1X5KA

The solution structure of the sixth fibronectin type iii domain of human neogenin
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
124
structure length
124
Chain Sequence
GSSGSSGTAHGTTFELVPTSPPKDVTVVSKEGKPKTIIVNWQPPSEANGKITGYIIYYSTDVNAEIHDWVIEPVVGNRLTHQIQELTLDTPYYFKIQARNSKGMGPMSEAVQFRTPKASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of the sixth fibronectin type III domain of human Neogenin
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Neogenin
total genus 8
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2005-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1x5kA01
5AZ2L 5EUOB 1YMMA 1MEXL 5C3TA 4DVRL 1WV7T 4BA8A 4XC1H 1YEDA 2VH5L 2X7LB 1RZIA 1UZ6E 4ODHL 1QA9B 1MWAA 3HE6A 3QNXB 2AGJH 5IEKB 2MQ3A 1HQ4A 1FL6B 5IK3B 5KSVA 2X89D 3Q6FB 1A1MB 3ARQA 5IB1B 2H9GA 1X7QA 5E8EA 3QFJD 3O8XA 3BPCB 2LABA 4M8VA 2CIIB 1KJMB 3QUYD 3RPIA 1DVFA 3SBWC 5FCUH 3CVIL 4JHZA 3H7LA 4PTTA 1U2HA 4IMLA 4BUGA 4PRAB 1DSFL 2L7UA 3IDIB 1MHHA 1YQVH 4TUOA 5IHZB 3T0EB 5EUKB 2WBWB 5D1ZA 4Y0GA 5T5NG 2QTEA 4WO4B 4X4MA 3H9HB 4UB0L 3IDNA 3B5HA 4X9IA 2G2RA 3GSNH 3VFMA 4QRRE 3F5WB 3AB0C 3HFMH 2DIJA 2NXZD 4FG6D 4Y16D 5DQ9B 4LVHB 3QO1B 3WLBB 4N0YH 3BESR 3S36X 3TVMC 5LG1A 1SMOA 3WFDL 1GHFH 1WZMA 2HYMA 3QO1A 5D2NC 5IVZA 2BNQE 4JPWL 1QLEL 4HWZB 3F12A 1WEJH 3CUPA 1IAOB 3BZ4A 3UTQA 2C3XA 2JIXD 1CCZA 4LCIH 3T0WA 2HFEA 3QDJE 2B0SH 3A6OA 1T83A 3SGKA 3MUJA 4ZPTB 1V5JA 4RWYH 3TO4B 1I85A 3NIFF 5L7XH 1P9MA 3LKSB 4JKMA 4P99A 3RJDA 4QRRA 2YEZA 3NCJH 4PRHB 3LEYH 3LEVL 5FB8A 1KT2B 3CU7A 3VWKA 4FXKB 1GZQA 2ZUVA 4POYA 5INCA 1G9NH 1V8HA 4GG8A 1KB9K 1R3JB 2GUOA 4K3HA 3IF1A 4KDTC 5HDOA 5IKCB 3OGCA 5FOBA 4ZXBC 1Y18B 3O41B 1PJ9A 3LS5L 3QEHB 4OUOA 2EYSA 4X9GA 3LS4L 1N7ML 1HZHL 1EDQA 5BZDB 1R0AL 3IDJB 1QNZL 5T3XL 5EU4B 1HIML 5HHOE 4HHAA 2OJZH 1CLOL 4NGHH 1FNLA 2NY6B 2QQNL 5L88H 4YDLB 2VTFA 5K59E 1CR9L 1DL7H 4M8QA 4V1DD 4HEME 3NFSL 5ILTH 1JE6A 1UWGL 5IROC 4NHCH 4CVXA 1HILB 2FL5B 4P46A 2CR6A 1NMCB 3C60B 3DURB 4PV9A 2FHFA 5GGSB 2OP4L 3QI9B 1A22B 1BEYL 2WLZA 1OWRM 1Q9WA 3FAXA 1ACZA 3ULUL 1W0WA 3RTQB 1CXLA 5TH2A 4GBXB 1ZGLB 3S3PA 3MLUH 2OK0L 3B3IB 5BOPA 2VIRA 2APVA 3DO3A 2CDEA 3QCUL 3VXRA 4JN2A 2HJLA 3D39A 3SO5A 5FUZH 3KPSA 1ND0B 4JM2C 3QP3A 2JB6B 5D70H 2A0LD 2WWMC 4GRLB 2KZWA 1FGVL 1LQSR 1FL5B 2HVJB 5F1NA 4QRPE 1LO4H 4OZFH 3C8HA 5CSZA 1FVDB 3MX0A 1TJGH 3EHBD 3M07A 1XH3B 5I76B 1DQML 4JQVA 3HB3C 4DGIL 4NZDA 5CSBA 2A9ML 2W9LA 5DWUL 1I8KA 1B3JA 1KIQB 1HH6B 3FQUA 4Z7VA 5C0RL 4MA3B 3SDXE 4WO4A 4OGAC 5EBMA 2Q1EA 3PGFL 1X6LA 3WXVH 4GAYA 1NGWA 3QJHA 5EBMB 3BRGC 3KDMB 4JJ5B 4XHJC 3BP6B 1I1RA 3QDME 1JNNH 4PJEB 4KFZC 4Q2ZA 4M43L 4L4VA 3BE1L 3HPJB 1CICB 5D7IA 4JRYA 1MCDA 4IRJC 2VOTA 1ADQH 4L5FL 5CZXD 1MCBA 1U0QA 3RWEA 3WE6B 4XI5C 4HUWA 3TP4A 4AH2B 2X4PB 2M8XA 2GJJA 5IGXH 2PETA 3LS4H 4G9DB 4N8CL 4WHTB 4TSCH 5AZEL 3EOYG 2OYPA 3L3OA 5LXGL 4PJXE 4PTUA 5F1SA 1JGDA 4LCUB 4PG2C 4UZGA 1OSPL 4WV1A 1KT2A 5E70A 1B6UA 3KPRE 4XPGL 5D5ME 5DZNA 1NCCH 1T3FB 4PY7A 4FFWC 2E7LA 1Q0XL 5DMKA 1NBVH 1GPOH 2EO9A 5KS9B 2JJTC 5CKGA 4F58H 1D9KA 3ARRA 2B2XH 4MX7A 2C26A 5DJZA 2VXTH 2Z31A 4OSUL 4IS6A 4EDXB 1WBYB 1K3IA 5D2LF 3MRBB 1AC0A 2VXVH 3JWOH 3OKEA 3VXNA 2NX5E 4EI5C 2E7MA 5EOCJ 4ZUSA 3V2AR 2APXA 1A4JA 4BFEA 5CBEB 4K3EL 3I2CL 3UP1A 1RZJH 2YPKB 1QSEA 2ED7A 1JGLH 3D87B 4ZUWA 3OKMB 3U0TB 5AZ2H 3AAZB 2ZG3A 4RFNB 2QSCL 3O9WD 4OF6A 4ZOBA 5DYOA 1JGVL 3T2OA 2NY4C 1LK2B 1FFQA 4APQA 1FYTD 4GXVH 5JLZA 1HILA 4XMKL 1GH7A 1NLDH 1HXMA 1WJ3A 5BJTB 5LQBH 4MAYB 2Y5EA 4CMMB 1IAOA 3BZ4B 1N5YL 1MRFH 4P2QE 4P48A 3QDMB 4IDJH 2A77H 1U8OA 1S7TA 4PJFE 4G7YL 3S5LB 2R2CA 1BOGA 3QPQD 1RUAL 2NLJB 2ZCKL 3ZYOA 2JCCE 3DXAB 4OF5A 1GSMA 3KLAB 4RX4D 4DN4H 4NQDE 4FTVD 2FX7L 4I2XA 4YXLL 3IDGA 4I3RL 4A6YH 3DJ9A 1RZ8A 5FUZL 3OG4B 2AV7B 4Y4HA 4P4RA 4P4KB 4F33A 2DLIA 1IAIL 1D6VL 4IRJA 2WAHA 1J86A 3EO1B 5CGYC 3AM8A 1U8JB 1F58H 1FZMA 2VL4A 3GJEA 5IFJA 4XXDA 5LGJA 4BQ8A 3S97C 1WLHA 5AYUL 5HI5D 1E4WH 1H8OA 3QWOA 3CXHK 1YY9D 5GRJH 5EDXA 2BVQA 2AK1H 3QWOB 1HHJA 2D3VA 3BP7B 4ZQKA 2R0WH 4XGZA 3HNSH 5C0NC 2P7TA 4F37K 2HG5B 4GW5B 2P8LA 1X5ZA 4PJ9C 4XMPL 3QPXL 2OQJA 3NIFE 4PJEA 5F7NC 4I77L 2EDHA 4IHOA 2D4DA 2WZPD 3GB7A 2EDTA 5F7FA 4Y4KA 4NJAH 2IC2A 2F54A 2VLJB 2AABL 3QG7L 2QQLH 4UBDC 1OTSD 3VXSD 3P0GB 3BT2L 4D94A 3MLXL 3GSWA 3HG1A 3BGMB 4PJEF 4JQIL 3VFNA 1K4CA 5I8EA 4OB5H 2VWEE 4Y2DC 3QUKA 5EZOH 1S5IL 4JN1H 1TCMA 3U36A 4PB9H 1KPRB 3RY6C 3T8XB 2M26A 2YUWA 1S9WA 5LXGH 5IW6B 2VIRB 4PJIE 4QXGL 3QIBA 4XNQB 3EFDH 5K9JH 1FVCA 1FRGH 5DLMH 5EWIL 1DQLH 3KR3L 2J2ZA 3MRFB 3TBVB 4NCC2 1R3KB 4ALAH 2OZ4L 5I75C 4JDTH 2N4IA 4L4TA 4KRLB 2OMNA 5KW9H 5F6HJ 3RPIB 5LWYH 1LK3H 2HAZA 4JY5H 1QSZA 2PXYD 4PTTB 4CDHA 1FDLH 2YMXH 3HG1E 4I2XE 4CU6A 1MJJB 1BIIB 1GC1C 2DI7A 5GS1A 1IEBB 3Q6GL 2Z31B 1J5OL 1S7VA 3T1WA 3MUY1 1S7UA 2XN9E 2GJ6D 2I27N 3P30H 4V2BA 3DX7B 2OL3H 4NZUH 3P4MB 3TGXA 5I6XB 3GMQB 5DEFA 5I1DA 4XP6H 3QXDB 3KPQB 5E6IC 3OAYH 5TDNB 5IT2L 4X5XA 3P0VL 2WIIB 1I9EA 4MDJB 3BKJH 5E2TH 1QG3A 2VDRL 5ANMA 4Z78B 3HR5A 3BP4B 1IGCH 4BQ9A 2JELH 3RDTD 1NUGA 4I48B 1KB5L 4NRYA 3UC0L 4I3GA 1C8PA 1MLCB 