5BRZE

Mage-a3 reactive tcr in complex with mage-a3 in hla-a1
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
241
structure length
241
Chain Sequence
AGVTQTPRYLIKTRGQQVTLSCSPISGHRSVSWYQQTPGQGLQFLFEYFSETQRNKGNFPGRFSGRQFSNSRSEMNVSTLELGDSALYLCASSFNMATGQYFGPGTRLTVTEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-1 alpha chain
publication title Direct molecular mimicry enables off-target cardiovascular toxicity by an enhanced affinity TCR designed for cancer immunotherapy.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2015-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07686 V-set Immunoglobulin V-set domain
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5brzE02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5brzE01
1NC4B 2AXGA 4OLVH 2P5WA 3O6FC 3TWCL 4M9OA 2Z4QB 1NGPL 3LHPL 4ZG1A 5KN5B 4U1IB 1E4WL 3MCLL 3WNNA 4NO0A 4IOIB 4LCWE 1T2JA 3HE6D 4I9WD 3G04A 3IFLL 1MI5D 3QA3B 5C0IA 1AHWC 1Y18B 1KCSL 4JANA 1NEUA 1B0GB 3VD5A 3VRJB 1N59B 5I66A 3ME0A 1QSEA 4OFKA 2IPUK 4MZ2A 4JKLA 3IXAA 4Z7UF 1NFIA 1YEJL 3FQWA 2NY0C 4Y5YC 5GGUB 2D7TL 2E6QA 2V5MA 3FB6B 2XG5A 3MV9A 4X6DB 3SDCD 1JIBA 1VPOH 5ISZB 3ZDYE 1GL4B 2VZSA 1SBSL 3FQXB 5FA3A 1DLHB 4MGXA 2PN5A 3REVB 3QXAB 1FVEB 1YPZE 1HXMA 5GIRB 4MAYA 3R06B 3BN9D 4HG4J 5DQDH 3GO1L 5AZ2H 3L95A 4JFFB 2JK5A 3AS2A 3N0PB 3WKNA 4OCYH 4RSVA 4YE4L 4LLUA 2A6JB 3G6DH 1ND0B 1BBDL 1XIWA 5C07B 3BKYL 5C08B 3TLRA 1QLRB 5H94B 4F15B 3MRKB 2GUOA 4J8RB 3VE0B 2OSLA 1JUFB 1V3MA 2YXMA 1MEXH 5T3ZL 3BEWB 3HKFA 1T03L 3OMZA 3FT4B 2AGJL 4YHIB 3M8OH 3KLSA 3AFLA 1G9ML 4NQDE 5KVFH 1U8QB 3DBXA 5ESAB 3EBAA 2R0ZL 1SJVA 4QHUB 3RNQA 1TXKA 2A6IB 5F88B 1Z5LA 4CMHB 5DURB 2ZUQB 1FBIH 1RZIB 3L6FB 4Q9RH 1BJ8A 1UWEH 4KHTL 1I8LC 3FQRB 1J8HB 3V4UH 4U3HA 1JWSB 1RUAH 2I5YL 3KG5A 1HILA 2WWMC 5GGTL 3MXWH 4IRJA 4JRXB 4E5XA 1YEFH 2YK1L 2QTEA 3IDNB 2L7UA 4EN3B 3E6FB 5FYJU 3MACL 3EZ8A 3WFEL 4QNPE 4G8GD 3WDIA 3QJFB 5AD0A 1S9YA 1NL0H 1R24A 3A6CL 2APTA 2MOVA 1EVUA 1KCVL 4YX2L 3SKJL 3EFDL 1WBYA 3VRIA 4XBEL 1UQSB 2Q6WA 2ZNWA 2PYFA 1K8DA 5I1DB 3C5SA 1FE8L 4OSUH 1JN6B 4LLVA 3QFJA 4HIIB 1JPFA 4YDJA 3NTCH 1M7DA 2YBRB 3P0GB 4Y2OA 5CSZB 1BZ9A 2X4PB 1SEQH 3W9EB 5J7CC 5CBAA 1JZ7A 4JFDD 5IVZB 4Q0XH 3SBWC 4DKAA 4F2MB 1QKZH 1WJ3A 4UBDC 5EOTA 5D1XA 1JPTH 4JY6A 3OJ2C 3LMJL 4YHOH 3OKDB 4XVUC 3T0WA 3ARWA 3HG1B 4RIRA 5E5MA 5SWZB 1T7WA 2BNRA 1IL1A 1FGNL 3UJTL 4PFEA 3OGCB 4NNPL 1EUUA 5D5MA 3WFBH 2AEPL 4ZO9A 4K9EC 4M03A 2RQ8A 4L4JA 4M7LH 2NCMA 3ARGB 4NRZA 2FGWL 4XNZC 5DQJA 1GC1L 3EJJX 5JZ7C 1NBYB 4BZYA 3WHXA 1CD0A 1IGTB 3CC5B 5DRNA 2JJWA 3OB8A 5ID0B 3DTXB 2BHYA 3QUZD 5D71H 4A6YL 1RPQA 1Z2KA 3O2DL 1DQQB 3VDCA 3GB7B 4PYHA 3N9GH 4PG2C 4B50A 3DGGA 4HIHA 2Q3AA 5JA8B 2H2SC 1A3LH 2P8LB 3HUJF 5HHOA 2FJHA 5DRXA 5DZNA 3VXTB 3BO8A 5ANMB 1KXQE 3S37H 5CIPH 3WIIH 1H3PH 4LHJB 1ZHKA 3MNVA 3DRQB 3GGWA 5DZLA 2NY6B 1XR9A 4GRWB 4OD1L 4U1NB 4JDZB 4DKEL 4RMQA 4OCYL 4JFHD 2EO1A 1SYSB 3BQUA 2UZIH 1G7IB 3L3OB 4RX4A 4GG6A 3ARQA 4JHZA 5T1LB 3TVMB 5I1LA 4JPWH 1WBXB 4OZGE 4NPYB 3N85L 2QSQA 3UTTE 3RY4A 4JQVA 4C4KT 1MFCH 1N5YH 4ZXBD 4NJ9H 3CGTA 2X89D 3NH7H 4P2RD 5ADOH 4ODHL 5E56A 2HKHL 3FN3A 4HJGA 2XWTB 3BP7A 1SM3L 4FTVB 4WU5A 1RU9H 1C16B 3FB8B 5HGBA 3OG6B 3CVHB 4HHAB 2DM2A 5C92A 4ODTL 5FYKL 1N5AB 4AT6A 4X7TA 2YN5A 3VFVA 2GCYA 4MDJA 3VXMD 2Z35A 1WWBX 3W82A 1AXTH 4JQVC 4QXTB 3RVVD 4KHXL 5IMLA 4PP2A 2AJSL 2DN7A 4F15C 1IAMA 2YRZA 3D2UA 3H42L 3MRMB 2UV3A 3PWVA 2BY2A 7CGTA 3UCRA 1DDHB 4P2OC 1CU4H 4GAYA 2DF3A 2FIKB 1MVUA 2IPKB 3CU1A 3Q6GL 2YEZA 2DQJH 4YGAB 1N0LA 4R2GD 1UGNA 4CDHA 4DKDC 3KR3H 4IHOA 4CMHC 5KVDH 5C0AB 3HI1A 3QPXL 4HC1A 4HJ0D 4GMSL 3QIWB 4BH8A 3QI9B 5EIVA 4Z5RB 4ZUUB 4PJ9A 4WI7A 1HK6A 1SHMA 3KPRD 5F3HA 3O3EB 4TVPD 3LQMA 5L8KB 1BJ1H 4HXAL 4UNVA 5SWQB 4N8CH 2FCBA 1VFAB 2ZZUT 2B5IB 2A74B 1FGVH 1F4WH 1F3JA 1H3XA 3SE4C 4Z9KB 4UILH 2UWEB 3OKMB 4BKLB 2XWBA 2PXYD 3TC9A 2XWJB 2X4OA 2DJUA 4PJ9C 2JJSA 1UJ3B 2MQCA 5C3TA 4F7MB 4ZTOH 2FEDD 3JV6A 3BMWA 2ENYA 4I3RH 1MHEB 3JUZA 4JGJA 3RWCA 3QULB 3LN5A 1PJ9A 3X12A 3ARDD 1K8IA 5IVXF 4JREB 4ELMA 1L7TL 1DN0A 2ICWA 4JB9H 5DJ8B 3IFNH 3NAAL 1AGDB 3BOVA 4Z8FH 3MRBB 4MXWH 4UT7L 5F7FA 4AMKL 4GUPB 4L9DA 2E3VA 5IW1A 2GSIA 1JZ3A 2AXHA 1JPGA 4JN2A 1WAAF 4QCIB 3C5JA 3CZFA 2CDFB 1AXSB 3OZ9L 4P9HC 4XWOD 5DQ9B 3S37X 1MJ8L 5CP7B 1AD9B 4M5ZL 2O5ZL 2VLJA 3U48A 2E9IA 4U1KA 3RZCA 1HH9A 1T83C 3VXOB 1RHHA 3MA9H 4XI5C 2AJ3B 3MJ8B 4AIXA 4K7FA 3ARGC 4JFYA 4R7DB 2IBZY 1GGUA 4MB5A 1MLCA 5TE4H 4PY7B 3SQBA 5HYSB 5JHDE 3ILQC 5DK2A 2DQEH 1PAMA 5AG9A 4MDIB 5FB8A 4TUJB 1FNSH 1FIEA 2ZP0T 2EDNA 3D69B 1DEEB 4WU7A 3DXAB 1BD2E 2NR6D 1C5CL 3MUGB 2ZUSA 5GGRA 3SGEH 3LN9A 2OZ4L 2D0GA 3QIUD 4KK6D 4OGXL 3IDJB 4MD5A 3SJVE 1ZHLA 4HSQA 5I30H 1JWMA 1MWAH 4UTAH 5IR1A 4LNRA 1NC2D 2GJ6A 4I48B 5MP6L 1X6NA 4NM8H 4BSVB 3E8UL 2NY7H 1LK2A 1SJEA 2XTJD 4OF3A 4D8PA 1SVZA 2WM0A 4PJHF 1FSKB 3BIKB 2CDGA 1MCCA 5HD8C 3GHBL 4NO3A 3DECA 3TVMC 4P59H 3BJLA 1J18A 1KB5L 3MV8D 4YBQC 4FXKA 3BRGC 1Y6MR 2EE3A 2EXWC 1G7HB 3UTSD 4WHYG 3PHSA 1U58B 5GJTH 4ZUSB 5C0FA 4GRLD 4UV7H 3IDYC 2FWOB 1FFPB 3OKNA 3NIGF 4HS6A 4ZO7A 5B39A 4P4KD 1WZMA 