5BRZE

Mage-a3 reactive tcr in complex with mage-a3 in hla-a1
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
241
structure length
241
Chain Sequence
AGVTQTPRYLIKTRGQQVTLSCSPISGHRSVSWYQQTPGQGLQFLFEYFSETQRNKGNFPGRFSGRQFSNSRSEMNVSTLELGDSALYLCASSFNMATGQYFGPGTRLTVTEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-1 alpha chain
publication title Direct molecular mimicry enables off-target cardiovascular toxicity by an enhanced affinity TCR designed for cancer immunotherapy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 56
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2015-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07686 V-set Immunoglobulin V-set domain
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5brzE02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5brzE01
4UT9L 3SGKA 2F54B 1E4KC 3JTTA 2BRRH 3CSYB 3QUYC 4CMMA 2ICES 4ZS7H 4IDJH 2J1KA 2YUWA 5DJ6B 4X83A 5BOPA 4Y8DC 5JHDA 4OZFA 2VH5L 3QIUA 4YDKL 5DWUL 5JOEA 2BNUB 5FYLH 3TT1H 1S7RA 1Y6MR 4XB7A 4QRQB 1DSFL 3VWKB 1WCBB 1ETZA 5D7KD 2GUOA 2VWEE 3FOMA 1JWMB 4C56D 5IMLA 3O2DH 1NANH 5E8NA 4HIHB 5JDSB 4V1DE 4LKCB 4KFZC 3C5ZA 2NMSA 2P43B 1SJHA 4U6TA 3O0RH 3E6FA 1D5BB 4DEPB 4OCNC 1GHFL 5J89A 4JRXB 3KXFB 2W0PA 3LS5H 4MA3B 3QI9D 5F71A 3NZHL 1XR8A 4PJBE 1RZ8A 4LFHG 1H8OA 5BCAA 1NEZG 2O93L 2AJ3B 3VXMB 5K9JH 1BGXL 2EE3A 1CL7L 3KGRA 2D0FA 5DMIL 5KBNC 2NY5C 3MV7A 1PD6A 3SDDB 3V0WL 1U8QA 1CFQB 4CBPA 3SE3C 1RUAL 4TQEH 1YNTA 1HHHB 2DQEL 1MWAB 1E6OH 3WS6A 4KI5D 5FO8A 4JM4H 5KTEL 5F1IB 5CCKL 4NJ9H 5BOZG 1H15A 3TFKD 1KJ2A 4RGNC 4LEOB 5T3ZD 5IQ9B 3UTTA 3HZKA 4OIIH 3FO1A 1I3VA 5CMAB 1HN1A 1A9EB 5IQ7H 5ABDE 2JLLA 3KLAA 3MRJA 3OG6B 2DQDH 1WGOA 4M6NL 3HE7B 3LHPL 1CDYA 5SX4H 1N64L 2P8MA 1YMMD 5FHAL 1LWRA 1K4DA 1RUKH 3DO3A 2Z31C 1S7WB 3Q6FB 4OF5A 3UP1A 4KGJA 3WFEL 2W1NA 5DT1L 5DMJB 3HFMH 1MLCB 2R4SL 3CXDH 5IVXF 2FIKA 2FJHB 2HT4C 3DSFH 4J3SA 4NQCA 3CDGB 2HVJA 3HB3D 1LEGA 4NHCH 3QDJE 1HEZA 3W11C 4TVPD 4YDLC 1PLGL 3GBMH 4QRSB 4GOSA 3IDYB 4NQDE 1QSED 5J0BA 1CFNB 1U6AH 3EO1A 2HAZA 3ZE0E 3BRGC 3O8XB 1UWGL 4ZPVB 5H8DA 4G80A 4PG2A 5J1SC 5ESVB 4UDTB 1AIFA 3C6LA 3VI3E 4K71B 4XNZC 4LGRB 2SEBA 4GBXD 4XCCH 1R3KA 3WIHA 1GOHA 3V8CA 1LO3H 1OQXA 4ENEC 5IIEA 1TVBA 4I0CC 4JGJA 4OZGA 3ULUL 5IB3A 1CICB 3ROLA 4MNQD 4HIXH 1Q9KB 1S8DB 1YNKL 3MRQA 5J6HB 4MB4A 2V2WB 3HC0A 1HWHB 4N0UA 4JRYB 3RJDA 4PB9H 4P23B 5DJ0B 4NCC1 3KPLB 4KK9C 4QYOB 3BE1L 3DLQR 3LB6C 2Q7NA 1J5OL 4CRPA 4Y2DD 1U8HA 2UWEA 1J1OL 3MODL 5E1AA 4RGOL 1FE8L 3J7HA 3B9VA 3AU1A 2VTFA 2V7HB 5C3LD 3BZEA 3B2VL 1KFAL 3JWDH 3TN0C 3P77A 1KJVB 4NWUH 5CJ5A 3W81A 5E4IA 3E2HB 2XN9D 1K2DB 1OAZL 3MRDB 3SQOH 2VIRA 1YZZA 1IGTA 1L7IH 4ZPTB 1JPST 4ZFZB 1QR4A 3RTQC 4AL8L 2E7LC 4K7PL 4CVWA 3QJFB 1IL1B 4G9DB 5D8JH 5HHPA 4H0HB 4QWWD 2XWJB 2NY1D 2XNAB 1MHEB 2JJSA 3ESVF 1AHWA 4M9PA 3MV9D 4HWZA 5I75B 1ZHNA 4GRLD 2NW2B 3IDIB 4JKPL 3CVHL 4OLWH 4BUGA 5M7QA 5EUOF 5D71H 4Z7WE 2Q86A 4NO2B 3ZT7A 4KQ4H 1LP9F 4OV5B 4LHUB 2QEJA 5DF0A 4R4FH 3MLRL 2UUDH 4TOYH 2VZSA 4KKBC 2VR5A 3S36H 1ONQB 3SDCC 3RL1B 4Y1AA 3NPSB 3D9AL 4PJDF 4Z76A 5EZLA 1XGTA 2G2RA 4M3KB 4BZ1L 4WFED 2YPVL 1UEYA 5ICZA 2I9LB 2HA1A 3NOIA 4NUGH 5FYJE 5T1KB 2Z35A 5IROA 3ZYZA 3X3FL 5FYKE 2Q6WB 5H35A 2MPAH 1P4BH 3JTSA 5IMKA 1ZMYA 3V4PH 1SYVA 4D0CB 3T0WA 1CS6A 3ULVC 2XTJD 5F88A 2FB4L 1OGAE 4QRRA 3CK0H 3WNOA 1EERB 3EOTH 4XVSH 4WI7A 1U8PB 4MJID 4OAWB 4PJIE 1T5WB 2B1AL 3WN5C 1RJCA 1G9ML 2ZSWA 4DVBB 2MQ3A 3SKOB 1BQHA 3MRCB 4R7NB 2FEDC 1CFVL 5GRXG 3L5WB 1DE4B 2E7CA 3OKOB 2EC8A 3W39A 1HYSD 5D93B 3AY4C 2Y07L 3D39D 1OF2A 3RVXD 2YWZA 5IKCB 4WFFE 3MUHL 1KV3A 3O6MH 1RAMA 1MJJA 3DYMA 4XPGH 4U2ZA 1I1YA 1ULVA 5GGTH 5E2TL 5IEKA 1I7RB 4L3EB 4M7ZB 5IHUL 4P4RA 4XNQA 1OTUD 5AUMB 4MDIB 1QO3B 5ADPH 3ARGD 3KYOA 4PTUB 2BVPB 1YJDL 4M6ML 5EDXA 4K9EH 2YBRB 3B5GA 3PWPB 3BESR 5L9DL 5GJSL 4OJFL 5BVPH 3SKMB 3U30B 4XWGH 2QHRL 2XKNB 2ZG3A 1AXTL 4PY7B 2LAAA 5HYQB 7CGTA 4G42A 4P9HH 5DUMH 4OQTL 3ZSSA 1LO5A 3VFMA 4DGVL 4C4KT 2OMNA 3MCG1 5DJDA 4G3YL 2OR9L 3LD8C 1T0NA 1X7QA 2XA8H 3U79A 4PJEE 3P9MA 4JFDA 4YHLH 2F54E 2NNAB 1KPUB 1CLOL 3UJTL 2WP3O 3W9EB 3B9KD 2P5WD 2HG5B 1BIHA 4YPJA 4APQD 4HD9A 1HCFX 3IXTB 2A83A 4MCZA 3HG1D 1IAMA 4YR6A 5EO1A 2KH2B 2F19H 3B9DA 4X7EC 4MXQD 4GMSL 2DQCH 1A6TA 1XGQB 2DQGL 4L8BB 4FZEL 3G5YB 2EICA 4AT6B 4JZOA 5DHYA 1NBQA 4RIRB 2DQFA 4G7VH 4YUEL 4R26L 5DFVD 5FYJH 1F11B 1NCCH 1WWBX 4CN1A 4U1KA 4F33A 2IGFL 3MRNA 4NKMA 4Q9CA 4HIEB 5JA8B 1KLUA 1ES0A 1EFXD 2Z91B 3D3VE 3FL7A 1BP3B 2P44B 4ODWB 4G6MH 4WEUD 5A16A 4KK5D 1GGYA 2E6QA 4WU5A 2A0LD 4JRXE 5HGHB 1EK3A 3KXFE 5E9DD 4P3DA 1AJ7H 2DQHH 5HHNA 1QBAA 4GQ9H 2CLZB 3KLHD 1EGJH 1JHTA 3BN3B 4MD0A 3TBTA 2H26B 5EB9A 3OQ3B 1QFWL 3AFLA 3CX5J 2QADC 3VWJA 5BW7C 4LLDA 2ESVE 4KDTC 1DL7L 4JANA 1HHJA 4YFDB 3BP7A 2XACC 1X5ZA 3MBEA 4IHOB 4OIAA 3MROB 3HPLB 5D7LB 1MCJA 4MXWL 5D2LB 1F3JA 5T1LD 1KXVC 2DI7A 4LVOC 3HMWH 4HKBA 4ZDHA 2ZUXA 4K7FB 3N9GL 2H1PL 5D9SA 3G6JF 1MVUA 5SWZE 3IDNA 5MERA 4YHZH 3VGAB 4PJFF 3W5MA 1T21B 3MUJA 2IPKA 1JNLH 2CDGA 3QFJE 1NGWA 3REWA 3VXPB 3NBNA 5J1AA 4CU8A 4ZG1A 4CVZB 1XFPA 3JTTB 5ESAA 3BPNC 2OTWA 2ICWI 