3OKDA 2H6PA 1I85C 2R2HA 1S7TB 3EYUH 4H26A 2FZ3A 4KK6C 4TUJA 5BVJB 1QBLL 3VI4F 1T89C 3HLAA 2Z91A 2ZCKH 3S96A 3WNLA 5AAWA 3HC0B 3V4PL 4H0IA 3T2QA 1CU4H 5IV2A 1G9NC 4Q6IC 4A6YA 3S35H 4X0KB 3MRJB 2BC4A 4WFEE 1XF5A 5BO1H 1OTUC 1BM3L 1DE4A 5E2VH 3FFCE 1BAFH 4ERSH 3F6LA 2RGSA 1D6VH 1TZHA 2OP4H 2BOCA 4YHNB 1BEYH 1BJ8A 1DBAH 4P5TD 4O51B 3JV5A 3HI6H 3UTZB 5LGJB 3EDJA 4LAJH 3OB0K 2HJKA 2W59A 4NPYB 1R3LB 4G3YH 3RL2B 2O61B 2Y7QA 5HHME 4MXVE 1N64H 2OR7A 5BS0A 3MLSL 4NT6B 2J3SA 3LN5B 3NIGF 4QHMA 1EMTL 2NTSP 3BP7A 1TIUA 3NTCH 1Y6NR 5EZOL 2XY2A 4QYOA 5F1OB 3NCBB 4N9GA 3X13B 4DAGH 5DRXB 4RZCA 2B4CH 4L9LA 2V2TA 1UCTA 4O5LL 4HPYL 4LVEA 3VJ6B 5A16A 2ZCHL 5IW1A 3X11A 3MPCA 3QRFM 1U8KB 3SBWA 1U8PA 1G0DA 4MS8D 2E7CA 4YBQC 2XWBB 4C57C 3TYFA 3DUSB 5D7IF 1M7IB 5DURD 1EHAA 5LWYL 3I9GL 1Q9OB 4IRSB 2J6EA 3PGCB 4H1LB 5JLZB 5J6GB 3D25B 3TH3T 1I7UA 4RGMB 1U3HA 3MNZA 4TVPH 4KRPD 4KRNA 3JWDH 1KPRA 1DQJB 3T0AA 3FHAA 4Z95H 2KQMA 1ZE3C 2C3HA 2W0PA 4KJQD 5C07E 2VXQL 2J5LC 1OT1A 5TF1H 5DD1L 2KUTA 5EWIH 2F53A 5F96H 3BPOB 4ENEC 5HGDA 1G9MC 2MPAH 4JGMA 2UUDH 3MLRH 4U1MA 3T1FB 5KZCB 4XCNB 4YHMH 5ISZD 1N0XL 4OF0A 4PGDB 1A9BA 5AUMB 3UJJL 1Q1JH 1YMHB 4LCWB 1HHHA 1TQBC 5IR1A 1ZVSA 3HUJE 1L9MA 4P23B 1NKRA 2B1HH 1IGJB 1OP5K 1INEL 1LEKB 4NNXB 3QAZB 4C56B 1WC7A 5E94B 4JFDA 3NA9L 5F6HI 5JO5B 3TM6A 2H2SC 4PGCA 3RVWC 3RGVC 1BGXL 3OF6A 1WIOA 4XCEA 5HYEA 1EEYA 1H3VA 2DQTH 2O26U 5BZWB 4P2RD 3G04A 1UJ3A 4Z7VE 2ZUQB 2X4NB 3DI2B 5DFWH 5IVXA 3NFSH 3TNNB 4FP8L 1D5ZA 3NVQA 4LHUB 2EXWD 1J12A 3WSQH 1R5IB 3D0VA 4FQIL 2WIMA 3OSKA 2E6PA 3O0RL 1FP5A 3RUGE 2IAMD 1PD6A 4Y19B 1N3NA 1FHGA 4G9DA 1S7WA 4A6YL 1ZLUH 3SJVD 3VMOA 2O93L 3X12B 4P3CH 3PWVA 2FJHA 3WIIL 3DROB 1C1EL 2DM7A 2GI7A 2BXYA 4U6XA 1J1PL 3QDGE 3ARBB 1QSVA 1QR4A 3QIBB 1S7XB 2DTMH 5E03A 3RBSA 5JHDB 5LQBL 3D3VD 3VFOA 3SDAD 4QTIH 5KSUB 3MNVA 4H88L 2YPLA 3WLWD 5KTEH 3DETC 2V2WA 5ENWB 2FATL 2HTLC 3D9AH 2WBKA 3P0YL 1IC5L 4DN3H 4B41A 1XIWA 2EE9A 2FO4A 1FAIL 3U6RA 2HH0L 4P2OC 3MV7A 4HPOL 4DOHE 1ORSA 4K94L 3HC3H 4X7TA 4DGYH 1ZT7B 4OZFG 4XPAH 3OKEB 3SN6N 5D9SA 5IB3A 5IBUB 1ZHBA 5J89A 5E99L 1QRND 3NN8B 3RNKA 4X7SH 1P7QD 1K5NA 5LAXA 1NCAH 1LEGA 1KXVC 4N0UA 4M43H 2CKBA 1W0VA 3CCHA 2J1KA 1N4XH 2PCPB 4HZAA 5ANMB 5HVGB 2F5AH 2VZ1A 3QNZB 1NEUA 2DLFL 3MBED 2JJUA 5J4MA 2I9LA 1MCEA 5DQJA 5KVFH 1W8OA 5EOTB 1R0AH 3QISA 2COQA 3PABB 3TA3D 1NPUA 1GGCL 2B8OT 3L5IA 3X3GH 3LN4A 1JTPA 3ARGB 1MF2H 3O6LH 4NQDD 4I77H 4NC2B 4L8SB 3TIDB 4BM7A 1FYTA 1RZ8B 1KCUL 1T21A 5ESQA 4Y4HB 2WW8A 2K3TA 1M7DA 4JG1H 4XP5L 1JHKL 3SJVE 5I1CL 4U1SB 1CFTA 2R2BB 3HHRB 4NQEA 3ARDD 3EOBB 1I75A 3VXQB 3CDYA 3FN0L 2IBZX 5BQ7A 4I0KA 2DQFB 4MA7L 3N1PC 1FVEB 1KTDB 3AS3A 2J88L 5DQDH 5C0CE 2XRAL 15C8H 2BSRB 3MLVH 3UZEA 3ZYZA 5DHVB 5L2KD 3RL2A 3K8LA 4IRSC 1EGJH 3JTTB 3L95A 3O4OC 5IEHB 5ADOL 4K23L 3FTGA 1MNUH 1RK1A 4Z7NF 2P8PA 4S1DC 2YPLE 1K8DB 1MFAL 1LE9A 5IG7A 5IEHA 4LSSH 3LD8C 2VC2L 3FKUS 3ILQC 4CN6A 4YQXL 1P53A 3KJ4B 1OP3H 1W2KT 4ONFH 1HNGA 4HXAH 4J3XA 3V4VL 3T77B 3GJFB 3F7VA 1HDMB 2WM0A 4PPTA 5HYFA 3RX8A 4NBXB 4H88H 4HKXA 2VN4A 5JTWA 1KB5A 2VSDA 1HNFA 5C0RH 1CLCA 1S78C 2FDBP 4FQXA 5KVGL 2HH0H 1AGCA 2M1KA 2E8YA 1QO3B 4PJGA 1I7ZA 5GS3A 1AI1L 3MNWA 5HYSB 4CVZA 2A77L 4YIQA 5IMMA 5DSCB 4NUGL 2KPNA 5DRNB 4UIKL 1I1AC 4H0HB 5EU5B 3SDCB 4Y2OA 3TNMA 5SWSA 1ERNA 4QGYA 5C1MB 2A6KB 4U1LA 1UT9A 3ARBA 3SCMC 4BZ2L 2VZOA 4HQQH 4L4VD 5F71A 2AI0L 1CXFA 4CGTA 5CJ8A 2P43B 3I6LE 4IBLT 1KGCD 6FABH 3MRQB 2GJZA 3IJSA 5J12C 1FNGA 2LU3A 2ZUTA 5IMOB 5CIPH 1CFNB 1G6RB 4NKMB 4B53A 1A6TB 4OI9A 4LCWE 5FYJL 5MEQB 1CK0L 4F2MA 3ZDZE 4YFLI 5IJVB 4HUKB 2A9NL 4OD3H 4F7CB 3O6KH 3FONB 5J1AB 2H9GB 3ESVF 5ERWA 4E42A 2NR6D 2AAVA 4QHLB 2WUCH 3STLA 4WI3A 3UAJD 3LB6C 3NFPB 2ICES 5I73C 3D0LA 3DVFA 1IAII 3KPOA 3MACL 4JFYB 2VKXA 4ESKA 1A6UL 3JUZA 2CIIA 4C59B 3ULUD 1NL0L 5T5FH 4NHUB 4GAFB 2RIKA 1LO2L 2J4WL 1WZ1H 4G8FA 3HNTH 3JV0A 4PJ8A 5FHBL 1QBAA 1HXYA 3N9GH 4LEXH 5DUBA 3TNNA 1YQ2A 3VH8A 3CX5K 5FECB 5HHOB 5K59F 1HSAB 4M6MH 5CJXA 4MA7H 5F21B 3ZTNL 3WJLA 1TNMA 4TSCL 3V4UH 1CGVA 3N85L 3TN0B 1QPXA 3VW3H 3MRLB 3MQIA 1OGAE 4S2SA 3RL1B 3Q5TA 4NO2B 4P46D 2VITB 2BRRH 5H94B 1J05B 3NABH 2CLRB 1YNKH 4AQ1B 5ITBH 1Q0XH 3VA6A 2BFVL 4Z7UA 1T1YB 2CD0A 3V6ZB 3V0WL 1EHNA 4ALAL 1XGPB 2GTZA 1V7NL 1NAMH 1YEEL 1PEZA 4ZFOB 3LQAC 3VA2C 1RZ7L 4K7PX 1DUZA 3EJZD 4AENA 3U6RB 3HRPA 1KENH 2D7NA 4WUUB 4AT6B 5TF1L 2P24B 1G9NL 1BQUA 3D39D 3IXTB 3OKNA 4N9GB 2AQ2A 5I1HL 1U8IA 1DDHA 1RMFH 1LDPL 4P3DB 5GS0D 3B9VA 4ZFZB 1CE1L 3ARVA 4HH9A 5IFAH 3FQTA 3PHQB 1GGUA 5FDWA 1NEZB 4HAFA 3JV4A 3P11L 3PWNA 4ONGL 2GJ6E 2DIBA 1F6AB 5GGUA 2VL5B 3JTSB 3KYOA 4GAJH 2I5YL 1UJ3C 4P9HC 5E4EC 4MD0B 5HPMB 3OKOB 7FABH 1N6UA 5FYLD 2R56L 4X9FA 4LMQE 4U3CA 3RKDC 1JWUA 3QNYA 2YUVA 4MJ2A 4MXQC 1NCNA 1C12B 5D2LA 3VFSB 3FMGL 3HNSL 2BVOB 1FO0A 1VGEL 4PRNB 4GW5A 4JO2H 5FGCB 5FHAL 5JPMB 5MEPA 4OFPA 1XF3A 4MXWL 3ROLB 3IJHB 3TNMB 1LO4L 5I8OL 5E95B 2BVUA 5EZJB 3S8WA 3VXMB 2EDXA 5HHPB 4BZ2H 3FB7A 1XMWA 3IFOB 4JZJB 2ZOKB 2VZVA 5E2VL 2P5ED 3BQUC 4KUCD 4M5YH 1FL5A 5T1KB 3BPLB 2W65B 1MFEL 5IHUL 2BNQD 5DGQA 1TCRA 1Z3GL 4OV5A 2LAAA 