3WJLC

Crystal structure of iib selective fc variant, fc(v12), in complex with fcgriib
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
168
structure length
160
Chain Sequence
PKAVLKLEPQWINVLQEDSVTLTCRSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
publication title Engineered antibody Fc variant with selectively enhanced Fc gamma RIIb binding over both Fc gamma RIIaR131 and Fc gamma RIIaH131.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 160
sequence length 168
ec nomenclature
pdb deposition date 2013-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wjlC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wjlC02
3GEWB 2Z35B 1KYOJ 4CL7A 1OT1A 3D1MC 3T0EC 2O5ZL 4JVUA 3VFUA 4XPHL 1ZMYA 2P48B 2F15A 2WUBL 2P44B 2ZUUA 3C60B 4NO5A 2C9AA 2R4SL 2NXZC 1ADQH 1D5IL 3C6LD 1AFVL 2GIYA 1V7ML 2DTMH 4LSTL 4Y2DB 4XMPH 3HC0A 1XFPA 1T4KB 1SMAA 4R4BB 1FNEB 1CXFA 3MRKA 1QR1A 4MQ7A 4O2EB 2CKBA 5CD3A 9CGTA 3OAUL 1U95B 2JKXA 1BQLL 1OAQH 5FUZH 5L6YH 3MLTA 5EA0L 1CIDA 4G5ZL 3QFJD 3VG0L 5JXED 3ARBA 2PTVA 5J6HB 1I9IH 2AXHA 2W0LA 3PQYB 1SM3L 2CUMA 1MAMH 1FYTE 4ZUUB 1UJ3A 3RWIA 1Z0MA 2ARWA 1U8PB 3Q3GA 4O9HL 2DJ4A 4YR6A 4MA7H 2O26U 3W82A 2Q86A 3KPPB 4J3SA 3MUJA 1A7RH 1TZGL 4L8SA 1BPVA 2OR7A 2OL3H 1RZKC 2VLKE 2W9EL 3BD3A 4HKJB 4MQSB 3UTPE 5FO7B 4ODVH 4A6YH 4NWUH 1C5CL 3LQAC 5EUOB 1MRCL 4AQOA 2E27L 2ZUWA 5DRZB 1JZ7A 4TULH 2XFXB 1K8IB 3ZDZF 3CVHA 3DX8B 5F1IA 2AJSH 3SKJL 1KLFA 1DDHB 4RFEA 4WUUD 4YIQB 1SY6A 3VFRB 1WC7A 2D7QA 4TOYH 2GKIA 1R5WA 3QJFA 4PGJA 4Q9RH 4QHNA 1YEKL 2R8SH 3TZVB 1CVSC 1XF4A 4FQXD 2QADC 3GMPA 5F6IC 2VOTA 3P0YH 2UYLB 2P5WB 4KTEH 5D9SB 1A6ZB 5GGRY 3LN5B 4IS6A 3FN0H 1U6AL 3CX5J 2JCCE 4UIMB 3QT2A 4OI9A 4OQTA 4QHKI 3D25B 4LKXB 5AZEL 5HGHB 5ACLA 3HHRB 3WFHB 5AAWA 5TGBA 3VRJB 1UH4A 3DTXB 2Z31A 2BNRE 2OX5A 4PLKC 1A4JA 4WV1C 2DAVA 1KSRA 1BGXH 1NMBL 2JK5A 3UTOA 4X6DB 1DLHB 4WJ5A 2NNAA 1RUKH 4UAOB 4XCCL 1V8HA 2VXQH 5DMJB 3WLWC 3QUMA 3DV6B 4PG9B 2G9HB 1CIUA 2Q8AH 4LCIL 2ICWA 3INUL 4PJIB 1RUQH 1J1PH 4S2SA 3PE9A 1F11A 3V2AR 4JZNA 3PWLB 5I18L 1ZT4B 4CVXA 2RJMA 1DEEA 1YEIL 5GGSA 4LQFH 2Z4QB 3F58L 3H42H 4WU5B 1U8LB 3TNMA 3VGHA 2RCSL 5SV3A 3RWGA 3KPSD 4P3DB 1J5OL 4X83A 4LCWA 4LFHG 5GISH 1RUPH 3WFBH 2DJUA 5ESVB 5EU3B 3X13B 3CXHK 1S7XB 1MEXH 4F7TB 1I4FA 4XPFL 2FSEB 2H2SD 4ZYKA 1YYLH 3EFFA 1S9KC 4OZFA 1J7VR 3QDMA 2HP4A 3BH9A 2O61A 4UINH 5BJTB 5L8KB 5F1KC 1E4JA 2IPUG 5TDOA 5FUOL 2XY2A 5LGJB 1SYVB 5JMOC 5HVHC 1ZA3A 1AHWA 3D2UD 4OM1H 4GQ9L 4NKIL 3G9VA 1Q72H 1NJ9A 5FM4A 1IMHC 3WIHH 4IRSB 5IB4A 4GW4A 2BY1A 4CJ1A 4MAUH 5F7LB 4BFIA 1G6RA 3MXWH 4JFFD 3S35H 3STLB 3H7LA 2XA8L 4UT9L 1MSPA 1YNKH 1FL6A 1OL0A 3B8SA 4P59H 4XXCC 1E6JL 5IESH 1NDGB 2ERJC 2H32H 1CLYH 4LDLB 3VMOA 3MRMA 4XNYH 3C08L 3RIFF 1YNLL 2H41A 1R0AH 4OFIA 4LSDA 1RU9H 4JGMA 5K93A 2XWBA 1JFQH 3U0PA 1MRFH 1UZ8B 2ZCLL 3VXQB 4WDIA 4UU9A 2WUCL 4PS4L 1TJGL 1AXSA 3GIVA 3E8UL 2PW2A 3CUPB 1BJ1H 1A3QA 4XWGL 1X5ZA 5AUMB 4H1LG 2VDKL 3W0WB 5IJKA 3DX9B 2R0WH 4L4JA 3BHBA 4HWEH 2BVOB 4XP5H 4LLMB 3QNYA 1WICA 4KGLA 1MIEL 4LQ1A 4G6AC 4APQB 1OM3H 5I71B 2AEPH 4EI5A 3O6FC 1MFDL 1OAKL 3T2QA 5BQ7A 3F7PC 2R2CA 5KSAB 1F58H 4JVPA 3CMOH 1DQLL 1JWSB 4YHIB 1LP9A 4LHUA 4O00A 2APBA 1EXUB 3DROB 3MOBL 3NA9H 4XRCA 2EDWA 4JFHE 4H5SA 4LEXL 4RMQA 1MCLA 1RAMA 4C83A 3MODL 3VFGL 5FA3A 4QKXB 1FAIH 1KB9K 3V6OA 1Q9WB 2Z9TA 2YPLB 5T5NF 1FCGA 2CD0A 1UM4H 4CADB 1OQXA 4YBQC 4HEPG 1S7UA 4OF3A 4NCC1 3QEHB 5JW5A 3BUYA 3MRIA 4ZO9A 2HJKB 5IEHB 2WW8A 3IFOB 1IFHH 1CGUA 4RGND 3U4EA 3MA7B 2ESVD 4XVSH 3PWPA 5J7CC 4MNGA 4JHWH 2YBRA 2XZQL 3BP4B 4RDQG 4JRYA 5GS0D 2EH8H 4U1HA 3MRHA 2W9DH 4HKZA 3WFEH 3LS4L 3MLXH 1J0ZA 4KROD 4CVUA 2FL5B 4XXDA 4G8IA 1KGCD 4LARH 1NAMH 3NCFB 4NN7B 5CEYA 3ZKNC 2YPKB 4M61B 1V7NL 1Y0LA 3ZZ1A 4ODUA 5M95B 3GSWA 4RFOH 3OR7B 1MI5A 4G9FA 1TQBB 1GHFH 1F4XH 1P4LA 1LO3H 3L6FA 4ONOA 5ID1B 1VKXB 1YQVL 3FCTB 1G7IB 1QSEA 3VWJC 3H9YA 1KG0B 3HE6D 2VC2L 1QFUH 1VFAA 5CMAB 3SKMA 4GXVL 4LCWE 5CSZA 1OSPL 3B2VH 1UB5B 4TN9A 3U4BH 1NAKH 3WXVL 4HWNA 5EU7E 1HHGA 2GK0A 5IBUB 3UBXA 4XC1H 4D9QE 3DX6B 5EC2A 4YC2B 3G5VA 5DD0L 5C0CB 3OJ2C 1NGZA 1CDCA 4JFDB 3QDME 1EPFA 5CEZD 1YEDB 2BJML 5F7EH 1AGBB 3C09B 1MFEL 1INEH 2ADIA 3CU7A 4UDUB 2UWEB 3HAEG 1A3RH 1YY8A 3H6JA 2EIEA 3K2UH 3UTTD 2YD5A 5ADOL 4HT1L 3TIEB 1A3LH 2VJXA 1L4IA 1AD9A 15C8L 4I3SH 5IMOB 5C08D 1C1EH 5C2BL 5DS8B 5EBWB 3D3VB 2OK0H 5BZWB 1RK1B 4XCYA 1U93A 4LGRB 4WW2F 3T2NL 1KENL 2BOBB 2HVJA 1Q9KB 2MJWA 2PYFB 3ARPA 1HNFA 3VJ6B 5EWIH 2XNAB 3A0OA 4JFED 4OIIL 3QBTB 3RX5A 1IGML 1RULL 4Q2ZA 5DD1H 4M9OA 1HXMB 4QGYA 1U8MB 1I7ZB 4HBQA 1UB6A 1Z5LB 1U3HD 5IW3A 3U9PH 4XB8A 2VDMH 3O8XB 2LVEA 2FHBA 1ZHKB 4D9RE 3QWOA 4NZUL 1K4DB 2AV7A 4UQ2B 4Y5XC 4BUGA 1MCBA 4G43A 4K71C 4KK5D 5C0JB 5C7XH 4NRZA 2QJDA 3QCTL 4JM2A 2VDRL 4LPVA 1TMCB 2PXYD 2AEWA 2UV3A 4OJFH 2XZAL 1FN4A 4QXWA 4P4RB 4JLRB 4I0PC 3QXUA 4HJGA 2XKNB 4Z7WF 2EDTA 2BNRB 2Y5EA 1VEMA 4W70A 4P57B 2O5ZH 3FQTB 1H8SA 5IFHL 5EO0A 2F58L 2F54B 1KB5H 3A6CL 2FJGA 4K3JL 1XGQB 4XPHH 3V9FA 3UDWC 1S3KH 3PDOB 2HN7A 3BKMH 2WUBH 1MQ8A 1B0RB 1LP9E 1CU4L 3BP5B 3OGCA 4H1LB 3GSOB 3IF1B 2FJFB 