5KW9L 3NA9H 1MCEA 3B2UD 4UNVA 3RX8A 5C2UB 2A6KB 1D6VH 1UEMA 3RVUC 4PJXB 4OZFB 5J4MA 1QLRA 3QIUB 4LCIL 2C5DC 3BPCA 3HRPA 3ZSTA 1ETZB 1QQDA 5C0BB 3L5XL 2GUOB 1NBYA 2DQJL 1II4E 3FOMB 1XGYH 4ODVL 1MHPH 3LN4A 1DQJA 1VFAA 2A9NH 5E8NB 4U1NA 3C5ZB 1PKQB 3SGJC 4X4ME 3QH3A 4HKXB 4JFXA 2FECI 4KKNA 3BIBX 1SJHB 4DN4H 4S1QL 3LDBB 3IJSA 3E6FB 1YEJH 5IJKC 4H20L 4KK8D 1A6VH 3B4NA 4HBQA 3BKCH 4F7MA 3HUJA 4WCYH 1X44A 1XR8B 4EXPX 3ZE2F 4U6YA 3WDJA 4JRYE 1H5BA 1R5IB 1I85C 1ZTXL 4TUOA 2DQUH 1W8NA 4FFZL 3DX8A 1U8QB 1JNNH 4RQQA 1JMXA 1YNTB 4FQXD 2AABH 5K93A 1QRNA 1UM6L 4P9ML 2LVCA 4XP5L 5AYQA 4L5FH 2ZUYA 3T2NL 3MNVA 4O02H 2DAVA 5FO8B 1NBVH 4M1GL 4OZIA 5F1NB 1G7HA 1I9JH 1H15B 4Z7QE 5F7DA 1KJ2B 4LHJB 1JV5A 1DFBH 4N9GA 3UTTB 1FIGH 1NMAH 4J7RA 4QOKA 5TPWH 4IRZL 3ARXA 3X14B 1T7ZA 2VXTH 4XHJD 1TZGL 8CGTA 2BVEA 4YZFE 5CKAA 5EO0B 4XMPL 3AREC 3MRJB 3MV8D 4UZGA 1U3HD 2J88H 3Q5TA 4J3OC 3VRIA 5TGBA 3UDWC 5KVEH 1XIWA 4X7TA 1N6QL 2OJZH 1BVKA 2X1PA 3RGVC 3S3PA 5C0EB 5D7IF 1KPVA 2HH0L 4WJ5A 1C16A 1WBXA 1RFDH 3KJ6L 4MZ2A 4Y88A 4KJPD 1A9BB 3ZTJH 2E3VA 3H6JA 1AGFA 3BW9A 1GZPA 4NQCB 4XNMA 3BN9C 1AXSA 1GGBH 1T83C 1HEZB 5CZXD 3NFPB 5K33A 2J8UA 2MKWA 4HWBL 5LBSL 4S10A 1E28A 4XVTH 4KKCC 3VFOB 5DEZA 4KAQL 4NRYB 5I76B 3ISWA 3AB0B 3EO1B 3Q2CA 5EU5A 4Z5RA 4G80B 4N1EA 1AIFB 1OARL 5C0CE 5T1MA 2FEEI 2J6EH 1F58L 5D70L 3WSQH 2BCKB 3NAAL 1KCSL 4LLQA 2CKBH 5IIEB 5HY9B 1WFNA 4OZGB 4ODUA 2YHGA 2JELH 3ROLB 3W82A 3MRQB 5E4EB 3VI4F 2FNBA 3PDDA 2VLMD 1MHCA 3HC0B 5CINL 1YMMB 3BEVA 5FUOL 1Z0NA 4U6VL 4YO0A 1NAMH 4G8FA 4CVUA 1U8HB 2P7TA 2UWEB 1L6ZA 3IU4H 5KSAA 3P4OA 3MLPA 1YQ2A 4LPCA 3AU1B 4AQ1B 1JF1A 3LPFA 3DOSA 3RZCA 3IDJB 4NNYB 4ORGA 3MRFA 3P77B 4HG4K 5FDWA 2Q7YA 3TO4A 1A7PH 4NKOA 2WANA 1CK0L 4P2YA 3LPGA 1IGCL 2DYPD 5JW4N 2VIRB 2EXWD 3FB7A 3HCVA 3LEYL 1UZ6F 5C07A 1BJ8A 5IOPA 2A6DA 1QSEB 4KRNA 4NRZA 3QEHA 5CHNA 2CO7B 1TTFA 4L3EE 5HHPB 4DJMA 2XXMB 3D85A 5GRZA 1AHWB 4OGXL 4G9FB 4HWZB 3EFDL 1CD0A 3DURA 3X3GL 4YBLC 5C9KA 2ZZUT 1PKOA 1HQRA 4WHTA 2ZUTA 4YDVA 3PWPE 4WV1C 1VESA 2OI9B 3QAZC 2Q86B 4O2CA 5KG9A 2YWYA 3TVMC 1I1AD 5F7FA 3TBSA 3DETC 4YDIH 4Y2DB 2C3HA 2FGWH 2GQHA 1P84K 3FN0L 4Z76B 5EZLB 1XGTB 5FAAA 1CU4L 3T1FA 5HBBA 5IBLD 4KJWC 5HDBF 4HSQA 4LIQH 4S1SL 2Z35B 2X4SA 2V5YA 4X4ZA 4H25B 3H42H 1DBMH 3QEUA 5CGTA 4I0PD 5H35B 4JFOA 3OAUH 4HIIA 1SYVB 1RIHL 4YE4L 1TQCC 4FQLL 4JO2L 1P4LA 4QRRB 3K2UL 5FGBA 2WBJA 4XBEL 3T1WA 1RIUH 4WFGE 1IM9D 1TJGH 2ZSWB 1BQHB 4JFZH 4NC1E 5FOJA 1HOCB 2B4CC 1FQ9C 3LQAH 3RI5F 4U1IA 4X9HA 1LE5A 3W39B 4UB0H 3GSNL 4M93B 3TH2T 4MAYC 3FO9B 5GGQH 3FQRB 5E95B 3BPOC 4EN3D 2Y5TB 4JB9H 4PD4J 4DUXA 4PY8I 1MJJB 3ARBD 2VLKD 1I1YB 1Q9WB 1F4XH 4Q6YA 3K2MC 2FBJH 3GMQA 4RMUA 4QXWA 2NW3A 1MFDL 1J9CT 3DTXA 3GMOA 4G6FD 2LU7A 4P4RB 3IETA 1SBSL 2APXA 1N8ZA 1T3FB 1NMBH 4HDIA 1YPZB 4P46D 4GLRI 5F1OB 4NCDA 4A2MA 3KYOB 1NC2A 4MA7H 3RBSA 4K23H 1W0VA 4GRWF 5I1HH 1VPOL 5E5RB 4LSQH 1FO0A 1K9TA 2COQA 2WLZA 5DURD 2XTJB 5D2LE 1UA6H 2X4OA 4LLUA 1DVFA 3FB6A 4NQED 1LHZA 4U1GC 2A73A 1LO5B 2GK2A 2ARJB 4R8WH 3EIFA 3TJHD 2ZKHL 1T0NB 5LGHL 5FKAB 5ENWA 4OLVH 3HRZA 3P9MB 2VN4A 4R6UA 3DWTA 4PJ8C 3E8UL 4CW1B 5DWUH 3CD4A 3C2SA 2HFFA 2A83B 4G7YL 1YEGL 2H6PB 4MCZB 2AEIT 4YR6B 1GVIA 3S96A 3O6FA 3V52H 1T2JA 4PJXE 4KZDH 1MY7A 4C58B 1L0XA 5KVFL 1WIOA 2AXJA 4YFLI 3PE9A 1A6TB 4EI5C 1MJ7L 5C0BE 4JZOB 5DHYB 2DQFB 2VLLA 5I19H 2PYEE 4WW2A 4WUKH 3CXHJ 4U1KB 4D9QE 4F33B 2X4QA 3MRNB 4NKMB 2FGZA 2Z8RA 1PKQE 1HQ4A 1TENA 5HJ3A 4HJJL 2P49B 4OSUH 5DJXA 5HHXL 1UXSA 4KUZH 5A16B 5HI3D 2IAMA 3WFBL 3TZVC 1TFHA 5DHVB 2XWTA 4WU5B 2FYYB 2AK1L 1A6ZA 5GRJH 3QQ9C 2WQRA 5HHNB 2VLRD 3DVIA 1U93A 4OZFG 2ERJC 1JHTB 2C1PA 2LQRA 3TBTB 4GXUM 4ELMA 1J1PL 3PP3K 4MB5A 3B9KB 1X6NA 2P5WB 4J12A 3VWJB 1LE9A 2VXUL 1MOEA 2DF3A 4LLDB 1T1WB 5KTEH 1UJ3A 2A9ML 3HG1B 1X5JA 1YQVH 3BKYH 3N0PB 1QSFB 4JANB 4LRNH 5TQ2L 1K4CB 2X10A 3BP7B 3ILPA 1WCQA 3MBEB 4KUCF 4K2UL 3MGAA 1F3JB 1OCWL 1EAPA 4ZTOH 2QQKH 4HKBB 2GJJA 3QULA 4ZDHB 4JHWL 3I9GL 3LHPH 5D9SB 4XVUD 3DARA 3A0OA 5FHAH 4C56E 5GGVL 2R56L 1CGSL 1PY9A 2Q1EA 1F4WL 2IPKB 5E2VL 2CDGB 4MD5A 3REWB 1NGWB 5J1AB 3ZMRA 5DT1H 1R5WB 4NM8L 2NX5A 1NCBH 4Q58C 4NZUH 3BDYL 4P2CG 4PRIA 5F1KC 5ESAB 2FR4A 2F58L 2YA1A 2HTLD 2AS5M 2AXGA 2NXYB 2JCCE 3GB7A 2VDQH 1EH9A 3UTQA 3MX0A 4Z7UB 4PJGF 1OPGH 4L8SB 4P3CL 1QQDB 3UZQA 3WKNA 2EIEA 4Z95L 1NFDF 4FQCL 4YBHA 4KI5E 1T7VA 3LN4B 4MA1B 4U1NB 1TETH 4OD2A 4P4KD 1CFTA 4JFXB 5EULV 4OFIA 2FX9H 1YNKH 5T3ZE 3LS4L 1D5XA 3BYTA 2YSSB 3N50A 4U2YA 3K3QA 3MLVL 3OMZA 4HT1L 2DL2A 4F7MB 3G04A 4WO4D 3HUJB 2YUVA 3BE1H 5KVMC 2JE8A 2YKLL 2WAHA 3MPCA 3EDFA 5F7HA 1H5BB 1YMME 4RGOH 3ULVL 4EUPA 1M7DA 1FE8H 4TUOB 3DX8B 4RAHA 4RQQB 2CRYA 1RULH 5JDJA 5K9QG 5FHBL 4WWKD 3BMWA 4Y5YB 3W5NA 1VGKA 1BECA 3OL2A 5I1IH 4Q74A 2IFFL 1QR1A 3MNVB 3P11L 4OZIB 4X9GA 4UI2A 1G7HB 4HBCL 4V2BA 5F7DB 1I1CA 5I8EA 4TVPE 5IG7A 4N9GB 3WL9B 5HDQH 1HHIB 5MENA 4QOKB 1AI1L 1QSEE 4NN6C 4JJ5B 5JQ6H 3H9ZA 2NY0D 1QA9B 3VD3A 4QRPD 4Q7DA 5L2KD 3RWHA 3U1SL 3L3DA 3CVHH 2D7TH 1FNGA 3BWUC 3K4AA 4G9FE 4XBPA 1JYVA 3W0WD 1XIWB 4X7TB 4D0DB 1KPVB 4WJ5B 2IBZY 1C16B 4KKLD 1WBXB 1RZKC 1GRWA 1NCDL 3MLRH 