1X5KA

The solution structure of the sixth fibronectin type iii domain of human neogenin
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
124
structure length
124
Chain Sequence
GSSGSSGTAHGTTFELVPTSPPKDVTVVSKEGKPKTIIVNWQPPSEANGKITGYIIYYSTDVNAEIHDWVIEPVVGNRLTHQIQELTLDTPYYFKIQARNSKGMGPMSEAVQFRTPKASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Neogenin
publication title The solution structure of the sixth fibronectin type III domain of human Neogenin
rcsb
source organism Homo sapiens
total genus 8
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2005-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1x5kA01
2CSPA 3DVGB 5FIEA 3PGFH 4M9PA 1UXSA 3UO1L 3MUHL 4U7KA 3FOLB 4D0CB 4BM7A 4LF3A 2BC4A 4XP4L 4LASH 3CAFA 1MAKA 3BPCB 3HKFA 2ZOLA 2KZWA 3ARZA 3K2UH 5J1AA 4JDZA 1JTTA 3GSRA 4NKQB 5ERWA 3RZCA 3ARYA 4KROB 2XKNA 3G5ZB 3MO1B 2QTEA 4RGNE 3BP6B 5D1ZA 3MV7D 2A6IB 4OFYD 4C58B 5TPWH 1TPXC 5F44A 4UNVA 3RIAK 4OF3A 4LHUG 4I4WA 5A2KH 1T0MB 3I6LE 2OXGA 5IBUG 3BN9C 4UTBL 5CBEB 2ZUWA 2XN9D 4QXGL 5DQJB 5IVXB 5LKNA 1ZVHA 3KYAA 1DQLL 1NLDL 3I75A 4PUBH 5IJKA 4GRLC 2VYRE 4NO0D 3GEWB 4DUXA 1MEXH 3MFGB 5KN5A 1SMAA 1XF3A 5CEZH 1TMCB 3L3KB 4NKMB 1WT5C 5HHOE 1JNNL 4YDJA 4N5EC 3WKNA 4KRMB 1A6AA 3BE1L 3HNTH 3ZKND 4PGJA 2R0LL 4MCZB 4XPGL 5C09B 3V4PL 1CE6A 1KCRH 4XHJC 1S9VA 2DAVA 4WEMB 1M05A 3G9VA 3ULSA 1HSBB 3HC4L 1E4XL 3TH3T 2EZ0D 4U1JA 5SWSE 3U4EB 1J0HA 4UBDD 2UWEB 3LMJH 3TPUB 1LO0H 3CDFA 1ERNA 4G8EA 3ESUF 4NN7B 2NY4B 5KOMC 4MAYA 4GFTB 1B0RA 4OV5B 4K9EC 4JJ5B 2IADB 1JPTH 3GSNL 2WK2A 5FYLH 1MCLA 5HYIA 4JHAH 1I1CA 3CLEH 3GHBL 3IS0X 1CVSC 4F58H 3ARFB 1U8QB 1E6JH 3LKPA 2HVJB 1XGQA 2YN5A 3QRGL 3U83A 1ORQA 1ZE3C 5T3ZL 1CFNB 5KSUB 1J8HD 4IDLA 5C08B 1EGJH 3C2AL 3OMZA 4DK3A 4OTXH 4QNPF 1DEEA 3ABZA 4X9IA 4Y4KA 4M48H 5D7IB 4ZUTA 1UEYA 1FSKC 2QJDA 2DKUA 4DW2H 5HI5D 3DX7B 4YIQB 1E4XI 4ZAKD 3GSNA 1S7VA 3IJSB 1N6VA 1G0XA 3VFGH 4HUKB 2ADFH 3BT2H 2JELH 1BX2B 3MV9D 3NACL 4Z77A 1CT8A 1K2DA 2C4FU 3JBG7 1EERB 4JO1L 1A6UH 5EZLB 2VH5H 3OJ2C 1IGIL 3VU2A 4PTTB 3OX8A 5MEQB 3TC9A 1S9KC 5ABDE 1L9MA 3ROLA 2E7LC 2BNQA 4I18B 3DETD 3DV4B 1MQKH 4RWHA 5BRZE 3MSPA 4LCWD 2I60L 1WBXB 5BS0A 1T1ZB 2Y25A 4WENB 3MRKB 4HMEA 2IH1A 3ZKNC 2ZUQB 1RV6X 3T0BA 3ULVL 1I7ZB 1I3UA 4TVPL 4TNVF 5F9AC 3P4NB 5CJOH 1OPGL 4R4BB 5EIIA 4NQVA 5JDSB 3VD5A 4G7YH 3RY5A 4UBDC 3SGEI 1ZT4B 2V2WB 3BSZH 2XZCL 3BYTA 4G8GA 1RURH 2QHRL 4OT1L 2FHFA 1XR9A 3VXNB 1MFDL 4P23A 4G6ML 3D39A 3LOWA 5DHXB 2ILLA 4PRPB 5GIRA 1M1SA 4NKDB 3QFDB 5JLZB 3O45A 2HH0L 1FGVL 2P48B 2R0WL 1TCRA 1LD9A 3U6RB 5D2LB 2XA8H 1FZKA 3QXAB 3LRGA 3O3EB 5HJ3B 3QDGA 2ZG3A 1FNFA 2XXMB 5EU4A 1PVHA 1BD2A 4HWUA 1C5DA 1DUZA 3K4AA 4F7PA 4Z7UA 4M43L 4TUOB 1G7HA 2VE6A 3HA0A 3MR9A 1RUMH 3S4SA 3SGJC 4J8RB 5HI5C 1IGCH 1YC7A 4KRPD 4ZAKC 4HLJA 3VMPA 1OARH 4JFHE 3HI5H 5F7DB 3VI4E 2QHLA 1MLBB 4WY7H 5BO1H 5JR1H 1VFBB 2VDNL 1YMME 4OIIL 4K3JH 1A6PA 1KIPA 1IM3B 1ZLUK 3UYRL 4NP4L 2ATKB 5I8OH 1E28B 4MJ5A 3CFEB 3WO3B 1JZ7A 1YNLH 3DX8A 1FVCA 1ZSDA 4K3HA 3DETC 5F7LB 1QFOA 1FZMA 1ULVA 2C7UB 2EYSA 2ZZUT 1CXHA 4NN6B 5CJBA 1HH6A 4AEFA 2R29L 1XFPA 2EC9T 1INDH 3WNMA 1FFQA 1RUPH 5J1SC 1J0ZA 3F65A 1OP5K 3ET9F 4HXBH 1NCCH 1KCSL 4GRLB 2YA2A 5GZOD 1AGDA 2J1KA 4E41B 4LKCA 1CYGA 4D8PA 2D31A 4BH8A 3WEXA 4BJLA 2R69L 5TGBA 1MFCH 4UUJB 1NC2B 4UQ3A 4IOSD 1CDHA 2C9AA 4JDTL 3T0EB 3V4VL 2X6MA 2GHWB 3MLZH 2Y07H 4OSUH 5E8PB 1KF9B 5B4MD 3TYGH 1YECL 2FLRT 4PJDE 3BISA 3GMMB 5I6XB 5AUMA 2YN3A 5KVMC 5FV1L 1G7LA 4MXWH 3SY0A 5EBLB 3QUZB 3DI2B 3QULB 3UC0H 5MENE 2P44B 4GBXA 5IMOB 1BFVH 1UACL 4X80L 2ICWJ 5ITBH 1IQDB 1ZT7B 2B4CH 2Q76B 4HUUB 4HS3B 5F6HJ 2V9TA 4HW6A 4Q2ZB 4KRPC 1XGPA 2PKDA 3PV7A 3SDCC 4H25B 4JR9H 5CS7A 2XG5A 3IRPX 2WNGA 3ARSA 3HZYB 2ERJB 5GGTH 3QUYB 4LCUB 3S3PA 2F58L 1SJHB 4NO3B 1W0VB 4ONGL 3DMMA 5GGRY 2FB4L 3HPLA 3O2DH 3L7FB 3X13B 1QSEB 1QA9A 4JFEA 4WW2F 4X4XA 2DOCA 1CD8A 5A16B 1EAJA 3V5HB 2CDFB 2E6PA 2WLYA 1U8KA 1S7WA 3NA9H 5B39G 1NJ9B 2R9HD 2G2RA 1ADQL 3I3DA 2SEBA 2C3XA 1N5YL 4Q9QL 3MNZB 3S36X 3ARGD 1L0QA 1JWMB 1QSFB 2AKRB 3O8XA 1U8NA 4GSDL 4RQQB 5HBBA 4HCRL 3T0WA 2J8UB 1CGTA 3F12A 2VLRD 4OFDA 1KACB 1YPZB 3F5WB 3UX9B 3LEYH 5GZOC 1X9QA 1X44A 2VQTA 3RL2B 4V1DA 3SE9H 1NCAL 4G9DB 4KI1A 5DJ0A 2P8LB 4JLRA 1XCQB 2KDGA 4XP5H 5B38B 4LVHC 3PV6B 4MDIB 4NQEB 1JNLH 3WJJC 1OAKL 3BPNC 1FP5A 1ADQA 1WWCA 3OZ9L 1JGLL 5DEGB 3BO8A 2AVGA 2NY6D 1SVZA 4AMKH 3NIGE 1A5FH 3NAAL 1S3KH 3MYJB 2FYYB 3KPSE 2FWOA 5IVNA 5DF0A 4P2OA 1MI5E 2PXYB 3G6DL 3NFNA 5AWNL 1F90H 3Q6GH 5B4MC 5TQ2L 4NOBA 1N8ZB 1B0GA 5KSBA 4PV8B 4NQDE 5DVKA 4F8QA 5JW4M 3PJSA 3CVIL 4HCRA 1IE5A 4PB0H 4WUKL 4LK4A 4MLSA 4X83A 2W9LA 5I17A 3D87B 4PP1D 1LO3L 1A6VL 5LQBL 2WWKT 1KJ3H 5DJ6A 5GRVL 2GQHA 1A14L 2NTFB 3WXVL 4ODXA 5I18L 1SBBA 5A1AA 4JY4B 2NYYD 2X4UB 5DUPH 2OR8A 5FGCB 4B41A 4JB9L 5KAQG 5ICYB 1K4CB 4XPBL 5IHUH 1KC5L 1UA6H 1XF4B 4X5XA 5DYOA 2BVQB 4B7LA 1HH9A 3CFJA 2DS4A 1K5NB 4MAUH 1YY8A 2CLVB 3C09B 3KLSA 4WHTA 5EOCH 3O2WL 5HHQA 3RWIB 1UH3A 3CDCA 4JFZH 1A47A 1CLZH 1JZ6A 3GKWL 5DVLA 1JGVH 2WBWB 1U92B 4YPGA 5D71L 2EH7L 2VABB 2R9HC 5BZDA 1RI8A 1NCBH 5HYSA 5BVPL 