3QUKB

Crystal structures of the murine class i major histocompatibility complex h-2db in complex with lcmv-derived gp33 altered peptide ligand (y4a)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Unexpected T-cell recognition of an altered peptide ligand is driven by reversed thermodynamics.
pubmed doi rcsb
source organism Mus musculus
total genus 14
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qukB00
4KAQL 3QI9A 2FYYB 1RURH 4TQEH 4AIXA 1AGFB 4G6KH 4MB3A 1FG9C 3QUZC 2NY6D 3P4OB 3ZDZE 3KLAB 1MWAB 4WHDA 5L6YL 3BISA 4JHAH 1K8IB 4I5BA 4LQFL 2ZKHL 1FFNB 1W72L 2PYEB 1JZ4A 3KYMA 3H3BC 3GUTB 5FYJU 1K6QL 5CILL 4Y8AA 1QFUL 3H9SB 3WKML 2F9BT 1AO7D 4HAGA 1UVQA 4ZQKA 5AG9A 3V0WH 1WCQA 4PD4K 4FQ1L 3KJ6H 4O02H 4E41B 4LCWA 4Z78B 5CZVL 4NBXB 4BELD 1CLYL 2C3WA 4NP4L 4YDIL 3K1KC 3CMOL 3LD8C 5KVFH 5D1QD 4HC1L 1G7MA 2QKIB 1NBYB 1IC4H 1NBZA 4OZ4B 4O5LH 1G1CA 1JPGA 5E9DE 1X7QB 1LEIB 3GMLB 2DTMH 4NJAH 2FRGP 1NMCC 5LBSH 4BH7A 1A9EA 1VB9A 2J7LA 5ISZB 2F53D 3HG1B 1BIHA 3T2NL 3U1SH 3QCVL 1WWCA 3KPOB 4FABL 5CEYB 4U6YA 4MQXD 4XPTH 1AGDA 1AO7A 5AYQA 1KF9B 3FT3B 1MHCA 4S0TD 4L9LB 2ZUTA 4IOIA 4MDIA 2Q86A 2X1OA 4XNZC 2C4FT 5D1QA 4ZYKA 1HE7A 3VD7A 4XI5D 1A6TB 3T0DA 3FQRB 1PSKH 2NY5L 1TVBB 2NX5D 3DBXA 1B9ZA 2F53A 4RMWA 3FT4A 1LO3L 4LPTA 3RUGF 5IK3B 3ELAT 5DMGD 2VN4A 4UTBH 1FC2D 3OAUL 4K55A 5KSAB 3SE3C 4RFOL 1WWWX 4LSUH 1N6UA 5IKCB 2QADB 1KXTB 3NCMA 2Z92A 1V3JA 1VADA 2C5DC 5F96H 5HVGB 3MGTA 2P7TB 5EU5B 2XWBA 1CFVH 2KPNA 3SDXA 3QJFB 3OHXA 5I15H 4UIKL 1G6VK 3MBXH 4FQLH 5TQ2H 5JIPA 3MV11 5HI4D 1QZ1A 3KYNB 4JPVH 5LCVL 4KK9D 3FQUA 4OBRA 4WW1B 5BZDB 2NX5A 2I9TA 3HI5H 2FR4A 1PKQA 2R0LH 4GW4B 5E5MA 5TFSL 2AS5M 2GJ6E 3HMXA 3L1OH 4LHUD 1LMKA 1T7WA 1FO0B 5EIIA 3V7AG 5JDJA 1UACH 1T5WA 4UINH 3RVUC 5EU3A 3K8KA 3BPLC 1BJMA 4FTVB 1DQML 1HHIA 1YMMB 3RVXD 1VPOH 4S1RL 4EQ3A 3M17B 4N8VB 1MAML 4R97B 4ZFGH 3N50A 3SGDI 4XNUL 4F15B 2AJSL 3VGEA 3HR5A 4LLYA 4XMLH 3OTTA 3V0VB 3QO0A 4DN4L 2GUOB 4P4RA 4R90L 1NGPL 3TBSA 2W60A 1I8MA 4UB0L 4PLJC 4ZD3H 1DLFH 4D9RD 1CXLA 3IJHA 2EYTA 4MNGA 4OAWB 4HH8A 1RIHH 2WLZA 4BSWB 1ETZA 1FNSH 2YEZB 4K7PY 3OJDA 4WUUE 4XCFL 5D7JC 4WGVB 3IXAA 4NOBA 4W4OC 4I3SH 3U7YL 3R8QA 2QTEA 5J12C 3K80A 3ZTNH 3RBGA 1EGJL 1KIPA 2J88L 3Q6GL 3X11A 3JVGC 2DI9A 4P9HH 4N68A 1FNAA 1CDCA 5FO9B 1HDMB 3V6BR 1LK3H 4GG6A 1YUHA 1INEL 2V7HB 4U6TA 5EU6D 4JFFE 1UEYA 1BVLA 4K3HA 4Y4FB 4QHLB 5DO2C 4JFEB 2ORBH 1K9TA 5ACMA 1N5YH 4PREB 2CUIA 1X5HA 3B3IA 4WU5A 3AY4A 4OGAC 4G43A 1MJJA 1RZ8A 4YDVB 3DJ9A 3DLQR 2H2SC 3NOIA 4M93B 4HJJL 2ARWA 4AM0A 3KYOB 2ESVB 1TJHH 4N90E 1KIQA 3NCBB 1A7PL 1B3JA 1KB5L 3EOBB 3QNXB 4XMPH 4HWNA 4RFNB 3MLVL 4DVRL 3F7PC 5D2LB 5GS2D 3VI3F 3RWDB 2BRQA 3TBYB 5DVLA 3HI1B 5EU6A 1LO5B 3CU7A 1J12A 1MQKH 3WO4B 1WFUA 2UY6A 3TIEB 3MV9B 1RZKL 1CD1B 1JHLL 1RJLA 3RDTA 1IGJB 4PUBH 1KBGH 3NGBC 4KHXL 3SE9H 4NPYA 3CH1A 3EJYC 3OZ9L 1NCBL 1CDGA 2B0SH 3NPSB 1J8KA 3R8BB 3TGXA 2UZXB 3T0EC 2ITDA 2BCKA 1U91B 3FB6A 3ZT7A 3FO1A 4PJEA 5IOPB 4EDWL 4OLZH 1KV3A 4EQ2A 3C5ZD 1TNMA 4R3SA 1IGIL 3V2AR 3ZYJA 2V7NB 4OCXL 3ZDXF 2EXWD 3MJ8B 4XPHH 1Y6MR 5JORB 1P7QD 1FFPA 5B3JE 2R2BA 2OTPA 4P9HC 3SDXF 1UB5A 4QRSB 4XNQB 2Z93B 1LO0H 3QHZH 1KPUB 4P5TB 1QBAA 4YE4H 4CMMB 2B4CC 1XCQB 3OL2A 2BDNL 1QBLH 4KV5E 2AK1L 2ERJB 4M1CD 2P5ED 3IT8D 1JYVA 3MUGA 5BOZG 4HLJA 4KKLD 2EIZA 3HZYA 3C5ZA 4KK8D 1QHOA 2DAVA 1FL3B 2WIMA 4PV8A 3BJ91 3KPLB 1I1FA 1WEJL 1MFBL 3CD4A 4S0SD 2CO7B 5HVFB 1MQ8A 1LO4H 5D96C 1HXMB 4YR6A 5D2NE 1SMOA 4KK6D 4P46C 1HH6B 4ZUVA 3GKWL 5C7XL 4BQ6A 1XT5A 1EEQA 5F1OB 5E2UH 2FECI 2P5EA 4HAFA 2DI7A 2X89D 3FO9A 3X14A 2JJUA 3WJJA 3QIUD 5EZJB 1BQLL 3G08B 3HKFA 4TSBH 4ZUUA 1DFBL 3DUUA 5FECA 1N6QL 4JFQA 3QA3B 5C2UB 4D9QD 3JWNC 2ED7A 2ZOLA 4Y2DD 1I3VA 1R3KA 4XPBL 5DD3H 2NTSP 1CFQA 1JZ8A 1XF3B 2RR3A 4GOSA 3CUPA 5GSRB 3L3IB 4G8FB 2A73A 3HFMH 4LCUA 4GG6F 3GNML 5ETUA 2AVGA 3LN5A 3IDJA 1F3RB 3HC0A 4FFYL 1T21A 2X89A 3QIUA 3SE8L 5J11C 1GAFL 3OKDB 1V05A 1GHFL 1JWUB 4FQ2H 4PR5A 1S3KH 2YZ1A 1NH6A 4E5XA 5I74B 1TVHB 1W0VA 4DVBA 1SBBA 3CXDL 5C09B 2FJHA 4Y2DA 1EFQA 4YBLC 2B20A 1KTKE 2H32A 2CDFA 3FONA 4I77H 3T4AA 5BS0E 1RD6A 1U8MB 3QIWC 3V52L 4MA7L 1A8JH 4NUJA 4JY6B 5TDNB 1UCBL 1J1XH 7CGTA 3L5XH 3HC3H 4JKKA 3EYUH 2J5LB 5DUMH 1CICD 4PYHA 5MI0C 3BQUB 3EJZC 1P4BL 5JDSB 4JM4H 3RWCA 5CIPB 4JQIH 5J9PB 4U0QB 5DJCA 5F7DB 2BP3A 2NXZD 5K59F 3RTQB 4PYGA 3CVHB 3O4LD 5DR5H 4U6VH 2NXYC 3RHWF 3ALPA 3CFKB 3GMNA 4XX1E 4DW2H 2QSCL 5C0FB 1QA9B 3C5JB 