3QUKB

Crystal structures of the murine class i major histocompatibility complex h-2db in complex with lcmv-derived gp33 altered peptide ligand (y4a)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Unexpected T-cell recognition of an altered peptide ligand is driven by reversed thermodynamics.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 14
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qukB00
1DUYA 2PTUA 1NCDL 4WY7H 5C0BD 4KTEL 3HUJF 4FZEH 4HDIB 5E7FA 5JDSB 4OCSH 4P9ML 1HHGB 1UYWL 4PBWD 5SWSA 1QYGL 4U1GC 3OF6A 5IBLD 4QHKI 2JKXA 4O02L 1TZGH 2VXTL 4OF5A 4ZTOL 3OX8B 5ESAA 3TF7C 2FEEL 2CDEB 2D7OA 2NY2C 4TSBH 3RIAK 1MPAH 4UILH 3F65A 3VE0B 1F4HA 4KROD 2DF3A 2V6HA 3H9SA 3TYGH 4NRXB 4JM4L 5JIPA 5IIEB 3OKOB 4NBXB 5F97E 3BUYB 4X6CB 5E5MA 5F1NA 4U05A 3F5WB 1HH6A 4LIQE 4CJ0A 1S9VB 5IM7A 1A8JH 2VDOL 4QHUA 5GGTH 1KYOJ 3AUVA 2YUZA 1V7ML 4X6CE 3O9WD 1W8NA 5DJYA 3RX5A 4OZ4A 4IRJC 3PGFH 3D0LB 5BRZB 5FECA 2A9MH 3RI5K 4I2XA 5FYKU 5DMKA 4F9PA 3TO4D 3ZO0A 4CVWA 3CIQA 3IFLH 3QISA 4XX1G 3UC0H 4ZPVA 5TDOB 3RWIA 3BT2L 1NL0H 3KPSD 4OKVA 2Y36L 4GRMA 2JIXB 4XI5D 3SDDD 1PKOA 3EFFA 1XF4B 1PFCA 5L9DL 2BP3A 4PJ5D 2GJ6D 1GGIL 3RWCB 4TULL 5J3HC 1AHWC 2AABH 5DUPH 4FNLH 2GT9B 3MV7A 4IBLT 3QDGD 1BM3L 3DMMA 1BJ1H 2EEAA 4R9HA 5AEAA 1PLGL 1UXSB 4EXPX 1QA9B 3GBNH 4KI5D 3FT4A 2NY4D 3JV4B 2B4CL 1FV1A 4X6FB 2EDDA 3QXVA 2OQJB 2FR4A 4H1LA 4FTVD 3TA3A 4JRYA 3OB8A 4WFGD 3WDJA 4NOFA 1RUKL 2X4TB 3LPGA 4W4OC 1X9QA 3P4OB 1N5YH 2E9BA 4RMWA 1DVFD 5HYJA 3VXMA 4P3CL 2BVQB 2EIZA 3P77B 1G7MA 3VFMA 4G8GA 2WQRA 4MX7A 1IC7L 4ELMA 3EO9H 1KJ2B 5FKPB 4GAJH 1UQSB 3LEXA 4HHAA 1XF3B 4G43B 5GRJH 1IFHL 3T0AA 1IAKA 3ARGA 4DEPB 4FFVC 3V8CA 4I13B 2YBRB 4F15C 4U1NB 4S0TD 1A3LH 4J1UA 1F90H 1S9WA 4PJXA 2FSEB 4X8JB 5C0CE 5KVGH 1BZ7A 3RL2A 5DYOB 2VLJB 1A3QA 1XT5A 3KR3H 3SDCA 4PRDB 1MWAB 3B43A 2QQNH 1A22B 3DX7B 1CK0L 1EUTA 4K7FB 4QNPE 3B9DA 2C3XA 3QG7L 1DQLH 1QHPA 5DJAA 3FB5A 5D71L 2VQUA 4PGBB 4Y4FA 3LZFL 5C9KA 3E8UL 3NZ8B 3S4SB 4FQJH 1QO3B 3CH8A 1CFNB 3VFOB 1AXSB 4Y4HD 2CQVA 3OAUL 3TJEL 1LVEA 1CGSH 4I9WD 3VFWB 4U6XB 3FN0L 3CX5J 4LPCA 2DQDL 3BJLA 1QR1A 4YGAB 3MUGB 2AV7A 2AJXH 3AM8A 4YDKL 5IB1A 1JNLH 3NTCH 3RGVD 2AK4B 3D25A 3BQUD 4KAQH 4ONGH 2VLRD 4Z78B 2EE6A 4BUHA 1T20B 4R4FL 3R8BB 4ERSH 1DQDH 2AK4E 4LRNH 2ZG3A 5K9JL 4KHXH 1FCCA 2ICWI 3T0WA 2D31B 4TTGA 3SKOA 3QCTH 5GSRB 1MHCB 4BELD 5HD8D 3JWDH 1KLFA 4G42A 2ZCLL 3HAEB 1WLHA 2MHAA 4MWFB 1JPSL 4K7PX 4PJGE 5ANMB 2NMSA 2XZQL 2M1KA 2ADGB 2ARJA 5DURB 3RZCB 4RIRB 5DMYA 1YPZB 4JQXC 2FBJL 3RVTC 1EX0A 3HG1B 2JE8A 4TUJB 4F2MB 3H0TA 4F7PB 5MEQB 5I16B 2F5BL 1QFUH 1NEUA 5BZWA 4JFPB 4AIZB 1RJYB 4PP1C 1QBBA 2UV3A 3UPAA 5DJ8B 2PYEE 3MRIA 4LHUD 1KG0A 1YPZE 1RUQL 4HKJA 1PKQB 2VZ1A 3ZKMC 1J87A 3PWNB 2IFGA 4OQTH 5EO0A 1AGCB 2ICWA 3FL7A 5HBBA 3T77B 5IG7A 2QBWA 2DQJL 4JZOA 2QHRL 3JWDC 1A7QH 1PKQE 5DWUL 5C08A 3QB7C 2X4QB 2Q20A 3G5ZA 4B7IA 3WN5C 2AJZB 3KPQA 1A02N 1R3LA 1J5OH 1QHOA 4MS8C 2UYLB 4APQB 1I8IA 3PWJA 1ZVSA 1UG9A 4YWGH 2V5SA 3UXFA 3MNWB 4LVOC 2AJUH 2A83B 1SVCP 1E4KA 1PQZB 4OD2B 2X9WA 4X80H 2X10A 3BPOB 3SDXA 3NFSH 3M45A 5IF0B 3RUGA 2YWYA 3MRKA 1FNSL 2HFEA 5FOJA 1A6TA 4L1HA 5DQ9B 5TGBB 4HWBA 4LPWA 4M5ZL 2OTUA 3LKQB 1A47A 1X5FA 4LBEB 5D7JB 2BVPA 2AI0H 2P5EB 4MAYB 3KWWA 3DYOA 3UYRL 4YAQB 4N8VB 5EO9A 3TYFB 4LSUH 5B8CB 2ZCKH 3CUPA 3IDIA 3QPQC 2PW2B 4OF0A 1Z6JT 4ODXB 3C60B 3BPLC 2P5EE 4NO0D 3LKNA 3X12A 2YA1A 3K4AA 4O58H 3C5JB 1MCSA 3PP4H 1U8LA 2ZG1A 3GM8A 2P48B 3T3MF 4P2QB 3FKUS 1T2QL 3D5OF 1AY1L 3ESUF 4U1GB 1XCTA 3M8OL 1K4CA 3O6FC 1TQBC 1A21A 3C9NA 3MODL 5I2IB 3O9WA 4OFKA 3HMWL 3MRCA 3O3AB 2NY2B 4LK4A 4X83A 3ZE1F 4JZJA 3HZYB 2D7QA 3VDAA 2G75B 4UU9B 4X6BB 3TO4A 4Y5XA 5I1DB 1P84J 4Z7VB 1SJXA 2ZUQC 3MLPA 4OAWA 1EXUA 3OG4B 3SDDA 4YHIB 1CFQA 3HLAA 4WTZA 4KJWC 2XACC 4I48A 1AGFA 4PJ5A 2GJ6A 2ZKHL 4Z7VE 1ZHLA 1LMKA 2IF7A 4P9MH 4YHNA 1Q9LB 5D2LB 3FMGL 1P9MA 4NKDA 3HNVH 1T22B 2XKNB 2VXTH 3N50A 4BUGA 3LD8C 1LD9B 4IRJB 5CEZH 3HHRB 2YSSA 5D8JH 1T4KB 3CK0L 1FFOB 3IXAB 4WWKD 5D2LE 4Z7WA 4Y5YA 4FQPA 4P5TD 3TT1L 1AJ7H 5GRVL 4JM4H 5DD1L 3DECA 4QOKA 5MENA 4JFED 1DR9A 5ERWA 1I3RB 3LQAH 1FFQA 1LK2B 5H35A 5KS9B 4GUPA 2APWA 1AHWB 3QEQA 1JNNH 1Q9WA 1P1ZA 1V7MH 4D0BA 1G7PB 5KVEL 2VSCA 2H2SC 5KS9E 4G8IA 4QRPB 2Q86A 5C0DB 1LP9F 2HTKD 4K2UL 5BVJB 2A1WH 4HX1A 4PRHD 1F11B 2X4PA 5ICXA 4DVRL 2DL2A 3DHMA 4PJ7F 4QRPE 4JY5H 5CSZA 4M1CD 1PG7L 4O2CB 5CEYB 4C55A 3KPLB 1I1YB 5ICYA 4LPYA 3LQAC 1AI1L 3I9GH 1U8MB 2QR0A 1PAMA 2X70B 2J88L 2OJZL 4AZ8A 1U91A 1U8HA 3EYQD 3WLBA 3BAEH 3P9MA 4R96B 4F15B 1S7QB 1KJ3H 4RAUB 1R5WA 1TLKA 2DLHA 2DJUA 2XN9B 3LS5L 4YXKL 3WXVH 4LAQH 2A6KA 1Y6NR 2EDWA 4P3CH 2VZOA 1F2QA 1X44A 2W65B 3X11A 3OR6A 3EW3B 3RGVA 1LO5A 3BQUA 2VLRA 3TBVA 3BO8B 2XN9E 4UNTA 2FL5B 5GS3A 4TVPL 5JXEC 3BIKB 4MXWL 1IFHH 2EDFA 5JLZA 5KN5B 1KV3A 4GW4B 1DLHA 4LLVA 1DFBL 3MV8B 4WVRA 4ZMAT 5DUML 3IJYA 3UEZA 1TVHA 4JFXA 3MV9B 4EUPH 2Z8SA 1UM5L 1JRHH 2E7MA 4J2XA 1MAKA 5FB8A 1ZV5A 4YDVA 3U9UA 4DN4H 3NCJL 3MV8E 1S9XA 5CLWA 1YYLH 2NTSP 3LRSA 3HC4H 2Q7NA 4IMKC 5I15H 3NAAL 1ZHNB 3CVHL 3MRRB 