4HGKC 3S37L 1I1RA 2Q6WA 5ANME 2X09A 5E2VL 4DJMA 3ARGC 43CAB 3D3VE 2Z31D 5FA4A 3RWHA 3G5YB 3H9YA 1JRHL 1OQXA 4L4TA 1NFKA 5E0QA 5DK2B 2P5EE 4QTIH 2NY5H 4K3GA 4HS8H 3KYOB 1OQOA 3P3YA 3IXTA 4LPUA 5ALCL 3CDYA 4NNYA 3BHBA 4GH7B 4OCSH 1TZGL 1GYAA 1S78D 4UIKL 5L0QC 1KIQA 4N90E 1NAMB 3O9WB 2AXFA 3O3AB 4XPAL 2NY6C 3O11A 2NY2D 3L1OL 4ZUSA 1G7IA 4YHYC 5ISZD 4PY7B 5DJXB 3TO4A 1Z3GL 2VLKE 4P49A 2V9QA 5CIPB 1ZOXA 3T4AB 1T80A 2C3VA 4EN3C 2BNUB 5GRJH 2K1MA 2FSEB 4MA1B 2DQIH 1I3GL 4OKVA 3TYFB 5IUSA 4PP1C 4TRPL 3GMRA 4Y16A 1PZUB 3I3BA 5C8JA 5MERB 1I1YB 2V17H 1KTDB 5HYFA 2NYYC 1FO0B 2HT4D 4L9LB 2ARJA 1IM9D 3LN5B 5SWZD 5C0JA 4G6FD 3ARUA 1E4KA 35C8H 5MP6H 5HYJB 3IXAA 2BVYA 2Q8AH 5GGQL 3P77B 4EBQL 2X1PA 5CEZD 4OI7A 3MLYL 2ADGB 2Z8VC 3N85L 5E2UL 5LAXB 4HIJA 4QEGA 1LDPH 1CXIA 4KJYA 3WJLC 4JRYD 5D4QA 4WCYH 4WHYH 1YEDA 1N7ML 3ZYOA 2Y5EA 4E42B 2X4SB 2XQBL 1IC1A 1YYML 4L4VE 4ORGA 1VFMA 5E1HB 3EFFA 4X6FA 1RIVH 3K81A 2WINA 4JHWL 3QPXL 5JZ7C 3FOMA 2FNBA 5EBGA 3SE3C 4OUUA 5C3TA 4M3KB 2MPAH 4PJBF 4GT7A 3MLUH 1BLNA 4RNRB 5C0DB 5MHSD 2Y23A 3K8LA 4PJ5B 4ONFL 1P84J 3MLWL 1D5IL 2A1WL 2Z31C 5C0EA 3DX9A 2V7HB 1KBGH 2D9CA 2OJZL 4KVCH 4Y5VC 5T5FL 2XIDA 3BH9B 4BELD 4ZOCA 5ICZA 4DN4L 4TUJB 1AXSA 4WFED 4WW1A 4BZ2H 3FCTA 1GIGL 1ND0A 3QUMH 4LLMB 3MNVB 3SDAA 1S78C 1NEZB 2PYED 5GSVA 4G8FA 2X89D 3JUZA 3WDHA 1FJ1A 2VDOL 3MV7E 4V2BA 3DSFL 1TQCC 1Z9LA 4UDUA 5E08H 2MCPH 4I5BA 5C3LD 2DJSA 3TBTA 2FATL 3UAJD 3X12B 2DD8L 4Z5RA 4NPYA 3NZ8A 2BVOB 4M02A 1MIEL 4X4MA 3NBNA 3TH2T 1D5XA 4U6HB 1JGUH 1KPUB 2GUOB 4F80A 5KW9H 1UVQA 1NQBA 2BHYA 2Z91A 4Y1AE 4Y19D 3STBA 2XN9E 1FPTL 3LQAC 4BQCA 4WHCA 3KPQB 1I8LC 1F3DJ 2FRGP 2XXCB 3CCHA 3HS0A 5HD8D 4JG0H 2HT4C 3QWQB 4OD3H 5I30H 4OF7A 1YEJH 3WS6C 2FCBA 4OLZL 4OUOA 3ULUD 2D9QB 3MFFA 1NAKH 2J6EL 1RULL 4YDIL 4Q9CA 2LAGB 3VG0H 1U6AL 2DL2A 4ZUWA 1P1ZA 3BQUD 3FMGH 4M61B 2F5BH 3LS4H 2VB5A 4K7FB 3CFKB 1GH7A 3F7VB 2LV4A 4FQQA 3VFUB 1G7JA 1CFSA 3RDTB 4DZBB 1N64L 2YK1H 3MRLB 5F21B 1DEDA 3V6OA 4GG6B 5JHDB 4WGVB 3FO1A 2PW1A 3QDJB 4JY5L 2H1PL 2I26N 5CHNB 4TULH 1FCCA 4ZNEA 3BDXA 3GM8A 1J8KA 2A83B 3MMEB 2J6EA 3S96A 1EFXD 3O3BB 3Q6FB 2DYPA 1MCFA 1I7TB 4I8DA 1G1YA 5TF1L 4G80A 4LCCC 2WBJD 4PRID 1O7SA 1GAFL 1IGTB 1JK8B 5CILH 5EOTB 1J8HE 2VQ1A 5D1XD 1RJYA 2GTZA 2AJZA 1F6AB 4KK5C 1CVRA 4YHKL 5AAMA 4QHNB 1D6VH 1AD0B 5INCA 1SJEB 3QDMD 3VW3L 1FVDB 3O81A 3U7YL 4HIIB 2VTFA 1HWHB 2VUYA 4JFDA 1T2QL 3UAJC 2B1HH 4YFDB 5KOVC 1UM6H 1T4KB 3BUYB 4D0DB 3H8NA 1LO4H 4QHMA 1AE6L 3D69B 2IALB 2A6KA 1I4FB 3EO1B 3MV9E 2AQ3A 3QCUH 3O3DA 1ZS8A 5FB8B 2E7BA 4X9GA 3SKMA 2P24B 3S98A 3IJYB 4PJEA 4LHUB 5EZIL 5EBWB 4O2FB 3CK0L 3GSXB 4QY8B 4KUZH 4ZUUB 5HD8C 1NGXA 1NAMH 3OKOB 5J3HD 2AS5M 4OKDA 4H0IA 4QO1A 3WLWD 5J6HB 5DJ8B 3QRFM 1MH5A 4LCWE 4WV1B 4MS8D 3ULUC 4EN3B 2B7DT 3R8BB 2EDJA 2BSRB 3IDUA 1QVOB 2Y6SD 4K7PY 2YPLD 3IDMA 4UILL 5CIPH 3HR5B 5IB1B 3BQUC 3AGVA 4MD0B 4HAGA 4NRZB 9CGTA 2GJ6A 3HMWH 3ZL4H 1R5WA 2IFFL 1VGKA 2ZCHH 3BDBA 2VDMH 4JKPH 4X6CB 1JHLH 1XIWA 4MD5B 1XF1A 1QPPA 5IMKA 3W9DB 1FO0H 1F11B 2LVEA 5IGXH 5FK9A 2CLRA 3O4LA 2UY6A 1X5AA 3WS3A 2J2ZA 3SBWA 4PJ7F 3RGVB 4IMKC 1U58A 1MJ7H 2IAND 4PJHF 3E8UH 4PBVC 1MRCL 1KLFA 3ECBB 1R24B 2CJUH 4OZFA 5BZWB 4CN6A 2EYTB 1SBSH 3BZEA 3I50H 4RMRA 3VH8G 3OAUH 2H9GB 2AEQL 5HHMB 4YDKH 1UZ6E 2WBJC 5C0BB 1RY7B 3OKEA 5ACZB 3OAZK 1YMHA 4E5XB 3D9AH 4PJ9A 4PJGB 5D1XC 3IRZA 4ZSOE 2AQ2A 4QHUA 2KQMA 3VWJA 1YJDL 3ARRA 5TQ0H 4PREA 3V0VB 1NGZB 4U1LA 1ETZA 1E4WH 5HDBF 4XNZC 4JFYA 4QT5B 2WWMD 4LQ1A 1QBLH 2ZSWA 4X4YB 2J88L 4NHUA 2YD4A 3Q3GB 4DFIA 1KCKA 2D7QA 1T7XA 3HRPA 3EYVA 3NA4A 3RUGB 3ARFD 3B2VH 3E2HB 4P4KD 3IFNH 4LNRA 5SV4A 1AHWB 1S7UB 1J05A 4L9DA 2ZWLT 1RZKC 4CVXB 2ADJA 3OJDB 4OLUH 4S1RL 4N9GB 4BFEA 4ZPTB 3JWOC 5J3HC 1PDKA 1UB6B 5IWLC 1EEYB 4R90H 1QEWA 4JFPB 3WLWC 5HI3D 4MS8C 2P5WD 3PWPB 4R3SA 5I15H 2IAMD 1S7TA 1D5BB 1JGEB 2Y6SC 4JPWL 4L8SC 1CBVL 4JQXC 1DANT 4XP6L 5GGSA 4LBEB 5SWSA 5CBAA 1ZLWK 1I3VA 2VXVH 1ZAGA 3W5MA 4Q58C 2DQFA 4P2RA 2ITDA 4GXVH 3QQ3A 5MEOB 4U7SA 4X6DF 4IRZL 1KXQE 3D0VA 4X7FC 3N9GH 5E5MA 5HYEA 5I16A 5IHZA 1ZV5A 2QADB 3MV8D 1J18A 4P5TD 4LGSB 4MNQA 2WP3T 5E2WL 4EI5B 4OZGB 1MCNA 3NPSC 2W91A 3C5ZB 4KMQA 1FZOB 3FO0H 1DE4B 5FYKH 4PJXE 1I9JH 4L29B 3IU4L 3LQZA 3MRBA 5T1LA 4RIRA 3GSWB 3KPPA 1LK2B 5IB3B 5TE6L 5CSGA 5F71A 2I9LB 3DBXA 2F8XC 2EXWD 4PJIB 1WSST 2DQGH 2P1YA 1QR1B 3UTSD 1A1NB 2PCPA 4APQD 2P8PA 5DRWB 1HILA 2R15A 2WWMC 5ADPH 1AKJB 3VFTB 4CVWA 1AO7D 1KNOB 1RUAL 12E8H 2CLZB 4HWEL 4DVRH 4YWGL 1FZJA 4LHJB 4KC3B 3T3PE 1MIML 1MPAL 2HFFB 1CU4H 2Q1EA 4Y4FB 1YEGH 5IQ9A 4P5MB 3TA3D 4OZ4B 4P4KC 3QT2A 1EO8L 1KB9K 1R3KB 5I1AA 3JV6B 4P3DB 3WUWG 1C7TA 2DQEH 3ARWA 3FL7A 3V7AG 3ZE0F 4YDVB 1NLBH 3C9NB 4ODHL 3L3IA 4YC2C 5TJWK 4XWGH 4AEIH 1G9MH 5GS0D 2XTLA 4W81A 2ESVD 5HI3C 4Z95H 4Q97A 4F9PA 5J06A 4YZFE 4PRBA 2IAMC 3LRSB 3VGHA 3CSGA 4MD4A 1OTTC 4J6RL 3TVMA 1U3HC 3HE7D 2BRQA 4EI6A 3HZVB 3NIDF 2NZIA 2Y36H 3BP5B 2OZ4L 2VLRE 2BOBB 2R4SH 2RFXA 1I7RB 5DJZA 1DVFB 4ELKB 3NCCB 2CK0H 1MAMH 3L3DA 2JB6A 3UXFA 2PR4H 5GRYA 4M1CD 5CINL 4RDQG 4PRAA 4JRXE 3T77B 3KXFA 1BQUA 3EYQD 5EPMB 3D18A 4YBHA 1R3HA 1HYSD 