5J06A 2DLFH 5EIQA 1AGFB 3BW9B 5EWIL 1GZPB 3SO5A 2Q3AA 5D72H 4XNMB 3D9AH 4XCNA 4RNRA 2N56A 1DLFL 3KVQA 1H3WM 1INDL 3I6LD 4RRPG 5JW5A 2YPVH 4Y16D 1MVFA 2MKLC 1N0XH 4U1SA 3IJYA 1GIGL 1DANT 3QO0A 2KDGA 3A6CH 4NQXA 1FCCA 5HYFA 1BAFH 1U8MA 1I7UB 3GUTB 5J12C 4DTGH 1IARB 3VMPA 3X3FH 1CIUA 4KKAC 4D8PA 5F3BB 5L0QC 5GXBB 3TH3T 4AEIH 4P5KA 4F7CA 1ZVYA 1T1YB 3HNTL 3TPUA 4ODUB 5BV7C 2R29H 4XNYH 2NY3C 1MJ8L 2QKIA 1EUUA 2O5ZL 4OLUL 3MNZB 1MHCB 1FZKB 3DVNA 3V6ZA 4I2XA 1U3HB 2B1AH 1ZLVH 3WCYA 3BEVB 4QRRE 3FAWA 1CFVH 2UVFA 3T0ED 4ZUWA 1G7IA 5F7LB 4KHTH 2NYYD 4YO0B 4G8FB 4R0LB 2DKUA 2P7TB 4OM0L 5IB1B 3P4OB 4JN2B 1JF1B 2R9HD 4ORGB 3O6LL 5KSBF 3MRFB 5FDWB 4ZD3H 5DUPH 1OTTC 4NKOB 5E2TH 2EO1A 4NO0A 1OP3K 1UKSA 3C60D 1VACB 5IHUH 4NRXB 3FB7B 5E5MA 3HCVB 4YAQB 5FA3A 5IOPB 1D7FA 2A6DB 3DYOA 4LP4A 3BEWA 3B5HA 4UUJA 1QLEH 4NRZB 3QEHB 5CHNB 5HDLA 5HHOD 5KJRL 3CC5A 1KIRA 4WFEE 4KZEL 3EKCA 1YJDH 4M6MH 5D7JC 4BA8A 3D85B 1YPZE 3NACL 1CXKA 1PW3A 5GJSH 4OJFH 4WHYH 2GYSA 3RZWA 4NYLA 4PLKC 3OKNB 3DURB 1LK2A 2QHRH 3FRPA 1AXTH 3QIBA 1HQRB 1D9KA 4WHTB 4YDVB 3KPOB 1MEXH 5I71C 3MRKB 4OQTH 5C2BL 4TVPH 2VQTA 1U91A 5HYSA 2NZ9D 3R0NA 2XTJE 4O2CB 2VR4A 4DGVH 4Q9BA 1F2QA 1A47A 2OR9H 1A1OB 4YIQA 5JHLH 5A2JH 3CVHA 4JDTL 1ZA3B 1K6QL 3QNXA 3TBSB 3KNBB 5T5NG 3GMMA 4XXCC 4EXKA 5A2FA 3UJTH 4KVNL 1YNLL 3IU3B 3DECA 3OF6D 4IOSD 2DYPB 2X4SB 5I30L 2FLRT 4W6XB 5HVHC 5CJOL 12E8L 4KI1A 2DQGH 3VGFA 1P1ZB 3QEUB 4FZEH 1UVQA 4I1NB 3TA3D 1NH6A 5F7UA 1NCWL 4JFOB 4HIIB 1EHAA 4YUEH 3RVVD 5CJ8A 1IGYB 5DTFA 2D31B 2FCBA 1P4LB 2IGFH 5D1XA 3IRZA 4XPBH 5CGYC 2WBJB 4HLJA 2H9GB 4YHIB 4B50A 2OSLB 3VRLF 5JPNB 2BHZA 3MRHA 4QTIL 4LLMA 3BO8B 5JXEA 5TF1L 5CGMA 1CR9H 3CFCH 2C3XA 2EDFA 3GKZA 1ZS8B 1LE5B 1XR9A 4U1IB 4GSDH 4WDIA 1I1AB 1JRHL 3NPZB 4HAGA 4B53A 1NDGB 2DLGA 2W0KA 1CE1L 5JNYA 3NMEA 1RUPL 2VDNH 1Y18A 2NW3B 4MS8D 2EKSA 4PR5A 3DTXB 3GMOB 5BRZA 1QSVA 1DL7H 4TUJA 1N8ZB 3SO3C 5I8OH 4HDIB 2R1WA 3UX9B 1QFOA 2P5WE 3G9VA 3C6LC 1NC2B 1H0DA 3HG1E 1HKLL 1W0VB 3AXLB 4MXWH 1QSFE 2Z4QA 4N0CC 5E7FA 1BM3H 3ILQD 3GJFK 1FO0B 2GAZA 3SCMA 2H1PH 4MJ4A 2X4OB 4LLUB 4LCWD 1DVFB 4FP8H 1LP9E 2BOCA 3A67H 4PLNC 4W6YB 2A73B 2HN7A 3HE6A 3S9DB 3MSPA 5ENWB 3QWOA 3RWEA 1ZGLM 4OQTA 1YEFH 4R3SB 4LSSL 5DI8A 2VR9A 5I16B 2RFXB 1IKNA 1LGVA 1WFTA 4M61A 3TP4A 1AE6L 3NGBB 1Y0LA 5ACMA 4MQTB 1C7SA 2HFFB 4QT5A 3I84A 3VXUA 2GIYA 3OKEA 3VXRD 3O6FB 2X42A 5DD6A 4TSBH 3L5XH 1FZJA 1NSNH 3VFVB 5HD8D 4I18C 4Z7UE 1G6RH 4PP1D 3WHXA 2R2HA 5IEHB 2D4FA 4P46B 2BNQA 4ODVH 5DC0A 5EFIA 3CMOL 4NSKA 3ESUF 4XP4H 3OR6B 2VLLB 1FV1B 2R4RH 3KLDA 1KIQB 4GG8A 2IMMA 4S1QH 3PWVA 2DMCA 1Z0MA 4L4VA 5EOQL 1C1EL 4LNRA 1HQ4B 1NKRA 5D6CA 5DRZA 5HJ3B 3FQXA 3L6FB 5DJXB 1UXSB 2ADIB 4G6KH 1P9MA 3MJ7A 4H1LH 1JPGA 1YYML 1T89A 1S9XB 3UTSA 1KCUL 3EO0A 2XWTB 5D2NE 4NN5B 1A6ZB 2JKXA 2W59A 4FFZH 4BZ2L 2ZCLL 1HYRC 4S2SB 1U93B 4I48A 3V95A 4ERSL 1UM6H 4P9MH 4ELMB 2Z8VC 1F90L 4XP5H 5ICXB 3N1QC 4Y5VC 2W92A 5KSVB 1U58B 1P69B 4JFFA 4M1GH 3QEQD 3L1OL 3U0PA 4GKNB 2D7NA 1FG2A 3BAEL 4NPYA 3DXAD 2R0KL 5IROC 2CUMA 1WFOA 4W70A 4NWTL 3ILPB 2NY2B 5ALBL 4OZIE 5DHVH 4OGYL 4IRZH 3VG9C 3GSUA 1AD0A 1Q0YL 3S34H 3L3KB 4UIMB 2OMBA 1IAIH 1NGPL 5JIKA 1NLDL 1ZT4B 3PV6B 3S37X 1EEYA 1N6QH 3DROB 3KPSD 2P46B 1WAAE 1FDLL 3QUXC 4MD5B 2L0DA 4UTAH 2BFVH 4M7LH 4XZUA 3NTCH 2XY1A 4ZSOA 2VXQH 3KJ6H 2K3TA 4MNGB 5CBEA 2CR6A 3MGTA 2FR4B 3QUZA 3DI3B 3O3AA 2ZCKL 4JPIA 4OCSH 4I5BA 1KB9J 4LVHC 1MY5A 4U4BA 3QUML 1OB1A 5ANMB 3WFHA 4Y4FA 4QXUL 4HWBH 3UTQB 1I9RH 4YXHL 4EDWL 4KAQH 2EH8H 2OK0L 1GH7A 1ZGLP 2AJXH 4CGTA 4MD4A 1C12A 3JWDC 1OARH 1U41A 1V5JA 4W6WB 1FAIH 2K9UA 4EOWH 1PZ5A 1IT9L 2YD8A 5D70H 1BQUA 4DKFL 1KCSH 4EI6A 5I8KL 2Q8BL 3GFUA 4Q9RL 2NY6B 5E5UB 3QIWD 1CFTB 2H32H 1V3MA 1NMCB 4PRAA 5J3HC 4J4PA 4HKZB 3QHFL 3ULSA 1D5XB 1I8LC 2RQ8A 3PWLA 5CINH 2XI9A 4LPXA 2EXYC 3G04B 2NY4B 2VC2L 1WTGT 4M1CC 2X4UB 1SJEA 2DWEB 3P0YH 3MV8E 3OGCA 5FCUL 1MFAH 4RDQG 2EDJA 3BP6A 3FFCD 3NFSL 4Q0XL 4EUPB 4F2MA 5F6IB 2VISA 3RDTC 3ZHDA 5LWYL 3K8KA 3BFOA 3CFJA 5GS1A 4H1LA 2KUTA 3CMGA 1GZQA 1VGKB 1LMKA 1RI8A 1IGCH 3O41A 3TO2B 5CSZA 2DQIH 1B0WA 2C9AA 3BT2H 2B4CL 4RFOL 3MA9L 4TNWK 5MI0B 5I8EB 5IG7B 3PDGA 4PRPD 5T1DL 3EOBA 4GKZB 1ZT1A 1J8HA 4XI5C 1NQBA 1Y6NR 3RUGB 4OGXH 4C83B 2CK0L 1REIA 4QCIA 5SV3A 3X3GH 3C5SA 2A6JB 1WT5A 3L3DB 1KUMA 4PJ9D 1FNGB 3LMJL 4XBPB 4E42A 2H2PC 1NC4A 3PJSB 1Z3GH 3TBVA 3WIIL 4YHML 2BXYA 5HGGS 4F57L 1DDHA 3MOBL 1JGEA 2OXHA 2ITDA 5D1QD 1DTUA 4KU1A 1C5CL 3FFDB 1TDQA 1MI5D 4FN0A 4PYHA 3RWFB 1HILA 3QQ3A 2VLME 4J1UA 1ZANH 1IKFL 4MSWA 1BFOA 3MOAH 3OKKA 4XCNB 1R3LA 4RNRB 4RBPK 1CU4H 4IRSA 4O2EA 5EU7E 3KWWA 3DMMD 4X9FA 1P7HL 1PYWB 3IJYB 3PHOA 3UZEA 4YK4B 4S1SH 5EUOA 5C08A 4HV8A 1EEZA 2CLRA 2VDKH 1U8MB 2EDWA 1E4WL 4KTDL 1K8IA 2J8OA 4HWBA 3C6SA 1NCTA 5IVZA 1DBAH 1RIHH 4HC1L 4P5KB 4FG6D 4YE4H 3QSKB 4PJDA 3B43A 3TPUB 4JO2H 3FAXA 2C7UB 1B6UA 2NY0B 4HAFA 2QKIB 5DD3L 4QRPB 3RGHA 4XBEH 5L2KB 1C5DA 2IADB 2CDFA 4KH2A 4MHHI 3DVNB 3T8XB 3HI5H 4I2XB 4K9EC 4HS8H 3M1BA 4HLZG 3BQUD 1I7TA 4ORZC 2F15A 4ZUWB 1G7IB 4WUUA 5C0RL 1FZMA 4D3CL 1NPUA 3GSNH 1EBPA 3FONA 1JK8A 5ADOL 4P9HC 3LKPA 3WJLC 1GOGA 