3QUKB

Crystal structures of the murine class i major histocompatibility complex h-2db in complex with lcmv-derived gp33 altered peptide ligand (y4a)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Unexpected T-cell recognition of an altered peptide ligand is driven by reversed thermodynamics.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 14
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qukB00
5E4EC 3WMSA 3ZHLA 4EOWL 3KPRD 4GAFB 3G6DL 1MCOH 3VG9C 4LQ1A 2R2HA 4U6HB 3O9WC 5EOTB 3DUSB 2E7MA 4NWUH 5C8JA 1C1EL 3KJ4C 5DEFA 4EXPX 3KAAA 1TJHH 2LAAA 3I6GB 4Q6IA 4QYOB 5E8PA 4N1EA 3QDJB 3FFCB 3GIVB 2AJYH 1UJ3A 3C60D 4IOSD 2UYLA 5I1AA 2YRPA 2XZCH 3KYAA 4LARH 4LSUH 2DM7A 5FYKH 1VDGA 4RWYL 4MAYB 1LEIB 3HE7D 5H37G 1RJCA 4PJIA 1K6QH 4PRIA 3G04B 4APQB 1FN4A 3MFFA 5EB9A 5CP3A 1UWXH 1G7LB 3CVHL 4HWZB 1CQKA 5D7SH 3TVMC 5TPWH 1KOAA 1QLFB 3G5XA 1A7NH 3RIAF 1JZ4A 1QR1A 3DXAD 1OLLA 1R3KA 2W91A 2NTFA 4G6FD 3MUGA 2HFFA 4XT1C 5T3XL 2UWEF 2DQCH 5DC4B 2HT2D 4OLXL 1OTSD 1QFUL 1A7QH 5I30L 5D5MA 5J1SC 3KPLA 1YECL 1PZUB 4J4PA 1BECA 5J6GB 4KTDH 2Z8SA 4HKJB 1QBLH 4Y5YB 3C08H 3QO0A 1T1ZB 1HKLH 1GGIL 4RAVB 3NPSB 1HNGA 3MOAL 2XXCB 2ZUQB 5MERA 5DJDA 4UU9B 4P23D 7FABL 4LL9A 4LSVL 3UAJC 1ZSDB 3EZ8A 5GXBB 1RZJL 4R26L 4M6NL 2YA1A 1GC1C 5EU6A 4NO2B 4DKFH 2BVOA 2P5EA 4JQVA 1AD9B 1JRHH 4XP5H 3IAGC 2BOBB 1OSZB 3BXNB 2NLJB 5JW4R 1T1YA 2YD4A 4M1CC 1LWRA 3LB6D 4LU5L 4NKMA 1AO7E 3VH8G 5I66A 4XP4H 5BJTB 1A14L 1MFAL 5BXFB 1F11A 1G7IA 4HC1H 3W9EB 3LEVH 4F7EB 1GGBL 4GW1B 4Z7UA 5E8EB 3ZKMC 4K8RH 1T04A 4TNWF 4QTIH 1FZJA 1U8PA 1CIUA 1REIA 4KFZC 1OAYH 3T0DA 3TO4D 2PTUA 5ESQA 4NQEE 4L3AA 4U33A 5ANMA 5D7KD 4M7JH 1UQSB 2ESVD 3AREA 2OX5A 2ARWA 4M7LT 4IM8A 1NGQL 3NA9L 2AQ3A 4WVRA 2FHFA 3OXSA 5FXCH 5JHDB 2QHLA 4G80B 3RTQC 3MV9A 4KUCD 2CK0L 4RIRA 1IKFL 5CUSL 1OAKH 2IH3B 2HH0L 1LILA 1P9MC 4XVSL 3QT2A 1T7XA 5T3XE 4LFHG 32C2A 4NRYB 1UZ6E 1XGPB 3QDGB 4WWID 5SWQB 2NX5A 2L7JA 3SCMD 1FO0L 4LMQI 1KV3A 3DETD 1A1MA 2EO1A 3RVTD 3LOWA 5ESVB 5JIHA 4S11A 2R69L 1GVIA 2R1WB 1YPZB 2EE6A 3CVIH 3L3DA 3N1MC 1HI6A 5D2NA 1T03H 1OSPL 1QQDB 4C4KO 1KEMH 1QYGH 5EU7E 5EO1B 3PV6B 1CFVL 4QXGH 1JCKA 4HJJH 4FXGA 4HHAA 4P46D 1E4XL 2XQYG 5CP7A 4CBPA 1A7OH 1FC2D 2YPLD 2WIIB 3MUHL 3QQNA 5LQBL 1CLZH 2X6MA 3UYRH 4LLWB 2BNQA 2ZCLH 1N64L 1FYTD 1XEDA 3F7VA 1NGZA 3C87A 3MRFB 4QGTA 1RHHB 1T2XA 3M07A 5DURD 2BDNH 2IMMA 2Q6WA 2P48B 4R8WL 4YNYA 4JFEB 3IJYB 4FQIL 2P8MA 4P2RB 3RPIB 3BYYA 4WDIB 1SYSB 1S3KH 3TN0D 2VWEE 2QQKH 1EFQA 4MB5A 5GGVL 5IQ7L 5IVZB 1ZANL 4GJTB 2E9WA 3I6LE 3L95B 5HHPA 3IF1B 4ZUWA 4TVPD 2P24A 3SHSA 3RZCD 2GK0A 4C56B 1BD2B 2YD2A 1DVFD 2VDRL 5F7LB 4OZFG 2JTDA 4DOHB 4I3RH 3WEXA 4RFEA 2YA0A 3OX8B 5DWUH 4PTTA 4M00A 1QO3B 2AV1B 4XGZA 1MIEH 4OJFL 1IFHH 5IB2B 5HHOB 5DJ2B 3U30B 1X5AA 1FQ9C 2K9UA 4RZCA 4V1DA 4XAKD 3QG6A 2ZUVA 3RWHB 4F15B 5T3ZH 1T3FA 3R4DA 3BZEA 3SKNA 1GAFH 3PWUB 1IEBB 2XOTA 3NH7H 4OF5A 5BMFL 5EUKB 4FZEL 1A3LL 3ARYA 3BHBA 5AWNL 1VFOA 4YJZL 5F96L 1TFHA 3FQNB 2EDYA 3BSZL 1ONQB 2V2TA 4YR6A 3K4ZA 1TENA 2IQ9L 4UTBL 1NGXB 5L0QC 1W72A 3QHFL 1UWGL 2FHCA 1IJ9A 2H41A 4HW6A 4XPHL 1UKTA 1KIRB 4XPBH 4XNMA 4KAQL 2UWEB 2ZOLB 4QCIB 1D5ZA 2Y7QA 4JY6B 1QKZL 4CNIA 4QHKJ 3UTSB 2F8OA 5A43C 4HLJA 3BD4A 3WS3B 5ILTH 1RK0A 4HV8A 2ZCKH 3QIUA 4LCWB 1IQDA 3PIQB 4EDXB 1TCRA 3W11C 4J23A 3O3BB 1NGYA 4X6BB 3HRZA 3PWPB 5EN2B 4O5LH 6FABL 5D1QC 3CDFA 1KPRA 4KJPD 2AJUH 1JNJA 5ITFB 3EFFB 1LEKA 1LK2A 5L2KA 2RGSA 5HDLA 1W8NA 1ZEAH 1C5CH 4WHYH 2XWJA 4AENB 4O02L 4F2MB 3A6OA 5I8EB 2BHZA 3TZVD 1G7HA 1BZ7B 1XR8A 3QSKB 1W0WA 3WUZA 5C9JB 1CFTA 3OR7B 5E2TL 1AGDB 1CT8B 4QWWC 2WINB 2E7LA 1C16A 4M8VA 4LIQH 3F12A 4X7EC 4X98B 5FYLL 2BSED 3S37L 3L9RB 4BH7B 4DVRH 2ATKA 5EO9B 2YEZA 2HAZA 2A1WH 3VI3E 5LXGL 2NXYB 3GJEA 3PWLA 3MRLB 2APXA 1YQVH 2PF6A 3SY0A 1FP5A 3REWB 1EAPA 3MRGB 2DLFH 5TE4L 1LNUA 1KLUB 4O9HL 1M6OA 4U3HA 3UTTE 5L9DL 4YO0A 4XCYA 4M6OH 3RHWK 4O2CB 1B0WA 4H1LA 1RZ7L 5EBLA 2CGRL 2DQFB 2EDFA 2G5BA 4OD3H 3BT2L 3MBXH 2B2XH 2R2EA 4LQFH 4HWBH 4N5UA 4Z7QE 4OV6F 4QHLA 3BP6B 4AG4H 1TTFA 2NY2D 3VMOA 5DJCA 2VXUH 2BNRB 4P5KA 3PWVB 4QRPB 3ARTA 1MNUH 4FFZH 2YD5A 4FMKA 3BP4A 4MA1B 4OZFB 1ACYH 4PGBB 3VD7A 2VDQL 4LLQB 4LMQE 4NUGH 1JPSH 5E2VL 4HK0A 2C1OB 2FSEB 1U8MA 3QUKB 3PXHA 3SGJA 3HMWH 1YEKH 5BZWB 1X44A 1NGPL 3OKOB 1XF2B 4HK3N 4NJ9L 4CVUA 2F74B 3EDDA 5CJQL 4KVCH 4ELMA 4I0KA 1E6JH 4FQXD 4FFWD 4FQCH 4U6XA 2JK5A 2A6IB 2F53B 3KPSB 2D9CA 2DMBA 3C6LC 3FO2A 4KRLB 4MA3B 2AV7B 3DVGB 2CRIA 3QIWD 4ALAH 2VQTA 4WGVB 1PQZA 4EDWL 1U9KA 5CSBA 3CGTA 2XY1A 4JFDB 2G60L 4LLUA 1Z2KA 5BV7H 2H2SD 4Q6IC 2IWGA 2H6PA 2P7TB 2GTZB 1IC4L 2FWOB 5C0AD 1WWAX 4LVOC 2A0LC 5GS2D 5FYLE 1CDYA 1LO0L 4I0PD 5KSAC 5DVMA 1I9JL 1FORH 4U1GB 3UYPA 1H8SA 3MLVL 4DN4L 2XKSA 3EOBA 3IDYC 1UH2A 2BRRL 3LKRB 3PGCB 1HK6A 4P2OD 4XHJC 4GQ9H 4I5BB 3S5LA 2G2RB 4NKDB 4NP4L 2Z91B 3T65B 5DMIL 3RVWD 4U6HA 4ODTH 5E8OB 5EOTA 3DUSA 1U42A 1KUMA 4KGLA 2HG5B 1JRHI 2OTWB 1HSBB 2ICWB 4RGMB 1F4WH 3QWRA 2EH7L 3I6GA 2L7UA 1HXYB 1KELH 5IMLB 5IFJB 3B9AA 4HLZG 3QDJA 2FX7H 1M71B 3GIVA 4F80A 4XX1E 4DQOL 4KKLC 