1JYVA 3ES6A 3VWKB 1T1WA 4LPCA 3BZ4B 2CDGA 3E6HA 4ZYKA 2DBJA 5L2KE 5F8RC 4LLVB 2OQJB 5ETUB 1QHOA 4RGMB 5JDJA 2OMBA 1HQ4B 3LKQB 4NM4H 2OZ4A 1MRFH 3QUXB 2EXWC 3RBSA 4I0PC 2DTMH 4FXKA 5JIKA 1G1CA 2ZKHL 4HFWB 4IRSD 4HPOL 2A38A 4APQC 2R39A 4J3TA 5ID1B 1JPGB 5DQDL 2AXJA 3DVNA 5D96C 2HTKD 5D5MA 5MI0C 3WFZA 3NFPA 3G08A 5ITFA 1PKQA 4I2XB 3TA3C 4DZ8A 1WZLA 1A6ZB 3T0VA 3SDXE 5JW5A 5L88H 3LZFL 4HF5L 1E27B 4O51A 4GW1B 3JVGA 3LKRA 4GLRH 3TEUA 3TBVA 3HNSL 3FN0L 4QRPD 5GS0C 4KK9D 1MFEL 2CUHA 3HC0A 2EDYA 4YAQA 2C3HA 4K3DL 1B4JL 1HKFA 2YWZA 2XWJB 3S5LA 2X1QA 2OI9C 2G9HB 2K3TA 3HE7C 2HJKB 3X3FL 2HJLA 4GKNA 5D9SA 4ZFFB 3AUVA 5GS2H 4HIEB 3T1WA 3HCVA 1S9WB 4L8DA 4MJ6B 4Y5YA 3NIFE 5IVXF 4AQ1B 4FMKA 3FJTA 4U6XB 4M1CC 1ZGLM 4W4OA 3WUZA 4MNHB 4M8QB 4DKEH 3EYQC 3U0TA 1QHPA 1HYSC 3WL9A 1F4YH 2DM4A 4HWZB 1J10A 4NKIH 3R0MA 3PUCA 3QO0B 1H3UA 4LSPL 4IBLT 2QSCL 4DK6A 3VFVB 5ISZE 4M6ML 4QOKB 3OJVC 4OZHB 3BVNB 4S0TD 4HHAB 1ITCA 4IIQA 1YEKH 4WO4B 4YO0B 1F4AA 1V3KA 1SQ2N 1NMBH 4KKBD 4WI2A 2X4TB 3HI1A 1FV1B 4QCIA 4ELMB 4LVNC 4F33B 1JNJA 1UM5H 5E9DD 3X3GH 3CC5A 4IRSC 2UZXB 2WM0A 3BD4A 1MREH 2EDXA 4OLYH 2YEZA 1A7QL 4ZD3L 2AJSH 5SWZE 4HUNB 1FNGB 3T1FB 1NCTA 4MCYA 4HUXB 4JZNA 1VACB 2FH8A 5CEZE 2B5IC 5DT1H 4KH2A 5IHLB 2HTKC 4PGCA 4XTRC 5FUZL 3DHJA 2VR5A 3LKOA 5DLML 3R06B 1MHEB 3IVKA 4HWBH 4RISL 4JRYE 1HWGB 2YC1A 5DS8A 1QQDA 1QSZA 2YUZA 5D7IF 3QO1B 5JO5B 2NXZD 3VCLB 4U1IA 3QEQA 1BZ7A 3ARED 4NHCH 3REWA 4F7TA 3GNMH 4GRMB 3AU1B 1G6RL 3C60A 4MHHI 2HA1A 5MHSE 4I3GA 3MREB 4Z7VF 2DMKA 2Q7YA 4KJPD 3KPRD 5HGBB 4DQOL 1HHIB 1QRKA 3CGTA 5KVEL 4ZDHB 1B88A 4FRWA 4Z76A 6FABH 4ZUVB 1FBIL 4NQXB 4XH2A 4LLQB 3P0GB 1WZ1H 1DBML 2CIKA 4WFEE 5HHXL 2DKSA 4LEXL 4MJIB 5F7FA 2PYEE 5T5NF 1JHTB 2E7CA 1N0XL 4Y5XA 2YD2A 4IJ3C 2W0LA 5JW4Q 3S4SG 4POYA 5AG9A 5FCUH 1G6RA 2H2SD 2UYLB 3EOAB 32C2B 5FUOL 5BW7C 5J6GA 1S7RB 2W9EH 2YUWA 2H45A 5DMIL 3RIFK 3ZDZF 4O2CB 4Y19E 1INEH 4QF1B 3OR7A 5CFHA 2BY1A 1NCDL 3CZFB 4N0RA 3QP3A 4ISVB 3FQNA 3KYNB 4U2ZA 15C8H 2QQKL 3IB4A 3QDAA 4LSSL 4JANB 2DQJH 2B2XL 3REVB 4JM4H 3HTLX 3HG1D 3QG6A 1FC1A 2NX5A 4UZGA 5EBMA 3WDJA 3ULUE 4PTUB 5DI8A 2FJFA 4BKLB 4LCIL 2OSLB 4PJ8A 2LU3A 3QWRD 1RZGB 1GGIL 4GOSA 1V7NL 4M4PA 4S1SL 1KJ2L 1FFNB 4PJAB 4X7SH 5D2LF 3BZFB 2GITB 1JWSA 1HHKB 5D7JA 1EBAA 2ORBH 4LLYA 4OB5L 4ALAH 2I07A 3PNWA 4XCYB 4KVNL 1JN6B 5IB5A 4MA3A 3MGOB 1HDMB 2NXZC 5ANMA 3AREC 4PPTA 4U7MA 3WBDA 1KN4L 1K4DA 3L3JB 4XNMA 1RFDL 1K8DA 3JTTB 5J57B 3VD4A 3CFCL 1KFAH 4LPWA 4ZTPH 4XBEL 5GSRA 2CH8A 2BNRB 3OKLB 1KJ2A 2QQNH 4HJJL 4U1KB 4PRIE 3P11H 4GO6B 1P4BL 4PLNC 3ARTA 4NUGL 2IJ0C 4KRNA 3NTCH 5KSAA 4U6VH 1QOKA 2O61A 1DN0B 2HN7B 2JK5B 4WI6A 3QDME 1RIHL 5TFSH 2F74A 4TNWK 4M1DH 4U0RB 2H2SC 4J1UB 1LGVA 2YMXH 3D85A 1OSPL 4R0LB 1JP5A 4KK8D 3GSUB 1NDGA 3QQ9D 1OGTA 1Q1JL 5E2JA 1FAIH 1NGPL 1RZKH 3K8KA 4TVSa 2W60A 1XH3A 2VXQL 4BK4A 4F57H 4NYLA 4WEBH 4P46A 1CFQB 2CMRH 2X9YA 4ZFGL 1QFWI 1ZEAL 2BXYA 4JKWA 3MLSH 3T4YA 1IEAA 4GQ9H 2HYMA 5CJQH 1TJGL 4LRIC 4JG1H 3G6JB 3FB8B 1IZJA 5IR1A 2H26B 4UT9L 4LVOB 4JAMB 4H8WL 1Z9MA 2YKLH 1BZ9A 2NY7L 4HKJB 1LE9A 2YPLE 2J5LB 4ODTH 1TFHA 3ZKXC 4OFKA 1IVLA 2YWYA 1FORH 5E6IA 1KB5L 4L4VA 3BKCH 5D1ZD 2I24N 3BW9A 3OWEA 1H8SA 1N3NB 5FKAA 4X6BB 5CGMA 5D7LB 3EFDL 4GUPA 2LU4A 5F7WC 1A1MB 4NRXB 3GBNH 4HIHA 4IHOB 4LCYA 1AC0A 4U1MA 5JXEA 1KT2B 4HKXA 3WIIL 1CL7L 4C56B 2ZUSA 1ZHKA 1EBPA 1FN4B 2IANE 4JGJA 4K7PL 2YRLA 4LLWA 5J4MA 3S88H 5KS9E 3F62A 5KVFL 3D0LB 3VGEA 3P0YL 2NPLX 1QP1A 4X9BA 4OCMC 1I1FB 2VITB 1MSPA 3SKNA 3IDXH 4OJFH 1ES0A 1CZ8L 3VFWA 1FYTB 1A8JH 3RY4A 4QTHB 5C09E 4ERSH 4OFPA 3GO1H 4DUVA 3K4DA 1KB5A 4P57B 1HHHA 1RUQL 1CDUA 1UKQA 4U3CA 4GMTH 4AENA 4OFYA 3LD8C 4CW1A 1WUNT 3ZYIA 3FRPA 1LP9B 1M7DA 1MCDA 1AGFB 1GC1C 1AGBA 4ZFZB 1I85C 3UTTB 3W11C 5IEHA 3RRQA 2DBLL 4XNYH 3OF6A 1BREA 3ZE1E 3PWVB 3MLVL 4PJFE 3MXVH 4Y1AA 1Q9WA 4KK8C 5FHAL 3V9FA 1U41A 5M7QA 4WI7A 3SN6N 1CL7I 3LHPL 1H5BA 2R2BA 1YPZF 3IFLL 5DEFB 3H0TB 3TNMB 5JA9A 3L3OB 4MAYD 5KVDL 4D9QD 2B1AH 4NNXA 4LLUA 2Y4SA 4M5YH 4KWUA 1HIML 2F53B 4HULB 5CEYB 4XCCL 5EO9B 2EDWA 4M7JH 1UWGH 5TDNA 4JM2B 4DGVH 5A3ID 3IDIA 1F3JB 2XQYG 1FIGH 4ODSH 5EUOB 2P5WE 4PLKC 5HYSG 2ATPB 3WD5L 3MRFA 3B8SA 1CFTB 4YDLC 3TIEA 4S1DC 3VG9C 3MRGA 1H3XA 1NCNA 4R97B 3RZCC 1GGCL 2WWKO 1LO2L 4YHMH 4Y4KD 4TSBH 5JMRA 3BRFA 2AK1L 2W0KA 1C5BL 4OAWA 1EXUB 5F93C 2EDTA 4UINL 3VFRB 3O6FD 1IL1A 4BSVB 3MV8E 5F7EH 4GW4B 5E8EB 4A6YB 1FFOB 1HHJA 3GMPA 4NOFA 2AV7A 1H8NA 5ESQB 1MF2H 1KULA 4GG8B 2IQ9H 1IGFL 4NGHL 1X5LA 3CMGA 2AJVL 4FZEL 2GJZB 2WUBL 5BOPA 4FG6D 3WFHB 2WIIA 5IJKC 4OCXH 3X14A 2BNQD 2W65B 3PGCB 3KWWB 3VH8B 5BS0D 1W72B 1BQSA 4JEGB 4S1QH 4XCFL 2VDPH 4XVSH 4YNYA 5E94A 4KMTL 5K59E 1YYLL 2A73A 3RWCA 5ACMA 4X7TB 2OK0H 2AI0H 3E6FA 1NGWA 4P2YA 1AO7E 1N4XL 5J9PA 4MNGE 4QKXB 3DTXB 3O41B 2D7TH 4ZQKB 1T1XA 5I1GH 3DGGB 5EORL 3ILPB 3DYMA 1UZ8B 4X98B 1BOGA 1EUUA 3MJ9L 2AJXL 3DXAB 3OL2A 4NC2B 2YBRA 4XPTH 3NN8B 1S9YA 1VPOL 4MAYC 3PQYB 4OLVH 3L3GB 4P23D 4ENED 5SX5H 5C7XL 1CFVL 3F7PC 3FFDA 2XZZA 4LCWA 3NVQA 2OR9L 4U6TA 1CIUA 1IKFH 5A3IC 1PAMA 1YQVH 5IW1B 4QRUA 3QWOA 1NBZA 2N7BA 2H2PD 2PUQT 4GW5B 