3MRDB 2ICWI 5HGDB 5JW3H 3NIFE 5BXFA 3PDGA 3LIZH 3T2OA 4HMCA 3ZTJG 3RX5A 1Y6KR 2XY1A 2FJFA 5HPOA 5C0BA 4FQJH 4XGZA 2WWKO 4PBXA 3VJ6B 2W0FA 4YHZH 5BV7H 1ETZB 4OKDA 1VGKA 4NP4H 3TN0D 3HMXH 3T65B 3C6LA 4LP4A 3AS3A 2AJUL 1A02N 2YWYA 4U1LB 2EDYA 1JK8A 5EBWA 4C56A 1HYRC 3EOTH 4KUCD 4JZNA 4XPBL 3U7WL 4HBQA 3P0YH 1NFDF 5T1MA 5IUSA 4KRNA 3PWPB 3RGVD 4BZ1L 3GMNB 4PJAB 4BK5A 4YHPB 1G1CA 4LGPB 4OCRH 2FECI 4YXHL 4BFIB 5DA0B 5IM7B 1QP1A 2I25N 2X4SA 3HZVB 1UENA 5C3LD 4XTRC 1RFDH 4L4VA 4E41D 5AZEL 4QEGA 2ZCLH 1AIFA 3F5WB 4U1SB 1H3VA 4M61A 3QDGE 1TJIH 1U8PA 3C08L 3CFJB 4KKNA 5H2BB 4W4OC 1R3HA 2X4UA 1KNOB 1PKQA 3VA6A 4PR5A 4LF3A 3B9DA 4PTUB 3QEHB 1VACB 1UJ3C 1DBAL 3TPUA 5CSGA 4PJGF 1EAPB 2FATH 4H1LA 5D2LA 4LRNH 5DVLA 2C7UA 4U0QB 4TVPH 1NCWL 2A0LD 3IETB 4JREC 5CS7A 5E5UB 3KWWA 1F6AA 5LCVH 1OAXL 5E8OA 4I8DA 3QO1B 1P4LA 1IQDA 4EEEA 4Z95L 4PJXF 1KJMB 4X6CF 3GSNL 1Q0XL 2Y9RT 4Q97A 2DLIA 3BP6B 4JHWL 2EYRB 4NKMB 2VUYA 4JR9H 2HVKB 5JXAH 3D3VB 1CFBA 3CFEA 2VLMD 4HF5L 3UYRL 3ZKMC 5IEKA 2EDXA 4WFED 2K1MA 5KS9B 1UFUA 1YEHL 4NFDA 1KGCE 4CNIA 4KV5F 3QXVA 3ZE2E 4D0CA 2IPTH 2GSGB 1FZMB 1RUPH 2VQUA 1MFBL 4MZ3A 5LAXA 4IOFD 1M71B 2JCCE 3SEPA 4PJDA 2ESVB 2ZSVA 4TSCH 5E94B 5BCAA 3FFCD 3U79A 4P5MB 4M1GL 3BKJH 5J6GB 2CK0L 3QRGH 1V7NH 4KRPB 43C9A 4BJLA 3ZE1E 2H2PD 5ICXB 3BWUC 4PRPB 3O6FD 5DEZA 1IVLA 5LGJA 2J8UA 2BDNL 2UYLA 4QXWA 1DL7H 1PVHA 4P46A 1GGTA 5E8EB 4GAJL 1CTNA 1DQJA 5DFWH 2PO6A 4KMTL 4U2YA 3PGCB 5E00B 1EXUB 4ALAL 1XZ0B 4MHHI 1UM5H 2DQFB 4JM2B 4UIKH 4Y4FB 5CD3A 3R1GL 3WUWG 2ZJSH 2OL3H 2IQAB 3F7QA 3KPMA 4WW2B 3ZO0A 3ZTNL 1I3GH 3TV3L 2P5WD 5JW4M 4Z0XB 1QRNA 1FSKC 1FYTE 1X5JA 2NY0D 3LQAL 2Y25A 1E0OB 1PG7L 4V1DB 5HPMA 1U8JB 5I0DA 1GOGA 4YR6A 3MROA 5L6YH 4K7PL 3KJ4C 4HUWB 4JPVL 1RZ8B 4QF1B 3H9HB 2Q76A 3V5KA 1NBVH 4YAQB 3K2MC 1Y6NR 2NY5C 2X9YA 1A1MA 4XPTH 3UPRB 1T80A 3UZVB 1D3CA 2ZPKL 4LSQL 3RWHB 2F54E 3VW3H 4I18B 3U2SA 4O02L 4OQTL 1AJ7L 2ORBH 1AD0B 3ARTA 3MNZB 1CFTA 3MOBH 4XNMB 3P11L 1YQVH 2HRPH 4S1RH 2D03H 4JM4H 3QZWB 1QG3A 1OAKH 1IQWH 5J0BA 3HAEH 3MLWL 2NX5D 5DJ6B 5ENWB 3KPLA 4ODXB 1FG2A 3U7AA 4WWID 3NPZB 4HT1H 5CGYC 3WXWH 5HJ3B 4OCWL 1I9JL 2N7BA 2VKXA 3JWOL 2HFTA 3MRPB 1ZLUK 4FN0A 4LBEA 3CK0H 3I6GB 3BI9X 5EFIB 3SCMB 25C8H 3O6KL 3DUUA 4XNQB 3LKRA 2Y72A 5FYLD 5C0NC 1NCAL 4Z76B 4P99A 5JO5A 2IWGA 1NLDH 1ZT1A 4FQIL 2DM3A 4NHUB 1XF5B 3B3IA 5IV2A 1KCRL 5DEGB 3PQYD 5C6TL 4LU5L 3PDOB 1KXVC 2XKSA 3QG7H 1KC5L 4NJAH 5D7JB 2P47B 3U6RA 2J4WH 1XAUA 1BBJA 4NM4L 3MLRL 1BQLH 3MRQB 5BVPH 3E2HB 2VAJA 1S5HA 3QDJE 4UQ3A 5EC2A 5F9JB 3T09A 4L4TB 5DI8A 1NAMA 2PYED 4JFEE 3EHBC 5F7LB 2AKRB 4KJQC 2K3TA 5C2BH 1EHAA 4EIGB 1KENH 4PGBB 3S36H 2AI0H 1MIEH 1VGEL 4AEFA 4FQ1H 3MLUH 1YMHB 3S35H 4JCLA 4JFPB 3GUTA 2VDNL 1JRHI 3DUHA 1LO2H 4CL7A 3V9FA 3IRZA 2R29L 5CINH 3BXNB 1S7RA 2X9WA 4UBDD 1XF4B 2ATKB 1GPOH 4WI9A 1A7OL 1V7NL 2WUBH 3STBA 1UB6A 4PJ8B 1MJUL 3VFSA 1A4JB 3TJHC 1GZPA 3CXDL 1D5ZA 2V7HB 2XXMB 3GSWB 3MREB 4LSVH 4PLKC 1IEBA 4H88L 4DZ8B 2Z91A 5E99L 3QWRA 3PHQB 3K4DA 4GKNA 5GGVH 5JZ7D 3QIBB 5D1XD 1XCTA 3O3AA 3VXNA 5EZJA 4XC3L 1T1ZB 4CVZA 3FFDA 4YDIL 4D3CH 1XGYL 3D39D 5IK3B 1OTSC 5J1TC 4NKDB 4MNHB 2O61B 2F8OA 3QDAA 5B21A 1I7ZB 4N90D 3QO0B 2Q86A 4XCNA 3ZMRA 1KPVB 4KDVA 5DGRA 3CMOL 3DOSA 5FA4B 1RIVH 2H3NB 3WIHH 3WLWC 1NGYA 4O2FA 1NKRA 5I1CL 1O0VA 3BSZH 4I9WE 1CFVH 4JM2C 2A1WH 4Y4FC 3GKZA 3VW3L 1MI5E 4WO4C 1JBJA 2EDLA 4NQEB 2ZUXA 1K5NB 3TH4T 4GW4A 2DYPB 2XPGA 4WV1A 4XNYL 5DSCB 3I84A 4ZS6D 2KPNA 4X83A 2J88L 4QRRA 5E2VL 1TQCB 2P7TB 4EI5A 5ISZD 3BUYA 3FHQA 3U0PB 4BFEA 4QRTA 1F00I 5DS8B 3Q1SH 1FZJA 2ZCHL 5T33L 2H1PH 4LKXA 4RGOL 5HHNB 5EBLB 1KEMH 5C0CB 1JZ6A 3NCCB 4RX4D 1IGIH 3BW9B 1OB1A 5ITFA 3DX9A 5JIPA 4I18C 4FQCH 4EI5C 5D6CA 1NLDL 5C6WH 5ETUB 5C07D 5C08D 3K8LA 3P0VL 4YFEA 3NZHH 1G7MB 1G84A 2VYRE 3V8OA 1R5WA 4YGVA 2VDPH 5HHPA 2A38A 3ARVA 4IMLA 5TF1L 2Y23A 1JMXA 2ED7A 4P2OD 5GHWL 3JSSA 2X42A 3T3PE 5H35B 1UCTA 4JO1L 2HTLC 3NA4A 4HKBA 5GS3A 4OI8A 5IHZA 3REWA 3BPCA 4NNXA 1JTTA 4HK0A 1A0QL 5F6IB 3EDFA 2EDFA 5GSVA 1BX2B 3SCMC 4RGNC 4OZHB 3KHOA 5DURD 1FVCB 3W2DL 3IF1A 3QUKA 4FXGA 4F9PA 2ICEB 4MD0B 2HN7A 1J86A 3U36A 4EOWL 4YDVB 4HH9A 1ZHBA 1J8HD 5BOZG 2UUDK 4WHTB 2ZOKB 3T2QA 5SX4I 2F5BH 5CBEA 3HS0B 3MJ9H 4IIQB 1NMAL 1EFXB 5EZOL 1MCPH 1OTTD 3BH8A 4N8VG 5D7JC 5EO1A 4CRPA 4RQQA 1NLBL 1T1YA 3LKNB 4Y4HA 3ZDYF 5DHYB 3PWJA 5FYLH 4NKOA 3O11B 4G8GE 1YPZF 4PJ9D 1WT5C 1LE5A 5IG7B 3MLVH 5KVGH 5I2IA 3BT2L 1NGXA 4RFOH 3FB5A 2O26U 3ECBA 4QRQA 4DK3A 2W9EH 2EDOA 1C1EL 3ULSB 4OLXL 4LSVL 4OTXL 4CGTA 3KDMB 1CK0L 1ZWIA 4OLUH 5CKAA 1HXYB 3DETC 4P23A 1KTLA 4LCIH 5C09D 2YPKA 3EGSA 3B83A 5K9KB 1LDSA 1JWUA 4MJ6A 5LG1A 3LZFL 1YN6B 4AIZB 2G2RA 1WCBA 3HG1D 2YPLA 1QVOB 2X4RA 4PJ8C 3I02A 1YQ2A 3AU1B 4GQPH 1A1NA 4QYOA 3BUTA 3DI2B 3U9PL 4G5ZL 4DUXA 5F89B 5DJ2B 5HGHA 3O8XB 3WIHL 4XI5D 4R4BB 1MJJB 1UVQB 3ARGD 4H25B 1ZGLA 3HC4H 3QIBC 5J6HA 1KPUB 2OR8A 2P5EA 3ILQD 4K23H 3DHJA 1ORQA 2GTWA 4JO3H 4X4YA 4N0FB 3D25B 1IC1A 1YUHB 1ORSB 5TDNB 1CGUA 4RMRA 3D18B 2VLJD 5EU5A 3RZCD 1GGYA 1H0DA 3WMSA 5DLML 3PNWB 3LPGA 5EUOA 1V8HA 1ZSDA 4QNPF 4ORGA 4K9EH 3RUGE 2H1PL 4Y5XA 3RWEB 