1JHLL 2A9ML 4LGRB 4NCDA 2WM0A 3WFEL 1G1YA 2IPUK 4PJHF 5ALBL 1Q72L 4MAYA 4Y19E 1LEIA 5I73C 1AI1L 1NKRA 3G04A 1J0HA 5HDBF 4APQA 3RX7A 1FGVH 5LVEA 1AIFB 4HWZA 1G7LA 1MAJA 3GSWB 2VC2H 3F6IA 1MCOL 4MNHB 4PJ7F 1QLFA 3O8XC 2OXGA 5D72H 4IDJL 4TUJB 4JQVC 2UV3A 1KLGB 3RKPA 5ISZE 1F2XK 4PRAB 5EOCH 2HTKD 2EECA 3ULUC 5K9QI 4O00A 4IIQB 1L0XA 4ETQB 5A2JH 2AJYL 3KGRA 3RDTB 3HG1D 5J6GA 4HKJA 4LSUL 4Y5YA 1T1ZA 4QGYA 4ZFZB 4RAVA 5FDYA 4PG9B 1NAKL 3TNNB 4UU9A 2DLIA 2NPLX 2VZSA 4G9FD 1ZSDA 4JN2B 1CXHA 5B8CB 5D7SL 3DRTB 3RBGA 3S35H 2LU7A 4NO2A 5IEHB 3CU1A 3H0TB 1AD9A 4YHZL 3CXHK 4WW2F 2WBKA 2BOBA 1OSZA 1GZPB 2BSRB 3HE6B 3TC9A 1RURL 3BXNA 2NLJA 3F8UB 4LAQH 3U4BL 1OD9A 1RUAH 5BJTA 1PD6A 5BXFA 1L7IH 3C08L 1HKLL 3EJJX 3W9EA 1TZGL 4F7EA 3WNMA 3T04D 3ULSB 4GW1A 1EO5A 1JYWA 5HY9B 1OOAA 5E8EA 2R8SL 4K9EC 5CJ8A 3AMLA 3TJHC 4XI5D 4HG4J 3U4AA 1UQSA 1JTOA 5JQ6L 1JRHL 5D2NC 5F70A 2H8PB 3KPRB 4U1JB 3DRQB 3MOBH 2IANE 4IRJD 4JHWL 5F9JB 4G80A 3LEXB 4OLZL 4U6VH 5DMGC 5C08E 2IH3A 2QSCH 4YDLB 3C9NB 1ZLVK 3LEVL 4NRYA 3TLRA 1EMTH 1PG7W 1XGPA 5E6IB 4ZUVA 3QDGA 1IAIL 5SWQA 3TCXA 3EHBD 4NJAH 5AYUL 5C0JB 4IHOB 3VDCA 3O2WL 5ESVA 1JGUL 3U4EB 3V4VL 3QDMD 2R1WA 1YPZA 4LNRB 5FYKE 1EVTC 2NY3B 3GKWL 1WF5A 1XCTB 5TDPB 1DBKH 5EO1A 3PV6A 3QI9C 3EDJA 4TUKH 4CU6A 4P59H 5DK3A 1WK0A 4I13B 3LVEA 3DJ9A 1X5IA 2H1PH 3S37X 1T66D 2WIIA 4G6FB 3FO0H 4PJCE 4R90L 4LLWA 1X6LA 4GMSL 3U2SB 3HZKB 1IL1B 4JANA 4QNPE 1FJ1B 3MRFA 4UNTA 1RHHA 3TM6A 5I1HH 1F4HA 3VXRB 3FQRB 5IM7B 3KLHD 4BELD 2B20A 3ZSTA 4JFEA 3VFWB 3IJYA 4CU8A 3D39D 5GIRB 4P2RA 4PJAB 3RPIA 5GS0L 3WO4B 1SYSA 3ME0A 4P2QB 4GW5B 4QF1B 1KEML 2DLEA 3D0VB 3QCUH 4OGYL 4JG0L 5IVZA 1HEZB 2NY1C 3L95A 4I48B 3MODH 4QXGL 2C4XA 3IF1A 3CZFB 3KNBB 3V4PL 3SKMB 1G9EA 4C56A 1BD2A 3WXWH 3QUZD 1A7OL 1MJ7L 3LKQB 1XGYL 1RZKH 1N26A 5D7JD 5DD0H 3UYRL 1YQ2A 2Q3AA 2BXZA 2DQGH 3QZWG 3OX8A 3T77B 1QO3A 2AV1A 4XCFH 5IB2A 4R96B 5HHOA 2MQ3A 5DJ2A 2BDNL 1JGVH 2EH8L 5JA8B 3UROR 2D0FA 3IKCB 4YDKH 1R5VB 4CVWA 3FTGB 3RWHA 5ERWB 4Z7VF 2IBZY 3QIUC 3PWUA 1IEBA 5MHSD 2RBLA 3ECBB 4PJHB 3MROB 5EUKA 4X8JB 3RUGE 5FYJU 3TGXA 3GJFH 4H88L 5DHYB 5HHMD 4EUPB 4WHTB 3FQNA 3JTTB 1ONQA 5E2WH 3GB7B 4PJ7B 1NGXA 4H8WL 1S7SB 4GXVL 2A73B 3VGAC 3S4SG 1X5YA 1OPGH 4Z9KB 4C4KT 1EGJL 1KIRA 2HJLB 5CJXC 3QWQB 5FM4A 2UWEA 4A6YH 1IFHL 4RMQA 2ZOLA 4QCIA 4JY6A 4H20H 2CDFB 4QXTB 3T0BA 1MLBB 3K3QA 3PP3H 3UTSA 4OCWL 4LDOB 2E7LC 2AJ3B 3WS3A 4LCWA 4JGUA 3PIQA 4EDXA 3O3BA 4CVXB 4NRZB 3SCMB 4X6BA 3PWPA 5EN2A 4RCAA 4ONFH 3NH7L 2F5BL 4M7ZC 2EYTB 1U3HD 5ITFA 4JO3L 3EFFA 4K3DL 4Z0BL 3ARFB 3NZHH 2XQBH 3C2SA 12E8H 4WTZG 3OAUL 4AENA 2J4WL 4JKWA 4F2MA 1LE5B 5I8EA 1YN6B 1IGYB 1KGCE 1BZ7A 3GNMH 1S7QB 4LDEB 3MLSH 5ITBH 4XPBL 3PHQA 5C9JA 3OR7A 4WW2B 1A1NB 1AGDA 1JYNA 1CT8A 4X7FC 5D2LF 1UZ6F 3E1F1 3SO5A 1S9WB 1AGBB 2WINA 3SDXB 2YXFA 4AQOA 1IC5L 1NBZB 3H9SD 4QRRB 4X98A 4XP9L 1GRWA 3L9RA 4BH7A 2R1YB 5EO9A 4QRSB 1HCFX 4WHCA 4QXUH 1CICB 1TQBC 3IFLH 3MRLA 2XN9B 3SJVD 3REWA 1JPTL 2IBBA 3MRGA 1DQMH 4HH8A 1UFUA 2RQ8A 3VXSE 5F9OH 1JF1B 4AIOA 1MREL 1KLUA 1P7KB 1C5CL 2FGWH 4LGSB 2OYPA 2BY1A 3B83A 3SGJC 3P0VL 4IS6B 2OTUB 1JHKH 2JJWA 3ZE1F 4O2CA 5GJTL 5E9DB 1G9ML 1J8HE 3S36L 2DQFA 4KKAC 1VA9A 4E41B 5GISH 5KOVC 1KCSH 1CLCA 1IGFH 4K3JH 1UACH 3BP6A 2ZUYA 1INDH 3O0RH 4JDVB 2BNRA 3NCMA 3PWVA 4QRPA 4LEXL 4DVRL 2A74B 4S1DC 4KPHH 1MUJB 1U6AL 3U7AA 4PRNB 5SWSE 3FT2B 1GGCH 4K94L 4OZFA 4Y4FD 4PGBA 3ZTJH 4LLQA 1YQVL 3QPXH 4LSTH 2C1OA 3V0AC 3QZWB 5I71B 2DLFL 2FSEA 1OWWA 3QUKA 2GJ6D 2QADB 1FE8H 1IEAB 3OKOA 1XF2A 4WTXA 1DP0A 1FLRH 1Z3GH 5HGHB 2F74A 1X5GA 4L3CB 3S3JA 1EHLL 1HYSC 2A6IA 3LDBC 2GK2A 3KPSA 3ROOB 2ZOKB 4OD3L 3MBXL 4LQFL 4MA3A 1KJVB 2AV7A 4OLVL 5IWLC 3DVGA 2P46B 4DUXA 2DJUA 5F9WC 4IMKA 5FV1L 1QSFD 1TMCB 2YD3A 4JFDA 4MQ7B 4FFZL 1SEBB 1UA6L 2BOCB 3WFCH 1T5XB 3LS5L 4JEGB 4NUGL 1RIHH 1C08B 1OTTC 4N0CC 3C5ZD 3S4SB 2P7TA 2GTZA 2VLKE 2FWOA 1DQDH 4EBQH 1DQJB 5AD0B 1VHPA 2DMKA 4ZUSB 5GRVL 3CSBA 4MXVF 2CKNA 3F7PC 3PGCA 4MAYC 3LKRA 2R0WH 4FQCL 4I5BA 2G2RA 5CEZL 4WO4B 5CILL 2HFEB 4NKDA 4RMTA 1WWWX 2Z91A 3T65A 2DJ4A 5E8OA 1RVFL 1SBSL 1ZA6B 5CJ5A 4ALAL 4ELKA 5DK0B 3ARVA 2HG5A 4NIKB 2OTWA 4JQXA 1HSBA 2ICWA 5CJOH 5DUBB 1HXYA 3IDNB 3LH2H 2KH2B 3P0YL 3SDAB 5BV7L 5IMLA 5IFJA 2YWZA 3U82B 1M71A 5KTEH 1PFCA 3KXFE 2DQUL 3MBEB 5BRZD 4KY1L 4X9GA 1SJHB 4NWTH 4Y5YC 3VI4F 43C9B 3MLZH 4MLIA 3BIBX 4I1NB 3NPSC 1BX2B 4JHAH 3SOBH 4EJ1C 4UILH 1F3JB 1AIFA 5F7KC 3GSWA 4MNHA 5CZVH 3LZFH 3WN5B 2D3VA 4K2UH 2WNGA 5TFSH 3ROLB 1SJXA 4TUJA 4WU7B 4K7PH 4KJQD 1J87A 1TIUA 1A9EB 1T7ZA 1F4WL 2OP4L 3ARWA 1KLGA 4PRAA 5CWSB 1Q9WB 4H25B 4IIQA 3VI3F 4ETQA 2HA1A 2CIKB 3RDTA 5C2UB 3LQAH 3E6HA 2XA3A 2V5YA 5J3HD 3L5JA 4ZFZA 5HI5C 1W0VB 5EA0L 3MLRL 4FQ2H 4PG9A 2QQLH 3VXME 3IFPB 4FQPA 1ZWIB 4K8RD 3TNNA 3IJSB 3VGDA 4NQEB 2NY0D 4JN2A 3I9GH 5B8CA 3G6JF 3DRTA 1DQTA 1KN4L 5IEHA 5D72L 4JPWL 2J3SA 3H0TA 4K55A 2ADJB 1FYHB 4PTUB 3BJ91 3AGVA 4N8VB 5E1HB 1PYWB 3HE6A 2BSRA 3PUCA 5C71A 2RB8A 5CEZE 3UZVB 4RX4D 4Z8FH 3GM0A 2J88L 1Q1JL 4OB5H 4JAMB 2AKRA 1UKSA 2MHAB 2NYYC 2V2XB 3FCTB 4D9LL 1DQLL 3DX8B 4YXLH 