4YBLC 3ULVD 2XTJD 1JPFB 3OXRB 4TVPD 5FGRA 4YXLL 5EWIH 3U30B 3MA9H 3PF2A 3MRRB 2X44D 5EU3B 4C4KT 1G6VK 1XF5A 5AYUH 5FHBL 3TNNA 1T03H 3QDGD 4JO4H 4XMKL 3WFCL 4JZJB 4CU7A 4GAYA 1BD2D 1F58H 4PGBB 7FABL 4D9LL 3FQWB 4Y4KC 2KH2B 3MJ9A 3RX7A 3PWJA 3DARA 3BX7C 1OOAA 2Q3ZA 1BWMA 3SDDB 2DQUL 5L9DL 1MHPL 1MJUH 5I75C 3BKML 3SE8L 4Z8FL 3QI9A 5IBTH 1MCPL 1V05A 1A3RL 1R5IB 4H20H 2PF6A 4R26L 2R1XB 2RB8A 1ZANH 2EDBA 2NLJA 2Z4QB 4XAKD 4PD4K 1UZ6F 4B0MM 4CDHA 1KG0B 4HKZA 4UU9A 5GISL 1HXMA 4K8RH 3VXTB 4FG6C 4KAQL 3BP4A 2W0FA 2W9DL 4KPHH 4HK0A 4P99A 4P2QA 2R1YB 4FTVB 4XNXL 1EVUA 1OGAB 2A77L 1ACYH 3CPLA 1VFAB 4LMQI 1E0OB 4XZUA 5IVOA 1Q9KB 4EDWL 5HGGS 2R2EA 3VGGA 3KJ4B 3QEGH 3OKDB 4FFYL 1HI6A 3HUJA 3O0RL 3OB0K 2O5ZL 3I6GA 1LE5B 1NFDB 1BQHB 1J1OH 1RZFH 4P23C 4ENEC 3VJ6A 4OD2A 1OP3K 1BGXL 1EAPA 3A6BL 5ESVB 3P4MA 4JZOA 1E6OH 5KANI 1RZJL 1PYWB 2H2PC 3ULVC 2FL5A 2XTJC 2FDBP 1HSAA 4FXGA 3U0PA 4HBCH 4I3SL 5CSZB 1ITBB 1LK3L 5FYJD 5HYQB 1A7BA 4FQLL 2IH3A 1BJ1H 1RHHB 1KPRB 2VDRH 3BEVA 2VIRA 4PG9B 5EZJA 3GMNB 1P6AB 4NUJA 4PBXA 3X11A 2FJHB 1SJXA 4UB0L 1Z5LB 3RTQB 5E99L 5KTEL 1X4YA 1JFQH 5GGUA 3FFCB 3BXNA 3HZMA 2ZG1A 1NCUA 2C1PB 5CWSA 1J1PL 3FQRB 1HHGB 2ID5A 2LAAA 4PJXA 4Q9BA 2DIJA 2X70A 5DURB 1PD6A 3DMMD 4WHDA 5GGVY 3BGFB 1BEYL 3VXQB 2OL3L 4JFED 1ZTXH 4FNLH 5FO7A 1TZIB 3K80A 2O5YH 5JW3H 4ZXBB 1AJ7L 2OYPA 1DDHB 3IETB 1NFIA 2OM5A 3V8CA 1DUYA 4DCQB 4RBPK 4NZRH 2VLJA 4ZPVB 2DIAA 1DVFD 3VXRA 1JL8A 5E9DE 4M4RA 1JHKH 2BX5A 1RJZB 4PP2B 5KJRH 4NWTH 3T09A 5I8KH 2X2YA 2CUIA 5I1DB 4A6YH 3F7YA 3U36B 5CD3B 4GMSL 5EOQL 5GS1B 3B3IB 4JFFA 2XRAH 3O8XD 1FDLL 2WQRA 1CI5A 3M17A 1LEKB 4ONHB 4NM8L 1JCKA 4LGPB 3PWUA 4J7RA 2ARWA 5T33H 5F9WB 4X8JA 3RAJH 2FIKA 2OL3A 4V1DD 5BV7L 3SCMA 3IJHB 4G9FA 5E6YA 1J88A 1T5XA 1HOCA 4KUCD 3WFBH 3HFMH 1W72H 5DFWH 3DPBA 1U8PA 1OHQA 3PWNA 5E1AA 1S9VB 2Q87A 5FGCE 1BQLL 1DBJL 4XRCB 1EV2E 2HKFL 1T3FA 4LARL 2FZ3A 3ARDA 3RZWA 4G8EB 1CR9L 4P9HH 1MCIA 4K2UH 3RKDD 1G9NL 4OZFG 4RMQA 3KPRE 4GBXC 1FL3B 1YDPA 4MQ7B 3JUYA 4UNTA 1OB1A 1U8HA 1QLRB 5FA3A 3FO2A 3TZVB 1EMTL 1PGRB 1XF2B 3LN4B 4YGVA 1F4XH 4JRXA 3VXPA 1HNGA 1ZLVK 3SKUD 1YEIH 1I7UB 3V79C 5DJ2A 3BKJL 4YR6B 2BHUA 1A3QA 3WN5A 5L2KA 1FH5L 5TE4L 5E00B 1QLFB 4N8VA 1UJTA 3C8KA 4B5EA 1AXTL 3WIFA 5DQ9A 2XICA 3DMMC 4KGJA 5D7SH 1KTRL 1HQRB 1Q8MA 3BIKA 3CXDH 4M1GL 5INDB 5E4EC 2Z35B 4UV4L 1S7VB 3ZDXE 3B9KA 4U3XA 3T8XA 3GB7A 1VEMA 4IS6B 1QFHA 3MRCA 2HFEB 1VGEH 2YRPA 4BUGA 1A7NH 4HT1H 4JPIA 3UJIL 4FQHA 3BH8A 4H0GA 1S5IH 2DJUA 3HG1E 4WU5A 3O8XC 1JPSL 1VSCA 3GJFA 2V7NA 1WWBX 5T1KA 2AW2A 3DURA 4PJCE 2NXYD 2ITCA 3C08H 2A9NH 4L4TD 4HXAH 3OKKB 3SDXA 1TTGA 4LASL 5CZXC 4M6NH 5DD6A 5LGJB 4GRWB 3UTQA 1CF8H 3B6SB 3K2UL 3QAZC 4WO4D 4AT6A 1U8MA 1T20B 1D6EA 4PJGF 1P7QB 1SEQH 4XC3H 5F7MC 4JFOA 1A7RH 3B43A 5B8CB 5I2IA 1M4KA 4PRNB 4P2OC 3Q2CA 4PJ7A 3TO4D 1RUKH 4PS4H 4OQ1A 1CG9A 4KKLC 5TPWL 3WFEH 2GTWA 3STZA 3I02A 4G42B 3NABH 3JXAA 3RKDC 2Z93A 4IRJA 5E5RB 4PFEA 4Y16D 3BN3B 3VGBA 1RZ8B 3NCBB 3VXOA 4TTDD 1YEHL 1BP3B 3D39B 3O6MH 3BD5A 3A67H 4UQ2B 4TNWF 1AD9A 4PUBL 2F54A 4RAVA 4QGTA 1VCAA 2GK0B 5IK3A 1Q0XH 1MEXL 5GJTL 3F58H 5CEZL 3NH7H 3JWDH 4KHTH 4D0BA 2H32B 1A7OH 2YSSA 5F7NC 4WFFD 3MLTB 1JI2A 1WV7T 2JE8A 3FT3B 4IOFD 4JFXB 2VLMD 3HNTL 1IAMA 3ZHLA 1TLKA 1D5MA 1LVEA 4P3CH 4LOUD 1A2YB 1PQZA 5EU5A 5IW6B 1EO5A 2VR9A 3TO2A 3V7AE 1R3LA 3IDYB 2EH8H 1NUNB 1GGYA 1JUFB 1FVEA 5C0AB 4M6OH 3LMJL 1LO0L 2ZUYA 1YEFH 2R2HA 3S34H 5DR5H 5SV3A 5SWZA 1QRNA 3V5DA 1M7IB 4J4PA 5BXFA 5C0FB 4OGXH 5F88A 2IQAA 3C6LB 1J1XH 4LU5H 1PEWA 4F7CA 5FYLL 3HRZB 2NXYC 1LO5A 4FFZH 4JHAL 4JQIH 3B5HA 3CLEL 4XXCA 2C3WA 3VFMA 4ZO7A 2X7LB 4F58L 3OG4B 4HFUH 1E6JL 2HRPH 1UWEH 4ZFOB 3VFOB 2MQCA 2BCKA 1P4IH 1U93B 5DWUH 3SDAD 3FONB 1ZHBB 1C12A 2D2OA 4X6DA 4AIZB 1EGJL 2APTA 4N0CD 4NQTA 5IMLB 4OTXL 4WRLA 5MEPB 4D2NA 1HE7A 1IEHA 4M48L 3MOBH 3W9EA 3MRIA 1RZIB 2HTLD 4G43A 4DW2L 4JJHA 3WLBA 3TO4C 1D9KB 5D70H 2VZTA 5I19H 1MNUH 4XT1C 3RKPA 4DGIH 1GZQB 2ADFL 3KLAA 2JELL 1NBVL 5TGBB 1S7XB 25C8H 1LMKA 3TN0A 1I9IL 4Y16C 3L95A 1PG7X 5FYKE 5HVHC 5KVGH 3EYSH 3KS0J 3V0WH 1A6UL 2R0KH 2FR4A 2CKBB 1F13A 1EGJA 2VH5L 3LEXB 2X89A 1A21A 3L9RA 4HLZG 3SJVB 5F89B 5C0GB 1E4KC 1ZHLA 1ZHNB 2BSSB 5D2NB 1U8IA 2EIZB 3MROB 5M95B 4GG6E 5DHYB 1MQKL 5ESAA 1YN7B 1JWUB 1CICA 5GPRA 3MCG1 4JE4B 3NCYP 3QUKA 5A2IH 4IOFC 2G5BB 2V6HA 1EHNA 3BPOB 5HY9A 4KJWD 1DN2A 3OKNB 3OQ3B 4I48B 4Y19A 4LOUC 4ODBD 4UT6H 4LVEA 5CJOL 3RPIB 3QEUA 4G7YL 2XWTA 2AK4B 3FB6B 4D9QE 3BSZL 4P48A 4L8CB 1UB5A 5E7BA 1RURL 2OX5A 3LEVH 5AAWA 2HRLA 3EHBD 2VDLH 3CD4A 3LV3B 2G75B 3J8F7 4XCNB 2DYPD 4R7NA 2RIKA 4WW2B 4LSTH 2HJFB 3WSQH 5HPOA 3S5LG 3BZDA 2XA8L 1FLRH 2DL9A 2G2RB 3U1SL 2EEBA 3WHE1 5C70A 3SDAC 2X40A 1BFTA 4I13B 4LPVA 4WWKA 3IKCA 5DD5H 1ZA6A 4N0CC 2NY1B 5C9JB 4XBPB 1TQBB 4JFDD 1RUML 5JPNB 3LAFA 4P9MH 1IGCL 1A6TA 3MRDA 3NZHH 1LEGB 5HPMB 1XR8A 3SGDH 4M93B 3HI5L 3QIBB 4GKSB 3VE0B 5C0CA 1CDBA 5D7KD 4WY7L 5BO1L 5JR1L 3MJ7A 1WAAA 3DROA 1QFUH 3VRLF 4OF5A 4GRWH 2AXGB 3CSYA 4K3JL 4EUPB 1I1AB 2BNQE 2D0GA 5I8OL 4CKVX 5HVFB 3QDMA 4X6CE 1JF6A 5E7FA 2YXFA 4TSAH 4LIQE 2AEWA 3QJFA 5FYKU 