2IALA 4OD1L 1V7MH 4O58H 1NFIB 2CMRL 3E6FB 3D18B 3PWVB 1K8DA 4GKSB 3WDIA 2V5SA 1IGYB 4MA1C 4OZHA 4ZODA 3MROB 3VFVB 2YMXL 1GZQB 4GT7A 3V6OE 4AH2B 4R0LB 1DUZA 1G9ML 2GTWB 3OAYH 1FO0B 3SCMC 3OAUH 2Q3AA 4XX1E 1IGCL 3DNKA 3RL1A 3MLRL 3BZ4B 1OAUL 3AS2A 3VG0H 2VLME 3RWCA 4CMHB 4PJ5A 2ICES 3LMJL 3C5ZD 2ZCKL 3WO4C 4XBPA 2R9HC 1KIPB 1SM3H 1H3UA 2NW2B 4NO2A 4HKXA 4MWFA 3PWPE 1H9VA 1UG9A 2A74B 4MNGE 5T1DL 3V4VL 5DVOA 3VXRD 4HS6A 2X4SB 2P4AB 3LV3A 4K3EL 2WQRA 3EYVB 5T33L 4JRYE 2EDQA 5C09A 1RZ8A 4P9HH 1TZGH 4HLJA 4OGZA 1JWUA 4NO5B 5HD8D 1INQA 1WK0A 2DQTH 4JQVC 1WWCA 4UTBL 4EIZC 3QJHB 4PRAB 4U6VH 3MRKB 1T5WA 4TYUA 1QR1B 3V0VA 4ZFOB 2CKBL 5SX4I 1MRCH 1MI5E 4NQSB 2LU4A 2CKBB 3ECBA 2OJZL 2NY5H 1M7DA 3P77A 5E4EB 5BW7C 4YAQA 4UILH 4U2ZA 4CDHA 3IS1X 3MLTB 1ZHLB 4N8VA 3SKJH 2Q3ZA 3PDGA 1MFBL 4PLOB 4BSVB 3LQZB 3RDTD 2AJUL 3EJYC 4NC2B 4X7TA 5C0EA 1WLHA 2ZUSA 2A1WL 4POUB 2R15A 5T1KB 1GJIA 1FLRL 1HWHB 3HFMH 4YEFA 3I3EA 1YEKH 2HVKA 1UJ3B 3SBWA 1I8LA 1BAFH 1QOKA 5EU6D 3W11C 1WBZB 1AKJA 4Y89A 1BBDH 5JNYA 5HXMA 2XG5A 2GSGA 5GJSL 1U6AH 4MXQD 1PX4A 4WWKB 4G6FB 1FG2B 4IBLT 1B90A 5AZEH 1UCBH 1YC7A 3MSPA 4M4PA 1X5LA 5SWQA 1QTYT 3P9LB 1AGCA 4QTHB 4AIXA 3TT1L 1ZOXA 3ARXA 1NMBH 2C1OA 1K85A 5J9PB 5MEND 5CWSB 1N3NB 3B2UC 4ZFZA 3HAEB 3E2HC 3CVHL 4XCCH 3CVHB 4PRPD 2DS4A 5I8EA 3C6LB 3KPLA 4FA8A 1SY6L 4GG8A 3EO1A 2BFVH 4RFEB 1LEKA 3PJSB 4FG6D 2QEJA 5CSBA 1DQJB 3K8MA 5I18H 4HWBA 4X4ZA 2PO6D 3DBXA 1YEIH 3C60C 4PJ8D 3F58H 1FZJB 5EC1B 5HHOD 4NO3B 2CLRB 4OSUL 5ALBL 2XQBL 2IJ0C 4Y2DC 5F1NB 2I27N 3NVQA 1CG9B 5IHBA 1J5OH 4CU7A 3C5SA 3C8HA 5EB9A 5IVXA 5GS1A 4BSJA 1A1OA 5GRVL 4NQCD 2L0DA 1KUMA 4XPFH 5TGBB 3PV7A 4JHZA 3QQ4A 4PY7B 3T04D 1I9RH 4FABH 1TLKA 2JK5B 4X5LA 4K94H 4KC3B 5D1ZD 1WISA 1KPRB 4QRPD 3QUML 4IEFB 4MS8C 1H0DA 4NKIH 3VI3E 4WI8A 3P30H 4C55A 1NGQL 3V6FB 2ICWB 4FNLL 4YHYB 3HMWL 4IM8A 1QVOA 1AIFB 5F72S 3CFDB 3UBXG 3CH8A 3QA3B 1T22A 1DEEB 4UT9H 4NRXA 4JKWA 3IJHB 3TNMB 4U1IA 3RWGB 5EFIB 1GL4B 1E6JH 3OB8A 1LGVA 4WUUB 4PJ5E 3C08H 1YNLH 4KUZL 3RWJA 5EOCH 2A83A 2YA0A 4HUWA 5B4MD 1JZ4A 4OLZH 4EI6A 2NY7L 3SDAD 3F7QA 2DICA 3EFFB 2QQLL 2W38A 3DSNA 2EXWC 4FQXB 4X98A 3QDMB 4N0UA 3JSSA 1RJYB 4OCXL 4PS4H 1TJGH 4YBLB 2BHZA 5C0AA 2O61B 3U6RA 3E8UH 4PRHA 5DD3L 1B0WA 4PJXF 1ZVHA 1CICA 2VDKH 1G7HA 1M7IA 1AHWB 3CFEB 4HK0B 2JELH 3RIAF 1ZLUH 4B53A 1QACA 4GKNB 4NZDA 3HR5B 5IQ7L 3RBGA 1MIEH 2C3GA 3TZVC 2IH3A 4EZMA 3IS0X 1JRHL 1LWRA 4GW4B 1G6RL 4EOWL 3D0LA 5K59E 5KW9L 1MFDH 5ANMB 1SJHA 4I48A 2HKFL 3BAEH 1UM5L 2JB5L 4GG6B 3R1GL 1FL6B 4F7PB 1FNSL 3MOBH 1QBBA 4JEGB 3ZE0E 1X5KA 4LEXH 5C07D 3RTQA 3B9EA 3MRMB 1S9XA 4YLQT 2O5YL 4HS8L 4BM7A 3MODH 1P9MA 3G6JB 3VFGH 1VPOL 5HDOA 1VSCA 3U4AA 5C0RL 4M43L 4NP4L 3SPVA 3QUXD 4UAOC 1KC5H 2XWBB 3IKCA 5DT1H 2J2ZA 2I60L 1NMAH 3U0PB 4WDIB 4UU9B 1JZ5A 1ED3B 2CIKB 3WYRA 3OG4B 3PHOA 2XQYK 3AU1B 2PW2B 4OFYA 1HSBB 3U30B 4LSPH 2X4QA 5E94B 4NJAH 3EDFA 3PP4L 5FFLA 4M5YH 5CP7A 4MHHG 3QNYB 3FOMB 2Y6SC 3QXVA 4Y1AE 2XIDA 3FT3B 4MYWB 4O4YL 3C2SA 2XZQH 1X5HA 3IDUA 2I07A 5BQ7B 4I3RL 1QKZL 4V2BA 4YHKH 3OB0H 2AK4B 3LS4H 4HK3N 3D2UB 3V6ZA 1A6VL 3CH1B 1G7PA 2PETA 3F8UB 1SVCP 4URTB 1JJUA 3DMMA 2Z8WC 4RWHA 1F00I 4WI2A 5EBLB 1XGUB 4K07A 1V7NH 4JJ5B 2A6IA 3O6LL 1BZ9B 4PJBA 3V7MA 4HGWA 4ZUWA 3S6CA 1YECL 4JFFB 5L7XL 4J3TA 2A9NL 5FGBC 1EH9A 1R5IA 1S8DA 4UI2A 4K2UL 1RI8A 5JA9A 3ARWA 1BMGA 1YQVH 5C0FB 1I3RA 5FV2A 4IRSC 4MLSA 3HMXA 2VC2H 4Q6IA 4Q9QL 1JGUL 4GXVH 4GFTB 4ZPTB 5DJZB 5DUPL 1OSPH 2CK2A 1NUGA 3WXVH 1U8OB 5FYJD 2RHEA 1MHHA 1F3RB 1NCNA 4IOIA 4OLWL 3VD9A 1MHCB 3MMEB 3FB6B 1S7WB 5CIPB 4E5XB 1L6XA 4WIQA 4L29B 4F9PC 3QXWA 2BJMH 4RMUA 4BH8A 1VERA 3BZFA 1N26A 4U1HB 4WO4D 4BFEA 3UXFA 1JZ8A 2D7PA 4G8IB 4HT1H 5D93B 3S37L 4GAJL 4MXVF 15C8H 5DHVA 4ODUB 3UAJC 5C2BH 1II4E 3EDJA 2FLBT 3ZT5A 2A6DA 4WGWB 4G9FB 2QLVB 1P4LB 1A9EB 1KENH 3QQ3A 1YEFL 1R3KA 1NBVL 1QSEB 4APQC 3RWHB 2AXFA 3ULVD 4OFKA 5I71C 1P6AB 2ZOKA 1IGMH 1RULH 1Q0XH 1FVDA 1DJSA 4FZ8L 5KSAC 4AZ8A 4K8RH 4A2MA 1HILA 2EDOA 1L7TH 1BOGA 4N0UE 2DLHA 4M7JL 5C0AE 1P5VA 4X0KB 4XP9L 4NZUH 4NNPL 4PRHE 5GZOC 2DI9A 4OCRL 1D6EA 1YY8B 1ZHNA 4PJDA 3QCTH 3U48A 3O45A 3P9WB 4AG4L 5IEKA 43C9A 1ZS8A 4FFWD 5T3XD 2F8VA 1L0XA 2FJHA 4NBXB 1Q9LA 2OJEA 1MJJA 4XCYB 2J4WH 4TUJA 1U8IA 3A6CH 4K3JH 3EBAA 4LBEA 1XCQA 3SKNB 1JZ3A 4X9GA 2V17L 2H2PD 1YQ2A 4KROB 3I6GA 3L7EA 1BWWA 1CU4H 2WWKT 1JPFB 1GOGA 2JTDA 1GRWA 4QHUA 5E7FA 3ARFD 2UY7A 4OD1H 5EZOL 5E08L 2RGSA 5JIKA 4AENB 1FGNL 4PR5B 2WBWB 4J7RA 4RIRA 1OAZL 1CLZL 3FB8B 4L4TA 1IKFL 5KBNC 2EC9T 4X4XB 3LPWA 2JJSC 3KYNA 1IGCH 2WM0A 4NN7C 3MLRH 1Q8MA 2L7UA 3ARDA 1BJ1J 1OAUH 3IYLW 3HE6B 2ADFL 3T2OA 1OCWL 5DRNA 4NRZB 4XCNA 3KXFD 1WT5C 2GCYA 3LMJH 4R6UA 1DQDL 3QUYA 3RY4A 1CGYA 1TQBC 1KBGL 2XY1A 1S9WA 5T1DH 1FZMA 2ATPA 4XP1L 3U79A 3GSQA 4K3EH 5D2NA 2D7OA 5D7KE 4S1RH 4YHLH 5SX4H 2EDEA 2K3TA 3UTTB 2DTSA 3IU3B 3OGCB 2MHAB 4PJHB 4YC2C 5IIEB 4E42A 3E3QC 2B2XH 5DEFB 4PJBE 3UTSA 4G80B 2G5RA 2DLEA 3C09C 4OZHB 5DHYA 3FRPG 1CXIA 3PNWA 1DUZB 2UVFA 3GJFK 4JN1L 5I8KL 2ARJA 4YX2L 3U82B 2WBJD 4N9GA 3CDGB 4H0HB 1RZGA 1DQMH 2CK0L 2X4RA 4JFEB 1MFBH 2ATKB 1LE5A 