3ULSA 1M4KA 5HY9A 5DA0B 2DQJH 1MVUB 2YD1A 2M26A 1Z5LB 1CFBA 3P73B 4I0PB 1T83A 4BFBD 4PJDF 5D7IA 3HB3D 4KKCD 4P2OB 3TT3H 4WY7H 2NY6D 2YD6A 2H8PA 4U1JA 2FX8H 3DRQA 1KIQB 1TDQA 3T0ED 2AI0H 4LAQL 4HWEH 5F9JA 2CQVA 3ZYIA 3LEXA 3OZ9H 1YYMH 5K9JL 3V7AE 3WLWD 3GSRB 3C9NA 5E6IA 1A6AB 4H26B 5KSVB 1F8TH 1UWXK 3EJZD 1WAAE 3FAWA 4G6AD 5C0JA 4IHOA 2BRQA 4FP8L 5MENE 4YQXH 3U4EA 3VWKC 3I02B 4AL8H 2VDPL 4LNRA 1E28B 4HJ0D 1S8DA 1XCTA 5TDPA 1OAXH 2PO6B 1P2CB 4W4NA 1S9VB 2B1HH 1X3DA 3RKDD 4YEEA 2EIBA 3ESVF 3U2SA 3SGEH 3HZKA 1IL1A 1MCWW 1FFOB 1YJDC 2EDDA 3BIAX 2EYSB 5KBNC 1FJ1A 1EMTL 5JIKA 1YMMD 1ODAA 2HKFH 1W72H 4GRWH 4S1SH 1AY1H 3VXRA 3FQRA 1F4AA 3NIDE 5IM7A 3JVGA 2NY5C 3VFWA 4LSSL 4OCYL 2FATL 4PJAA 2AK4D 4JB9L 4MS8C 5GIRA 5T3ZD 4P2QA 5KANI 4GW5A 1LK3H 4QF1A 5F97E 1FO0B 3KPNB 5C6TL 5D8JL 4GSDH 3D0VA 3S36X 1DBKL 1ZVYA 5FGSA 4F15C 1HEZA 1KYOJ 5DSCA 4I48A 2O5XH 4WI7A 3EYUH 3CZFA 3KNBA 3SKMA 3O6KL 4XVUD 5CGYD 3LKQA 3ZKXB 4N5EC 3FO0L 2H2PC 4LVEA 5F6HJ 1JE6A 4WGWB 3AM8A 5BO1L 5I17B 5DLML 4NQCE 1ZLSL 4TNVF 3VGFA 2R23B 2HLAB 3UJJH 1NBVL 3ESUF 5JOPD 4ZS6D 5JIPA 1XGUB 4R96A 5I18L 5IVNA 3L6FB 4GH7B 3VXTB 3IKCA 1R5VA 2OJEA 3FTGA 5ERWA 2FH6A 1BBJB 1MEXH 3UBXI 5T1KD 3CSPA 3BGMA 1AHWB 3ECBA 1LD9B 5ALCL 4PJHA 3MROA 4X8JA 2EYRB 5DHYA 4EUPA 4JO2L 4M1DH 4WHTA 4NC1E 3JTTA 1U8IB 2YC1B 4KTEL 4XX1G 1RZKL 1EJOH 5IB5B 4S10A 3GB7A 1S7SA 4J3OC 2A73A 4YDIH 3QWOB 2DQGL 2RR3A 4WUUD 2HJLA 2Z35B 2VR5A 4JRXD 4XCFL 3ZE0F 5IVXF 2CLZB 4HCRH 1DUZB 4H1LH 1UGNA 3KXFD 2CDFA 2RCSH 4QXTA 2AGJL 1MLBA 2DBLH 1KTDB 2AJ3A 5HHNB 4J2XA 2VL4A 1C12B 3O6FD 1ORQB 1XFPA 1MCPH 4CVXA 4NRZA 2HJKB 3SCMA 2VDKL 1V7NH 3I75B 1CN4A 4GS7B 3ARBD 1RUQL 5DVOA 5GRUL 2FJGB 3HI1B 1ZT7B 1KCRH 4KHXH 3ARFA 2YMXH 2VDNL 4ZPVB 3UTTB 2MKLC 1QBBA 3GHBH 25C8H 4GXUN 3WIHA 4HPYH 3DYMA 1OVZA 1LE5A 1PAMA 1YN6A 2N7BA 1IGYA 4U1IB 1S7QA 2HWZL 3JBG7 1RUKH 2WQRA 5C2BL 4WW2A 3DMMB 1A1NA 3QXTA 4IEFB 2WQ8A 4MA7H 1UWEL 1S9WA 1AGBA 4H20L 3SDXA 1S5HB 3FQXB 3VA6A 3KJ6H 2YUWA 1NBZA 1NMCB 4QRRA 2X4OB 4OKVB 2R1YA 1P84K 3ZDXE 1EEQA 4QRSA 3ZL4H 4YBQD 2FZ3B 1CICA 1GHFL 1JHTB 1CU4H 4ZFOL 2JJVA 4J12A 4BK5A 2XN9A 4X5LA 2PUQT 2VE6B 4K3HA 4MA1C 3E6FB 2VLJD 4BSWB 4YHOL 3NZHL 1JF1A 1P7KA 5LGHH 3UTZB 5A40E 4YHMH 1MHEB 4IS6A 2OTUA 2HTLC 2YN5A 2EE9A 2GKIA 5E9DA 2XNAB 4P9ML 3QUZB 4ZAKB 1GCFA 2HRPL 3X3GH 4E41A 3O9WD 5GGTA 1S9XB 1A6WH 3V0VB 5DO2C 4TTGA 1NANH 4JDVA 3LV3B 3TBTB 3PJSB 2W0FB 4P48A 3R8BB 1PKQE 2A74A 5IBTH 1MUJA 1IBGH 2D03L 1YEHH 3STLB 4PRNA 1I3UA 3FT2A 3MLXH 4UTAL 2MMXA 2IMNA 1F4YH 3KPPB 2ZUUA 3QZWA 5J6HB 1P4LB 2XZQH 4GKNB 4P4KD 3B9KB 4F8QA 1IEAA 2DTSA 1HWGB 4RSVA 4Y2DB 1J18A 3RVVC 4X6EB 1JHKL 5HGHA 1MF2H 4L3CA 2WV3A 4XCNB 3TYFB 3IRPX 4LKXB 3QXAB 3UJIL 1V7ML 3QPQC 2ZOKA 3ROOA 3TVMD 1EFXD 1KJVA 3TP4A 4K3JL 3ZKQD 3BN3B 5J1TC 3O0RL 3BPNC 4U2ZA 2MNUA 4KMTH 5MEOB 4PRHD 4MQ7A 2R29H 1SEBA 4JQXC 1GGCL 1B2WH 1HZHH 2BOCA 2GYSA 1T5XA 2BX5A 1C08A 4LSTL 3S4SA 4ZODA 1T0NA 4RGNE 1NBYB 3S3PA 4X9FA 4Y19B 1DQJA 3NAAH 5AD0A 1YEGH 2QBWA 3TESA 4WFGE 3WDJA 4ZUSA 1FLRL 3HNVH 5I1LB 1Z3GL 2VXQH 1U3HB 1FNEA 5DD3H 4U6TA 4JO4H 2UZXB 4WO4A 3KDMB 3CFBB 3LKPA 1A6UH 3VFSB 1MFBH 1T80A 3P4OB 4Q7DA 1ZA6A 5I1IL 3JWDC 5DK0A 5ISZB 3PP4H 3HKFA 5CINL 4UT9L 5E08H 4XP6L 2FD6L 5K59E 4ZOAA 3O3UN 5DUBA 1NAMB 1U8QB 3IDNA 3SDAA 4IRSB 4GAYB 4M1CD 5DC9B 4PRPE 3WFCL 4OQTH 2DKSA 1FZOB 4MNGE 3D85B 3IAPA 2OLDA 4DGVL 3MBEA 1N59B 4Y16D 1SJHA 3RDTC 3RWCB 43C9A 4LK4A 4BFEA 4Y4HC 1L9NA 3T3PE 1I3GH 1KG0B 1J1PH 1M1SA 3EDEA 5JR1L 3ZKMD 4RDQF 2R0WL 3LN5B 1N4XL 1OD7A 1F3JA 2ENSA 3WN5A 1WV7T 4ERSL 3SDCB 3IDMB 5B8CC 4IDLA 3P4NB 3ROLA 4WU7A 3TV3H 5DJAB 1A9EA 3E3QC 3FAXA 4D94A 1MRDH 5CWSA 3LH2L 1P7HL 1Q9WA 5DHXB 4H25A 2WWMC 2CIKA 2JJUA 4GKOA 4MJ4A 3WIIH 1ZAGA 5GRVK 5CIPH 4W6YB 2P5WD 3ZYZA 4OZIF 1MCWM 1W0VA 2DIBA 1KT2B 1J05B 3IFPA 1ZWIA 4MA8H 2DICA 4KDTC 1Q0XH 1H0DB 4WEBH 5D1XA 3IJSA 3QEHB 5GRJL 4F7PB 4NQEA 3VE0B 4UILL 4TRPL 5DD5L 3JWOH 5T33H 3ORJA 2ORBH 5IB3B 5TFSL 1T83C 3F58H 2ADJA 1GXEA 4PTUA 5KVDH 1WWBX 1A6TB 4N8VA 1PYWA 4YPJA 1DLHA 2IANB 5JXEA 2JB6B 3RWEB 5T1LD 3MXWH 2HT3D 2AXGB 5C08B 3V5KB 4P9HH 5BS0E 4JAMA 3QA3B 3SGEI 2MHAA 2WWKO 4M4RA 2V2XA 1CVRA 3R1GH 3PV7A 2BVTA 1KJ2L 3DX8A 4FQ2L 3DO3A 1IM3B 1HWHB 1OT2A 1MVUA 3NACH 4DGYH 4ORGA 4EIGB 3WUWG 1Z5LA 2HKHL 4M7KH 1A64A 3C60C 3P73A 1MSPA 4I0PA 4FTVD 2FNBA 3PNWB 2E9IA 3UZQA 3D9AL 1OW0A 3UPCA 3HE7C 4I18B 4HUXB 1KIQA 4JN1H 4PJCB 5KJRH 5AZ2H 1QRND 1U8NA 1CDGA 3DSNA 2YBRB 1RZFH 2KKQA 1MCIA 3TBYB 4OB5L 1QLRB 2X1OA 3GSRA 3PDDA 1WFNA 1MPAH 1A6AA 3RJQB 4H26A 5JXAH 3HPJB 5KSVA 1MRCH 5LWYL 1FFNB 1FIGL 1CWVA 4XNYH 5BRZB 5JW4Q 3QO1B 4N8PA 5IP4A 3I02A 3JVGC 1E28A 1WJ3A 1EK3A 3WO4C 2PO6A 3G9AB 1RAMA 4Z78B 1CLOL 3QEQD 1P2CA 1HIMH 1S9VA 1G7MB 1BREA 2AJSL 3AAZB 4P23C 2AI0L 2Q8BL 2EC8A 4M48L 2O93L 4K7FB 3BYTA 5DC0A 2ZSWB 2V17L 2DQHH 1YYML 2R4SL 1FFOA 2ARJQ 1YZZA 1IILE 2EYSA 2ICWJ 4JG1L 1BVKB 1EXUB 3LB6C 2AABL 2HMIC 1YEEH 5D7LE 5DD1H 2CLVB 3UO1H 2ICCA 3F65A 3IXAB 1MHPL 1B4RA 4Y1AE 1FO0A 3KPNA 3RUGB 4JHZA 1JZ2A 4PG2A 4PS4H 2YRLA 2GSIB 3JTSB 3TO4C 4U0RB 2EDLA 