2L7JA 4Y2DA 3TNNA 1I3VA 4N0UB 3T0DA 3IDMB 2Z92B 3KHQA 4PJBB 5EBGA 4KI5C 5FUOH 2WANA 1N0XH 4HIJA 1KELL 1E28B 2G5BB 2V9RA 2D0HA 1KIRA 1FFQA 5A16A 3NZHL 2QHRH 5INDA 2CUMA 2X40A 3TVMD 5KW9H 4IDJH 4ETQB 3S3PA 4YBQD 3E6HA 5DD1L 4XXCA 3IVKB 3H9YA 4ZAKB 5HYJD 2BVEA 1H9VA 2GJ6D 3CSGA 4HFUL 3HPJA 3CPLB 2VN4A 3PXJA 2WINB 4G9FB 1DE4B 4MD4B 2NY2D 2DQTH 3CCHA 4H0IA 4R0LB 4PGCB 3SKOA 4Y1AB 2EDRA 2YSSA 2W9DH 2FO4A 2WW8A 3GMLA 5D7LA 3T8XA 1Q0YL 1XGUA 3VXME 3HNSH 1NGQH 5C1MB 1YEIL 3FO1A 2F5BL 3V7AE 2EIZB 4LMQI 1DEDA 4WEBL 3RTQC 2ADGA 2FR4B 3IDGA 1J0IA 4X80H 5GRUH 4BUHA 1HDMB 5DC9B 3HC0B 2MNUA 3V79C 4NC1C 2R1WA 3EFFA 4TOYL 4LLAA 3U0TA 2YN3A 1ZT7A 3MCKA 4MA1B 4HKZB 4HMDA 1LK3L 1QLFA 3NIDE 4RFOL 4JDTL 1PZUB 4DEPC 3C6LD 3FQTB 4YQXL 3U9UB 4M6ML 1FORH 4HX1B 4KKCC 3ZKXC 3L1OH 2VLKB 4C56D 1JNHB 5GGSA 3V52L 1IGYB 4XTRD 4UT6H 2WBJB 1T21A 1CGWA 4OLUL 4MA7H 3KPRE 1S7UA 4TVPE 5FKAB 1R3KA 1UH4A 4F57H 4L3AA 4OZGF 3LKSA 1KCKA 1FPTH 3GNML 5FO7A 1N7MH 3O9WB 3CFKB 1NMCB 5HYFA 4JRWA 4HK3J 1KT2B 2XI9A 3C2AL 7FABH 5DJDB 1FL5A 3SKNA 1U8HB 5EDXA 1CXLA 2ICES 1Z9SA 2BSSA 4RRPA 5DZOA 3F7YA 3T0XA 2R2HA 5I1HH 4QXGH 1AGCB 1GVIA 3LQZB 3DIFB 3OXSB 4MNGB 4P2QB 3RKPA 4NNYA 4X6FB 5IW6B 2Z8RA 3OAZK 1KBGL 2IADA 4AH2B 4M6NH 1D6VH 4XMPH 3S6CA 5IW3A 2R15A 2ZUUA 5D1QA 3PGFH 2HTKC 1RV6X 3GMQA 1PSKL 1G9NC 4HWBH 3VI3E 3A6OA 4NQDB 3MCG1 5C0RL 3QQ3B 4DFHA 1OP5H 4PJ5B 3S5LA 2W91A 3T1WA 2GK0B 3MLSH 5DMIH 4HIEA 1BFVH 2NTFB 3T77B 3ZKMD 1RAMA 3T1FA 2VE6A 3QDMB 2R2EA 1B2WL 3CDYA 1TZGH 2EDHA 4A2MA 5L2KB 5I15L 5HHQB 1JGLL 2E7MA 5D1QC 4DGIH 1UM4H 5BS0A 5E0QA 5I1JH 3LDBC 1OGAB 1WLHA 3HRZB 2H9GB 1XF2A 5CJXC 3WJJA 5FUOL 2YRLA 3NFSL 3WD5H 3O81A 1DBML 3KS0H 1DBKH 1I7TB 4M00A 4F37F 5JW4R 5FOJA 1MRDH 1LO4H 4Y19A 5BZWA 3T2NH 1MLBB 4P9HH 4MA3B 4CN1A 1W2KT 2DI8A 2XTLA 4PJFB 1QFUL 4RAUA 5CJBA 3RL1A 3SDXB 1L7IL 1MY7A 2VN7A 5DDHB 3RL2A 4QRUA 4UOW0 1LO5B 4LIQH 1BREA 1DQML 3GJEB 3GFUA 4LVEA 1CDBA 4FZ8L 4NGHL 4ZODA 3HC3H 4NO2A 2GJZA 4YDKL 4WUKL 5DFTA 4F7EB 4MWFA 2DWDB 4TUOB 1XGRB 2F74A 2BSTA 5L88L 4YXLH 3CU7A 1NQBA 4FFYH 1AO7B 1AP2B 1FCCA 4V2BA 2VABA 4K3GA 4GG8A 1FC1A 2XTJE 3UBXG 2EDDA 3RIAF 1DBBL 2YPVH 3UPCA 5KN5A 3QQNA 4WI8A 3MV8E 2PO6D 2J1KA 4IOIA 4X80L 3UTSE 1UH3A 2J2ZA 5F9OH 1CD8A 1T04B 1TNMA 3I9GH 1MRCH 1N4XH 2XT1B 4GRWH 2QLVB 5HI5C 2EKSB 2M8XA 4EI6B 5HDQH 2YKLL 1QRND 1SJHB 3VRJA 1G7PA 2QJDA 4K8RD 4LSPH 3MZGB 3S88L 3DVGB 1CLZH 4NWUH 3BZFB 3EOAA 2D9CA 4X6DA 2EDWA 35C8H 4ZFOL 2B7DT 3SQOL 1JMZA 1IKNA 4N1CA 5BRZA 4LSRH 3O3DB 2CRZA 3B43A 4JAMB 5JOFA 3CVIH 4FXLA 2E8YA 3SE9H 1I3RA 4M6AA 4F7TA 4MA7L 1FVEA 3ZL4L 2F8XC 2O5YH 3R06A 5CGYD 5E2WH 3WS6A 3OKKA 2XNAA 3TA3C 4JFFA 4XNXL 4LSSH 1U3YA 1I7UB 4G8IA 3D85A 3FONA 3GK8H 4OZIE 4QRPB 4MLSA 3PWPD 3I6LD 1ZS8B 2A6JA 1NAKH 5C0ND 2XN9A 5CZKA 2E7CA 2WK2A 2WWKT 3MQIA 4J8RA 3VE0A 4X99A 4F58L 4ZD3L 5DUBA 3MLYH 3ESUF 4WJ5A 1EO8L 5GXBB 3D0VB 3NA9L 2F9BT 2NXZB 2WBJC 1VCAA 3UTTB 4HC1L 2B2XL 1RURH 1MHHB 4XP5H 1S7XA 1NSNL 1V3JA 3H9SE 3PGFL 4WUUE 2DLTA 4CJ0A 1XFPA 1IAII 1QBMH 2A6IA 1ZGLP 3O9WC 5GJSH 3P4MB 2AJVL 4MSWB 4RCAA 4KTDL 1RZIA 3U4BH 1M4KA 4N1EA 3VXRE 3FQRA 4U7MA 3H0TA 1JE6A 3EHBD 4ELKB 2ICCA 2DQGH 3NIFF 1KTDB 4RDQG 3IGAB 4L9LA 4JRXA 2F53A 5AAWA 3CH8A 3L5HA 3DV4B 2C4FT 5I1EH 3FO2B 5FO9B 4IOSD 1WZKA 1A1OA 2FEEI 1LO0H 4L8SC 4G8EB 2EYSA 4NQSB 1DBKL 2B1AH 5TE7H 1SMOA 3G6JB 1KLUB 1KLGB 3V5DB 1QQDB 4J7RA 4HJJL 4Y16B 4I5BA 1QFOA 4NZUH 1JYXA 3LAFA 5MI0C 2AS5M 5F21B 2EECA 5BJTB 3TO2B 3TJHD 2YBRA 3CH1B 2VLME 3TO4B 1WUNT 1ES0A 4Q9QH 6FABH 4PJ7B 3MRGB 2W60A 2PCPB 4PLKD 2A77H 5DD3L 1J8KA 4YXKH 1D9KB 5IVZA 3GMRB 1P4BL 3DLQR 2AQ3A 1KTRL 1A3RH 1IM3B 1YYLL 4H1LH 1BZQK 4XMKL 1OTSD 3QPQC 4UOJA 1NMBL 3OKDA 4PJEA 3PG2A 4JFQB 5F7WC 3X11B 3VDBA 2JB5H 3QSKB 3FFCE 3P73B 1K85A 5EWIH 1P7QA 1RJZB 4PRPD 3RBGA 4KROC 3OGCA 5EU4B 1CLOH 4ODSH 5CEZL 1AGFB 1FNEB 4WW1A 4PV8B 2EDKA 5IIEB 5D1ZA 3TNMB 1CT8A 3DO7A 1NBYA 4XP1L 3RVWC 3CC5A 4JM2D 4Y4FD 2BSED 5CWSA 5EORL 3DTXA 4WO4D 3EYUL 1CN4A 4OKVB 3GB7A 3KYKH 4P3CL 2E9BA 3AMKA 2OTWA 3EAKA 3P4LA 3U4EB 1TITA 1WFOA 5CJOH 35C8L 3W0WA 5I17A 2W59A 3ISWA 4R97C 4V1DD 4MA8H 1YY8B 1YJDH 1U41A 5ANMA 5IF0B 2O5YL 1E4XL 4NRYA 5F1IB 1WFUA 5EU3B 3UROR 4KRLB 5ALCL 4Z7UA 4DZBA 3R4DA 1SYSA 1W0VA 1VSCA 2B39A 2O5XH 5DK0A 3SGKA 4QRRD 3VRLE 4EI5D 5T1LA 4W6YB 4RMWA 3ZE2F 3F58L 4C55A 2Z31B 2EO9A 3RY6A 3MLYL 2CR3A 5TQ0H 5K9QG 3FCTA 1CICB 1HHHA 1RMFH 1CLYH 4KK5D 3U30B 2NY5H 4TRPL 3CXHK 4IMKA 4PJCE 2JCCF 1KJ2A 1BD2B 4MCYA 2NX5E 5INCA 43CAB 4I1NB 5CJ8A 4QT5B 1IM9B 2DICA 3W39A 1DP0A 1CYGA 1C16A 2F8VA 3FB8A 3G5VB 3CVHA 3ZE1F 3SJVB 4K8RH 4HHAA 3RP1A 1A6VH 2AP2A 4OIIL 2NXYB 2ITCB 1H15B 4WRLA 1HCFX 4NWTL 4RGND 3SCMD 5C8JA 5KSBA 1NDMA 1JRHH 3OF6D 4O51A 1OF2B 4WY7H 5ESVA 3KXFE 3WFZA 5FYLE 2FD6L 3WJLA 3MRMA 4Q9BA 1QBAA 3L5JA 4JJHA 1DDHA 1GGIH 1WZ1H 2CLVA 3ULUD 2G9HB 5C70A 1Q94B 3EYSL 3PQYE 3HZYB 4M93C 2F5AL 2IBBA 4NIKB 5I19L 5FDWB 4DOHB 3BMVA 5D7JD 4TULL 2DQCL 3QEQD 1W72B 5C0AA 4FQQB 3MO1B 3QIWA 5HHXL 3BGMB 4WI5A 2GAZA 4JQIH 4LLYB 4Q6IB 5HI4C 3QI9A 2HT3D 3NCJH 3B6SA 2VDRH 3BKCL 4LLDA 2V5TA 4PRHE 1LD9B 4X7SL 1QOKA 2PYEE 1UB5A 