4FXLA 4HWNA 4JEGB 3CXHJ 4X9BA 4FABL 4DKFL 4E42B 5D71H 3LZFH 1AR1C 4X4XA 1JFQH 1A14L 4H0GA 3WLWC 3LN5A 3C08H 2XRAL 3QDMB 5F7NC 2Q87A 1T0MA 1IAOB 2Y4SA 2DQDH 3SE3C 1AGBB 1YEFL 5AG9A 3ULVH 1M7IA 3DVNA 4GMSL 4YUEH 4R6UA 3QQNA 1MCCA 4I5BB 2LU3A 3QDME 1WBZA 4CVXB 1RIVL 4UQ2B 5FUCC 4YC2C 3HNTL 1T21B 3A6BH 5IFAL 5LGHL 3K1KC 4EI5C 4N1EA 1X4YA 1YA5A 1T3FB 3KPMA 5DRNB 4X0KB 1NDGB 1W0WA 1UEMA 5I18H 4PJCB 5CZXC 3U7YH 2XQYG 3DBXA 4M6MH 5HJ3B 3V0WH 3KPPB 2YD6A 2HVJA 1MFDL 4C56A 3I6LE 5M94B 2XZQH 4FA8A 3GSUB 4G8EB 2WNGA 4NPYB 4PJCE 4XWGL 4CL7A 5F88B 4NRZA 2EE2A 3WN5B 1A5FH 32C2A 3FB6B 4P5MB 3ULVC 2F5BH 1YNTA 1RULL 3TBYA 2C7UB 4KVCL 1N4XL 3WIHL 2BSTA 1MF2H 1RUQH 3QXWA 4GKOA 4NQDD 1JYWA 4LVOB 4I77L 3C5ZC 1WIOA 2VIRA 2ZUUA 4CMMB 2R1WB 4CVZB 5T5FL 4E0RA 2DQJH 4NO0A 3WSQL 3MGOA 3OMZA 1LEIB 5DWUH 3PNWB 3FQNA 4JY4A 2VITA 5CP3H 5I9QC 2DWDA 4Q9QH 3ALWA 5E95B 3WNOA 4LLMB 4HLZH 2EYRB 3FCTA 4YGVB 1A7OH 4RFOL 3X3GH 2YPLB 3MLVH 1B0GB 4JGJA 4YX2L 1V3MA 2JLLA 4Y16C 2D7TL 3BPLB 5BZDB 4HFUH 3MACH 3STBA 2YPLE 1KPRB 5GSVB 3HB3D 1HNFA 5HVGB 4N0CC 5DMGD 2IAND 3SDYL 1WWAX 1WBYB 1MCPL 1FNSH 5GGUA 2FB4L 4PJBB 1DTUA 5I1KL 2LV4A 2HT4C 2ZWLT 3RY4A 5I73C 2Q1EA 3O6FB 1TQBB 4O2FB 4L8SA 3BP7B 1PYWA 2BX5A 2BXZA 4FMKA 4ZYKA 3R06A 3E2HC 3CCHA 3UYRH 3KLAB 1P7QA 3MYJB 4FRWA 4PJBE 3C2AH 1MHEB 3CU7A 5A43C 2BOBA 4WWKA 3Q48A 1MAJA 5F7DA 3GSOA 2O26U 2ZUQB 2NY0C 2GJZA 4P5TA 3LEYL 4KQ3L 4F7TA 3CLFL 1OTSD 4JN1L 3T2PA 3O6KL 3E0GA 1J0IA 2PCPB 1T2QH 2Q8AH 4WU5B 2R0KL 4WGWB 2H45A 3MCKA 1UM4H 3M8OH 2FHCA 3VGGA 5HPOA 4YHKH 3EOAB 6CGTA 3MODH 3LD8B 2JB5L 3HMWH 1L6ZA 1I1RA 1UWEL 2R2CA 3QDAA 4F8QA 1ZK9A 3RA7L 4R2GC 3O4LB 2EDTA 5ICZB 5CEXB 1C8PA 4WUKL 4B53A 4WJ5B 1PEZA 1KCKA 3O8XD 2VLLB 1MLBB 4L8BA 4DKDC 1V3KA 1J1OL 1YNKH 2VDNL 3VXRD 3O4LE 1IILE 5DJ2B 3GSNH 1I8KB 3IFNL 5BV7H 2ZKHH 1FO0A 2FGZA 1KLUB 2I26N 3EDEA 3H9YA 2FJGB 5CIPH 12E8H 4LQFH 5JPMA 3ZKND 1MCOL 4A6YL 5J9PA 1JPTL 4N0FA 3TT3H 3CK0H 3TEUA 4GBXA 3T4AB 4ONHA 3HE6D 4ISVA 5F3BB 4NKOB 3FN3A 4R3SB 5DQDL 4L4VD 1ZE3C 3F7YB 3HZVB 4M7KL 5IVXA 3OKLB 4AH2A 2XG5A 4I0PC 1KJVA 2WIMA 4HFWA 1WK0A 2GCYA 5CEZE 2ICWJ 1VGEH 1NPUA 2FGWL 3W39A 1IQDA 3S35H 4ZFOA 4KQ4L 5F7EL 1JZ8A 2DTMH 5BV7C 1WFNA 4UV7L 4PJDE 4XVJL 4F8TA 2X4OA 3HPJB 3B2VH 2BNQB 1OGAB 3V4PL 3BEWA 1F2XK 3VXOA 1D9KD 4LAJH 3ARDC 1SM3H 5IJVA 1N64H 5L2KB 3MRQA 2BNQE 1OGAE 4YO0A 3EKCA 4M4RA 3I3EA 1WBXA 5TDNB 3GK8L 1BBDL 2PETA 3OXRB 4X4ZA 3KPOB 1A9EB 1IGCH 1EO8H 1PG7H 2Z31D 1JF1A 3QEGH 5L2KE 3PJSB 1UWGH 1AI1H 1FC2D 4NKQB 1UVQA 4JRXD 4MXQC 1KCUL 2J88H 3UPRB 5CGMA 4IMLB 5E94A 2GAZA 2QADC 1B4RA 2CSPA 3DGGB 3I6GA 3T4YA 4B0MM 4AK1A 2X4RA 4PJIA 2R0LH 5GZNC 2H9GB 2OI9C 4D9QE 2PYFA 4PJ8D 2A6IA 1Y6KR 5DO2D 3NZHH 5L2JA 4FZ8L 3LS5H 4KU1A 4N0UA 4KRNA 5KTEH 3AXLA 3OKEB 5IW6A 1FVEB 5CLTA 4KY1L 4XCCL 5T33H 3PIQA 3MOBL 4FQCH 1QP1A 1LE5B 2FECL 5DHYA 3A0OA 1FHGA 4U1MA 4MXWH 1CDJA 3AY4C 4TUOA 5DUMH 1ZTXL 4LLQA 5ID0B 1AQDA 2BJML 4PUBL 3O2WL 2WZPD 4EUPB 3KLHC 3U4EB 4D0CA 4S1QH 5EWIH 3NCJH 5D2NA 1CFBA 1ED3A 2JB6A 5MP6L 2WUCH 1NCBL 5IWLA 4YZFF 3DJ9A 5EZJA 3DX9B 1X5YA 5SX4H 3WFHB 5BS0A 3RTQC 3L3OA 3CMOL 1RV6X 3G6AA 2GEEA 1IT9H 4YC2B 3MA7A 1XGPB 4EI5B 1YN6A 2BSSA 4HV8B 5EC2B 1A14H 2WQ8A 1YY8B 1N59A 3FFCA 4LF3A 1RZGB 5DA4A 4K55A 2MNUA 2JELL 2BVEA 4M5YL 2EYSB 4HIIB 1T5XB 4JPWH 3DTXB 4ZSOB 4J8RA 3T2NL 1GZPB 5GJTH 1YY9C 4FQQA 2W9EL 1BAFL 3QXTA 1RIVH 1FAKT 4WW2F 5I1AB 3I3BA 5LGHH 4OGXL 1HNGA 1BD2D 8FABA 4NZRL 1VCAA 4BFEA 1CDHA 4OFYD 3V4UL 3ULVE 5DK2B 2NXZC 2Z91B 1CU4H 5FM4A 3CGTA 3C5ZB 1NUFA 1FDLL 4FXKA 2D03H 1DSFL 5E2VL 5J6GA 3PABA 3SO5A 1MFDH 5C70A 4KKAC 4JKKA 2IANA 5DF0A 4M93C 3K2UL 5I9QB 4OGZA 1RZIB 1IGTA 5I6XC 1MOEA 1ZT4B 1EGJL 1I3VA 1VFBB 1OM3H 2B1AH 4GT7A 1FL5A 4IOIB 5GGQL 4TUKL 1N4XH 2ESVD 4PJ9C 5AUMA 4I77H 5FGBC 3TNNA 5F7UA 4Z0BL 5EU6D 5C9JA 2FJHA 4N5UA 3IKCB 5IVOA 4QRQA 4Y16B 1OP5H 2Y6SD 5DR5L 2EKJA 3BSZH 4H20H 3V9FA 3G5VA 4FQLH 4EZMA 4OLVL 2VL5B 3HUJA 5BCAA 4G6AC 2DKMA 4YPGA 3VD7A 3OL2A 3HI1A 2C26A 4ZQKB 2HFTA 2XT1B 5I73B 1MJJB 4MD0A 1KNOB 3VFPB 1FNEB 4AMKH 1A4JA 3LSOA 3E2HB 1YMMA 3G08B 5D6CA 1JE6A 3FRUB 3GMQA 4I3SH 2F8XC 4M00A 1M71A 1J1XH 5IB5A 1ADQH 1U9KA 1Y18B 4OZHE 2NY0B 3KG5A 4X6CF 1S9YB 3O8XA 3D2UA 3LKPA 5DRZB 4DGVL 3P4LA 3SDYH 3EYOA 3K80A 3AFLA 4MZ2A 4PBXA 2FB4H 5I1KH 3CSGA 2R1YB 5EIIB 2YKLH 1OWWA 5GZOD 4NYLA 1Z5LB 2F19L 4JHAL 5TF1L 3GSVB 3NABH 4Z7QE 4Z8FH 3Q1SH 1CE1L 4R2GB 3GJFH 4L4VA 1FH5L 3FO9A 2ZCHL 2XQBL 5JR1L 4KQ3H 3CLFH 1CGUA 4WDIA 3WDHA 2VE6A 2XICA 3VDBA 3PQYD 4M1DH 3CH1A 4HUUA 1KCRH 2MOVA 2DM4A 3WIIH 5JHDA 3GUTB 4RISL 2R0KH 1X5HA 4WO4C 1XH3A 3P4NB 3PXHA 1BZ9A 1RIUH 2Y72A 5HI5D 3QZWA 4RBPK 5DS8B 1CCZA 2C5DC 3DVGB 2Y07L 3WNPA 1YECL 2A6DA 1QFPA 4KVNL 2FH8A 5MEPA 3ES6A 1WSST 2A6JB 2E7HA 5D1ZC 3F7RA 4I0PB 4AG4H 1RVFL 3MMEA 4JDZA 1F4WH 5HYFA 2EXWD 4M6NL 4ZXBA 5JO5A 3F6IA 4NZDA 4CGTA 4FQHA 2AV1A 3MRJA 4KI1A 4H0HB 5CS7A 2Z31A 4ZUVA 4GRWH 5BW7A 3IFNH 5J56B 3GSNB 3T0ED 5BV7B 1CG9A 3OAZK 2DDQL 4JRXA 1MI5D 1T04B 4HKBB 3V8OA 5MHSD 3H9HB 5CIPB 1T1WB 4XMPL 4J12A 5EUOE 1NCNA 1U93A 2PKDA 1HXMB 3UTPD 4TOYL 