1HN1A 1XAUA 1LP9E 5I17A 4S1RH 3QUYB 4C58B 2QL1A 4AEHH 2CMRH 2CD0A 2HKFL 1KXQE 2HLAA 1BM3L 3D0LB 4MJID 3ARUA 4QWWD 2DQTH 3G5ZB 4ODBD 3L6FA 4UV7H 3VXTA 3ZO0A 5CAYB 1BBJA 1LK3L 4WHYG 4K3GA 2DLGA 2BJML 4GSDL 4LHQB 1AHWA 4N1CA 1LD9A 3SCMC 2V5RA 4MXWH 1T20B 1GOFA 3DETC 3F6LA 1OP3H 2EYRA 3RVTC 2IG2H 4XH2B 1BFVH 1U8IA 2I60H 2YC1A 5IB5A 3ARFC 3WUWB 2OR9H 3GI8L 1AKJD 3QWOA 3WFZA 3E8UH 5D93B 2Z35A 4DWHA 2CLZA 1DUZA 5GJSH 2R0ZH 3QEUB 4WW2C 2DM3A 1KTDA 1NANI 3Q6GL 1UEYA 2OI9B 1MVFA 1C12A 1F3DJ 3PQYD 1ORQA 4PJXE 5FYJH 2YN3A 4M5YH 2AJZB 4FMFA 1CGUA 2HJKA 2W9EL 3SE3C 3EDKA 2ZJSH 3I75A 3WXVH 5TF1H 3DBXB 1R0AH 3VXSB 2FJGA 4KVNH 4BUGA 2AVGA 3HI1A 1ZT7A 1S5IH 5BZDB 4FN0A 4H0IA 4ZPVA 1RHFA 3FFDB 3UTTA 4JVUA 1EJOL 4N0UE 2DYPD 1DN0A 4RBPK 1J8HB 3TN0C 4O2EB 4G6KH 2HYMA 4FFYH 3S3SA 2DIAA 4U1IA 5IFHL 1DBBL 4LSRH 4OCRL 3LN4B 5D70H 2BC4B 1FRGH 1T6VN 3DMMA 3WKNA 4NZTL 3Q6FB 1S5HA 3FQXA 2C3HA 4I3SH 4PGZA 1WAAF 2X4OA 1DBAL 5SWSB 3RL2B 1EERB 4OKVA 2BXYA 2E27H 1MCPL 3MUY1 2FZ3A 4TTDC 5E99H 2FIKB 1JHTA 3FN3A 4RRPA 3DVFA 2VE6A 5D96B 1FL5B 3E6FA 1KCRL 1A6PA 2VN7A 4KHXL 4BSWA 4M43H 3GHBL 1T2QL 2FX9L 25C8L 5I71C 4G7VH 4KQ4L 3TFKC 4RQQB 3UTZA 1OCWL 1MHEA 1Q8MA 2QADC 1AXSB 4XB7A 7CGTA 2XNAA 4LPYA 4ZAKA 1DN2A 4PRID 1RK1B 4UBDC 4MA7L 2EDHA 5ESAB 5CEXB 2QLVB 1S9XA 3IU4H 3KJ6L 3CDCA 1PGRB 2HRLA 3LV3A 1NDGB 3TBTA 2W0FA 4ZTOL 3NIDF 4Z95H 3QNXB 3ISWA 3STLA 3ZL4L 3KPMB 1XGTB 3CUPB 4JR9H 1CU4L 2VLKB 3KPPA 5ACLA 3R0MA 5I8KH 4KKLD 4M6ML 5J6HA 1P4LA 2DWDB 3D3VE 4GKNA 3B9KA 4J4PD 4POUB 5T1KB 2DM4A 5CSZB 3V7AG 4Y2DA 4ZD3H 4X6EA 3IDGB 3Q5OA 4RFNB 4XCNA 4M7LL 4KJPC 3TYFA 4DAGH 1CDJA 4LKXA 3VW3H 1OB1B 2DD8L 3NFSH 3QXAA 1BFSA 2DS4A 5FM8A 2Y06H 3TBVB 4WO4C 4KJWD 4Q6YA 1A6WL 2W1NA 3NABL 4OLEA 5FUOH 1UT9A 5MEOA 5EU6D 2AJXL 3V6BR 3BDYL 1IBGL 2P5ED 1YEHL 4JRYE 4NKIH 3KXFB 5DJZB 3RIFF 1F4YL 1QFHA 3SDAC 3BISA 1IM9D 4HUMB 2NZIA 1NBYA 3O6FB 4Y19A 1X5XA 1MAMH 4PLOB 4D9QD 5DRZB 2K7PA 3EO9L 4XWGL 3I2CH 2DL2A 5I1LA 2Y07L 5SWZE 4YEFA 2Z9TA 1U3HA 2XXMB 2FL5B 1NCDH 4PYHA 4PJBF 3AS1A 3RI5F 3KDMA 3CFBA 1UEMA 3VFSA 1FIEA 3P4OA 5CCKL 3BPOB 4OAWB 3RX5A 2JJSA 5ISZA 2IPTL 5EFIB 1NAMA 1U8QA 2EXWD 5D9SB 2QV2A 1RJZB 1J1OH 3ARED 1NJ9B 2WBJB 4IRSA 4GAYA 4PJ5E 4PJ9B 4OGZA 3H7BB 2NR6D 1J1XH 1OARL 1VGKB 4PB9L 1FZOA 1U91B 3D85A 4PGEB 3RNQB 1D5MB 1N59A 3NAAL 2NY2C 3MV9D 2B4CL 3TYGL 3RWCA 1BAFH 3VXMB 3WV0A 4JKKA 2LVEA 3VFNB 5J0BA 4XC3H 1KG0A 5CGMA 4HIXL 4QHUB 3JZ7A 4HGWB 5FUCE 3LN5A 4NO0A 4HT1L 4L4VE 2NX5D 4JO4L 3JWNC 4AEIL 4CADB 3SDCA 1V3JA 3IDMA 1Y6KR 1TQCB 3P4NA 3LRGA 5L2JB 3PP4L 4NN5C 4F9LC 5DJAA 1ZHLB 1A3RH 3IDJB 1AR2A 3KPQB 4FFWC 1NEUA 4MD5B 5JXEC 1O7VA 4W4OA 5J4MA 3SKJH 3NOIA 4AMKL 5BV7B 2BNQD 1MFDH 1KT2A 4G5ZH 1J05A 4Q9QH 1KFAH 1H0DA 2H2SC 3QEHA 4KRPD 4HJGB 4P4KB 4F7PA 3VE0A 1ZHBB 2EEBA 2D31B 4OFKA 4U7SA 3TBSB 3EYSL 5IEKB 4PLKD 1ZHKB 1GGUA 2OXHA 4RISH 4I3GA 4N90D 1EEYB 2EZ0D 1IC1A 1SMAA 4I0PC 5AYQA 5IB3A 3RA7H 4F3FB 4AJ0A 3BKJL 5C0RL 1A6TA 3MRBB 4OCXL 4M62H 1OW0C 2IANA 5DHVB 3ZT6A 4TSBH 5KS9E 2JB6A 1BQHG 3RWEA 4P2OC 2AXGA 3MRPB 4HK3J 1V5JA 2X4QB 1RZJC 3FONB 5C08A 1EEZB 3V5KA 2IFGA 4PUBH 3LEYL 1K85A 5JUEH 3BPCB 3QA3A 4F57H 4UNVA 1H3UA 4MAUH 4QHKI 1YNLH 5LGJB 1IM3A 3L5IA 3H42H 4BFIB 5MENB 5I9QC 4OZHE 4MA8L 3QIBB 1MI5E 3T4AB 3BRGC 3VD9A 5JO5A 2VAAB 3PNWA 1E27A 4V1DD 2VWEC 1V8HA 3GBLA 5KVEH 4TQEL 4UAOB 2NY1D 4I18A 4GMTH 4FXLA 1X4XA 1AFVH 4HUXA 1JFQL 3MXWL 5E5MB 5DJ0B 4N0RA 4PJCA 3GIZH 3KG5A 3V6OE 3WS6A 1ZXQA 5ADOH 2YBRA 4P9HL 3TBYA 1QLRA 3V79C 3EOAB 4OI7A 3QHZH 2HFGH 3N50A 4ZPTB 4XPGL 3R1GL 1CG9B 2FYYB 1SJVA 4XNUH 3HPJA 2HTKC 1FFNA 1WZ1L 3P9LB 2EKSB 5BRZA 1GPOL 3QO1A 3IDXH 4Y16B 3OHXB 1XGQB 2Z31B 3NIGF 2DQDL 1T1WA 3F7QA 4PFEA 3QIUD 4MSWB 2VDML 4Z78A 1HHKA 1U8HB 4L5FL 1G7MA 4MYWB 4GRMB 4WWKB 3AAZA 3V2AR 4JN1L 1BJ1J 4NQDE 4PG2C 3O2DL 4K7FA 5AZ2L 1U36A 1MFCL 2ZSWA 3SO3B 3K8MA 1RZFL 1CBVH 5ID1B 4NQCB 4EUPH 2FLRT 2PCPB 4NM8H 3K8LA 4JVPA 3ZKXC 1U2CA 1D3CA 2VQ1B 1MWAH 4PJGE 4WI3A 5JXAL 1FDLH 1BVKA 1EXUA 3OAZK 3ILQC 5JORB 3WKML 2H9GB 3MV7E 4OD1H 3D3VD 2CLVA 5IHZB 4G8EB 3IXAA 3RUGA 3C8DA 3ABZA 4NM4L 2WWKT 4X80H 2EE2A 4HIIB 1RIVH 2J5LC 2QHRL 2GSIA 1YC8A 3JTSA 4L8CB 3BKCH 3FMGH 2KPNA 5EZIH 3U83A 3NIFE 2PYEE 5J12B 5KW9H 2RHEA 3QUYA 4KK5C 2UY6A 5KANG 4QXWA 1FVCB 3D0LA 4HQQH 1HQRB 3G5ZA 3H8NA 3JUZA 4K3EH 3MRMB 1AXIB 4JFPB 4ODHH 5DD1L 1YC7A 4KV5E 4RMRA 1DDHB 1GC1L 4NZUL 3T2PA 1FPTL 4HZAA 1LE9B 2PTTB 1T20A 5EU4B 4GS7C 2FIRT 4MD4B 4XH2A 2P1YA 4NUJB 1P4IL 4OM0L 4LPVA 4HULB 1NMBH 3L3KB 5GRWA 4NO3B 4PJIF 2XTJD 3OR6B 3WUWA 3DI2B 2D7NA 2FR4B 4HZLB 2BSTB 2WMPA 4KKAD 4HIJB 3QEUA 3ZLQC 1T66C 5JPMB 4UV7L 4PB0H 2OTPA 4JREB 4G8GE 1KB9K 5GGTH 4QRUB 4ZNCD 1NMCC 2AJZA 2D2OA 3T3ME 3DBXA 3LHPH 3VXSA 4HMCA 1ULVA 3KLHC 3GRWH 5BZDA 1BFVL 3FFDA 2WUCL 3CFJB 1J8HA 5DQJB 1G9NC 1OAZH 4O2EA 4PRBB 3K2UH 1BIHA 3ZDYF 5FK9B 3C6SB 3E2HB 1QNZL 4UV4L 3LN4A 1KXVC 2BC4A 1XF1A 4FXKB 2XZAL 4KI5D 1RFDL 2I24N 3Q6FA 4Y0GA 3QUZC 4ZAKC 5FHAH 3THML 3QNYB 1PKQB 2CJUH 3GSQB 4LCCC 4XXCA 4TOYH 2UZYB 5D7JC 5SWSA 3OQ3B 3K7UA 3RL2A 3V0WL 2C5DC 1N7ML 5FYJL 