1IJ9A 4Z7UE 1B9ZA 4RMVA 5D71H 4QRRD 5E9DA 1TITA 1REIA 2EDDA 2EH8L 3WUWB 3DV6A 5K9JL 4J12A 2XZAL 4ZO8A 5DJ8A 4RIRA 1BOYA 2I9TB 4F80A 3QFJA 2IH3A 1UJ3B 5E4EB 3VD5A 4GLRH 4PJHB 4Z7QF 1G7JB 4UTBL 5CSZB 1SMAA 3U30C 1N6QH 3MRDA 4OB5L 3DHMA 3LEXB 4QHUA 1I3RA 4JANA 3NZ8B 3SEPA 4NN7B 3HE6D 5ADPL 1U58A 3E6FA 1WSST 4TNWF 4GMSH 3VDBA 3MA7B 3CLFL 5HGGS 2VMFA 4DVBB 1VGKA 2VLLB 3BO8A 1ZWIA 2DAVA 2R2EB 1YN6B 3NABL 1S7QA 3GMNA 3Q6FA 4JDTL 5FM8A 4G6FB 1A2YA 2W9EH 2VKWA 1AR2A 2XWJB 4WIQA 2GTZB 5TGBA 4PJGF 1I1YA 5JIKA 1KIRB 4UINL 1OW0C 4XPHL 2MQCA 1CDYA 4OFKA 2FZ3B 4TUJB 5BVJA 2F8VA 4WY7H 2R56H 3C09B 3WFBH 1NMBH 4Y2DB 1TZIA 1MFBL 4HGMA 4NQCE 4R26L 1U91A 3QEUA 4JAMB 1HHGA 4JFXB 1U95A 1KLFA 3T0EA 4NQSA 2A74A 1Z9OA 3DMMA 4QHLA 4HUMB 3STLB 3KXFE 4POZC 2IMMA 4K7PL 5DRZB 1C5BL 4YPGA 4LIQH 4E41E 2BXZA 3WNPA 4N0UB 5CINL 3GSOA 4X5XB 2DQDH 4XH2A 4LSRL 3B6SB 2APBA 2WBJA 1N0LA 4JFFE 4X6CA 5HDQL 3MYJB 3KNBA 3O2DH 4OT1L 3S98A 4EDXA 4XBGB 5F89B 4M1GL 3VFVA 4HJ0D 3V4PH 3S37X 3U4BH 1F2QA 5IVZB 5F7KC 3SKMA 4NRYB 4GH7B 5IF0B 3QCTH 4ZPTA 4O5LH 1UXSB 3DTXB 2MOVA 3FT2A 3PL6A 5DT1H 4M61A 5GISH 3G6AB 5E6IB 4HKJA 3TCLA 3VD3A 3WKNA 1K3ZA 1N5YH 3U0PA 5C08A 4I18C 5C0CD 2R1WB 43CAB 4ODWB 3TC9A 4KKCD 1FGNL 1JWSB 3MJ7B 4QTIL 4CDGC 3ULVC 1YEGH 4PP1C 1QKZL 5FO8B 2FATH 1IGYA 1DBKL 3D3VE 4QXTA 5CP3H 5J56B 4YDJB 3SQBA 3B8YA 4J6RH 3CZJA 4TQEH 4IOIA 3ESUF 3MRHA 1V3KA 2AJXH 4ZFGH 4DGYL 3QDGD 5C08E 4YBLC 3THML 3RVTD 1VFBB 5D1QA 3MR9B 1CVSC 1KEMH 4QEGA 2VDOL 3VG0H 1QFWM 1GGTA 3VWJD 3QUZC 4ZAKD 2HVKA 1PG7L 3L3HA 4PGEB 4LFHD 2NY7H 3KXFB 5TE7L 4D8PB 5A1AA 4G9FD 4X4YA 4AG4L 2YEZB 3MREA 3V0VA 1OAQL 1A4JB 4YHML 3FQXB 4JFED 4KXZH 4UTAL 2H45A 3ECBB 1T7XA 4KZEL 5JNYA 1IGIH 1A3RL 3S4SG 4XNYL 4JFFA 3SGJA 2OSLA 3DBXB 1GAFL 3D6GA 4C56A 4PRIB 1AFVL 3SKJL 3IDMA 4CVZB 1CR9H 1MLBB 5IIEB 4OCMC 3N1FC 4KROD 3GMPB 4R26H 4CBPA 4U6TA 1NCDH 4I0PB 1MLBA 5IIEA 1AXSA 5K9KA 3S5LA 5GGSY 5DI8B 1B4JL 1K6QH 3GMMB 4E5XA 1NCCL 4EVNB 1AO7D 1X4ZA 1ND0A 4HBQA 3EJYD 5EB9A 1YEEH 3GSXB 2XICA 2VDMH 3DYOA 5FGBA 3RZWA 3AM8C 5C0GB 4KKNA 4ODVL 3RWIB 1M7XA 1I9RH 3F8UB 3HRZA 3FN0H 4J8RA 2FHBA 1HYRC 1T04B 3QEGH 2V5TA 1T20A 1E28B 3H7BA 3QI9A 2VUYA 4BSWB 4KAQL 1G7HB 4L1HA 4HXBL 3QUZB 4OZFA 3V6OA 4JPKL 4PJAB 4W6XB 1HQ4B 1KN4L 5B8CB 2RJMA 1UB5B 5M7QA 4JRWA 3SKOA 3ZKXC 5BW7C 4Z5RB 5E9DB 3HS0B 5T1MB 2Q76A 3BH9A 3MCKA 2C7UA 3T0EE 2VXSH 1KIQA 1G7LB 4R2GD 4Z7WE 3KPOB 5IP4A 4PJ7F 1S3KH 3KLDA 1F6FB 2NNAB 4JFDE 3BSZH 4S1QH 1EAPA 1T7YA 1CQKA 2X4SA 2VLRE 2DMCA 1CN4A 1KFAL 3NGBC 1HHKA 1AGEA 1XF1A 1BFVL 5FK9A 3DX7A 5HJ3B 1N6VA 1ACYH 1GZPB 5BRZA 1BFOA 5BVPH 5D6CB 3RWFB 4QF1B 4G8GA 3VFNB 2AXFA 4NKDB 4NWUL 5FYKL 2CGRL 5FUOL 3FT2B 4WW1B 5I8KH 1V3MA 1ZSDA 1KEGH 5L2JB 5E2WH 2HT2C 5DT1L 3MOAH 4GAJL 2GW5A 3FN3A 3PWVB 3QIWD 4X6BA 3RGVB 2YWZA 4MDIB 4EI5B 2LV4A 4FHBD 1U93A 1YEHL 3O2WL 4RAHA 3PDOA 2DQUH 4DW2H 3C5ZD 1BMGA 1BQHA 4OBRA 3IFLH 5KS9A 1INDH 2HFEB 3O45A 3S34H 4GBXC 5I66A 2BDNL 3F7YB 2R0WL 1UZ8A 5CD3B 4YLQT 3F7YA 4PRAA 1GIGH 4O9HL 4ELMB 2CH8A 3PWLB 5FAAA 2GY7B 2YR3A 2WUCL 2G60L 2V7NB 3BHBB 1CFBA 1KG0A 4I4WA 2Z8RA 1CFVH 1IM9D 4I13B 3WN5C 3B8SA 1P1ZA 4B50A 4OIBA 2KZ1B 4MQ7A 1EFXA 4NDMA 1HKLL 1L0XA 5KN5B 2HT3D 2Y7QB 1D5XA 2GY5A 3QH3A 1QBBA 5I1KL 1C5CH 4JGJA 4MWFB 3MROA 2VQ1A 1QSFD 4OZHB 2CKBL 5F89A 3UBXA 4OZIB 4Z7OF 3QDMA 4E41D 2Z4QB 3O3DB 4JPKH 4OM0H 4HHAB 4YQXH 3JZ7A 4MZ2A 1E6JL 1AXSB 5I1CH 2GYSA 1DQLL 3KR3H 3NCMA 5TQ2H 1HZHH 3SDAA 1EUUA 2FJGA 1QVOA 1I7RB 1ZTXL 3DUSA 5GGVH 2YPKA 1X5AA 2FWOA 3LKSA 4ZUWB 3D85D 1VESA 4CN4A 1WBZA 2XRAH 1YYLL 3RZCB 1I7UB 4KHXL 4J8RB 4LPTA 2VQTA 4U1KA 1MAKA 3FFCD 5F96L 1A9EA 3GJEB 4NZUL 3QUZA 4OZFB 3GKZA 3ZKQD 4L29A 5T33H 3P4OB 4DQOL 1YYMH 4FZEH 4JN2B 4BSJA 5KJRH 5FCSH 2X4OA 2R9HC 5FA4B 3NIGE 4OLYL 4PLNC 4H0GA 3WNKA 3RX7A 3TT1H 4JHAH 2Z35A 1OAKH 3EFFA 3KWWB 3G5VA 4QT5A 3GSWB 1RUPL 5D70L 4XX1G 1RZJC 1BJ1H 4ZPVB 1PAMA 2YKLH 1XCQB 2OLDA 4GRWF 4OLUL 4E42B 1CL7H 2FIRT 3BI9X 2ICWJ 5GZOC 1X5HA 4LLAA 3UPRB 4KRPB 3UTSE 3QDHA 1YDPA 3CU1A 3IB4A 2ITCA 1I7ZB 3I75B 1OP5H 3U9UB 4CNIB 4WHDA 4G6JH 2XN9D 5HHVL 1J0KA 2XG5A 2OZ4A 4F9LC 4FZ8H 4MNQB 1YEJH 3TYGH 3LKRB 5GRYA 2AVGA 3CIQA 2H32A 2QBWA 4L4TB 2PW1A 1SM3L 1RZKL 4HCRH 1WFUA 4HIHB 1HKLH 4YHIA 3VWKC 4OF8A 3RI5F 1MHCA 5GZNC 2FO4B 3GM8A 4TNVK 5BV7H 1QR1A 3HMWL 1SJHA 4WRLA 1GGIL 5DO2D 3T0EC 3PIQB 1KXTB 1PYWB 1Z0MA 2DM4A 4HS6A 2I25N 3U36B 1T83C 4BQBA 5D9SB 3R0MA 5FKAB 1XH3A 4EXPX 3SDCC 1DJSA 1RULL 2HN7B 3V6ZA 3VFPA 2HT4C 1F2XK 4HUVA 3HUJF 3MXWL 1UH4A 3K4ZA 4PJAE 1M6OB 1F3JB 1OM3H 5B4MC 3QWRA 1J5OH 1U36A 4HGWB 3CNKA 4HV8A 1RJZB 2FX8L 3IKCA 3HE7C 1ZHNB 4NSKA 4JM4L 3QB7C 4KTEH 5DC4B 1DVFB 5DMIL 3BPNC 2W60A 5D1ZB 1N26A 3LV3A 5C6WH 5FECA 5FYKE 4NNPL 1AQKH 2SEBB 3KHOA 5SX5H 4X7EC 4NZRH 1IM3A 2BFVH 1T2XA 4NN6B 1N3NB 2FGZA 4R0LB 4QKXB 4M48L 4OGYH 4XC1L 4MQXD 1G7MA 2L4OA 3BRDA 3OAZH 5E6YA 4ONGH 1A8JH 2V7HA 2AK4A 2IQ9L 5HHMB 1V7NH 3QXAA 3MLVL 1IC4H 5TE4H 4H1LG 1GAFH 3HR5B 3ARBD 4HG4K 4OLVH 5I30L 4K23H 3TH4T 5BJTA 2HJFB 3D3VB 3U1SH 4HXBH 4U1KB 2VZUA 2XG4A 5GRXG 4O51A 3S36L 2AK4E 4OGZA 4PIRF 2DD8L 4X4XB 4YBLB 4WI2A 