4XRCA 1SHMA 1U42A 4U3CA 4IMKA 3CLEH 4TPRL 1ZLWH 1LO2L 3ES6A 2XFXA 1MFDH 4WEMB 4NO0B 1FGVH 1RUQH 2PTUA 3PL6C 1GGCL 5E5MB 4NO5A 2V6HA 2VOTA 5FA3B 3L3HA 4PG9A 4UUJB 2XZZA 3CC5B 1KIRB 5F9WC 1Q9LA 5JOPD 1ZV5A 3EHBC 3ZL4L 3TBYB 5J7CC 3TWCL 4NYLB 1HKFA 1LK2B 1P5VA 5ECJE 3T65A 1D9KB 3HMXL 4ONHA 1IEBA 1BREA 3C8HA 3T4YA 3TJEL 3GRWL 2O5XH 5D7IE 1FL6A 3ALXA 4DW2H 3CPLA 1U91B 5IM7B 5ILTL 5HYSB 2WK2A 3GM8A 1EZVX 3ZKND 1MCHA 2ZKHH 4J3WA 3O9WD 3QNXB 4DVRL 3UMTA 4Q9QL 2VDPL 1CG9A 2E9IA 1ZEAL 4JE4B 3E8UH 1QHOA 1GSMA 2NXZB 4JGMA 4G7YH 4POZD 1YEGH 2AJYL 1D3CA 3S35X 1KN2H 4O51A 1MCPL 3PXJA 3RP1A 5FOBA 4AEHL 2GTWA 2VJXA 5C0FA 1NCAL 4KXZH 2VLKE 1MJ7H 3RRQA 2NCMA 1J0HA 1UVQB 4HLZH 1V7ML 1E4KA 3VFWA 2X70A 1W8OA 1QNZH 4NDMA 3SY0A 3QUYA 5DTFB 4N8CH 3HC3L 5D1XB 3UJJL 5IVOA 2QHLA 4YJZL 4OLYH 1VKXA 1NCNA 3KPPB 3NCBB 3MRHB 2BVOA 3CH1A 2F5AL 4LLMB 1G84A 3DUSA 4XP1L 4LLYA 3VFTB 3WFBH 2B2XH 3QPXH 2ZOLA 4OTXH 4AMKH 5JW3H 3CCHA 3WDHA 3WUWB 3WLWD 4FQXA 5FA4B 4NQEE 5FUCE 3F5WB 3B3IB 4DAGL 3OJDA 4ZAKD 4MYWB 1V3JA 2ZOKA 1MRCH 1Y18B 5EORH 4X6DB 3FCTB 4E0RA 3GSNA 4AENA 4PR5B 5KVGH 4GG6F 5BRZB 4HS6A 3LAFA 4KY1L 4TUJB 1D5MA 4ELME 4U1HA 1X6LA 3SJVA 2R1WB 4YFLF 5KN5A 4KRPB 4OKDA 3HA0A 3AS3A 4K2UH 3RVWC 3W2DL 2HMID 2VLJD 2Z4QB 2CMRL 5FGRA 3VRJA 3WKML 5EC2A 2EDRA 4O9HL 4JHWH 3PGCA 4QXTB 3I9GH 4XTRC 3CLFL 3SE3A 4PJCF 2R56H 1JYXA 4Y4KC 4KROC 1IC4H 5DD5L 5HHMB 3I50L 5E2VH 2BOCB 1FFNB 4TN9A 3BSZL 3WMSA 4OD3L 2PW1A 4NM8H 1TTUA 1I3UA 2BP3A 3HE6B 1MPAH 1XZ0B 3BDYH 5AEAA 4FQ1L 2F58H 1KC5H 2ID5A 3HC4H 4MNGE 3VFGL 1EO5A 4Z78A 2D7MA 3GEWB 3NCYS 1U2HA 3QDMA 4M61B 1FYTA 2C1OA 2PR4H 3RZCC 1MQKH 2YPKA 3VXTA 4HHAA 2BVUA 1Q1JL 4PP2A 4IEFB 3OKEB 5ANME 2VLRE 4P3CH 4XC1L 4YBQD 1KNOB 1FZJB 5EZOH 1ED3A 2Z31A 3WHXB 2R2HB 4OCRL 3VCLA 3RWDA 5EFIB 2BNQB 3SDXA 4FQJL 4GT7A 4JFPA 3P30L 5GIRA 4UOJA 3DSNA 4GXVH 4E41B 4R2GC 3PWVB 4PJBF 3EGSA 3LS4H 4L4VB 1N5YH 4LNRB 4O4YL 2D0HA 4HT1H 5DRZB 5ALCL 3FQXB 5LCVL 3U6RA 4BSWB 5TDNA 4LCWB 2EEDA 2BY0A 5E8DL 1JPGB 4U33A 2DIJA 3UTSB 2PN5A 4ZS6D 5JIIA 3JZ7A 4F15B 4I48B 2GITA 4JQIL 1OVZA 5H94A 4L4TD 4DZ8A 4FZ8L 4ZUVA 3RJQB 5K9QI 4WFHD 1FSKC 4QRUB 1XEDA 4F58L 5DHXB 3P11H 4F37F 1A22B 4JFFB 3B6SA 4P57A 5AZ2L 5EN2A 5T3XE 3D6GA 5A40E 1FG2B 4NPYB 4ALAL 1H8SA 3HI6H 5LKNA 3RL2A 5I1AB 3AAZB 4JREB 1T04B 1N4XL 5FEBA 2NPLX 4UU9A 4U7MA 3IDUA 2O5YL 3K74B 4M3JA 5CEZL 2MHAB 1KXTB 3U1SH 1RD6A 2JK5B 3BHBA 4RA0C 3RUGE 4QNPE 3FZUD 1D5ZB 3CH8A 4KHXH 2ZJSL 3E6HB 3TN0A 3GIVA 3V6FB 5FM8A 3VMOA 5EBGA 4JN1L 4ZSOB 5GZNC 5D96C 1VADB 2DI9A 1E6JH 5JR1H 1IZJA 3RTQA 2E7LA 3QUZB 3O3AB 3IDYC 4X7DC 5A43C 4I5BB 4IOIA 2IQ9H 4LP5A 3U7WH 4PJ7B 1INDH 4Y4FB 3VI3F 3R8BB 4K71C 1GIGH 3MUY1 4WI4A 5EG6C 2HWZH 1H9VA 4I0PA 5LQBH 4RX4A 1RZIB 4MD4B 1C12B 1G9NC 3R1GL 1OAQL 1CICC 1NFIA 1PZ5B 2GK0A 1CN4A 3V5DB 5CD5C 3LIZH 3STZB 3GNML 5HI4D 4JAMA 1F02I 1HZHL 3HNTH 4LFHD 4PRAB 1JGVH 3SDCA 1IEHA 2O5ZH 2APWA 4HEME 4P2OD 4GUPA 1W72H 3PWLB 4M7KL 3TIDA 2V2XB 3P0GB 5ISZD 1MFCL 3KPSB 3F65A 4QRPE 1P6FA 1U8KA 4HK0B 5L2KE 1A7OL 2EYRB 1M7IB 1JTOA 2A6IA 3OGCB 4HUXA 2QQNL 2I26N 4X99B 2MFNA 4OM0H 2YUXA 1YEDA 4MB3A 4UIKL 2PO6C 3W0WE 4LSTL 3BWAA 1CDGA 4UV7L 2VISB 2DDQL 2DLEA 4UV4H 1T22B 4XC3L 1I3RA 2OYPA 3MRMA 2O61B 5GS1B 1QFUL 4N0FA 5B4MC 3O41B 2A74A 1QBML 5CSZB 4UT6H 5F7MC 3ORJA 3G08A 4HQQL 1KENH 1RJZA 4ODBD 5KJRH 1OAXL 3EOBB 1ZT1B 3MRIB 3BZ4A 1J8HB 4N0YH 4BH7A 4A6YL 4YDJA 4Z7WF 2P5EA 4UBDC 2FDBP 1J0JA 4PLJD 4QCIB 3AY4A 3DX7A 4WW2C 2BRRL 2ZPKL 1BMGA 5EIIA 5C2BH 2WINB 1NC4B 4LKXA 4GRWH 1C8PA 2ICEA 3L5HA 5GISL 1N6UA 1BZ7A 1JGEB 2GI7A 1LVEA 2UUDK 4JY5H 5I2IA 3D2UD 1OD7A 4OZHA 1VEOA 2IAMC 3MREA 4JDTH 5FYLL 3TT1L 3QYCA 1HILB 3QQ3B 4ZQKA 1K6QH 4J1UB 5BMFH 2GKIA 1I3GH 1KEGH 2BNRA 3GSWA 4CL7A 1BFOB 2EC9T 3WO3B 3JV0A 2Z8SA 1R3LB 5EH1A 3T0EE 2M26A 1WFUA 4LPVA 4KVNH 4NO3A 4PJGE 1XF1A 3O2DL 2I24N 1YNLH 4DFHA 3LQAC 3PHOB 1EEUA 1WZ1H 5C08B 5I30H 1EEZB 2CLRB 3K81A 5E6YA 4X4YB 1HINL 1KTLA 5D1ZC 1A6AA 2GEEA 2YD7A 2RGSA 5JMOC 4CU7A 1K8IB 3C6SB 4GAGH 4Z8FL 4JFYA 5IVZB 2DKMA 3LS5L 3U83A 4PRPB 5CJQL 4PJIF 1TPXB 2KQNA 1RV6X 3OJVC 1DQLH 5HHOE 3QWQB 1AO7A 4PJAF 5TDOA 5HYSG 4RFNC 4LBEA 2FZ3A 3IFNH 5C0AB 1MRFL 3MRGA 3M1BB 4PBVC 4WTXA 1I7TB 4IOFD 3QNYA 5KSUA 3ZKSD 3TF7C 1RMFH 4WUUB 4L8DA 3HKFA 5IV2A 4XCYA 4Y4HC 1JK8B 4YNYA 3LKPB 4XRCB 4LPTA 5H2BB 3CSPA 2IJ0C 2V5SA 1RK0A 1T4KA 1A14L 3I2CH 4OIIL 1SJXA 3VJ6A 1OAKL 4MX7A 5ESQB 2XFXB 4F7TA 1BIIA 2DM7A 3DMMB 4P5MA 3CAFA 5CP7A 4NO5B 4NQVB 1RJLB 2BDNH 2DQDL 4JKLA 3L3HB 4X6DE 2VN7A 2MCG1 2W9LA 5D5MA 1I9IL 3WIFA 3U46A 1LNUA 3ARQA 1CE6A 3LRHA 1CDIA 3PG2A 4MXVE 1BX2A 2P48B 4TNVF 3CXDL 1FCGA 5GRUH 3DSFL 3DJ9A 4ONHB 2IC2A 3T4YB 1KIPB 5EZIH 4PJEF 2M8XA 4NHCL 2BSTA 4PRNA 1NEUA 1JHKH 3GBML 3WUWG 5BW7A 3QP3A 5HHME 4KDTA 5FF6B 2BXZA 2Z0BA 4X8JA 1MUJA 3BRFA 1U6AL 4S1RL 5BS0A 1CG9B 3IT8D 5I18H 5JOFB 1CFBA 3OKDA 4XP9H 3D0LA 3GKWL 4IRJD 2X9XA 1H8NA 1LO3L 3HAEH 4DKEH 4O51B 3I02A 1KULA 3X11A 1NUFA 4PJHA 4F8TA 3I85A 4HIXL 5FOBB 5FGCB 3G5ZA 5C0FB 3FO0L 5MEQA 3MXVL 3IF1A 4PB9L 2GJZA 3CMOH 2ZUSA 3VFWB 2X70B 2YPLD 4NC1C 2HYMA 4NDMB 4NZJA 3QXWA 3WO4B 3QUYB 2EH7L 5DDHA 