2Q8BH 4M8VA 4ZXBD 4PJ5B 4F15B 5HGDA 3ORJA 1Z9OA 2VR5A 2YS4A 3D0VA 4RBPK 2A1WH 5CJXA 1FLRH 1HQRB 2NY3D 5EN2B 5DRXA 3SE3C 1BF8A 3MZGB 4TSBH 3VGEA 1RHFA 3MLUL 5GJSH 4W68A 4HFUL 5CLWA 5C09B 3U7AA 4BZ1H 4R7DB 1RZ8B 2VUYA 4WNQA 3GJEA 4N1CA 3KPMB 1J0HA 2VXVL 1INQB 1WWBX 3ZMRA 2PXYB 3BRGC 5FYLE 4TVPH 5HHPA 1DE4B 1KLUB 4JY4A 4Z7OE 4HFWB 3RWFB 5I66B 5I17B 3RRQA 3VFWA 4KI5D 4LPTA 4D2NA 1M7DB 4P9ML 1EVTC 5EOTB 3K80A 5HYSG 3MRGA 4Z77A 1SY6H 2BERA 4KVNL 3OF6A 3RWDA 4JKLA 5DMIL 4X7TB 4ZOAA 4RMSA 5F89A 3I9GL 1VADA 5HI5D 4JPKH 2QQNL 4ZTPL 3V5DA 1MCCA 4NQXA 4R97B 3IFPA 5CS7A 1IBGL 4OZIB 2UVEA 1XF3B 3IETA 3QIWA 5ALBH 5JNYB 4OLYH 1CF8L 3IDJA 1VGEL 2VAAB 4YE4L 3O2DH 4OQTH 1X6NA 4ERSH 4PJDE 3C5ZB 2EDXA 4R0LC 4XPAL 5C3TA 1CE1H 4X6EA 5E8DL 1G9MC 4KKBD 4H0IA 4PJ9D 3VXRB 4Z7VA 1H15A 5IROC 2CJUL 4QRTA 1TZHA 4U1LA 3O4LE 4CMHC 3JV4A 2N56A 4YXKL 3WFCL 4JCMA 3MJ9H 3QUMH 2YUZA 1AR1D 1E4KA 1HQ4B 1V3MA 4I5BB 3QEUA 3CDYA 3HI1A 5D5MA 4N0RA 2BNUA 3NFSL 3EO1B 4GG8B 4PP2A 1CDUA 1NBYA 5D7IA 1UKTA 5B39A 1BEYL 4OLXL 2ZOLA 1ZSDB 2NTFA 1T0MA 2HTKD 4XZUA 3U2SB 3HZMA 4NZTL 2DQCH 4LEOB 1AJ7L 4L4TE 4UNVA 2A0LD 3CCHA 3L5HA 2V2TA 1N5AB 4WFGD 3IDXL 5I8CA 3DRQA 3L5WA 5LGKA 3EYSH 3IGAA 4NO0D 1QBMH 2CH8A 4L8BA 4LU5H 5IVXB 1MCKA 2XI9A 1A1OB 2GT9A 2DL2A 2NY7H 4U33A 2N4IA 4OZFH 4ZO6A 5E4EC 2QQLH 3ULUL 1U58A 5EU6B 3V6BR 2ED8A 1LMKA 2OTPA 3GSNA 4OCXH 1IQDA 5EUOF 1QSFD 5D2NE 3DVNB 3TESA 1FFRA 3GSXA 4OLVL 5DD3H 5IB2A 3LEVH 4QRQA 1ACYL 3VGAB 5E6IA 2DYPD 1H0DB 1U92A 4S1SH 3TFKC 2GSIA 1UJ3C 4Y7MA 4OB5L 3MO1B 5HYJD 4PJEA 3UTSE 1G6RH 3BMVA 1D5BB 2XZCL 3L3JB 5KW9H 1UCTA 2DRUA 5DK2B 4JRXA 4WWKC 5MENB 4JZJA 4Z78A 4NRXB 2VDLL 2ZUTA 3R1GH 3QI9B 3HR6A 4U1IB 2NX5D 1FNSH 1UC6A 1X4YA 3EYUH 5GRJH 1KPUB 2YK1L 5E8NB 5I1GL 2O5YH 3WLBB 3NZHH 1JHKL 1VPOH 1MCJA 3Q6FB 3HNTL 5I1CL 1WCBA 1WZ1L 5D2LA 1IL1B 3N06B 3JUYA 4GS7B 4P46D 2PKDA 5HHOB 4NQUA 2FBJH 4N0UB 3C6LC 1T2JA 4W4NA 5H94A 4X6DF 2DI7A 3GJFA 2YN5A 3DXAD 1BZ7A 5JMRA 1NUDA 3DHJA 4ZFGL 3PP4H 4LIQE 4JANA 4LLDA 4EN3A 4PJIF 2IH3B 1WGOA 4LASH 2GK2A 4X6FB 4O4YH 5D1XA 1W72A 4NYLA 2ITDB 3JZ7A 4DW2L 5ESQA 5DI8A 5D1ZB 1RUMH 4L4VD 1FIGH 5EZLA 4QRPB 5SX5K 3HPLB 1A6VH 5GJTL 3ULSB 5CJBA 4F33A 5DEGB 1IC4L 5ENWB 2DIBA 1S9XB 2HT3D 5DQ9A 5CD5D 1UEYA 2DIJA 4QHKJ 1F90H 1W0YT 1MNUL 4JFPA 5HI4D 3SPVB 3MJ7B 7FABH 2A9NH 3AMLA 4JDVB 4NT6A 4EVNB 3FQRA 4HJ0D 3T1FA 1XGYL 3T1WA 4LSRL 3QCVH 1CLCA 5A2LH 3QDGD 5ACZB 5HYSB 2F53D 3A6OA 4YHYC 4KVCL 3IDGA 3I02A 1MIMH 1JGUH 3OXSB 5DUPH 4F80A 5T3ZD 3ARED 4F2MA 3F12B 5JZ7D 4XBEL 5CP7B 4OLWH 3MRQA 5I9QB 5IT2L 3P0VH 4KMTL 4Z7VE 2J12B 5DK0B 5CJOL 4HWZA 2BOCA 5FGRA 5L2KA 3TVMD 2IBBA 3OPZL 2MNUA 2MQ3A 5EU7C 2H26A 5KS9A 4Z5RA 2VZ1A 2OXHA 5D5ME 4EBQL 1SVZA 1B3JA 4FQXC 4XMKL 5D7IE 4PJBB 2HMID 4YBLC 1WBXB 1NLBH 1QRND 3SDDD 2UZXB 2CLZA 2CIIB 3TN0D 1EUTA 1TVHA 4PG2C 1R5IB 1MCNA 1S8DB 2HAZA 2VL5A 2LV4A 1AHWC 3FO2B 1RFDH 4PJCB 5IBLD 3PWUB 4DKEL 1JHLL 3HMXL 3WHXA 5C92A 1K5NB 1YEHL 5C07B 2VZOA 4BYHA 1KXVC 1CXLA 4WENB 1KTLA 3TH4T 5EUKA 4FZ8H 1CDGA 3QUXB 4EEEA 2ZCHL 1NDMA 1TVBB 5IMKA 5I1HH 3WE6B 3WD5L 4X6CF 1DVFA 4XP9H 1MFNA 2I26N 3Q1SL 4OCRH 4LLQB 2NZ9C 3WIIL 4AG4H 4OM0H 3TO2B 5M94B 3O0RH 3MOQA 4QO1A 4PJEE 5HTSA 5IB1A 3DURB 1XMWA 3U30C 2A6DB 4JRXE 1G0DA 4IOFD 4O2FA 3B6SA 4KZEL 4PGCA 2V17H 1B88A 5JPNA 2NYYD 3VCLA 1XF2B 4WCYL 2Y36L 1J05B 1JWMA 2H2SC 3MGOA 4FFVC 5E08H 2AXFB 3B8YA 2YOCA 5EOCJ 5HGAA 2F8XC 2PTTB 3OX8B 4L9LB 5FKPA 1FPTL 1OAZH 4ZO7A 5D2LE 3O6MH 1CLZH 1FGVL 1HEZB 1IKFH 4J6RL 4MAYA 4ELMA 1BOGB 1QD0A 3BEWA 3CJJA 5F7WC 2AJZB 4KQ4L 1MWAA 4Q0XL 3BDYH 5E8EA 4B7IA 2YKLL 4YZFF 2ADFH 3Q5YA 3IXTA 1OCWH 1ZHNB 4PJDB 1UZ6F 3VXUD 1F3DH 1DR9A 3HUJB 2BSTA 1OWWA 1JGLL 3O45B 5IEKB 4JZOB 1DQDH 5DQJB 3T8XB 3NFNB 1ZS8B 5ABDE 1KBGH 4XPGL 1XGRB 2C1PA 1GVIA 3MLPA 4XP1H 3OKKB 1FZKB 1IC1A 4LBEB 2HA1A 1A1NA 1VGKB 4LPXA 4WO4B 3D85A 4WEBL 4M3KB 3L7EB 1WAAA 2QSVA 3GSVA 5GGTA 5BO1H 2ADJB 3KR3H 3RNQB 4UOJA 1BD2D 1ZVSA 3BXNA 5LWYH 3FQNB 4QXTB 2IQAB 2J3SA 4RIRB 4J1UA 4AEFA 4JFXA 4FQHA 1O7VA 2EC8A 2UUDK 3LVEA 1FG9C 3UP1A 4YX2H 2C7UB 3C5JB 4M93B 1I3GH 3BW9A 3ULVL 5FB8B 2UWEF 4RGOL 4HAGA 1XF5B 5D7JA 2FX7H 4QT5A 2GCYB 5IR1B 4BH7A 4PTUA 3CZFB 5E8OA 2C4XA 1EIBA 4U7MA 4B7LA 5DO2C 2X6MA 1S9WB 2X1OA 3DIFB 3AM8A 4Y5VA 5I76A 3GSQB 2VL4A 3ILQD 3VDAA 4MCYB 1MF2L 2LAAA 5L2KE 2BSRA 3NPZB 5KS9E 2DQDH 4I0CC 4TNWF 1I1AD 2VXVH 3LN9A 5T3XL 5B38G 4GSDH 1OGTB 2VABA 5ALCH 5DSCB 4P2OA 3VFNA 2PTUA 3VFPB 1V3LA 5C1MB 4KV5E 4KWUA 3KPSE 3PNWB 3NGBB 4XNMA 1HHJB 1LHZA 2MQCA 3F5WA 2JIXD 4P9MH 2IBZY 4RGNC 4ETQA 2I24N 4N9GB 1ETZA 2ILLA 4HCRH 2X4RB 3EOAB 4KVNH 2Z8RA 5KAQG 5KG9A 1O7SA 1B0GA 2H1PL 5HGDB 2BXYA 3W5NA 3WHE1 2VR4A 3MV9D 5GS0C 4CN4A 2QQNH 4H88H 1D9KA 1EEYA 1FNHA 4KDTC 4KROC 2NXZD 3PIQA 2B1HL 1PJ9A 2R29L 4LKCA 5H8DA 1OARL 5GXBB 3MV7D 3VE0B 3WS3B 5AYUH 4I77L 1J8KA 3MREB 3HB3D 3QPXL 4YGVB 2APFA 5DTFA 2HRLA 4XC3L 1GC1L 3FT2B 5E8DH 4AIZA 2QKIA 2FB4L 3NPSB 1MVFA 3AAZA 1P7QD 4JY4B 4NZJA 4DZ8A 3I6KA 1ZTXL 3HE6C 4OGXL 5J13B 1T7VA 3GSUB 2J8UF 4IRJA 1QFPA 4PRIA 3VFWB 4YHZL 2GY5A 3S4SA 3GBML 4FQLL 4YXKH 3WFCH 2K7QA 4BSWA 2W0FA 