3TBSA 3L3GA 3WFCL 3FTGB 1NDMB 3ARZA 5JPNB 2AJVH 5L8KB 3X14B 1NC2D 3DUUB 2QHRH 4UIMB 2VDNH 4QXUL 4Y5YB 3K2UH 3CVHH 2R1YA 5SWQB 2VB5A 1EJOH 3FRUB 3LH2L 4HX1A 5DK0A 3T3MF 1ZT4B 1U8JA 3INUH 4QOKB 1GGBL 5DRXA 5E8PA 1BZ9A 1AHWA 4KKLD 3SQOH 1MI5E 1ZS8A 2NW3B 4P2QB 3S4SA 2V6HA 4U1JB 4QWWD 4IJ3B 4RAUA 2V5YA 3QI9C 5DXWA 5HHQA 3S35L 4MGXA 3JTTA 2HWZL 2Q6WB 1D6EA 5T3ZH 4LCYB 2MQ0A 4LCIL 2IFFL 4RIRB 4KJYB 4LPUA 1MOEA 4D0BA 2ZJSL 5CJOH 4CMMA 1TQBB 5K9KB 1H15A 3K7UA 3MNZB 2H8PB 2PXYA 4JM2B 2P49B 4ZDHA 2WWKO 1LMKA 1YEKL 4LHUG 4ZTOL 1FCCA 2VR9A 3DXAA 4BQ6A 2EDOA 1NMAL 4H8WC 4WDIB 4RCAA 2C3VA 3NACL 3U7YL 5DWUH 2A73A 1J87A 1ACYL 5IVXF 4DK6A 4GW1B 4OCWL 2F53B 4JFPB 4S1SL 1DBML 1UB6B 4XP9H 3DVGB 3DGCR 5BV7L 1UXWA 2EH8H 5DJYB 2ORBH 1KGCE 1HN1A 3T2PA 1A7QH 1FVEA 1KTDA 4JGUA 4CW1A 3MGOA 4N8VA 3V6FB 5L2KB 3B43A 2CUIA 4KQ3L 4ODTL 1IE5A 4EJ1C 2EC9U 3W0WA 5MP6L 3VFGL 5JQ6H 4RGND 3L95B 5J12B 3CZFA 3W39A 2Q87A 1TJIL 1VFOA 2XTJC 2FCBA 3C8KA 4MQSB 1I1YB 4JR9L 3U46A 3P73B 3DO7A 2HG5A 1FE8H 4FQQA 1HIMH 1I8MA 4EIGB 1G7QB 3LRSB 3WIFB 5D1QC 2HFTA 5C0AD 3I50H 1FIEA 4K2UH 5DVMA 2O5ZH 3BD3A 4KMTH 4OCRL 4WGVB 5TFSL 3FOLA 1XAUA 1OF2B 2JK5B 1EBAA 3QDMD 1V3JA 5EUKA 4OQTL 1SEBB 2DMBA 2IMNA 3DXAD 1PKQE 1QP1A 1LEKA 2R0LH 1JBJA 4FTVB 3RHWK 3TJHD 1LDSA 3QUMH 5DRNA 2XNAA 3HMXH 2EZ0D 2X05A 1G84A 5KVEH 3P30L 1A7OL 1P6FA 5CHNA 4LU5L 4S1RH 3ES6B 3BGAA 3U2SA 2YRZA 3ZE1F 2V9QA 4X6DB 5IT2H 4KV5F 3O3AA 2ZZUT 4X80L 2QQNH 4C54A 3U1SL 1CFSA 3IVKB 1LDPH 1A6AA 2GJZB 3IJSB 1BBDH 1XFPA 2WMPA 3MRLA 4ETQA 3MV7B 5HHXH 4Z76A 4TTGA 4H5SA 4MB3A 5J1SC 2R8SL 1MCCA 2V2WB 1RZIB 1OPGL 2IAMA 5C0EA 1IGMH 2MCPL 2WBJC 2VC2H 4NRXA 2PUQT 3WFCH 3R4DA 3MZTA 1NC2A 5CD5C 2C4FT 3ULSA 1FL6A 5IK3A 3AREC 3HZKB 4ZG1A 2QSTA 5C0DB 2VISA 4NQXB 5DRWB 1NEZA 4FFYH 1QSED 2IALB 5EZIL 4EBQL 3D0LB 1QACA 5D7JD 1JFQH 3QIWA 3VXSB 4CL7A 1W0YT 4U1JA 3U7YH 4FA8A 2ESVA 2EXYD 4GKNA 4D9LH 3QHFH 2E9WA 3QUMB 1EVTC 3SCMA 2F74A 2FX7H 4YXLH 4PJIF 5GS2D 1QLFA 1CDHA 1KPUB 1VERA 1I7TA 4LCCA 1CTOA 5HHVH 4XTRD 4KC3B 4OUUB 4G8IA 5CS7A 5LGKA 3DX6B 2YD8A 2ED9A 5E6ZA 4TULH 3WDJA 1AGDB 3KYOB 3DRQB 4M1CD 5M94B 1LD9B 2XPGA 5I2IA 1EAJA 3PWPB 3L9RB 3VGDA 4XPBH 1CI5A 3QYCA 3ZKXB 4GW1A 5F1KC 4HH8A 4ZS7H 3DURA 5GGSA 3DSFH 1RAMA 2DLGA 2A9NH 3ARWA 3AU1A 1QYGH 4AL8L 4LOUD 4KK5D 3VFGH 1CT8A 1LE9B 4UT9L 4XPFH 3D39B 4U6HB 1OAZH 3REVA 1YN7B 2ICCA 2VABA 3RWIA 1RURH 2FLRT 5C70A 2DLHA 4MAUL 3SKNB 4MSWB 3KWWA 2ED8A 2DWDB 4TTDD 3WEXB 1MF2L 3VFUB 2LTQC 4BH7A 1NDGB 2OI9B 1KIPA 1HDMA 3G5ZB 4LSSL 1SHMA 3BW9B 3U0WL 5HHQB 4HUXB 3UYPA 4XCYA 5HHXL 1AGCB 1GPOL 3I3EA 1MQKH 2W9EL 3BP5A 3PGCA 1NGYB 4H1LA 3V7AG 3UPRA 5DK3A 5I1AA 4HWNA 3U30B 3BQUA 4XVUC 4Y5XC 4AK1A 5J7CC 3AS0A 2V2XB 1PX3A 1MJ8H 3KPLB 4RGMC 2B1HL 1F90L 4EI6A 3H3BC 5DQDL 1QEWB 1ZT1B 3VXOA 4NQCD 4J2XA 2BNUB 1T7WA 3O11B 4J3TA 5EU3A 2XI9A 4PLKC 2QADD 2OX5A 3QG6B 5DK2B 5SWZE 4PJBB 3SE9L 5C0BA 1I9IH 5HGHA 2F53E 5DC0A 1RD6A 4ZAKA 1KXQE 5JDSA 4JG0H 4HUUA 1MFAH 2IH1B 1IQWL 1F02I 1DLHA 3MRPB 3GSNB 5TPWH 1M4KA 1Q9KB 4V2CB 2DTSA 1QPPA 3A67H 4H5SB 5KSAD 1C5BH 5DMGD 4KTYA 1JGEB 1E4WL 1G7PB 4ZFFA 1YYML 4L3ED 5C07D 5HI4D 4P5MB 1WZLA 3B2UD 4OJFL 2MMXA 4G80A 1P7KA 4I9WD 4NNXA 4RFEA 1YEIL 4S1QL 1BPVA 1DTUA 4QRPB 1MJUH 1DQQA 4UOJA 4YK4C 2LU7A 2J7LA 2K7PA 1A7NH 2DYPB 1NCBH 4R7DA 1INDL 4LPCA 5HD8C 1F3DH 1FLTX 1FZOB 1HXYB 3VH8B 4G6AD 5CD3A 2Y6SC 1RJCA 5IVXB 1YPZE 1ZT7A 3NZHL 3ROOB 1HHGB 4FQLL 4F2MB 4J23A 3TN0A 4YHLL 4IDLA 1G1YA 2VXUL 2VRAA 3HI1B 3MLXH 4K07A 1YUHB 3V5KA 4R7NA 2G9HA 3RVUD 3RZCC 5D6CA 1GOGA 3RWFA 3T08A 3QJFB 4UUJA 4MDJA 5IWLC 3D18B 1KJVA 3DNKA 1FNHA 4WTZA 5T1LB 4FABH 3BEWA 2WBJB 2CKBB 5EU7C 5TDNA 4N5UA 5L2JA 3FL7A 4LVNC 2BX5A 3WLBA 1RURL 4QCIA 2IFGA 4LLDA 3S34L 4LQFH 5I74C 3D69A 3SGDI 1Z0NA 3VFOB 5D71L 3O3EB 1NCUA 4P23D 3MACH 3RWEB 4M7KL 2APTA 5IMKA 3P4LA 3L5JA 5MP6H 1Q9LA 2X42A 2JJVA 2NCMA 5H8DA 1B0RA 2FBOJ 4UT6L 2B20A 4UDTB 4LVHC 4QY8B 1MHHB 1FE8L 4UT7H 4P3DA 4Z6AT 4Y5YC 1X44A 3QDJB 4C4KO 2AW2A 1FG2A 4JCMA 4U33A 1DBMH 3JVGC 3MXWH 4XP9L 4CADA 5GHWH 4HK0A 1AKJA 4NQXA 1PQZB 1WCBA 4NFCA 4U3HA 3PDGA 4XAWL 1T3FA 4DKEH 3MFFA 3KLSA 1EA9C 1RIHL 3B83A 5K9QG 2PYFB 2X10A 3JWNC 4HEPG 1ZHLB 3EDDA 2UZIH 3VXUE 1MWAH 2V9RA 4G6KL 2OSLB 5TPWL 4C4KT 1D3CA 4Y19D 1KSRA 5D2LE 4E41A 1HYSC 4JKPL 3B9KD 4LLWA 3EO0B 3BDYH 3SJVB 2C4FU 1OB1B 4KQ4L 1GOHA 2BVYA 2EYRA 2NW2B 4JREB 3S9DB 4PFEA 1BJMA 1CLZL 2Z9TA 1VENA 4UV7H 5FFLA 3AXLB 4E5XB 3VGAC 5ESAA 3MOBL 5B3NA 1U8NA 1OAKL 1JHTB 4WFGD 3WN5B 3TO4A 3T0DA 3SDAB 1G1CA 1OTTC 4PJ5B 3D25A 3FB7B 3IFOA 1P7HL 3WNNA 4X6DF 1NMBL 2YC1A 3MRIA 4KKAD 1CL7L 5JMOC 4KGLA 4Q9QL 1AIFA 4MNQE 5ILTL 4L9LC 3P9WB 1MCRA 2VDML 5I16A 1KTKE 3IF1B 1YJDL 1A7OH 4XNMA 5I75B 4JFOB 1YMMD 2EICA 4I3SH 4OF3A 3QDGB 3CAFA 3ZDYF 1A5FH 2EYSB 4N0CD 4OJFH 1I8LA 3CFJB 1UM5H 5KSBB 1BVZA 4U1MB 2EEAA 1WZKA 3L3HB 3O4OB 3GO1L 3GHBL 3OKYA 3B5TA 2E3VA 4PRHD 4RFNC 2G5BB 3C6LB 4Q9BA 4G42B 4YO0A 1ZKAA 4NCDA 5BRZE 1DSFH 4PJBF 4R6UA 5FV2A 3OAYK 1T0NA 1F45A 4G43B 5JW4R 2JF1A 4W68A 2YD3A 4Y1AA 3HZVB 5GJSH 4NRZA 4FXLA 3ARGD 1U8LB 3N06B 3L6FB 4QO1A 3MCLH 2LU4A 4F7MA 3RTQA 