4EIZC 4KXZH 2BVUA 3H9HB 5CJXA 3DVGA 4J3SA 3DUSB 4IMLB 1UJ3B 2GJ6D 2GSGB 3FOLA 1T6VN 4D0CA 1INDL 5K9KB 3VA6A 2B20A 2ZUXA 1X5KA 1XIWD 3BPCA 3OBAA 5EULV 3V6OC 4HXBL 1NCCL 2MHAB 5I1JH 1WFTA 2A2QT 2E3VA 5LCVH 1G7QB 4GKZB 2V5TA 2V2XB 3U9UB 4MHHG 3G04B 1MFCL 1S5HA 2XV6B 2IWGA 2JCCF 3G5ZA 3GBMH 3MO1A 4Z7WB 3BP6A 3EHBC 1I9EA 2A6IA 3L5XH 2H32H 3SQOH 3MLZL 3ULVE 2XTJE 2Y07L 3TYGL 4X99B 4WEUD 4OZHF 1T0MA 1CGUA 4PJ9D 3PDGA 3QDGE 2PW2B 1BFSA 3VWJD 5HDLA 1BD2E 2AJ3B 4MXWL 5ALBH 5DQJA 5HYSB 5IVXA 1BFVL 4XAWH 5TDPB 5ITBL 3AY4A 3GSQB 2NQCA 4OIAA 3D2UB 2B4CL 1KENH 3MJGX 3LKNB 4UAOB 3I6LD 3DX6B 3QCVH 3E3QC 1BZQK 2PYFB 3L3KA 4NKMA 5C07B 3QSKB 4PYGA 4JR9L 3K8MA 4XAKE 4MCZA 3BHBB 3LY6A 4OV6F 5GGTL 1BVKB 5C09A 1DL7H 5KAQF 1KIQB 2AABH 2X41A 4NSKA 1HSBA 3H9SB 1QBBA 3U4EA 1MCOL 2UWEA 3TPUA 3ARPA 4AY0A 1IQWH 5FUCC 4YK4C 4O58H 5CEXB 4WI8A 5DJDB 2DI8A 2XFXB 3NA9L 3QXWA 2R0ZH 4F15B 4OV5A 4Y4HB 4JJ5A 5BJTA 5FM5M 4Q6YA 1P9MA 1PY4A 2IADA 5C0IB 3GJEB 2CRIA 3HLAB 3UYRH 3Q48A 5DRXB 4QXUH 4QXWA 3ARFA 1U8QA 5GGTA 5FKPB 4JPVH 4P2RD 1CGXA 5F6HI 2DRUA 2HVJA 4FFVD 1BIHA 2E9BA 1UQSB 4F7EB 1CFNA 5KSUA 2JJWA 3O2DA 5C08A 2CKBH 3SE9L 2EO9A 1QO3B 4AH2B 5I8CB 1JZ8A 3PIQB 4MNQD 2EXYD 4XP5L 4BFGA 1R0AH 4PJIE 5D7IA 3SBWC 3GHEL 2R29H 4EDXB 1AH1A 1K3IA 1WZMA 3DX7A 4YIQA 4AMKL 1QZ1A 5J12B 1S3KL 5FF6A 4BSWB 2MWCA 1JJUA 3IJSA 3IAPA 5T1LD 1F90L 3Q6GL 4R6UA 3BDYL 1BX2A 4PJ9C 1CGWA 3IDGB 4BSJA 4XXDB 1M71B 5FYJE 3UZEA 2CR3A 3VWJC 4PB0L 3GUTB 4M7ZC 4DEPC 1CLOH 1SM3H 2JJSA 2X4NB 4DGYH 2Q86B 3D48R 1C08B 1KJ3L 5EZLA 4PJBB 1OF2B 3QDHA 4IM8A 3WO4B 4P5TA 4PTTA 5MEQA 2G5RA 2R8SH 3BPLC 5DUPL 3PQYD 1OT1A 1IZKA 4I18A 1PKOA 5DVOA 3DV4A 4HJGB 5IHUL 1UA6L 4KZDH 1GSMA 4MB4A 3T2OA 1WBXA 2P4AB 4HG4J 3MRKA 1X5XA 4MAUL 3VXUB 4MZ2A 5EOCL 1I7ZA 3MRNB 3P4NA 4C54A 4JFEE 4JFZL 4Z18A 1CLZL 3TFKD 3EYUH 1YJDC 4R4BA 4FP8H 5JDSA 4WTZA 1U91B 1YC8A 1ZT4A 2V2WA 4YE4H 1JGVL 4XPHH 2AGJH 3VXNA 2F58H 1G9EA 3TVMD 2Z91B 1NCBL 3VFNB 4ONGH 2PO6B 1NUDA 4PRPA 2VC2H 3S3JA 4NKDA 3FAWA 3QFDA 5JLZA 3L6FB 3ZT5A 5GGVL 3MBEB 3VFPB 4V1DE 3HC3H 1VEOA 5D2LA 3U6RA 4FFVC 2D0HA 3QXAA 3LKSB 3O3EA 4EUPH 4QTIL 1RVFH 2NY5L 5HJ3A 2HLAB 4HIXH 4M7KL 3HE6B 4ETQB 3KXFD 1C16B 4NZDA 4OCSL 3DOSA 2CXKA 4TUOA 1OTSD 2EDFA 4PRHB 5C9KA 4J8RA 2AJYH 5KSBE 5C2BH 5F7DA 2D7MA 5I1IH 3DSNA 4QHLB 1MLBA 1VFBA 3SOBL 1DTUA 3PABB 3CMOH 5F6IC 1SHMA 2K7PA 3MXWH 1IM3A 1ZGLB 2IF7A 3QEHB 3NAAH 5D6CB 3C5SB 3D25B 1CDIA 2ATKA 1FL6B 1E28A 2V17L 3G6DH 3CFEA 2OXHA 3B5TA 1EUTA 5J13C 2N56A 4IOIB 1UCBH 4NC1C 3CVIH 3G6JF 5FYJU 2C7UA 3FRPG 35C8L 5MP6L 3GIZL 1IAIL 3EW3B 3EZJB 2Q8AL 5EU6B 1LO3H 4YFEA 2FX9L 5EZOH 4DTGH 1RJYB 3IS1X 2VL5B 1N26A 1LNUB 3VXSB 2VAAB 4FMFA 5LJYH 1LDPL 1TVHB 5F70A 3KPNB 3RWEB 3TFKC 3UYOD 4LSUH 4RAHA 1KC5H 4GRLA 4WCYL 1T0NB 1AI1L 3H2WA 4E41A 1T6WA 3OAYH 2F8OA 4JVPA 4JY6B 5FCSH 4N0UB 3RWDB 4Z7NF 1KLUB 4F9PC 3TV3H 5L7XL 4UUJA 1NC2A 2Z0BA 3WFDH 1RIVL 4YHIB 1OT2A 3TVMC 3T0EA 4HZLB 1DQDL 1KCLA 2MPAL 3MLUL 5E8PA 2B8OT 4O02L 3QFJB 2HWZH 5FO9B 4L4TE 1G7PB 3GMMA 2H8PB 3C5JB 4NN5B 1KBGL 2UVFA 5F9JB 5DZOA 2AJUH 5EBLA 3QUZA 3OR6B 3QJHA 3QULA 4BZ2L 5IMOA 4HPYH 1CTNA 4FN0A 2BVEA 1IQDA 1ZT7A 3IDMB 1OTSC 1OLLA 4ELME 2Q76A 4HUUA 3MODH 4HS3A 3FN9A 1JRHH 4Q2ZA 4PY8I 4KZEH 5E08L 2MCPL 1KGCD 1W2KT 2MMXA 3G5XB 5IOPB 4H25A 5HSFA 4R4ND 5ENWB 3HZYA 3P9WB 2E7HA 1IGJB 3QUYA 1JGUL 5KW9L 5FK9B 1SJHA 4LKXB 4NO3A 1W0VA 3O4LB 5L6YL 3P2TA 3ARBB 1DZBA 4DWHA 3L7FA 4JFQB 4PV9B 3X13A 4LSQH 4PJHB 3CU7A 5A16A 2CR6A 1N5AB 3V5HA 2CDFA 4JG0L 1TVDA 1S8DB 3TT3H 4OD3L 4AEHL 1HXYB 3EDJA 1NJ9A 5I30L 1YEJL 2LTQB 2JIXB 4LNVA 3MNZA 4WFFE 4TRPH 1NAKL 4ZOBA 2VLME 1MJJB 2APWA 3W39B 5E5UB 1DSFH 1RD6A 4RGNB 3VG0L 1JWMA 4NZUH 1QSFA 2AKRA 2G60H 2RHEA 3FMGL 4RQQA 3CFBB 2J8UA 2F5BL 3LS4L 3UBXB 3JVGC 1WWAX 1Q9LB 1YPZA 3F5WA 5A43C 5E8NB 3EZ8A 3RL2A 1JZ3A 2YK1L 4G9DA 2JJUA 1U95B 2EEDA 1XGYH 3MRHB 2P8LA 1XCQA 3QEQD 3AAZB 3PV6A 4MDIA 3C60D 4NQEA 5J1TC 5BQ7B 2YA0A 4OF6A 6CGTA 5DEGA 5F97E 4OGYH 4MJIE 1AQDB 1QG3A 3MYJA 1O7VA 3TPKA 1N7MH 2PXYA 2ZUVA 5EFIB 1PZ5B 2APXA 5DDHB 3RWFB 1N8ZA 4KY1H 2BHZA 4PV8A 4Y5YC 5DJYB 3U82B 3UZQA 3L3HB 5HHOB 2V5SA 3H9ZA 4ODWB 4W4OC 2RCSH 2NTFA 1NGQH 3H7LA 4JY4A 2X4UA 1D6VL 3IU3B 2AEIT 1MLCB 3G5VB 5SWSB 5ICYA 1K4CA 4NDMB 2VSCA 1PLGH 3MPCA 4HUWB 1XF4A 4X4ME 2BVQA 4IIQC 2B1HL 3EGSB 4DN4H 3STLB 1UM6L 1Q72H 1J87A 2XYCA 3EO9H 1K5NA 4OZIF 4R4NC 2CLVA 1A1OA 4CVUA 2GK2A 3RWIA 3L5WB 3NCMA 4Z7QF 1KYOJ 3FT2B 4YJZL 1J0JA 4L3CB 3ZZ1A 1CLYL 2FO1A 2NW3B 5HDQH 4TOYH 2VXSL 1UT9A 2XY1A 1EZVX 4KUZL 1U92A 2NX5D 2QKIB 4TQEH 2VABA 1NAML 3L5JA 2IBGA 4FHBD 5DRNB 4PJ8D 4C4KO 1A7PH 43CAA 4KI5E 3QZWB 1R3JB 5IHBA 4OCLC 5D7JD 3HMWL 4W68A 3ZL4L 1KIRB 5DK2A 3ZDXF 4WTXA 2ZCHL 4OLZH 2VDML 4JKPL 3KYOA 1JHLL 5D93C 1W0YT 5GRVK 1X5IA 1RULH 2N4IA 3JV0A 1FO0L 3C60C 1KJVB 1AGCB 3Q5YA 1NL0H 1ZLSH 1Q0YH 1NAMA 2EDNA 3O9WA 2XQYK 3O3AA 3QXUA 1ONQB 4PJCF 5CCKH 2AERT 1MJ7L 3E8UL 3UMTA 2CJUL 2WANA 4PY7A 5DJXA 3ORJA 1SBSL 1UFUA 1UWXH 2VJXA 5CIPA 5A40E 4M6AA 3T4AA 2BNUA 5BRZB 1YEEH 2WQ8A 4YDKL 2FSEA 5KSAD 3TYFA 3D9AL 2VUOA 1QFPA 5MERA 4Y5XC 5TQ0L 1WTGT 1I1YA 1KTDA 