3M8OH 1A7OL 1CDHA 4KKNA 2EYRA 3U7WL 3V4UL 1ZLSL 3RUGF 4HS3B 2UY6A 3HN3A 5F89B 1BEYH 4HWBH 4ZD3H 4OLXH 1JK8A 4O51A 2DQIH 1G7JB 1CFSA 3KNBA 3V5DB 1BQHG 4NZTH 1CWVA 3OKLA 4ELME 5HDBF 4DEPB 1I7UA 2PR4L 2WBJB 3IDXH 1BFVL 1A6TB 3MYZA 4O2CB 3T77A 4NN5B 4OGAD 1BQSA 3OV6A 4WU7B 4MB4A 3EFDL 1QLEL 3ISWA 3P73A 3OJVC 4LLVA 2M26A 3BPCB 5IGXL 3QWRA 2RQ8A 3JWOL 2OXGA 5JOPD 4HD9A 1ERNA 2BDNL 4Z7NE 1RMFL 2NY1B 4P99A 5I0ZA 1TZHB 5F9DC 2ZKHL 3ALPA 4F15C 3DUUB 3M17B 4AEHH 3SJVD 4MX7A 2XTJB 2B8OT 5C0DB 5GS3A 3VD3A 1R3HB 2MMXA 1ACYH 4L3EB 1WAAE 1PKQB 1U3HC 3QEUB 4ODBD 3HI1B 1U8QA 4H20L 2QADD 1IEBA 4PP2B 4OB5H 3FQUA 2H9GB 2ZOLB 1XT5A 4FQIL 5FAAA 2E9WA 2ZWLT 4XZUB 4LLYA 1QYGL 3HZMB 3ARGD 2X89D 3CCHB 2V2TB 4GW5A 3GNML 2H8PA 3HCVA 2VXUH 5DGQA 1DBKH 2PXYC 5CHNA 2YK1H 3CSGA 3IGAB 3C9NA 3D39D 4OIAA 4AYFA 3I85A 1P1ZA 1B6UA 1HWGB 3I6LE 4KXZI 3V7AE 1V3JA 3EOTL 2DQFA 1BHGA 3FOLA 4K9EC 3UEZA 4QHMB 3TGXA 4YDKL 5JLZA 3BN9D 4JKPL 1EHXA 3DVIA 5MEOA 3MLWL 3HLAA 1U58B 1U36A 1JZ2A 1UEMA 2E7CA 3S3SA 4QYOB 4NHCL 1S7SB 3LB6D 3S96A 3GSXB 4H8WC 1I1YA 4DZBA 1CL7L 4R2GD 1HCVA 4W81A 5E6IB 4ZFGH 1NCDL 2C4FT 1YN7A 1I8IB 3GMOA 4V2CB 4R97C 1JF1B 4N5UA 1I8LC 4U1MA 2EEDA 5J11B 3QEQD 4Z7UB 2DLGA 3RVUD 4NQED 5E1AB 3DI2B 1MCWW 3OKEA 4NWTL 1T89A 5K9KA 4DW2H 2HWZH 2V5TA 4NKDA 3IDMA 5CUSH 3C5ZC 1CL7I 1K4CA 2MQ0A 4U1GB 4F7EA 5H35A 4K55A 3FQWA 5LAXB 2FH6A 5EZIL 5GJTH 4AT6A 5B38B 3UJIL 4MCZA 1P84J 2PYEA 4TQEH 3RI5K 3A6BL 3Q5TA 4IMKA 4HPOH 1Z9MA 5T5FL 2CXKA 3V5KA 1PAMA 4NZRL 3KPRA 4AMKH 2IPTL 4XNXH 1EGJA 2KZWA 3CXDH 5HD8C 1Z6JT 3QEGL 1XGYH 4PYGA 4UT7L 4WRLA 1ONQB 5I1AA 4PGBA 2P42B 5H94B 5C6TL 3GRWA 4P5TA 4NO0B 5ID0A 3IJSA 3X3FL 2X1QA 3SGKA 5DFTA 3UPRA 2WIIB 4JANB 4FMFA 1Q94B 1MVUA 4LLDB 5F88B 5IT2H 1J87A 1SEBA 4KMTH 1W72L 2WIMA 5HPMB 4QGTA 1W72B 4PREA 5CJOH 5D1XB 3HI5H 4YXHH 2O5XL 4NQVA 1IAOA 4FXLA 3SQOH 5DI8B 5SV4A 4PRIE 3VXOA 3OPZH 4M1CD 2NY0D 5SWSA 5EZLB 4MJID 2DYPB 2Y7QA 4XH2A 4POZD 4EBQH 2EDLA 1YEEH 1IVLA 3EOBA 4P4KA 3CC5A 5HYJB 3ULUC 5DQ9B 5TE7L 4CNIB 2W59A 1BVLB 3ZDXE 5BV7B 4NJ9L 1BECA 2Y07L 4MXQC 4DVBA 5ITBL 3SO5A 1AR2A 4NT6B 3VGAC 4C56A 1VACA 4G6AD 2NX5B 3STBA 4DKEH 3OKDB 4PLNC 2NY6D 4NQCA 4K3HA 3O6FD 2E6QA 3QIBA 3G5YB 5IVNA 2YEZA 1J1XL 1KLGA 3BDXA 2E7HA 5GSRA 5IF0A 1AXTL 1BQHB 3WEXA 3WKNA 3QI9C 4P46B 1A7QL 2ZCHH 1DBML 3DX7A 3MV11 5ERWA 5FKAB 3WD5H 4HWZB 3S36X 1EVUA 1U8KB 2J8OA 4X99A 4FG6C 4PTTA 4GG6F 3Q1SH 1FFOB 3DXAB 3T3PF 2VIRB 5BS0D 5KS9B 2H26B 1FL5B 4RAUB 4Z5RB 1KN2L 1NH6A 3WIIH 1XGTA 4U3HA 5FYLH 4GS7C 5DHVH 5TPWL 1YNTA 2HFGL 4YBQD 4J3OC 3HI6L 3G6JF 5TE6L 5GSVB 4Y2OA 5GS2H 1JNJA 3BISA 4TVSa 4TUOB 5F96L 3T0AA 1AH1A 2VL5B 4LCYA 1A64A 3QULA 2NTSP 3PGFL 2Y36H 1NFDB 1CR9H 4BQBA 4KH2A 3WHXB 5C2UB 1EO8L 2AAVA 2PW1B 3BUTA 5L9DL 2IAMA 2QQKH 1FE8L 1B2WL 3PL6A 1AQKL 1BFTA 1WBYB 3H3PL 5D1ZC 4RMRA 3VWKD 1FGVH 1T83A 1G7MA 3LKOA 4J6RH 1T66C 3BRFA 3ZHLA 1OP5K 5C0GB 2MOVA 3QDGB 4KQ4H 4Q0XH 4GMTL 2YKLH 5B8CA 2DBLH 2KKQA 4R4FL 3OKOA 2WQ8A 4UUJA 1JGLH 1AO7A 1J0IA 5K9JL 3VFMA 3WS6A 3QUKA 1EFQA 4KU1A 5DD6B 2VNCA 1IM9A 3TJHD 1I1RA 4XPGH 5KJRL 1CGSL 5CGTA 3BWUC 1CD9B 4ESKA 2AKRA 3WNOA 5IBTL 3TVMB 4PGCB 5B4MC 1YPZA 1E27A 4WEBH 3QNXA 5E56A 5I9QC 5SWZD 2RFXA 3B4NA 1KEMH 4YDVB 4M1DL 2PYEE 3TNNA 5HGAB 4FXKA 3SDDB 2AJVL 3O81A 5LQBH 5FKPB 2HLFC 3TN0B 3VI4E 3KPRE 1H3TA 4HLZH 1TZIB 5I1KL 1G9NL 1CFNB 1MWAL 3BEWB 1X7QA 1FC2D 3H9SD 4LF3B 4U6YA 2HFFB 5E8EB 1MWAB 1MREL 3TCLA 1TXKA 4RGOH 4A2LA 3PV6A 4QRRA 3IXTB 1PSKL 1DUYA 5DJ0A 5DC4B 1S5IL 2BSTB 4GMSH 5CSGA 4YHML 3UPCA 2C1PB 2FEDD 1NANI 1I7TB 4DGVH 5MHSE 1U8HB 4OZ4B 5A16A 4K3DL 1BREA 2CUHA 4GRMB 4R3SB 5SWSE 5GGTL 3VDBA 3VXSA 3QUXC 3WKML 3HNSL 5C9JA 4LCUA 4NFDA 4MD5A 3FL7A 1IT9L 4MZ3A 1ZVSB 3BXNB 2P5ED 2AXGA 4YK4B 5JIIA 4NNYB 3SOBL 2BVQB 4JQXC 3BO8A 1NCCH 3QUZA 4D0DA 4JFXB 4FQHB 1DL7H 3L3IA 2GJ6A 4P2QD 2BCKA 4JO2H 3MA9L 4C56E 3SKOA 3WJLC 3BW9B 3JTSA 5I1IH 4NQCE 1I85C 3LN4A 5DUBA 4DQOH 4DGIL 3FFDA 4PJGB 4UIKL 1SYSA 3DYOA 4U05A 3L3GA 4C57C 4ODSH 5E8OB 4ODWA 3TEUA 1YZZA 4NPYA 3I75B 4K7PY 3NACL 5IUSA 1NC4D 5IB3B 4MNQA 4X7SL 5KSBA 3AROA 4Y5VB 2B1HH 2NLJB 1HOCB 2XV6B 1Z3GL 3R4DA 1LD9A 1IC7H 4L9LC 4RMTA 5BMFL 4XPBH 4LIQH 4U7SA 1GC1H 1IAIM 1EEZB 1NBZA 2FB4H 2VABB 1KJMB 3L9RA 4FTVA 1RY7B 2B4CL 1P69B 3CLEL 1T0NA 5F3BB 1ZTXH 3FMGL 3G6DL 1JNNH 4XP4L 2HJFA 4XNMB 5DFVD 4YHZH 3EYQD 3F5WB 4FQLH 1UXWA 4JFYA 1EHAA 1KIRA 3SE8H 3ZYIA 3MBED 2OR9H 3HE7A 4OKVA 2H6PB 2FCBA 5FDYA 3U7WH 3V4UH 1ZLSH 1BD2B 2AV1A 1B0GB 3MPCA 2VYRE 3S36L 3RAJL 5BZDB 1GZPA 2F19L 4WO4C 3BIBX 4AEEA 2X9XA 1BM3L 3UTZA 2XWJA 4OFVA 3T0XA 4KMQA 4HUXA 2L7JA 1BFVH 3IAQA 3L3OB 4UDTB 4P23A 4G7VH 3FFCD 1HYSD 3RQ3A 1QLEH 2OTUB 1SHMA 1M7XA 4PJHF 4YUEH 1IGFL 5DTFB 3GFUA 4M6OL 1AO7E 5FOBB 3JWOH 2F5AL 4OBRA 4IIQA 2FO4B 4M93C 2BDNH 1KIQA 1A22B 1RMFH 2FATL 1JI2A 3ULVC 2ZKHH 3EJYD 2VDOL 3DUHA 3LPGA 1YPZE 4MJ5A 1K2DA 2W0FB 3VH8A 1YEGL 3CSYA 1S7VB 2ZSWB 3W11D 4RAVA 2EYRB 1MAKA 5IM7A 1T3FA 1VFOA 1X5FA 4HZLB 4TSAH 4P3CH 3QR2A 1FJ1B 5I74B 3TBYA 4FQIH 5F3HA 1JK8B 1K6QL 1QLFA 4KXZH 5IVZA 3KNBB 2VISB 2VAJA 2XN9A 1N8ZA 1G1CA 4BZ2L 1MPAL 4X4YA 1QHOA 