4RWYL 2V2XA 5DSCA 1MH5B 3AREA 4X6BB 5DVNA 3KYNA 2DQCL 1YN6A 2E8ZA 4X7CC 4LLDB 4XWGH 4M7LT 1Y0LA 2NZ9D 3OR7A 2UWEF 4GW4B 3LZFH 4ODUB 4KMQA 3TZVD 5SWZB 4C56D 3LAFA 5CWSB 1Y0LB 4GW4A 1BQHB 1A6AB 4FRWA 3MOAL 2ARJQ 2JB6A 3MODH 1BWMA 4QF1A 5JDSB 2FD6H 1BD2A 2IANB 4FNLH 3GBNL 5I66B 1S7WB 5I71B 3P4NA 4HFWA 4PJFA 2R4SH 1A7QL 4NO2A 4Y5VC 4L4VE 4M6OH 4HBCH 4UAOB 4EUPG 2V5RA 1I1FB 1H0DA 1EX0A 3O3BA 5DA4A 1UWXH 4IOFD 5KAQG 4JZJC 2FJHB 4QGTA 2DLFH 5GS1C 3VXTB 4U6YB 3LIZL 2JLLA 4PJCB 1OHQA 4KPHH 4I4WB 1CLOH 1XGPA 5D96C 1VA9A 4R2GB 3C08H 2B4CC 2HKHL 5HYQA 4Q0XH 2AEQH 4XH2B 3ZTJG 3CFCH 3L5WB 3KDMA 1AO7A 3RU8H 2AXJA 2ZUSA 2DN7A 1X6NA 1BVLB 1IQDA 2IPUG 1QSFE 3IRZA 3U9PL 2DD8H 4WO4D 3TBYB 3H3PH 4DGVH 4QRQB 1S9VA 4WW2F 1VB9A 5I9QC 43C9A 3S37L 3W9DA 4RBPK 2Y4SA 3CVHL 4XXCC 1IT9L 2M2DA 4PJ8D 2MHAB 4I3SL 3VG9B 3DGGA 4UV7L 1IAIM 2NX5D 5D7KE 4RAVB 4JKKA 4OSUH 2FHCA 4GS7C 1GVIA 1BZ7A 5HGBA 1JPTL 3HN3A 4PJ5A 4U05A 5E00B 3HCVB 4Y4KC 3RVXC 1E6JH 5DQJB 1FG9C 1HXMB 5I71C 1MRDH 3C5ZB 1F6LL 1S7SA 4RDQF 1XGTB 2XTJB 3ULVL 1RK0A 3P9LA 3QULA 3G5XA 1FAKT 2WQRA 3P9LB 2VDNL 4QXUH 4W70A 3FQWA 4UDUB 2QQKL 4ZD3H 2VXSL 3TT1L 1XGRA 1MJUL 3FO0L 1XGRB 1YY8A 4Y88A 5A2LH 3E2HC 3GSUB 5KSBA 1FBIL 4PJ7A 1JGUL 3E8UH 3MREB 3V0VB 4K8RH 5GJTL 3RAJL 4Y1AD 5KANG 4ZUUB 3C5JB 4PGEA 3IJYA 4UB0H 4C55A 3Q5OA 2DLTA 4HK0B 4URTB 4OKDA 3GIZH 2VE6A 5KSBF 5EU6D 5DJ6A 1A7BA 2ADFH 1B0WA 4PJXA 2MFNA 3LKPB 4M5YL 4U0RC 2OJEA 1EGJA 3DBXA 4ZS6C 5J3HC 4XX1E 3WL9A 4L9DA 3VCLA 2OJEB 1BQLL 2F58H 3M8OH 2A9MH 4OIAA 2WNGA 3Q3GA 3EO0A 2H41A 2ZUQC 4X5LA 32C2B 5FYLH 5EZLB 4PGCB 4ACPA 1RU9H 1MCWM 3LPWA 3O2WH 3HZYA 3TF7C 1PKOA 5C7XL 3KXFA 3ULUF 1BWWA 4LKCB 3KPRB 1JNNL 1P5UA 1KLGB 3PGDA 1U8KA 1FN4A 2CJUH 2ORBL 3DMMD 4NOBA 2GK0A 3CDFA 5J13C 3RTQD 3D85B 5IVOA 1M7IA 2XZQL 1NFDE 1X9QA 3VXRE 4Z7WA 1Q9KA 1OAXL 1X5GA 4FNLL 2GEEA 4NJAL 2EDKA 4ORGB 4HC1A 4N5EC 1FFOB 5K9OA 3C6LC 3MV8B 1PYWA 4ZMAT 3ARFA 4YHPB 3C2AL 1JPFA 3CK0H 4RMQA 1ZAGA 1AO7E 4OZ4A 1MCQA 1CFVL 4U6XB 5E24E 4F8QA 3IXAA 1TJHH 2PW1B 4LDLB 5E1AA 2PTTB 2VLRA 3TWCH 2JJTA 4NQED 1SJEA 2E7HA 3TH2T 1OSPH 2ADGA 1NUNB 3I3DA 3B9KA 1N59A 1M6OA 3ALWA 4Q0XL 4OI7A 3CMGA 5F1IA 4GXUN 5TF0A 4NGHL 2XQYK 5JXEC 1KCVH 5JA8B 3QUXD 3SDDD 5JHLH 3QIUC 3NCYS 4JFHD 4BZ1H 4TUOB 3TFKC 1T5WA 2P5EA 5MEND 4ZPVA 1U95B 5FUCC 4M7LL 3V6OE 4WY7L 3WFBL 1RFDH 4JPIB 4R0LA 3L6FA 4BZYA 4X8XA 3MA7A 3BH9B 3GRWL 3PXJA 5EZIH 2J5LB 4BFIA 3QWQB 4POUB 4L3CB 3QA3B 4NO0B 2G75B 4XP6L 3WHE0 4KJPD 2AEWA 1ULVA 3LKRA 5IBTL 1T89A 4XNQA 3KPMB 4NYLA 5D96B 3K74B 3GZKA 2DQGL 3MA9L 1OPGH 5IVNA 4HIHA 3RY5A 1VACB 2VLJD 3IU4L 2ADFL 4BJLA 1CFSB 4M3KB 3A67L 1IC1A 2IANA 1IC4L 4PJ7E 5H94A 3SQOL 4UOW0 5JW5B 4X4XA 1IAMA 1MRCH 2EIZA 4Y19A 3PIQA 1JYNA 2NXYC 5JIIA 4QY8A 2V7HB 3VGGA 3PDDA 4WW1A 3UCRA 3UC0H 1P4LB 2ZUXA 2LE9A 5FKAA 2BNQA 1FBIH 4H1LH 4UU9A 1DBJH 1AKJD 4U6YA 4BKLB 3TN0D 3T4YA 4NQSB 5AG9A 2AJUL 5JOPE 3F65A 2GT9A 1MCPH 2DKMA 3UBXI 2HJKB 2UWEE 1T1XA 1OARL 1BVKA 3KS0J 4IMKA 3KHQA 3VFWB 1NFIB 1LO2H 2J4WH 4HV8B 1LNUB 4X6CE 1C16A 3T3PF 4PREA 1UZ8B 4JQIH 3UBXB 4S10A 4UILH 3ARYA 1D9KB 2XIDA 1EZVX 4J7RA 4XZUB 4PLJC 5EZLA 3VW3L 4NC1E 1F11A 4D0DA 4LNRB 1JUFB 1ZMYA 2AP2A 3O6FC 4OD3L 3RNKB 2GSIA 5T5NF 1MCLA 1Q8MA 1XR8A 2ZUWA 4MD0A 3T0VA 5HHMD 3LOWA 1A1NB 1RUML 2FEDC 4NO3A 2MSPA 5HDBF 5I1EL 3VMNA 1ZLWH 1I7RA 2MJWA 1WWWX 3PQYB 4YDIH 1XF5B 1SY6L 1FO0B 4M6OL 3SE8H 4PRNA 2D2OA 2AJSH 1JYVA 5C0BD 5EIVA 3RWCB 1IGIL 1JWUB 3QNYB 4YIQB 4LEXL 2NY0C 4WU7B 5D5MB 4JDZA 5IOPA 4WCYH 4HLZG 2P5WB 3V8OA 5JPMA 3BEVB 2LQRA 4ZYKB 4F57L 1EZVY 5B38G 4PJ9A 1JPGA 4MNGB 1JNJA 1D7FA 3MLTA 1UKQA 1LO5B 1IRAY 4KQ3H 4N1HB 2YA2A 5GHWL 4KTEL 4RA3A 4F33B 3EYQD 3EOBA 5GGRB 3ZYIA 4DQOH 4MHHG 4DTGH 1T2QH 1UQSB 1P84K 3FQXA 1R3JA 1MNUL 1A14L 2I5YH 4PJAA 4WEBL 1KLUA 1T5WB 2P5EB 4HFUL 1CGXA 1U3HD 2WLYA 1L7TL 2YS4A 3SGKC 3BPOC 4XMKH 5ERWB 1X5IA 2W9DL 4KKBC 4UINH 5MHSE 3EOTH 1HHIB 1ED3A 3OJ2C 4HG4J 1Q94B 2P7TB 3PUCA 2OJZL 4RGOL 2YUXA 4M7ZB 4U4BA 5DJXB 4R3SB 3MJGX 4P49A 2I9TA 3HUJA 1FV1A 4NO0A 2NYYC 5BO1L 1T1WB 4OLUH 4FQXD 5I8OH 3MJ9H 2CDGB 1IGTA 1PX4A 1H3UA 2UY6A 1J0YA 2JELL 1MHEB 1XGUB 2VLKA 4S0TD 1WF5A 2V5MA 4YDVA 2A1WH 3FO9A 3H9SD 4NZTL 4OGXL 1OWWA 1UB6A 4GOSA 4XMLH 1BD2E 4HAGA 4ORGA 2AEPL 5IB4B 1VFMA 1CBVL 5GGRY 4APQC 1SEQH 2Q8BL 2R4RL 5FA3A 5D1ZC 2A6IB 5IMMB 4LVOC 3C60C 3L3OB 5KG9B 4AEIL 2WWKT 3HE6B 3ULSB 4HMCA 2L7JA 4X6FB 2VLKE 1F4XL 2AK1L 3KJ4C 3QQ3B 5FIEA 5E94A 1F3JA 5I15L 3WFDH 3MNVB 3ULVH 2XZAH 1BLNB 4PJ5E 1KJ3H 3O8XC 3MGAA 8FABB 5HVWA 4FQQB 4XNXL 1CL7I 2CRZA 4YGVB 3ARFC 3R8BB 1X5KA 4MAYC 1NSNL 4P5KA 2GJ6B 4N1EA 3ZDZF 4F15C 1AGBA 5JORB 4AM0B 1RJZA 3MO1A 3UO1H 1DANT 1ZA6A 4XNZC 4Z95L 4UT7L 3NTCL 5HJ3A 2ZPKH 1S7VB 1SEBA 4HCRL 5E2UH 2OTUA 3QSKB 5DTFA 3FONA 3OL2A 4GUPA 3UTPD 4H8WH 1MJ7H 1KCKA 4YR6A 4P4KC 4G7VH 4WV1C 4FQ1L 3BIKB 5C8JB 1F42A 4MA8L 1CGTA 2ZUYA 4YPGB 4YWGH 4OQTA 3ZT5A 5DEGB 3TJEL 1OSZB 3QXAB 4H25B 1AD9B 1AQDB 4U7MA 4G8FB 1CIUA 2FR4A 1G6VK 3KPMA 4BELD 5C9KA 3DYMA 2AJSL 2BCKB 4OZIE 4GG6A 1IAKA 4M7JL 3FQWB 4TVPL 1NGZB 4MAUH 5D72H 3ZE1E 2SEBA 4RMTA 1A3QA 4WCYL 3GIVB 1FSKC 