2BNQE 3SPVB 2IH3B 2X4PA 3TLRA 4AIXA 5EUKA 1GCFA 1NDMA 1C1EH 4UT7L 1UYWH 2DIAA 3ALWA 1VKXB 4E41E 3HPJA 4JHBA 4WEBL 3HZYB 5JIHA 3HTLX 2BVOB 1GXEA 5FYKD 3UAJC 3DUSB 3AUVA 4LLYB 1YYMH 3IKKA 5EU6A 3G5XB 4WTZG 5SWSA 3SDAD 3SQOL 2VE6A 1PG7X 3S37H 3V6BR 3IFPA 3CCHB 3ZKQD 3BGFC 3IDMB 3DHJA 4WWKA 4LCWE 1CDUA 4BZ2H 5IGXH 2ZCLH 1R0AL 1WTLA 1LK3H 3UTSE 3ROOB 5D8JL 3TIEB 1RHFA 5CP3A 4LEXL 2ZOKB 5C0IB 3ARED 1YDPA 1BF8A 4E0RB 3F58H 4AENB 3L1OH 5C0JB 4HS6B 5LAXA 3BAEH 4OFKA 4U1HB 5IJKA 3SJVB 3RIAF 6FABL 5HHVH 4NWTH 4G8GD 4OLWL 4HWUA 4JFFE 2YZ1A 5I1DA 4WFFD 5D71L 3U2SA 2EDOA 4BKLA 4S1DC 4D2NA 4HMEA 1K3ZA 5DR5H 4KQ4L 4MA8H 1OY3B 5JUEL 1I85A 3VRJB 4R4FL 3ELAT 3BN9D 4KVCH 5EC2B 4TOYL 3PGCB 3U4AA 1NLDH 1XF2B 3S36L 5DSCA 1A4JA 3EJZC 1YY9C 4TULH 1FDLH 3I3BA 5J13B 4P5TD 1T1ZA 1V7NH 4I8DA 1ND0B 4AYFA 1BD2A 3FB8A 2BERA 4RGNB 4ZSOE 4RWHA 3QUMH 4Z78B 1FYTB 4QXUH 1YEIH 2MPAL 1P4BL 2YPKB 3VXTB 4XH2B 3O3DA 3UTPE 4YXHH 3V4PL 4FXLA 3QNZA 4HHAB 4FFVD 2AQ1A 2F53A 4ZOBA 4PP2B 1NGYA 5FM5O 4PJ7E 1QZ1A 4FFYL 2OK0H 4NT6A 2X6MA 5E00A 4UTBH 3CK0L 3H9SD 1QBBA 2BY2A 4MAUH 2Z31B 4OF7A 5BZDA 3EOTL 4XVSL 3RGVA 3VCLB 1JNHA 2F54D 2Y6SC 2HT2D 2VXVH 3SDXB 1FFOA 4YLQT 4DKFH 4JFPB 5I8KH 5GIRB 3NIFE 4OLZL 5ITFB 3L3IA 3LCYA 5C0GB 1CXHA 3TT3H 4Z0XA 3QHFH 2OCFD 4CJ1A 3VRLE 3QIBC 1HI6A 3HR6A 2D3VA 4YDLB 3O6ML 5CILH 2FO1A 1R3JA 2YK1H 3E3QE 3OR7B 4XPGL 5TDNB 5GGTL 3QQ4A 1WWAX 5FCUH 3NFSH 4Q0XH 4LK4A 3RIFF 1XCTA 3JV6A 3KPSE 4ZFFA 1SEBA 3LEVH 4U1MA 2BHUA 1A0QH 4XNZB 5DJAB 3T0AA 1EDQA 1KGCD 2GITB 3QDGA 4JDVA 5H94B 3X17A 5IJVA 4QY8A 5ADPL 4Z7QF 4ZUVB 1DJSA 4K9EL 1OT1A 5IBUB 2EDQA 5KS9B 1IC5H 5BVPL 4LGSB 3V6OA 1ERNA 3B6SB 4MLSA 4P57B 2B4CH 4RFOH 3MA9H 1PEWA 4YZFF 5B39B 1FFQA 4P9HL 2FHBA 5DUML 2VZ1A 2X05A 4UU9B 4S11A 2P24A 2ICWJ 3D69A 3VFNA 3VXMD 3DRQA 3MRLA 1FL5B 3BOVA 5IB4A 3SDDD 4GAJH 2XA8L 2AV1B 2IQAA 4YHLL 2G5BA 3GIVB 3QI9C 1CDCA 3STBA 1BZ9B 4F57H 5HGDA 2RCSH 3UTOA 1MELA 4D0BA 2A77L 3RU8L 1AGDA 2DQTH 2AAVA 3ARTA 3VGBA 3K8MA 5ICYA 2IBBA 4MMXC 5FFLA 1CI5A 2HRPH 4JY4A 1RIVH 3AMKA 2UVEA 3VH8A 4QHLA 3HZMA 4UMGA 2WLYA 1S7TA 4HX1A 2A1WH 4X0KB 1YMHB 4G7VL 3HE7D 4BJLA 3TFKC 5GRVK 3WJJC 4AIZB 2YR3A 3H3BC 5FYJL 1IQDA 4WV1A 4KV5F 3QUMA 1UQSB 2IBGA 4JO3H 5AWNL 4MNHB 1NFIB 4P2RA 5FYKL 2GK0B 3U9PH 4Q6IB 5I1CL 3TVMA 4BUHA 4G6ML 4MAYD 3AGVA 1VHPA 3NA4A 3MV11 3SDCB 3WNLA 3I3DA 5DD3H 4L29A 4PRPE 3TIDB 3BXNB 3JV5A 5MP6H 3VFSA 1EGJL 3B8SA 1EMTH 1PX4A 3CX5K 2K7PA 4KXZI 4D9LL 4FMKA 1KIUA 2DB8A 2R69H 3HB3C 4EEEA 4HUXB 4RISH 5C0AE 1S7UB 1YEDB 5ADOH 43C9A 3SDYL 3JV4A 4LLVA 3T3ME 3I6GB 3WEXA 3MRMB 4TPRH 5CJBA 1I8IA 3TNMA 4XBGA 1MI5E 3NCFB 2UV3A 3HMWL 3UYOD 3B9AA 4YHYB 5E7BA 1VFUA 3P9LB 3G08B 2X9WA 4GBXC 3TCXA 4P23D 1UH4A 3RPIA 3WFCH 1WISA 2KPNA 3WN5B 4CAGA 3BZ4B 3S35H 4BH7B 2QR0A 1QFWM 2NLJA 5GGRB 3TWCH 3VW3H 3GJFA 3DX7B 1Q38A 3HMXH 2ADGB 3MUGB 3NA9L 3WDIA 3GRWH 3VDAA 2BY3A 2BZDA 4LKXB 5ILTH 3MFFA 2ICEB 4POUB 1D6VL 5I9QC 4Y2DC 1BZ7B 2E5EA 5E03A 5ISZB 3MLTA 3Q0HA 4OZHB 3TEUA 4ZQKB 4JM2D 1QBLH 3RWJA 3UPAA 2BNRB 3GSWB 2VDPH 5EOTA 1ZEAH 5MEOA 4R97C 1XGYL 1RZ7H 3O4OC 4NO3B 2P4AB 1ZVSA 1MHPL 2AJYH 4JQXA 2A9NL 5E0QA 4WI5A 3SQBA 1MCPH 3VDCA 4E5XA 3VD4A 2I5YL 4DN4L 1KTLB 5GGSB 1BOGA 1UXWA 2NY1C 1YEJL 3VXSA 4KJQD 4QXGL 1V7MH 2JB6A 5ID1A 5A1AA 3TYGH 1A6VL 4HUKB 4LHUD 4Z77B 4JFYB 3ARFD 4GRLC 4MJ5B 5FGCE 3Q5YA 1P7QA 4GAFB 4WCYL 3LD8B 4YGVA 2W07A 5EU3A 1HE7A 5B38A 3H7BA 3EYUL 5JOPE 3GSXB 5TDOB 1YY8A 3MLYH 1JNNL 4LBEB 4PJ8A 3QXVA 5C0ND 4FTVA 4HC1A 2FZ3B 5C09D 2F5AH 1CGTA 1WBYB 3AM8C 5KSUB 3CFEB 3CFKA 3FO2A 4OI8A 5IV2B 2AERT 1NBVL 4NM4H 5DQJA 4XCYB 1LDSA 4LASH 4DAGH 4EI5A 1S7QA 1DFBL 1RK0B 1J0IA 2DTSA 1ORSA 4YHOH 3OKLA 2Y7QA 1T4KB 4ZYKA 5A3ID 1FIGL 1NMAL 5F70A 5I17A 3VJ6B 3NCJH 4ODTH 4MX7B 4F7TB 2VXTL 1F00I 4I0KA 4P5MB 4K3HA 43CAA 3PWJA 3WXVH 4XGZB 2WWMD 1OHQA 2G60L 1S5IL 2R23A 5CIPH 4CVXA 5KVEL 2OJZL 5D2LF 5D5MB 2XTJC 3W2DH 3WIFB 1KJMA 1LNUB 3U46B 1HWGB 1CE6B 2G75A 2CMRH 1RFDL 1BX2B 4GAYA 3CLFH 1H3PH 1WF5A 4QTHA 5DD5H 1L9MA 1I8KA 5DA4A 2BSTB 4PRNB 4P2QD 1GGBL 4L3ED 1HYSC 2QADB 4XVTL 4FQ1H 4WI9A 1IAIM 3HMXA 3RVXC 3GRWA 4X8JB 1K5NB 1MUJB 2F8OA 4PUBL 4RMQA 4PGZA 3VFGH 5MHSE 3AS2A 5J9PB 5BS0B 5C1MB 3PWPD 1XF3A 3U48A 3OKDB 2J6EL 3S3JA 1B2WH 1E4JA 4LVOB 1INQB 4HXBH 1VFBA 1OTUC 3RY5A 2CKBL 3I02B 3X11B 5JIPA 2OZ4H 3U82B 1J86A 3ARGC 1I8MA 3P0VL 4U3XA 1A8JH 4OCRH 5MEQB 1KCVH 1DQTA 4FQJH 2GJZB 3LKNA 4JJHA 2B5IC 1G7JB 3V8OA 1MH5A 3BPNB 3IFLL 5EBLB 4CDHA 4ZFOA 4QHUB 5DDHB 1NAML 5DJCA 2OX5A 4PY8J 3ARZA 5EUKB 1NDMB 5F6HI 1B4JH 5DEFA 3HPJB 5ALCH 4MGXA 1G9NL 3KLSA 5LCVH 1A7PL 5E8DH 5BO1L 2A38A 4H5SA 5SWSB 3NCCB 3IFPB 4ONGL 1T5XA 3QZWG 1NFKA 2HKFL 3REVA 3VXNB 3X12A 3TH4T 4APQC 5L6YH 1LO0H 1WEJL 4FZ8H 1VENA 2NTFA 1T2QH 4R4ND 3L7EA 5DUBA 4MXQC 5AZ2H 3CFDA 4JZNB 3DO7A 4HZAA 2D4DA 4OBSA 1WWWX 4YC2C 2BVYA 1OSPL 1XF5B 5FK9A 3P73B 5KS9E 2PXYD 4WY7H 1MCRA 5I1DB 4WU7B 2ICWA 1F4AA 3P40A 3L7FB 4BKLB 5DFVC 3U2SB 2O5YH 1NBZA 3NFNA 4OFYD 4LSDA 2WBKA 5CEZH 1CLYH 3PGDA 1R24A 2R1XA 1LD9A 3K4ZA 5DSCB 3RKPA 1A4JB 2ZJSH 5CSGA 1QHPA 3BRDA 4KK5C 5SWQA 1D6EA 2KZ1B 2A0LC 1HXMA 1FNFA 2FHFA 4WW1B 