1P4IH 2X1WL 1NCUA 4S1DC 1JGEA 2K7PA 3X3GL 2VDNL 4QRRE 4WHCA 3P73B 4RCAA 1F3DJ 4ZDHA 1JHTB 1J1OH 1VFBA 3FO9B 3CMGA 3MV9B 3ZTNL 3DGGA 5EH1A 1HKLL 3EOTH 3NGBC 3SGDH 3B2UD 2VH5L 1YA5A 2H2PC 3VGFA 3HZKB 4JKPH 4HUUA 4LSUL 3GSNH 2R0ZL 4IMLA 3MNWB 5DJ6B 3MJ6A 3MV7B 1KNOA 1CL7H 3BQUD 3JXAA 5I1DA 1NCDH 3VXSE 4XVJL 2YA1A 3C60D 2BSSA 2WV3A 1P7QB 3FQUB 3Q48A 4M9PA 1U42A 5EG6C 3SDXB 5CBAA 3UZEA 2YRZA 4LLYB 2IQ9L 3NTCL 3K3QA 1FNGA 4OZIF 4KRNA 5KANI 3WFZA 1D5XA 2GJ6E 3MCKA 4RGMB 2EYSA 32C2A 4ZXBA 2HKHH 5CZVL 1KCRL 1QPXA 4GW5B 1EMTL 5DMYA 3N0PB 3NPSC 4BQ8A 1TTGA 2B5IC 1HE7A 1NGXB 1P1ZB 1UKSA 3BGFB 3A6BH 3QXAB 2R1XA 5J13C 2DF3A 3PQYD 2YPVL 4NZRH 4MS8D 5MEOB 4MNQE 5KSBE 3QEGH 4HEME 1KB9J 3LH2L 3BP7B 1XCTA 5C6TH 2YXMA 3GJFH 1J12A 4NNXA 4FP8H 2IF7A 2B1AL 4JQIL 1LNUB 1JIBA 4XTRC 3PXJA 5E9DD 2IH1B 3KPOA 3ZE1E 3ROLB 2WBJC 3LIZL 4RBPH 4W4OA 5H2BA 4NN5C 2R0LL 5HDLA 3OKEB 4ZFFA 2O5XH 3RIFK 1P7KA 1IGTB 5TE4L 3SJVB 4F7EB 5H35B 1A7PL 4ORZC 3FB5A 3O3DA 2HG5A 3FQWB 4JG0L 5CGYC 4ZS6D 1ZT7A 1QFWL 1MFCH 1RURH 4MDJA 2EXWD 3QPQC 5DWUL 2NY1C 1I8KA 3CVIL 5TE7H 1AGFB 3D69B 4AEIL 1T1YA 3GUTA 3U7YL 3MNZB 1EGJL 3TWCH 3UMTA 2XTJC 4OLUH 1OQOA 3ARGB 5ITBH 4Y4FA 3ULUF 1N6UA 3GRWL 3TZVD 4LNRB 1WJ3A 5MI0B 1EO5A 3D39B 3O9WA 5FECB 3KDMA 5F9AC 1ZXQA 3ZYOA 2FZ3B 5D1QA 2KDGA 4FQ1L 3G5ZB 1JN6B 3GSRA 1J1XH 1C16A 3MUZ1 1LEGB 1B4JL 2P8PA 4KI5C 1AXTH 5CEXA 1MRDL 1WIOA 1A7QH 4NM8H 1N0LA 1XGPA 3RWEA 1ZEAH 4TRPL 4OD3H 5AD0A 3VXOB 1U8JA 3VXMA 5SWSB 3QO1A 1A02N 4R2GB 3E6HB 3KYMA 1BX2A 1S7TA 1C08B 5TPWH 1IAKB 1ADQL 1JUFB 1R6VA 2HFGH 5FGCE 3LKNB 2R56L 4P4KB 2EIZB 2EO1A 3HI6H 5TE6H 4NQEB 4GKOA 1WFTA 3JBG7 1IAMA 1C5BH 2JJWA 1V5JA 1DN0A 4MJ6A 2N7AA 5F96H 2XN9E 5DVMA 1FRGL 5E6IC 3O3EB 3QG6B 3KXFE 2Y6SD 4KKBC 2R4RL 3NIFF 4YGAB 5J11C 1EO8H 5FUZL 5L6YL 2WAHA 4P49A 4P5KB 5L9DH 4QTIL 1FE8H 5DC0A 2CSPA 1VFMA 2YEZB 1AQKH 1ZA6A 3H3PH 3P40A 4U1GC 3QDJA 2E3VA 4I9WE 1MAML 3QNZA 3AGVA 5ERWB 3DX7B 3ESUF 5BCAA 3BKCL 1TTFA 3WUWA 4GMTH 1S7QB 1ZGLM 3CFBB 5HYQA 4PTTB 4MA7L 3PP3K 4R4FH 4ORGA 3SDCD 2HTKC 1HHIB 4U4BA 3UCRA 5K9JH 1XGTB 2A0LC 3DRTA 1MH5A 3BZDA 3RVVD 3UJJL 5KJRH 3C8KB 3GO1L 2RIKA 4OKDA 3DVGB 1CGSH 3BKJL 1SBSL 4Z0XB 4Y4KD 5E2UH 2EDJA 4A6YL 4NWUL 4Y16A 2R39A 5J1TC 4A6YB 3V79C 1SJEB 4XHQA 2NY0B 1KT2B 4AJ0A 4K7FA 5B3JE 4MJIB 4F7CB 5C0BD 4TULL 1ZE3C 3GB7A 2AJSL 3DPBA 2R2BA 1V3KA 4U1JA 3HTLX 5D1XC 3VDCA 1ES0A 1QO3A 1MCDA 1X5GA 4JKKA 1JV5A 1MLCA 5BRZD 3EYFB 2AQ3A 4KDVA 5I1KH 3IFNL 1CCZA 1G9NH 1D5ZA 4FRWA 5HYEA 3HRZA 4CMMA 3RNKB 4LRIA 1NANH 3OHXB 2NY6B 4WI3A 3P0YL 4F9LA 4KTEL 5B8CB 1UVQA 5KVEL 3GHBH 3JV6A 3P4OA 5JHDD 1E4XL 2X4UB 4XBGB 5BV7C 4WFHD 3PUCA 2Q20A 3MLSL 3W39A 1RZJH 3VH8G 1RJZB 3W0WD 5ECJE 3MRRA 3UYRL 3L3HA 1MHEA 5D7LD 4Z18A 5J1AA 4BKLB 2VLLA 4YHMH 3B9DA 5B21A 3VFTA 5LGHL 3NFPB 1LVEA 4APQD 3ZKXB 3V95A 2PF6A 4ODXB 2AW2A 5DJXB 1JZ6A 5JTWA 3TH3T 4N0FA 4K3DH 1BGXL 4CAGA 3B5GA 2ARJQ 3OKNA 4PJCF 1YPZB 4PB9L 1WZMA 4Y19A 3WKMH 3X17A 1G0YR 2SEBB 2VXQL 4P46C 3O3AA 3RP1A 1IT9H 2Q8AL 1EX0A 4FXKB 5GIRB 3V52H 1I7RA 4NSKA 3SOBH 1RUQL 1G0XA 2BNQA 3H2WA 1UYWL 3E1F1 2IMNA 2F53A 3MLZL 3EDEA 4FQJH 4ONGH 3CPLA 1KJ2H 3TA3A 5GQBA 3H42L 3OSKA 4BK4A 1PG7W 2EKSA 3AREA 3X12B 2KL6A 4GRLD 5SX5H 4DGIH 3REVA 1DUYB 4JY5L 4UIKH 5FM5M 5IQ9B 3G6AA 4RQQA 1AGDA 1RUPL 1HSAA 3VWKB 1F4WH 5KSVB 5I1EH 3NACH 1T20A 1KCLA 4X7SH 1YYLL 3QZWA 1QFHA 1M05A 3NCBB 1Z3GH 1EV2E 3H3KA 3NIDE 4ZOBA 5A16B 2WP3T 4UINL 3VXME 4DK6A 2H45A 4XVUC 5HI4C 5IKCB 1J0KA 3ILPB 3FB7A 5C9JB 5EU4B 4N0YH 1Q72L 5DJCB 1AXIB 5IFAH 2B4CH 1OF2A 5I73B 3CLEH 3M07A 5HHNB 2R69H 2X4NA 4WHDA 3BO8B 4MAUL 3VFSB 1NC2D 4D0DB 1BF2A 4KUCD 4U1KB 3S35L 3ZDZE 2WBKA 3QH3B 4MD4A 2GJ6B 2BCKB 1CFVL 1UWXK 4P5MB 5E5RB 1PBYA 5HJ3B 2F9BT 5DGRA 3SKOB 5SWZB 3C2AL 3F6LA 3LN4B 1CTOA 5DUBB 3FZUD 1CLYL 3HUJF 2FIKB 3K4DA 4DUWA 4XNYL 5CEZH 3S36H 2H32B 4ODWB 1QSFE 3TVMC 5IJVA 3QDJE 1ND0B 3SHSA 1RU9L 5J4MA 4N90E 1JFQL 3H9SB 3O3BA 1MRFL 3LKPA 4WFEE 1BIHA 4WI4A 3QHTC 4PRNB 3SDDC 5AZ2H 3MRJA 1FVCA 1J18A 1GGBL 1IGFH 3TN0C 3IU4H 3ZLQC 4HKBA 3AXLB 5IW1A 3VD5A 3GMRA 4XP5L 2F5AH 2VLKD 4FTVB 4KHXH 2XT1B 5LXGL 4MXWH 2AEPL 3UTPD 3X11B 3DHMA 3N50A 4S0SD 1ORQA 4PJ7B 2BC4A 3IXAB 2O93L 5EO1B 2DLFL 3MRDA 3CMOL 2A9MH 1AE6L 1HCFX 1MHPL 3ULVF 2APVA 3IFLL 4PP1D 2P5EB 4PBVC 5IWLC 3MRFB 1ZHBA 5HGBB 3UTQA 3TPKA 5CAYB 5F7FA 1YMMA 1QBLL 4ISVB 2P49B 4BZ2H 5F6HI 1MPAH 3TO4D 3VXUA 4HUXB 5ISZA 3O8XD 1IE5A 1FBIL 3IVKB 3CFJA 4YK4C 1XH3B 4HIIA 3ZTNH 5J89A 1KTRL 5KSUA 1DANT 2VH5H 1HH9A 1NL0L 5HI3D 1X5IA 2FEEI 2EYTA 3DJ9A 1NC4B 2OSLA 4IIQB 2YRPA 5E95B 1FYTA 4PBWD 1TVDA 5KZCD 2BNRD 3QDHA 5ADPH 4NC0B 4QCIA 1U8NB 4ZAKB 1F3JB 1A6AB 4YHPB 3BJLA 4MJ5B 3BGMA 1V05A 4FQ2L 4Y19E 3F7YA 3WFEL 3MLXL 4I18B 5EDXA 4XVJH 4PJFB 3MGAA 3MRNA 4Z95L 3AM8C 5IM7B 4Y5VC 3LZFL 1NAMB 4KK8C 4CKVX 2OYPA 3S88H 3TBYB 2BNQE 1QLFB 4Q74A 1R3IL 4WW2A 2IQ9H 3PHQA 2F53E 3NTCH 3U36A 2XN9B 4EUPA 5JPMA 1ROWA 1N8ZB 1EEQA 1KCRH 3MBEB 1JGEB 1F4XL 2ITCB 1RZ7H 4D0CA 4ZSOB 1YJDC 1T5XA 4JY6B 4ZDHB 1VFBB 4YBHA 3MNVB 3DGGB 4KRPB 5ILTL 1H5BA 2YPVH 4V1DA 4ZUVB 3K4ZA 1AGEA 4XC1L 1CXKA 4HUUB 4DFIA 5HVGB 