1RZGB 4BFBD 4KRMB 4X7FC 4J4PD 1U3YA 2ESVD 2BVPB 4NIKB 5A3IC 1WBZB 4HK3N 4FXKA 3WJJC 3GBML 3ZE2E 3RFZC 2QQQA 3PV6B 2DQTL 3U0PB 4NHCL 4LSUH 3EO1A 2YC1B 3MRIB 1KBGL 4OM1H 4JZNA 3QIBD 2DWDA 5CP3A 1ZT4A 2F15A 4OD1H 2ZSWB 3P0VH 4OKVA 1JHKH 3O4LB 5LAXB 1EO7A 1KUMA 3G5ZA 1T80A 2ZSWA 3SGJC 2DQDL 1R3IH 2XKSA 5EH1A 2NXZB 3NCYP 4F7EA 3RVVD 1CGSH 3ISWA 4ZQKB 3I6GA 2FSEA 3G6DL 1H3PH 3REWA 3PWPE 5ID0B 5EO1A 1PZUB 3BMWA 3IDXL 4OLXH 4JM2A 1GOFA 3DIFA 2PO6B 3W0WD 3IDJA 3BYTA 3PNWA 5TE6H 1G7JA 4O4YL 4XBPA 1J1PH 5ADOH 3DX6A 3PHSA 5B3JE 4M8QB 1RUQL 3HE7B 5E8NA 1CF8H 1ZS8B 2NW3A 5I15H 4M5ZL 4OZGE 1RHFA 2FL5A 4ZAKB 4OLYH 2B1AL 2QHRL 1MQ8A 4XNXH 5EO9A 1CS6A 5E8DH 2A1WL 1RFDL 3LPFA 4O2EA 4TUKH 4MVBD 4R90L 3INUL 3FZUD 5EOCL 3OX8A 2AEPH 4X99A 5DJAB 4BH8A 2DDQL 1UM5L 3FN9A 2QQKH 4ZD3L 1XIWD 3GMMA 4OFIA 2NY3C 3GI9L 1KC5H 2BY3A 4KI5C 5MEPB 4JREC 5HI3D 4J4PA 3WHXA 4BH8B 4MNQA 4CMHB 4XNMB 3MGOB 2DQCH 2RHEA 2GSGB 1ZLSH 3B3IA 1ADQL 1VKXB 5CWSA 5T1DL 1PG7H 4PV8A 3ZKMD 4JZJA 4HKZB 4Y4HD 3MGTB 5IB2B 5JIHA 2Q8AH 4Z7OE 2Q7YA 1F58L 4PJDA 2VO5A 4Q6YA 5T3ZD 3TT3L 2V9TA 1HSBA 3NCCB 4ZXBA 2OR9H 4UTAH 2PYED 4ZSOB 5C09E 4DZBB 4RFEB 2ZPKL 1AFVH 4PD4K 2FH6A 4FQJL 4ZNEE 1AE6L 2Y06H 3WYRA 5J11B 5D1XC 3BWUC 3GGWA 4GKZA 4K2UL 1AD0A 3FO1A 4WUKH 2WIIA 1T1ZA 4QRUA 4P0DA 2ITCB 1KELH 3U46B 2G75A 4O2FB 3W9EA 4NBZB 1D5MB 4OQTH 4Y4FD 4X7DC 3KYNB 1T1WA 3QZWB 3MJ8B 5EORH 3Q5YA 5DUBB 3N1MC 3U9PH 3CLFH 1UJTA 4FFVC 2C1PB 1UYWL 4XBGA 5LGHL 2R4SL 4JFDD 1Q72H 4U1HB 5F9OH 5EA0H 3S37H 1YNLL 4TRPL 3BVNB 5IMKB 4RNRA 4GRLD 5D2NA 5E0QA 2UUDK 1CE6B 2F5BH 3GIVA 4XPTL 4KPHL 2ZG2A 3SKUD 2WP3O 5I74B 5C9JB 4UV4H 4ZFFB 2IADB 5EFIB 3S35X 3VDCA 4L3EB 4XNZB 3UYRH 5JXAH 4CRPA 2YK1L 4M02A 5C0DA 5JZ7C 3JWDC 3MYZA 3WDIA 4XHQA 3IRPX 3NMEA 3OAZK 4RSVA 4JZNB 2E9BA 3AY4A 4WV1B 4WHCA 3SE4A 5DVOA 1EO5A 1MRFL 4X9BA 2DB8A 2DYPD 1S9XB 4XWOC 4JY5L 1UVQB 3IDUA 3BN9D 3QIWB 4P5TA 4XT1C 1XCTB 4HIXH 3ROOA 3RBGA 1TVDA 3X14A 4NUGH 2VAAA 4XAWH 1HSAA 4ZOCA 5ID0A 2NPLX 4KV5E 2ZCLL 2UWEA 3NPSB 2QHLA 5DVKA 1L0YA 3MRKB 3MCG1 4JFXA 1YEFH 5TDPB 1KN4H 1X5YA 2YD9A 3ILPB 4Z9KB 3L3KA 3RNQA 1A6VH 4G5ZH 1TFHA 5SV3A 3E1F1 3OPZL 2QJDA 2GCYB 1A1NA 1DEDA 1CXIA 2NY2D 1KF9B 4LGSB 5DEGA 5KJRL 1RJYB 3TLRA 4I0PC 2E27L 1V3LA 3ZT6A 2VQ1B 2FR4B 2HKFH 4LSQL 2F9BT 5E5MB 4JEGB 1ETZB 3H9SA 1DP0A 1JNHB 1YECL 1DUYB 3I85A 1UACH 2VLKD 2YA1A 25C8L 5H37G 3MV9D 3TPKA 3HI5H 1VGEH 4Y16C 2QQLL 4P4RB 3P3YA 4PYGA 4F9PA 1NL0H 2G5RA 3BISA 3QDJD 3QWRD 3MRGB 5T1DH 3TVMD 4Y5YA 4CAGA 5AD0B 1S9KC 4GRLA 3CFDA 2ENYA 5GGRA 4XRCA 2VNCA 4N0UE 3CC5A 5B8CC 4QHNA 1TCRB 1HCFX 4Q6IB 3CC5B 3H9SE 1E27A 2AXGA 3QHZH 5C6TL 3IETA 2CMRH 3O6MH 1T6WA 1LP9E 5E2UL 4D3CL 1GCFA 4XCYB 1F8TL 4XXDB 3BIBX 2NY7L 4OTXH 3D1MC 3P4OA 3S6CA 4GQPH 3TWCL 1JHLH 4TSAL 4DAGL 4JCLA 2ZOLA 1HEZA 2FJFA 5D93B 5MHSD 2PO6A 5ID1B 2GQHA 2NY3B 1QOKA 3G5VB 3PWUA 5CGMA 1IGTB 2G60H 4JPWH 3FQRB 1Q0YL 1T22A 4ZXBD 4P2CG 35C8H 1OQXA 3ZE0F 4PRIE 2XN9A 4W4OC 1NH6A 3MRMA 4PP2A 5GGVL 1DFBL 1LHZA 4IRZH 4LSVL 4YXKH 3CFEA 3LKQA 3FQNB 3D85A 4GFTB 4JPIA 5GXBB 3T3ME 3I75A 4Z8FH 4MJ4A 2XNAB 1I9IL 1S8DA 4AMKL 4P5MA 4MMXC 4BFIB 1X5JA 3EDFA 3JWOL 5K93A 2H32B 1P5VA 4M1DH 1JGDB 2PW2B 1CE1H 2Q3AA 1S7XA 1IGCL 4K7PY 3IYLW 3WNOA 5DK2A 4WJ5B 3O8XB 3OAUL 4ZO7A 1S9XA 4U6VL 4MB4A 3ARUA 2IG2H 2PF6A 4NZRL 1HI6A 3OHXB 3ZDXE 4O58L 4K8RC 3LRSA 3ZKNC 4H20H 3O6FB 1I1FA 5IHBA 1E28A 4JO2L 5EC1B 2FO1A 3GRWH 1FZKB 1X5LA 1BIIA 4P9HL 3FMGH 1WBYA 2PR4H 5B8CA 5CKAA 5CZVL 3MRBA 2Y36L 5FCUL 3E6FB 4JM2D 2P42B 2FH8A 3QJFA 2A0LC 1UFUA 3ARXA 3E3QE 1MFBH 2G9HB 3AFLA 4JB9L 1K5NB 4KHTH 4I3RH 3P11H 2NY6C 4FQLH 1C08A 5JDJA 4PJXF 4GT7A 3T4AB 4KU1A 1FJ1A 3BRFA 3TZVB 4NWUH 1CDCA 3QZWA 3BFOA 4HWEH 2YN5A 3BP4A 1SBSL 3CUPB 5BCAA 1U8HB 2NZIA 1YEIH 5IBLC 1IEHA 1IAKB 1ES0A 3O6ML 4KY1L 2W60B 1QFWL 4LLYA 2IAND 2DJUA 2A2QT 3BAEH 5FKPA 4HFWB 3OXRB 5HYJB 4XHJD 3K1DA 2NY5L 3FOMB 5IFHH 3GUTB 1DVFD 5IESL 2B1AH 1J8KA 4IRJD 4Y89A 12E8H 2BY0A 2Z31D 4EN3C 5CZXC 5EO0B 1WCBB 3TT3H 2RR3A 1KTRL 3HZKA 4LIQE 3PDOB 4R90H 3I84A 4XI5D 3VGAB 4R4ND 2AXGB 4NJ9L 1G6RL 3CSGA 5IQ7H 1A9EB 4JHWL 3UTQB 5C7XH 1FORL 3X17A 1U8QA 3EYOA 2HTKC 2I60L 3VFWA 4HPOH 3SO3C 1JI2A 1WT5A 1JP5A 3O2VH 1ORSB 1FFRA 1EJ6A 4KI5E 4I18B 4JM4H 3Q3GB 3WO4B 4ELMA 3CPLA 2CQVA 4L9LB 5IG7B 3R06B 5FA4A 3CSYA 3V5DB 1DDHB 2AJXL 1WQVT 4M00A 4WI8A 2X1OA 2UZIL 4U0RB 4WW2A 4LNRA 3DTXA 1KG0B 3PP4L 3EFDL 4UT9H 4XPFL 5HTSA 2AKRA 5HGBB 4ELME 1NFDA 4IRSA 1CICC 3S4SB 3AAZA 1QLRA 4JFHE 3RGHA 1FL3B 1JI1A 4LP4A 1OM3L 3QQ9D 1OGAB 4EN3A 1TJHL 5CFHA 1UM6H 4EUPB 5I8EB 1NCWL 4JR9H 3CSPA 4RFOL 3E0GA 1WAAE 3VFSA 4WFED 2DLEA 4R9HA 3GDBA 5SWSB 3ZKSD 3VD4A 1HWHB 2FYYA 3BJLA 4WWKC 4TSBH 4DKFH 3O9WC 5ECJE 3VE0B 2NY4D 3OKLB 3E6HA 4GXUM 2CR3A 1K9TA 3EO9L 3WS3B 4J3VA 2OK0H 2J8OA 1CD0A 5F1IB 4GRWH 5DS8A 1D5BA 1EIBA 3UTOA 4DUWA 4KVNH 5DHVH 3VFUA 2W07A 3TBTA 1U8LA 4WFFD 1TVHA 2MKWA 2LTQB 1YMHA 2XXMB 4LCWA 2OL3A 4FXGB 5KSBE 3I2CH 2JKXA 5D1XB 3UTSB 1JZ6A 3QXDA 4KAQH 1CYGA 2IFFH 2ZJSH 5CJOL 1BBDL 1I8MB 4ZUTA 1EV2E 2PN5A 4LIQL 1IC5H 3TO2B 4DN3L 5FHAH 4F7MB 4NHUA 1C08B 1DBBL 4PRPB 1YJDH 5KTEL 