1H15B 1E4KC 3ES6A 4UOW0 5FYJE 2YS4A 2ZCKH 4OKVB 5I19L 3LQZA 4OI7A 4LAJH 2J2ZA 4B7IA 4PJGA 5JO5A 3S98A 1MJUH 1EEZA 1CICA 1DBAL 1OVZA 5JIHA 4H20L 3LS5H 4UAOB 4HJ0D 4GUPB 2V2XB 2BY1A 4LVNC 3D69B 4FQJL 3O4LA 4HIHA 4LRNL 1L9MA 1TJGL 3QEQD 5TH2A 1DUYB 2X1XR 3R06B 1ACYL 3DVIA 1HSAA 4NKOB 5D8JL 4Y5VC 5F21B 3VE0B 2QQKL 1RJYB 3IDIB 4MQTB 5E2WL 2D31A 1DUZB 4OZHB 4K9EH 2FSEB 4GJTB 3T09A 4CW1B 2BERA 2VL5B 1MFDL 3QCTH 3VG0H 2J8UE 2BC4A 3NIDE 1M71A 5I8OL 3MRPB 2FB4L 2VXSH 1NCDH 2NY0B 2UWEE 2NR6C 5E8PB 4ODTL 1K85A 4LCIH 4QY8A 2VLJB 2GQHA 5TJWK 3I02A 1K3ZA 5F88B 3WXVL 3QEQA 1OGAE 4KJQD 4F7EB 3BD4A 4NBYB 3ISWA 4LAQH 4LVHB 5DJ0B 4G80B 2XTJE 2XICA 3O45B 3T0WA 1RZJH 3MLRL 1AKJB 1NDGA 1ZA3B 3MRJA 1NAMA 3QEHB 3NFSH 4QCIA 2ADFH 3GRWH 5HGHA 4NWTL 4L1HA 4GW1B 3MZGB 1D6VL 4B7LA 4LPCA 2CIKB 2FEDC 5DVKA 3UYRH 1U2HA 1KCSH 1Z5LB 3D39B 3AS3A 4PJAB 4U1HA 3N9GH 3T0AA 5TQ0L 2EDKA 1EFXB 5IW3A 1ZV5A 1YNLH 1GPOL 3SQOL 3U7WH 1PG7L 2VLRD 1C12A 2UV3A 4QHUA 5FOJA 2H1PL 2X44D 2AV7B 4GXVH 2XIDA 4JRXD 1IT9H 3IAPA 2LAGB 5C0NC 3DXAD 2XNAA 5F9JA 2HG5B 2Y06L 1K4CA 2GFBB 1XGPB 2G2RA 3HTLX 4NHCL 4OUUA 4PJCB 3N1MC 5TF1H 3MV7E 2Q8AL 3LIZH 2VLLB 1N5AB 4P57A 1A1OB 4ELMB 3VWKC 3KHQA 4HH9B 2XQYK 3OQ3B 2I27N 5F3BA 3W11C 3TA3B 1IM9D 3UTPE 4PJ7A 5EBMB 2GK0B 2VE6B 3VXRB 4EN3D 1A7NH 4QT5A 2VLRA 3QEUA 1YEJH 4O2FA 4QTHA 3ROOB 4QKXB 4JRXA 2BFVH 2L0DA 2Z31D 4AYFA 2DLGA 5JPNB 1DN0B 1ONQB 2OTWA 3DXAA 3RKDC 5FAAA 2YXFA 5DZNA 2H3NB 3WIHL 4X99B 1U8HA 1AGCB 3WL9B 3OR7B 3J7HA 5EUOE 5JNYB 1RQ5A 3ULUC 2HN7A 4P2OD 1F3JA 2G75A 4J4PD 4YNYA 2EEAA 3O0RL 5HY9A 1YPZA 2DQJH 1NGZA 1U8QA 3MJ7B 1FL6B 5D6CB 1IM9A 4YHLL 4PLOB 4WUUB 2NZ9C 1GZPA 5J57B 2IPTL 3DURB 3L3DA 1BJ8A 2Z31A 1DJSA 1OSPL 1SYSB 4Z0XA 1QEWA 3WXWL 3G04A 5BXFA 4UMGA 2O93L 5KG9B 2OK0H 1DBBL 2XY2A 1IAIM 3MRMB 1IC7H 2Q87A 2OR7A 2J8OA 4Z7WE 4P2OA 3TBVA 4FQXB 2HTLD 5A2KH 4J4PA 4F57H 2FX9H 3HNSH 3LKNA 4NGHH 2CK0L 2E8YA 5C07B 1UB6A 3C6LB 4RSVA 3S96A 2EYSB 1A21A 4TNVK 4TUJB 5E8DH 1N2RA 4M7ZC 5CJQH 4YZFE 3S97C 1X5AA 3CSGA 2AJ3A 2OR9L 3ZTJH 2Q8BH 4CAGA 1P84J 3HE6A 1K4DB 3V9FA 1C5CL 4KVNH 2EYRA 1BWMA 3B5HA 4AEEA 4OD1H 5IMMA 3BRDA 4UNUA 3ESVF 4QRQB 4M02A 3RIFF 5L9DH 4PS4L 4NZRL 1B0WA 4XWOD 4DEPC 5FM8A 2BOCB 1BOGB 1WSST 1U95A 4UTAL 2JLLA 3WO3B 3GJFA 3GBLA 5IW1B 1UYWL 3NIFF 1MHPH 5F6HJ 3S88L 4LNVA 3ARXA 3UTZA 1LQSR 5CBAB 4G9FE 3LH2L 3ULSA 43CAB 2VDNL 4R7NA 3ZKMD 3RY5A 2OMBA 1EH9A 4JY5L 3OB0K 3VFVB 4DOHE 1BLNA 1HHHA 4KZEL 4WI6A 3LN9A 5F7EL 1ZA6A 3T08A 1YQVL 3PGDA 5DYOA 3DMMD 4LCYB 4LLUA 5D4QA 1I9IH 3GJEA 1INQB 4M4RA 2C3VA 5LGHH 4I0KA 3VFSB 1SEBB 1LP9E 4R2GB 3ALWA 1JMXA 4PB9L 2R29H 2WUCL 2Z8WC 4XCCH 5IEKB 1FJ1B 4J7RA 1CVRA 4MJID 1HH9B 1B2WL 3UJJH 1NGXB 1KOAA 1EHNA 5EC1A 3DVNB 1LD9B 3KG5A 3WN5A 4UBDD 4LF3B 3DO3A 3FAWA 3GSNA 1A3QA 2MCPL 4OCLC 3G6DH 3D0LB 5GRJL 3TVMB 3PQYE 4PJ7F 1TQCC 3NN8A 1XR8B 2FATL 1UWGL 1FL5A 4AG4L 3DMMA 1EZVX 4GBXB 3MROB 1AE6L 4EBQH 4ONFH 3MRNA 3CXHJ 1A14H 4JZNA 4QOKE 2FJGA 3T8XA 3UPAA 4U2YA 4N0YL 1OD7A 2F8OA 1M1SA 4QHMA 1S5IL 1GIGH 3LKRA 4KTDL 4MJ4A 3MC0A 2MJWA 4MJIA 1TCRA 3UP1A 5DK0B 4YHZH 1G7PB 3PV7A 5DJDA 1YEFL 4JHZA 4UDTA 3L3HB 3IF1B 5D72L 2VH5H 4MDJB 4N0UB 1J1PH 5L0QC 3F7RA 1KFAH 1YPZF 2EH8L 1YYLH 1FNGB 4LBEB 5FKPA 1IM3B 3KXFD 4X7CC 5INDA 5HDBF 1MFAL 3VG9C 4PJDB 2J6EL 4Z7UF 2NY1C 5EZLB 3VRIA 1NAML 1ZHBB 1N3NB 4OTXL 1BBDL 4K2UL 3WBDA 5JW4R 4DZ8B 2A9ML 3P0VH 1HNGA 1DLHB 5M7QA 2BVPB 5DUBB 3D6GA 5ITBH 3GSUB 1YYMH 1ZS8B 4RRPA 3OXRB 3I75A 2RHEA 3QDMD 1J1OH 1MUJB 1L7TL 1RUKH 1CE1L 4Z7VB 2RFXB 2D0HA 3WHXA 4WO4B 5HTSA 2ZP0T 3KXFA 1ZHLB 2AEWA 3NFNB 3E8UL 2F74A 4CVXB 3WDIA 3RL1B 3ET9F 3LQMA 5FUCE 1QO3A 1PZ5A 3H7BB 3INUH 4X5WA 4LQ1A 1PYWA 5FXCH 4L9DA 2XA3A 1KLGB 4RISL 5C0EB 4FQHB 3VWJC 1I8KB 1B0GB 5HGBA 3QDMA 1Q9WA 3D3VD 2AXGA 4ZAKB 3QUKB 4L8CB 4LEOB 5GS0H 2H9GB 2MSPA 2E27H 3UO1L 1UGNA 4ACPA 3EO0B 3AM8C 3C8KB 2XZCH 3BKYL 3GI8H 3H9HA 1AXTL 4Y4KB 1RUQH 2IAMD 1I3GH 4ZO6A 1LK2A 4X6CA 3PWNB 4OB5L 5LGJB 3KPSB 1AP2B 4IRZH 5I8CB 4RAUA 4KI5C 1XEDA 5I18H 3IGAA 4LPWA 4HT1L 5TPWH 3EYVB 4R8WH 2DBLH 3ZT6A 1FE8H 2VXTH 3BUYB 3D3VA 2GTZA 5C0DB 1R24A 2ZUQB 1UJTA 4JM2B 5SWZD 3AU1B 4FQIL 1ZANH 4KJWD 1YQ2A 5EZIL 3DUSA 1FIEA 4WHTA 4C4KT 1H3PH 1WGOA 2W9DH 3SCMB 2IAMA 4OV5B 1JPFB 3FRUB 1RMFH 4OSUH 2O5XH 3TH4T 3MCLH 3LY6A 2DM4A 3NACL 6FABL 2XTLA 3MRGA 3BYYA 4MS8C 4Q9RH 2I5YL 4JJHA 1I7TB 3GSQB 5KJRH 3AS1A 3G5XB 4XMKH 3WNNA 3DO7A 1X4ZA 5FYJH 1INDH 2J8UB 2YMXL 5J7CC 4M48L 3CSYB 