4XCFH 1I1AA 3MACH 1I8MB 2GI7A 3LEXB 1QLRB 2UUDH 3FFCB 2VLRB 5F7EL 3MUGA 3QQNA 4TSCH 5I1DB 2HJLA 1A3RL 4U6HA 4JQIH 2BSSB 1P4BL 1R5VB 4Z7WA 4KKAC 1WVZA 5DDHB 5DJDA 4I3SL 2JIXA 3MXVH 3NAAL 5TJWK 3LIZH 1UGNA 5C8JB 2CDGB 2R0LH 3AY4C 2X05A 5CBEB 2EE6A 1A9BA 5TE4H 2XPGB 1A7PH 3T0EA 5JQ6H 1Q0YL 2Z91A 4JG0H 1R3JA 3FTGB 4X9FA 5FK9A 2VDQL 1FFNB 4RNRB 1IGIL 5D72L 3TH2T 5EWIL 5FDWA 3ARBD 3ILQC 4QRSA 3MRCB 1W0VB 3BP6A 3RPIB 3VXTA 3U7YH 1EGJH 1BFOA 1C7TA 1JPST 5J06A 3RIAK 4HC1A 3U9PL 1R3LA 4GBXA 3K8LA 1M6OB 5D70L 1XCTB 1U9KA 1OTSD 3KAAA 4HH9A 4IDJH 4U6TA 1G9EA 1YDPA 2BY0A 2DI8A 5I74C 5JO5B 1EJ6A 4NNXB 1S9VA 2ZPKL 1QEWA 5C7XL 2ZP0T 3G08B 4WWKD 1ZAGA 3MV8A 1JTTA 4ZQKA 1B4JH 3BVNB 3HA0A 3QCUL 4QOKA 3P4MA 3LCYA 3KPOB 4MB3A 4YJZL 1IM3A 4L8CB 5H2BB 2X9YA 2XG4A 2ENSA 3EJJX 3HPJB 4TRPH 1P7KB 1A2YA 4KI5F 4G8EB 1S7RA 1KB5L 1KB5B 3BQUB 1S3KL 3PWNB 4FS0A 1ZT7B 3BKML 1S5HA 3M1BA 1Y18B 2R56H 1D7FA 4U31A 2DLIA 2GTZA 3S9DB 4JFHD 4PRDB 4O58L 2HT4D 4DCQA 1T1YB 3B5HA 3C87A 4JG1L 4RX4A 5EIIA 1KPVA 5A3ID 4G9DA 1YMME 2AI0L 4K7PX 4P2RA 2FWOB 3HB3C 4Y4FB 5F7HA 1FRGH 5TQ2L 4E41A 2APTA 2F74B 3QZWG 5T1LA 2BX5A 3VXUE 2AABL 5ISZE 1B9ZA 2R4RH 3LKSA 5K33A 4E0RA 5L0QB 4OZGB 3TBSB 5TH2A 3CDFA 1U91A 1KCKA 1TCRA 4QTIH 4MNHA 5HHVL 5J8OA 1T04A 1C16B 3MLVH 2DWDB 2P8PB 4RGMC 1U2CA 4Z7UF 2EICA 5F70A 2B20A 4RZCA 2Z31D 1MCEA 3BKCH 4JPWH 5I2IB 1ZT1A 3H3BC 2R2HA 3BGFC 5ICZA 3VXMB 2DWEA 4QHLA 2OQJB 2P8MB 3RFZC 3NIDF 1BJMA 4P9HL 5E9DB 1F13A 2DQTL 4TNVF 3HG1A 3UJJH 5FYKE 2IFFL 3EO9H 5BVPL 2YRLA 3GO1H 1S9YB 5JOFA 6FABL 3SE4C 3BKJH 2M1KA 4OGAC 1GGYA 1SBSH 4U6VL 4X5WB 4BUHA 3OXRA 1DN0B 4MJ6B 4KKLD 1JPTL 2VITA 4WV1A 2D31A 2NY5L 4NN6B 3OAZK 3OR6B 4UILL 3W9EB 2AQ2A 3GMNA 4Q58C 1WIPA 1CFTB 3VXPA 4QF1A 2WINA 1T89C 2ZNXA 1OSZB 5AAMA 1ZA6B 1QA9B 2DOCA 4R90L 4V1DE 4HUVB 3CZJA 3QNZB 4OI7A 3HFML 3IFNH 4K3GA 5FUCE 2NPLX 1BAFL 4YDLB 3VXNB 3QDMD 1BBDL 4R7NB 3V0WL 1MCFA 5J0BA 1IKNA 5KVEH 1XR8A 1E4XH 5J12B 4ORGB 2W0PA 2GJZB 3MLSH 5B3NA 1HDMA 1OW0C 3O2DA 3ARGC 3UYRH 3T4YB 3DRTB 4PV8A 4Z7WE 3PXHA 2AJ3B 3JV0A 1UCBL 3MFFB 1CT8A 5LGHH 5INDA 4U1NB 5MI0C 4NKMB 2CKNA 5IW6B 3SN6N 2YSSB 1XIWB 1M71A 4P48A 3T0EE 5IHZA 3EYOB 3MYJB 4PB9H 4X6BB 5C86A 2F8OA 2QL1A 3BN9C 2EE3A 3TPUB 1P5UA 3MJ9A 1LEIA 4HV8B 2MCPL 1J8HA 2BFVL 3X14B 4ELKB 43CAA 3LB6C 5MERA 4L5FL 1ES0B 4MJ2A 4DN3L 1UYWH 1JV5B 2NZ9D 4OF7A 1CQKA 4R2GC 3MLZH 3CFKA 1JTPA 2K1MA 5HHXL 4PJAB 5GZND 5AG8A 1ZLWK 1AC0A 5L2JA 5DJAA 4P4KC 1ZGLP 3BPLB 1YY9D 3RVUC 2VLJB 3KJ6L 5EO9B 3P4OB 4JY5H 2Z92B 1R24A 1WZLA 4XXCA 4H26B 4X5XB 3WJJA 3MV8E 2V2XB 3MRRB 1MHEB 4Q9BA 3U46A 4D8PA 4QOKE 4IHOB 2COQA 4WVRA 2VLLB 3V4PL 3VFTB 4F7MA 4FFVD 1MCSA 5DFWH 1BVKA 1T1ZB 4EI5D 3T65B 2NXYB 5IG7A 4PJXA 3RL2B 1I9RL 2H3NA 4FABL 1T21A 4EUPG 2FYYB 3G04B 3T3MF 4ZMAT 4K94L 1TCMA 3SDCB 1F2XK 1NFDF 4EDWL 2YUXA 35C8L 2AK4D 1OGAB 3SY0B 1BZQK 4LHUD 3GHEH 1AP2A 2Z0BA 4HMEA 1CD1B 4KJQD 3P30L 4I4WA 5HHME 1I7RB 4NSKB 4Y4KB 3JTTA 5JDSA 3WNNA 1FFQA 4P2RE 2GFBB 3O6FA 1CFVH 4E41E 4NQDA 4RRPA 3IJYA 5FYJH 3MR9A 3TA3B 5C0BB 2IGFH 3C2AH 2BMKB 4DN4H 2B39A 4J8RA 3H0TA 3K81A 3G6AB 4RQQB 1AGDB 1MCWM 5EOCL 4LVHB 1MLBA 5JW3L 4Z0BH 4M1CC 1C5DB 2NY0C 5H37H 4OLZL 5BRZB 1VESA 1EZVY 5IMMA 1H8NA 4WHYG 3PWPD 4POYA 4POZC 2NW3A 4J3UA 3QZWB 1M05B 3EZJB 5F9WC 4N8CL 5KTEL 4HIJA 2Z93A 1TTUA 2V2WA 3L7FB 1PYWA 4JRYD 5JHDB 5I19L 2LABA 1LE9B 4G6JH 4WUKL 4ZNCD 1GGBH 3STZA 1T83C 2JELL 5D7LB 5HY9B 3HG1E 1DSFH 3MRLA 1CE6B 5LXGH 4AQ1B 4LVEA 1Z0NA 2NY6C 2X4NB 4JFQA 4TVPE 5B8CC 5EU5B 2DMBA 5DJ8A 4MD4B 3HNVL 3L1OL 3BAEL 4G9FD 5DO2D 2DLFH 2OMNA 3T0DA 1AE6H 4P0DA 1MHPH 5DURD 2AJXH 4OCLC 4XAWL 1HH6B 1QSED 3IFLH 4X8JB 4PRBB 4LVOB 1T1WA 3ZKXC 3TYGL 1ULVA 3ZSSA 3W9DA 3MZTA 4BZYA 4R9HA 2GAZA 1KELH 2W07A 3MJ8A 3PABA 3VW3H 1WEJL 4GKZB 1XF1A 4GLRH 4G8GA 5DJYA 1KC5L 1QBLH 4JM4L 5DT1L 1EHNA 3O3BB 1NMAL 3W5MA 1IGJB 4OUOA 1YN6B 4XNUL 1BLNB 4QRUA 1X44A 1FBIH 4GRLB 5F9JB 2KQNA 1EFXA 3P9MB 3DV4A 3VFOB 4LSPL 3VWJA 4ONHB 4NJAL 4HKBB 3MRPB 1LO2L 1NL0H 3H7BA 4M5YL 1KXTB 3SO3B 2G75B 1ZGLA 8FABB 3NZ8B 4JFOA 4QLRA 4LLUA 1IZKA 2BC4B 1OP5H 3FT4A 2D7MA 4YHKL 4FQ2H 3L95A 3K7UA 3VWKC 1FV1A 4Z95H 4PJGF 2CR6A 2VRAA 3PDDA 3LZFH 1J8HE 3NN8B 3ZKMC 5TDPB 3RGVA 4JE4B 3I50H 4GRWF 1NC2B 1R3IH 2IFGA 2QSCH 4LMQE 5FO8A 1H3WM 1IEAA 3B9KA 4HHAA 3T4AA 3F65A 1KCSL 3I84A 3FQXB 5DMKA 3PWJA 3TJHC 5FV1L 4NRYA 4L3CA 3IDNB 5CFHA 3CFJB 2Q6WA 5I73C 3N1GC 4UTAL 5ICXB 1RK0B 5ILTH 2CDFB 4JM2D 1XR9A 3LPFA 3WNMA 1Q9OA 3ZT6A 2D7TL 1FYTB 1GGCL 3GMMB 1OHQA 5GRUL 5HPOA 3E0GA 4PJXE 5TF0A 3MBXL 4DKDC 4G42B 1A0QL 2GYSA 3BGMB 3F7YB 2BY2A 1FORH 5FYKL 1HI6B 1P4BH 4Z8FH 5LG1A 1RZIA 2VLKB 3J8F7 3NAAH 4HIHA 3RZCB 4FHBD 2CLVA 2DQEL 3ZO0A 4WW2B 1QFOA 3PHQB 4I0PA 1LK2A 1NGYA 3B5TA 4YPGA 4EUPB 4NQDE 1Q0YH 1EJOH 2P24A 2BVYA 2VDQH 2ZUXA 5TF1L 1F6FB 4D0CB 1IGIH 5D72H 2FEDC 1MAJA 4DK3A 4PD4K 4PJ5D 2V9QA 5F7MC 1Q0XL 3GMQA 4PGDB 1H5BB 1GH7A 3BWAA 1NMCB 1AGEB 4K8RL 3VA6A 2VO5A 4WFFE 3FONB 4ODHL 2ZUVA 3TO4B 1L7TL 4OFDA 5D70H 4KZDL 4IOSD 3SCMA 4LVNB 1TETL 3MUGB 4M8QB 4CW1B 2ZPKH 4OGYH 4Z76A 5C09D 4U6HB 2JCCB 3KPQA 1L0QA 1LO4L 4M7KH 5EPMA 