1JF6A 2BSED 3RWCA 3DV6A 3U0TA 2BRQA 5HPMA 3KLHC 1M05A 4M6OH 4LVNC 3H42L 2V17L 1B3JA 5D7LD 1LDPH 2NR6D 5K9KA 4ZXBA 3SHSA 3KPMA 3O3DB 3UEZA 3OAUL 3CU1A 3HR5A 1CL7I 4LSUL 3QNZB 4QHKI 5IUSA 5LGKA 2F53B 1BFVH 2AK4A 3EDJA 3LY6A 4KI5F 3AREB 1NGYB 5B39G 1HK6A 5HGBA 2Y5EA 4HIJA 1U8LB 4MA1C 3MC0A 2DRUA 5L2JB 5TJWK 1A6PA 1IZKA 3R1GH 3V4VL 3RGVB 2JTDA 3GNMH 2EDLA 3TYFA 2AEQL 1TJGL 4OZGF 1EO8H 3WNNA 2J5LC 2P8LA 1YC8A 1GOFA 3D18A 3NN8A 3I75B 4FQHB 4JFZL 4K94H 5D2NC 3LQAL 4NGHH 4CNIB 4Z0XB 4UB0L 4PD4K 3QG6A 5GGQL 1HI6B 4JB9L 3QIUD 3MBXH 1MFCH 1UB5A 1DUZA 2QSTA 1AGEA 1F4XL 4KK6D 4BQ6A 4RMVA 4IIQA 1XGRB 2UWEF 3B2UC 3IGAA 4Z0BH 3QQ4B 3DPBA 4UIKH 1IAOA 1XCTB 3JV6B 4LSTH 4ZFFB 5KZCB 4UV7H 1NMBL 2DDQH 4G8EA 4M5YH 4XC3H 4OB5H 4XPHL 4JDVB 3QDGB 5IJVB 4QY8B 1QFUH 3C5ZD 4GXUN 4MA7L 1CVRA 4PJ5A 4FABH 3BZDA 1FL3A 2MQCA 5HVGB 4HQQH 4NKQB 5TFSH 3ULVE 2X7LA 3PNWA 1UA6L 4Y19A 2OP4H 5GS0D 2ZUQC 4HS3A 1JUFA 3F7YA 5D6DC 3D87B 5EA0H 3ZT6A 2P24B 3DRQB 3MRLB 5FM5M 4R90L 4R8WL 5IB4B 5BQ7B 3MV7D 4PJCE 4KK8C 4HXAL 4WI3A 2ZPKH 4OLVL 4NKDA 1P4IH 2IQAB 2MNUA 3H9HA 3W9DB 4QHNA 4PIRF 3PP4L 5I1JH 1MNUL 5GISH 5HGDB 1XAUA 4D0BB 3MQIA 2DBLH 1AGDB 2CQVA 4XP6L 1A5FH 4HMDA 5C3TA 2HTKD 1B4RA 3V52L 5E2JA 3BJLA 4JY4B 5IF0A 1JBJA 1ZHBB 4FQXC 3UTTD 4X6CA 3VG0L 5ISZE 4KZDL 1EZVY 2NY7L 3LQZB 1ZHLA 4QHLB 5D7JA 3VH8B 1EUTA 2Y06L 4HX1B 4N5ED 2H3NB 2VYRE 1ZE3C 3CXHK 2LE9A 2UY7A 1S5HA 1J8KA 5I19L 3MZTA 4YBLB 4WUKL 1HINH 1IFHH 4EQ3A 2CSPA 1G9EA 3L95B 1MLBA 4XHJC 2EYSA 4Z8FH 4OSUL 2F74A 3TVMB 5CJQH 3T0VA 4KUZL 4NQCD 1RHHA 4GLRH 3KYKL 4GW1A 2HFGH 2F5BH 4XXCA 5GRJL 1ZLVK 3BKMH 3WS3A 3VFSB 1MRFH 4U3HA 4MQXD 4KJPC 4LU5H 4X7SH 1BF2A 5GJTH 5CFHA 3C6LD 43C9B 1PDKA 5EU4B 5CZXC 1YQVL 3JV4B 4LLVB 5GPRA 1DBKH 3BKYL 5T5NF 4WGWB 4LRNL 4HFWA 3MNWA 3WEXB 2D03L 4ACPA 1A14H 1U8NB 2OJEA 1F4YH 3RHWF 5I0ZA 1I8IB 3TNMB 1OAKH 4XBGB 1F6FB 1TQCB 4LPWA 2GJ6A 3Q6GH 1YPZF 4ZTOL 2QQKL 4FXKB 4PRBA 3BDBA 3L3GA 3RPIB 2VLJA 3NVQA 2YD5A 3V2AR 2NQCA 4POYA 4X5XA 1I9IH 4L1DA 2QR0B 3NCEB 3HNSL 1F42A 2NLJB 2IFGA 4I77H 3PQYA 2XT1B 1NCBL 4NZUL 1BQLH 1UZ8A 8FABA 3QA3A 3BPLC 2ZNWA 4LSPH 4MAYB 4KTEH 3LKRA 2CXGA 4I3SL 3MJ9H 4B7LA 4A6YA 3MFFB 2VNCA 3LKQB 2VDQL 1ZWIA 1NUDA 4Z9KB 3MLTB 1DQDH 2GHWB 3FT3A 3S5LB 32C2A 3G6AA 1OPGL 4S1RH 2MTPA 2ADJA 2BX5A 1RK1A 3CVIL 1UACL 4TTDD 3OHXA 1MCQA 2HP4A 4G9FD 5FGSA 2AEPL 5GRYA 1ZVSB 2EXWC 3GKWH 2ORBH 4M9OA 4G8IA 1TETL 2VDLL 3V4UH 4IJ3C 2FX9L 1BOGB 1UXWB 3EJYD 3SE8H 2VQ1B 3TGXA 3FO0H 2YA2A 3VXSB 3O2DA 5INDB 3U4BH 3MXVH 2JB6B 5ID1B 4U1GB 3QPQC 4I3RH 1P7QB 2GY7B 2EH7H 4LAQL 4Y1AD 5EU3B 1FLRL 1EVUA 5E1HB 2ENYA 3V0VB 5B38B 3H7BB 4UT7H 3D0VA 3MFGB 1YY8B 1DBBL 4PJ8B 4WEBH 2DLTA 1RULL 3QDAA 4FTVB 4LSRH 1CXLA 1I1AC 2JJWA 2APVA 5I1IL 4K3JH 3BX7C 3CFKB 1FVEA 2CH8A 3FO2B 1CXIA 5DQJB 4AZ8A 5CZVH 2YD6A 1R0AH 4I18A 2YEZA 2W9EH 1S7QB 4JM2B 5SWSE 5IBLC 1ORSB 1SYSA 1X5LA 5HDQL 4LEXH 2PYFB 2Y7QB 5DJ8A 4X8XA 2OTUA 3MGOA 2XRAH 5I17B 5JQ6L 4QRRD 3NCMA 1CXEA 2LTQC 4DWHA 4MVBD 3MR9A 3DI2B 43CAB 3PWJB 3L5JA 4I0PC 6FABH 2D7TL 3H0TA 2R23B 5E6IA 4CVXB 1KTDB 1ZAGA 2QSVA 3F7RA 3RQ3A 4U1LB 3N1MC 3HZVA 2G75B 3RWGB 5JUEH 3TZVB 1ZGLA 3T3PE 3ARFB 4JKKA 1G7MA 3C8KA 4UNTA 2R0WH 1KJ3H 4GAYB 4JRWA 2DLFL 2R2BB 5D72L 2ERJB 4QTHB 3O11A 3PWUA 3QG7H 2YPLE 4Y5VA 5C09B 1N0XL 1KB5H 4PRHA 1X5AA 3KYNA 1B9ZA 4EN3C 1V8HA 3A6CL 3EZJB 1QYGL 1BAFL 3ARBC 4JFEA 3BI9X 4DTGL 3KR3L 4CN4A 4EIZC 2YC1A 1XF3B 4KC3B 1K8DB 4OGZA 4E9LA 1QFPA 4Z7UF 4AEIL 2OS7A 3TCLB 2IPTH 4FFYH 1KBGH 2R29L 4ZODA 4XNYL 2HJLB 4U7KA 1UKTA 4LSVL 2F53E 3QUXA 1Q94B 2E9WA 3ARYA 1NEZA 2H2SD 2EIZA 3C09C 3LKNB 4PV9A 1H3GA 4OLZH 4PJAE 1MH5B 4KHTL 4ZOEA 1TVHB 4CU6A 4JFDD 4ZFOB 5DJCB 4G8GE 5FUCC 2J12B 3K7UA 2Q20A 5BXFA 3WLBA 5T3ZL 5DEFB 3UPCA 1ZT7A 3HUJF 4NN5C 4AH2A 1EXUA 4V1DA 4ZD3L 3TJHC 5DUPL 2Y25A 2FD6H 1JZ4A 4P2QB 2AKRA 4H5SB 5CUSL 3EDDA 2WBWB 5FYJU 3SE9H 1T5XB 2XY2A 3DRTA 1G7PB 1A7RH 3X12B 1MFBH 1QLEL 3PV7A 2OL3B 5DLMH 1M6OA 3WE6B 1A2YB 1CD9B 5FYKU 2NTFB 3C08H 5CJXC 1TNMA 4HKJA 3BVNA 4OZIF 3L7EB 1S7SA 1HHKA 2UYLA 1E4XI 1FPTH 2F8XC 3CFDB 5B22A 1I8LA 2FLBT 1FNSH 5HYJA 2J8HA 5FK9B 1MEXL 5DJYA 2X4NA 3SKNB 5DS8A 4TVPL 1SMAA 4WWID 4M48L 2WUCH 1IGJA 5DRXB 1AR1D 1WAAF 1NBZB 3NFNB 2X4TA 1A6UH 1WUNT 5JHLL 3PGDB 1LD9B 1OSZA 3H9SE 3RDTA 3IVKA 3M45A 4XPFH 1U2CA 4M6AA 5ERWA 5HI3C 3VWJD 5SWQB 2A77H 3RU8H 3K1KC 4ONFL 5C71A 5HYIA 2R1YB 3RWCB 3U0TB 1VSCA 1AP2A 4U1JA 1QSFD 5HPMB 1M05B 1OP9A 4ELKA 4RDQF 3MBED 3K46A 4ZO9A 2H41A 2AQ2A 3S3SA 4C57C 4I4WA 1KSRA 3HR5B 2AK4B 1A7BA 2YOCA 5HGBB 1KGCE 1IM3A 4XPBL 3QDJA 2FX8H 5AWNH 5FYKH 4M62L 2GSGA 2PXYB 5F9OH 4NQDA 3TYFB 4I13B 5I1CH 4JO4L 4X6EA 3JUYA 1CR9L 2P8LB 2XQBH 3CFCL 5FXCH 1IAKA 1VERA 3NN8B 4XVUC 1QFHA 2VSDA 3MACH 4GSDL 2X1XR 3H3PL 2NXYD 1A1NB 3QG6B 1S78D 3OSKA 1B0RA 4OGAD 1S3KH 1KOAA 3MA7B 3VXME 1MAKA 3LEXB 2ZP0T 2WP3T 4XPTH 3RY6A 4D9LH 2VDNL 3K8LA 1AGEB 1S7VB 5JO5A 2E27H 2HTLC 1IAOB 5J12B 4KPHL 3SDYH 5I8OL 4G8EB 2LFGA 3FQWB 3IJHA 3LSOA 5LVEA 5GGTA 2KQMA 5L0QB 5C8JA 4PJ5B 5DO2D 5BV7B 1FL3B 2NY3B 1BM3L 3INUH 1S9WB 5B8CB 4AG4H 2FHCA 2BSRA 3V9FA 1FFPA 2X7LB 4PBXA 4Y19B 3SBWC 4OLEA 4FP8L 4HS3B 