4KK5C 4PJ8A 4QNPF 3ARDB 4HJ0C 2F9BT 4M7KH 3REWB 2G9HB 3HA0A 3VFGL 3RWJB 3UROR 2HJLB 3CZJA 3I50L 4ACPA 4PLOB 2YUWA 1T66C 2O61B 1J8HA 3RGHA 4JFOA 1WEJH 4KQ4H 3HR6A 1OARH 3EAKA 5IESH 5TF0A 4EVNB 3PL6C 3VFRB 2G2RA 2QADB 3N1GC 3HPLA 3P9LB 4HGKC 3U2SA 3UBXA 1FYTD 2BDNH 5HHQA 2J2ZA 1QRND 1FBIL 3VXUD 2DJSA 5FV2A 4BZ1L 4BQ6A 4MYWB 2OI9B 2H1PL 3RIFK 3RDTC 3TH2T 3NCFB 3VI4E 5JW3L 3BWUC 4R4BB 3CFBB 2CRZA 1JCKA 3NA4A 5GGSA 4OBRA 1NC4D 3FB8A 5FDWA 4JJHA 3EOTL 2BNUA 2ZOKB 3BN9C 4M61A 2WBJD 1IAIM 4BSVB 1S7XB 2CLVB 4MD5A 5IT2H 4U1IA 4LSTL 4BSWA 4F9LC 3GHBH 1CICD 1VGKA 3PDDA 5EBWA 4EN3D 4XPBH 3FZUD 3PDOB 4PB0L 1G1CA 1A6AA 3G04A 3O41B 5D5MA 3D87B 4D3CH 1FCGA 4FZ8H 1YPZF 1DDHB 2DD8H 1ZANH 5AZEH 2HKFL 3K8LA 5AWNL 3PXJA 3FOLA 4XPHL 3RTQB 3OAYK 4YDIL 4M4PA 2ZUWA 4JAMA 4POYA 4N0RA 2X4NA 3G6DL 1A0QH 4GJTB 1NBVL 3LOWA 3EJZD 4OIAA 2OM5A 2HT3C 5DSCA 3QNYA 5MERA 2IFFH 1E4XL 3RNQB 3HI5L 4KPHH 3QUYC 5F1IB 2HJKB 2BJMH 1D5ZB 1A4KA 3KPNA 2AKRB 3PP3H 1M05A 1IQWH 4M7JL 3EYVA 5MP6H 5EB9A 1NCTA 4LRIC 3ZE0E 4E41B 3HS0A 5F9AC 3CMOH 2F74A 3ZLQC 1NLDL 1I7UA 5AYUL 1KULA 4XZUB 2DKUA 3CSYA 2Z35B 4V1DB 5D72H 1M6OB 2W07A 2NXZB 4MMZC 5ISZD 5C86A 5KVDL 3RKDC 4NQEE 4HUXA 5EU6A 1W72L 5EZLB 2A38A 2BCKA 3PHQA 1MCIA 3CFJA 1UT9A 4QRSA 1G0DA 1MLCA 4JHBA 3F62A 2XFXB 5E8OB 2WUBL 1JZ4A 4M93B 4RFEB 2Z4QB 1YMHB 4YFDB 2IMMA 5I6XB 4Q0XH 4QXTB 4UIKL 2QTEA 2W9EH 4PLNC 2HA1A 3KPRD 4DUWA 1J0ZA 4IOSD 1G6RH 2V7HB 3ZSTA 1UKSA 4PJ9B 1JZ5A 2FX7H 3V4UH 4RMVA 4ORGB 3RAJL 3RWFB 1U8NB 2EKSA 3ZYJA 5HYQB 1INDL 1FDLH 3FQUB 2Z8VC 2CIIA 1DSFH 1RU9L 5E2VH 3BOVA 1IL1A 1H3WM 1F4YH 4Z95L 3GIVA 4OV5B 2AQ2A 4OZFH 1SJVA 4DJMA 2PXYD 5JW5A 4JG0L 3K2UH 3BIAX 4NGHH 5DJDA 4M9PA 3DYPA 4XAKD 2NW2B 1I9JH 1CGXA 3JVGA 3AREC 2EC8A 1JZ7A 2E27L 2VR9A 3ZYOA 1I8LC 4HT1H 3VMPA 4NSKA 1JTTA 3QI9C 1SJHB 4XP6H 2H3NA 1MIML 3R8QA 1IGIH 1K8DB 1OAQL 3CFKA 1PBYA 4YR6B 4D8PB 3GMOA 4NC1E 1AGEB 1C08B 4Z7VF 1OPGL 5F7YC 5DMIL 3X3FL 2R8SH 3HNSH 3VXPA 1P7KB 3EJJX 5HDBE 4J4PC 3RHWF 5DR5H 5D7LD 5E2UL 3F58H 5I76B 4PJEA 5IEKA 3MLSH 4QHNA 3PQYA 4LGSB 2IAMD 7FABH 1NCUA 1I1AC 2BY0A 2YRLA 5D2LF 3L3DB 3A6CH 3IDMB 3O3UN 5FYJH 3PDGA 3BD4A 4NQCB 4G8FA 3QWQB 4ZOBA 1MNUL 3HCVB 5K59F 2R2BB 4Y4KC 1JPFB 4RWYL 4JFFB 5INCB 3BI9X 2NNAB 4OD3L 5IFJB 4G9FB 4MHHI 5JOEA 4NQCE 1BFSA 4HXBL 2FX8L 4G6KH 1T1YA 1F3RB 4JY6B 4PG2A 4JFFE 1AO7B 3L5WA 5HGGS 2DLFL 5KS9F 4Y19B 5JQHC 2DQEL 2BSRA 1BIIA 5IW3A 1B0RB 3MRBA 3T0EA 1F3JA 4XHJC 4WO4B 1NGWB 4OCYH 2Z0BA 3QJFB 2X4SB 4Y19E 2B2XL 2B5IC 4GW1B 4YHZL 2FZ3B 5JW4M 3CFDB 4GRLD 5I75C 4ESKA 4LPVA 4LSQL 5DQJB 5IOPB 2R0ZH 5D1ZB 3GBMH 4HKXA 3B9AA 3GJFB 4WFHD 4PPTA 4FXGA 1SYVB 4MJ5A 4HUWB 3HTLX 4PRPB 4ZAKC 3C87A 1BFTA 5DUBB 4F7MA 4Z7UB 5C0BE 1OW0C 2NXYD 4EKXA 4RISH 4BA8A 4N5EC 4XNQA 2F53B 4WCYL 4LKCB 1MFBH 4ZUWB 4OCRL 1VB9A 4Z7UE 1QRNA 1YECH 3BVNB 1K4DA 4NO2A 1UJ3A 4XCEA 4X5WB 5C2BL 2F53E 1GCFA 3RY6A 4ALAL 5ELIA 4KUCF 3F12B 1XR9A 3EO0B 3GGWA 3IXTA 1ZMYA 1ZT7B 3VXQA 4GKZA 1MH5B 3PWLA 3BP4A 4EJ1C 4OCWH 2WBJA 4GRWB 5TDPA 4AEHL 2IG2L 3IF1A 3PL6B 4L5FL 3SKUD 1ITCA 3S88L 2EH7L 1CICA 4XMPH 3B83A 4N1HB 1G7IA 1ZGLP 2CK0H 2DM3A 4EN3A 2RIKA 3BISA 4GRWE 4WHDA 3RDTB 1G9NH 3THML 5JW4R 2CRMA 3WS6A 1RHHA 3VFGH 1H3PH 2AEQL 1N6UA 5ECJE 3GMMA 2GTWB 2R1XA 3QIBD 2Z93A 1Z0NA 4M6OL 1BJMA 3UZEA 4LEOB 3QDGE 4RAHA 3OWEA 2HN7B 4HGWA 4KJPD 4F37F 1A1OA 5HHMD 1MQKH 2I5YL 2OL3A 2H1PH 4FTVE 5D1XC 3TIDB 4WFGE 3NFPB 4KJQD 5DHVH 1TIUA 4ORZC 1WCBA 4PY7A 1G9NC 1NGZB 3KGRA 4HWZB 3H2WA 3VGAC 2P45B 4J3VA 5KW9L 1OP3K 2ZP0T 4LOUD 1CR9H 2C4XA 2ATPB 4BFBD 5DD0L 3L5XL 1ZA6B 5KSBA 4BK4A 2DQUL 1P7HL 2NYYC 2GKIA 3T1WA 3SGKA 3WFDL 4O51A 3BDYL 1GGCH 4PJCF 1MAML 1RZJL 2HVKB 1J1PL 1RJLA 6FABL 3QUYB 4EBQL 1T7ZA 3KDMB 1AXTL 4HWEH 4PB0H 1EAPB 4KK9D 4U3XA 4OCLC 5ILTL 2MCG1 3SCMA 4K3DL 3MOQA 1QLEL 1QSFB 1MQ8A 3NMEA 4K9EH 2HKFH 4RSVA 3UPCA 2VR4A 1LK3H 3HRPA 2J4WL 1BLNB 2ICEB 4XVSL 3L3HB 1MJ7L 1KIUA 4YDIH 3F7VA 4Q9BA 4K07A 4MJ6A 4ZS6D 1DN2A 1LO4H 1FJ1A 4YHOL 4HIJB 5GJSL 3HR5B 4XP4H 4XMKH 1CXLA 1P4BL 2CMRH 4EDWH 4JN2A 4MSWA 3TPUA 5SX5K 3HI5H 3Q3GB 4U6VH 1T7XA 1D5MB 4I9WE 1B9ZA 2FIRT 1ODAA 4M7JH 3LEVL 1WAAE 4HCRA 3D85D 1PD6A 2Y5TB 3OJDA 4K9EC 1NKOA 1OAXH 1Q9OB 1TJIH 1UXWB 5T1LB 1KSRA 5ABDE 2DQFA 1MSPA 3HRZA 5CILH 5AYUH 1S5HB 1ZVHA 3ECBA 4XH2B 4KMQA 4HC1A 1QVOA 1U58B 4TTDC 4P3DA 4Z0XA 3TVMC 3W0WB 5JHLL 4QXUL 4NHUA 1XAUA 4L8DB 1W72H 4MA8H 3UDWA 3D1MC 3OHXA 5D7LA 5IMKB 3W0WE 1FGNH 2WUBH 4HWUA 1EHAA 4PJBF 4U1JA 2IAMA 4AM0A 3L7FA 3KJ6L 2A73A 4NT6B 2V17L 3AREB 2EYTA 4GQ9H 2YA0A 4JG1L 2OXHA 1I7TB 4G80B 3QI9B 4GMTL 4AQOA 5C0AB 4Z77B 1BPVA 1G6RB 4PV9B 2DICA 1KC5L 2OTWA 4IJ3C 1FG2A 4AENB 2VWEC 1J0KA 3LHPH 2W38A 4OD1H 4XAWH 3VFUB 3FO0L 4WUUB 3GJEB 4IDLA 1NGQL 4G3YL 3EZJB 4Z95H 3RJDA 2LVCA 1FFRA 5DJCA 2VZSA 3WCYA 2GW5A 3ARSA 3MLXL 2RQ8A 4OZFB 1FN4B 1I1AB 3QCVH 2HFGL 1X5LA 3VXNB 4XNZC 4WUUE 3ARRA 2HJFB 2P42B 1KB5A 1SJEA 1E28B 3DI2B 3MV01 1OSZA 4ENED 2W91A 4Y4KB 5T1KA 5EFIB 1HHIB 4GRLA 1UZ8A 1W0VA 2BERA 3OKDB 2M2DA 2VDKL 3N85L 4NNYB 5INDB 2FO4A 5DMIH 2VAJA 1A1NA 1CZ8H 5FV1L 4GG8B 1XGRB 2XWJB 