3OKEB 2JF1A 2WK2A 1EO8H 1FG9C 1NCBH 1CGVA 2X4SB 4P5MB 2APWA 4ESKA 5TF1L 3QWRD 4JO1L 4S0TD 1MQ8A 3L3HB 3I50H 5DUPH 1OTTD 3A6BH 3ARGB 1FL5A 3MXVL 4FFVD 2FH8A 4JKLA 3QUMH 1I4FB 2DTMH 2X44D 1U58B 3QJHB 4Z7UF 4RQQA 4J6RH 2F19L 3B9KC 5ECJE 5TJWK 4WFEE 1AXSA 3W39B 1JNLH 3GJFB 1DL7L 4MAYD 3RQ3A 5D70L 1FRGL 2EEDA 1RK1A 4FABL 5ESAA 4APQD 5CEXA 3BKML 1RZIB 4I3SL 1NDGA 1YEIL 4PD4J 4GG6E 2EC9T 3QNXA 1QFWI 2IBZX 5D6CB 3NTCH 4A6YB 2G75B 3FO1B 3KPMA 5E99L 1XGTA 3CUPA 3PGFH 3VD3A 4RGNB 2VLKA 4TVSa 4V2CB 1WEJL 4I8DA 1HH6A 1HQ4B 2EXYD 4ZUUB 1KCKA 3O2VH 2DWDA 2CRMA 1DFBH 3BH9B 3QQ9D 1WICA 1E6OH 3UJTL 1LQSR 1GIGH 5CSZA 2XG5A 3IDGA 5EU5B 1OT1A 5FF6B 5KVGL 1OB1A 4ISVB 4FOMA 1U3HC 3BEVB 1YEJL 1AR1D 3EGSA 3T0WA 2ZKHL 5TQ0H 2KZWA 3TBVA 2E8YA 4MVBC 4Q58C 1U92B 1ZK9A 4YBHA 2CDEB 2PTVA 2JJSC 4PRPB 1CXEA 3QUXB 4MNGB 4MMXC 3KXFA 4JR9L 3QNZB 5DJZA 5HYIA 3HNTH 4UT7L 4AM0B 1IT9H 1R3HB 1CE1L 4IRSC 2RAMA 1BPVA 3O6FA 1FZKB 3UBXB 2J1KA 5DRZA 1JTTA 5FYJE 2CDGB 3VFUB 4C54A 4D0BB 4HXAL 2FL5A 5GGSB 1KENL 3H2WA 3AB0C 1D7FA 2QSVA 1ZMYA 4OAWA 2ERJC 1V3KA 1LO3H 5DGRA 1RMFL 3MYZA 4W70A 3RWJB 3WFHB 3SDCC 2OJZL 5EFIA 1FNLA 2XY2A 5C0BE 3S6CA 4Z7OE 4GUPB 5D9SA 1RJZA 4UUJB 1NJ9A 4PJXF 2WBJA 2DMCA 3O6MH 4PJ9A 3INUL 5EUOE 3CVHH 3H7BA 5CKAA 1VGKA 1U91A 1DLFL 4HBQA 4PGEA 1D5MA 1Z9SA 3WSQH 5EORH 4W4OC 4LAJH 2YKLH 3VXMA 2SEBB 4EI6A 3VFNA 3I2CL 5I16B 4OLXH 4QHUA 5F7EL 4HGWA 3QDGD 5EZLB 3C5JB 5FGRA 1YECH 3AC0A 3D6GA 4XNQB 4CADA 5I1AB 2CXKA 4JFHD 3LD8B 3BZDA 1GGIH 4WUKL 2PYED 4URTB 1B6UA 1IEHA 3QCVL 1OY3B 5L2JA 1QFWL 1ZHLA 3MOAH 3IDJA 3KPQA 5IHUL 1OTUC 4GRLB 7FABH 4MD5A 4DUVA 5BS0B 1IAOB 4PJFE 3PE9A 4UMGA 4GRWF 4LPCA 5F7YC 1BOGB 3WL9B 2F54E 2YA2A 4NO5B 2C1PB 4E5XB 5B3NA 2NXZB 4HJGA 4P4KA 5EWIL 1ZHBA 2D31A 3C5ZC 3TBSA 4LHJB 1A14H 2W0LA 3OG4B 1WFTA 5IEKA 1ZHKA 4TSAH 4KWUA 1EEYA 4JFED 4F3FA 1GGBH 4P2RD 3T8XB 4OGXL 3BZFB 1A3RL 3MRBA 3NCCB 3NGBB 5DHVA 1JMZA 3MRPA 2X4QA 1ADQL 3N85L 4HUUB 3FONA 2HN7B 1OGAE 4JKMA 3MOQA 1EEZA 4C56D 1BD2D 4YXHL 1P4BL 3PWJB 4G8GD 1JP5A 3BPCA 3WS6C 3P9WB 1TCMA 1X5FA 4OF7A 1FHGA 1WAAA 2Y36L 1HHGB 5HD8D 5LGJA 4L8SB 1NGQH 4BFIA 5MENA 4S2SB 4G5ZL 3VMPA 3Q0HA 1IM9B 3QIBA 1KFAL 4PLNC 9CGTA 3T4AA 2PYFB 2CK0H 2Q1EA 2EO9A 2J6EL 5HHOD 5CUSH 2HH0H 2VAAA 4MS8D 1ZS8B 3MCG1 4XVSH 3RA7L 1Q0YL 4R0LC 4M62L 1FO0H 5BVJB 2G9HA 1DBML 5E5MA 5DJ0A 4MCYB 5L8LB 2R69H 4JFFE 4YHNB 2D7TL 4PUBL 4Q9RL 1OSPH 2H2PD 4RAHA 5JUEL 3S35X 3EIFA 2IGFL 3EOAA 35C8H 2LU4A 4Z18A 4X9HA 4KJQC 4ZPTA 1ITCA 1CG9A 1UM6L 2FYYA 1E4XH 2W9LA 3P9LA 2EKSA 5D7LB 4Y16A 3NCJL 2I07B 1A6VL 5LQBH 3DARA 3OHXA 4Y1AB 1XGQA 5B21A 1Y6MR 4M1GL 5J3HC 2VDLH 3BQUB 2Z31A 3UTSD 3DHMA 4AEFA 1K9TA 4XHQA 5L8JB 4MSWA 4LCWD 5GSVB 2NW2B 1U8HA 2NCMA 1VFUA 4GMTL 4OCNC 3VGEA 4K8RC 4GRMA 3PWPD 4WWKA 3VFGL 3UPRB 5F6IB 1A4JB 2Y23A 3GIZL 1LP9B 1LDSA 4WW1B 3BIKB 1EDQA 5ID1A 4NQCA 1T89A 1U41A 5I2IB 2PCPA 3T4YB 3FQTB 1PDKA 5GGVH 3PGDB 4WENB 2VQ1A 3WBDA 1ZANH 3C5SB 3QUYC 1XIWB 1QR4A 2CSPA 5JORA 2ARJB 2H9GA 3IDXL 4F7MB 4YC2B 4NT6B 4ZNEE 5IW6B 5DA4A 5IHZA 4G8EA 5F9AC 1YEDB 3R0NA 2OR8A 3GHEL 5ELIA 5J13B 4WEUD 2NXYD 4HIIA 5E7BA 2X7LB 3MV8E 1SVCP 1KJ3H 4L8CA 4H1LG 1BGXH 2YUZA 3OF6D 3ULUL 3H3KA 1CBVL 2YPVL 1D9KB 4KI5F 4NM8L 3HB3C 4KKCC 2NY6C 4FZEH 1A3LH 2VL5A 4QHNB 3RY4A 1BEYL 1FVCA 2J8UE 5AWNH 1HQRA 4LDLB 3V4UH 4OD1L 3P40A 4PJXB 5IT2L 3BSZH 3GK8H 3R06B 4HS3B 3MRMA 5CBAB 1X4ZA 3WLWC 2IQ9H 4UTBH 3QHFH 1UWGH 4G8FB 4GBXB 5I1EL 1DDHA 2OI9C 4XPHH 4QRPD 4XBPB 2A6DB 3IGAB 4NQXB 5EDXA 1NFDE 4KAQH 1LE9A 3CDGB 4G6AC 4HEME 1IAKB 3CSYB 1OAUL 5EU4A 4MD4A 3UEZA 1QKZH 4NUJA 5I1CL 4N0UB 2JJTC 1BWMA 3L3KA 3FMGL 5FKAB 1NUNB 4NO3A 4ZXBB 3BZEB 4A2LA 2BZDA 3B5TA 2GEEA 6FABH 2FR4A 5H37H 3BW9B 4L4TE 1AGFB 3CSGA 1ZLWH 3TNMB 1VEOA 3RJDA 4HIJA 2UZIH 4HQQL 3RKDC 2LABA 2DI9A 4X6FB 3AVEA 5JPMA 4OZHF 3T1FB 3KPSD 3WD5H 4K3EL 4NDMB 4K9EL 2KUTA 1EEUA 4O02H 3EAKA 4XXCC 4QRUA 1WZKA 3RY6C 5CD5C 4JFDD 2YOCA 4D9RE 5MP6H 3QRFM 1CGWA 3MLPA 3DECA 5D96C 1L9MA 5FYLH 3S37H 3CFJA 3M17B 3S5LG 5HYJE 2F15A 1XH3B 2B39A 1N5YL 4PRBA 5LXGH 1F2QA 5FK9A 3C6SA 1D6VL 4FXKA 1I9RL 4L8BB 4HUVB 4XVUC 5CGYC 4TULH 3QNYA 1PKQA 3OWEA 5IQ9B 3GSQA 4R4ND 3ULUE 2F54D 5L9DH 2VLMD 3OKEA 3HPLB 4HX1B 5C70A 1T21B 4TN9A 2X4SA 4P5MA 1RZ7H 5C92A 3U1SH 4YHYB 4TSCL 2LV4A 3D3VB 2XRAH 5AZEH 3ARGA 1ZT1B 3WCYA 5DYOB 1J8KA 3GRWL 3B4NA 3GMLB 1I4FA 5DK2B 1U58A 3QJHA 3QAZB 5HXMA 5FECB 4Q2ZB 3LKNB 3W39A 1DTUA 5J11B 3K2UL 2XYCA 3GJFA 2VDQH 3FRPG 2VXVH 3FHQA 5ANME 4MHHI 5JLZB 4FQJL 4RFNC 4AYFA 1RZIA 4PJGF 5FOBB 5C07E 2CJUL 2P45B 1CXFA 2C3XA 4JRYB 4PBXA 3GMOB 4N0FB 4NJ9H 4KMLB 5CJQH 3QFJE 5D6CA 1WCQA 5DD6B 1NCBL 4A6YA 4L29B 1F13A 4U1SB 2G75A 2IC2A 3FO1A 1X4YA 3W0WE 4WFHD 1KF9B 2CO7B 3Q5TA 1HQ4A 4ZUUA 3A6BL 4NGHH 4X4ME 2J7LA 3HTLX 3BH9A 3QUML 4EDWH 3RDTD 4PREB 5SWZB 3HZVB 3O6FC 4HPOL 1FL6B 4PGCB 3GM8A 5EU5A 2GTWB 4ZFFB 3ARBC 5FF6A 3KYMB 4ISVA 3LRHA 3IJHB 3BEVA 3LRSB 3K1DA 2XTJB 4M6AA 1LO0H 4PIRF 2FB4L 1HCVA 5BOZG 1I9JH 3BPOC 4WHDA 1U92A 2CDEA 4PJ5B 3MLVH 4DN4H 1V05A 4PRPA 3Q5YA 3QUXA 1PKOA 5FKPB 4MNGA 3HE6D 3QNZA 4AIZB 3PGFL 2WWMD 