1JUFB 3QWRA 4P4KC 2E6PA 3A67L 3KJ4B 1EJOL 5CEXA 1ZLUH 1CGUA 1L9NA 5C92A 4CMMB 4XPAH 3WJLA 1YEFL 5JLZA 4NQSA 5E08H 4QHNB 5EZJA 4WO4C 2QJDA 1QRND 3UROR 1PEZA 1XH3A 3ARDA 5HPOA 5JHDB 3T08A 4FRWA 3ZYIA 4OUOA 3PL6A 4ZFGH 1S7RB 2RJMA 2MMXA 1NL0H 2Q76A 5IF0B 4WWKC 4TSBL 4YK4C 1NSNL 4QOKD 5GSRA 1G6RL 1ZHLB 3EYVA 4HFUL 5D7JB 4PPTA 1U3YA 4P3WA 5IMLB 3G6DH 3QCUH 2I07A 4K3DH 4XP4L 4TTGA 2E8ZA 5I1KH 2R4RL 2W38A 5JPMA 3PIQA 2I5YH 5I71B 1XIWD 3KAAA 1NGQL 1KT2A 2VITA 1IGIL 4QXGH 3CZFA 1MLBB 2EYSB 4K07A 1TJHL 4G6KL 2P45B 1RZ8B 4IDLA 3BKJH 1BBJA 5BJTA 1RHHB 1N7MH 2EIBA 4GS7C 1ACYL 4XAWH 4Z7VA 4GMTL 3EYUH 3MV7B 3QT2A 3RWIA 1ZK9A 3PABA 3WS3B 4KKLC 1SY6L 3STLA 1E27A 1MAMH 3SGEI 3S5LG 4IMLA 4XNUL 3UTZA 1OGAA 4HUNB 4OFDA 4FTVE 3AVEA 5HVHB 1KG0A 2HJFA 2V7NA 1EGJA 1ZLWK 4RZCA 4PJIA 4Y16C 1PBYA 3MNWB 3L9RA 3HZKB 2Y23A 3E1F1 2QLVB 4TUKL 4EKXA 5E8OA 1QG3A 3FO1B 3WNKA 5J57B 3OAYH 1AKJA 1UADC 4FQIH 5ACLA 2AJVH 1U9KA 3S34L 2GJ6B 5E8PA 1IAIL 3JUZA 3KLAB 1Q72H 2YD1A 3NZ8A 2P8MB 1MWAH 3L3GB 2G60H 3UBXA 1S5IH 1K4DB 4PGDA 2D9QB 4NFBA 5H37G 1I4FA 2PUQT 4X5XB 1X3DA 4UTAL 2BFVL 1U8JA 4M7LL 2LU4A 3NTCL 5F21B 1INEH 2VXQL 3PQYB 4HPOL 1R3HA 2J4WL 5KSAD 4DFIA 3MRBA 1UZ8B 3QA3B 1UT9A 2FIKB 2VL5A 1KB9K 4RCAA 3RZCD 1JPSH 4L3CA 3LKRB 2HVJB 4N1CA 3TO4D 3HHRB 4OCSL 1LEGB 25C8H 4FOMA 3T0EC 4A6YB 4HUVA 2NYYC 3O3BA 2BOBA 1I9RL 4HWEH 5C07D 2X4RA 3MO1A 3QFDA 4Q2ZA 3FT3B 1N5AA 2X5PA 3G6AB 4PUBH 3SO3B 2R9HC 2EH8L 2AJXL 5C09E 3FOLA 1RK1B 2OBGA 3D85D 3C6LB 4BSJA 2VXSL 5CSBA 2SEBB 1R3KB 1FAIL 3C60C 4EOWL 3LH2H 2VMFA 2ZG2A 1JYWA 4KV5E 1TVBB 4NFCA 4PJEA 3IS1X 3V6OC 1G7QA 2F54A 4LCYA 5IB3B 4F3FA 2HRLA 2APFA 3P0VH 4Y4KA 4K8RD 3FT2A 3LRGA 1VCAA 4N0UB 4LHUG 3VDBA 2VABA 4XMLH 3BP4A 4DQOL 3IFLH 4J6RL 3P0YL 5L8LB 1B6DA 3IAQA 3DYPA 1MFAL 5E1AB 1JYNA 3D0VB 2NZ9C 3O2WL 4QRQA 2ED8A 4K3GA 3VWKA 1G9NH 3BZEB 1WCBA 4B0MM 5BO1H 4FQ2L 2MWCA 1IGTB 1FVEB 2DQIL 4HIHA 4ONGH 1JFQL 4LKCA 4NJAH 3FN9A 2IANA 3BT2L 1KN4H 2HKFH 5J11B 4I18B 5B3JE 3FQNA 4YGAB 2YEZB 4P2QE 3ETBF 5H37H 1WEJH 1MCLA 4ELMF 3D3VA 4I3GA 1QKZL 1SYSB 5DJ8B 5DYOA 3MLSH 4PGBA 4JRXA 1S9YA 3KXFA 1ZHNB 4ODHL 2WBJD 3MR9B 4OD1H 2LVEA 1OSPH 3H0TB 3TA3C 3RVVC 3VFUA 1Z3GL 3SDDA 5I8CA 3UJIL 2ESVA 3FMGH 4Y2OA 3C8KB 2WV3A 2BJMH 1ZANL 1FNEA 3WHE0 4Y1AB 1MAJA 3MOAL 2I27N 3KS0J 2G2RB 2G9HA 4Y5VB 4LEOA 1JE6A 3WD5H 1CTNA 1FVCA 5ICZB 4QO1A 4PRHB 4H88L 3KYNB 5SWZA 5CMAA 1Z9SA 2BY1A 1KLGA 2VAJA 2VDKL 5CD5D 1WVZA 1F5WA 1NC2D 2V17H 4JFEB 5GZOD 3QFJA 3HE7A 2YC1B 4MS8C 4HH8A 3VG9B 2YS4A 3JTSB 5TDPA 5IMKB 4LSUH 4X6FA 1DBAL 3GSRA 3EYFA 5DK3A 1S7WA 3Q6FA 5F88B 1JF5A 1MCOH 2CLVA 2GW5A 1DVFD 5LGJA 4MHHG 3R4DA 4RMTA 3QUXB 2FJHA 2J6EA 3V4VH 4K55A 1UWXH 3GO1H 3CDGA 3RVTD 2WIIA 3HI5L 4HS8L 2CKBA 2AEQH 3ILQC 5IWLC 2YXFA 4PV9B 2W91A 2GT9A 2DJSA 2AP2A 4XHQA 5E8EA 1OF2B 5I74C 5BXFB 4LVHB 3WLBB 1SM3H 3KPTA 4CJ0A 5IMOA 1ZT7B 4KMLB 4J3UA 3O8XA 2LABA 4AH2B 1EXUB 2WW8A 3CLEL 5ESVA 4KJYA 4X4MA 1NAMA 3O6FD 1QLFA 2AKRB 2Z9TA 1MFEL 5IEKB 3THML 1W2KT 2HT3D 1FGVL 1RUQL 4U0RC 4XNQB 3DRTB 4LQ1A 1ZA6A 4XPHH 1CICA 5C6TH 2V2WA 4JRYA 4JREC 1S7SB 1HHKB 4JQXC 4HEPG 2UYLB 5HD8C 3I3EA 3KPLA 1MIML 4PP1C 1GPOH 5HYJB 4PJ5E 5D7LE 5DJYB 2X4NB 4G42B 5DS8B 2O5XL 3RUGF 2Z93A 3QHZH 4DW2L 4QNPF 1A3LL 4M7JH 4LMQE 3VFMB 4R90H 5DJDB 2CUHA 4HXAH 1X7QB 2WWKO 1FH5H 1MJUH 2PO6A 1I1RA 5KANG 3RDTB 4ZOCA 4ZPTA 1AC0A 4JFDB 2EZ0D 3PP4H 5ERWB 1MNUH 4Z6AT 5EOCH 3GI9L 1IL1A 4XP6H 3QQNA 3OWEA 3OPZH 1MHEA 1DQQA 1F8TL 3V0AC 5EO1B 4U1JB 1KN2L 5JHDE 4K8RL 1R3IH 2NY2D 3VG0H 4NN7C 2NY7H 4YQXH 2NW2A 3IDIA 4QEGA 2Y06H 3BIAX 4I4WB 4S0SD 1PAMA 1QNZL 4N8CL 1ONQA 4OLYL 1KLUB 1ES0B 2JIXA 1UWEH 2NX5D 2EDNA 4NQDB 4PRID 4BM7A 1IAKB 2B2XL 3KYKH 2Y9RT 4JHZA 3QPXL 4OTXL 4AMKL 5JW3L 4HJGA 2I9LA 4P3DB 1Q0XH 5C0CA 1OM3H 1O7VA 5T1KA 1S9KC 3ULUF 3F62A 4MD0B 4EDXA 3FJTA 1OWWA 3MCLH 1SVCP 1MRCL 3MV7E 5EORL 2JJVA 5EIVA 5KVGL 2R8SL 2RBLA 5D1ZA 4D0CA 1W0YT 1O0VA 5A2LH 4DKAA 1HHJB 3IJHB 2D03H 4JPKH 2VERN 3RI5K 2NY6D 2P1YA 1HIML 1T5WA 3MJGX 3UTTE 4R7NA 5TE4H 5K59E 1P6AB 1MVUB 3IDNB 2BSRB 5MERB 2NY4D 3RA7L 2GJ6E 1IC4L 3KS0H 2AGJL 3QIWC 5IKCA 2UZIH 3HNSH 3SEPA 1EA9C 2DM2A 1MPAL 3RKDD 2OTWB 2XZQL 4Y4HA 1I7RA 4I3SH 5T3XD 5EZJB 3PQYE 1KC5L 2FWOA 1F3DJ 3HC4L 1XH3B 2PR4L 4PGEA 1MQKL 1PSKH 3P2TA 5DD1L 5B21A 4NQCE 1QLRB 4OQ1A 4PTUA 3PL6B 3BPCB 2YBRA 1PY4A 1NJ9A 5TF0A 2YA0A 4FXGA 5FO7A 3CVIH 1GC1L 1KELL 1NBYB 1UACH 5EZOL 5F9WB 5MEND 1ZXQA 3EYVB 4PY7A 2DJUA 2AEPH 1DQJB 1VFAB 4TSAL 3WBDA 3ZTNH 4GXVL 2MCPH 2VDLH 3C9NA 3N85H 3QH3B 1VB9A 5JPMB 3PIQB 3IDXL 1WIPA 3IJSB 4HUWA 5FYLE 4OZFH 4R9HA 1N5YL 4Z18A 1KT2B 2VITB 3CZFB 2AV7A 4OZGE 3KPRA 5C6PB 1ZHKA 4XMKL 1KPUA 4JG0H 5F3HA 3W9EA 3C87A 5E99H 5F7YC 4LAQH 5BJTB 4U6YB 2ICCA 4N0UE 4PJ9C 1FLRH 4Z7VB 1YC7A 3RWIB 3PABB 3RNKA 1DBBH 3OB0H 3DUUA 5D1QC 2UZXB 1E27B 2UWEE 5L8KB 1QRNB 1CF8H 2V5RA 4IMLB 4L8BA 1OGAB 1QSZA 4WHDA 4AT6A 4RIRA 1KG0B 2HJFB 2V7NB 4XXDA 2IWGA 3HI6L 3P9WB 1JV5B 5GS0H 3DMMC 3NABL 4X6DF 5DD0L 4Y8AA 4ZXBC 1AKJB 4NBYB 5E8PB 1T66D 2QSCL 4ODWA 1FBIL 1PX3A 3N1PC 1T20A 4M4PA 4MXVF 4U05A 3DX9A 2KBGA 3UBXB 4OCWL 4KHXL 3VRIB 5TGBB 3ULUD 4PGDB 4NNPH 