5J8OA 4HEME 1FO0A 1E4WL 3GSVB 4L9LA 4JFDE 1DBAL 4FQCH 3N50A 4MDJB 3LN5A 5E56A 5TF1H 3E3QE 1JGDB 1QBLL 1OLZA 2NY0B 5HYJA 1UEMA 3BI9X 2I9TB 1TTFA 3P77A 3U46B 1AGEB 1EEZB 2ADGA 4RFOH 4RSVA 1MCWW 2F5AH 5DO2D 5D7KE 5LAXA 1YY9D 5B3NA 4R7DB 4FQXB 2X05A 4P46D 3B2VL 3IDJB 4XPFH 2M2DA 3IFNL 1NFDF 4F37F 2ZPKH 4NO2B 3EJZD 4E42A 2X4SA 3ARQA 5C92A 3EIFA 3K3QA 4CADB 2Q7NA 1IKNA 5GGRB 4R90L 1P5UA 4PJ8C 5C0DA 4RNRA 2LVCA 3MRMB 4PJ5A 1IILE 2MOVA 2GJ6E 1BIIB 1K6QH 1MVFA 5E6ID 5D7JC 1JF1B 2V7HA 1Y18B 2VXVL 3KAAA 3BH9A 1KELH 1HKLH 4CGTA 3O6KH 3JTSB 4TUJA 4GXVL 4LLMA 4ZO8A 1UM4H 3MNVA 5JXED 2OP4H 1II4E 1YMMB 3N9GL 4MQTB 1NEZA 3QR2A 3SJVD 4MA8H 2PTTB 2W38A 4ZMAT 3DV6A 1B2WH 2IBZY 5JIIA 2IFFH 2MQ3A 3X12A 1LP9E 4CNIB 3OG6B 5E6ZA 3FO0L 1WITA 2BVOA 5FYKL 2R4RH 1I9JL 1NMAH 3QIWB 2XKUA 3IKKA 3QIUB 3OKYA 3A6OA 1F4WH 1KIUA 1KPUA 2GUOA 5KG9B 4FXLA 5KSAC 1OM3H 3HC0B 3FZUD 1KJMB 3KPLB 3WJJA 2DQGL 2OTUB 2VZVA 3KPQA 2ZSVB 4G6JH 1ZLUH 3VD3A 3QNZB 5HHPB 2AK4D 2VDKH 1T7YA 1SEBB 3P30L 5ADPL 2AEPL 4PR5A 1ZXQA 3OF6D 1QBMH 2OTWB 4Y1AD 12E8L 4N8VG 1YJDH 2ED9A 5DO2C 3BWAB 2Y7QB 2KL6A 4KHXL 1CU4L 4HH9B 1YY9C 3VD7A 1YEGL 4M61A 3NGBB 4P46C 4K7FA 1FHGA 1A4JB 4ODUB 3F7VA 3AS1A 1OP5H 3SHSA 4PJDB 3VFUA 3RDTA 4DZBA 3LN9A 3MRLA 2DQEL 3EJZC 4NFBA 4GG6A 5JHDA 1I8IB 1NLBL 4I0KA 5D1QB 3QDJA 4RFNC 2A74B 2EDKA 3DWTA 4MSWA 4XWGL 4AEIL 4LLAA 1G9ML 5MENB 4IDJH 3GZKA 1XGTA 4Z95L 5CHNA 4G6KH 4JN1H 4G6AD 4DKAA 2A83A 2CGRH 3MMEA 3MGTB 3H3KA 3O3BA 5JIPA 1I7TA 2H3NB 3CC5B 5E6IC 4P2RE 4EZMA 2Y36L 3KYMB 3WYRA 1IGTA 2R4SL 2YD5A 1JK8A 5EOTA 1MAML 1AP2B 5JPMB 3AVEA 5FXCH 2PR4L 4RZCB 1M6OB 5JXEC 4MNQE 3PHQB 1F6AA 2CQVA 1MWAB 1IAIM 4H8WC 4QHNA 1AD0A 1DLHB 2DM3A 1SJEA 3S97C 1FVDA 4HIIA 1RJLB 4DKFH 1IAKB 2BSTB 2P7TB 1BFOB 1T4KA 2YA1A 4P0DA 3BUYA 1MFNA 4D0DA 2XT1B 3D69A 4U1HB 5BVJB 2IALA 3MJ6A 1QQDB 1JIBA 2IGFH 1I4FA 3EO1A 4YGAB 4GS7B 5FB8A 2P24A 4I9WD 5E2WH 3IJYA 5IP4A 2XOTA 5EBWA 3O6FA 4O2FA 2DTML 3EDDA 3GSXA 1WBYB 4XB7A 5I66B 4XCEB 5KZCD 3PDOB 4QY8A 4ZUUA 4Z7VB 4LIQL 3P4LA 5AZ2H 3PQYE 4TSCH 4NC1E 3OKOA 3TBYB 1IMHC 5HHNB 5J6HA 5DJ8A 3SO3B 4B7IA 4WV1A 3CZJA 3PL6B 2BSRA 1QVOA 3DIFB 1AFVL 1DLFH 3HR5A 3O6LH 1H5BC 5IB1A 3TT1H 4MD0A 3I9GH 5GJSH 4DFHA 2QR0B 3V8OA 3KPSB 4NRZA 5L88L 1EX0A 2EDDA 4GRWF 4HX1B 3NCEB 1MI5B 1TJHH 5I73C 3CNKA 1FE8H 1YNKH 4X6CA 4CDGC 4MD5A 4NQDB 3UTPD 4CU6A 5T1DH 3W9DA 1F11A 3JV4B 4D94A 4Y2DB 3V52H 4LSRL 4JGUA 4NO5B 1WICA 3QNXB 4MYWB 3RGVA 1NSNH 3EDFA 2GAZB 4G6AC 2EZ0C 3ECBA 1R24A 5BZWA 2EYTA 3H3PH 1C8PA 2H9GA 1MCWM 4MA7H 1BBJB 1WBZB 5C0BA 5T3XH 5H2BB 1BVLB 5ACZA 1I8MA 1CGSH 4E5XA 4PJGA 1VKXB 3QI9D 2UUDK 1NBQA 3KXFE 1U42A 3V0VA 1NGZA 5I1LB 3ULVF 2O5XH 1BJ8A 3VMOA 1V8HA 4QT5A 4DKEL 3O4OC 5GGSY 1F4YL 3RJQB 3VGAB 4NKIL 4X4YA 3TJHD 2BSED 3GGWB 4K94L 3Q3GA 4GLRI 2X9WA 4HBQA 1I3RB 4NNPL 1LWRA 1YEKL 4Z7UF 5E03A 4P2QD 3RUGA 2BDNH 1NMBL 2NW2B 1AHWA 1S7UA 4U1GC 3D3VB 4Y7MA 3CVHB 2E8YA 1J0YA 4CVXA 3N1QC 2DQDH 1UM5L 3X3GL 3OJDA 1R5VB 4S2SB 1L0XA 3PHOB 2RJMA 1MREL 4N9GA 5DFTA 1NGYB 4OLYL 4ZPTA 2P5EB 5H37H 1UB6A 5JXAH 1EEYA 1MAJA 2AJSL 3BEWB 4OI8A 2H6PB 4JFPA 3OPZL 2EYRB 5D5ME 3PWPA 1MCBA 4J2XA 3KPMB 1D5BA 5DT1L 1JGEA 4U1NB 1PKQE 2PNDA 1D3CA 4LBEA 1OSZB 1EHAA 1TPXB 3QQ4B 1Z9SA 1ZA3B 4HWBL 2VLKB 4M00A 5MEOA 5CGYD 5AZEH 5FM5O 3GMOB 2J4WH 3D85B 2CKNA 3IYLW 5JHLH 5I1CH 1EH9A 4NJAH 4EQ2A 4NHCL 4EI5A 4OZGA 3GNML 2BY3A 5K9QI 1SYVB 3C5ZA 3FQTB 1FZOA 2DJ4A 2LE9A 3CFDB 5FYJL 1DE4A 1XAUA 5F7HA 2VDQH 3H3BC 2XACC 4L29A 3DVIA 5C86A 3ZDYF 3HMXH 3GSWA 4H5SB 6FABL 5IB3A 1LK2A 3QXDB 1P53A 2I9LA 4HWBA 2OJEB 4PJIA 1WF5A 3QI9C 3RGHA 3SPVB 1JV5B 2UZYB 4Z9KB 1NDMB 1QR1A 43C9B 1A1NA 5DRWA 5IF0B 3LSOB 2DLFL 4P4RB 1AKJA 3VFTA 5DTFB 1KNOA 3MCKB 5FCUL 1KGCE 4E0RB 3TJHC 2CLZA 1K8IA 1CDJA 2W9EL 4DVBB 5K9JH 2HFFA 1ZVSB 2FO4B 4Y4FA 3CDGB 1WCBB 2V9RA 4P5MA 4OQTH 1INEL 2VLJD 4OZ4A 5FGSA 3VXRD 4CN4A 4XBGB 1NH6A 4OM1H 1R3KA 1OW0A 1DJSA 3OHXB 3D6GA 4LEOB 4P3DA 4PGZA 3HAEB 1VB9A 15C8L 4XVTH 2Q3AA 4M6MH 1MWAH 3HE6D 4YDVA 4JFFD 3C9NA 1UADC 4PLOB 2DQJL 4EOWH 4JM4L 1N59B 3EO0B 5HGHB 1AIFB 1FNEB 1PW3A 2KKQA 5CGTA 5F96H 2E6QA 3LRSA 3ZT6A 3ZSTA 2R56H 3JWNC 4AZ8A 3P9LB 1FSKB 3SCMD 3QUMB 3MV7B 4G9FD 1F6FB 4MXQD 3HZVA 1BF8A 3BP5A 4X7SL 5IB4B 1AQKH 4AL8H 4OLWH 1MCJA 2BOBA 1I7RA 4CAGA 1DVFA 2EIDA 4ELKA 5ADOH 5CGYC 2ORBL 3HPJB 1XGUA 1PSKH 4HV8B 4ALAL 5C0RH 2BVPB 3QEQE 1NUFA 3BGAA 5F9OL 1S7SB 5IESH 3PP3K 1OAQH 2XN9B 3T77A 4OLEA 4L8BB 2B39A 3WHXB 3ARDD 5EPMA 2V2TA 3VWKA 1L6ZA 4X0KB 3BZ4A 2QQLH 4NO0B 1W8OA 5DJCB 1KFAL 4ZTPL 4TPRH 5EU6D 4LLVA 2OQJA 5ETUA 4GAJH 4JRXD 4QNPE 2EO1A 1HQ4A 3LKQA 2UV3A 3P11L 3QUXA 1Y0LB 1X3DA 5IKCB 1QKZH 3NTCL 2EKSB 1RZJC 4U6VL 2V5YA 4HFWA 5L2KD 2GI7A 3KNBB 4MWFB 3C6SB 5FDWB 4MX7B 1CCZA 5KVEH 5TFSL 5I0ZA 4M1DL 4EXPX 5ID1A 1JPGA 4J3OC 3KPOB 3CUPB 3AXLB 4MZ3A 5JOFB 4OCYH 4NQCB 1IL1B 2C1OB 2A6JB 3LCYA 1FAIL 4I2XA 1A6ZA 3B9KD 3QXTA 4F57L 4K71C 3GMPB 1E27A 1WCQA 4GW1A 4WEBL 3RNKB 2CMRL 4UNUA 3MLSL 2NX5E 1IC7H 3OV6A 4GQ9L 3ZE2F 4YBQD 5CJQL 1T66D 5EOCJ 1TETL 4JG1L 5T1KD 1J8HB 3ZMRA 1P69B 4Z7WF 1KEGH 2YKLL 2DDQH 5DMKB 1JYWA 4U6YB 4OCNC 4KV5E 4NBYB 