3O3EA 4NBXB 1EJ6A 4OGYH 4R3SA 3DETD 4NUJB 4M7JH 3VD7A 4M9PA 4BKLA 1A9EA 3BD3A 5J3HC 2JJTA 3EYQC 2V2XB 2HWZL 5A2LH 3HTLX 4URTB 4GSDH 4DGVH 4PJ8D 1YNLL 3QULA 5IFJB 4S0TD 1YC7A 4QTIL 1XEDA 1FZKB 4YHML 1BM3L 4QHNA 1D9KC 4YPGA 1A6ZB 4OLZL 5D7IE 1MQKL 3QG6B 1ZT4B 4GOSA 1NAMH 4U7KA 1J0YA 2FX8L 3WNPA 2ARJB 2YPLD 4GRMA 2VITA 3JV4B 4QCIA 3O41A 5F7UA 1T5WB 3D39E 2CDFA 1Q9WB 3WFHA 3AS0A 1I8KA 3DMMB 3GSUB 2HT4C 5IB5A 4P5TB 2AJYH 5E2UL 3VXQA 1I7RA 4LEOA 1T4KA 3CFDB 2IFFL 3GHEL 4R7NB 5FV1L 4XCCL 1SEBA 1A6TB 4U31A 3AAZA 3SE8H 2AJ3A 3UEZA 5TDPB 4X8XA 4CVUA 2A9MH 1ZTXL 4R7DA 2Y36L 2UZYB 2A6DB 32C2B 5LBSH 4JFZL 4KI5D 2Q3ZA 1JGDB 2BFVH 4NN5C 1EHNA 5A3IC 5DD0L 5JNYA 1IC7H 1YYMH 2MPAL 12E8H 2VDML 3BWAA 3HUJA 3UTOA 1CE1L 4XRCA 4CMMB 4KH2A 5F93C 1T1WB 2FZ3B 1U3HB 4M8QA 3IDJA 1IBGH 3TJEL 5ISZE 1EZVX 1AGBB 1RUMH 4K8RL 5SX4H 1G0DA 5C0CD 4ODUB 2EC9T 2BJML 2R2BA 2I9TB 1B4RA 4OF0A 2YUWA 1IRAY 2D31A 5EIIB 3BIKA 1MOEA 1MREH 1VFBB 3PIQB 4DUWA 4NQCB 1S7TB 4KQ3H 2PR4L 1EGJL 3CLFL 3JV5A 1HHIA 2Z31C 4GAFB 3HPLB 1QZ1A 5D2NB 5B8CB 3ARPA 5CZVL 2V2WB 1NFKA 2YZ1A 5C07E 1DSFL 3L7FA 5C08E 1D6EA 2Y06L 3STZA 2NQCA 1U58A 3MXVL 5E24E 3RTQD 1YEDA 4ZUSA 1I1AA 3IJYB 1MHCA 1UWXK 1TJGH 1FFPA 3KPTA 4LRIA 5F1SA 1F4AA 5B3JE 4OQ1A 4OI7A 1S8DB 1G7LB 3P9MB 4XB7A 3MNWA 1HQ4B 2NW3B 3U7YL 3OXRB 1I4FB 1ONQB 1HH6B 5D96B 4PB9H 3OJVC 4HUMB 1FYTB 2R69L 1J8HE 1OCWH 3QCVL 1WC7B 4GKSB 2GEEA 5JOPD 2R56H 4M7JL 5E1AB 1P5UA 5HYQB 3MJ7B 4EXKA 2NW2B 2XZCL 2CLRB 5IB2A 4G6MH 3AB0B 1QYGH 3W5NA 4XP6L 1MY5A 1H3WM 3GSXB 3T0EA 3VFGH 4BFIA 3S8WA 4NN6B 4DGVL 1G6RH 4JKPL 4GQ9H 2IALB 4N0YH 2CJUL 3GJFA 4I0KA 3NCMA 5IMMB 4LLMB 4YFLF 1FLRH 3ULUH 3KNBA 2DD8L 1QLEH 2DBLH 4ZYKA 5KSAB 1MFEH 3RI5F 3OQ3B 3TBVA 3ARUA 1WICA 5E6IA 4XXDB 3L5IA 2R23B 5E8DL 1JHTB 4S1SH 1YMMA 3FB7B 1U8KA 3FAWA 3VFOB 4XX1G 3OKOA 5C09E 3T3PF 3U0WH 1U42A 1J1XL 4ONGH 1ZA3A 2P44B 5F7YC 1VACA 3KYNB 5IVXA 1IFHL 2NY1B 3H9ZA 4XVJL 3CX5K 2VDLH 3CSYA 1SY6H 4O4YL 1I9EA 4U05A 1I1CA 3HG1E 4ELME 3DVNB 3MLZH 5FF6B 5SWZE 4H26B 3J7HA 3MV7B 1JFQH 5D1QD 4MJ5A 5IGXH 1IAOB 5DJCB 1LEKA 4WWKB 1R0AL 1NGZB 5C9JB 3FMGH 1WAAA 3QFDB 3O3BA 4OCNC 5DK3A 5SX5K 3WS3B 4KU1A 4XP4H 5EC1B 3THMH 12E8L 1REIA 1HQRA 4HGWB 3P9WB 5IESH 1F6LL 1BP3B 4HPOH 4X5XA 5B39G 4BFBD 1UCBL 3D3VA 3DMMC 4OT1H 5CCKH 1MHPH 3FRUB 3RAJH 2ZSWA 4P5TC 3QDJB 3KPSB 4X7EC 3QNZA 3HLAA 1EA9C 1KJ3H 3ZYZA 2AQ1A 5DUMH 4Q2ZB 1A7NL 4F8QA 2H8PB 5CGTA 4Y19D 3AY4C 2BP3A 4MXQC 4P3WA 4WI3A 5TGBB 1CE6B 2IANA 2ESVA 4GRWE 1WK0A 5J12B 4EDXB 2I07B 4BZ2H 5ICXA 1N3NB 3A67H 2D7MA 5BO1H 4LKCB 2DKMA 1TJGL 4PRNA 1Q8MA 3DJ9A 3G5ZB 3V6FA 5HYJE 2GJ6E 4ACPA 2VDQL 2MWCA 1B90A 5KVEL 5HI5D 1XZ0A 4PJHA 2DQFA 2IJ0C 4TNVF 2ZKHH 1DUZB 1JYNA 4MLIA 4ODVL 3HR5A 4A6YA 3O4LB 4FTVE 4OIAA 4MHHG 3GBML 2DQHH 3H2WA 3NACL 4KZEH 4OZFA 2BRRH 4DN4L 4O58L 5M95B 4U6HB 2GHWB 1NKOA 1HNGA 5D2NC 4HUWA 4P4RA 4ZSOB 5E8NA 3L3JB 1K4DB 1GC1C 1GSMA 4YAQA 3GSVA 1J5OL 1EDQA 1S9XB 5EU6B 4MAUL 4FQ2L 2L0DA 4ONFL 3DUSA 3TA3D 1U93A 4H1LG 3D5OF 4G6ML 2DLFL 1AQDA 1T20B 2DLEA 3O6LL 1MIMH 3WHE0 3RUGF 1ZVSB 5DHVH 1S9WA 3INUL 5JXEA 5ILTH 5CEYA 5BRZD 3TBWA 1T22A 4N5EC 2DDQL 4XNMA 1OSZA 4K2UH 3QH3B 4BSWB 1N6QH 5CJQL 2QQLH 1FLRL 2QQNH 2CLZB 5D96C 5ENWA 5JIKA 1CXIA 1MFEL 1M1SA 1PLGH 4EBQH 3BDYH 4L3EB 1CGSL 4U6YA 2XZAH 2YOCA 2WBJD 3VFPB 3ZSTA 4LPUA 1NFDA 1T0PB 1NJ9B 4UTBL 4XP9L 2J5LC 2Q8AH 3D85D 3SDCB 4R9HA 3K8KA 2GFBA 2XN9D 4CVWA 2A83B 3BE1L 1QA9B 2I26N 4XNQA 4EUPH 3O9WD 3AB0C 3A0OA 4PBVC 4JJ5A 2UWEE 4X8JA 4NHUA 2VNCA 5AUMA 4UV4H 4PB0H 1S7WB 4NN6C 5A40E 3NCFB 4WCYL 1C5DA 3QCUH 1JGEB 2UVFA 3BEVA 5A2IH 1A7QL 5KSAC 3DURB 1UG9A 5F1NB 3ROOA 1K4CB 3MGTA 3GSRB 2CO7B 4H0GA 5TFSH 5IHUH 3VFMB 4WGWB 2FX7H 2QSCH 5F1OB 2OCFD 1T5XA 2LAAA 4HUUB 3SGJA 4PJGA 1MF2H 1FL3B 4HKJA 5F9JA 1IE5A 4PJ5D 2UVEA 1YY9C 4OV5B 2Q7NA 1CIUA 5FIEA 4O9HH 1D5MB 1RK0B 4GBXA 3G08B 2J8OA 2OX5A 2VDOH 5IP4A 3HZMB 1JNNL 2BOBA 2V2TA 3P77B 4PJXA 5IBTL 3NIDF 4U6TA 8FABA 4X6CA 2XRAH 4WWKC 5I75B 1D5BA 1MAKA 1G9NH 1FZOA 3GI8L 4QGYA 4LPTA 3GM8A 5EPMB 1S3KH 4NKQB 4OD2B 2ZCKH 2CIKB 1J05A 4GBXC 4WTZA 3PWUB 2DMBA 3UZQA 4PRIA 3MRNB 3P4NB 3CSPA 3I2CH 3L3GB 1MCSA 5LQBH 1A4JA 1U2HA 1GXEA 3H3BC 4JRYA 3VXSD 2QADC 4KC3B 4KROD 2BOCB 5I1KL 3UPAA 1RJLB 2B0SL 4TQEH 5EBMB 1PKOA 2I24N 4HCRH 4OV6F 4LCCB 1P6AB 3LH2L 5DD6B 4ZDHA 1LO3H 1G7JA 1U6AH 3TESA 1QD0A 4MCZB 1HE7A 4L3CA 5GRXG 1JGUH 3WFDL 3DPBA 3QNYA 4MNHA 1P7QD 2O61A 3IJSB 3R8QA 4JFDB 2CIIB 2XZZA 1UXSB 4YHKL 3ZHLA 1RVFL 4G6KH 2RR3A 4OUUB 1FO0L 4LASL 4AG4H 3VI3F 1MRFL 3EDKA 1ZVHA 4KPHL 3GSNB 4IEFB 3PWNB 2APFA 3IU3B 1GGBL 3K7UA 3L3IB 5CLTA 3CDGB 4OLYH 2ICWJ 2VWEC 1J0ZA 3OR7B 3PF2A 4UINL 4ZFGL 3O6MH 1IKFH 2FIRT 4PG9B 4TUKH 2DYPA 4JPKH 1UM6L 1I1FA 2Y6SC 1PEZA 1C7TA 1P5VA 5JORA 1IAIH 3SDAA 1MWAB 4B7IA 4YNYB 3HE7A 2OZ4A 4I77L 2IGFH 5I8OL 1JHKH 5DWUL 4XPHL 2VDKH 3QUZB 5DS8A 3SOBL 4EBQL 5GRJH 4BQ9A 2VISB 4N8VB 4KTYA 3LS4H 3MRIA 1P4IH 1OY3B 2PF6A 4X4XA 3RWDA 1UACH 3MUZ1 4OF8A 5GRVK 3BHBB 3ZDZE 3RUGB 1E4KC 4MNQD 2CH8A 4H5SB 2E7LC 5CEXB 1KN4H 4UB0L 4TNWF 5I71C 3SDAC 1W0WA 2JF1A 2IMMA 1G7QA 5LWYH 1G7MA 3PWPE 4LLQB 1GIGH 3JWDL 4PJAE 