2CDFB 1I1FB 1MCQA 3FQXA 2A0LD 3U7WH 3ZYIA 3UBXG 1CL7L 3D18A 4HMDA 1QOKA 2B0SH 3OR7A 5BRZD 4OFDA 1AP2A 1EEYA 35C8L 1MNUH 1A1MB 4OSUL 1LEKB 3PHSA 2B5IB 3O45A 5FO9B 1HYSC 4RWYH 3BHBA 5I75B 1EVUA 4OD3H 1U8JA 5BOZG 2JIXD 1UWXK 5FHAH 1ZSDB 5FHBH 4K3HA 1IEAB 4PJAB 4ZAKB 4YNYB 4GS7C 4TRPL 5CP7A 2GFBB 4N0YL 5BQ7A 2W92A 4XCFL 4HJGA 5D93C 3U36B 1EERB 1VESA 1OWRM 3WJJA 3SGJC 5IMMB 2CIKA 4KV5F 3W9EA 5FUZH 3STZA 2OR9L 4LSQH 5KG9B 2YS4A 3ZT5A 3AAZB 1DQMH 3BKCL 4ZFZA 1U36A 3D3VA 3WL9A 4GKNA 5E2WH 5EU7C 3G6JA 2IPTH 1X5IA 2PO6C 1A6ZA 1RI8A 2FCBA 2YD4A 2W0FA 5DRXA 5HI3C 5TH2A 4NNPL 3A67L 4OCRH 4XBEL 1D5IL 3ZDZE 4OFIA 4QY8B 4XBGA 2RR3A 2VLJD 5C2BH 4XP5H 1QBLH 2VB5A 3EGSB 1SYSB 3N1PC 1IAII 2GK0A 4CAGA 4Z76A 4OUUB 3T0XA 4MVBC 3OV6A 4TN9A 4MDJA 4WI6A 1OCWH 3QUMA 4MCZB 3L9RB 2YA2A 1GGBH 2BC4B 1NBYB 3VXSA 3IDXH 1FZJB 5EU4B 4JB9L 4XX1E 3DIFA 2FH6A 3NCEB 3IGAB 4U1KA 1K6QH 2EH7H 5HYSA 4O00A 2ICCA 2ITCA 4C83A 3DROB 4HIXH 4PB9L 5D1XB 4ZDHB 3THMH 3FO1A 4PRHE 4HW6A 4UAOC 1G84A 3VGAB 2AEQH 1FZKA 3LB6D 2AK4D 4I8DA 4MA7L 4LLWB 2AK1L 1C7TA 4XXCA 4NDMA 2LE9A 3QO1A 5DVMA 4M6OH 3GRWH 3MGTA 5I71C 2SEBB 4HLJA 3RBSA 5E0QA 4C57C 4G5ZL 1I7RB 5LGJA 1ZLVH 2I5YH 2WK2A 4D9LH 5BVPL 4L3EB 5DEGB 1M7DA 1I3UA 1KF9B 5DURD 3RZCD 2X4UB 3HG1D 4JFDB 2YZ1A 1HOCB 4L9DA 4HWBL 3NH7L 1R24A 3ARZA 3D85A 2R4SH 2H41A 3ULVF 4XVUD 4DFIA 1FL3B 2V7NB 3FT3B 3G9AB 1T6WA 1U3HA 3UJIL 4K94L 5DD0H 5JIHA 4WW2A 3RJQB 5DD6A 2DQUH 3BD3A 3FT2B 3VMOA 4KKLC 3WFDH 4WEMB 5F1SA 4ZNEA 3U0PB 3N1MC 5SWQA 5EIQA 2R69L 2Y7QA 2BOCB 2A77L 2CXKA 1J1PH 4EBQH 4GFTB 1XIWA 3QDJA 1SY6A 2VZVA 4TPRH 5T3XD 3QUXA 3L3KA 2Y06L 5KSVA 4JJ5B 4QRTA 4APQD 3LQZB 2B39A 2VDLH 2DAVA 4TNVK 2R0WL 1DN0B 2X89D 3VJ6B 1OL0A 1EFQA 3HFML 4UINL 2XZCH 5IQ9A 3TVMB 2ZPKH 4WI3A 1ORSA 4HH9B 4KK8C 3EO1B 1IKNC 4U6HA 3SDAA 1Q0YH 1KJMB 1ZEAH 2GIYA 4XNUH 4LSRH 4U6YB 3RPIA 1IGML 2AQ1A 1HHGA 3V7MA 2B1HH 3W2DL 1IC4L 2BK8A 4UTBL 1CDGA 5D7JD 3LKSA 1MRCH 2P5ED 3OX8A 4MAYD 4UOJA 4LCCC 2CDEA 3BXNA 2HTLC 1TZHA 1UZ6E 2QSCL 4BKLA 5E8EB 2XZZA 4IJ3B 2FYYA 3C60D 1G7JA 5DJ0B 4FN0A 2NCMA 3OKOA 4X6CA 3KXFB 2AJSH 2DQTL 2UVFA 3FQWB 4P2QD 2YD1A 5IJKC 3IKKA 5FIEA 4LMQI 2J5LC 4HPYH 5I0DA 1YEEH 2IPUK 4Z7QF 4ETQB 1OT2A 5E8DH 2K3TA 5HHNB 3MPCA 5HHVL 4U1HB 5FYLH 4XNZB 1ITBB 2V17H 3AU1B 3GO1L 4JG1H 2NY2D 4NKIH 2YD3A 5IBTH 5I8CB 3QIWC 4MQTB 3D0LA 4GMTH 5I8OL 5A40E 5C6TH 3RVWC 3CDFA 4U0QB 2OJEA 4X9FA 5TDOA 4NQDE 1MREL 3WFZA 4ZFGL 2JIXA 2WINB 1VKXA 1DZBA 1XF4A 3PE9A 1OAKL 4IIQC 1XR8B 3NFNB 3IU3B 5IVZB 4Z6AT 3RWCA 3LMJL 3HN3A 4LCWB 3NIDE 2GT9A 2RBLA 3DXAB 4HEPG 4IRJD 4JDTL 1UXSA 1QA9A 3DVIA 4LCWE 3D39B 3K3QA 1BVKB 2X4TA 3LQMA 3TZVA 4PLKC 1U6AL 3O3EB 1UEYA 4HF5L 1JHKL 1ES0A 2OBGA 3O2VH 2BVQA 4YH6A 3P77A 1J0JA 2H8PB 1JGLH 3O81A 4S1RH 4YBQC 1A6VL 1AC0A 5J3HD 4GS7B 1KJ2A 1S7UA 5FKPA 1UQSA 1XF3A 4K7PH 5B3NA 2GUOB 3HC0B 4ZOAA 2CDGA 4P4RB 5C0CA 3DMMC 4D94A 1CL7H 1YJDH 1NFDB 3VH8B 5D93B 4K3EL 1HIMH 3PWPB 2DQIL 4QRPD 4W6YB 4X8JA 1A9BB 3E6FB 1NFDE 1HZHH 5DYOA 4XWOC 3PWPE 3BRGC 4OF7A 4YHLH 1O0VA 1MWAA 1OSPL 3PV6A 4PRDA 1N26A 4R0LA 3WIFB 2ZJSH 3DX7A 1FSKC 1JJUA 4K7FA 2PO6B 3NIFE 4PD4J 1SBSL 1L7TL 1I3GH 2Y1VA 4KMTL 5A2JH 2HH0L 4OGYH 1OAUL 3ZE2E 4PGBA 1UGNA 1YJDC 4FFVD 1R0AL 3NZ8A 3S4SA 1QO3A 4QT5A 4XPTH 3IETB 3NBNA 1F13A 5CKGA 4MNQB 4BH7A 5C2UB 2BRRL 1AE6H 2XN9D 3VFWA 4U6XA 3RHWK 3DRQB 1PG7W 5F8RC 3BKCH 4KUCD 3MJ7A 3MUGA 4R8WH 3SKNA 4X7FC 1VHPA 5JORB 3DUUA 5M7QA 2QLVB 2AK4A 4MNQE 1JWMB 4H25B 2QKIA 3VXRE 4KZDL 4MQXC 2LVEA 2BY2A 1HSAB 4GQPH 1T20A 4F7EB 2DBLL 4ZTPL 5L8KB 3MV8D 4PJGA 1LGVA 4Y4FC 3A67H 4HMEA 3TP4A 2ZSWB 3Q6FA 4HD9A 4XPAL 3MV9D 1OAZH 25C8L 15C8L 4MNGB 4RX4D 4Y8DC 2FATL 5TE7H 3HAEA 1VPOH 4MWFA 5EBLB 1DBMH 1QFWH 4UV4L 2ADFH 1HQ4B 5ENWA 1C1EL 1TNMA 2PYEA 3FONB 3RZCA 4H88H 2WANA 5HDQL 3SKJL 4RIRA 4UAOB 1YPZA 2KL6A 4MNGE 4F2MA 3AM8C 5MEQA 5I16A 1I85C 4K3JH 1RJYA 4LU5H 1MEXH 1GZQB 4EQ2A 4K7PY 4GLRH 5DDHB 5DJ8A 2DQCL 5C09A 3JUZA 3C5SB 3PGDA 4UNUA 1L9MA 2XWBA 4NN5C 3KYMB 5I71B 1PKQA 4JB9H 4Y0GA 3PWNA 4Y2DA 5F71A 1AGCA 5ESVB 4O2EB 3T77A 2X2YA 2KBGA 3GIZL 3QDMD 1IKFH 3ZE0F 5IW1B 3BDBA 3N06B 3JUYA 5ITBL 3RRQA 3V52H 2X09A 5IHUL 3INUL 2X4QA 1UM6L 2GY7B 3JZ7A 3ROOA 5JXAL 1VEOA 5DVKA 2NLJB 3RVTD 2ADIB 3ETBF 5DVNA 5DJZB 1CGYA 1NUNB 2W60B 4KJYB 4MA7H 5BO1H 1DEDA 4PP1D 3SE9H 4K23L 1NGXA 2WW8A 5T1DH 5CBAB 4APQA 2Q7YB 3ZKMD 4YEFA 4HG4K 3MNWA 5KBNC 3W9DB 2DQGH 2N7AA 5KSUB 5CHNB 5F7HA 3FAWA 4OD2A 3ARXA 4RAVB 5BVPH 3WJLC 2P44B 3QG6B 4G6ML 1I75A 1JIBA 5FCUL 3CLEL 3LN4A 5DRWB 1JZ6A 5IF0A 1J9CT 2VXQH 3Q0HA 2DM2A 5DQ9A 3NH7H 5TGBA 3OTTA 4MAUL 4UDTA 1CBVL 4MS8D 3TBTB 3LKQA 5D7JA 1A2YB 1QNZH 2OXGA 2P5EA 1L6XA 4MAYA 4K94H 3RWEB 5A3IC 3TYFA 4N8VA 3ZHKA 4LEXL 5B8CA 4M7LH 1L7IH 3Q5YA 4ODXA 4XNYL 2R69H 1G9ML 2PF6A 2A77H 3P0YL 3MUZ1 1OP9A 3LAFA 1TMCB 3C5JA 4F33B 2H2PC 1EEQA 3RU8L 2KH2B 1JTOA 1LDPH 3ILQC 2JJVA 5I2IA 4LCCB 3O3AA 3ZKSD 4F37K 3L1OL 2YPLD 4XCYB 5HDBF 4K94C 5HDOA 3HZYA 1Y0LA 4YFLF 2NTFB 1FFPB 4X6BA 5DZOA 1BOGB 3QPQD 3HFMH 4YQXH 5I1DA 3VD3A 1IGYB 3TNMB 4Z7VA 4LLYB 1D7FA 4HQQL 3EHBC 1BQHA 4YHIA 