2XWJA 3SCMC 5IIEB 3H42H 2G9HA 4HEPG 1DBKH 2HJKA 2YHGA 1AR1D 4ZAKB 4ZFFA 1HINH 4MXQC 1CDGA 4CMHC 4ZO6A 4HIEA 1FORL 3WMSA 3OGCB 4MJ6A 5ICXB 3BKCL 2EKJA 3CVHH 5DRZB 3MV9B 2EIBA 4U6XA 3GBNL 1TXKA 4MNHA 4R2GD 3ARDC 4M8QA 5DD1H 4HWZA 5IG7B 4IRJD 4UIMB 2A6DB 3QO0A 3S88L 4QXTB 3VFVA 3SE4A 3MJ8B 5BV7C 3V6ZB 4QOKA 4OZHA 3BVNA 4OB5H 4HHAA 3R4DA 4YHLH 5JA8B 1OAUH 4TN9A 4Z78B 4MJ2A 4WO4A 3M1BB 3IDXL 4OJFL 3P0VH 4YO0A 2F54D 3GO1L 2X4TA 3LS5H 4GAFB 2NY3D 1KN4H 1DQTA 2VL4A 1FV1A 4ELMA 4F33A 3WN5C 5GS3A 2NNAB 3B5GA 4GMTL 5IVZB 4G5ZH 4Q6IA 1NC4B 5I9QC 2EC9U 1FNGA 3T1FA 5TH2A 1G9NC 3GIVB 1P4BH 4HUXA 3D5OF 1VACA 3BESR 4XNYL 2X4RB 4GXUM 3MXVL 2Y5TB 1A4KB 2R23B 2ED8A 3R06A 1MHEA 3B9KC 3ISWA 5I8EB 1QRND 3SDYH 3GI9H 4J4PD 5JOEA 2B1AL 1RSFA 4WTZG 2CUMA 4M5YL 1VERA 4KKAD 3M8OL 3DI3B 4YBQC 1T66C 3NFSH 4M7JL 1UWGL 3S37X 4KKCD 5JO5A 4HUVB 4FABH 1KUMA 3VCLA 1H3PH 4ZSOB 4DGVL 4L1DA 3GI8H 1BVZA 3EYOB 4GRMA 3AU1A 1FIGL 3BD3A 4ODSL 1CDYA 4PY8J 1OAZH 4AM0B 3MREA 4K9EH 2VSDA 1CDCA 1KN2H 1Y6KR 5HGBA 1AR1C 1HHIA 4KRPB 4ZDHA 4YHML 1EVTC 3SDCB 2EE2A 1KLGB 4ZUVA 3FT4B 4NQXA 4TSBL 4LLQA 4H8WH 1YN6B 3HAEH 4HZAA 5J11C 3OAZH 4I3RL 4KK6D 4H0HB 3B9DA 4MJIA 1FC2D 5FYLD 1PX4A 5F7EL 3SJVE 1JHTA 4R2GC 2XNAB 4F8TA 3EOAA 2UYLA 4IRJC 32C2A 4OLXH 4BFIA 3TN0D 1MF2L 1GOHA 1GVIA 2GY5A 1S7RA 4LDEB 2IQ9L 5C6WH 3RIAF 3EFDH 4XP9H 4O2CA 1GJIA 2MNUA 4QF1A 4UT7H 5D71H 4HMCA 4QWWD 4Z7OF 1XGRB 4OCXL 2ZOKB 3CZFA 2NY3C 4XMPH 2NY2C 2VMFA 4ISVA 3KYNA 4NQSB 3KJ6H 4JN2B 2AK4E 1CICD 4QRRB 4N0FB 4S1QL 4XVSL 2VDPL 3V4UH 4JANA 4JREC 3PGDB 3KLHD 5SX4H 3REVA 2OK0L 2AI0L 5IQ7H 5I71C 3OTTA 4AG4H 2YUXA 5E8DH 4ZS7H 4PTUA 3CX5K 4LVHB 4BKLA 2WUCH 4NUJB 3RVVD 2OSLA 3PG2A 5I1GL 4YEEA 3X11B 3BPNB 3V5KB 3P4OB 2OCFD 4A2LA 1RZGA 5CJ8A 5F1SA 1FFNA 3BXNB 3FKUS 4PJAA 4XPTL 1ZLWH 3BZFA 2GITA 4OCRH 1HHKA 1S9XA 1UYWL 4J4PC 3TCXA 4LSVH 3E1F1 1EJOH 4XCYA 4D3CH 2DLIA 4UV7H 1JN6A 4DAGL 4KKCC 3ZTNH 3MGOA 1IKFL 1HDMA 2RQ8A 1YQVL 4XXCC 1U3YA 2DWDB 4H1LB 3L3JA 2X4OB 5EWIL 5DMJB 3JTTA 1RK1B 2HT2D 3MRPB 4N1EA 5I74C 5AYUL 1OD9A 4TNVK 1T03L 4JO4L 4WWKD 3UTOA 4HMDA 4DN3H 1CLCA 1XT5A 4OD1H 1F58L 2BNRA 3OKLA 3VRIB 4U1KA 1F2XK 2GW5A 2W59A 4TYUA 2E9JA 3BIBX 3FN3A 2Z92B 5EN2B 4KDTA 1MRDH 4HS6B 1BPVA 4KK6C 4WHYG 3EYFB 1MJUL 4F7MB 1DN0A 1X5GA 2HN7A 3A0OA 2JK5A 4H20L 5C0CD 2DLGA 2VZOA 3TN0C 1ZANL 2AK1H 3LVEA 4J1UA 4JGMA 3OXSB 4R0LA 4KQ4H 3UJTH 1CD1B 4UINH 3NCJH 2KBGA 3GSUA 3WNPA 1WVZA 4K8RL 1U9KA 4MXVF 2YPKB 4QWWC 4I9WE 1TVBB 3F7QA 4KPHL 1UKSA 1A3LL 1SY6H 3ARGB 2DWEB 1IC4H 1CFQA 4XC1H 5LXGH 3HZKB 1CICC 2VLRB 1CIDA 3FQXB 2W92A 3G6JA 1CK0H 3KLHC 3FB8A 3SO5A 3ZTJH 5D8JH 4FZEH 4JAMA 3SGKA 1U8OB 4PJEF 4HKJA 4OCWH 5L0QB 3RVVC 3QEGL 2QBWA 2AAVA 4Q0XH 3VXMB 2FECL 2NY6B 5IBUB 4L5FH 3H7BB 3QH3B 1YYLH 2GKIA 3QIWD 1ODAA 3UDWA 4KROD 4MQXD 4YHYB 1GXEA 1GGTA 3DUUA 1J1OL 1RZFL 1F8TH 1N3NA 1P7KB 4X6BA 3UTPE 5D7LA 1UH4A 4MMXC 1A9EB 1A1MA 5L2JB 4NRXA 4IHOA 1E6OL 1U3JA 1KT2A 1BBDH 2EDRA 3EUUA 1H3GA 4C56A 4L3EB 1B6UA 2DI7A 1FN4A 4P5KB 4BQ8A 4R96B 4HBCL 8FABB 2HT2C 4NFCA 2OLDA 2HVKB 4WWKC 1KCVH 4WIQA 1I1FA 2VITA 5JORB 5IFJB 2L7JA 1BWWA 1FYTA 3L7EB 4QTHA 5JQHC 4FQJH 5HGDB 3HI6H 1J12A 4P57A 4QRTB 4NT6B 3TIDB 4C59B 1MVUB 2FECI 1T04A 4GAGH 4WUUB 2HKHL 1JFQL 2LFGA 1RU9L 1LP9A 4N0YH 1FLTX 1AGFA 1MHCB 4ZFZA 3UTTA 5C09D 3U4BH 4Y8DC 4CU8A 3PWVA 3MCLH 5F1IB 4LMQE 3BKMH 4FNLL 4P2QE 5EG6C 2O5YL 5LBSH 5JW3L 2EDOA 1T7WA 1Y6MR 1H15B 2NY4D 3H0TA 5DEFA 3TNMA 3L3OA 2Z31B 4NZRL 4R4FH 4XVJH 4D9RD 4Y5VB 2F53A 1JHKL 5CEYA 4RMVA 5EO9A 4NWTL 5I8KL 5CJXC 1TJIH 4JM2A 4A6YL 1F3JA 2QSVA 2XRAL 4KAQH 5EUOA 3HUJE 1X5YA 2ATPA 3S3SA 1CFTA 1CTOA 3SKJH 5T33L 5C08D 1TQCB 3RAJL 1NKRA 3RHWK 2WW8A 4JKMA 2NY2B 4BUHA 4KROC 4MQXC 5ISZB 4NJ9H 4WDIB 3WFBL 1EXUA 3WXWL 3INUH 3HFML 4CBPA 3VFRA 2EE6A 5AG8A 3AS2A 1W72L 5CMAB 4BSVA 5K9OB 2NZ9D 4GW4A 3KLDA 5E8EA 4A6YA 1FFOA 3P73A 4JO2H 5AD0B 5TF0A 4M7LH 5ESQA 4NKOB 4F2MB 3RL1B 5B22A 4GG8A 4K2UL 1IM9B 4P9HL 2HLFD 4G6FB 1BGXH 1PFCA 3VXUE 2GJZA 3WFHA 3AY4C 2FEEL 2P46B 2UVEA 3U2SB 3VDBA 1F4XL 2X1WL 3U9PH 1P2CB 2W65A 3PGCA 3KWWA 2MKWA 1A9BB 5GHWL 1BM3H 2IFGA 1W72A 5ACLA 1LK3H 3GK8L 4JRYB 3WV0A 4MLIA 4X7TA 3WKMH 2ENSA 1JE6A 3KHOA 4H1LH 3FQUB 4YHNB 4CJ1A 2D4DA 3DTXA 4J3WA 4ZQKA 3AB0C 3DGGA 4X9HA 2FGWL 5IM7B 3ILPA 5D7SL 3T3ME 2EEAA 3VDAA 1UZ8A 2DIBA 2FJGB 4M62H 4X98A 1RK0B 4ETYA 2ED7A 2VLJE 3DXAA 3VXRE 4NN7C 2NY4C 3NN8A 2B4CC 3OB8A 3PQYA 3L3GA 5GRXG 4X5WB 5ILTL 2OR7A 5FM8A 1P9MC 2IBBA 2FBJH 4PRPD 4LCCB 4JFFE 2XKSA 1VGEL 4DKDC 1A7NL 4HT1L 4LPXA 1ZWIB 3G6AB 2FEEI 1S5IL 5IW1A 3MLRH 4GW5A 3ARFC 3OXRA 1JPFA 5F3BB 3O3UN 3U0WH 3L5IA 2ENYA 3C08L 1RIUH 2PYEB 2A9NL 1EEUA 4HXAL 3MRRA 5EU3A 1FCGA 3QNYB 1ZHLB 1ZT1B 4G9FE 4M6NL 4MGXA 5D72H 4H26A 4JZJA 4PGBA 1CF8L 3FQWA 2AV1B 3SDDA 1SEQL 4XC3L 5H35B 1A7RL 4P2CG 5EUKB 2NZ9C 5FECB 4J23A 2H41A 2C4FT 1NEZG 1R5IA 4AIXA 4PS4L 3WFEL 2BOCB 4XMLH 2R1XA 2DKMA 4AJ0A 3S35H 2Z4QA 2ICEA 3NABL 4BFBD 1AC6A 2DQHH 2JJSC 4ZOAA 3EJYD 5EU6E 1KG0A 1CE1H 2HLFC 4HK3J 1B4RA 3LIZH 4P5TC 1GZPB 3VXTA 2CRYA 3UPRB 3O6ML 4C83B 1OAXH 3A67L 4DOHE 4I18C 5DUMH 2YPVH 1HEZB 2R1YA 