4YNYA 2YBRB 3IKCB 5GGQL 5GIRB 1ZHNA 4EDWL 3HNVH 2HVJA 4Q9CA 2GFBA 4RQQB 4U1HA 1YY9C 4YZFE 1A7NL 1DN0B 3NH7H 5BXFA 1GZPA 5BRZB 4KJWD 4NJ9H 3VGFA 3RHWF 1JWMB 3C9NB 4AH2A 4JFEE 4M3JA 2ID5A 3NA4A 4FFYL 3Q48A 1T04A 4G9FE 4MJIB 4YR6B 3HA0A 4OD2A 3RI5K 2DDQH 1AH1A 2XXCB 4LLUA 4Y1AE 4PJ9D 3S96B 1MCPL 3DROA 2YSSB 4HWBL 5ELIA 1JPFB 5IB4A 1I9JH 1YDPB 2CK0H 1JNLH 4XAKD 2WANA 3PL6D 5C09D 2CLRA 4DKDC 4KROB 5A2JH 1UH3A 4NP4H 5IM7B 4LCWD 4U1GB 1IGFH 3U4EB 4YX2L 5ITFA 3I3BA 1OTSC 1MIEL 5JHDA 1WGOA 3W11C 1A4KA 4HJGB 4KZDH 1WAAA 4PB0L 1AO7B 2XV6B 5E2WL 2CIKB 5C3LD 5I1IL 1WITA 4Y2DD 1AJ7H 4CU7A 3I6LD 5LVEA 1FIGL 4OTXL 2PO6C 3O6LL 2YPLB 3WE6A 4UTBH 4RMWA 1EUTA 4PREB 3QUXB 2VDLL 3X3GL 5I8CA 2X4SB 3QZWG 1I4FB 5MEQA 5EC1A 1AGBB 5ICYA 1MPAL 4JG1L 2P45B 2AEQL 5DJDB 2D0FA 3PG2A 1I4FA 3JWDL 5MI0C 1B4JH 4LVOB 2CO7B 3V5DA 4LEOA 3FQTB 1TZHB 3LEVH 4KK9C 2VXQH 3RWGB 2VH5H 2PXYC 3BPLC 4TOYH 5C0CA 4LKXB 1W0VB 2J88H 2BVTA 1KJ2L 2NY1D 3CCHB 1JMXA 5BV7B 5LKNA 4QRTA 3PQYE 2AV1A 1N8ZA 2JIXA 4RAUB 2CKNA 2MPAL 1P4BL 3TEUA 4D2NA 1K8IA 4UNTA 1OGAA 5DJ0B 4EN3B 4YPJA 3QEQA 4LVNB 1RPQA 3LIZH 4XNUH 1H3WM 2DL2A 4AEHH 5T3XH 5E6ID 1MLCA 4GG6B 4LCCB 1AHWC 2CLVB 4DTGL 3KLAA 4MXVF 3ZTJH 3VXMA 4PJ7B 4OCYH 1F5WA 2R0LL 2YK1H 3WO4C 4P4KA 3MLTB 5FV1L 1EERB 4OD1L 3RDTC 1OGTB 3OR6B 4G7YH 3EO9H 3Q0HA 4GSDH 4NZJA 1R5WA 4CADB 3BSZL 3KLHC 1FNEA 5CP7B 2HJFA 1QRNB 1Q9WB 3LDBC 4WU7A 4MQ7B 4O2CB 1H3PL 4XP4H 1HK6A 4MAYA 4CJ0A 3TO4D 4FMKA 5DJ6B 3AU1B 3BZDA 4Y5XB 2EDWA 5BS0B 2N7BA 3IFPA 5I1HH 2IQAA 4JFEB 5I6XC 2Z4QA 1JZ2A 4LSPH 1NANI 4YHZL 3GSQA 4ZFZA 4P5TC 2Q8AL 4F7TB 5GQBA 4TULL 2A6JA 2FIKA 4YX2H 3FQRA 3WIHA 3EYVA 2ARWA 3SKNA 4GRMA 1TMCB 5EPMB 3SE4C 1JK8B 1JZ3A 2AGJL 5DHXB 4EBQH 1AJ7L 2BDNH 3LKQB 1JWMA 3C9NA 2R69L 1JGUH 1BP3B 3QBTB 4JFFB 1EXUB 1NEZG 3AS2A 4MQTB 2VLLA 2PKDA 4A2LA 5B21A 4D9QE 1CXHA 12E8L 2BNUA 3ULVF 4TYUA 3BKMH 4MS8C 2XZQH 4YBQD 4LKCA 5JIPA 3AROA 3SDCA 1RZFH 2OQJB 1U3ZA 3MRFA 1URLA 2ZSVA 4JRYE 3QO0B 3QG6A 2DBLL 2OTWB 4AEEA 3D0VB 4Q97A 3MSPA 5T3XD 2R0KH 2BRQA 1UGNA 1F4XH 2WINB 4XP1H 4AIZB 5E9DD 2IAMB 4D3CH 1T20B 4J3OC 3UX9B 4JFZL 2YZ1A 1SYVA 3HFML 5ITBL 3SDXA 3E2HB 1LK3L 3V6FA 2X1QA 4JAMA 1KELL 4JLRB 2H3NB 3ZHKA 6CGTA 2BJMH 5F88A 4CMHC 3ARPA 1JZ8A 3Q6GH 5KSUA 4OCYL 2ADGB 4OCRH 5TFSH 2JJWA 3OKKA 3C2AH 3TBVA 1UADC 5JHDD 4G6MH 5C07B 5I19L 1X3DA 4U1GC 5FYLE 3SDYH 5C09A 3LQZA 1KYOK 3C6SA 1EAPB 1VPOH 2HA1A 1IL1B 5AWNH 5B3JF 2FNBA 2ARJA 2K9UA 4QRPD 1DN2A 3O3UN 2IJ0C 3GBMH 1I9RL 1YMMB 3ARSA 3KYAA 5HDLA 1MCSA 3IAPA 1YEFL 3RGVD 1G7MB 2CLVA 5J6HA 3V6BR 2RBLA 3OB8A 1Q38A 1RIHH 2A6IA 1O0VA 4HD9A 1TJGL 5ESQB 3GMNB 3WNMA 5BMFH 3BPNB 2EIBA 1T2QL 4U1NA 4JKPH 5ISZE 1S9YA 1S7SB 1A7RH 4M6NH 5DFVD 1T0PB 5ALBL 1JCKA 3FFDA 4UNUA 4RRPA 2NY5C 4IMKC 3K80A 3QDJA 1YY8B 3GSUA 1EEZB 2YD4A 3IFPB 1IEAB 4WUUA 4X98B 4WTZG 2W1NA 1FFNA 2VABB 4UIKH 3A0OA 2J6EH 5F9WC 1JPST 3JV4B 3MLSH 3SDAC 3UTPE 3KPPA 4GKOA 2MTPA 4WNQB 4OBSA 3DETD 3T2NH 2HTLD 3WEXA 3ALXA 3F7VB 3ZL4L 5CBEA 1ORQB 4Y7MA 1ZLVH 4P2OD 5I1GH 3O0RH 5F9JA 3QQ4A 4JVPA 4E41B 5GGUB 3WJJA 1D5XB 1IFHH 4WEMB 4NQVA 5F8QC 1BBJB 3O2DL 4OT1H 4V1DB 2R4RH 3ME0A 3ZHDA 3REWB 2KQNA 1RK1B 4MNHB 4XPGH 2HMID 1ZANL 3UJIH 4IM8A 4X83A 2AJUH 2H2PD 1RI8A 3CFKB 2BHYA 5T3ZL 1FNSH 3NPSC 3WN5A 3QPXH 3QFDB 3FAWA 3F7RA 5GISL 2IBZY 1LWRA 2HRPL 1FC1A 1F4WL 1NDMA 2AQ3A 3AXLA 1FYTB 3T3PE 3FT3A 4HS3A 3BKCH 4Z7NE 3MBEC 3MGTA 4NQCA 1BD2D 1DFBH 3NGBB 4IRZL 4YXKL 3QDAA 1RIUH 4LLVA 1JWSA 2AJ3B 3IJYB 4DKEL 2VZ3A 4U31A 3TBTB 4GBXA 4HWBH 3BWAA 3O4LD 3WHXB 4JN1L 5CIPB 3EKCA 1EO8H 1OAUH 1QQDB 3MLRL 5GSVB 2DICA 1CDGA 2BZDA 1L6XA 1LGVA 5C2UB 4JPVH 1MCWW 5I1LB 3CFBA 1PSKL 4FQ1H 3FB5A 3FCTB 4GKZB 3ARDC 2BERA 1AD0B 2O5YL 2BRRL 4UT6H 4L8BB 4LSTL 4L4JA 3AMKA 4D8PA 2E6JA 4FQCH 2HLAA 2VLJE 4PG9A 5I30H 2R0ZH 1I3UA 3RA7H 2A6DB 4QOKD 3SDXF 3C6SB 1S5HB 3ECBA 2C4XA 1A7RL 2G5BA 3C6LA 4M93B 5GRZA 1D9KC 1J0HA 4RMRA 4YUEL 4MA3A 2PR4L 5L8LB 2J8UA 3QFJE 4RGOH 4R8WL 4G8GB 4Z77B 3P4MA 4PRIA 4TVPE 3C60A 4PV9B 2E7LC 3ILQD 4K55A 4O02H 1UYWH 3STBA 1FNFA 2ADIB 1GXEA 3L7FB 4HLJA 4L8SC 4JG0L 5MENE 3OAUH 1R3HB 4ZFOL 4JRYB 2P8MB 1LE5B 5D6DA 3CLEL 1AR1C 5TDOB 2P8MA 1LE5A 4ODHH 1UCBL 2RCSH 1S78D 5F97E 3P73A 3P77A 5JW3L 5C0BE 4YDKH 2HWZH 4NM4H 1EFQA 5E8OA 3OBAA 1CGSL 3MRPA 3BYYA 4LLMB 4GQ9H 5IHLB 3GKWL 3OPZH 4BSWA 3MJ9A 1HOCB 1WTGT 4JDVA 1JF6A 1IEBA 2F8OA 3SCMD 4DWHA 5IJVA 1P69B 4K3JH 1FGNH 2YKLL 1G9ML 4GJTB 3L5WA 5HGAA 4S0SD 3GMQA 5DEFB 5I1DB 2W0FB 2HLFC 2Z93A 3GM0A 3P40A 4M93C 3DMMB 4FS0A 1FO0L 2W0FA 1DBJL 2VAJA 2PCPA 3MLZH 1K8IB 1MFDH 1NC4B 5F7YC 4NQDA 5D7IB 2X4UB 4H8WL 2OM5A 1NC4A 3MXVH 3ZSTA 3W81A 1Z3GH 3L5XH 3SKMB 3TA3A 4FABL 2NR6C 4D9LL 2CUHA 4Z0BL 3MRKA 5JOPD 3J7HA 2ATKB 1EO8L 3LB6D 4JQXA 4LRNL 1NGXA 4YHYB 3IJHA 4HPYH 3S5LG 4N0YL 4S2SB 5FKPB 1NSNH 5IW1B 3WMSA 4PYHA 4WI6A 1JHTA 1UEYA 1A3RH 2EEBA 4I5BB 1ITBB 4KZEH 3FT4A 2Y23A 3VI4E 3G9VA 4PB0H 4MLIA 3IAGC 5EBWB 2W65A 4WU5A 1QRNA 1T66C 25C8H 1NBYA 2BMKA 3RU8L 3ZHLA 1P2CA 1NBVL 3OV6A 3IGAA 4HWBA 4KMTL 5JR1L 4P46C 5EOTA 3MRHB 2HFGL 1Z5LA 3MV7D 3VRLE 5EZJA 1C16B 3U79A 3OF6D 9CGTA 4WUKL 4KK8C 1H8NA 