3MRQB 2PYED 3GHEL 1SM3L 2A9NH 3QUZB 3NH7H 5SWZA 3BN9D 4G8EA 4O58L 3SHSA 3H9SD 4JPIA 4KRMB 1QLFB 4KXZH 3D2UB 3UXFA 4YJZL 3V5DB 3IRZA 2ICWA 4N0FA 3MPCA 5L88L 3HLAB 1CF8H 3VH8A 1T1WB 4XAWL 4E41D 3F12A 4Y2OA 5GS0C 5DSCA 2ZCHH 2UVFA 1N0XL 4TSAH 3MRFB 5ERWB 2IFFH 3MODL 2FYYA 5BV7H 4GQ9L 4XP4H 1OPGH 1AGFA 1ZLUH 5I1GL 3P4OA 2AGJH 3KLAA 1MWAA 3JV5A 3HNVL 1XH3B 5CD3B 4UV7L 1K8IA 2DQFB 1HOCB 5ISZD 3HG1D 1IAOB 5ESVB 1FFNA 3LD8B 2PYEA 1R5VB 1FPTH 3GUTA 3VFPA 3T2QA 4ZFZB 1NMCB 1KYOJ 2IMNA 5GGVH 3RRQA 4YHYB 5JUEH 1BF2A 3O6LH 1BVKB 4Z78A 3LS4L 4NN6C 3WFCH 1R3HB 4BZ1L 1HINL 1JV5A 2EIBA 2VSDA 4OLXL 4JO2L 2QKIA 1NBYA 3DRQB 4OZ4A 3P30L 1LEIA 3IJYB 3GMLA 3F7YB 5KSBB 5GGRB 5IB5B 5I1HL 3G6AB 4B50A 5D5ME 2DKSA 1XMWA 4OD2B 3UBXB 4ODVL 4RWYH 5DURD 4XCYB 1A1MB 3KPOA 4JG0L 5CSBA 5CEYA 5KSAD 2DQIH 4GAGL 1U8PB 2MQCA 2ZUWA 1WICA 3ZYIA 4PJFB 2CR6A 3GSNL 5HI5D 1X44A 4NQSA 3FT3A 2QADD 4AEHL 4L9LA 5I1JL 2K7PA 4PGEB 5CMAB 5CZXC 3VGFA 1E6OL 5FYKD 4DGVL 4JVPA 3KHOA 2Y6SD 4UILH 4X6CF 1A6TA 1FHGA 3FQRA 4IDLA 1TVBA 2W0FB 3MOAL 4NC0B 4RGNE 4HWBH 3W5NA 1NANH 5IK3A 3BVNB 3RQ3A 3SDCC 3LEVL 2BXZA 5KSAA 4S1DC 4U7MA 5CINH 4FTVD 3WNMA 5GRVK 1YMMD 4QWWD 5IKCA 4HG4J 3B83A 3KPRE 2RAMA 5LQBH 1RK0B 2I07B 2P7TA 5EU5A 5SWSE 1S9WB 3QJFA 3BPLB 4R4NC 3DUHA 1NFDE 2E6PA 3S37L 3KYNA 1MPAL 5IQ7L 1GGBL 2X4UB 5H2BB 1KN4L 3K2UL 4WW1A 4LLDB 1WAAA 3PWVA 5IMLB 1GCFA 4D3CL 4GW4A 1I8IB 4H88H 4IOFC 2HKFH 3SKOB 2VLME 4HIIB 1FO0A 1PW3A 3U0WH 3TC9A 4FTVA 3RGVA 5IVXE 1YMMA 3T3PF 5GS1B 1OLLA 3QDJE 1DQDH 3M17A 4N8VA 2QQNL 3WHE1 1CFNB 1D7FA 1RFDH 5F44A 5FF6B 5J12B 5HI3C 3V0VA 1S7TB 1UZ8B 3VU2A 1T1YB 2BVYA 1E28B 2GUOA 2G5RA 4LRIA 1X4YA 4Y4FD 5DQJB 3GMOB 3VH8G 4JFED 5GIRB 1I7RB 3IAGC 4JHWH 3V5HB 4OAWA 4OJFL 4H8WH 1BGXH 2DQGL 5DK2B 5DJAB 4BSWA 1V7NL 1CGVA 2YEZA 4PRPB 3WS3A 3TP4A 1VSCA 2ICWJ 3VA6A 3KPNB 5IM7A 3RZWA 1D9KC 5DD1L 2R9HC 4GXUN 5FK9B 3SE4A 4D2NA 1DZBA 4JDTH 2ESVD 3C2AL 2YPLE 1JGUL 5EU7C 1A3LL 1FG2B 3RVVC 1IC5L 3HUJE 5FO9A 1HDMA 2XN9B 4X7SL 2YPVL 2FGWL 2V7HA 3H3KA 2CXKA 4Y4FA 4QHLA 4JFEA 3HZMB 5K9KA 3MV9D 5TE4L 3NIGE 4PREA 4X0KB 1LP9B 3WLBB 3I9GL 3FZUC 4YDVA 3RY6A 1F90H 3H9YA 4DGIL 5GZOC 2VDLL 4QXTB 4OFIA 5DFVC 4NWUH 4WI2A 1U58B 3P4LA 3KYOA 4OZFB 4WFED 1DR9A 5FCSH 2CRZA 3ZZ1A 3EOBA 3LMJH 2FO4A 4HF5L 3RPIA 5L2KB 2JTDA 3HC4H 3T0EB 1FYTE 3RWDA 3L3JB 1ZLSH 3TBYA 3PQYB 3HI1A 2XXCB 1S78C 1J05B 3JV0A 3NAAH 3OGOE 5AYUL 4NFCA 2YKLH 3TIEA 5EIVA 4P2CG 1CD1A 1IGJA 3B8YA 4WHCA 4P5TD 1PVHA 3KPQA 3QP3A 2AJVL 1AQDB 5SWQA 1IAIL 3S35H 4U49A 4WWKC 1BAFL 4I0PC 1U91A 4PP1D 5IOPA 3MRLB 3ARBC 4H8WC 3IS1X 4LLVB 2EH7H 4EZMA 4H1LH 5CJBA 3MJ8A 4O2EB 3Q3GB 3GIVB 1ACZA 5CS7A 3RL2B 1J8HE 3RUGE 3WDHA 5JORA 1YY8B 3LPWA 3O3BB 5J4MA 3LKQA 1MWAL 2G60H 1QLEH 4QRSA 4KQ4H 4XNQA 2X42A 1I3RB 2C1OB 2Z93A 4DQOH 3QHTC 3UJIL 5E99L 1KPUA 2R0WL 2GW5A 2WZPD 1F4AA 5IBTH 3IJSB 4Q0XH 1PX3A 3MOBL 2QJDA 4QRTB 4CMMA 2HYMA 1WAAF 5D96B 1XCQA 1T03L 1T83C 4XBEH 4HLZH 1KENL 3LSOB 1EPFA 2IANE 3K74B 4LCCC 1UH2A 4P46B 3Q1SL 4JR9L 3VFOB 1BP3B 1JGDB 3NZHL 1Q1JH 4D9LH 3QG7L 1FL3A 3TNNB 1EJOL 2IQ9L 3DX8B 3KPLA 3V7AE 2CDEB 4N8VG 1OCWH 2VZVA 3LB6C 4D0BB 1ULVA 1HH6A 5MERB 3CPLB 1JHKH 4Q97A 3A67L 4ZPTA 5C86A 4YUEL 4FQCL 5JZ7C 5JOFB 1HEZA 3BZDA 2AI0H 3BP7B 5ALCL 1ZLVK 4OCYH 1PQZB 5EZJA 2DB8A 3G08A 5DC4B 3UZEA 3DYOA 4LEXL 2CMRH 4KI1A 2EO9A 3DX7B 1I4FB 1OP9A 5MEPB 5K9QI 1T6WA 4ORGA 2AP2A 4CRPA 4WCYH 3QPQC 5C09D 5I1DB 5J11B 3QUYC 2ZG3A 1XF3A 3SDDD 4MQSB 1TZIB 3L3IA 4G8FA 5GSRA 4Z7QF 4KMTH 5E4EB 4PY8I 2HFEB 4HUUB 1PJ9A 4YBLB 3DROB 2QSTA 1YJDH 4ZUTB 5HHVH 1BREA 3WLWC 3BQUD 2ED8A 5F1IB 4OBSA 4NNPH 2J4WH 3QIWB 1A5FH 4M7LH 4HS8L 2NLJB 3OKDA 4MNQA 1JWUA 2J12B 3RTQD 3MX0A 2W0KA 4XNYL 2CGRH 1UCTA 4QEGA 4WI4A 5JQ6L 1TVHA 4YXHL 2DQDL 1FAKT 3O2WH 3VD9A 4NCC1 5FYKL 4ZNEA 4L4VB 3CFIC 3I6LD 1NEUA 5I1CH 1U8MA 5F1SA 2EE6A 2NXYB 4QXWA 2DQTH 4HS6B 4OT1H 5D2LF 4JY6A 5TDNA 1JPTH 3CLFH 1EAJA 3LEXB 4NO5B 1FZJB 1ROWA 1XF1A 2VQTA 2C4FU 1C1EH 1K3IA 1FO0L 2MNUA 4M43L 3HNTH 3BQUA 3B2UC 5JDSA 1T20B 3BZFB 1AO7E 1WK0A 3UPRB 5CIPA 3VI3E 5J9PA 5EOQL 5F7DA 5CJOH 5J6GB 1H5BC 5EBWB 2X1WL 3RTQA 3JUYA 3CVHA 3RIAK 2PUQT 3BZ4B 4OLWH 4GG8B 4AIOA 3CFKA 2R0KH 2HLFC 1J0YA 5C0FA 1QA9A 1H15A 3UPCA 1UM6L 1UA6H 1CQKA 2Z4QB 4LVNB 1BFTA 4OKVA 2F53E 5IUSA 3PIQB 1TVDA 1A4KB 1NPUA 5SX5K 5D1ZC 2DN7A 4Y5VB 4U6XB 5FGBC 4AENB 4JZJA 5IB3B 1OW0A 3BJLA 5CWSB 5D71L 2NY0D 2CPCA 1AD0B 4H25B 2UUDH 3MRCB 5GGTA 3ZDXE 4NKIH 2HT2D 4RAHA 5IJKA 