1MCKA 3BQUB 1VA9A 4FZ8H 1CR9H 4FTVA 1KCUH 1OGAA 4Z0BH 2XZAH 1TZHB 1Q0XL 5DUBB 3F58L 1IAOB 4BZ1L 3NH7L 1VFAA 3JWDL 4KHTL 1A7OL 1EMTH 1Q9KA 3RVTD 1IBGH 2VISB 3OKDA 4GRLD 4E41D 5K33A 1LE5A 1FL5B 1NFDA 4HKBB 4M6OL 1BQHA 1NC2D 3VI4F 1EFXB 4YXKH 3S34L 1RZ7H 5DR5L 3P9MB 2HFGL 3T0ED 3NMEA 2WBJB 1QPXA 4PGDB 4PRIB 4RRPA 5ESVA 3RWJA 1DQQB 3U79A 5DHVB 1J1XL 5D1XB 4LU5L 3ROOB 1QNZH 1PYWA 4XNQB 4UV4H 3UTZB 4FFZL 4JQIL 3PP4L 4XNZB 5IEKB 3QUZD 4XX1E 5CSZA 3QDMB 2HRPL 1UWEL 1NBYB 5GRZA 5HYQA 1P4IL 1RHHA 2QL1A 5DWUL 1IGMH 1KPRA 1IARB 4PG9A 2VWEC 3GMNA 5C71A 1EK3A 1IEBB 3QA3B 1WGOA 3VGDA 1L9NA 4PJ7E 2FJHA 3MOBL 5DSCA 3LH2H 2VXTH 4PJHE 1Z5LA 4WJ5B 3RTQA 3MOAH 5B39B 3FFCA 3MACH 5D70L 1J9CT 3J7HA 4FQ2H 4RAUB 2C1PA 5FOBB 3FQRA 1HHGA 5I19L 3QUYD 4QRQB 1MNUL 4DGIL 4HDIB 2VN4A 3EJYC 4XGZB 2NY5C 3AROA 25C8L 1S5HB 1QSED 3VXQA 2JCCB 1QACA 1TZIA 1T21B 3GSOB 4FQ1H 1RJCA 5KVGL 3EYSL 4OM0H 2F54E 4JDVB 5HDBE 3V0WL 4L8SB 2F19H 2R0KL 4ZXBA 1DDHA 2YPLB 3IETA 3M07A 1KPVB 4PJDF 4DCQA 4ZPVA 2XPGB 1RJZA 1T5WB 2X10A 2IPTH 4NN6C 2BJMH 4PP2A 3THMH 1NCWH 3LQAH 5I1DA 3U36A 5CD3A 1O0VA 1DANU 3IDNB 5GS1A 1YEHH 3B3IA 3VI3E 1QSFD 4HGWB 2OTPA 4PRDB 1RMFH 3RVTC 1LEKA 3T04D 4ONHA 3VRJB 3KDMB 5I1KH 2GEEA 4QRSB 1I9RH 4UT6L 1JYNA 3NPSB 4LQFH 5GJTH 2IANB 3IJHA 5KS9B 1QRNE 4NQED 5LGHH 4GJTB 2EDLA 1E4JA 3T0EC 1PG7H 3MRQB 2Q8BH 3LEVL 4RMTA 1KYOK 1J0KA 1XZ0B 1WC7B 4EVNB 1CQKA 2PXYD 2VDLL 4M5ZH 4NSKB 3AB0B 4NFDA 4XRCA 3AMKA 5I6XC 1JTOA 4Z0XB 4WNQB 4LSTL 1UKTA 3QUZC 3WSQL 2ICWB 1CFBA 5DGQA 1VESA 1FL3A 4X6DE 4MQ7A 1FLRL 5DJAB 1QLRA 5BJTB 4NQCD 3TZVA 4WI5A 1XF2A 1G7MB 4KK9C 5DD5L 3LN4A 1YUHB 4PJFB 1EO7A 1T22B 1HCVA 4JKKA 1I7UA 2HAZA 4JO3H 2C3GA 1XEDA 4P4KB 5FYLE 1GRWA 2BMKB 1A6WH 4P9ML 5DEZA 5F3HB 4YR6A 1T2JA 3NZHL 4N8CH 2ERJC 4X8XA 3QUYC 4NCC1 5E00A 1QLFA 5EO0B 2APBA 3MV01 4YC2B 3T65B 1A0QH 1SJVA 2ZCLH 3RBGA 2AQ1A 1HQRA 2FD6L 3FTGB 4O2EB 1QFUL 5E8OB 2P5WB 3NIGF 1UG9A 2IAMB 5INDA 1INQB 3I2CH 2QV2A 2GSIB 2Z35A 2IPKB 5FF6B 1UWXK 1U3HB 2IG2H 2LU7A 2ZNWA 2FHCA 3BGMB 4IS6A 2HFEA 1NBVH 4NRYB 2HG5B 2NMSA 1I9IH 4TSAL 2Q20A 5ECJE 1ED3B 5H94B 5JUEL 4ZNCD 4KKBC 5SWQB 2O93L 3MV8B 4P5TB 5I0DA 3OKKA 3KGRA 5LGJA 3ULUH 3ZE0E 1P4LB 2XI9A 3B6SA 3SGDI 5I1JL 5CZKA 2PETA 1T20A 3DRTB 5LCVL 1P7QA 4NZTH 3O9WD 4N9OB 1WEJL 5K9QG 5B8CA 3GBML 3MUGB 4PRNA 4EXKA 4P3WA 1OAYH 2BRRH 2PXYC 2V5RA 3L5XL 4KV5F 4I0PB 3SQOL 1H3TA 3GJFK 5EO1B 1NC4D 3NIDE 4G3YH 4YHPB 3EOTH 4KTEH 4G42A 4RMUA 3UTSB 4APQB 3EDEA 1GGBL 1RQ5A 1ZMYA 1AY1H 1GHFH 5F1NB 3NCYS 1AO7B 1RZ8A 5JOPD 4KXZI 2CDEB 4ODVH 5ALBL 1DQJB 4MNGB 5D96B 4KQ3L 4K3EH 5EC1B 4UQ2A 3V0AC 4XAWL 5MI0B 5CJ5A 5T3XE 1Q94B 1VENA 3TA3B 5F1KC 2FX8H 5HYJD 2GK0A 1KENL 3MV11 5ID0B 2GY7B 1I8KB 1QFWL 3L5HA 4KJPC 3QCVL 5DHVH 3QCTH 2WV3A 4XNUH 3C09C 2F15A 2H32A 5C0CE 3U1SH 3RU8H 4YFLF 1WAAE 1SMOA 1KTLB 1H0DB 3FT3A 1QYGH 3MLTA 4Y89A 4JFXA 3T0XA 2DQTH 3FO9B 5IB2B 5HGAB 4ZFOL 1A2YA 1DL7L 3RA7H 5IW6A 2AABL 2ESVB 3FHAA 2BY0A 3IFOB 1JUFA 1REIA 1W0WB 2E27H 5LWYH 5C0AA 1WTLA 2P8MB 3GMQB 3UYPA 4EEEA 3SDCD 2OI9B 3HE7B 1IQWL 1MY5A 2Y9RT 4JHBA 4O58L 5TE7H 5HVWA 1M7IA 5C0FA 2R0ZL 3C6LA 2ADIB 2CIIB 3BAEH 5CP7B 3OKMB 4PJ5D 2X4QB 3HRZA 5F8QC 3JWOH 4PYHA 3LQMA 2X7LA 3CH1B 4QXUL 4ZFOA 3VFOA 5CZVH 4JPVL 3RVWD 3FB7B 1U93A 5EDXA 3FONA 3W2DH 1ZHBA 2CKBL 1W8NA 1MFBH 2ZUUA 4AIZA 1QBAA 5IMLA 1S7QB 2GJJA 3O9WC 5MEPA 4PG2A 4CMMB 1R0AL 1JNHB 4PGEB 2MFNA 3EOYG 1JMZA 4PBWD 1RZIA 2MCG1 1U2HA 1D9KA 4QRRD 1B3JA 3IFPB 2ZJSH 4LVNB 1IGYB 1XCTB 3CJJA 4IRSB 4MA1C 1GZQA 1Q9OB 2E5EA 1CGVA 1NANH 5IV2B 5DFVD 1MFAH 5IVXE 1S7XA 4PD4J 1CLOL 1SM3L 4RGOH 3O2VL 3S36L 3SQBA 2B5IB 3SKOB 1PY9A 4DGYL 3QHZH 4L9LC 2CKBA 2FHBA 3LEXA 4CVZB 3SJVA 5EC2B 5F89A 2R8SL 5C0GA 3BKYH 1ZHNA 2BSSA 4U31A 4H88H 5D2NA 3RNQB 4QYOB 2EIZA 2JLLA 3MROA 2GFBB 1FNSH 5DHYA 4KZDL 5FYKD 1YN7A 3I6KB 2MKLC 1JWUA 3MBXH 3QJHB 2G5BA 2VQUA 3KR3H 1OWWA 3GKZA 3OKNA 1V3JA 3W0WB 3FHQA 4I48A 4QRPB 2UWEE 3RDTD 4HH8A 3EYUL 1J11A 1L7TH 3RPIA 4FP8L 3OB0H 5JHDD 5T1MB 3QDJD 2AK4A 2JB5H 1URLA 3FB6A 4YE4L 8CGTA 1IKNC 1PEZA 4XPHL 4L8CA 4D9RE 2AGJL 2YS4A 4LLDB 1WFUA 1N2RB 4G8IB 4RX4A 1OP3H 5IFAH 3LV3A 3QQ9C 2VLLB 2G75A 3RHWF 3FB5B 4JVUA 2VC2L 4XCNA 5CUSH 5FOJA 4I77H 1MCOH 4WW2A 2X4PB 1BF2A 4TUKH 3K2MC 2HJFA 2Y06H 4IJ3B 5C08E 3RVWC 2M1KA 3HC3L 1Y6NR 1J5OH 1RVFL 5D7IE 4X6EB 4HIXL 3RWGB 5IMMB 5I1HH 4U3HA 2YUVA 2C5DC 1ORSB 5C9JA 4XBPA 1F42A 1MUJA 4RMWA 4K7PX 5JPNA 4Z7VE 2AJYL 1LEGA 5HPMA 5C2BL 1QLEH 3QIBA 5E9DB 3WE6B 3T2QA 5I1IL 5JNYB 4GKSA 3VE0A 5KSVB 3V6FB 1RAMA 5D1ZC 3DO7B 4M8VA 4LHUD 5DFVC 4BQBA 3GHEH 1V5JA 1BHGA 3TBWB 2FBOJ 1MCSA 3TJEH 2AXGA 3CMOL 3VXMD 4EUPA 3MXWL 1EHXA 1I1AA 3TCLB 1VEPA 1VADB 3VDCA 4ZTOH 2DB8A 1D5ZB 5DC4B 3BDYH 2HT3D 4RBPH 3MRJB 1UCBL 1YNTB 4EN3D 3ZO0A 4YH6A 4WU7B 1T7ZA 1EHLL 2I25N 3ZDZE 3H9HA 3DUSA 5EZOL 4DTGL 4IMLA 5TDOB 5J89A 1UJ3A 2GSGA 4L3ED 3U7WH 3DECA 2NXZB 5K9KA 3AREB 3RDTC 4N5UA 4LSUL 2MHAA 3DRQB 3FRUB 1G7QA 4GKZA 3KPRB 4OZIB 3U9UA 2V2XA 1SVCP 5I76B 3RGVD 4PRPE 3G04A 5F72S 3TV3L 1A1OB 3VFSB 1OL0A 4Z7WA 3WFDL 2YXMA 1EA9C 4WTWA 3BP7B 4WUUD 3IF1B 5HHMD 1F5WA 3DGCR 5D2LE 5ELIA 3TESA<