3I6KB 3OAUL 4X6BA 5DR5L 3BZDA 3M1BB 5H35A 2FH8A 1XGPA 1GH7A 3TBSB 3C8DA 3EZJB 1CFNB 3EIFA 3S96A 1EO5A 3SDCC 2FX7L 4ZS7L 5BV7B 2R0KH 1KEGL 2VLRA 4ZXBB 2GTZB 1N2RA 4I2XA 4O2EA 4LSTL 1CGVA 4KJYA 1Z3GH 5TH2B 4XNUL 4P2RB 1R5VA 4AYFA 4YDVA 2X05A 5I76A 5HI4D 4PJIE 3F7RA 3PJSA 1XF3B 3D0LB 3CNKA 4QHMB 2CMRL 4F7PA 5BQ7B 4PUBL 3VG9B 3HS0A 3UJJH 2UY6A 3VXMB 1GZQB 5IEHB 3NCEB 4G6JH 4RISH 3C60A 3OHXA 5F7EL 3UTZB 3T4AA 3WDHA 3UDWA 1S3KL 1LEIA 1RZGB 3RWFB 4GKZA 2M1KA 5KVMC 3VXUA 5J3HD 1BIIB 3EYQD 2NLJA 2HG5B 4NT6B 3O3UN 4B5EA 1IC5L 1NDGB 3LRSA 1JPSH 2XFXA 2UY7A 1MJ7L 4JVWA 4LAQH 1OOAA 2MCPH 2HFFA 3DX6A 3DSFH 5CGMA 1OP3H 5KTEH 1X3DA 1I8IA 4OZIF 2JTDA 3UDWC 2VZTA 1C7SA 5SWSA 5KS9E 5JUEH 1EEYA 1D9KD 2DI7A 4LQ1A 4ZUVB 5I75C 1BLNA 1ED3A 2IH1B 4NZRH 4K3DL 4K3HA 5F7MC 5FV2A 1E6OL 2Y5TA 3KPRB 5D7SH 5K9KA 2IMNA 5KG9A 4R4FL 4M6OH 2Q8BH 2YUXA 2VZUA 1PZ5A 1J88A 2EC9U 2WAHA 1GOHA 2HT2D 4I0PC 4Y4KA 3AREB 3JVGA 1QVOA 1A5FL 3DV6B 3NCBB 3V0VA 1LP9E 2HT4D 3AU1A 4KKAC 2WMPA 2P4AB 1QNZH 4FG6C 4XC1L 1YN7B 3ROLA 2PXYB 4PRPE 1EHLH 5DD5L 5E9DB 1EPFA 2LU4A 4KUZL 1UVQA 3UO1L 1TCRB 4FFZH 1PW3A 3RJQB 4NBYB 1IKFL 2J7LA 4RWHA 2GT9B 4Y4KC 3ARDB 5KAQG 4M48H 5JR1L 1K3IA 4O00A 5A3ID 4XMLH 4NHCH 3TYFA 3EYFB 1NANI 5GS2D 3T4YA 1BEYH 3K2UH 4ZO6A 3BAEH 2FRGP 3FT2A 4V1DE 2IQ9H 1OW0A 4U49A 1A2YA 3V6OC 2VUOA 5IFAL 5BMFL 2VL4A 3BH9A 4BYHA 5ICYB 1MQ8A 4JG1H 2KQNA 1MPAH 3ESVF 3VU2A 1CG9A 3IDMA 1ROWA 2AV7B 4HQQL 1F11B 4PGDB 3UTQA 4HUVB 1MFNA 4LPVA 2PW1A 4LOUC 5CD5C 2H32A 2PTTA 1GIGL 4QRRE 3FO9B 3CX2A 2ADFL 1HINL 2NMSA 3MRCB 2Z31D 3SDDC 1OQOA 4NCC1 4OGAC 3CFIC 3O2WH 3GSOB 5IQ7H 4NUGL 3MRLA 3QUZC 2R1XB 1UZ6E 3KPNA 3VFRB 5D72L 3I3BA 1CD1A 2A9NL 2BNUB 4NQXA 2FL5A 4D9RD 4R0LA 4Y1AA 1G6VK 5GZOD 1KN2L 3RY5A 2HJFB 1I9IH 3VWJB 5DJ0B 4ESKA 2ITDB 3GRWH 5IKCA 1A3QA 4RGNE 4RFNB 1IGCL 1YEKH 2X70A 2VR9A 1I1AD 3FOLB 2EIZA 3L7EA 4I0CC 2XTJB 5AYUH 1DFBL 2XKNB 3PWLB 1OQXA 4IDLA 4RDQF 5D4QA 3C6SB 1TETL 1IC4L 5LJYH 5D7KD 3ZYIA 3KPOB 1JGVL 1JV5B 2LU3A 4IRZH 5ALBH 2I60L 3G5XB 2EEAA 1J7VR 4LCWA 3BDXA 5HVFB 1E27A 3LQAC 4ZXBC 5ITBH 4FQHA 4OQTA 3WKML 4LARL 3QEQE 4GRLB 1ACYL 5FM5M 4OFPA 5T1DH 4DN3L 1DJSA 2FSEB 2PKDA 4L5FH 2ZWLT 4S2SB 3SO3B 3U9UA 5JHLH 3ARSA 15C8H 4WFGD 1TZIB 2FLRT 1ZXQA 3VG9C 4L4TE 3DX8A 3X3FL 4GMTL 4PGZA 3GKWL 1ZLSL 5IQ9B 3SGEI 3VMNA 4QRSB 1XR8B 3VRLF 2DQIL 1WWWX 4B0MM 4X7FC 2NZIA 2HFEA 3WNOA 1XGQB 4ZUTB 4ZNEE 3VG0L 1YPZA 3BFOA 4AENA 1W8NA 5I8KL 4PJCF 4YUEH 1I1YA 1FJ1B 5IMOB 3VGFA 1WGOA 4YWGL 4Y5VB 2G60L 5HVGB 1YDPB 3QHFH 3MPCA 3RU8L 4L29A 2R4RH 5IBUB 4LNVA 3JWOC 5E6ID 4HZAA 4P49A 4WNQB 3DIFA 1PDKA 1JZ8A 4HJ0C 1Y0LA 1YEEH 3VFTA 2VXVH 1U92B 3MV01 3QAZB 4PREB 1YMMD 5IFHL 1QFWH 3OKEA 1DLFL 5J57B 4YBHA 4ZTPH 1O5DT 1JNLH 4AH2A 2G5RA 5IB1A 2V17H 4NZJA 4HPYH 4M7ZB 3UBXB 4PGEB 4XZUB 2VH5H 4NQDA 1JNJA 4LMQE 4NHCL 4YO0A 4E41B 2R8SH 4G3YL 4MQ7B 1HHJA 4N8PA 3AREC 3JBG7 1KCUH 4Z7OE 4P5TD 1T6WA 1A14L 1U9KA 2PXYC 5IB4B 1QR4A 3P4OA 3LN4A 4MJID 3LPFA 5CHNA 2YMXL 2W65B 5FUZH 5I16B 4EUPG 4Z78B 2YS4A 2CKBA 3NFNA 5K9OB 2WUCH 3QWOA 4MXQD 3M07A 3FOMA 5D70L 1ZLWK 1HSAB 4JZJA 3S7GA 1P1ZB 1A6WL 5T1KA 4E42B 4KI5E 4M4RA 5DVNA 5FHAH 4NQEE 2P24B 1AKJA 1INEH 4XPFL 4KY1H 3M17A 2OJZL 3BKML 5H37H 2IAMA 1RQ5A 3BVNB 3EO0A 5IQ7L 4QOKD 4U1JA 2X41A 4NQVA 2BCKA 1X5ZA 4K94L 4KI1A 4NC0B 5DEFB 5IB3A 1TJHH 4KTEH 4GKOA 3RZWA 4Z7VB 4UDUA 5GRVL 2IAND 4I4WA 4X6EB 2DWDA 3F6LA 1XGRA 4TUOA 1A6AB 4GW5A 1AFVL 3QQ4B 5DFVC 1K6QH 5C0CE 1S7SB 4HS8L 3ILPA 3AXLB 5KSUA 4GXVH 5MEQB 5GS2H 3G9VA 4LVHB 2H6PA 3LOWA 2QL1A 4OCXH 4G42A 3OPZL 5D7IF 5SV3A 5GGVY 1CFSA 1EJOH 4HIXL 2R1YA 5L9DL 5TQ2L 2PW2A 3MBXH 3DNKA 3UTPE 1UXWA 2OTUB 2FBJH 2XQBH 2X10A 3QNXB 3GBLA 1MNUH 3PV6B 5HGAA 5MENB 4RRPG 4F7CB 3N1QC 4EXPX 1SJHA 1RZKL 1T1XB 2AABH 4D0BB 4NC1E 1HKLL 3DVGA 5TPWL 4XBGA 4JCMA 3VWJC 1KJ2L 4N5ED 1M05B 2GQHA 4OZHE 5DRWA 5DRZA 5FHBL 2V7NB 1AHWB 4G8FB 4IRSA 3CVHL 3VFUB 3MZTA 3C9NA 2P5WB 3MFFA 1UYWH 1RZJL 3S5LG 3MYZA 1UA6H 2HMIC 4NO0B 3P3YA 2VSDA 4ONHA 3TWCH 3G04B 1NGPH 3LHPH 3WO4B 4X9IA 1CZ8L 1I75A 5C0DA 5C0EA 1U95A 1E4WH 3MCLH 4GRLC 4OCLC 4PTTA 1CDHA 3CXHJ 4KGLA 5C0GA 1QSEB 5I66B 3Q6FA 3IXAB 1NFIB 3IFLH 3FQWB 1F90L 1KCSH 5DT1L 3RBSA 2EH8L 2VXUH 4X5WB 4OZGA 5FYKD 5KSAD 3F12A 1QFWL 2VXQL 3UTTA 4ZUWB 4R90L 2OR7A 1OARL 5DMYA 1XCQA 2D7TH 4TN9A 5E2JA 2NX5B 5IWLA 5HGGS 1QRKA 5JLZA 1SBSH 2DLGA 4NDMA 3L95B 5KZCD 1OAUH 2JK5B 3VGAB 4NSKB 1YY9D 1RK1A 4Y5VC 4OGZA 4LLUB 1KCUL 1NBQA 1XIWB 5HHMB 5KSVA 4X98A 1RULL 2GUOB 5TDOA 1JF1A 2YC1A 1RIHL 1S7VA 2OSLB 5B3JF 3CUPA 1BF2A 2C1OA 3DV4A 4KAQL 3QAZC 1BBDH 4JE4B 5FO9A 3BKYH 4CADA 3BZEA 2YR3A 5F9DC 4WWKD 3ABZA 1VESA 5F8QC 3EO9L 3HMWL 5BZDA 3SE3C 3OB0K 4JPIA 3GJFH 3DBXB 4FMKA 3VGEA 4CDGC 1T03H 3ORJA 3IDUA 4J6RL 3N1MC 3RWIB 4GBXD 3RNQB 2ZG3A 2AGJH 1INEL 3IS0X 1Z5LB 4UNUA 4JO4L 1G9MH 2F19L 2CSPA 2DL9A 4XAWL 2R0ZH 5ACZA 2P43B 4KDTC 1WFTA 2QADD 4BQ8A 1P9MA 3ULVE 2PCPA 5F1KC 4JKMA 2JIXA 4J4PA 4IRJB 4E5XB 3GMRA 3PL6A 2XZQL 3L3HB 1K6QL 1FFOB 4N0UE 4LCUA 1IM3A 4PRID 2I5YH 4GAGL 1FRGL 4PJBE 5GGTH 3DVIA 3OJMB 4DW2L 4JRYD 3X11A 4R26L 2YK1H 5AD0B 3PXHA 1S9YB 1R24B 1NBZA 1P9MC 