2VISB 4OJFL 5CD3A 1NLBL 4M8QB 2J5LB 4RZCA 5TE4L 3W2DH 3BH8A 5D2LA 4U4BA 4J7RA 1LO0L 4S11A 3O6FD 3I3DA 5KSAA 2XKNA 4LHJB 3RI5F 1LD9A 1WISA 1JMZA 5ESAB 3U46B 3QIWB 4DCQB 1FFOA 3IXAA 3MCLH 3FQRB 1BD2E 3H9SB 3DSFH 2YEZB 4KHTH 3UTZB 5CJQL 4KJWD 1I3RA 4IIQB 3D6GA 4ZFOL 1J11A 3CFCL 5KS9A 5IMLA 3UAJC 3QEHB 1AHWA 3B6SA 2AEPH 2G5BA 5IM7B 1CE6A 4F58L 4P9HC 3S34L 3VRIB 4QHUB 4IDJL 5KANI 2EIDA 4OT1H 2EDJA 1OQOA 5HHVH 4N9GA 4W6XB 2J6EL 4FQIL 1RJZA 4QRPA 1R3HB 3O4LD 5C0DA 5E7BA 2D7NA 2V9QA 5ETUA 3HC3L 1X7QB 2ESVE 4W4OA 3ZKXC 4NRYB 1WZ1L 4Y5YC 2K1MA 3RWIB 2CXGA 5LAXA 2MPAH 4EDXA 3WXWH 4O2CA 5CEYA 3KPLA 1I1YA 4Z7UF 2PUQT 1U8MA 3MTRA 1RD6A 5HYSG 3MV7B 2X1XR 3DMMB 1Z3GH 4NQUA 3K1DA 4QRRB 2H2SD 5CEZD 5B22A 3ME0A 4L4TB 4R96A 1S7QA 4ZUUB 2FR4B 5DA0B 1BFVH 3MV7E 4JRYB 2VXSL 4RAUA 5TQ0L 1U6AH 1FVDB 2XN9A 5SV4A 4QRRE 4JQIL 3V6FA 4L4TE 3G5YA 5D9SA 1IARB 1G7MB 2RB8A 3VFMB 4MX7B 4NJAH 3AS0A 4FHBD 3BFOA 1FSKB 2IGFL 4NWUH 2DLGA 3X13B 4AL8L 3R1GL 5DC0A 3LEXB 4GRWF 3CZFB 3RKPA 4P99A 1AIFA 2BNQD 1OGAD 4OLZH 5EIVA 5KN5A 1QLFA 4GW4A 1IAKB 1U8IB 3MV8A 3WNMA 1PY4A 1RJCA 2DLEA 2G5RA 5HPMB 3K81A 4OLYL 4NKMA 4HXAH 5L2KD 4PJXB 1HI6A 3DV4B 4HK3N 5EOTB 1F42A 3RL2B 3TWCL 2NY1C 4QHLB 3LKOB 4HIEB 3MRRA 1CFSB 1HINH 5DVLA 4OZGB 4JHWL 5JXED 1KLGB 4M43L 1JL8A 2EDRA 5H37H 1B3JA 2WIIB 4E42A 1R0AH 4Y4FB 3BWAA 1BEYL 5F6IC 2EH8L 2WAHA 4OZGE 3OKKB 5K9QI 2JJTC 1LEGA 3ULSB 4DZBB 4U3CA 1DBBL 3F8UB 3QDMA 3ORJA 2PNDA 5FA4B 1ZGLM 3NACL 4HS6B 4FQXC 1W8OA 2BFVH 2AAVA 3WKNA 2AV7B 4JQXA 4WRLA 1CLZH 4I5BA 1KENL 1CVRA 4KKBC 1U8KB 4XCNB 2D2OA 4CVXA 3V6BR 5KVMC 5F1KC 4ZD3H 1KT2B 1T21A 4BQ9A 1K5NB 4Q97A 4NN5B 5LWYL 2DBLH 4ODWA 4ZTPH 3LKRA 1T3FA 5HGDB 1MI5E 2ATKA 1AR1D 5DRNA 4X0KA 4RQQB 4P46C 4FMFA 4QTHB 3VG0H 4PJCA 2EIBA 3EDDA 3WLWD 5CGTA 1HXYA 4XPAH 2DMKA 4NHCL 25C8H 1ZXQA 2R23B 3SKOB 8CGTA 4BFIA 2G60L 1LP9E 4GSDL 3G9VA 3KPPA 3MROA 3ZT7A 2MHAB 2P8MB 4UV4H 2AW2A 3GSUA 4NPYA 5F88A 3IDNA 3JV0A 1IAMA 1ZT1B 5E5RB 3SKJH 3WN5A 4PJ7E 2E3VA 4LKXB 3FB6A 3HZMB 2YZ8A 5C0EB 2AJVL 3TBSB 2HFFA 4Q2ZA 2C7UA 2VQ1B 2J3SA 3GSQB 1HKLH 5M95B 4DGYL 3TFKC 4EI5D 3SGEH 1KG0B 1IBGL 1R5VB 4N8CH 5ADPH 4WW1A 5CZXD 1FYTE 1BQSA 2JJUA 4PRBB 1CYGA 1JPST 4U31A 3C8DA 3VXUE 4CVZA 4YXLL 1UENA 3GIZH 1H15B 1T89C 5ITBH 3IB4A 5C08B 5IHUH 1UM6H 2GSIB 5JXAH 1KFAH 1YEDB 3G5ZB 3ZTJG 3KPQB 5F3HA 3ULVD 1YDPB 2XA8L 2R56H 1FIGL 4TSAL 5CWSB 2L0DA 3KYOB 2PR4L 1HCFX 3DGCR 4DKEL 4PTUB 1ZVSB 1Q0XL 1UACL 3U6RB 2YPLA 1JHLL 1B0GA 4HZLB 3C5ZD 3ARYA 4LGRB 3GEWB 5GSVA 1KPRA 2R4RH 1FNFA 4X7SL 3SDXB 1NCWL 1F02I 4RA0C 4NQSB 3RUGB 4PJBA 2HFEB 2ENSA 4BYHA 1YEKL 1R5IA 5D1QC 1SEBB 3H9ZA 4MAUH 5JQ6H 2EDYA 5LGKA 3KLAA 2B20A 3MYJA 1WTGT 3IDIB 4Y16D 5FO7A 4XNYH 3LKNB 4WU7A 1TTUA 4N0CD 5KOVC 3LRGA 1T1ZA 1EJOH 3UJJL 1FLTX 5HGHB 3BRFA 5HDLA 2HT4D 5T5NG 1WT5C 2C1PB 3EOAA 5JIIA 1EEUA 4L8SC 1KACB 4CADA 3SE4A 4YDLC 4WV1A 4HBQA 2ZUYA 3Q2CA 4TNWK 3O4LA 3MRPA 2NY0D 5ISZE 1FNGB 2VLLA 1MLBA 4OAWB 4XNXH 1WZMA 1EXUB 4XP9H 3BW9A 2X1PA 3Q5TA 1CFQB 3HLAB 5C0JB 5IB2B 5DJ2A 1NLBH 1AGFB 1I8KA 1MCBA 1KB9K 5F70A 1FO0H 5SWZB 3S4SG 2V5RA 1GSMA 3HI6L 4H0IA 2VABA 4BK5A 4LGPB 4NKDB 5EN2B 1Z2KA 3W5NA 3L3GB 2DLIA 1NMBH 3S36L 3KPRE 2YSSB 5SWZE 3WE6A 4OZIA 4NKOA 4R3SA 4R2GD 2I07A 3F7YA 3HZVA 4NM4L 3ILPB 3OKLA 2UY7A 3ZKXB 1JYXA 4Y5YB 4PJDA 3ZDXF 3Q6GH 4PJAF 4QOKB 1MCWM 3OB0H 5MENB 4ZFFB 3MA9L 2LU7A 4HBCL 1FYHB 3CFCH 3PHOB 1KPVB 4GUPB 3TO2B 4I3RL 2CUMA 3QEQB 4XAKE 1SBBA 1F8TL 1OGAA 1P1ZB 3HAEG 2NY3C 4KDTC 4LNVA 2O5ZL 1GC1L 1H3TA 1U2HA 4GBXC 2Q86B 4MQ7A 4CJ1A 4I0PD 4XXDA 5E99L 3HC3H 5L2KA 4HX1B 2K7QA 3ZSSA 2NY5H 2X4PB 1C5DA 3EYUL 5F7WC 3OXRA 1JF5A 4U33A 5ICYB 4LPTA 3TCXA 3PJSA 3ZDZF 4KGLA 1YEIH 3UPRA 1UH3A 3DGGA 1KGCE 1U8HB 1IC5H 3QIUA 4YXHH 4OI9A 2H6PB 3BE1L 1I9IL 3B9KC 1KTLA 5JNYA 3P9MB 1F4XL 4PGDB 1U0QA 3ARDD 4E5XA 4P59L 5TQ0H 5EPMB 1JRHI 4FP8H 4JQIH 1MJUH 2FIKB 2NY5C 4CU8A 1UKTA 2A6KB 2UUDH 2MQCA 3S6CA 4OI7A 3OKEA 3X11B 1FVEA 2NY1B 5CAYB 4IMKA 1VFMA 2IGFH 1LO5B 4MXQD 5LG1A 4AL8H 3R1GH 1LE5A 1RUPH 2QADD 1N5AB 1IC1A 5EC1B 1MCEA 2AERT 5GZND 1NSNL 5F6IB 1Q9KA 1QTYT 3SJVB 5ID0A 5D4QA 5EBMA 5DD5L 3BH9B 3NGBC 4EUPA 3QWOA 2HG5B 3U4EA 4YDVB 3U9UB 1W0YT 2WWMC 3TWCH 2HKHH 2EC9U 4FQXB 4JM2C 3SE3A 3SJVE 4DQOL 3CJJA 1NUGA 3WFHA 5IQ7L 1Q94B 4N8VG 1UJTA 3IJHB 4LSPL 3PGCB 4M43H 2QSTA 2EDHA 3LIZL 4P0DA 1XGPA 3IFOA 4EI5A 5C7XH 4C4KT 4HV8A 4OBSA 5EC2A 4TYUA 4P46B 4RGNC 4HS3B 1F5WA 2QEJA 1RZGA 4DWHA 3KLHD 2APVA 1MCNA 2BMKA 1GGYA 2EYSA 5D2NC 1T0MB 1Q1JL 4OLXL 1YYML 2EDNA 1GZPA 1PDKA 4BQBA 3RTQD 1ZA3B 1X5GA 2C4FU 5K9KB 3BIBX 1PJ9A 3MNVA 3EDJA 2GITB 1XGYH 5LKNA 5I1AA 1WIUA 3P4MB 5IR1A 5LWYH 4HUNB 2FHBA 4AEFA 5DK2A 1BQHG 1BECA 4NO5B 4CU6A 2P5WB 1DQJB 3DBXB 3MRHA 2QV2A 1OTUC 5ALCH 3SQOL 2VUYA 3P9WB 3RNKB 4C56B 4JFQB 4JO2H 3VU2A 1RZFH 1BQLH 3QH3B 1NGYB 1BFOB 1YY9D 1P4LA 4J23A 3GI8L 4E41D 2P5WE 3UTQB 32C2B 4ONFH 1VFBA 5CINH 1NC2B 4JKWA 3TBYB 4JZNA 2A74A 3UJTL 43CAA 3V7AE 4JPVH 2BSTB 4V1DD 3DPBA 4UB0L 2NXZD 3IKCA 3UTTA 1LO3H 2VIRB 4Y16A 3L3IA 2LAGB 4MA3B 4OM0H 4HG4J 3DURA 4KKAD 1XGTB 3T04D 2VL5A 3V5HA 1E27B 