1NFKA 2VLJD 5JIKA 4GUPA 2V2XA 3RWIB 5A2JH 3BXNB 1EHLH 4PRNB 3D69A 2E5EA 3SDXE 1HYRC 5DDHB 4M6ML 3VDCA 5DJ8B 1DUYA 1G0YR 3R06A 5DK3A 4NKOA 4QTIL 3VE0A 2HWZH 4P3WA 1F11B 4KROB 5KVDL 4EVNB 2ZUYA 1AKJD 1IBGH 3GMPB 3IDIA 3M8OL 2NX5E 4ETYA 1I9JL 2MFNA 5FOBA 2XKSA 1FSKB 1AHWA 1DUZA 4YAQB 1G9ML 4OZHA 4CW1A 2FSEA 2VL5A 4YIQB 4LIQL 4MXQD 4LDLB 3MRPA 3OF6D 3UJTH 5LKNA 1G0XA 4OM1H 5E8PA 1U36A 2B2XL 1J5OL 3HN3A 1IEHA 1GVIA 2YUZA 2VLJA 3D39D 4GAJL 1S9XB 4JO4H 3BZEA 4J3OC 4P48A 2BY2A 5F88A 1EFXD 4KKBD 4F7EA 1T7XA 2VC2L 4XVTH 4FG6C 2AJYH 2B7DT 1OF2B 5DJ0A 4G80A 3O45A 1PD6A 5I1LB 5GRUH 1AKJA 1ZA3A 5H37H 4AL8H 2P48B 1R5WB 3QEHA 5ESQB 4L4TB 4MNGE 4NRXB 3PP4H 1CFTB 2WBKA 4GW1A 3B2VL 1ZT4B 3OF6A 1FORL 2CIKA 3THMH 4CN1A 1AFVL 2DQUL 2DF3A 1Z5LA 1MREH 3D39A 2R0ZL 1Q72H 4PJAA 4KK5D 1EFXA 3TA3D 4BFIB 3VXRD 5JXEC 3VWKB 2H26B 3P73A 1KEML 1VKXB 4GG6E 2DLFL 2AV7A 4WTXA 3WE6B 4ALAL 3SOBH 5SWSB 4I48B 2DIAA 1G7IB 2HG5A 3CDGB 4J3VA 4D9RE 2GFBA 4JHBA 4MX7B 3BH9B 1CD9B 1XGPA 4IIQC 4KAQH 4PJCA 5A2IH 1TETL 2VLLA 1N5AA 4YFEA 5IR1B 1A1OA 4ELMA 1OL0A 1QHPA 5L6YH 2OJZH 3SDAC 4PRDB 4HH9A 3BDBA 4LQFH 2E8ZA 2ZKHH 2GJ6A 1W72H 4HFWB 3N1FC 2IQAA 5C0JB 3TA3A 5IBUB 3UEZA 3LDBB 5EBMA 2GK0A 2VE6A 3VXRA 4WUUD 1K6QH 2VZ3A 5CILH 1FNEB 1QFUH 1NLDL 2X6MA 3WKMH 3ROOA 3F7VA 4YXKL 3BKCL 4KRLB 5JPNA 1DN0A 1YNTB 1ONQA 1NCWL 3E2HC 4J12A 4P23C 3IVKB 5CZVH 4F9PC 1T4KB 3K4ZA 1CLYH 4NP4H 1P2CB 2H3NA 4YDIH 3EFFB 1AGCA 4ZODA 3CMOH 3D48R 3OR7A 3WL9A 4BFBD 5K59E 3JWDL 5JNYA 4HC1H 3SKNB 1OP5H 3LHPL 4FQXD 4N1EA 3PE9A 1PG7X 2IALA 5C07D 3IKCB 3BO8B 3MJ7A 3C6LD 3DNKA 1FL6A 5D6CA 1DBKH 4KXZI 3MXVL 3T2NH 4WUUA 3QCVH 2JB5L 1XR9B 4FABH 1A3RL 4WY7H 2A6JB 4Y5XC 3ZE2F 3DURA 3NMEA 4RNRB 3DOSA 2WWMC 1V3KA 2P4AB 3BMWA 3KVQA 4I1NB 35C8L 2N4IA 3DGGB 1SYSA 2CDGB 2YR3A 4M7ZB 1RVFL 1KT2B 4G6FB 4EDXB 5KANG 3KLHD 4OF8A 3HUJB 2EZ0D 4C57C 3GKZA 5KG9A 4AIZB 3MRMA 5E5RB 2BJML 2ZSWB 4FQXA 4KKAC 4OZHF 5F3HB 2ENYA 1IL1B 2VUYA 5C07A 4DEPB 2ZNXA 3C6LA 2EYSA 4TUJA 3ZE1F 1WBZB 5I75C 4XHQA 3UTQB 3OAUH 4RFOH 4X80H 5C9KA 5CHNB 3AAZB 3JWOL 3K0WA 4JO1L 1K4DA 3QQ9D 4M7JL 1F58H 2APBA 1J86A 4OFDA 3IYLW 3MBEC 5IB4B 3S36L 4QRQA 2E9IA 2CD0A 4O2CB 1B4JL 3BEWB 1FBIL 3WD5H 5D7KE 4DTGL 3TN0C 4UIKH 2Y5EA 3DETD 2BOCA 1XF5A 1BOGA 5LCVH 5L7XL 3EHBD 1PEWA 4R2GD 4V2BA 3DWTA 5IW1A 3TFKD 1IEAB 4AZ8A 1EAPB 2Y9RT 3R0MA 3V4UL 5CBAA 2ZJSL 3MLXL 4L3EB 5TFSH 43CAA 3LKSB 3CVHL 1OAUL 3QXTA 5K9JL 2WBJC 4JDVB 4PJAF 3VFVA 4J2XA 1DQMH 2X9YA 1H8SA 5BW7C 4M5YL 3TVMD 4S1RH 1MAMH 4CN6A 2VDKL 3RWFB 3ECBA 4UV4L 4GBXD 4LCYA 2FEEL 5F9WC 1NGYB 4XNUH 1SY6A 1INQA 2AJSH 1Q9LB 2E7MA 2R2CA 3OAZH 1SEBA 4YGAB 4DN4H 1NANI 4R90H 1YA5A 1I7UB 4ZS6D 1NGPH 5F1KC 3EOYG 5GGTL 2R4RL 3HS0B 1F8TL 1RIVL 5EH1A 4UB0H 2F5AL 5IEKA 1FJ1A 1CD8A 3ILPB 4PJCF 1HH9A 4P0DA 3RI5F 3RZCB 3K8LA 4PGCA 1NGXA 4L8BB 4ELMF 3LRSB 2ZUVA 2EICA 4QHKI 4QRUB 3DVNA 1LD9A 4JRYB 4XCFH 2IANB 3PXJA 1VHPA 3O2DL 3U7YH 3D0LA 3TVMA 5I30L 1EX0A 3PV6B 1KB5B 1EGJH 2J88H 3Q6GH 1XR8A 3ETBF 15C8L 3P4MB 2WUBL 2PKDA 5TDOB 4GBXA 2FH8A 3MROA 5CJXC 5CLWA 2OP4L 4NQCE 1MHEB 2M26A 3TWCL 3FB5B 3VG9B 1EXUB 1KXVC 1INEH 2NY1B 4NN5B 2A1WL 4C58B 3RHWK 3HAEH 4P3DB 5DK0A 5GRXG 1G7PA 1YEGL 3LN4B 4UT9L 1J0KA 1TENA 2R8SL 3L3HA 3IF1A 4N0UA 1N59B 1MIEL 3ZT5A 4APQB 3TJHC 1A6ZB 4WO4D 1QTYT 5JOEA 1T66D 1BX2B 3P11L 5FO7B 3BPNC 1FNGA 4YHPB 4LBEA 4HJJH 3ZHDA 1IM3A 4PJDA 2ARJB 5EZLA 2BY0A 1A7PH 2VABB 3D5OF 1ZHBA 4H26B 4ZS7L 5KTEH 4NNXB 1N3NA 1E4XH 5ECJE 3O6ML 4K94H 3RP1A 1VCAA 1NUFA 3MLVH 4DVRH 4UU9B 4DZ8A 1NDMB 4LOUD 2YD9A 5K9QG 4WV1C 1DLHA 1L0XA 3MACL 4Q9CA 2BVPA 5DUBA 3GSUA 2PF6A 4FXKB 1J0HA 1ZS8A 3OXRA 4PRHB 1ADQA 1RZKH 1JHLH 4LSPL 4KHXH 1D5BB 5EC2B 4Y4HC 3O4LE 1MUJA 4Z7VA 2XRAL 5FEBA 4ZAKD 2RFXA 5BZWB 3VXME 3OZ9H 1RHHB 3N85L 1NCBH 3BKJL 4WO4A 3VWJB 3N1PC 5F7FA 1ZHLA 2VZUA 4PLKD 3NFNA 4Y4KD 4EDWH 1NSNH 4CVXA 5B39B 1IGIH 1MEXL 4OCXH 4U1GB 3VD4A 4PY8J 4F9LA 5SV3A 5F9DC 3H7BA 1CXEA 3TYFB 3PWUB 3KPSD 4YXLL 1KLGA 3DSFL 3VGHA 5C0EA 1S7QB 4FQHA 1I8KA 1B0GA 3MJ6A 5HJ3B 1EUUA 5E6YA 3CH8A 2DLTA 2FD6L 3QEQE 4DN3L 4ZAKA 5LWYL 1TTGA 3UTTB 1WVZA 5HYSB 5CD5C 3QUKA 4GSDL 4L8CA 2BDNH 2H9GA 2YWYA 4JM2D 2AK1H 4OF0A 3C8KA 3QUXC 4M4PA 4Y4KA 3SCMD 1DCLA 2ZOKB 4CU7A 1U3JA 5IHZB 5C0BB 1X5JA 2EDWA 1I8LA 2QHLA 1WT5C 3PWNA 1CL7L 5B22A 4FNLL 1WEJH 1R3IL 1MFBH 4N5ED 3KPSA 5LGJA 2X4RB 1AP2A 4Y19B 2W92A 3QXDB 5I8CA 3VRJB 5DEZA 4Q2ZB 3EYVA 1IEBB 4K94C 4JANB 5AZ2L 2O5ZL 5DC9B 3TCXA 3GKWH 