3JXAA 4AM0A 1Z9OA 3PP3H 3WFEH 1WBYB 1P84K 3MA7A 3VRIB 2Q6WB 3TPKA 3IDIA 2PYFB 1GHFL 2AJZA 2E27L 1K8DB 2Q1EA 5JPNA 2GK2A 1JCKA 3A6CH 4YX2H 1KCVH 4LLVB 3SKJH 1JPFB 4YDJB 5IIEA 3EFDH 4M7KL 2CKNA 4XBEH 3QUMA 5EZLB 3B2VL 4WTWA 5HYEA 4G9FE 1FE8H 3UC0L 3RKDC 1BECA 3O4LD 4ELMF 5CBAB 2QKIA 4Z77A 1JVKA 3S4SA 1VKXA 2W07A 1YZZA 5BVJA 4X4ZA 3DWTA 2BXYA 5D1XB 5EOTB 4JY6B 4RAHA 1FL6A 1FNLA 1IGFL 4RIRB 5E5MB 3NVQA 3D39B 3UBXI 2BNRB 3NZ8A 1NEZA 3QUYA 1IL1B 1I1RA 5EU6D 2Z8WC 3LMJH 4DKFL 5IROA 5HXMA 1MFAH 4JDVA 1Q9LA 2EEDA 4EDWL 5DC4B 3LS5L 2HJKB 4NRZB 3WIFA 1FGNH 3A6BL 3UJTH 4QXUL 1AR1C 3FRPG 4NNPH 3SDAD 2VXSL 3WHXB 2AEPH 5JHDA 1QBBA 1B9ZA 4HKXA 2FGWH 1U8OA 3QUYC 3K74B 1GC1H 3DGGB 1IAIM 1PEWA 1BAFL 4HIHB 2VXUL 1QPXA 1BD2A 4GRWF 4A6YH 4L3ED 3DX7A 3O2DH 2VLKE 5EO0A 4QT5A 5I18L 5CJ5A 2FJHB 3BO8B 4GW1A 3WV0A 3SJVA 3OX8A 3QXWA 3WBDA 1ZHKB 3MNVB 4LDOB 5ERWA 2ITCA 1H15A 2AK4D 4JO2L 4TPRL 3WO4C 1OAUL 1XR9B 3NOIA 1U8MA 2JJUA 1YEGL 1BGXL 1EUTA 5GRYA 3SGDI 3BQUB 4GG6B 4OD1H 5I1LB 1T2QL 4DKEH 5CUSL 1S5IL 1B0RA 4LP5A 3Q3GA 1M6OA 2G9HA 3HZYA 2VLRD 3QUXA 1FCGA 2RBLA 2QSVA 4ONOA 4MNGE 6CGTA 2VZ1A 4PLOB 2CK2A 5FGBA 2X1XR 4P2QE 4WI2A 4P2OB 4HJGB 2K7PA 3N85H 4MAYC 3BP7B 1QSZA 5HGBB 1NCNA 4FQQA 4X9BA 4KVCL 2WQ8A 1WBZB 3BGMA 5DMJB 4KVNL 3VGAC 4AT6B 4X7TB 3VFVB 4ODHH 2GCYB 2HKHH 4MDJB 5CILL 1SM3H 2Z35B 3NBNA 4PJ5E 4XVSH 1XIWC 3ARXA 1FAIL 5IMLB 4PP2B 1A4KA 4ODTH 5FYKH 2QQKH 2DLHA 3D2UB 2HH0L 4P3DA 5DO2C 3PWVB 3QDME 3RDTA 3KJ6L 4S1DD 4GAYB 4KHXH 5L2KE 3RX7A 5C9KA 2AJSH 1MVUB 3TZVA 2DJSA 1EH9A 3H42H 5I6XC 1OGAE 4LEXL 2YEZB 3WFCL 3V0WH 1V7ML 5J11C 1X5GA 4C57C 2MCG1 3WSQL 4IHOB 3EO1B 4I0PD 1BQSA 3BPNB 3HI1B 3Q6GH 1HHGA 3OSKA 4BH8B 3MRRA 4KKAD 5SWSD 1JYVA 1J0KA 4FG6D 1P7KB 5F6HI 4PJFE 3VXSE 3QPXH 3SDXE 4PJ9B 1FZKA 2DQUL 2UWEF 4UAOC 4GMSH 4HUKB 3N1FC 5ACMA 5F3HB 4IRJC 1FNHA 5K33A 2GITA 3CX5J 4YEEA 4Y4KD 2ARJA 1HCVA 3JV4A 1F3JB 1JHLL 1TENA 3QDGA 3VGHA 1DQDL 2BSRA 3VDAA 1VADA 3GIVA 2XWBB 4HXAH 1Q9WA 1AO7E 5FKPA 4C83B 2RCSL 2X4OB 5C09B 4XCYA 3CFDA 4F33A 4R7NA 3JV6B 1BWWA 3RWCB 2KZ1B 4HV8A 1TPXB 3LN5B 1CGXA 3X12B 5I73B 3OTTA 1MFAL 1K8IB 4H0HB 4ELMB 3RA7L 2A6DA 2ICWB 5E8PB 4F9LA 3V4PL 4FZEH 5ABDE 1FNAA 2FLBT 5IW1B 1YA5A 1L7TH 2GSIB 4LOUD 4P57B 5CD5D 4AK1A 3NAAH 4K55A 1HN1A 1JPGB 4ERSL 1EO7A 1U8NA 4UT7H 4OFVA 4AMKH 5B22A 5D1XC 3SDDD 1HHKA 4GS7B 1CDUA 3H3PL 4OGAD 5E08L 4XCFL 2FZ3A 1EEZA 3MR9A 1U3HA 3MLTA 2XOTA 3CZFB 3IS1X 3U1SL 3MBEA 2B1HL 2E9JA 4RBPK 1BVLA 2BRQA 5IOPA 1AGBA 4IM8A 4I3SH 2KKQA 2VLJB 4U1KB 3RZCB 4HGMA 1VERA 1NUDA 4DK6A 1HH9B 1EK3A 5D8JL 3OZ9H 1RHHB 2I9TA 1F58L 4K7FB 1BZ7B 2X9XA 4JFYB 1MJ8H 4M5ZH 2O5ZH 4MNQE 1MLCB 2RFXA 4K71B 5HTSA 1UZ8A 5DK2B 1RD6A 2J3SA 4QRPE 2JCCA 2V2WA 5FB8B 3AUVA 3QXDA 4WU7B 5ADPL 4X9HA 2ZG2A 5GGRB 3IJYA 1MSPA 2MHAA 4ZS6C 4MD5B 5K9QI 1SYVA 2VOTA 1CDGA 1KIPA 4ORZC 5I1GL 1C5CH 2W0PA 4JG0L 1JWMB 1FDLH 5IR1B 5HYJB 4LNRB 5KSBE 2GJ6B 2OZ4H 1U36A 4OGXH 4E0RA 1S8DA 1G7LA 5H37G 3IDYB 4S0SD 1LK2B 1SJEB 2NY2B 3LVEA 1CXKA 4ZFOA 2EC8A 3BQUC 4D8PB 5C7XL 1T3FA 4XVSL 4GJTB 5MP6H 1FYTA 2QQKL 4KK9C 3E8UH 2VLLA 3LY6A 4FXKB 3VWKA 4LCWD 1Q9OB 1CFQB 4HWZB 3X17A 1QSFD 3GHBH 2BERA 2OK0L 5C0FB 1TFHA 1DQTA 1KB5H 1X6LA 4OLWL 3OKNB 3V0WL 3GEWB 2HFGL 3HCVB 2PETA 4HS6B 4HFWB 5B39B 2VAAA 1B0WA 4UZGA 4OBRA 4PV9A 2EDBA 5BXFB 2JELL 1CDYA 2F54A 3G6JE 4ZPTA 3LCYA 4OAWB 4PRAA 5MHSE 2IALA 2FJFB 4OIBA 3ZDZF 4XGZB 2CPCA 1JP5A 3B9KA 3LD8B 2W0FB 1KG0B 1NANH 4IS6A 1VGKB 4AL8L 5FYKU 5EIQA 1RIUL 4YHLL 3C6LB 2M26A 4PJAF 2R23A 4PJ7E 1JHTA 1A7RL 5EBWB 1JK8B 4JLRA 4C56B 3IFPA 3VFOA 3TGXA 4JZNB 5JW5A 2Y07L 4NFBA 4K3EH 1ZANH 5T1MB 3MOAL 2AJUH 5EOQL 2Q7YB 1U8LA 1OTTC 3ARED 3BPNC 4L1DA 5IMKA 5EA0L 5T3XL 4XPBH 3U7WH 4H26A 2DM4A 3HHRB 4YH6A 4BZ1H 5E9DD 3WUWA 2ZOLA 4YHNA 4YXHH 4PJIF 4FZEL 4BSJA 1A7BA 1AIFB 4M61B 5DJYA 2R0WL 3K3QA 1CXEA 1OGTA 4OCSL 5AZEH 4MJ4A 4OZ4A 3O0RL 2DIBA 1MCIA 4LF3B 2EICA 1A6PA 2VERN 4D0DB 3QDJA 2JJSC 1UKTA 4NQUA 3C08H 1EBAA 2IG2L 4FABL 5J06A 5FM8A 4I3SL 4U1MA 4DVBA 4JFEA 3MGOA 4H1LB 2C7UB 1DBJL 1TPXC 5IJKA 3BDBA 4AEIL 5I73C 1DBAH 3KWWB 1F6AB 2H8PA 3VXPA 5T1KD 2SEBA 1ERNA 5E8OB 3T0VA 5DFVD 1NPUA 5BW7A 1P4LB 4FNLL 1NCWH 1IQDB 5B4MC 1NCCL 4LSUL 5ICZA 2X4TA 1OAXH 1OP9A 4KWUA 5KS9F 3V7MA 4C54A 5J89A 1BJMA 2C3HA 1N3NA 3X3GL 3O45B 4D2NA 3S9DB 4GS7C 1FN4B 1KJVA 5F7DA 4Z95H 5HYIA 4P5KB 4PIRF 3CFEB 3SDYL 3GSNH 3G5ZA 1Q0XH 2ID5A 5IEKB 4JHWH 3RZCC 3L3DA 1K2DA 5F9WB 4DCQA 3FN0L 2X4QA 5HHVL 4CNIB 4MVBC 5D93B 1LP9F 1FDLL 3UYRH 2OMBA 4HF5H 4D9RE 2WIIA 1FYHB 3CDCA 4FP8L 1YEHH 2P8MA 4K71C 3VWJD 5CIPA 5LAXB 4PJDB 4U6HA 2ZSVB 2EDJA 2IFGA 1DUYA 3JUYA 1K4DA 3QISA 4PY8J 1MFBH 3B2UD 43C9B 5EZIH 3TIDA 1S9XA 4JM2F 1IAKA 3GI9L 2J8UB 2UYLB 4WW2F 4M1GH 1HOCA 2CK0H 2H32H 2HMID 3EOBB 1F4XL 3KJ4B 1Q9KA 2PO6B 3ZT5A 4DOHE 4NKIL 2BDNH 2BMKA 3HE6A 2X09A 5CD3B 2YD7A 3KPMB 1OT2A 2NY2C 4GAJH 2D2OA 1MI5A 5KJRL 4KMTH 4I3GA 1QRNB 2BXZA 4ALAH 5GS0L 4NYLA 4O5LL 3R1GH 4HLJA 5F3BB 4RFEA 1RZ7L 4WFGE 4YR6B 3MROB 3ZTNH 3VFPA 1R6VA 3TV3H 4TTDC 5I1IL 2Q76B 2RIKA 4XH2A 1Q1JL 3V5KB 3KGRA 3LQAH 1OL0A 2ILLA 1PG7H 2CXGA 1A1MB 3L3KA 1DVFA 4K7PH 4JPVH 