3QCUH 3QRGH 1C8PA 5KZCB 3S34L 4MB5A 4AM0A 1UA6H 2P8LB 4QY8B 1A9BB 2J4WL 4JJHA 1T1XA 3O6KL 4WWID 2ZG3A 3OZ9H 4F3FA 2VN7A 1MCIA 4UBDD 3DWTA 3NCYP 1I1FA 4Q9CA 2X4OB 2WZPD 4QRSB 4KKCD 4KK6D 4ZAKC 4JG1H 2A2QT 4G8GE 1BFOB 2AI0H 1D6VH 4HC1L 3ROOA 2FLRT 1UXSB 5TQ2H 4D94A 3O41A 4I18C 4NOFA 1CYGA 4GBXB 5I75B 4OZFG 2AABH 1AKJD 1EEUA 4HH9B 1PDKA 3TBVB 3NCJL 2ZSVB 5BW7A 4YO0A 1A4KB 1S9VB 5KVFL 1QEWB 2VE6A 5AEAA 5HHVH 3HZVA 3CD4A 1ZWIA 5DFVC 5DVNA 4Y4HA 1MCQA 3EYQC 2A6JB 1KTDA 5I16A 5EZJA 1BIIB 3SDXF 3GMLA 4JHAH 3MBEC 2UZYB 5BXFA 1YYML 4D9LL 4JDZA 3B83A 4OV5A 1A2YB 1F97A 4XNQA 3VFUB 2PCPA 3DLQR 4S1RL 2A6KA 4YHLL 2XXCB 4RRPG 3THMH 4KRPC 1QHPA 1IAIL 2DKUA 3MRBA 1O5DT 4MXVE 1VHPA 4G7YH 3V5HA 3M1BB 5C0IA 2IFFH 2GTZB 1Z9SA 5BVPH 1RZKL 4G8FA 3D48R 3HC0B 2B2XL 3ZE2F 4HX1A 6FABH 4DCQB 4OUUA 2NY4D 1HYSC 1G7QA 2F5BH 4MQ7B 2E6JA 4G9DB 1JPTH 3LQAL 2CUIA 5AWNH 1IAII 1UQSA 5CD3B 5T1LB 4ONFH 3BKYH 4NDMA 3TP4A 4E0RB 3ARZA 1DQML 4OD2A 3K0WA 2CDEA 2Q8BL 1MCPH 4HCRA 3ARBB 1WSST 4MNHB 4R90H 2MFNA 3M45A 4J2XA 5BVJA 1MUJA 3UYPA 3ULUD 3RWIB 1ZT1B 4TSBL 3RKPA 3V0WH 2ZG1A 5JDJA 4OF5A 3Q3GB 4YR6B 2Q86B 3EO0A 4Y2DA 4BZ1L 1T4KA 4R4BA 4LHUG 1FNEA 4L8SB 4S10A 2WWKO 2R23A 3FRUA 1X3DA 2QTEA 3RKDD 3MFGB 4Y1AA 5JOFB 4TVPL 4HK3J 3DO3A 3UPAA 3DOSA 1S78D 4MVBD 3L5XL 1AQDA 3TBTA 5GGRA 1EAJA 4LGPB 2VITB 1IRAY 4JR9L 2D31B 5J6HA 4XX1G 2GEEA 3QI9D 4LOUC 1J10A 4BQ9A 5F1IB 4UV7H 2MCPH 2FD6H 5D6CA 5DQDH 3VXPB 2WINB 4L5FH 3RJDA 4EIGB 4DN3H 1WC7B 1ITBB 4JPKL 3B9VA 1KOAA 3BQUC 1R5WB 5HHXH 3QJFB 4QHNB 2P46B 4DFHA 1G7LA 3KPPA 2OS7A 1XF4B 3GMPB 2KPNA 2NY2D 4OLYL 5C0AD 3KJ6H 4IS6B 1JPSH 3O2DL 4OQTL 4PRHD 4ERSL 1H3VA 4J3VA 4HKJA 1CICD 5D4QA 5FO7A 4Y4FC 4PV8B 1CE1L 1CFBA 2VN4A 5EUOA 3V4PH 2EH7H 5INDB 3HS0A 2Z31B 3BD5A 3VRLF 5JUEL 5F1SA 5L0QC 4S1QL 1A4JB 5IHUH 2XFXA 1K8IA 5JW4Q 3DX8A 5DD5L 2AEIT 3SGEI 4WJ5B 5IHZB 1DDHA 2NNAB 4YIQA 4EDWH 3VFRA 35C8H 3MJ9L 3NCMA 1T66D 1DEDA 3QUMB 2OLDA 2OM5A 4N1HB 3OL2A 1J8HB 3RTQD 5IV2A 3QRFM 5MERB 4JRWA 4S2SB 1F11B 4JZNB 2GUOA 4CVXB 4FXGA 1RQ5A 2UYLA 2P5WA 1A6ZA 2DQCL 3CFKB 2EXYD 5JHLH 5GGSB 4P9HC 5L2JB 4UIMA 3OWEA 3P4NA 5DJAB 1AY1L 1J88A 3D25A 2X09A 5HGHA 3GK8H 3EYSL 4LSSH 4HF5H 4OFYD 3WFHA 3VRJA 1QBML 3GBLA 2LU3A 4LCWB 3DTXA 1CK0L 4LMQI 3BI9X 3MOAL 4LU5L 4LHQB 5JW3H 5EULV 4RAHA 5FCSH 1HINL 1I4FB 4ZS6C 4NN6C 4U3CA 3D87B 4ZYKB 4X6DA 1DLHA 2NY5C 4KQ3L 3CK0H 4OZFB 4N8CH 4O02H 4UB0L 5KTEH 4PJXB 4Q7DA 3BH9B 1RZFH 3DV6A 5D7KD 5TDOB 5I19H 2HLFD 4PG9A 1OTTD 2G9HA 4WUKH 3LEVL 2C5DC 2YD1A 4KRMB 5C3LD 2MPAL 1ZA3B 4K7PH 4PJIA 4Z7QF 4HZAA 1AP2B 3WXWL 1ZT4A 1NJ9B 3JWNC 4S1SL 3DMMD 3U83A 4LLWA 2OI9B 4YDLC 2BZDA 3N1PC 3QP3A 5IB4B 3KGRA 5DMGD 3JTTB 2Z4QA 4WU5A 4YH6A 1U8LA 3BH8A 4BFIB 5JDSB 1G6RB 5J12C 2Y23A 4P3DA 4OCSL 3HNVH 3L1OH 1T80A 4OCYH 1NFKA 4XAWH 2ZG2A 5EU3A 3X13A 4F7TA 1S7XA 3EYUL 5GRJL 1GPOH 1X4XA 4J8RB 1PGRB 2IPUK 3TYGH 4Z9KB 4XI5D 1D5MA 3NZHL 4HXAH 1XIWC 1WEJH 4TNWK 5FYKU 5BJTA 4JM4H 3Q5OA 2NW3B 4NC1E 2FBJL 4HULB 3EZ8A 5LGJA 2Z93B 4XNUH 1SJVA 2E9BA 1A7BA 2V2WB 1AXSB 1P6FA 3GIVB 4UZGA 5DUML 5F93C 4IRSA 3STZB 1NGPL 4UOW0 1LO2H 1B6DA 3BHBB 3RU8L 3RY6C 4FQQA 4TPRH 4LASL 4JFQB 4EI5B 3BPLC 3KWWA 2E8ZA 5CCKL 4MZ2A 5CJQL 2VB5A 5DVLA 3SGJC 4F9PA 5GS2D 1NDGA 1RUML 1FIGL 5E5MA 1LP9B 4LHUB 1FNAA 4XRCB 4H5SB 4C83B 2NXYC 1L9MA 2OR8A 3ARYA 2XXMB 1HHHA 5E2VL 1F90L 1UZ8A 3VXQA 5FA3B 4G8GB 2XTLA 5DZNA 3SDCC 4OF8A 7FABL 4K94C 1RIHH 4MA3A 3CUPA 1KCSH 1XZ0A 3QO0A 5AUMA 3RVVC 3QCVL 1S7UB 4QRUB 1X5JA 3DX9A 5JW5B 25C8H 1EFXB 4H0GA 5F97E 3BUYB 2BVOA 3A67L 3DV4B 3EGSA 3EIFA 3MRIB 5E03A 4Y4KC 1MIML 4UTAH 1T2QH 1NGWA 3U4EB 4B5EA 1VEOA 5EUOE 1OWRM 2D7TH 4X6CA 3PWPB 3TA3C 5KSAA 1GGCH 3P0VL 2KBGA 4MNGB 2DL9A 5GRUH 1TNMA 2YBRB 3BRDA 4YHIA 3MBXH 1BWMA 3RHWF 1EXUA 3DROA 4JRYB 1A0QH 2E5EA 1Q38A 2YD8A 2FX9L 3MRHB 4LVHC 3L95B 4HKZB 2Z8VC 4XXDB 5FYKH 5F7DA 4N8VG 1N6VA 5CEYB 2X41A 3VG9B 1Q9WA 1Y0LB 2YPLA 3RGVB 1NLBL 2DQEH 3GSWB 4CADA 4EUPH 2JLLA 2P5WE 3QEHA 1MI5B 1F02I 4LAQL 3B9KB 2R2EA 1IZJA 2HJKA 4R4ND 5IEHA 1CGTA 2XYCA 5DURB 1RFDL 2DN7A 3L6FB 4UNUA 5TF1H 4NRYB 3ARDD 2Q6WB 3MA7A 3QQ9D 1VFAB 3SKMB 3WIFA 5CSZB 1UM6L 1HHGB 2GK0B 1XR9B 4OCNC 5FHBH 3QUYD 3U1SL 3UBXB 5FO9A 1FSKB 3BP4A 5JR1L 5EC2B 3G5VB 1NGZB 4X6DE 4ODHH 1LO0L 3QAZB 3TV3L 5I1HL 3CDCA 4KZDH 4LVOC 1TETH 2FL5A 3HC4H 2JJSA 4PJ7F 5JOEA 2ADIB 4N68A 2YPKA 2QSQA 4M61A 2EIDA 4PJIE 5GGQL 1LO4H 4HH8A 4OM0L 1WT5A 4WHYH 1KCVL 4S1DD 3IAGC 1AD9B 1RZIB 3O0RL 2AXJA 3S34H 3UTSD 4HUMB 5DR5L 5A40E 3KYAA 4GRLC 1T0PB 2APWA 4LSQL 1VKXA 1G7IA 1LK2B 3O4LA 2J5LB 1U93B 5D71L 2IANA 2V5RA 3O6KH 2DJSA 2P24B 5CMAA 5F8QC 4C54A 1UB5A 4NKQB 1UJTA 4DWHA 2HVJB 5EOQL 4AK1A 3SO3C 3DX6A 5C0CA 4KHTH 4Q2ZB 3GMQB 4DTGL 4JFDA 5FA4A 1UB6B 1MJ7H 4HC1H 1AGBA 5EORL 3O6ML 4X9BA 4UT6L 4UDUA 1BQUA 2UWEA 3MC0A 3EW3B 2Y72A 3BDYL 1M1SA 3NCJH 3QWOB 1UWXH 3TIEA 3PGDA 2AV7B 1CDBA 1LK3H 4G43B 5KVFH 5CJ8A 4PJFF 4JM2B 1KN4L 5DS8A 5EBWA 1YEJH 1JL8A 3D3VA 5BZWA 1RK1A 2AQ1A 1FN4B 1WZKA 4M7LT 4HJGB 1YYMH 5CZXC 4D9LH 3CLFH 3FZUC 5EO0B 3QIUA 3RY5A 3SE3A 2BOBA 2FJGB 3VJ6A 5GRVK 1H3PH 1IAIH 3UC0L 3IAPA 5F6HJ 2HN7B 