5C7XH 2GY7B 5E8EB 5C0DA 1CGYA 1PY4A 3QUZD 1MFCL 3AU1A 3SGJC 4U1SB 2DQCL 2VDPL 3D2UD 2IBGA 1F6FB 1CLZL 3SCMA 4OV5A 1BQLH 1JPFA 3FRUA 3S3PA 2XACC 5A40E 1CGSL 4MZ3A 2WW8A 4GKZA 4JAMB 1BIIB 1DFBH 5F89B 4QHNB 1MCRA 3UROR 1ZT1B 1N6QH 4XPFL 3U6RB 3MLPA 1WISA 3CFBB 3DGCR 1I7TA 3GSQA 2R2EB 5FHBL 4XPBH 4UQ2B 3O2VL 2HFFB 3G5XA 4HBCL 1FZKB 4PJ8C 3VFRB 2J8UA 1UG9A 4EI5C 3QI9C 3CSYA 2Y4SA 3MRQA 3GNMH 4NHUA 4XXCC 5F6IC 3QUZA 4FFYH 2VLRE 2D4DA 3WFDL 5LVEA 1MCWW 1T6VN 3HZKB 3GMMB 3MRBB 4HFUL 4JRXE 1T80A 1QLFA 3D2UA 4TRPL 1ORSB 1YN6B 5DRZB 3V5DA 3LQAL 1LWRA 3BIBX 3DXAE 3SE8H 1GAFH 3P3YA 3HLAA 3KLSA 3WFZA 1CLCA 1GHFH 1JNNL 3ULVC 3SY0B 5ID1B 4EUPB 4PBVC 3U46B 3RWHB 2SEBB 5IESL 2DICA 5ERWA 3MRFA 1YDPB 3CXDH 4PJDF 2XKNB 3FFCB 3FFDB 1XH3A 5CD3A 4NN6B 1YPZE 2DQFA 3V52H 1HOCA 1MLBB 4LHUB 4MA7H 4M03A 1IAOA 5ESVA 1UCBH 3AS2A 3MNVB 4KKCC 4NQEB 5HDBE 4BQ8A 4Z7UE 1R5VA 4ZFZA 2WAHA 3Q5YA 1P4BH 1KJ2B 5EZOL 2FDBP 4U1KB 4Z7VF 4OM0L 2DJSA 5GGQH 1BVKA 1F2QA 1U6AL 5FYLD 3AS0A 3TIDA 1R3HA 3IKKA 1A0QL 1SY6L 1NKRA 2QSCH 4XT1C 3DRQA 2X4SB 1REIA 5DUPL 3QWOB 3IJYA 3B9KC 5I19H 3F7YA 5KSBA 1NFIB 2F19L 4IRSC 5IB5A 3GFUA 5FYKU 3G6AA 4CKVX 5AZEL 5D1QC 4L3CB 4Y5YA 4OD2A 5EPMB 3UBXA 4XCYA 1A1MA 3RIFK 3LZFL 1DBAH 1ZHNB 1JK8B 4OF7A 1U8PA 4H20H 2PO6A 4PJFA 4KDWA 2X4TB 4Q6IB 2YUWA 3U9UB 3S3SA 4O9HL 3SDCB 1HIML 4FQJH 4LRNH 4PGEA 5CMAA 4EIZC 1TJGH 3WDJA 1ACYH 5D8JH 2QQKH 3WMSA 5EOCL 1CXIA 5E2WH 1KELL 1TFHA 1CN4A 2W0FA 1MFDH 3NA9L 4MCZB 1HILB 3KNBB 3NABL 3P2TA 3HI6L 1MH5B 3BVNA 1KXQE 3TBWA 5I8OH 3VXUB 2FB4H 4ODTH 4NZUL 2Q76B 3SO5A 4K8RL 1LGVA 2E6JA 1C5BH 1RK0A 3BE1L 2I07A 4NNYB 5T1KB 4JM2F 3WXVH 1S9WA 1T7ZA 3MV01 3MLZL 2IEPA 4MVBC 4DGYL 3GBML 3UDWA 4OFYD 2LABA 3HB3C 2UYLB 3MLRH 2H41A 4JO3L 2Q6WB 2X4UA 4X5XB 1M4KA 5I17B 4NO0A 5IMLA 1ADQL 1X5ZA 1FVDA 1I8IA 4MSWB 4NWTH 3VXOB 3CFDB 2V2TB 4MWFB 3SKOA 4X4YB 1UH4A 1D6VH 4HIIA 4JPKL 3O4OB 4PRPD 4GW5B 1BOYA 5DO2D 1GC1L 2J8UF 1N0LA 3BUTA 1ZOXA 2E7LC 5GS1A 5TQ0H 3EOAB 5HDQL 5JW3L 2WK2A 1GPOH 3SQOH 1CFNA 1OAXL 1PG7H 2IBBA 1D9KB 5GS2H 2H1PH 5FF6A 4OFYA 1S7TA 1UZ8A 1JZ2A 1RUAL 1T1YA 1E28A 2XN9D 1MOEA 3CFEB 3JVGA 4NDMA 1U8NB 4UZGA 3GMOA 2Y06H 5DQJA 3U4BL 4GKOA 5I9QC 1FIGH 1I7RA 2VWEC 4PG9B 4YDJB 5GIRA 4LU5L 3V5HA 3LKOB 5DK2A 3BMVA 5DJAA 5GJTL 2Q8AH 3QJHB 1XGQB 3FTGB 4PRPA 3QCUL 5EUKB 5F7UA 1UKQA 3KPNA 3Q0HA 5DMJB 3O3AB 4PTTB 2PTVA 5FK9A 1A6WL 3BP6B 1IFHL 4HUMB 2YK1L 3AY4C 3ARZA 2GI7A 2VKWA 1FG2A 4NCC2 4PP2B 1RU9L 4Q7DA 3O11B 4PPTA 4IJ3C 5L2KD 3T0ED 2XN9A 3PQYD 4C55A 4A6YL 3OKLB 3HZMA 5DHVB 4HIJB 1TLKA 5C1MB 3WIHH 2UY7A 5IG7B 4AQ1B 4P59L 4X0KA 1LP9A 3RX5A 1KN2L 3WLBA 5KSBF 3C09C 4C54A 3O0RH 4HIEB 4QXTA 3KXFE 3RDTC 1U58A 4XVJH 4OZFA 2A77L 2VDOL 4YHLH 3VW3L 4GKSB 3UBXG 4PJFF 1WC7B 5L2KA 3T0EA 2ICEB 4CMHB 2VXUL 2Z0BA 3L3JA 4OCWL 3PQYA 1QKZL 3ARBB 5T3ZD 1OSPH 1J05A 4JVUA 4JPWL 4I0CC 3WXWH 3MA7B 3PDGA 5HHME 3ARSA 1IGTB 4NQCB 5FKAB 5DRWB 3QDME 4L8DB 3S9DB 1DBBH 2M2DA 5JR1L 1AQDA 4QHKJ 4IMKC 2AEPL 2D9QB 1OTSC 2CK0H 4P46D 4HZAA 3MRLA 1BHGA 4LLVA 1KCUL 4ZMAT 2OR9H 2IG2L 3OKOB 4O2EA 3GIVA 3RL2A 4LCCB 3EYOB 1YY8A 1S8DB 2L7UA 1CXKA 5E6IC 3O3BA 1C5CH 4POZC 2H32H 4RCAA 5ABDE 3C5ZC 2AV1B 5CAYB 2FZ3A 1I3RA 2C1OA 3CDYA 4PS4H 4NZRH 5IW6B 4NRZB 3D3VE 4KJYB 2CKBB 5I71B 4Z8FL 2O26U 4D0DB 3IJSA 3QEGH 5MEQB 1JGLL 3PHQB 1L0QA 4QRTA 4UTAH 4FP8L 1UWEL 1Z9OA 4FHBD 2OL3B 1UYWH 3LSOA 3TLRA 4WEBL 4HV8B 1C16B 4XP6L 5C71A 3S88H 3QB7C 3MLUL 3DV4B 4P46A 3V8OA 1FV1B 5D1XC 3LH2H 3VFOA 2VDNH 4RMSA 1JGDA 3VXMB 3TNNA 1X6NA 2X7LB 3DX8A 3QXUA 1FLRL 2RJMA 1MJ8L 3G6JB 4CADB 4PJBB 3WJJC 4KZEH 4HWZB 5F7EH 2VERN 2OCFD 2ZG1A 2CDEA 4DK3A 1A6AB 1YQVH 2D9CA 2X2YA 1EVTC 4FS0A 3T3PE 4MQ7B 1F4WL 5MERA 1JF1A 3CPLA 1ZE3C 2YD2A 2FO1A 5SWZE 5JOFA 5JQHC 3I2CH 4PB9H 4MD5B 3F58L 5F72S 3QIWD 4OKDA 3BP7A 2WUCH 4YBQC 1YEHL 1PQZA 5JHLL 1B2WH 2I26N 4G6KL 2R4SL 5FYLL 3VGDA 4MCYB 3EJZD 3DX7A 1I4FA 4JHAL 5MEPA 3QIUC 2MCPH 5FUOL 5I1DA 1U42A 5GRJH 4L4VD 4HXBL 5FHAL 1PBYA 32C2B 3W2DL 2FATH 1UWGH 1TZIA 2VZTA 2NXYD 4AG4H 3OGCB 3TPUB 2PYEE 1AE6H 4M7KL 1WZMA 2HFEA 4HUUA 3DROA 4N0YH 4ZUTA 3VFMB 4ELKB 4W81A 1S5IH 3H9SE 4KTDH 2ZCLL 3QIWA 1NC4B 4U3CA 2BSTB 2NLJA 3S4SB 1LP9F 4LSVL 4E41E 1YEFH 2KBGA 5KBNC 5D72H 3BT2L 3CSPA 4E9LA 3AC0A 3KYAA 3ALXA 4L4VA 1OARL 1MFAH 1H5BB 2WNGA 2J6EH 4ZUSB 1AIFA 5GGRY 4OZFG 1NAMH 3DECA 5ISZE 3HG1E 1YC7A 4G7YL 3MR9B 1UFUA 4HS6A 4KVCL 2KL6A 3LEXA 4H0IA 4NO5A 1FZJA 4UUJB 7FABL 1D5MB 2A9MH 5C2BL 3MGOB 4ZTPL 