1V05A 5EOCH 1OVZA 4K3EL 1ZANL 1UZ6F 1HIML 2OXHA 3TIEA 2NYYC 5J56B 2XQYK 4HS3A 3U2SB 5T3ZE 4KQ4L 5FYJE 2DMCA 1EZVY 4MMZC 4APQA 1C08A 3MLXL 1CFTB 2ZPKH 4LSQH 3LD8C 2KQMA 2I9LA 3DURA 4J3XA 2J6EL 1LNUB 1CR9L 4O02H 3KPQA 4OQTH 5F1NA 1AJ7H 1FG2B 3GDBA 2Z93A 3C6LC 3OJDA 3P11H 5J1AA 1PGRB 2XIDA 2EIEA 1JYWA 2NY3D 1F97A 3MLWH 3ARZA 4LBEB 1A47A 1FL3A 2J12B 3V4VL 4QTHA 4OCWH 1I9JH 2OR9L 1RK0A 3JWOH 3KPPA 1ZT1B 1ZMYA 2ZUTA 2EH7L 5JIHA 5IV2B 3O6KH 4OZFG 3LEYL 4PJIB 5J8OA 1ZA6A 1DANU 4JFOA 1NCAH 3MMEA 4FQIH 2D4DA 4G43A 4JY5L 4MJIE 1E6JH 1E4XI 2CRMA 1KCRH 3U6RB 1INQA 1BBJB 5C6TH 4LU5H 1RZFL 3BP5A 3WL9A 3PWUA 4G6AC 4X9FA 1KC5H 1QO3B 3L3GA 1KACB 2BVUA 1S5HB 2BVPB 3AGVA 5EC2B 4G8GA 1MCWM 4IJ3C 5IT2L 4NM4H 3LKPA 2X44D 2KBGA 2JIXD 5DI8B 1NAMB 3MLRH 1CLCA 4QOKE 1S9VA 1L6XA 3B5HA 3G9AB 3P30L 4NZDA 5EBMA 5E2TL 2CUHA 2HLAA 2YD8A 3GMMA 3ARBA 3TBYA 1JI1A 4LQFL 4UU9A 1TVHA 3GUTB 4LHUA 3RKDD 3TCLA 3ULVL 1R3IL 3RWGA 4KMLB 1VGEH 4QHLA 1S7RB 4JEGB 3CFCL 1BFSA 1I85A 4NRXA 2VDNH 3HRPA 3WXVL 4NQCE 2MKWA 2LE9A 4F37K 5EZIL 4YFLI 1UB6B 5D2NE 2R29H 4XCEA 2V6HA 3VFSB 1RUQH 4S1QL 3ZE0E 1LP9B 3QEUA 4N1HB 2C4XA 1A7OH 1D5ZB 4M43L 5F9WC 5C71A 5MEND 5D93C 2QR0A 5CMAB 1IEBB 1MJUH 1T89A 4Z7OF 3H7BA 4GKNB 5IJVA 1YJDC 1KFAL 1AR1D 3CXDH 4D9QD 3K4ZA 2RGSA 1XCTB 3VXNB 1OAZL 5EZJB 3ELAT 2EYTA 4H88H 2GJJA 4AQOA 2FYYA 5E99H 3QUYD 4HWEL 2P45B 3NIGE 3RIFF 4WO4B 4XC3H 3DHMA 4ZFZA 1YC8A 2VISA 3I50L 3WNKA 4YDIH 1XGYH 2V5RA 5FCUL 2HJLA 1PG7X 2Q86B 4KI5F 1P7HL 1QBLL 4HW6A 5AWNL 3RIAK 5TJWK 4K7PX 1NCBL 4TSAL 5EU7E 4NO0D 4P46C 3RUGA 1A6UL 4H5SA 3VCLA 5JHDD 2F58L 5JW4Q 1NGYB 4O2FB 3W11C 5EOCL 4EVNA 2PO6C 2YUVA 1EGJA 3CMOH 4LFHG 2YD1A 5CP3H 3QR2A 1CDCA 4ENEC 2MSPA 3OAYK 1QSED 2IEPA 4WDIA 4WV1B 1OPGL 5I1CH 2VJXA 4K8RC 2HKFL 4QRRB 3DROA 4LGRB 3MV9D 1Z9MA 4EI5B 4WTZG 1XGTB 4JN1L 1BF8A 4XNYH 4QRTB 1OT1A 3FHAA 1FZJB 5FYKE 2W0KA 2BVQA 2J88H 1CL7L 2VC2H 4LKXB 5E2VH 2LV4A 4MAYD 2Y7QA 2GTZA 4Q9CA 2X89A 3H7LA 3PGDA 3X13A 2ZCHH 1OB1B 5ITFB 1PYWA 5T33H 3DX9B 3Q2CA 1FNGB 4RGOH 3WNLA 5D6CB 4KJWC 4PYGA 1LWRA 2EKJA 1XIWD 5HHMD 1MCOL 1OD7A 1PX3A 3QUXD 1R5WB 4RGNB 4YGVB 3VXMA 5HHPB 1I9RH 3LEVL 2WIMA 5DO2D 5IEHA 2OQJA 3P0VH 2ATPA 4OZHF 3MV7E 1E6JL 1IGJA 1G6RB 4CUCA 4HKBB 5ACLA 1A7PL 3TYGL 1B6UA 1R3LA 2P42B 5TF1H 5GHWH 5IHZB 3REWB 3BPCB 3U4AA 1WEJL 4NNXB 4HK0B 1N8ZB 4JO1H 5J1SC 1D7FA 4ZQKA 3RPIB 2XACC 2ADJA 4HAGA 1B4JL 4DAGH 4JQXA 5GZNC 2VXTL 5B38G 2BVOA 3QUKB 2IPUG 4FXGB 1F4YL 3QEQB 4L8DA 4NO5B 1WZLA 3U36B 1A0QH 4HH9B 1X5LA 2G75B 3TZVD 1QPPA 5JQ6L 5LGHL 3KPSE 3VMOA 3W2DH 1QR1A 3VH8A 5CBEB 4ODWA 4O2CA 4EOWH 4HBCL 1LMKA 1K3ZA 4IRJD 2R9HD 4OI9A 1C12A 1JTOA 3MUJA 3NN8A 4YIQA 3KPRA 4JQXC 5DUPL 5EO1B 1T1YB 4Y4HB 2FB4L 1FH5H 1G9EA 1NMAH 5EZOH 3FAXA 3PWJB 3RQ3A 4NKOB 1JZ2A 3MRHA 1F8TL 1N26A 2R0LL 3GMOA 1NLBH 1LE5B 2CKBL 2BNQA 4XPGL 1YN7A 5I2IB 1H5BA 1RUQL 1FQ9C 1ZEAL 4PRDA 5I74C 3ECBB 4WEMB 4OF5A 3QFJD 3QCTL 3BT2H 1BFOA 4MQXC 2GY7B 1ZWIB 1R5IA 3ARDA 2DJ4A 1C1EH 1GGCL 3D9AH 3LKQA 4LLWB 3P9LA 4OLXH 1M7IA 3O4LE 3N06B 4OTXH 4HUXA 3EGSB 2V5SA 1H5BC 1CK0H 4LVOC 1IZJA 1JWUB 4MJ6B 4HXBH 3W9DA 1ZHNA 4UQ2B 3WN5A 1WCBB 2YPLB 2Q20A 2X4RB 3SGDH 3I02B 5CZXC 1UKQA 4ZSOE 2BNRD 2IH3A 1A1NB 1RJYA 4QYOB 3LZFH 3EOYG 2CRIA 4KZDL 5HGHB 2AV7A 2WBWB 5EU6E 2NNAA 2AV1A 1EMTL 3QJHA 1AY1L 4G5ZH 3SKUD 3U9PH 3UYPA 5JPMA 5J6HB 3BD4A 3MRJB 4M02A 3ULVF 4U3CA 2P5EB 2ZG1A 1ORQB 4X4YB 3MBED 4DTGH 5J9PA 1Q72L 4ZPVA 5I8CB 1CDJA 5IHBA 2ADIB 5EU5B 4BA8A 1H0DB 2R1XA 2OL3A 3EJYD 4RGMB 4PJBF 4LPWA 5EUOB 3VFRA 2BNUA 1F3RB 4ZOBA 1VEMA 4ORGB 1FP5A 5HHOD 1PQZA 4L3EE 2VC2L 3QEGL 4Y5XB 4KJPC 3QIUA 4EZMA 5DLMH 3TNNB 3KLAA 2DOCA 1G0YR 2Z0BA 2AK1L 4XBPA 2A73A 2AK4E 3IFOB 1NC2A 4HIJB 3BQUD 3QT2A 1KIRB 4WV1C 4QGTA 5INDB 4U33A 1I9RL 1UWGH 4KK9D 2BC4A 1FV1A 1KELH 3KYMA 3E6HB 4RNRA 4CU8A 3B8YA 2NZ9C 3EYOA 3KPOA 5DHVB 3H8NA 3MV8A 4HDIB 3T2PA 5E1HB 3HPJB 3UTSA 4CU7A 4CW1A 1OM3L 5DD1H 4KK5C 3HAEA 8CGTA 4YPJA 3RTQB 3CCHB 3SKMA 4G80A 2W9LA 3SKOB 1XH3A 2YSSB 3IDXL 4HFUH 3OWEA 4DAGL 2FO4B 2LVCA 3OKLA 3GMLB 2AXFA 1A9BA 1WIOA 2FSEA 4NOFA 4P4KA 5D7LB 3CFBA 3T8XB 1ZLUH 3VWKD 4OF6A 5JTWA 3UJIL 5D9SB 1DQLL 1TZIA 3V0AC 4OB5H 3BZ4A 3MYJA 1XR8A 3D2UD 4EUPB 5HSFA 3FO1B 4R8WL 4RA3A 4F3FA 3G6AB 1Q0YH 2AJXH 4M7LT 2BX5A 3V6ZA 4DEPB 5GS1A 3IDGB 3S36X 4FQXA 3ZKXB 1TZHA 2Z9TA 3C5ZA 3TN0A 3S35X 1YEIH 4E9LA 1RSFA 2F54D 3TBTB 4WEBH 2R1WB 5F97E 3ULUC 1FH5L 1J9CT 3O2VL 3U0TB 3B9KD 1JZ4A 1ZT7B 4UIMA 4FOMA 1CF8L 4OZIA 2FX9H 4Z0BL 1KPRA 4F9PC 5EN2A 3RGVA 4CVXA 2XXCB 4ZFFA 4TOYH 5GS1C 4WNQA 1AGEA 2X1WL 4FQXC 5SWSE 1U92A 2J8HA 3HNTL 3C5ZC 3IB4A 5DJZB 1LK3H 3CIQA 4FQLL 3F7VA 2HT3C 4JHAL 1UT9A 4JDTH 1T21B 2UZXB 3FTGA 4U6VL 4YQXH 4M6MH 1LDPL 1S7UB 1T7XA 3D9AL 5L2JA 1F3DH 4N9GA 2CDEA 1R3KB 4OJFL 3V52H 4Y4HC 3H9SA 1FVDA 3IKCA 5FO7B 4WUUA 1T0NA 4MX7B 1WQVT 4HXBL 4M5YL 4G9DA 4Z7WE 1FL5B 4JFDE 3DRTA 3JTSA 4OM1H 3GNMH 3VXRA 5IB4A 5DTFA 3UAJC 3F7YB 3PABB 4HAFA 2R2HB 3C2AH 4AQ1B 3S98A 3V6OE 4UT9L 1KV3A 4Z78A 2BVYA 5K9OA 4NNYB 4P23C 5B4MD 3IXTB 5D1QB 2E6PA 3GMQB 3LDBB 2C3XA 2RAMA 2C3WA 4DTGL 5GISL 1KBGH 3IJHB 4JFED 3S5LB 3MRFA 3QUML 5DEFA 