2DWDB 4ZQKA 5D1QB 2XA8H 4DZ8A 1MJJA 1KNOA 4FFWC 4OZHA 1FNEA 5DLML 3FCTB 3SN6N 2PR4H 2V9RA 1T03L 2FLRT 3G08A 3WS3B 5B38G 4PJ9D 5EOCH 2ZSVA 4UTAL 3MLYL 5CCKL 3OKMA 3VGHA 1BGXL 1S9YA 4CN1A 3AROA 3V4VH 5DRZA 4X7SH 4G6AD 1RHFA 3TV3L 5T3ZH 3KYNA 2V2TB 1RURL 1SHMA 1T5WA 5GGUB 3BGAA 1QZ1A 2CO7B 4HIHA 4XP1H 4Q9RL 1TDQA 4L8SB 2DMBA 1MHHA 1YQVL 4RMUA 3GSVA 4YDLB 5FKAB 1P7QB 4H8WL 3BKYL 4NM8L 2AS5M 4P2YA 3VWKC 5GIRA 4ZPTB 5IROC 4A2LA 1G9EA 3T3PE 3GSOB 1FPTL 2E8ZA 4ZUTB 1EH9A 4F7TB 4HUKB 1DBKH 3UJJH 5DD3H 3O6LL 4UT7L 2GTZA 1NCAH 1JNHA 3MCKB 4NQCD 3MLUH 1JGEB 4EOWL 1DL7L 5DS8A 5ADOL 3DVGA 4DN3H 4ZS7H 4JFFD 3GMPB 2ED7A 4G9FD 1DBAH 2EZ0C 1A6UH 5LXGL 1NBZA 1NMAL 5LBSL 4JKPL 5GS1A 1OF2A 4HKZB 1AO7D 5D6DA 2J7LA 3QFJB 4B7LA 4Y19D 3U79A 3ARFC 5EUOA 4IRSA 3BGMA 3E1F1 3B2UC 4MJIA 1JWSA 3GSNA 4PYHA 5TJWK 4WO4D 1FO0B 1YEGH 1NFDF 2Y25A 4HKBA 1JN6B 3G5XB 2YD2A 3QFJE 2XTLA 5CIPA 5JPMB 2NY3B 3DETC 1N0XL 1RAMA 2NY6C 2BVUA 1HXMA 2AJ3B 2J8OA 4GBXB 3BX7C 4ONHB 4ISVB 5D1ZD 4GG6B 5I1EL 3NIFF 3ARDA 4NM4H 3OGCA 2G9HA 1H9VA 1VEMA 5IVXB 4FQ1L 5B21A 2UWEA 2FWOA 2HJLA 4EEEA 4ZXBC 4PRPD 1CIUA 3ZE2F 4ODSL 3HMXA 5H94B 2O61A 5FGCB 4GG6E 3W39B 1IQDB 3C6LC 3QCUH 1QPXA 4POZC 3FTGA 5I1CH 5J1AB 4HJJL 3V6OE 1JUFB 4EVNA 2F53D 3D9AL 4I3RH 1J05A 3RWGB 4N1CA 4DTGH 4DW2H 5FGCE 2XTJC 3B9KB 2OL3L 4X7EC 4NQXA 2R15A 1ZLSH 1A7RL 1UADC 2VMFA 1CFTA 2WP3O 4KK5D 4HJ0D 1DEEB 1EHXA 1V05A 1OP5K 4R4BA 3CFBA 5IJVB 4YO0B 3EYUH 1T66D 4Z5RB 5I19L 1VADB 3B5TA 1AFVH 1MIEL 1U8OA 2ZOKA 4BSVA 5J11C 4YDJB 1JF1B 1S7XA 1TQCC 3PL6D 1CI5A 3QR2A 2VC2L 1K8IA 5HGBB 3WD5L 3AY4A 3I6GB 2VDPL 3MLRH 1OVZA 4NP4H 5BRZE 2I9TA 1G0YR 2AQ3A 4OKDA 4CVUA 3RDTD 3RL1A 3WUWA 4JE4B 4GAGH 43C9A 1F4XH 2P24B 3GMNA 4ODUA 1J0HA 2PYFB 4QYOA 3NGBB 1LHZA 2YD9A 3CFIC 1NAKH 1E4JA 2F15A 3HE7C 5I30L 4TSCH 3K0WA 4AT6B 4JM2B 1ULVA 2H26A 1FNLA 5L7XL 4X6EA 1T0NA 3BN9D 5IW6B 5J13C 4LL9A 3RTQA 5SX4I 4I18A 5E08L 4LMQE 1CN4A 1DBJL 4JO1H 5E2TL 3ARBA 1S7TA 1DANT 1M7XA 4NN7C 4U1MB 1S5IH 5DT1L 2VJXA 1IVLA 4TUOB 4RGNB 3GJFK 4V2BA 1H5BA 1ZGLA 4MNHA 4JCMA 4G6JH 3S35X 3UO1L 5C0RH 1AQDB 5I1IH 2HMIC 3WFCH 1OGTB 3EFDL 1KN4L 5F1OB 1IGFL 1S3KH 4PGCB 5IV2B 1D6VH 4HCRL 5D2NB 4RGNE 3RWHB 1ED3B 4DQOH 2OMNA 3P30H 4JGMA 4NWTL 5BS0B 1MFAH 2CKBH 3L3OB 2C1OB 4NQEA 4LSVL 3TCLA 2VDRH 1CTNA 5D2NE 3KJ4C 1DQQA 3MQIA 4HC1L 4XZUA 3LIZH 4D0DB 5C0IB 3MA7B 1KTDB 2HT3D 4CMHC 2A9NH 2Z35A 4NC2B 1YN6B 1M6OA 2BSSB 5LQBH 2P8LA 1JI1A 3QUYD 3VCLA 5EZLA 3FFCB 1T7WA 4NZUL 2F58H 2VLJE 4NQTA 5GGSY 2VOTA 5IHBA 2DYPA 2YRPA 1QSFD 4OLXH 4EIZC 2CJUH 5GISH 1KBGH 2XV6B 4J8RB 3WO3B 1KELL 1YMHA 5EORL 4OV6F 4FQQB 4L1DA 3LV3B 3VW3H 1CGWA 4YFLI 3V5DA 1II4E 3NA9L 4PJ9A 3KPTA 4XMLL 3MSPA 3GKWL 3RKDD 3RWFA 1U8NA 2IH1A 5HYQA 3FQUA 5J6GB 3SQOH 1A7NL 1PW3A 5EUKB 1NAMH 5IB4B 3RVXC 1S7SB 3MZGB 5T1LD 4JQVA 3U0TA 3GI8H 1XCQA 4NNXA 5FYKL 1IGTB 4PIRF 1CD1B 1KB5L 3C8KA 3L6FB 1SJHA 1GIGL 5B4MC 2CLZB 4GKSB 1FRGH 1HWGB 4NUGL 5J57B 1VACB 4YR6A 3W0WD 5C0NC 5AUMB 1AGEA 3ULUH 1D3CA 4OLEA 1UA6H 2FJHB 1FGVL 1P7KA 3H7LA 4QRQB 3TPKA 5HHPB 4PGEB 2YOCA 2JJWA 5ANME 3G5VB 5I76A 1YEHL 1F4AA 5F9OL 4LDEB 4UQ3B 5HHOB 3HG1E 4YPGB 3L3DA 3HI1B 4YE4L 3ARED 4LCYA 3CDYA 3S37H 2DQHH 5CMAA 3QI9D 4NQCA 4XVTL 2DI9A 1F97A 5C0AD 3GDBA 1YEJH 2R2BA 2VXUH 5HHOE 4JFFA 1YMMB 5D6CB 5INCA 4QRUB 2NNAA 5IFJA 4OTXH 5GS0H 1TENA 3VWKB 1E4WL 3ULUC 1N7MH 2F54B 4NZJA 1VFOA 2L7JA 1SEQH 1ADQA 1W2KT 4J4PD 4WUUD 2DI8A 1BGXH 4MB5A 1GOFA 2VERN 1U92B 5KVFH 3EYSL 1NEZA 5F21B 5FF6B 3D2UB 4Y19A 1I1AD 2BRQA 5T3XE 1RURH 1WCQA 1G7QB 2F54E 2IQ9L 2Z8RA 1NGPH 2WBWB 4OFVA 2WLZA 4WO4A 2APFA 1NGWA 4AIXA 4G9DB 4PRIB 1ZLWH 2X4SA 3MRFA 4Q9RH 4NYLB 4Y4KD 3H3PL 4GW1A 1YQVH 2MCPH 5T3ZE 5DI8B 3CFDA 5DQJA 3M17A 4H8WH 5GHWH 5IOPA 2IC2A 3MV11 5C0BA 3GJFA 4PRIE 2VXVH 5GS0C 3GHEH 3PP3K 1Z0MA 1FPTH 4HUWA 1YN7B 4PG2C 2P46B 1JTPA 5DUBA 3ARFB 4Z7UA 2OMBA 1U8PA 5HHXL 3CH1B 4HUUB 4XHJD 3BGFC 1S7WB 5JHDB 1S78C 4BM7A 2F53A 2XYCA 1XH3B 2VDQH 4LKCA 5FYJD 1B4JL 2R29L 2RGSA 1GRWA 4ZUWA 1Q72L 3ET9F 2YK1L 2NY6B 1RZKH 3TH3T 5JHDE 5JUEH 5EULV 3MNZB 5DC4B 2RFXA 1HH9A 3MMEB 5I8EA 1CQKA 1AQKL 1JBJA 4NZTL 3F12A 4ZXBB 3EO0A 4ZAKD 3STLB 1N2RA 5E8NB 2XOTA 2AV1B 3MUJA 1MH5A 3C6LB 3MRJB 4P2QE 3QUML 3B9VA 3U9PL 3GSWA 5E24E 1E0OB 3OKNB 1U3JA 1H0DB 1BJ8A 4N5ED 3PWVB 2QQLH 3DI3B 3PL6A 3KPSA 3RIFF 4U7SA 1KCSL 1ZVYA 3SE8H 2XTJB 5F9DC 4X9GA 2CLRB 3QXUA 4PJXF 1RZKC 2LABA 1NCDH 4AYFA 4KTEH 1UJ3C 5E5UB 5L6YH 4FQ1H 1UYWH 2YUXA 4XPGL 1QYGH 3V0VB 4AEIL 1IAIL 3QDGA 4O02H 4NQVB 4ODSH 4ZTOH 5IVNA 3UTSB 1LE9B 1J8HB 3IS1X 3AB0C 4OZGF 5J11B 1TQCB 2BXYA 4FTVA 1KCLA 4LEOA 1OAYL 1FVCA 2HN7A 2VUOA 3VFSB 3HPLB 3UTSE 1DVFA 3AMKA 3TH4T 5I66A 5K59E 4UOW0 2OL3H 1EBPA 3TIDA 4HULB 4EI6A 3LCYA 4NBZB 1TCMA 4HWZA 3HE7B 2VDOH 1QSEB 3V2AR 5I1JL 5I19H 1MIEH 5J13B 2E9JA 2ATPA 4JFYB 4P2OC 1N3NB 1FFNB 3L7EA 1ZA6A 2O5YL 5K9OA 1QSEE 3LPWA 2QQKL 3BT2H 4NN7B 5D7SL 2VC2H 2Y36H 2P8PA 2VDPH 3IVKB 2HVKA 5D1XD 5L9DH 5A1AA 3R0NA 3QUYA 1VFAA 2X1WL 3KDMA 4E9LA 1GGIH 1SY6L 4TULH 1EAPA 1A6AB 3G04B 1NANH 5D5MB 5A2LH 1BM3H 1BX2B 4ZO7A 3U7AA 1PLGH 