3BZFA 3UPRA 1T2QL 4RMQA 4HG4K 5IB1B 5EBWA 5J6GA 5TDPB 1L7TH 1CE1H 3RVWD 3WFBL 2H6PB 2NR6D 3BZ4A 4GG8A 1P5VA 4A2LA 1ZT7B 1XAUA 4KROD 2PTUA 2VN7A 2NXZC 3SGKA 2Z4QA 3E8UH 3EW3B 3KGRA 3PIQA 3KS0J 1FGNL 1A4KA 2V9RA 2AKRB 4Y5VA 5J3HC 1YNKL 2VDRL 4AENA 5CP3A 5IB3A 4G8GB 1ZMYA 5DT1L 4OF3A 4M1DH 1AD0A 4H25A 1CFVL 3MRCA 4RISH 4JKMA 3DYPA 2ILLA 4HK3J 4KJPC 3CDCA 3HMWL 3MUZ1 2OBGA 4Z7UB 4RGMC 3BXNA 5C70A 4JQVC 1AH1A 4PRNA 5GHWL 5DDHA 1AC6A 3A6CH 3UO1H 1EERB 5FYKE 2MQ3A 2R0LL 1F11A 4NKQB 3BKYH 4EVNA 3GMPA 1AXTH 4DCQB 2ADGB 1T1ZB 1WAAE 3QUMB 4YAQA 1MNUL 2OI9C 2N1KA 1KG0B 5IWLA 5IFJA 4YIQA 4L4TD 5EA0H 2EDTA 2VITB 3BWAB 4OB5H 5E2TH 2BSRB 3QNZA 4RMUA 5CJ5A 1P7HL 2B1AL 2BRRL 3E3QC 5E4IA 5C0ND 4HW6A 2XT1B 4HT1H 5DJ6B 1YMME 5CGMA 3FO0L 1S9XA 3R1GH 2NY3C 4P5KB 3VWKD 2VXQL 3QIBB 4FQIH 1DLFL 4XP5L 5EZIH 1Q0XL 5I1LA 3NCJL 3W11D 3O3DB 4HUWB 1PAMA 1KACB 3TO2A 3ARTA 5T5NF 5F93C 5SWSD 1G9NL 1ZTXL 1KGCD 1KJ3L 1AJ7L 3NACH 3GMQB 5ESQA 4L4TA 6FABH 1RY7B 4NRXA 2IBZY 1CFTA 2M1KA 4JEGB 3KLDA 1ZT4A 5I2IB 1C8PA 2I5YH 5CP7B 1AGEB 4TNWK 4KRNA 4GRLC 4JFDB 2Y5TB 3GSXB 4IIQB 3L7EB 2YMXH 4BH8B 3ZKXC 4ZXBC 1FN4B 3GHEH 5IFHL 2NW3B 3ULUD 2B4CL 3E6FB 4YGVB 4G6JL 3VWKA 4Z7QE 4H5SB 4BK5A 2H26A 1VKXA 3GHBL 3P9LB 5T3ZL 3WE6A 1KB9K 2Z8VC 4JKPL 5EU4B 5L88H 5SWSA 2VXVL 4JFEE 4I48A 3CDGA 1G7IA 4XAWH 1H3XA 5F7MC 1NFDA 3QAZB 4MX7A 3BH9A 5I0ZA 3CLEL 2C26A 3VXPB 2IF7A 3C60C 4LHJB 1N0XH 4LDEB 3MODH 3SQBA 1CWVA 4GQ9H 5J6HB 5FGCB 5IR1A 5HGDB 4P23B 4OI9A 1U8LA 3IDYB 3GJFH 3GMRB 1C7TA 4PRDA 4QGTA 1QOKA 4UV7H 1M7IB 1ND0B 3PDOB 2A83B 2ESVE 2FHFA 4HFWA 5C0JA 5HHQB 2GT9A 3GIZL 3QXAB 5BVPL 4TULL 1S9KC 2YD8A 5D2LE 1BM3L 2DLHA 5IVXA 3VMPA 4QRPB 2ZUXA 2EECA 3MFFB 2PETA 4OV6F 4X6BB 1YNTA 4FZ8L 2YXMA 2R23B 3IVKA 3CVIL 4G6FD 3MV9E 1T4KA 3LS4H 4UQ3B 2YD6A 1P2CA 3EFFA 4BZ1H 3GGWB 1NGQH 1HINH 2Z31C 4ZSOE 1RULL 3MOQA 3P9MB 4OLXH 4JO2H 4ZO8A 3SKNA 3V8CA 3P30H 2BNUB 2JJVA 5I66B 5I1HH 4WFEE 3IKCA 3BO8A 3A6BL 1O0VA 2P49B 5BRZE 5DTFB 4PD4J 4ODVH 1U93B 2EXYC 4JG0H 5DA4A 1UWXH 1XR9A 2A6JA 4GAGH 4RNRA 3OKKB 3PWJB 4Q9QL 3GSNH 3MJGX 3U2SB 2W0LA 2YUXA 3AREB 3DGGA 2CDGA 4Y8DC 4N8CL 1GGIL 4AEHH 2OS7A 1KT2A 4EDXA 5I1JH 1IAMA 5JW5B 3DVFA 3HUJA 4XBPB 3HE6C 1E6OH 1TNNA 2K7QA 2EDJA 4JRWA 1CD0A 1IQDB 4DGVH 2DWEB 2ZSWA 3B9AA 2A6KB 1SJHB 3MBEB 4PB0L 1YEEL 1OAQL 3RVTC 3FT2B 5F3HA 4W70A 4J6RL 1EMTL 1HI6B 1SYVB 2HMID 3MOAH 1GGTA 3TN0B 3MLYL 5E8NA 1WBZA 4Z6AT 4L3ED 3UTQA 5JA9A 3LEVH 4ZDHA 2HTLC 3ARDB 5CHNA 1VFMA 4XBGB 5E5UB 3AAZA 4FMFA 3FL7A 3SO3B 1NCAL 5FUZL 5IB4A 5B38B 4O2CA 3J8F7 2JELL 3BEWA 1Q0YL 1DEEB 2HAZA 4JDZB 3S37H 3VXSB 2HRPH 1OD9A 1MCOL 4ONGL 5IQ7H 1KN4H 5HHMB 3OX8B 3K2UH 4TSBL 1IEAA 4NC1C 1EAPA 5IIEB 3O9WB 3T3MF 3DVGB 5F9WB 2FHCA 4D3CH 3ARGC 1NEZB 1CGTA 1QUNA 1QYGL 1TTUA 2GK2A 4L3EA 3RZCD 4MAYC 5F97E 3LKSA 2VUOA 4NQDB 1BECA 2DI8A 4JRYD 2IAND 3N1GC 5F9OL 4JDVA 1QFWM 2IFGA 1JYXA 3LVEA 1HCVA 3U9PL 3RJQB 1AR1C 4WJ5B 3ZKMC 2QQNH 5B8CC 3RWFA 5C6PB 4PG2A 5L8KB 4PV9B 1NGYA 3NZ8B 1Q9LA 1NLBL 3HAEA 1I7UA 2NY1D 3EUUA 2BHYA 3HS0A 4HUVB 1IQWL 1J9CT 3ILPA 4LKXB 1LEKB 3RZCA 1IE5A 4L8BA 2DQGH 3LRSA 2OTUB 3FMGL 1V7NH 2HTKC 4QRUA 1CE6B 4JRYA 1T5XB 2IANA 4APQD 1DL7L 1D5ZA 5C09E 4OGZA 4ZNEE 1HCFX 3HC3L 3CDFA 3ULUF 2WWKT 1KB5A 1AC0A 3C2AH 4JKLA 3TV3L 1JGUH 3P4MA 5E08L 5TDOA 1A3LH 4JM4L 4BZYA 1IC5H 1MHEA 1QLRB 3BPNB 2D2OA 3RNKB 5IGXL 1CK0L 3FB5A 3PGFL 1EXUA 4X7SH 2YPVH 3IB4A 2FGWH 5DR5L 5MEOB 2F58L 2PTTB 3NBNA 4EEEA 1L0YA 2VMFA 4PRHD 5TE4H 4X83A 4P3DA 3PJSB 1XGRB 3LN4A 2R39A 3T1WA 3CSBA 1JF6A 3PWLB 4WV1B 4OD3L 2EC8A 1N59A 2ZCKL 4IM8A 4M6AA 5A2FA 3I9GH 2AXHA 5IROC 4APQA 4DGIH 5DS8B 1A6ZA 1MRCL 2O5YL 1BX2A 2VDLH 5FO7A 3RWJB 3VWJD 1DSFL 4YHPA 5GISL 1JI2A 3I6LE 4OLEA 2ARJA 5EO9B 2VABA 4H26A 4RDQF 4YQXL 4HF5H 5T33L 5ESAB 2XZAL 2BVTA 1XIWC 3K46A 1HXYB 4RDQG 3FB8B 2YD7A 1FP5A 4L1DA 1NDMA 2WQ8A 3WFEH 2YN5A 3OAYH 3T77B 4TPRL 3W9EB 4RGOL 3HUJF 3ZE2E 4FXKA 1MI5B 5AYUH 3D9AL 4PRHA 4XNMA 5EC2A 1D5BA 4OGYL 3VFGL 3BSZL 3CX5K 1KTLB 5INCB 1GL4B 2AJVH 5BZWA 3UTTD 3X12B 1NCUA 4MZ2A 1RHHA 3NIGF 2P47B 3VWJA 1BAFH 1J10A 1KLFA 4HPOL 5DGRA 1N4XL 2A38A 5DD5L 4OZHE 3C6SB 5B39A 2X9WA 5C0BD 3MUHL 3AM8A 1CI5A 1TMCB 4M6NL 1JRHI 1RUML 2W9EL 3ZE1E 3QUXB 3TYFA 3PWUA 4Y19D 2UZIL 3E1F1 1MWAH 4JB9L 2VLJE 1S7QA 2WINB 1P7KB 1MLCB 1OM3H 3UTSB 5D93C 5E99H 2LAAA 2VR5A 5HJ3A 2R0WH 4MS8D 3OR6B 1GGYA 1T0MB 3V6FB 3UAJD 3MOBH 1UJ3C 3UTTA 3ULUL 5HYSA 2XQBL 3LAFA 1T03H 2R1WB 4V2CB 5CBEB 