5D6DA 1MUJA 1PSKH 5EUKA 2DWEA 5ESQA 1RY7B 4HIEB 2HLFC 3T1FB 5C0RH 2WLYA 4QY8B 1A6AA 1OAYH 5HY9B 5BS0B 4MVBD 3STLA 3KYOA 1S7SA 2LTQB 2EDQA 4R96B 3ARFA 4XWGL 1EIBA 3V2AR 1P84J 1B2WH 5J13B 1XF2B 4PJFF 4G7VL 2PNDA 5I15H 1M7XA 1JGLH 3SDXF 1CVSC 3EDDA 5FO8A 5EH1A 5B3NA 5CEZD 4Y19B 1FO0A 3V95A 1UWGL 4BH7A 3HI6H 4XVTL 3NFSH 4H8WL 1J1PL 1INDL 1DBMH 3FFCA 5JDSB 1F5WA 1H3TA 4JFHE 4RGMC 4RAUB 2EE2A 3RL1B 3FQUA 2GYSA 1X5IA 3RL2B 1D5IL 4QRUB 1J1OL 3O6FA 4Y5XC 3MOQA 4Y2DC 4NO2B 1QFUH 5C6PB 1WV7T 4DQOL 1L7IH 4HUNB 2F74B 2BSTB 3L5XL 3E0GA 1HEZB 1DQMH 1U0QA 4FZ8H 4NGHH 1AHWA 1RUKL 3IU4L 4P2RE 1GOFA 4GG8B 4WUKH 4YDKH 1TTUA 4WFHD 4OB5L 5L88H 3VFUA 2FNBA 3BP4A 3ZHKA 5MEOB 4Y5YA 2AJXL 4TTDD 4UDTA 2VL5A 2WSKA 4XXCC 4CN4A 2DTSA 3SY0A 1R3JB 1QEWA 4X4MA 1DBBH 1QSFE 3E3QC 4TSBH 3NFPB 5FGRA 5LKNA 2X4NA 1EAJA 1KXTB 1G7PB 3VD4A 2NYYD 4F8TA 1C5BL 2FX9L 3IYLW 3TA3B 3RHWK 2YKLH 3EOAB 1WISA 5C0BD 3UP1A 1OAQL 2FHFA 1W72L 3TT3L 4X5WA 3GSQB 3S88H 4PRBA 5BRZB 3L5WA 4ZUWA 5JOFB 1DVFD 4PLNC 1EBPA 1ODAA 1I3RB 4PJCA 4F7TB 1CD9B 2UUDH 2JB6A 2NX5A 3JWDC 3MV11 3SQOH 3HNVL 3HI5L 3OKKB 2XNAB 3MJ9A 2GY5A 3C2SA 3OG4B 3WLBB 3ZL4H 4APQD 3HFMH 4G8IB 4NSKA 3D85B 3FONB 1BVKA 5DJAB 2XN9B 4XNXH 3GMPA 4OM1L 4AEHH 2CGRL 3KXFA 4X99B 5KSBF 5F96L 5DUBB 2MFNA 2VIRA 4WJ5B 5FYJL 2OYPA 1I8LA 1HI6A 5E9DE 4L4VD 2OMNA 2OJEA 3PQYA 4DGYH 4F58H 4ZD3H 1AE6L 3RI5K 4BM7A 1EO8H 1S7XB 5HVHB 3NA9H 1IEAB 3RWIA 2DL2A 3B5GA 4G6AD 1ITBB 4GT7A 4HC1H 2B2XH 2R4SL 4L8SB 3FQNA 1NSNH 1IT9L 3WEXA 2HVJA 2APXA 3T0AA 2C3VA 3H0TB 3VFNA 5DYOA 2AJVH 4TTGA 4KTDH 4P2CG 2DM7A 4PRHA 2PYEA 1OAYL 4L9LB 3G6JF 2F53B 5MI0B 3L3HA 1FFOA 1T7VA 3GIZL 3S34L 1A1OB 2XQYG 2OP4L 1BQHA 4X7CC 2EYSB 2WZPD 4YZFE 4KFZC 4D9LL 3SBWA 4PJ7F 3HI6L 4OM0L 1UEMA 4LCYA 4M1DL 4V2CB 4I5BB 2PTVA 3ARBD 3K4AA 2DI9A 1MAML 3VFWA 5FOBA 3LKOA 4HJJH 4LHUD 1ES0B 4X0KA 2W92A 5A1AA 5EZLA 2W60B 2X7LA 3DYPA 3VXSB 3NABL 4KROB 4Q58C 1YNTA 2LTQC 3FL7A 1L4IA 2D7OA 5J13C 5D7IA 4YLQT 3WJJC 3RNKB 4OFYA 5IBUG 1P2CA 5ID1A 5DD3H 3U46B 1BOGB 3FO0L 4J1UA 4PJEB 1P4BH 3I75A 4OLVL 3D39A 4S11A 1YYLH 1P7QB 4ODBD 4PG2A 5L8LB 5I0ZA 4RZCA 4XMKH 1NMBH 3SHSA 1A64A 1XMWA 3K1KC 1NC4A 5E95B 1IILE 2P46B 4R97B 2KL6A 4P46D 4TSBL 2Y1VA 2Z4QA 4WW1B 2HJKA 5D1ZB 4U1IA 3W11D 1CT8B 3DO7B 4ISVB 5CEZH 5CWSB 4XHJC 4BFGA 4ENED 4DWHA 4TNVK 3JTTB 4K07A 3QA3A 1Y18A 4OD3H 2FHCA 2OTWB 1B0GA 4XP1H 1N59A 1VPOL 3W0WB 5I17B 5EORH 5TE6H 5H8DA 3EYUH 3E1F1 4B41A 4P3CH 2MMXA 5GGUA 4AJ0A 3HR6A 1T0MB 3FB6A 5ISZA 5DQDL 5I9QB 3FQXA 4UOW1 3HB3C 5AZ2L 4NRYB 1DLHA 5DJXB 5HDBE 5E70A 3REVA 3QXAA 4Z7UB 2ZNXA 4DZBB 3HFML 5GIRA 1W0VB 2Z8SA 5DK0B 1E4XH 2I27N 3G6DL 4PBWD 4MNQB 1IJ9A 4KJWD 4AEHL 5ALCH 1MEXL 1ND0A 3FCTB 1IKNC 5C07A 5C08A 1QLRA 1HHHB 5H94A 3MRKA 3F58H 1KJ2B 5GRWA 4MCYB 5INCB 3M8OL 4LDLB 4DGYL 1JUFA 4P2OA 2APWA 5KVFL 4U0RB 3W39B 3BEWA 3WS6C 2E9WA 4TRPH 1WBZA 3FT4A 3V5HB 4YHIA 3BPOB 1FBIL 4M93B 5C8JB 1SVCP 4E41E 2M2DA 5KSBB 1U8QA 5ESAA 4Q9RL 1J0JA 1NDMB 5GZND 4O51B 5ESVB 1UWEL 4QHUA 1L9NA 1B3JA 3V4UL 5F88A 4OIIH 1QFPA 1RUAL 4JGMA 4NWTH 3L6FA 4KXZH 3S4SG 1KIQB 5EOCJ 1NUNB 3MXWL 5MERB 2CLVB 1YEFL 2X1QA 1J8HA 2OI9B 1K9TA 3FT3B 2FD6H 1OLZA 1JWSA 1NEZG 2ED8A 5KANI 2BY1A 1N64H 4AY0A 5HVHC 1CGTA 3IDNA 3OAZH 1NL0L 3EYSH 3EO1A 4EN3A 3E6FA 4WHCA 2ZUQC 2F5AH 5I19H 3SE4A 4BUGA 1WCQA 1F4HA 4TULH 2GAZB 3BX7C 2DQCH 3QJFA 1P7KA 3CZJA 4OSUL 4HWBA 4LAJH 4R6UA 3B6SB 4LLDB 3NTCL 1A21A 3EUUA 1UB5B 1UQSA 5HHXH 4L9LC 5I1DA 2QSTA 1SEQL 1JN6A 1O7SA 4MQXD 4Z7VE 3OR6B 3BKCH 1VFOA 4HIIA 5FFLA 4R3SB 4EN3C 4X7SH 4Q0XL 3RGHA 4WFEE 5CSZA 1QKZL 2X4PA 1A9EB 3W9EA 2DIJA 2BNQD 2FJGB 1JPTL 4C83A 4YHOL 3D1MC 5C09A 4F2MA 1X7QB 5CFHA 5CZXD 4GFTB 2X5PA 3WFBL 2HWZH 3HG1A 5SWZA 2X1PA 5E8PA 4M7LL 1L6ZA 1TVBB 4OUOA 4W70A 4QHNB 5C0JB 1YNLH 2AERT 4YPGB 3QWRD 1T83A 5MENE 4YC2B 4P57A 1U91B 4QTIH 5D71L 4D9QE 3ARGA 1GRWA 1XF1A 4YHMH 1BM3H 4OD3L 3N9GL 4GRMB 2VITB 1F13A 4OLZH 1IGTA 1MQKH 3Q5YA 3O41B 5ID0A 3WFHB 5TE6L 1I8KB 4NN5B 1A3LL 1DQQA 5IB5B 2FX8H 3VXQB 1I7RB 4LEOB 3MTRA 1T4KB 3S37L 2P5WE 1H3PL 3WIIL 1SEBB 3AAZB 4KJPD 1BZ7A 4JKWA 2P8LA 3VGDA 1C8PA 5E2UH 5D1ZC 3VXTA 3BN3B 3KLDA 2IFFH 3GHEH 4K94C 4XCCH 1NCUA 4W6XB 2UZIL 3RVUC 3DRQA 1ZTXH 4PS4H 4RAVB 4U1NA 4JDZA 2Y36H 5JNYB 4JPWL 3BWAB 3HUJB 1QSEE 4R4ND 4XRCB 1G7IA 2BK8A 4JFZH 3L3OA 1N5YL 1MFCL 2NZ9D 5DD0H 3TVMA 3JZ7A 4M8QB 3MV9E 4NJ9L 2MPAH 2VDMH 1WBXA 3NH7L 1CE1H 5ADOL 4NPYA 5I9QC 1RU9L 5HYJA 2NY6C 3TJEH 2R2BB 4OCMC 3ZE0F 2XWTA 4FTVA 1NCDH 1AXTL 3SGKC 2E5EA 2D31B 1H3GA 4L8CB 2BJMH 1N5AA 4TNWK 1HHIB 3RY6C 1GAFH 1RZKC 3L7FB 1CU4L 5HHME 1Q9OA 1D6EB 5EO9B 1CFQA 4QXTA 3STZB 4HWZA 2PR4H 1EGJH 1YEDB 3CLFH 4IMKC 1I1AB 1MHCB 2DQJL 5CZVH 3VI4E 1DSFH 3U83A 1MCJA 4U0RC 3HCVA 2Y06H 1N64L 4HFWA 4PY8I 3TFKD 2FIKA 3MXVH 2IPKA 3KR3L 5KVDL 3BPOC 2B8OT 1RZJC 4LPXA 4OAWA 2VKWA 1L9MA 3MNWB 3G5YB 1KG0A 2XA3A 3WJLC 2XYCA 3B9EA 4FQXD 3C5ZD 2OI9C 4Z5RA 4ZUUA 4N8CL 3U7YH 2MJWA 3W81A 1CWVA 1X5FA 1FGVL 2B4CH 2R69H 1F4WL 3QCVH 4UILL 2OBGA 4Y4HD 5SWQA 4N0CD 2Q7YA 4U1GB 5IB2B 1VFAA 1NCTA 2A74A 1FFRA 3T0EB 4W4OA 3QIWC 4ZTOL 1LILA 1XT5A 2UWEA 3OKMA 3QI9C 4I3RL 2XZCH