3ZT7A 5BO1L 4MQXD 1HXMA 3K46A 3KR3L 1I1FB 1I7ZA 2IALB 1WWWX 1Z5LA 1RZKH 3OF6D 2HFTA 1K8DB 5LWYL 2D2OA 3ET9F 4C4KT 1EZVX 3LQAH 3ROOB 1I9JH 1ZHKA 1F6LL 2E7LA 1K4DA 3O41B 4UQ2A 4XTRD 4WFHE 5C0JA 4NIKB 4FFZL 1GGIH 2A73A 1JNLL 3QIWD 1X9QA 3RL1B 1I3GL 4NCC2 3RZCC 3RWCB 2VE6B 2FX7L 3HZVB 4P4RA 4WW2C 4JLRA 4Y4HB 1E4WL 3LSOA 4XBPB 4HG4K 1KTDB 2WLZA 1CVRA 5CGYD 5ESAA 2IC2A 3FQTA 4JB9H 4HKXB 4NO2B 3TBWA 2AVGA 4Q6YA 3BSZH 2FDBP 1G1YA 2F54A 4MWFB 4X6CE 3QPQD 3WN5A 1N7ML 2Y06L 3PDOA 4HS6B 4PP1C 2NY1D 4H1LA 1B0RA 3LV3B 3ZSTA 3GSOA 4PGZA 4DKFH 3IF1A 2FJFA 3DO7A 1AC6A 2XTJD 2IEPA 5IP4A 1AI1L 1NFIA 2DQDL 3E6FA 1NMCC 3D18A 4L3ED 3PWVA 1JWUB 4GKSA 2E9IA 1IGYA 4K8RC 4GSDL 4X9IA 1VDGA 5ALCL 3VFVA 3TO4C 1GZQA 4G8FB 4AH2A 3NCEB 4R0LA 2GTWA 3O8XC 2YPLE 3GI8H 1FO0A 2J8UA 4LVNC 3BPOB 1T5WB 3L5XH 4JDTH 4XAKE 3V0VB 1WFUA 2QHRL 3BD4A 4JR9H 5IROA 4LP5A 2W0KA 3ECBB 3P77B 5HI3C 2EIBA 3RUGA 4YAQB 4EJ1C 3E2HB 1TENA 4LPUA 1KIPA 4HCRL 4N8VB 4DGYL 3LOWA 2NW2A 2CDEB 3AC0A 4HQQL 5FOJA 5C0EB 2A74A 2V7HA 2X4SA 4H88L 2OBGA 3DETD 3EYVA 2YZ1A 4LCCA 4YDIL 1TNNA 2HVKB 4YZFE 2VZVA 5BVJB 1MUJB 2HFEA 3ZDYF 1AKJB 4C59B 1UZ6E 3RVXD 1JYWA 1PVHA 2GSGB 1EBPA 5AYUL 3R06A 3EO0B 3SGEH 2C3VA 3D6GA 1RPQA 3QJHA 2DM2A 4PRAA 4PB0L 5E6ID 5D96B 2R23B 3FRUB 4DKAA 3RZWA 4GBXC 4ZFOA 5I75C 5T1MA 4CVWA 4NQSA 4Y1AB 1A7NL 5SWQB 5JUEH 2EDNA 2W92A 4S1QH 1AGCB 1AQDB 3TBTB 5GGRB 4EDXA 4J4PA 2GITA 3OMZA 5DD5H 4JRXD 3F62A 1ZHLA 2C1OB 2IANE 4BSVA 4ZFZB 3LQZA 4W6XB 2JJVA 4RWYL 3M8OL 4YEEA 4OZGF 5I8EB 3KPLB 5T1KA 5D6CB 4JHBA 5C0CE 1LEKB 3E3QE 4ALAH 2NY4B 4HWBL 4ZD3L 4JFDE 5L88L 1WBZA 2DQIL 5E1HB 4F57L 2FGWL 2UWEE 3DBXB 1G7LB 1CI5A 4WWKA 4YHOH 4U6XA 1FG2A 1AY1H 3JUZA 5LBSL 3ALWA 4OFPA 5D6DA 2LTQB 5D7SL 1CK0H 3C5SB 3MOAH 1PZ5A 5GS1B 3P9LA 1CDIA 3D3VE 4QTHA 1HINH 4DJMA 3JV5A 4EN3D 1CBVL 4KQ3H 1KCUL 5J9PA 3HS0B 3QQ4B 5CWSA 1N3NA 3HAEA 4UB0H 5D1XD 3BX7C 3ARBC 3S97C 3VA2C 1RV6X 3C6LA 4Y8DC 4AEHL 5GPRA 2YUWA 3PJSA 2MPAH 4M7LL 1UACH 3NMEA 3WXWH 1DQJA 3QXTA 5IV2B 5K9QI 1CGXA 1OTSC 2UZIH 2I9TA 1FZJA 5EC1A 2GUOB 4NO3A 1QVOB 2CLRA 1PFCA 1CDYA 5C71A 2EECA 4FXGB 5BOPA 5F1NA 1T22B 4OCSH 1CG9A 3QFJA 4L8SC 4IRZH 5JXEA 1EHLH 5JW4R 3P4NB 2VXUL 1DBKL 2XWTA 3LEYH 4JAMA 3RWJB 2A83B 1JI1A 3EKCA 4HUWB 4JO1H 4PY7A 4EI6B 2D4FA 3HZYA 1JMXA 2F54E 3WDHA 1REIA 4X98B 1KPRA 4YFEA 1FP5A 2NY2B 5EBGA 5C0AB 3U6RB 2HT4C 2CRIA 4NKOA 5E70A 4PRHB 5DUMH 3V6FA 3ZYJA 5L2KD 5A3IC 1CICB 1G7HB 1M7IB 1NGPH 1QG3A 1NCWL 1LDSA 3RU8H 1AIFA 3CFDA 5IBUG 4LLWB 3QA3A 2DMCA 2J8UE 1IKNC 3IJHA 3BH8B 3D0LB 5CCKH 2HWZL 5CJQH 1SJHB 3FHAA 5EFIA 4PJAF 4I48B 5HBBA 2D0GA 5CUSL 1RVFL 4WUUA 4HLZG 3D9AH 3RUGE 3KYKH 4J3WA 3RTQB 3TJEH 2Z31C 5I15L 4TQEL 1IJ9A 3N85L 5F1OB 1D5MB 4J23A 5E2VH 4JREB 4HPOL 4FQXA 2LU7A 5CLTA 4XVUD 1RJYA 1WFOA 5HDBE 4OTXL 4AMKL 3IKCB 4XNXL 3TCXA 3CXDL 4PG2A 4RISH 1DVFD 3CFEA 4HK0A 3SE9H 3VD4A 3PHOB 3A67H 4GKNA 3HR5A 3OAZH 2X4QB 2D03H 4KKLC 4OBSA 3KPNA 2XQYG 4YFDB 4FQQB 5ANMA 4QNPF 2W1NA 4GG6A 2ID5A 3KWWB 4YXHL 4GUPA 4F7PA 1L7IH 3HI5L 3U0WH 2I07B 2C3HA 3SQOL 3WJJC 2NMSA 2FX9H 5E5MB 3ARTA 1EUUA 3SQBA 3V6ZB 3G6JA 1G7PB 2N1KA 1UADC 3RVWD 3DMMB 1ZLVK 1YEEL 3S3PA 4M6NH 2A6IB 1HHHB 3FAXA 5I1JH 4HGWB 4WTZA 4ZUWB 2V5YA 1WUNT 1ED3A 2CIKA 3KPSA 1N5YL 4LAQH 1A6PA 1VCAA 4MA3B 3AU1A 1NBQA 1HSBA 4AL8H 1XZ0B 2FHCA 4MAYD 4PY8I 5E94A 3QO0B 3ZTJG 3R0MA 4XT1C 2OI9C 1I3RB 2EDRA 3EGSB 2ADGA 1LQSR 4Q6IB 3FOMA 2APXA 3CFCL 3FT3A 1RIUH 3KPTA 1UM6H 1NGWB 1PLGL 1MHHB 3U1SH 4HSQA 4IOIB 5JR1H 1NCBL 4X6CB 4PV9A 1LO0H 3TV3H 2CO6B 2JB6A 2AK4A 1NSNL 5I1LA 3D2UA 5F44A 4BQ6A 3CH1A 4BH8B 3BZFB 1ZLWH 2YC1A 5EBLA 3OG6B 1XGUA 4JJ5A 4LL9A 3D85D 1U3JA 3S3JA 1BZ9A 5GGQH 3ARSA 4HXBH 5F7DB 4I1NB 1GAFH 5A1AA 1KCVH 3SDYH 5FYLL 5GZNC 4JFFA 1A1MA 4KAQH 1DFBH 5DHVB 4YWGL 5DR5H 1A8JH 1YY9C 3F6IA 4LSQH 3EOYG 5C0FA 4K23L 4G6MH 5D71H 1KJVA 2R2EB 3QFJE 5LKNA 1DBAL 5IJKC 4ZPTA 5DJZA 4EQ3A 3QQ3B 3TLRA 1R3KB 2IMMA 1J0YA 1GGUA 1U8OA 4YXLL 1CR9L 2X1PA 5CINH 5EOQH 4NFCA 1UFUA 3WIFB 5D7JD 4EI5C 2ZOKB 1MHCA 3MMEA 5CZKA 2G5BA 3FB6A 2QQKL 1S7WA 3I6LD 5CIPA 1FVDB 4Y0GA 4DTGH 4E5XA 4F58L 4L29A 2ZJSL 1HILB 2CPCA 5FO9B 5EORH 4OAWA 4UT6H 3QG7H 3RVTC 4WY7L 2YD6A 2BSED 4KK8D 4KJQC 1P53A 2DBLL 4OQ1A 3AVEA 1CD8A 1D6EB 3P3YA 1KN4H 3J7HA 3V6OC 43C9B 1L9NA 4P2OD 4HBCL 2FJHB 1Q9LB 5B39G 2DDQL 1P7HL 3R0NA 2OJEB 1MJJB 1A9EA 4KUCF 5TDNA 4TUJB 1U8IB 3O4LB 1XCQB 2IANB 3RWHA 4WUUE 3UC0H 3N9GH 3I6GB 4WEUD 7CGTA 1OOAA 4QHUB 1J0JA 1KEML 3ZKQD 3OBAA 4LLAA 1A14H 1MCOL 5LQBL 1MFAH 5FA4B 1D9KD 3DVFA 4X0KA 3ARUA 4L4TB 1HYRC 1F5WA 4KKAD 5IVOA 3KYNB 4FFZH 5D93C 4LDOB 1JNLH 2G2RA 1N64H 1KJ2A 3ARDB 3VG9C 4B41A 3PGDB 2ESVA 3RGVC 2LFGA 5DRNB 4XCNB 1E4WH 4Y88A 3QUYB 3B9KC 5ANME 4GMSL 5FF6A 1A6WL 3SKNA 1N7MH 2Y06H 3FO0H 4GG6E 1FZMB 2ATPB 4KDTA 4JO4L 3T3PE 4DGVL 3QIUB 1TJHH 5D2NB 1JPFA 3RA7H 4IRJD 4M1GH 4PRID 1AI1H 4GO6B 4XHJD 3G6JE 1FSKC 4AENA 5L8JB 1CDJA 4UV4H 4E42B 4PR5A 3QAZC 3FB8A 5GGVY 3UTSB 3BFOA 4X4XA 1F4YL 5I0DA 1MQKH 1KFAH 5DHYB 2EC9U 2QHRH 1NCCL 1DL7L 2VMFA 3HE6A 1JMZA 4JO2L 2A73B 1ZV5A 2ARJB 3QFDA 4DGYH 1RZGB 5I1IL 1LE5B 1P2CA 4DQOL 2JCCF 4HQQH