5IUSA 4NP4H 2OQJB 1UXWB 1Q38A 1R3HA 2WBJC 3AMKA 4P5TB 4NHCL 4PJ9C 3VFMB 3O2VL 4BZ2L 1GH7A 1FZKA 1DFBL 4ZG1A 3UBXA 5HBBA 5DQDL 3GBML 4RA0C 2DI8A 1HE7A 2CDGA 3VFUA 1X5ZA 5ICYB 4BUHA 4D0BA 4YBQC 4L4VB 4EQ2A 3FZUD 4NOBA 3HNSL 5GGSA 1CXLA 4DQOH 3HCVB 5E70A 1JHLH 1YYLH 4C55A 1T7VA 2BK8A 3WFEH 1I1YB 5C0FA 3RWJA 3TO2A 3WFHA 1AI1H 1TZHB 1TQCC 1BF8A 4GUPA 2NY7L 4UUJA 4HSQA 5DJ6B 3ULVD 1OP9A 4R2GB 3HNTL 1IT9L 4XMPL 3WNKA 4U1KB 3T3MF 5C0EB 5I6XB 1S7WB 4JLRA 3BH8B 3LMJL 4IDJH 3VWJB 1AC6A 1FGNH 2WLZA 1QLEH 4KI1A 2SEBA 4X7TB 2PW1B 1NSNH 2EDTA 5I16A 5BV7C 5E6ID 5A2KH 2NQCA 5EZLA 3C5JA 3MV8D 4XNQA 3VFVB 4P4KC 1MCRA 4YHPB 2C9AA 1LO3L 5KS9B 5IOPB 1IZJA 2NY3D 3CX2A 1NAKH 5T1MB 5F6HI 4GRLA 1QP1A 3O6ML 2W0PA 1JF5A 2WP3T 5BS0A 1IAOA 1DBJH 4MDJB 3WSQL 1BOGA 3WL9A 5EORL 2V2WB 3T2QA 4YHZH 5FDWB 4NO5A 2YKLL 3OJVC 1DJSA 4OZHB 1A6ZB 3K81A 4X7DC 5JA9A 2C1PA 4E5XA 1RURH 1MI5B 1JI1A 3U4BH 1E4XI 3NA4A 1C7TA 2MCPL 4JDZB 3L7FB 1NCUA 4MNQE 3IAQA 3VXRD 1KLFA 1A7BA 3ZTNL 1TZGH 1JUFB 1H3VA 1OP5K 3T8XA 3TPUB 3BZFA 4P2QD 1FAIL 1PX3A 2R8SH 1PY9A 3MJ6A 4ODUB 1LO5B 4UAOC 4HUUA 2HN7A 3S97C 2YZ1A 3PWJA 5HDQL 1SEQH 5HSFA 3RL1B 5JQ6H 3N9GH 4YBLB 1Y0LB 3OL2A 1QSED 1HHGA 4L8SA 4ONGL 3UPAA 4S2SA 1IM9A 4OFPA 4U1HB 4JHWH 2HMID 5DRXB 3MREB 2PYFA 4OLZH 2CKBL 1LDPL 4R7DB 4TSAL 4Y16C 1ZS8A 3KLSA 1QHPA 2EDXA 1YUHB 3GSXA 4HUWB 2DF3A 5DVKA 2Z31C 1IAIH 5F8RC 4NQDB 3JWDH 5BVJA 1J10A 5AYUH 4MCYA 3O2WH 1JGUH 3B8YA 3HUJE 5CHNB 3V4VH 3EUUA 4WWKC 3FN0L 1EZVY 2PN5A 2VITB 4GLRI 4D3CL 3ZZ1A 4YHNA 4JFXB 1F4XL 4NFDA 3GKWH 3PDOB 4QOKE 1EJ6A 5EIVA 4PJGB 3SO3C 2A38A 4HG4K 4JFOB 3MPCA 3QXVA 4OLYL 5DZNA 3MV7B 2X2YA 4WCYL 3O6LL 5D7LA 1ZKAA 5CIPB 3CC5B 2I07A 4R90H 4Y1AA 4GMSH 2ILLA 3BQUA 1NFIB 1MLCB 2R9HD 4Y5VA 5HPOA 1IRAY 3L3OB 1L0QA 4ZUVB 5GSVA 2NW2A 5I0ZA 1IGJB 4YXKL 3JV6A 4X6CE 3V9FA 2UVEA 4HH9B 2EIEA 4IOIB 3UPRA 1A4JA 2E5EA 4LP5A 4Z7OF 1LP9A 4M9OA 1HH9B 2PYEB 1J0ZA 4WW1A 5GS0H 3BIKA 5JZ7C 3ARFD 4Z7NE 5I2IA 4DTGL 3FKUS 1WBYB 3T4YA 1G1CA 3FQTA 4NCC2 35C8L 3PGDA 4OGYH 4BQCA 4JG0H 1TJGL 4LRNL 2VDOL 3C5SA 1OF2B 3V4PH 1XIWA 2HT3C 3OKLB 2WAHA 4L3EE 4NZJA 2ARJA 3KLDA 1MJ7H 1BZ9A 1XGYH 4F7MA 1TPXB 4U05A 4NT6A 2XFXB 4XBEL 3V52L 1NUFA 1S7TB 2VDLL 3UTPE 5IW6A 1YEDA 4JANB 4QRRD 3QCTL 3HHRB 4ODWB 1A5FL 1UYWL 2KQMA 5IKCB 5A2LH 1CICD 1JZ5A 5E4EB 2EH8H 2X7LA 4OUOA 2XN9D 3VXQB 1RIUH 3OJ2C 5K93A 3OB8A 1HINL 5DT1L 1D9KA 4QHNA 1R6VA 2ITCB 4H88H 4JQIL 5E9DD 1U8OB 4EEEA 4KZEL 2ADIB 4G8GB 4E41D 3TA3D 1RPQA 4PJXA 3R06A 4HS3A 4CN1A 5CBAA 3IT8D 1DCLA 1AE6H 4H8WH 4GXVH 4G8FA 3PDGA 4GBXA 4JREC 4EI5A 1KB5L 3FFCE 4TTDD 4XBPA 2A6DA 1EGJH 3IGAA 4NQXA 1NUGA 5EO0A 3CDGA 5A16B 5GQBA 4U4BA 1QSVA 1IAKA 3CSYA 3ARRA 4F7CA 1KJ3L 4N0UA 4OCWH 5MI0B 3VDBA 1NH6A 4PV9B 1BGXL 4F7TB 5FKAA 3TFKD 1L6XA 3CPLB 2XA8L 2YZ8A 4ZXBA 2QADD 4HUNB 3ZKSD 2F5BH 3BW9A 3GI9L 3RWGB 1AGFA 3TNMA 4JO3H 4UBDD 4OI8A 2VH5L 4K3DH 4X6FA 4Z0BH 3V4UL 3M45A 4P3CL 1RZKC 3T1FA 3GK8L 5F3HB 1KNOB 1IGTB 4NDMA 3AS3A 2PXYD 2YK1L 3OAUH 2J4WH 3UMTA 3K0WA 4M93C 2MCG1 3CJJA 5FGCE 5C09E 3GKZA 3QJFA 3GMQB 5F1NB 4E42B 1IC5H 2P44B 2F5AL 2VR4A 4OUUB 4PP2B 4XP9H 2LVCA 4LLVB 3M17A 2L0DA 1XH3A 4FHBD 5GGRB 1KCUL 1JPTH 1ND0B 3P11L 4L8BA 2UZIL 4HUVA 5EBGA 4GG6B 4QTHB 1CGXA 4WO4D 1MREH 5IQ9A 3AU1B 3WD5L 3RVUD 3MGTB 1WBXB 1QVOB 1AD0B 3P0VH 3HPLA 4HX1A 1T21A 3DVNB 2QR0B 5GJTH 3QISA 1G9MH 1QG3A 5EOCJ 1PG7X 3PHQB 3S36H 1P7QB 3D3VA 4NFBA 5MP6L 2XT1B 3SDAD 1ZT1A 5DYOA 4RGNC 3WJJA 1ED3B 3GMLA 3V8CA 4XWOD 5DK2A 4KZDL 2VN4A 3MBED 4LEXH 1MCDA 5FECA 1FG2B 1Q9LB 1U6AH 3DUUB 4Q2ZA 3LKNA 3UYOD 4K94H 3GSUB 2VKXA 4DK6A 5JLZA 4WFFE 4HWUA 4YUEL 5D7IF 3NPZB 4TULL 5FOBA 3CCHB 3RTQB 2FO1A 2A9NL 3ULVF 4R3SB 5I1GL 3AROA 3OBAA 4JRYA 15C8H 3GMOA 4N0FA 2NY5L 4DN3L 5IIEB 5DD6A 5JHDE 4HCRA 4L29A 4U1SA 3U1SL 1EHLH 5I74B 1AO7D 2XRAL 5AZEL 3BI9X 4OLVH 3IS0X 2V9RA 4MWFB 5HGDB 4NNPL 4PREA 3CFKB 5SWZA 3HZVA 4XNZB 1VCAA 1FL6A 4PGCA 5HTSA 3MNZB 4OSUL 1INEL 2I5YL 2E6JA 2GTWA 5E0QA 4ZFFA 3UP1A 1UA6H 3QYCA 3KYMA 3LS5H 1YPZE 2VXVL 3VG0L 3T2NH 1F6LL 3IJHA 3LRSA 5I0DA 5D1XD 3WHE1 4NQED 1J5OL 4QRQB 5C0BB 2J8UF 4N68A 4UI2A 5E2JA 2Q8AL 4PJ5A 5EUOB 1I1AB 5FKPA 5CEZH 5CILH 4AIZA 3S98A 5JXED 3LKSA 3C09B 2OQJA 1I8MB 2IQAB 5ADPL 1UXWA 4P5TA 5L88H 4GAGL 1RVFH 1R5IB 3FN9A 3VFMA 1SBSH 4NGHL 1AJ7L 5KAQF 5T3XD 5ICYA 2KL6A 4FQQB 4L4VA 5KSBE 2F8XC 3P0YH 1EHXA 1EAJA 4PJAF 2Y25A 3HCVA 2DQUH 4KY1H 5I1KL 3FB5B 1NC2A 1UJ3C 3MRJB 2GJJA 3ES6A 1C5DB 1I1YA 3LD8C 4IRZL 1B3JA 1TZHA 3OV6A 3ARXA 4PJFB 1K4CB 5DJ6A 4PGDB 5FCUL 3FT3B 5DHVH 4NPYB 5IROA 1F5WA 1QEWB 2F54B 4U1KA 5C0EA 1S7WA 4NC0B 3BH8A 3VWJA 3DGCR 3QRGL 4ELKB 2X1WL 2OP4H 4X7TA 2PW1A 3PWNB 1JI2A 5E03A 5LCVH 3EOTH 4PR5B 5FB8B 4IOFC 1I3VA 2VXSH 1YY9D 1FZMB 5HYQB 1FV1B 3FB7B 3VFVA 1BZQK 1SVZA 1YYLL 4YHPA 5EULV 4J4PC 4ZQKB 3BO8B 2AEQL 3MUZ1 5KS9A 5EA0H 3MLRH 5IOPA 3I6LD 5D4QA 2YR3A 5T1MA 1IAII 1OGAB 3CMOH 1SBBA 4Z77B 2PO6D 1XF5B 3NGBC 1A1OB 3D87B 5KAQG 2IFFL 4L9DA 1U8LB 1KN4H 3RRQA 4MDJA 1A7PL 4KJWC 4HGMA 3FRPA 4JPWH 3P4MB 2V2WA 1FGNL 5FDWA 1QLEL 4OZHA 1A6ZA 5JW3L 1UCBL 1NSNL 1DSFL 1EIBA 