5I6XC 4GRWB 3EIFA 4M9OA 5I1IL 4P2YA 4OGXL 2MWCA 2NYYC 3Q1SH 5DZLA 4JR9H 2CJUL 3KWWB 4JFYB 2ZOKA 4F7MB 3NZHH 4CVZB 1F02I 5IHZA 5C0BA 3QG7H 5GXBB 5T5FL 3I3EA 2V2WB 1EJOH 2IQ9H 4U1NB 4Y19A 5C0GB 2H45A 3QXDA 3VRJA 4Q2ZA 3D39E 3TM6A 1E27A 1LO2L 4PJAE 5DURB 4JANA 4IS6B 4LK4A 3U36B 1I1AB 5E8EA 3UZVB 5GS3A 4BKLA 1JZ6A 3A67H 4K7PL 4YUEH 2I60L 4FQCH 4HK0B 1EK3A 3HAEG 3O3EB 1P4LB 4U1SA 4V1DE 1MJ7L 5ALCH 4EI5B 3QI9B 2X9XA 2OSLB 5F6IB 4KY1L 3EDEA 4DKEL 4YFDB 3QRGL 3IFNL 4JAMA 4LEXH 5F89A 2VIRA 1N7ML 2PYFB 5SX4H 4QHNA 1FCCA 1ZT1A 4PJCE 1XGUB 3U6RA 3CFBA 3VI4E 4OLVL 5ICXB 4ELME 3MRRB 2AJZB 2R2EA 4UQ2A 2ADJB 2HFFA 3FFCD 2AABL 4OI8A 4G9DB 1CG9B 3D87B 1FZKA 3VFRA 2I9LB 3RU8L 4ZO9A 3F5WB 2V5YA 3MLTB 4NQED 3EOTL 4ZQKB 3VXRE 5D70L 3RWEB 2VSCA 3GMMA 3HZKA 3MRBA 1ORSA 1YN6A 4HS8H 4U6HB 4NKMB 1NKOA 2X4QB 4JGMA 4UDUB 5DQDL 3R4DA 4OIIH 5ID1A 2WM0A 4EUPA 3U46A 1VA9A 4XNYH 2SEBA 4DUWA 1CT8B 2ZPKL 2DQDH 1YDPA 1BMGA 5K9OB 4AT6B 4OIBA 5FYKH 2FX8L 3U82B 2XKNA 5T1LB 2E3VA 3FFDA 4W4NA 2XZQL 4HKJB 1DQQB 1NAKL 4N5UA 5CZXD 1MLBA 4LHUA 1OWRM 3MNVA 1O7SA 4NQEA 4OFPA 3O8XC 5D9SB 1JTPA 5DFTA 4M1GL 2BK8A 1A4JA 1FO0H 3B9KB 2CR3A 4HGWB 4M43H 5EO1B 5I16B 1E6JL 3AMLA 4IRSB 1KJ2A 1SVCP 3UC0L 5J13C 4U1KA 2CLRA 4ODHL 5EOQH 4YHKL 4ZYKB 4HQQL 3SDCD 3H8NA 1Q9KA 1PX4A 3REVB 3D0VB 4S1DD 2PCPB 1JP5A 3GZKA 5T3XD 4TUKL 5EBGA 1UM6H 1U3YA 3FN0L 1JN6B 3QWOA 2B5IC 5I1EL 1NFIA 4KH2A 5C07E 9CGTA 2E7HA 4MD0B 4R4ND 5B39G 3P0GB 4L3CA 4KVNL 5EPMA 1NBQA 4TTGA 3EFDL 3VXUD 1ZHNA 5D71H 1UZ6E 1JK8A 2HFGL 5F6HI 5IVZB 2X4NA 2X4TA 4Q6IA 3U9UA 1M6OB 2CRIA 2K3TA 4PBWD 4IOFD 4KI5F 3SDCA 3TNMB 1H3WM 1RIUL 3FQUB 5T1KD 5KSAC 4M6MH 1MHPL 1RZGB 5HYSG 4LSSL 4XC1L 4QTIH 3IDNB 3H2WA 1GJIA 2B1HH 5KVDH 1QACA 4X4XB 3VXTB 3M8OH 1I9JH 3V4VL 4MCZA 3EDFA 1HILA 3KNBA 4ZSOB 1MH5A 4X6FB 4LIQH 1I85A 2XOTA 5JW4N 3VXUA 5C0AB 3QH3B 4LSDA 4PJXF 2B2XH 2OQJB 1AXSB 2Y23A 3MYJB 1J5OH 4J1UB 2Q76A 4HWUA 1IKFL 1D5IL 4GAJH 5BRZB 4M00A 2ARJQ 2BOBB 4NNYA 3OMZA 1JCKA 1OSZB 4R4FL 2P24B 3PNWB 3HRZB 2VR9A 4M62L 3RBSA 2VC2H 1D9KD 3RGVC 2R9HD 4PY7B 2UYLA 5E0QA 2Q6WA 4AJ0A 2EDDA 3C5SB 4X5XA 5I17A 2BVQB 4R97C 1FNHA 3OJDB 3QZWB 4WI7A 3TEUA 3MUY1 3EDKA 4LSTL 3RVVD 5D7KD 4HULB 4F15C 5J06A 2X4PB 4MSWA 3VXOA 1T3FB 3B2VH 3CFDA 4MWFA 4X4YA 2V2TA 4QLRA 2OZ4A 2IPUK 1FORH 1N64L 2ATPB 3DRTB 1K5NB 1AFVH 1UQSA 3A6OA 2DQUH 4GW5A 2YRLA 4JN2B 1NQBA 2R0ZH 3GB7B 3EOAA 4HJGB 4ODXB 1L9NA 2A6DB 1BVLB 1P7QA 3QDHA 5GZOD 1D9KA 1KEMH 3GO1L 2DLFH 2DLIA 2MTPA 3MRHB 5DFVD 3QDAA 4ALAH 3CFEA 1U3HB 3BFOA 3WIHA 1U8NA 2QQQA 1MCDA 4EUPG 4PG9A 4YDJA 4IJ3B 4J23A 3LKOA 4MA8L 3VFUB 1CIDA 2NY7L 1TETH 4N0UE 1S78D 3BD3A 1OAYL 3QJHA 3B9EA 1XGQA 3FTGA 4YPGB 5EUKA 1DVFC 2RQ8A 3X13B 4MB5A 3O3AA 4PTTA 4IEFB 5ADPL 4PJDE 3BP6A 3OBAA 4LHUG 2DQEL 4HEME 1MY7A 4N1CA 3C09B 3BW9B 2K9UA 2XQYG 4PP2A 3RY6C 3TT3L 4ZTOL 5HHXL 3O11A 4KRPB 3IDMB 4GKNA 1TCMA 5DRNA 1CU4L 1NLDH 3T04D 3RDTB 1SEQL 4ORZC 4YXKH 1R3LB 3NPZB 1RUKL 3ARBD 3BKCH 3BEVB 2FNBA 5H94B 4F7CB 1NCWH 3OKLA 5ENWA 3DIFB 5DHVA 4HIJA 5E8OB 4LPYA 4NQCD 4RFNC 5EG6C 3AB0C 4B41A 1F6LL 5HYIA 2APTA 2BCKB 5IG7A 4Z7VE 3WKNA 1FDLL 4P2QE 4PJEB 3JWDH 3B4NA 2V6HA 3LHPH 5IB2B 4R3SB 3WO4C 3L95B 4HIEA 5EIQA 3U0TB 1BWWA 2X5PA 3MXVH 5HDOA 4GKSA 5BQ7B 2JB5H 1WC7A 3NPSC 1LILA 1MRFL 3ARFC 3V79C 2ICEA 2IJ0C 1P6FA 4ETQB 3SDDB 4YHIB 35C8H 2R2HB 1A64A 5IHLB 1G7HB 1RVFH 3MA7A 4GRMB 4MLSA 3V4PL 1IGTA 4NQCA 1D5XB 3FB7B 5FKAA 5DRWA 4KZDL 4L8DA 3RKPA 3I84A 1G7QB 4KGJA 5E6IB 4PGDB 4S1SL 2EIZB 1I3GL 2BJMH 4HUXB 4DKFL 1JYNA 1QBML 1S7VB 2FGZA 3LB6D 3G5VB 4QF1A 2OXHA 2X70B 5IFAH 4LLAA 4TNVF 2AK4E 3VXMD 4QXUL 1T83A 2A0LC 3K3QA 2ERJC 3OKOA 1X4XA 4NZDA 4LCCA 1NGWB 3EYOA 3KPSE 3JWOH 1EBAA 1FE8L 1S8DA 1UKTA 4JO1H 5D1XB 4M7JH 5ALBL 1BZ7B 4NN7C 3U4EB 3S36H 2AV1A 1KCLA 5IW6A 1B4JH 3FKUS 1FBIH 1QSEE 4NRZA 2KKQA 4DTGH 4KJYA 2CKBA 4N1HB 4HPYL 3QPQD 2WIIB 4D0DA 5GSVB 5L7XH 3MCLL 4LNRB 3MA9L 2OL3A 3CK0H 2QSVA 1KJ2L 2DKUA 4Z0BL 3V4UH 4HV8A 1C16A 2HJKA 5CIPH 3DV4A 1FV1A 3MLXH 1P53A 4KHTL 3JWDC 3VXMA 4B53A 3CVHH 1OAUH 3ARVA 5K9JH 2NY4C 4UI2A 1VFAB 3NVQA 4LPUA 5E6ZA 2X7LA 3TZVC 1OTUC 3W5MA 3G6JA 1CTOA 4CADA 1F3DJ 2JJSA 1QFWL 4ONHA 4M5YH 2B39A 5HPOA 1KJVB 3HC0B 2VDKH 1P1ZB 4UV4H 3E6HB 3QQNA 1RZIB 4KDVA 4R0LC 5DVMA 4MQ7A 4POYA 4QRRB 1TPXB 1L7IL 2GJJA 1A1NB 3P0YL 4K3JL 5GGTH 2FX7L 2R4RH 1F8TH 1MHHA 1RIVH 1PEZA 2F5AH 1NC4D 4MAUH 2EEBA 2CLVB 3BGAA 4I9WD 5IVOA 1BBJB 4X5LA 4MCYA 1QD0A 1H9VA 3B2UD 1X5LA 4FFWD 