 1I7ZB 3IXTB 4WHTA 4ZO6A 4YEEA 5KOVC 3C5ZD 3KDMA 2HT4D 1T80A 1AO7E 3TN0D 3MJ9L 2R0WH 5EBMB 3QI9B 2D7TH 5BZWA 1G7LA 2I27N 4HJJL 4H1LH 3K8LA 3LKQA 1P7KB 3IKCA 4I3RL 4P23A 4XNQA 1MFDH 3QNZA 4K9EL 4E42A 1MVFA 4X5WA 5K9KA 5DC4B 3MRQA 4JGMA 1N26A 5I19H 1CGTA 4BKLA 3T1FB 2ILLA 4MA8L 1T2QL 2BOBA 3JV4A 4P59H 1E28A 4PJCE 2W07A 3RUGF 3CSYA 2OTUB 1NBZA 4IOIA 1A1OB 3O3DA 2AI0H 4DUVA 5C7XL 1UYWL 4OZFA 2NY0D 5JPNA 1A14L 4K71B 3EBAA 5F6IB 4KMLB 1CGVA 1GOGA 5FFLA 4OGXL 4PTTB 4OCXH 5T5FH 4PJEF 4EN3D 5DUML 4OQTA 5IVXF 3ET9F 3V52H 4XRCB 3FHQA 3MRFB 2BVPA 2F53E 5HHPA 2P43B 5ESVA 3QIBB 5IEKA 1G7MA 4QRPD 5I0DA 1U3HA 2NY7L 4WTZA 3KYNB 5EA0L 3HMXH 1NKRA 2GYSA 4MLSA 5E8DH 3U30B 2PXYA 4KVNL 1AE6H 5T3XL 3EYVA 4N8VG 2EEAA 1HH9A 1NBYA 5FUZH 4EQ3A 1NC2B 1K6QL 3MRBA 1NEZG 4FN0A 3E1F1 2JJSC 1FL6A 1H5BB 1EJOH 5EC2A 2CRIA 4RGNE 2XG4A 3B9VA 1JL8A 4K3JL 4LSDA 2X4UB 3QH3B 4ELKB 3L5JA 3UBXI 3T4AA 4CADB 2DYPB 5IVZA 4KKLD 3U4EA 3C9NA 2ZCKH 3GUTA 3ZTJG 3VFWB 4Z77B 5DEGB 2ARJB 4D9RE 1T20A 3RWCA 2DS4A 4RX4A 2GCYB 1I1AC 1JGEA 5HGAA 2FX8H 2GAZB 4P2OC 4OFKA 2H1PL 2JCCB 3U4BH 5ID1A 5IB5B 3CFKA 3OAZH 4I9WE 1MIML 1A64A 4JRXA 3E3QE 1O7SA 3RUGA 2MWCA 5F7EL 3O6FD 4IRZH 3TH2T 4PIRF 4QHUB 4NCDA 2XZZA 4Z8FL 1P7HL 4ONHB 2NPLX 3CLEH 3H7BA 3OXSA 4F80A 4O02H 4MAUL 3BYTA 5IW1B 1TZHB 2OM5A 4R90L 1MF2H 4CL7A 2X4PA 3SJVA 3WS6A 3ZKMC 4QRTA 3BPOC 4C55A 3V6ZB 5CD5D 4HUWB 4M8QA 5IVXA 3VWJC 1AO7B 3VXMA 2ZUXA 1EEUA 4LNRA 1OW0C 5EORL 1HI6B 2VLLB 4ZOCA 1TENA 2DJ4A 2YK1L 1YMME 1KIPB 4G6FD 1NMCC 1WBYB 1BFVL 3U1SH 3PV6A 1YDPB 2R2HA 4NNYB 5C0JA 2F54E 1CFTB 4ZYKA 3ZLQC 3GK8L 4KK8C 3IS1X 4M4RA 3ULSB 2DOCA 3UYPA 4PJCB 3QXAA 1S7SA 4H20H 3FQWA 2X1XR 3CXDH 4C83B 4YDIH 5CS7A 2G2RB 1FFPA 1GIGL 1JHKL 1HWHB 1C1EL 5AG9A 4WW2A 4AY0A 1MIEL 2Y5TA 3GMNB 1HCFX 1MFAL 4QRRA 3S34H 5IB1A 1BGXL 5BOPA 2NY4C 4FNLL 4RNRA 2Z35B 4Y4KA 4WI2A 2PTTB 5E70A 3OKDA 3MXWL 2F53B 3C6LC 3NCEB 4IRSA 1MNUL 2V9QA 3ALWA 4I18C 3EO1B 1FN4A 1V8HA 4OIAA 4XB7A 1MWAA 1XEDA 3UP1A 4M6AA 4XB8A 3U7WH 2R0LH 1G7JB 4JO1L 4KXZH 5EZIH 3ZE1F 1U6AH 4JM2C 5K9JL 4LLWB 1JRHL 4XZUB 1IL1A 5CHNB 2HTLD 4YWGL 1A8JH 3WIIH 4RGMB 5F3BB 2PXYD 2VXVH 3GSUA 5KVEL 4AM0B 4H26B 4YBLB 3S37X 1HHKB 4G6JL 2NY6D 4RGNB 5TQ2L 3LRSA 3SDCB 4O58H 1WZLA 1AY1L 5EC1B 4JANA 4NNPH 3O3AA 4LEXH 5IK3B 4KK5D 4M8VA 4RIRB 2B1AH 3W0WD 4PBVC 3MRRB 4DZBA 1KLUA 2J4WL 1J5OH 5E2TH 5DD5L 4Y5XC 4PRDA 2B2XH 3DV4A