1U9KA 4NT6A 1F4HA 5AD0A 4I18A 3F7PC 5C0AA 4XVSH 4UIMA 1AQKL 3CXDL 1VHPA 4RZCB 4CKVX 1IT9H 3VXPB 5F7HA 4NKQB 1A6WL 4YAQB 4LU5H 3H42L 3MRNA 1S5IH 3LKPA 4F15B 1QSEB 4Y5VA 2NY2B 2F19H 2N1KA 3EJZC 4J1UA 3JTSA 4CVXB 4CVUA 3OJMB 5GRUL 3K0WA 2XWTB 4Y1AB 3C5SB 3RWDA 2BSRA 3S3JA 4WWID 1S7RA 3ZE2F 3MUZ1 4DKFL 5DJ8B 5E08H 3RIAF 2DRUA 35C8L 1CG9B 2UYLB 3C87A 4HS8L 3V52L 3UYRL 5JXAL 1RVFH 4DGVL 1RV6X 1ITCA 3UPCA 4YNYB 2WUBH 3DUHA 4M03A 4PJEE 2ZSVB 1PY4A 2C1OA 3L3IA 5FF6A 2XWJA 4PP2B 1J8HE 4BYHA 2YD2A 1E0OB 5CINH 3RKDD 4MXQD 2APFA 5T3ZE 1MY7A 2IPTL 4M7LH 1CGWA 4IEFB 3QHFL 3DHJA 1SJHB 1HSBB 3KPRD 1PEWA 3G5YB 1E4XL 2AJ3A 3BDXA 4DVBA 1QA9A 3IKKA 3IETB 3QUYC 3SDXB 3DSNA 4R0LC 3MV8A 3ZDYE 3TVMA 4HGKC 4E0RB 4N8VB 1G7HA 2VLRB 4TVSa 5HDBE 1KTLA 3M17A 3MV9A 5ISZA 3VFPB 2XACC 3BQUD 2X4OB 1IKNC 1T1ZB 4QRUB 3B2VL 3MLPA 3CX5J 1IC7H 5FGRA 3QIUA 2J8UE 4LP5A 3N0PB 1JMZA 1H3XA 2DM2A 5JXEA 4AJ0A 4EIZC 1CLYH 3HPJA 3KPSE 5EC2A 1QBLH 4IMLB 1RUKH 4PJBE 5MERA 1AGEB 1AE6H 2D31B 3LRGA 2NXZC 4FG6C 3MRDB 5EU7E 1DLFL 4YHKH 5GIRA 4X7TB 3M45A 5C0BB 5C0AE 3CH1B 3TESA 1MPAH 2D31A 3ZLQC 3NACH 5JOFA 1OAXH 3CFEB 3EZ8A 5ACZB 4MD5A 5DR5L 3WS6A 4JO3L 1I8KB 4Z7VB 3LS5H 3W0WE 4ZODA 3IDNB 5J1AA 2XY1A 1NCTA 1N0XH 2F58L 3M8OL 4TOYL 2H26B 3LDBB 4PTUB 4JHWH 4CNIA 1MWAB 3RUGF 5GRVK 1QNZH 1MHPH 1KCSL 5DD0H 2H26A 4ONHB 1AQDA 2EKSB 1ZA3B 2IADA 1P4BH 4Q2ZB 5EFIA 4AG4H 4G8GE 3WV0A 2AK4D 5EBWA 2YD7A 3SE3A 3HE6C 2ZP0T 1IILE 5TDOA 2QADB 5ETUB 1DQDL 5I17B 2GTWA 4HKBA 1XF2A 1JRHH 5DUMH 3RDTA 1BX2B 2DYPA 1TVBA 4I0CC 3OXRA 2P48B 5JUEH 5EBLA 4ETQB 3UDWA 4OM0L 1FDLL 2YMXL 4UDUA 1HQRA 4FFZL 5IV2B 2UVEA 1MQKL 2ESVE 4FP8H 2HFFA 1HOCA 1XF4B 3WHE1 2XZZA 3SOBH 2V7NA 3JVGA 3I9GH 1YYLH 4FQ2H 1L4IA 2GT9B 5DZLA 1K6QL 3A6CH 3MZGB 4DOHB 1EFXB 4NDMB 3UTZA 3ORJA 1ORQA 2D7TL 1KJVB 1UKSA 4U7KA 4XPTH 1F4AA 2PNDA 3F5WA 3JBG7 5FOBB 3HKFA 4V1DE 15C8L 3QCTL 1KPVB 2P4AB 1NFIA 2ZG1A 3MR9A 1XCTA 1AP2B 3T04D 1ZXQA 4QRQA 5C71A 2W0KA 1K8DA 2VJXA 4ODXB 1MREH 1U8OB 3MA9H 4W6WB 4BFGA 3KYMB 4WI9A 1DUYA 3DI3B 1DQMH 4MA1C 4F7TA 4YHZH 1H3GA 3PF2A 5D7IE 4HUNB 2EDNA 1F11B 1JL8A 1B0RB 4ODSH 3T77A 4OV6F 3MV7E 1RZGA 3JSSA 3MLYH 5BMFL 5J06A 1J10A 2IG2L 1VEOA 1BZ7B 1FSKB 3RZCA 4MXWH 4IRJB 1I3VA 3HG1D 4YFLF 2FWOB 1U6AH 4HJ0C 2WWMD 5DD3L 4ZFGL 3CFDB 1RUQH 4O02L 3OX8B 4UMGA 2F54D 3HI6L 1IMHC 1A6VL 5CLTA 1P2CB 5GS0H 2X4RB 2ZKHL 5BVPL 5I1LA 1N64L 1HHJB 2DKUA 3EYSL 1AXTL 3EHBC 3HNVL 4JDZB 4WGWB 1KB9J 2E9IA 3B9DA 5H37H 3HB3D 1YEJL 3TYGL 1G7LA 1UCBH 2RCSL 1OB1A 3DO7B 3QIUB 4KKCC 4OGAD 1SVZA 3RWJB 4HC1H 5EU4A 2ERJC 3ULVD 4JHBA 4PP1D 4RMUA 3S7GA 1NUDA 1NCBL 1A9BB 5AUMA 1BQLH 3WDHA 2VLJA 1RUKL 2NMSA 3H7BB 3L3JA 1DN0A 1KCUH 3VXSE 1NFDB 2DJSA 5IKCA 1C1EH 5JW4N 4PGJA 1AGFB 4JLRA 3VWJC 4LHUD 3QUZD 4MMZC 1MIMH 1IM9A 1HHIA 4ZAKC 1FH5L 1R24B 3UJIL 5HY9B 3LHPL 2OR9L 2Q20A 2ICEB 5EIIA 3S3SA 3UTTB 2CJUL 2VUOA 3HUJB 4X99B 5DJAA 5HY9A 3HZYB 3DV4A 1BFSA 4AQOA 1UA6H 3PGFH 4JO1H 1YMME 4JY6A 2A6KA 4U1LB 1ZVHA 3PGDB 4YHIB 4K3GA 5HHOA 4GRWB 1K2DA 1JGLL 4ORZC 1RIUL 1AY1L 3U4AA 3MRQA 1P6AB 5I1EH 4LLUB 1C5CL 1O7SA 1XGQB 1T2JA 3O9WA 4FFWD 4KROC 4R97B 1BJ1J 1HH9A 1TZIB 4KZDL 5J6HB 4ZTPH 4L3AA 4WEBH 4M48H 5C9JA 3V0AC 1W72B 4Y16B 1A14H 4KI1A 1FQ9C 4WFGE 4ZNEA 5TE4L 5I76A 3W0WB 4OZGA 2X1PA 1T5XB 1CLZH 3EOAB 1VCAA 1F13A 1YC8A 2YXMA 2VDPH 4XB7A 3V0WH 4EI5D 2EC8A 1NGWB 3QJHB 3CXHJ 3LKNB 3BZEA 2XA8L 5GRUH 4ZUVB 1EEQA 5KN5A 4XVJL 1U41A 1G7QA 2CRMA 2EDLA 3IDIA 1J9CT 1D5MA 3RPKA 1TDQA 1CFQB 3QEQB 3VXME 4KHXH 3V7AE 3VXUD 3LV3B 4R4BA 5E56A 1I7TB 2JJSC 5GS1B 2CDFA 1I8LC 3ZO0A 4DCQB 4YXHH 4KHTL 5D4QA 5L6YL 4L8DB 4R2GC 3O3DA 1KN2L 5TDPA 3GSVA 4PJDF 4HH9B 4X5WB 5F3HA 1BREA 4IIQA 5D5MF 3VD7A 3GMRA 2ADJA 1NGQH 3QPQC 5FO7B 1X5XA 3L9RA 3HCVA 4HC1L 4MWFA 3PQYA 4N90E 4C83A 1MCKA 4LCCC 1U6AL 4F7PA 5JA9A 5E08L 3QULB 3KVQA 3ARDB 3GNML 4QXTB 2O5XL 4WEUD 4JVWA 5CGYD 1UEMA 4O4YH 2BCKA 3OMZA 3SPVB 4B7IA 2XA3A 5T5FL 1E6OH 1CXEA 5DD5L 3QIWC 5HI5C 1DUZB 1QKZH 1YQVL 3K46A 2J8HA 3TBSB 2XQBH 3OG6B 4PGZA 5E8PB 4J3SA 5F44A 2VXUH 3VXPA 3MRJA 5E99H 1A7PL 1MCOH 5C0ND 4FZ8L 5DGRA 2R1YB 5SWQA 2Y25A 5DRWA 3O4LA 4MA8H 1UG9A 1JFQL 4GBXD 3FRPA 1EMTH 3MODL 4LKXA 5AEAA 2CO6B 2OMBA 2UV3A 3TBWA 4JE4B 5F6IC 2ESVB 4HIEB 4WUUD 3P9MA 3OKMA 3RIFK 3RWHB 1HKFA 5CBAA 4N9OB 2CGRH 4UBDD 2D0HA 5BZDA 2EDEA 3KPSD 3PP4H 2CK0L 1ZK9A 4G9FA 3FCTA 4LLWB 1H15B 3VXNB 5DD0L 3MCLL 4UNVA 3WFHA 1G6RH 2R39A 3CSYB 1JNHA 1NAMA 3WFHB 2FECI 4GG6E 1MCJA 4L3EE 3DRTB 5H2BB 3V9FA 2OXGA 3BGFC 1MHEA 1XGUA 3WFEH 5L7XL 1OGTA 3OR6A 4LPXA 4XCNA 3RJQB 5B38B 1EXUA 2KDGA 4L4TE 4ZUUA 2QL1A 5HBBA 4F37F 4WHYG 1D5BB 4DK3A 4QRSB 1JGEA 2Z8SA 2YOCA 2DKSA 1SJXA 2GSGA 1ROWA 4QRSA 5I16B 3IFNH 4S1RL 4ZO6A 4LSTH 3DX9B 4Z5RA 2R0KL 4G80B 1A2YB 1SJEB 2W92A 2VN7A 4PGBA 2P8PB 3ABZA 4JFEA 4OF7A 4KVNL 5BZWA 4KQ4H 2IQ9H 4W4OA 1ZLWK 4MCYB 1LVEA 3G04B 2DJ4A 4WI4A 3BPCA 2YBRA 4M6AA 3IDXH 2FJFB 4LAQL 1JPTH 1FYHB 3CMOL 1BM3H 2IH3B 3VXRD 2HLAB 4PG9B 1FZMB 1NFKA 1CDJA 3T65A 2DS4A 3WIFA 3GKWH 4HS6B 4ZSOA 5FK9B 4G42A 2JB5L 3NAAL 3KG5A 5JOFB 4NFDA 4HZLA 1YPZA 1I3RB 1MFCH 2QR0A 5LBSH 3HAEA 2N56A 1AGFA