5L7XH 3X17A 2ICEA 2B4CH 4LRIA 2M8XA 3ESVF 1V3LA 1RUKH 4Y4HA 2NYYD 3KJ4B 4XB7A 4HIJA 4CMHB 3HR5A 2HAZA 2M26A 3QA3A 5MERB 1WAAA 4IHOB 1LWRA 4L3ED 3EUUA 3MJGX 1IC7H 3UO1H 5JPNB 5GGVL 5C0FA 1A4KB 3KPNB 4JFDD 3S96B 3GBLA 1KN4H 3EFDH 2CRIA 4HCRH 4UT9L 3SCMC 2Y5TA 3REVB 1Q9OA 5T1LA 4NWTH 2B4CC 1KTRL 1U2CA 3HS0B 1D6EA 2F74B 2CKBB 1I7UB 1S5HA 1EFXB 3L5JA 4TVSa 3MFFB 4WFEE 5CJOL 4LIQL 3W0WA 4JFZL 3I84A 1IM9B 2VN7A 3MV9E 2XXCB 3O2DL 5CKAA 1MVUB 4FFZL 2UVEA 1CK0H 5B39A 3SDXF 2RHEA 4QRSB 3CFJB 3LS4L 3U1SL 4JANB 3QG7H 3QXDA 2VZUA 3WYRA 3RUGF 5D96C 4LHUA 4RNRB 4LFHD 3E8UH 1KPUB 4NT6A 4WWID 1JGUL 3TM6A 1I8LA 5HY9B 2UZIL 3QI9A 3GSRB 3OAUH 4Z77A 1E6JL 3TJEH 2BHYA 4TTDD 4G7YL 3TVMD 4AENA 1WV7T 3FN0H 5I0ZA 4L3AA 3GKWH 1N6QL 3I2CL 1WFOA 3VFUA 1KYOK 4YDKH 2EKSB 1MCLA 3RFZC 4WUUA 2E5EA 2CIIB 1P2CA 3QULB 3IDGB 3GIVB 4OZFA 1HILA 1NAMB 4R4FH 4J3SA 3NVQA 2IAMC 5ITFB 5DJDB 3VXNA 4QHKJ 3UP1A 2CH8A 5FYKH 5K9JH 4WHCA 5D7IB 4LQ1A 4NSKB 2ZCLH 1WC7B 1X5KA 1WF5A 1JPSH 2E9IA 4CNIB 3CFKB 2C3HA 4NUGH 1AC6A 1I9RL 4R97C 1ZS8B 3OKDA 4HUMB 5D7IE 1QUNA 5INDA 2FBJH 3KXFD 3VXPB 4L29B 3VWJC 1KJ2L 2CDFA 3S3PA 1I1FA 4BFGA 5HYEA 1AD0B 1MFCL 2E7LC 1A7PL 4PJEB 5TE6L 5IEKB 5F9OH 3ULUE 5HVHC 3BKJL 4YJZL 1F58L 1WICA 4YE4H 3RWDB 1IEBB 5CSBA 2BNRB 5I1GL 4G8FB 1A1MA 2QHRH 1M4KA 4CN6A 3KYKL 1FZMB 1TJGL 4QLRA 2AP2A 2BNRE 1CGTA 4PYGA 1ZSDA 5TQ2L 3SQBA 3CDCA 2NY7L 1MWAL 4F3FA 2C3GA 1SMOA 5TFSL 1OB1B 3EYSH 4KTDL 5HVFB 4LCWD 2BZDA 3JWNC 2LU4A 3DXAD 2I9LB 3BMWA 3OJ2C 1XEDA 3BGFB 1P69B 3QAZC 3MRBB 3WUWG 1JGVL 3U36A 3D39D 2ZNWA 4PRAB 3U4BL 1HYSD 3ROLA 2CR3A 4X6DB 3AAZA 4RDQG 4JREC 2EO1A 1PZUB 4H1LG 3QRGL 4JRWA 4M5ZH 5GGRA 3IAGC 1DANU 2Z9TA 4X6DE 2DS4A 1MCHA 4GW5B 4F7MB 3QBTB 3PWPD 5IHZB 1B4JH 3BYYA 2KKQA 2WWKT 2OS7A 4O5LL 2YK1H 2J8UB 1AR2A 2OR8A 4JFEA 4QY8A 5F89B 1UJ3B 3EGSA 4XCEB 1HDMB 1SYSA 1AY1H 5CZVL 3MLZL 1AQKH 2CRYA 2J8UE 1T7YA 4OUUA 1K2DA 2PO6D 4R90L 1INEL 3VXQB 4HEME 3AB0B 5HI3D 3PWLB 4MZ3A 3LY6A 3VFTB 2BC4A 1FZJA 5EU4A 1C5BL 5TDPB 3RX7A 4I0CC 4PRHA 3O11A 1OLLA 3LH2L 1YUHA 4MNQD 1EO5A 3DROA 1P4IL 1N6VA 4ZDHA 4LARL 4M1GL 4KJQC 1RHHB 4XPGH 1XGQA 3LN9A 2ITDA 3FMGH 4OQ1A 4MVBD 4J3TA 2WV3A 2X6MA 3WBDA 1QFWM 3O3BA 2Q8BL 1A3RL 1T1XB 2H32A 4NUJB 5FUOL 4Q9CA 2P4AB 1JI2A 3KNBA 2Z93B 3BEVB 4P2OB 1GAFL 1BF2A 3U30C 3DWTA 1C5CL 3DVFA 1OAYH 3Q5OA 2NR6C 4HGWB 3TT1H 1I7RA 2ILLA 5DD1H 5CUSL 1A1OB 2WP3T 4BH8B 4PJHB 1D5XB 1QSZA 4KKCC 5DEGA 4LLUA 1FAIL 4PY7B 3TIEB 2X4UA 1HOCA 4JKLA 2FBOJ 3H42L 4LPUA 3ZZ1A 1KIPA 3MUY1 4PJHE 3B8YA 2VTFA 1F00I 3TESA 5KVEH 4KXZH 2V7NA 3FT3A 2J6EA 3NCMA 3CAFA 5DGQA 5KSBB 2IBZY 3ARVA 4K2UH 2OK0L 2QQKH 4ODVL 3SOBL 5DEFB 4O51B 4PS4L 2XWTB 3U0PA 5AZ2L 4DVRH 4PR5B 2R9HC 3BMVA 4P3WA 2BOCA 5BMFL 2W0PA 1CXEA 3IS0X 3IU4L 4KV5E 1RJLB 1SY6H 3KLSA 3MXVL 4I4WB 1I4FB 2OJZH 2ICES 3SCMB 1ETZA 3K2MC 3LQZA 1HQRA 4NJ9L 1U3HC 1DN0A 3F7VB 4YEEA 4OUOA 4RFNC 4X99B 4KKLD 1CLYL 1QACA 3O4OC 4YXKH 1NEZG 4HH9A 3MRMA 1WWBX 3EO1A 1DUZA 5I8KL 4JPIB 4CBPA 3T8XA 1U95A 2IH3B 1T2JA 1XIWC 4WY7L 4FZEL 4J6RL 4OCSL 3QUXC 4TVPH 5D96B 3F7QA 2X1QA 1UB5B 4GO6B 1GPOL 5EDXA 3OJDB 1DFBH 2DWEB 4WHTA 2DQFB 1QFHA 3HRZB 2UY6A 4TSBL 1MPAL 2XKUA 1YC8A 1UM5H 3ECBB 5CJOH 1QVOB 3TYGL 4LIQH 5IKCB 2PTTA 4Z0XB 2VZTA 5DJ0A 4KK8D 3C6SA 2Y9RT 3GZKA 4RRPA 3SDAC 1HE7A 4FFZH 3NAAH 3T0BA 3CVHH 3FQWA 3JTSA 1NMCC 3OHXB 3SPVB 1S7RA 4ETQA 3UYOD 2DJ4A 4FABH 5HHNA 2BVOB 4DKFH 4NQDA 3RVUC 4U1HA 1JGUH 1LO2L 3AU1A 2A73B 5FOBB 3T3PF 2EYTB 5FUCE 2HTLD 2IQAB 2A9ML 2P7TB 2XRAH 2E9WA 3IFLL 3UC0L 1NL0L 1FG2B 4R97B 2XZAL 5CJ8A 1YEFH 4GMSH 3TJHC 1XR8A 5IVZA 3VWJB 2A2QT 3HNTH 4LCWA 5IFAH 4AJ0A 5DUPL 4FNLL 5I1LB 4ZSOE 1I9EA 5HVHB 4RCAA 3GBNL 4WTZG 3QIWD 3H3BC 1BBJB 1SJEB 4U0RC 3VXTB 1JP5A 3RVWD 1BVKA 1OSZB 1ZLVK 3H9SD 5T1KB 4WNQA 3O3EA 1N5YL 1U42A 1KIQA 4XWGH 1W0VB 2FJFB 3IFPB 2NPLX 2NQCA 3NN8A 1INQB 1FLRL 2H8PA 5GGVY 1RULH 4C54A 4KVCH 3UMTA 5I17A 4GAJL 3FQXB 3WIHH 4OIIL 2GUOA 3HC0A 4P4RA 5GRJL 2FD6L 5ACZB 1F58H 1NFDA 2MQ0A 3QAZB 3VH8A 5FYLD 4BQCA 3PWPA 5I1GH 5T5FH 3WSQH 3SGJA 1A3LL 4PLKD 1F90L 3O45B 4GG6F 3BP5B 1UB6A 3E6FA 3TZVC 3IAQA 5IVXF 5C07B 4JREB 3EOBA 4XHQA 3KR3L 4YBQD 5C6WH 2QQNL 4JLRB 5TFSH 4KTDH 5IMOB 2PO6A 4RFOH 3MV7D 5C07E 2IADB 1DQLL 3V0AC 3DMMD 4YLQT 1MY5A 4ZUSA 3RVVC 4QRRD 1RZ7L 4HJGB 4YX2H 4M02A 1TZIA 4L4TD 1VDGA 3EYFB 2D7TH 3IETA 1PX3A 4JRYD 2HLFC 4KK6C 4MNQA 1ZHKB 3VXRA 4XWOD 4LP5A 5E6IC 1MCPH 3CXHK 4ZFZB 2XQYK 3D3VB 3O3DB 4Y2OA 2AJXL 1CVSC 3G6JB 3QRGH 4IOFC 4R0LC 1JWMA 1A6ZB 5JMOC 1TNNA 4DKAA 1HSAA 3HE6A 5DRXB 3TN0C 5TH2B 1DQDL 4Q58C 4KHXL 4MNGA 4UOW1 3LEYH 3QUKA 3BP6B 3HAEH 3JWDL 4JN1H 2V2WB 4PG9A 3O6KH 1XF5A 1HQ4A 3NPSC 3QUZC 5DVOA 4QCIB 4JM2F 2B8OT 3FN9A 2GK0B 2O93L 2YRZA 4Z76B 1CXHA 1QFUL 2JB5H 1CLOL 5DDHA 4MQXD 3GB7A 1CQYA 1UWEH 3C5SA 3WO4C 4NCC2 3U30B 1HHHA 3RA7H 4N90E 3VXSB 1D9KA 4Y4FD 4WUKH 2V2XB 4U1KB 3ZL4L 2AGJL 3LH2H 5E1HB 5B39G 3AS3A 5ESVA 3SBWC 5HYSB 3QXAB 4O2EA 4HMCA 4XRCA 1J1OH 2VDNH 2ITCB 3P73B 1A7QL 3VXSE 5IW1A 3QWRD 4LHUG 3GKZA 4M1GH 3B5HA 3FO1B 3SKMA 1X3DA 3MRLA 4YIQA 4J3OC 5DJZA 4PP2B 2W60A 1FZKB 