1BVKB 5J56B 1RURH 2XZAH 4LQFL 1KJ2H 4F7EA 3KDMA 1R3HB 3MRBB 1E6JL 5JR1L 2D7QA 2ATPA 2DJ4A 4L3CB 1HDMA 3S97C 3BUTA 3BQUC 3HNVL 4N5UA 1AXSB 2IQ9L 3U7WL 4JG1H 4NO0D 2J8UB 1VA9A 3O3BB 2EYTA 4Y1AE 1JPTH 1E28B 3MROA 1TLKA 3HPLA 2X4RB 2DD8L 3MO1B 3QFDB 4IIQC 4C59B 3AS0A 4Q2ZB 1N5AB 1OD9A 3JWOH 1OW0C 1QYGH 1AGBA 2HWZL 5CD3A 1JWSA 3LKOA 4UNUA 5LQBL 3BGMA 1DEEA 5EU5B 4Z5RB 3KR3H 5DK0A 5IBTH 3FTGA 1J0KA 5T1MB 1YN7A 1O5DT 1CQYA 3PXHA 6CGTA 4C55A 3LIZL 2VKXA 2K7QA 1EVTC 3O4LA 4LLQB 1AQKL 5DVKA 1JRHI 3QIBD 1D9KD 1F6LL 1JGVL 1G7QB 4LCYB 4F3FB 3U36A 4CVZA 3BYYA 4LSVH 4Y4KB 3CDCA 4KROB 3FT2B 3WO4C 1W72L 2EDBA 2VABB 2X44D 5INCA 4LARH 2A6KA 3BP4B 4PJXA 3WIHH 3ARSA 5EC1A 5KSAB 5T3ZH 2W9DL 5IR1A 4UV4L 3RZCB 2NXZD 5C0BA 3ZKNC 2E7MA 2Q7YB 3B9EA 3TO4B 3QR2A 2PYEA 2R0LH 3O9WC 4WHCA 5CUSH 1SEQH 4UT6L 1G6VK 4W4NA 3ARRA 5C07B 1PKQA 2IANB 4B41A 2VDOL 4HKXA 1KENL 3FQNB 1B88A 4POZC 3D3VB 3OZ9H 4M02A 5DYOB 1GYAA 1NKOA 4N0YL 5D7SL 2BK8A 1J0ZA 4PGBB 4R2GB 5D1XD 1S9YB 2C3VA 1HSAA 5T3XL 3N1FC 1F3DH 1R5IA 5JXED 4M48H 1BQHG 3IXAA 4LLWA 3SE4A 3VFUB 5IESH 5I8CB 5DMKA 1L0YA 5KG9B 5HYJE 3GBNH 4BQBA 4JY5L 2ESVB 3RX7A 2AI0H 3RY4A 5J13C 1BLNA 1YEKH 3VA6A 3OKMA 2EO9A 4XWOD 1Z2KA 5BMFL 1L0QA 1OAUH 1I3GL 1KEGL 1FNEB 5DZLA 1YECL 4FS0A 4G6AD 5F1NA 1FSKB 2OLDA 3T1FB 2G9HB 3IDGA 1FRGL 5BRZD 4ONFH 5SX5H 4JFDE 1BFSA 3C5JA 1FVCB 3WLWC 4HMCA 4K94C 4YH6A 3X14A 5SWZB 1WZ1L 4C56A 4ZAKC 1KLGB 2VUYA 4KRPD 4PJ7F 5EO0A 3ARVA 2ATKA 3QFJB 2ZSVA 4M43H 1EHNA 4GAGL 5TDPB 4X6FB 3GSRB 3EYFB 3SCMD 1TJIH 5C0EA 3MLXL 3LRSA 2CLVB 3NIFF 1DQLL 5HHMD 3SKUD 5IT2L 5LGJB 1QUNA 1A9BA 3QI9A 2JCCA 3JSSA 2EDTA 2HMIC 4FFWD 2N7AA 4M62H 3HE6D 2WIIB 3IFNL 1CFSA 2CKBB 4JO4H 4RAUA 2PF6A 5D96B 2GT9B 3MYZA 3NFPA 1RMFL 4LOUD 3JVGC 3UCRA 3H3PH 3UC0H 3VFOA 5E8EB 4L4JA 4NRYA 5I76A 1J1XH 3CNKA 5IMOB 1FVDA 2ZUWA 3VXUD 5EO9A 3I2CL 4KJYB 4DUVA 3GMQB 1NAMB 3WJJA 1QLFB 1JGUH 2BCKA 3IETB 5F7EH 3FT4A 5F7NC 4KPHH 4CMHC 1GGIL 2BDNL 5HY9A 2BNQD 3FB5A 1ZA6B 4Y5XC 4L9LC 1BWMA 4E41D 5IFHH 1XT5A 2EDYA 1JI2A 5DEGA 1JP5A 4QGYA 4YBQC 1YMMA 4L4VD 3D1MC 2MJWA 3U0WH 5GRUL 1XMWA 2RAMA 2WUBL 4RGMC 3FB6B 5EZIL 3V7MA 2Z93B 1IEAA 1A7NH 5GS2D 1EJOH 3GI8H 3UTSD 3IDJA 4NNYA 1JHKL 3DVFA 3ZKMD 1DR9A 4NZTH 1C08A 5AZEH 3BH9A 2PO6B 1NUGA 3HRZB 3IFOA 2GSIA 2B20A 4JVWA 4RRPA 2LAGB 1MRDH 4PREA 4BFIA 3DX6A 4AIOA 2ARWA 4OT1L 5I18L 1QSEA 4XP9L 4JFFD 1FHGA 2QQLL 1AY1L 4M4RA 1DQQB 4ZS6C 4DKEL 4YXLH 3ZDYE 3S96B 4XAKE 4GBXA 3QJHA 2Q8AL 3GIZH 3VA2C 4DGIH 4G9FA 5C7XH 1UM4H 2X89D 2XPGA 4HFUH 4O00A 3GK8L 2J3SA 4MNQA 3OV6A 5EBWA 4YXKH 4WW2B 1JPFA 1OTSD 2HLFD 1R6VA 4DK6A 4N0RA 4Q6IC 2I9TA 2X4QB 1NGQH 4RMWA 4N1HB 1IGIH 1T7YA 4RWYL 1UYWL 5LXGL 5E6IC 2JIXB 4Y2DA 4OCYH 1TJHH 4K7PX 2IAMB 3QUZD 3GSVA 3UTPD 3FZUC 3WFDL 1ACYH 1XGPA 3M8OH 4LCUA 3U7YH 3S37L 4GMTH 4HJGB 3BJ91 3HUJE 1WJ3A 5C0CB 5IGXL 2OTPA 2QV2A 2XN9A 3OGOE 4LDEB 4Y4FD 1T03H 1SY6H 1LK3L 4H25A 2N4IA 2C1PB 4FQQA 4EDXB 3T3MF 4Z7VE 1YYLL 4L3AA 2AVGA 4XNUH 1U0QA 3A6BH 3F58L 4RMRA 4P48A 3IAPA 1LE9B 2D7PA 3VD5A 5D1ZB 4JDZA 1UJ3B 1G0YR 1QRNE 4P59H 4XVJL 5I1LA 5HHVL 3MV9A 4H8WL 1V3KA 4YHYC 4GRLA 4TUKH 4WI8A 4LCCC 3PHQA 4J4PD 1F2XK 2RHEA 3K80A 5DR5L 4MA8L 5I6XC 1EAPB 4DZBA 1U92A 2B1HH 4C4KO 4HF5L 1DANU 4KVCL 3QULB 1JZ3A 4QOKE 1YN6A 4UOW1 1JZ6A 4RFNB 1HOCA 2UZYB 1N26A 5HI4C 4TULL 1I9EA 3NIDE 3ZYOA 3FO9A 3FQRA 1FZOA 2Y5TA 3AM8A 3UXFA 4HPOH 1H3XA 2NX5B 1CBVL 2BMKA 2J4WH 2MOVA 4PRIB 1Q9WA 4P2OC 1V7NL 5GSVA 4Y4HB 2XIDA 3DGGA 3F7QA 2VWEC 2Q87A 3VXQA 2FWOB 3MV01 1FC2D 1T3FA 4KGLA 2AXGB 4PB0H 1MCWM 3GB7B 3L3OA 1YPZA 4PGEB 5JTWA 2XYCA 1YEIL 5I1EL 4BQCA 1DUYA 4LDLB 5L7XL 3TNNA 2PW2A 1NJ9B 2J8UE 2VAAA 1DCLA 4FXGB 5FO7B 5F9JA 1J8HD 4UTBL 1C5BH 2VXSH 1LILA 1Q8MA 4MAUL 4G6JL 5IVXA 4LF3A 2VXVL 4DK3A 3MJ6A 2C26A 4JZJC 4OD2B 4CADA 3C9NB 3UBXG 3JXAA 4MJIA 3TT3L 1NC4D 1G6RA 2ARJA 4HUWB 2IG2L 3ECBA 5FKAA 2AV7B 2FATH 3KPRB 5CILL 1ZHKB 2YK1L 4PLJC 4DQOH 5F3HB 3D39A 1AXIB 4J6RH 4CW1A 5CBAA 2XOTA 3KPQA 2H6PA 1KACB 1M7DB 2IPUK 1GL4B 4IRSD 3LEVL 3O2WH 4AQOA 3RNKB 2FX7H 1A0QL 3AC0A 3DUUB 1IQWH 15C8H 4O58L 4FQ2H 3MLZL 5C08D 4R4BA 3N06B 4JPWH 1QR1B 5L8JB 1JFQH 1IC5L 2ADFH 3ARGA 2BHYA 1J05A 4XXDB 3ZLQC 1SY6A 2ARJQ 4F9PC 1T7WA 1RU9H 4TYUA 1QKZH 1A6WH 1GGTA 3PDOA 1W0WA 4X98A 5C07E 3UYPA 2IANE 5MENB 4FNLH 3CU7A 4ODHH 2XQYK 1WK0A 3MXWL 3RWHB 4GAJL 1T20B 2EKJA 4XCEA 3DX9B 5DHVA 5C0AD 4RAVA 2FYYA 3LQMA 4WUUD 2RCSL 3UJIH 2DQTL 4F7EB 3KDMB 3QB7C 3DVGA 3BGFB 1QRKA 4M00A 2ATPB 3B9KA 2P5WA 2HRPL 1HDMB 4APQA 1T1WA 1TZHA 1RIVL 1T0MA 3JBG7 3HG1A 3CUPA 4IOFC 2MSPA 1QSFA 5JW5B 1K4CA 1S7XA 2B7DT 3LZFL 4OM1H 3RY6C 2EYTB 2EDXA 4U1SB 1FAKT 1FIEA 2A1WL 2ZUVA 4H88H 3QO0B 1WIUA 1UH2A 35C8H 4NQXB 5CD3B 1AGBB 1JWSB 3LKOB 4HJ0D 1UB6A 4DOHB 4MQSB 3BGMB 3MLWH 1DEEB 1LP9A 5DK0B 4JO3L 1D5IH 3FTGB 1YN7B 4D8PB 3U9PL 1ITCA 4F7CB 3O4LB 4UAOC 1BWWA 1TQBC 1X5YA 3BIKA 1R5WA 3GMPA 1EFXA 3Q48A 3U36B 2ZCHH 3SDXF 3V6ZB 5MP6L 1EMTL 5INCB 5ITBH 1FORH 5E9DA 1E4XL 2H32A 2XXCB 1T0PB 1JL8A 1TITA 4ZTPL 1CDHA 3MRPA 2R69L 4RFEA 5HI5D 3QRGL 4EQ2A 4RISL 4Z7UA 1VEPA 5EC1B 1HSBA 1UCBH 5IR1B 3ZTJG 4L8SA 3GGWA 3M07A 1WV7T 4W4OC 2WNGA