1MI5A 2E3VA 4LPUA 4RNRB 5D1QB 4HKZB 5IMKB 3U9UB 3HFMH 4JDZA 4L8SC 2X9WA 4ZOCA 2B7DT 3L7FA 1VPOL 1I1RA 2J88H 3I85A 1Q1JH 5HVWA 3E6HB 3UXFA 3G5YB 5FO7B 1JUFA 1KJMB 4D9LH 4NQVB 1DQLH 3TPUA 4CW1B 4UZGA 4XC1H 3V6OA 4JFFB 4ODUA 1LO5A 3U36B 4HIHB 2AAVA 2W60B 1RU9L 2MQCA 1DBJL 3N1PC 4J3TA 2UUDK 3RL1A 2R0LH 4OTXH 5I1DB 3OPZL 1Y0LA 3DUHA 4CVZB 4OQTA 2EXWC 1I9EA 3SDXF 3AREC 2ITDB 3M1BB 4U1HA 3ILQD 5DRXA 2NR6C 3HI5L 3MLWL 3MREA 1GZQB 1Z6JT 4MB3A 4XVJL 4R7DA 3RHWF 3LQAC 5K9JH 1TVHB 4ZO7A 5D6DA 2AKRB 1YUHA 2EIZB 1CS6A 2IAMB 4HUWA 1A4KB 5FO9B 4EUPG 4I2XE 1SQ2N 3O41B 1C7SA 4NQDA 4FP8H 4M02A 3O4OB 5CHNA 3BDBA 1NFKA 2FRGP 2DJSA 2VDPH 2VITA 5F6IC 3MTRA 4JFXA 1SEQL 3LPWA 3PDOA 5D7IB 1BFTA 4PJGA 3N9GL 2JB5H 3TBWB 4JFOA 1FFPB 3MJ8B 4KK5D 4X7SH 3MV7A 3MYJB 4DEPC 3BOVA 5TDOB 1B88A 2YWYA 3A6CL 1A47A 1J9CT 5GZOC 2BNRE 3SEPA 5CIPA 3CC5A 1KBGL 2GHWB 2R0KL 4Y2OA 1K4DB 1NFIA 4YC2C 1MLCA 5F9DC 3MA7B 1A7RL 3MCKB 2FDBP 3KYNB 3L3OA 1GYAA 1FVEB 1CR9L 5HPMB 3MV8B 1IGJA 3P3YA 2CUIA 3JWDL 4HH9A 4IOIA 4KRPC 3PL6B 3MJ9H 1OAQL 1HH9A 5DRWB 2PYEA 4PLKC 4LSSH 4OCYH 2FATH 4JB9H 3MRQB 1HDMA 2EZ0C 3UTTD 4AIXA 1WBYA 1S8DB 4CUCA 5C6TH 2AEPL 5D8JH 3GMRB 2F53E 1F58L 2J8UB 3BMWA 2Z8VC 5F1KC 4LHUA 1A8JH 1OF2A 3VGBA 1PW3A 3O6KH 3OKLA 1MQKH 4OV5B 1DEDA 3DMMD 3WE6B 4F9PA 2XFXA 4UQ2B 1S7TA 4Y89A 3OKYA 5BO1H 5DLMH 1NFDB 4RBPH 5KSAB 2VLRE 2XIDA 1TNNA 1ZLSH 4ODWA 1NBVH 3ALWA 2AERT 5IKCA 1VB9A 5I18H 4R9HA 3VXQA 1TTUA 2VZTA 1I85A 3PXJA 1F90L 4JY5H 4L4TB 3DVIA 1CD0A 5IFAH 2MQ0A 5F44A 5DSCB 5ALCH 4PRDB 4OFVA 4ZXBC 3O2DA 1MRFH 4Z5RB 2FECI 4JM4H 1IMHC 1OGTB 3DURB 1KYOK 2ITCA 2VABB 1U8OA 2VJXA 2ADIA 4JO2H 4ZAKD 1S7VB 4G8GA 4RGOL 1KCLA 4KTEH 4NYLB 1QSEB 2FEEL 3T0XA 4XVTH 2Q87A 4ZOBA 3OG6B 2MFNA 4K71B 4ORZC 4TPRL 1P69B 5A16A 3SE9L 1JGEB 2AGJH 2BMKB 3DNKA 5HYJB 5F71A 1RIUL 5FYLD 4L4JA 4PV9A 3O8XB 2OJEB 4F7TA 3CPLA 3B9KD 2VDKH 1I9IH 3LQZB 4E0RB 3BGMB 1RUQH 4Y2DD 5GRUH 3RWGA 1IVLA 4OIBA 2ZP0T 3EO1B 2VDNH 2X1QA 4N9GB 5F3HA 1KNOA 1IGTA 1QRKA 3LS4L 4OIIH 1MWAB 1AE6L 3SQOH 4JZNB 2HWZH 1HILB 5JW4M 4G6JL 5AG8A 5C2BH 2OL3H 2JELL 1VFMA 2P8LB 1UWEH 3GMQA 4YHYC 1UADC 3RX8A 5F1NA 4E42A 1CLYL 4OUUA 4PP2A 4LLVA 3WJJC 4Y19D 3DLQR 2ZCHL 1GHFH 1HOCB 3MR9B 5GGRA 2IPUG 5J11C 1Y18B 5C07B 1ND0A 4GO6B 3SDDB 4YHOH 4GG6A 4QTHA 4DZ8B 2D7MA 3AU1A 3MGTA 1GGYA 1WBXA 3QFJB 1F00I 1QVOA 5KVFH 4MVBD 1AD0A 5EPMB 4EN3D 4KC3B 3DVNA 4XBGB 4B7IA 3W0WB 2QR0A 5ISZD 4P9MH 4YDJB 2HRPH 1U95B 1P7QA 1NLBL 5F21B 1J88A 4IRSD 3BUTA 4OIAA 1NCTA 1ED3A 1YA5A 4X6CF 3D85D 2D7PA 1MCNA 5T1DL 4HIEB 1FG2A 1Q9LA 2D03H 3DUUA 1GOGA 1CGTA 1JF6A 1KN2L 4Q0XL 4UTAH 3GSUA 4UOW0 4Z7NF 1T22B 1FNFA 2FECL 3LPGA 5F7FA 3HZYA 3P0GB 5GGUB 3OF6A 4NO0D 3STBA 2V7HB 2DQEL 3CCHA 3RTQA 4R3SA 1KPVB 3KPRE 2XTJC 1L7TL 3QEGL 3SDCD 1P9MA 1MIML 2NY4B 5IIEA 5B4MC 1N5AB 3AUVA 2X9YA 3TA3B 3UJIH 1V7MH 4BJLA 3VXOB 4MWFA 5HGDA 5EZJB 1O0VA 3CFKA 4LSQL 2ZPKH 1R5WB 3MNZA 1ZLWK 3QI9B 1J7VR 5FUCC 3ZYJA 2FHBA 4F33B 3CLEL 3H3PL 2KZ1B 4N8VG 5F88B 5I19H 2HVKB 5HI4C 1BF2A 4QRQA 5C0BA 1VENA 5HHXH 1N0XL 4TYUA 1JZ6A 15C8L 1AXTL 5EUOA 1VKXB 1I1AA 3DXAE 4JZOB 1OTUD 3SGDH 1CGYA 3RVXD 3BAEH 1D6EB 1G6RL 2IAND 4YK4C 5C0DB 4KI5C 1I8MA 2IQAA 3B9EA 4MB4A 3ET9F 2PXYB 1M05B 1R5IA 5C08D 3OKNB 5I1IH 5IROC 5I6XC 5CINH 4UT9H 4XP6H 3VWJC 2FD6H 5FV2A 4FQQA 1CTNA 1H3WM 1SM3H 4L9LB 4LLYA 3QUMB 5DR5L 2ZG3A 3T2NL 4DGVH 1T0NB 4FFVC 4HBCH 3ZE2E 3FB5A 4HXBL 3MRJA 5FYKD 1D5IL 1C5DA 3MUJA 1OM3H 3MRHB 5JR1H 4D8PB 4PJFA 1K4CA 1N4XH 4PGDA 1FNEB 4KDVA 3FT3A 2I9LB 2YUVA 5A2IH 3LKPB 4NPYA 4APQC 1QEWA 5L88L 2F54A 1WFUA 4ERSH 3R8QA 5I76A 3JV4B 3A67L 4JVWA 1S9KC 1NGWB 3ARQA 3PWNA 1QUNA 4WI5A 4PR5A 4BZ1L 5FB8A 1OHQA 1W8OA 2VISB 4JDTL 3D5OF 1FZMA 4MNQB 5DFTA 5EIIB 1FV1A 5B39B 5HYQA 1FFQA 3FB7A 1CDIA 2EXYC 3CIQA 3RIAK 4KQ3H 1AQDB 5GZND 1N0LA 3QQ9C 5IMOB 4TVPL 4ZQKA 3BO8A 4O4YL 4OCSH 2UVFA 3CH8A 3X3FL 2ATPB 1RUML 2DRUA 1OGAA 5DEGB 5D7KE 4Z77A 4G43B 1XF5A 1JPFB 2ZUQC 5GRJH 2CPCA 1A1OA 2ESVE 4NZRH 4TRPH 4U1NB 3T08A 4DKDC 1JL8A 5ABDE 5L6YH 4PJ7E 3V6OC 1AR1C 1U8LA 5DD5H 4XMKH 1KC5H 2NMSA 5TF0A 3P4MA 2PKDA 3MQIA 2OK0L 4YE4L 5F7UA 4ZTPL 1LO4L 5D71H 2QQQA 1PLGL 3EOTL 4YBLC 1AO7B 5LCVL 4D0DB 4RNRA 2VXSL 5D1QA 2Y4SA 4HKZA 5IESH 5IMKA 3U9UA 3WIFB 1FL3B 4OM1L 2BY3A 3MACL 4EZMA 3DPBA 5E8DL 3G5YA 3GSNH 4GT7A 5FO7A 1AC0A 3NN8B 1KJMA 4KJYB 4NQVA 1KJ2H 1QA9B 4CW1A 1YNTB 3HUJB 3CMOL 5MEPB 2XQYK 4KU1A 4JFFA 5D1XB 3U36A 4HIHA 3HC0B 2HKHH 5A2FA 2W60A 3OAZH 2JE8A 3L5XL 1I8KB 3L3JB 4QOKB 1U3ZA 3BVNA 1IQWL 3D9AH 5I1DA 2BHUA 3W5MA 4Z7QF 1F3RB 2YPLE 4RFOL 4OT1L 3HAEH 4CVZA 1DLHB 3CVHB 3QUYD 4TNWK 1FYTE 2ITDA 3M1BA 3VXPB 1CE6B 1TQBB 3HFML 5DEZA 1NL0L 4GXUM 5J9PB 2W65B 1GZQA 3CLFL 4MJ2A 4YHLH 5GGQH 1TVHA 4X5XB 5F8QC 3BESR 2EIZA 2IAMA 4X6CB 1A4KA 5FO9A 3O41A 2V9TA 1IGML 5LWYH 4PPTA 1FIGH 4XC1L 4ORGB 4OZGE 1FC1A 1MH5B 2B0SL 3JWOC 4LSPL 4TVPE 4OFYA 5JOFB 3EYQC 2WSKA 4OLWL 2R0LL 4NKOB 4OTXL 1KGCD 3TBWA 2RJMA 1FFPA 1ADQA 3MJ8A 1CLOH 4L3EB 5JHLH 3MYJA 5L7XL 2AJSH 2CLRB 5TDOA 5H8DA 2MWCA 2Q8BH 2KDGA 4M48H 1KCVL 4KUZH 4ZNEA 1U8NB 2BFVL 3K4DA 4MLSA 