4ODTL 4H5SA 5IK3B 1J5OL 1MCOH 4U3HA 4A6YH 5CBAA 4NDMB 1JPTH 1N8ZA 3N9GL 2XY1A 3QO1B 1O7SA 1GAFH 2Q7YA 2Z92B 5DHXB 5DQDH 5JZ7C 3MGTB 5J1TC 3V6ZA 4MJ2A 3W9DA 4U49A 4Y2DC 5CHNA 2AJUL 4XGZB 5F8QC 1S7VA 4DUXA 4RAVA 2FGWH 4OZFG 1KEGL 3QG6A 5F7EH 4M48L 1FAIH 2Q3ZA 5DRWA 4UV7H 4ZO9A 1CXIA 4XVJH 4TNVF 3V4PH 3TBTA 1A2YA 5KOMC 5EO1A 4X7TA 1U3HB 1L4IA 2Q6WB 4RFNB 4LSUL 2ZCKL 3O4OB 4B50A 4PS4H 5AZ2H 3GK8H 1BBDH 1S8DB 2Y7QB 4OCMC 2D0GA 2K7PA 1IKNA 4W70A 1TVBB 4LCUA 5E9DB 5C08D 4F33A 2QSQA 2ZOLA 4IEFB 1XIWB 4O58L 3QDJB 3WNLA 1TCRB 3MXVH 3PP4L 1I8MB 3MYZA 5D70L 1KCUH 3VFVA 3QUXB 2MKLC 5CSGA 4MCYB 4NN6C 5E9DE 3I75B 4QRTB 4LCCA 2ZUVA 5A3ID 1CD9B 1RMFL 2BHUA 4XCYA 2DBJA 2NTFA 4MA1C 1BOGA 1ZWIB 3TNMA 2GY5A 3C09C 4LLYA 1RUML 5IQ9B 4Q6IA 3S36X 4HPOL 4U6HB 5I8KH 3SDAB 4KY1H 4XCCH 2H2PD 3VD9A 2D3VA 3MOBH 5IJKA 1OTTC 1NMCB 2R2EB 4M8QA 4J6RH 3RPIB 2R2HB 4NIKB 1BD2A 3ILQD 1GPOH 5L6YL 3HNVL 2W9DL 4OFYA 3TBWB 3DUSA 3LKSB 1ZTXH 5CEZL 3U46A 3GMRB 1JNJA 5D8JL 3QIWA 4PUBH 3BXNB 3O2WH 1TZHB 4DCQA 4UUJB 4TVPE 3FQRA 2Z8WC 4BKLB 4CRPA 2YEZA 1UCBL 2FYYB 3UTZA 2P1YA 1AJ7L 1NCBH 1G7JB 3EHBD 1T7VA 4XTRC 5IB3B 4IIQA 1CTOA 3QJHB 3LQAL 3CVHB 3QEHA 3VRIA 1JNNL 2ESVA 5AYQA 2HLAA 4L3CA 4E41E 5KSAC 1F3DJ 2VLMD 1LO2H 2IEPA 2GJJA 2N7BA 4U0RB 3PWUB 1ZLUH 1R3HA 1BWWA 3WKML 2JELH 3S5LB 1X7QA 4V1DE 4M5YH 2OJEB 3MJ8A 3T0VA 2A1WL 4NRYA 5GRYA 2XY2A 3WHXA 2XZAH 3T2NH 1VKXB 2X41A 3JTTA 4JY5L 1FL6A 4J3XA 1V3JA 1BAFH 3UAJD 3FQTB 5SWZD 1JHTB 4PV8B 3I9GL 4OGXH 4NZRH 1RK1A 2X7LB 1IZKA 1HCVA 2XNAA 1CL7I 3OJVC 4QRRA 4NC0B 3BAEL 9CGTA 3OXSB 4L4TA 4ZUUA 1KJ3L 4LP4A 4J3UA 4YHPA 1WJ3A 3TZVB 1FVDA 2EDOA 3W11C 1ES0B 2CD0A 3WXVL 4LAQL 4QOKD 5MEND 1BVLA 3QQ3B 2DB8A 1OQXA 1QBML 1FLRH 1EGJH 3V79C 4X5XB 1ONQB 5GGQH 1S7UB 3X13A 4TUKH 4OIIH 3CZFA 3QEQD 1NCCL 2CDGB 3LVEA 2FD6H 5C0CB 4IS6A 3P3YA 1U8IA 1R3JB 3D69B 4Z0BH 3VRJB 5JTWA 4LHQB 5HPMA 1GOGA 2EDLA 5J12C 1JRHL 3DV4A 4OGAC 5EOTA 4OLVH 4DN4L 5E6IB 4P49A 5F9WC 1KEML 4JHZA 1KGCD 1YYLL 3HC4L 3B5GA 5CBEA 3TLRA 3PV6B 3S3JA 4QHLA 4WIQA 2VYRE 4R0LB 5I15L 3LKOA 3MREB 4HIEA 1F6AA 4UIMB 1CFSA 4OZGA 1ACZA 1KLGA 3BZ4B 2WIIA 3TN0B 4HAGA 5E8PB 1RZ7H 4FFYL 1QEWA 3DSNA 4QT5B 1JFQL 2IJ0C 3OKKA 3ULSA 4DZBA 3C08L 4BH7B 5H2BA 4DGVH 3J8F7 4G9FE 5FA4A 1QQDA 1JPGB 3QWRA 3NPSB 1QFWI 3QUZB 4HS6A 4LFHG 5MEOB 3MJ7B 2BHZA 3SKNB 4GXUM 1LDSA 2NY1D 1MI5A 3DUUB 3ULVL 4YUEL 1AO7E 1I85A 4YBLC 2FRGP 1REIA 1U8KA 2F19H 4XCNA 2QKIB 2YC1A 4JHAH 5TF1H 1KT2A 4NO3A 4GLRI 1HSBA 1K5NA 3WO4B 3A6BL 1LP9A 1CE1H 5HGDA 4GOSA 1AD9A 4PJGB 4RQQA 1FH5H 5E4IA 3SJVD 4QTHA 2EIEA 5I18L 3SO3C 3UTOA 2ZCHH 4PJ7A 3Q6FB 2XQBH 5JR1H 2R23A 3U7YL 2YWZA 4M6ML 4PY8I 3V0WL 1KIRB 2P8MA 5D5MF 3OQ3B 5ENWB 4FQXD 2PYEB 2YPVL 1IRAY 1ZT1A 5F9JA 3BPNC 4HUVA 4LKXA 4P4KC 1A5FL 4PRPE 3MLTB 5JOFA 1ZHBA 3HZMA 5DK0A 4CN4A 4KKBD 5C0EA 2IBGA 2NW3B 3ABZA 1FYTA 3L5IA 5FM5M 3TBSA 1CLOH 2Y07H 2VQ1A 3GSQA 5C09B 3VXUA 3PGDB 4L9LC 4YBHA 4KVNH 5FK9B 4DVBB 2XWBB 1MF2L 1R5VA 1JF6A 3QO0A 4P46D 4RRPG 1RVFH 4Y2DB 4M6NH 3ZL4H 2AGJH 3T2QA 3ZDYE 4PRBA 5C09E 1NC4A 3IJSA 3WJLA 1H15A 2C3WA 2GSIA 3ROOB 2AXFB 1YEDA 2YUVA 2DDQH 4Q9QL 4ODTH 3ALPA 1YDPA 4YFEA 5J89A 5CWSA 1NGXB 4XNMB 4A6YB 3N9GH 3KYOA 2PW1B 5EU5A 1JVKA 3TFKD 1A7OL 4WI7A 4TOYH 4IM8A 4PTUA 3U6RA 3X3GL 4QWWC 1ORQB 5E70A 3BKML 4HZLA 2NZ9C 3MLVL 2YN5A 3CC5A 3I50H 2P5WD 4HFUL 4RMSA 3MACL 4C56D 1KEGH 4M48H 3BZEB 5FXCH 4ELKA 4NQSA 3LN4B 1RIHL 3X14B 3BZFB 1KUMA 1SEBA 4RMTA 4NN6B 4LNRB 5FO8A 4UDTB 1NC2D 3IDJA 3TC9A 4QHMB 1FBIH 1LNUB 4BZ1H 3H7BA 5E6ZA 5JW3H 5F7KC 2EEDA 3C2AL 5DC9B 2CUHA 2JJSA 4MA1B 1I7ZB 3UCRA 4O4YL 3C09B 2VAAA 2CK2A 3EOTH 2OTPA 3MC0A 5KAQG 3WMSA 4EXKA 2ZNXA 1T83C 4MD4B 1X4ZA 2ID5A 3VH8G 5D70H 3BN3B 5HGHA 5D1QD 2Q8AL 1EEZA 4LSTH 1UM4L 2OSLA 2C1PA 5D7IF 4YHKL 5ISZA 1M1SA 3GNML 3QNZA 1IZJA 1RMFH 2Q76A 5ID1B 1Y0LB 2EDBA 3S8WA 5E1AB 3ULUF 1RUMH 1FNGA 3FFDB 5AWNH 2DTSA 4HPOH 1BQHB 4XPHH 1YNKL 5C0JA 5IB2A 4P23C 5CD3B 1XZ0B 3KPRA 4PJEF 3GSNL 4B41A 4QGTA 5SWZA 2OCFD 3G6DH 5BV7L 4RZCB 1QSFE 1NBVH 4Y1AB 3K8MA 4R7NB 3BH8B 3GMLB 4PREB 1Z9MA 4PTTA 5EN2A 12E8L 2W9DH 4LQFL 3L3GA 5KSAB 1E4XH 5BXFA 3VI3F 1X5XA 2YPKA 3TT3L 4AIOA 3SE4C 4WV1C 5FDYA 4OB5L 1P7QD 1MJ8L 4UNVA 3CPLB 4Y1AE 3ILPA 4DGIL 1QKZL 1D5BA 2APXA 3MBEC 4UT6L 2JCCB 2ERJC 1UCBH 2PXYA 4M8VA 3HMXL 2GSGA 4RGMC 4ZFFA 3CDGA 3DRTB 4X98B 1VGEL 4FS0A 3S35L 2MTPA 1NLDH 4JR9L 5C8JB 2JCCE 5IMLB 2DTML 1KPVA 3B6SB 3PHOA 3TO2A 2G5BB 5J6HB 1CE6B 4HK0B 3FO2A 4G7VL 3B2VL 5JOPD 4PRNB 5KVDH 2MWCA 3MR9A 1T6VN 4N9GB 1B90A 1RJZB 3KS0J 1HEZA 1HN1A 3U83A 5A16A 3WKMH 4X6DF 5DTFB 5ETUB 1SM3L 1N64L 2NX5B 5CGYC 5K93A 3QZWG 5B38B 3JSSA 4YK4C 3RY5A 3SGDH 5DFWH 3QFJD 2VZ3A 4UIKH 1F6FB 1IGCL 1JWUB 5LAXB 1EO8L 4JDVB 3M1BB 4EDXB 3QEGL 2NX5E 2YHGA 1UWGL 2NY3D 5MI0C 3RAJH 4CDHA 2H6PA 3QFDA 2R0LL 2BSED 5I74C 3VA6A 3DO7B 1INDH 2J8UF 4GBXD 1DE4B 1UH2A 5C0AE 1RU9H 4PGDA 4RGOL 1C12A 5J12B 3NZHL 5EPMA 1EUUA 1IE5A 2HT2C 4BZ2L 3GSXA 4JG0H 2FIKA 5F9WB 3V6FB 1UKQA 5KTEL 4UDUA 3G5YB 1QBMH 2E27H 1YC7A 5D9SB 3CSPA 5T33L 4FQCL 1MIMH 4F7CB 3MZTA 4R4NC 1OAQH 4PGZA 5GS2D 1NCCH