1MY5A 2V17H 1K2DB 1K4DA 1TPXC 2R4SH 1CGSL 3MA7A 3CMGA 4KROD 1WIUA 5IHBA 2E7CA 3MCKA 3KYNA 5IJVB 4XAKE 1FVEA 5HPMA 3MV8A 4JG1H 2CKBB 2J6EA 1MHCB 2AABH 4KXZH 2GSGB 3PL6A 1TZIB 4HF5L 3LDBB 3VXSD 3KS0J 5DRWA 5J06A 3MRQA 2X4NB 4UQ3B 1MHPH 3U7WH 5F9WB 2Z8WC 2JB5L 1I85C 3GMRA 43CAB 2J8UA 1J8HD 4HFUL 3REVB 4X7SL 5KG9B 3KPOB 4Q9CA 4X5WB 4OV5A 2Y1VA 1JIBA 3QP3A 3G6AB 3WE6A 2ID5A 3NCYS 4UQ2A 4RRPG 2X4TB 1NFDA 5KSAA 5CD5D 5SWSD 4P4RB 5HD8C 3HC4L 1BM3H 1UM4L 4HFWB 4M5ZH 4E9LA 5FUZL 4FNLL 3MJ9L 1IGCL 5I1JL 5FIEA 3U30C 1N3NB 1VACB 4NBZB 2CO6B 5F3BB 3U48A 5MI0C 4L4TA 5K33A 3EYFB 2BJMH 3RWFB 4PRDA 3BE1H 4Z5RA 3C8KB 1OGTA 3DURA 2VABA 5E5RB 1MQKL 1S7VA 2DI7A 4JM2F 3CX5J 1LEGA 4QT5B 2H32H 3CAFA 4NYLA 5E6YA 1QSEA 5FGCB 3GI8H 3IDUA 4WJ5A 4CMMB 5C09B 2HJFB 3MNWB 5GHWH 1A9BB 1HNFA 5ETUB 4ZFGL 1JGEA 3TIDB 3VFRB 5T5FH 1TJIL 2BMKA 2VLKD 5HYJA 3Q6GH 1ITBB 2QQNH 3O8XA 4LEOB 1R3LA 4Z7VE 4G9DB 1LO2L 4JY5L 2W9EH 2ZG2A 5EOQH 5IFAL 3LQZA 4UB0H 4E0RA 2EDWA 4XMLH 1MRFL 4JM4L 4XPAH 1LVEA 3M8OH 3CXDL 3EO1A 3Q1SL 4N9GA 1NC4A 4BQ9A 5CFHA 1MWAA 1V3LA 5GRZA 4XVTL 4JGMA 3ZMRA 4JZNA 5IFHH 1BBDH 1HILA 1DBBH 4OCRH 2PNDA 2P8LA 3X17A 4NZTH 2OS7A 1KB5B 5GGSY 1DBAH 2FEDC 4GFTB 4M61B 1HXMB 1I9IL 2W38A 4R6UA 5CMAB 1HOCA 3MR9A 4XCCH 4LCUB 2ED9A 2NXYC 1Y18A 5DZLA 5C07A 3SDDA 3V95A 1WITA 4DZ8A 4ZS7H 1T2QH 2FX9H 2YSSB 5FM5M 1G84A 3QFJA 4KQ4H 2VKWA 1DN0B 1OCWH 4OIIL 5EPMA 4XB8A 4UIKL 4U3CA 4XBGA 3SQOL 4XAWH 3W0WA 5C0CE 1CVSC 3HR6A 4YDJA 2ADGB 2OL3L 3SGDI 3P30L 1U95A 4X4MA 5D2LE 4HAFA 4LOUC 4XP1L 2WBJD 2D4DA 4PJ9D 2AEIT 2BHYA 5I74C 3ILPB 3LIZH 4ZTOH 4HIEA 1TETH 3MC0A 2GCYB 3KHQA 2IPKB 5C0AE 3VXMD 4XNZC 2DDQL 4YDVB 2WANA 1T22A 4Y88A 3WO3B 2Z0BA 3ALPA 5D1ZB 4M6MH 5DMJB 5GGUA 1H8OA 2W07A 3S88L 1R3IH 2V7HA 3NFNB 4XPTL 1KXTB 1KPVA 1KIPB 1JNNL 5KVFL 1VSCA 2Q76B 5SX5K 4PP1D 3ZE1E 4KHTH 5H35B 3T0AA 4PJCF 5IB1B 1N5AA 4M7LH 1ZE3C 2F58L 5CEZD 4WI4A 2DD8H 3TA3A 1I1AC 4LLAA 3EO0B 4O58H 4QNPF 1JPGB 3VXOA 2P8PB 1V3MA 3C09C 1X9QA 3VWKB 1CFQB 3NABH 5EZJA 4PJ8D 3C8HA 5KSBB 2AJXH 4O2FB 3BDYH 3NZ8B 4GKSB 1H3PL 1R5WA 4IMKC 4N1HB 3S9DB 4XXDB 3QI9A 3GRWA 4F33A 4QO1A 5E2UH 3WDIA 2BCKB 2C3GA 3MRIB 4X99B 4NKQB 1JNHB 1NEZA 1J0IA 5F88A 2HVKA 5E5UB 3EO9H 4XWGH 2Y07H 1VKXA 4JZOA 4U1GC 3D18B 3U7YH 5TH2B 1D6EA 5C0DA 2X89D 5CCKH 1HKFA 2PXYA 1UKQA 1M05A 4K23H 3OKNA 1Q9OB 1QPPA 1SMOA 4R4NC 5C0ND 4OLUL 2IPTH 2P49B 2ZUSA 4LCIH 2ZZUT 2ZPKL 3HG1E 4C59B 2Q7YB 3B2VL 4RGMC 4L9LA 3VH8B 2JIXB 2AXFB 3KR3L 4JJHA 4AT6B 1OARH 3OB0K 3QUMA 4PB9H 5MEND 4KKBC 1KTLB 2X09A 4YH6A 3QIBD 1WZLA 5I19L 3RUGF 2V9QA 2B4CH 3TYGH 5HHXL 1A0QL 4G9FE 2BVPB 2EDBA 3DI3B 4DUWA 4MXVE 4YX2L 3MRHA 4K7PY 4HIXH 1FH5L 5GPRA 2H3NB 4D8PA 4HT1H 1NKOA 3BAEL 2I9LA 4AEIH 2D7QA 2FJHB 2OZ4H 1I8IA 5F7MC 5CBEB 4CJ0A 4EN3B 2WZPD 3JV4A 4JM2B 1NGWA 2O5ZL 4NSKB 2AJVL 2HLFD 4NQSB 2BVUA 2VISA 4MNQA 4HMDA 1SM3L 5EIIA 3DTXB 5B39A 1G9NL 2E8ZA 4HBCL 1AQDA 4IIQC 1MCLA 4AMKH 5IMOA 5IBLD 3VI4E 3UC0L 2Z31D 4AZ8A 2ATPA 1CD9B 1OM3L 1CI5A 5DEGA 2QSTA 4G43A 4NO0B 1JPFA 3SDYH 5CJXA 4U1NA 3EYSH 3O3AB 4WWKD 3F62A 3S7GA 2FJFB 1JZ8A 3DX6B 4LSDA 3BKJH 3ELAT 5C0RH 3VXNB 4NQCD 3MLYL 4OCXH 3TH2T 1AO7A 2O5YL 4D0DA 3HE6C 3IVKB 3WIFA 2PR4L 1FL3A 2ICES 3LEYH 4KQ3L 1LGVA 4I2XB 1Z9OA 3NN8A 1UENA 4KJYA 4OCSL 3K46A 1QA9A 1YNTA 3QDME 4OCMC 3HUJA 4HKBB 3EYVA 2IAMC 1H3XA 5MEPA 3FZUC 1NCCL 4KXZI 3VGHA 3HC0A 1A2YB 3QXWA 4NZRL 3ARDB 3G6JE 5L6YL 1I8KA 3L3JA 4QOKA 5K9QG 4XMKL 3O4OC 3ZHKA 5JZ7D 1KC5L 4XTRD 5LG1A 1AH1A 5HVHB 1S9YA 5K9OB 2J8HA 4TQEH 5FEBA 2NZ9C 4JY4A 3CVHA 5D71L 1JFQH 5FHBL 3ULVC 3VXPA 5M95B 1CE6A 2ENYA 4C57C 5IESL 3OGCB 3L7EB 1O7SA 5J9PA 2W65A 4TUOB 4WI6A 4X5XA 3D2UD 3B5GA 3L1OL 4RMUA 4ZO8A 3GSNL 3EFDL 3T2OA 1H9VA 3W5NA 4XPGH 3MGAA 4X6CA 2ED8A 4YDLC 4GQPH 4RDQG 3D39E 4ZOEA 2CRZA 2XV6B 1WZ1H 5E6IC 1GPOH 4I4WB 4ONOA 1RI8A 3L3IB 4YZFE 1MH5A 1F6FB 1ACZA 4OGAD 4KK6D 3PL6C 5JO5B 1RJYB 5JOFA 1E27B 1NAML 2DQDH 4PJDE 3OGOE 4YGVB 4ZSOE 4NKOA 5HGBB 2R4RH 2HVJB 5IR1B 2VDMH 4UINL 5C0CD 4L3EA 3QDHA 2NY3C 2GY5A 4L5FH 4PY8I 1GJIA 2CLRA 5H94B 4S1QL 2FBJH 3O2DH 2E7BA 3U6RB 1MFCH 4WI8A 1D5BA 2DIJA 4YHLL 5GGQL 1K2DA 2VLRB 2KBGA 1JYXA 5DXWA 5IB4B 3ZE2F 2X4RB 5IJVA 5B22A 2E6QA 5DUMH 5CKGA 2CKBA 3QG7L 3WKMH 2XKNB 1MHCA 3BX7C 2GSGA 4GKZB 1TZIA 3GGWB 1MJ8L 5MHSE 3HC3L 4MGXA 1ZLUH 5BW7A 5IWLA 3N1GC 2X4NA 2MTPA 1MELA 3BPNB 1T1WB 4UQ3A 5HHME 4FQLL 5TE7L 1X5JA 4NM4H 43CAA 1HHKB 5INCB 3REVA 5ID0B 2B1AL 5JHLL 1WT5A 5KG9A 3KPOA 1VGEH 1ZHNB 4X5WA 3VXUE 3TT1L 1PEWA 2QHRH 4KUZL 1CDCA 1TVBB 4QYOA 3G6AA 1CZ8L 3FFCA 3DV6B 4LASH 2X4TA 4KK8D 1SYVB 4HS8H 4P4RA 3KYKL 3AM8C 1A21A 3BN9C 4EVNB 4HFWA 4K71C 1UH4A 2VQUA 3IFNH 5DZOA 3ARGD 3WLBB 1N3NA 4R97B 1VACA 5F3BA 3BKYH 4Y4KB 3S34H 3U7WL 1QFWM 3EYFA 1GC1H 1X5HA 3GUTB 4NZUH 3RWFA 4NWUL 3NVQA 1FPTH 2K7QA 2QSQA 3C8KA 1FVDB 1TJHL 1IC7H 4KUCF 1T7WA 4OM0H 1P4IH 1XR9B 1FBIH 3EJYC 3QQ4B 4QT5A 4CJ1A 3LY6A 5DVNA 3B2UC 4MXQD 4CMMA 3MA9H 5C09A 2HJFA 5GS1B 2XZCL 4UOW1 4LARL 1T6WA 3MNWA 3H9SE 4Y4HB 4DJMA 1A9BA 5FYKL 5ETUA 4M5ZL 3TIDA 3VFRA 4RGND 2CK2A 1K6QL 1EZVX 3L5HA 4WFGD 3SJVE 4LEOA