3O2DH 5T3XL 2J6EA 5I30H 3K4AA 4JFXB 2NW2B 32C2A 2H8PB 1IGCL 15C8H 2IPKB 2WUBH 3OGCA 3TPUA 3AUVA 4X7EC 4NFBA 2OP4H 2L7JA 3JWOC 1CQYA 3ME0A 5JUEL 4TSCL 4X9FA 3VFMA 4ELKA 2HJFB 2A1WH 2QHRL 1PG7W 1GZQB 1SJXA 4OCNC 1JPST 4GXUM 1NC4A 2YN3A 2BSTA 2DMBA 2LV4A 3S4SA 2R8SH 2J5LC 2YA2A 1MIEH 3BQUC 4HGMA 4V1DB 5IT2L 1U9KA 3P11H 4LGRB 1L6ZA 1H5BA 3RTQC 5KSBE 1GRWA 4ZUSA 4ZS7H 3BRGC 2CK2A 2IC2A 3Q5TA 4HGKC 3MR9A 2E9JA 2DDQL 3O6MH 2MHAA 4UUJA 1D5MA 5KZCB 4G8GD 2OZ4L 4K9EC 4BQCA 3MACH 3BD5A 2ATKA 3MGOA 4PJFE 5CLTA 1T04B 4HWEL 2BZDA 5J56B 3X17A 1HSAB 1II4E 4LSPH 5FGBA 4JZJC 4KQ3L 5FYLE 3G5ZB 1XGTB 5K93A 5TDPA 4AH2B 1OW0C 2XRAH 3U48A 5A3IC 1CBVL 3BESR 2H6PA 2K1MA 1C08B 3N85H 1UM5L 3BKJH 4W6YB 3QULB 5CEXB 5IJKC 1ZT7A 2JF1A 2P44B 1BFSA 5ACLA 4LFHD 4RGMB 1JRHL 1JHTB 4M61A 2DL2A 4U3HA 4Z76B 4K23L 3L5IA 1MEXH 4OCRL 1RZJC 4OFKA 2AKRA 4K3DL 1PZUB 1BPVA 5E2JA 3X3GL 4U1IB 4G8GA 1HSBB 2V17H 3ILQC 3AMKA 4YXLH 3DSFH 1AHWC 4PJHB 2OI9B 3JV6B 1HHJB 2W0PA 1WFNA 2YD3A 4EN3A 4Z7UA 1YY9C 2FD6H 4DN3H 1JI1A 5LWYH 2P5WB 1ZLUK 5CUSL 4GSDH 4ENEC 4YO0B 1QFHA 5DGQA 1CDBA 4M3KB 3QIBD 3ZYOA 1RHFA 2LTQC 4H88L 2NY3B 4DCQA 2HKFL 2ADGA 1T1ZA 3RGHA 3QUMA 3AVEA 1KG0A 3SKJL 1FGVL 3G6JF 4PJBF 4GFTB 4FNLH 2VITA 1FC1A 4I2XE 1R3IH 3S7GA 1QNZL 1SJEB 3UMTA 3MV8B 4XVSL 5DJ6A 4JFDD 1IAII 4KPHL 5AZ2H 3KR3L 2O5ZH 4N0CD 5F1NB 3RPKA 3ZKNC 2ICWI 4P5KA 4XHJC 5FO8B 1NCCH 1MFCH 4GRLB 3QIBA 3KPMB 4LLQB 2DQCH 2VDPH 1VENA 1RJZB 3OJ2C 3O3DA 4HZLB 1CLZH 3MRDB 4HUWA 4ZXBB 2LVEA 5IHUL 4FFVC 5DJZB 1CGSH 2E6QA 1J0IA 3MMEB 2DL9A 3GMQA 4FRWA 1FZMB 2I25N 1P9MA 5ICYB 5AD0B 4XPFH 1J0ZA 5I2IA 1OWWA 3TYGL 4PRPE 2UZYB 5FHBH 4P23D 5CP7A 1AGEA 4HBCH 5A2LH 4JFDA 2Y5TA 3GSXA 3C60B 4IIQA 3L7EA 3QFJE 4BH8A 2IGFL 3H0TA 2RCSL 1G6RB 1FN4A 1H3UA 1ZXQA 4HKXB 1AGBA 3E6FA 1UM4L 4YGVA 5MP6L 1GGCL 3WFDH 4H5SA 5HHOB 4HFUH 1UADC 4TRPH 4QRPD 2XN9E 3P9LA 3LQAH 3S35X 1KJMB 5EU4A 2R69L 4FOMA 2DM2A 5LG1A 1JNNH 3S4SG 4CDHA 5IESH 3VXPA 1XF4B 2P8LB 2F5BL 3BGFC 5D7IB 5SV4A 1FVEA 2CKBL 1U0QA 3EYFB 5J6HA 2NY2C 3Q2CA 5HGDA 4P23A 1U3ZA 2OL3L 1WWBX 3CC5B 3GMRA 5F8RC 2C1PB 3HA0A 5ID0B 3L3DB 3PDOA 1ND0A 3BP5B 2A83A 1MIMH 5HHQA 3QXAA 1J18A 1QEWB 4LGPB 2FCBA 4KKAD 5L2KE 1GGUA 3T0EE 5MENB 4WHYG 5EZOH 4QRPA 4GAYB 5SX4I 3OJVC 3MFFA 1IGFH 5HVHC 4X6BA 1KIRB 3ARED 5DJ2B 2R23A 4OM0H 2CKNA 3TBVB 1U6AH 4UQ3A 2VAJA 5LAXB 4TUOB 1A0QH 3GGWA 1SY6H 1PY9A 4NC2B 1UB6B 4LSQL 3P9MA 2G5BB 1CYGA 5IEHB 5IP4A 1QPXA 1DDHB 3MBED 5DUPH 1KCKA 2BNUA 5I66A 4XNXL 2F19H 4PTUB 1EV2E 4XH2B 3HE6B 5EDXA 3TN0D 5AZEH 4TVPD 5DTFA 4Z77B 1U93A 4E42B 2OLDA 3ARDD 2AAVA 3OKKA 3PWJA 5T3ZE 2WQRA 3C6LC 3FQWB 3U2SA 4HKBB 3AREA 4J3UA 4O9HH 1QQDA 1HIMH 4I4WA 5IQ9B 4XBPA 4WW2C 2EC9U 4G5ZL 3VRLF 4QGYA 3VXSD 1IQDA 2DWEA 1LVEA 2A6KA 1SJHA 3MBEA 3TF7C 1IZJA 3MRKB 4LFHG 4LPVA 3FT2A 5HHMD 1KELH 3KLHC 2CIIB 2EZ0C 1HI6A 2XWTB 1SYVA 3O9WD 3G5YB 3TN0A 3NA9H 3NABH 4P2QB 5DLML 5HXMA 3HI6H 4NQDD 1A6VL 4LASL 3ESUF 4ZFFB 3ARDA 4XBGA 5DYOB 8CGTA 5J89A 4NZUH 3ARGB 4MAYB 2WLYA 3BE1H 4N8PA 5B38A 4JFHD 1QBBA 3MLZH 2AI0L 1DEEA 3EO1B 2VAAB 2YZ8A 4P3CL 4JDZA 5GQBA 4YPJA 4DGYH 1OT2A 1LE5B 3VXSA 2IH3B 3GBMH 4JVWA 4JO3H 1TDQA 5B8CB 3OX8A 2JIXB 2CMRL 5IIEA 3O9WA 3DVGA 1F4XL 1ADQH 1IGML 2D7OA 1NEZA 1NL0L 4EJ1C 4NQDA 3MYZA 4R2GC 4JPKH 1T1XB 3BH8B 1WUNT 4UNTA 5C8JB 2ZZUT 3V6ZB 2DMCA 4L5FL 3UYPA 2F15A 4OUOA 1FRGL 2AK4B 2HT4C 3QWQB 4WJ5A 5HDQH 4XVUC 1EZVY 5JW3H 3RY4A 4J3WA 3IFLH 5EN2A 1PLGL 3PF2A 1NMAH 1OAXH 4PV9A 3TJHD 3NZ8A 1A7BA 4HMCA 5CCKH 4A6YB 1GOHA 2A74B 1FNLA 1RUAH 4O51B 1FNFA 4OZGF 4BZ2L 4HUVA 1QSEB 2IADB 3U4BH 2GCYB 4LU5H 1HHGB 4WFHD 1LEKA 4UOW1 5JTWA 3GSRB 2OTUA 5GJTH 3VRIB 3ZLQC 1CE6A 3QCUH 2AEIT 4YHML 5D2NC 5HPMB 4L4VE 4XCNB 3MNWB 1E4WL 2GYSA 5HGGS 3FCTB 1A6WH 4GO6B 1GSMA 3QUML 4BJLA 2YK1H 3MLWL 5GGUB 2BNRB 1RU9H 3LEYL 4JJ5B 1QLRA 3U30C 2COQA 4KUZL 1V7ML 3HE7B 3RNKA 4HMEA 4E0RB 3IDXL 4A6YH 3LKPB 5K33A 5MEOA 2PTTA 1MI5D 3HR6A 2BX5A 2VZ1A 1XIWB 2PW2B 3PJSA 1XGRA 1ZVSB 3TESA 4P59H 3PWLA 1KN2H 1BFVL 4WV1A 2BHUA 2PXYC 4W6WB 2P42B 3OV6A 4G42B 3RWJA 2A77H 2EDOA 5KVMC 2VDOH 5J1SC 3RWGB 4Z7NF 3VW3H 5CD5D 1YEIL 1VFUA 1WZLA 5ESAA 4WO4C 1HXYA 3FB8A 2VXUH 3FOLB 3QUXD 4OCWH 1QKZH 3S34L 2HLAB 3T77A 3W9EA 4JPWH 3BP4B 1MI5A 3EBAA 4WGWB 2Y36L 3UTSD 3TO4C 1H3GA 5B21A 12E8H 3K1DA 4PJIB 4LOUC 2AJXL 1KTLA 5INCA 3H9SA 5JR1H 3X12A 1NMBL 4NM8L 4MHHG 1A7RL 2AEPH 5KW9L 3ZE0F 5D93B 2O61B 4E41A 3MREB 4LLWB 1UJ3B 1KCUH 4RAUB 3C6SA 3BIAX 5I6XB 2IG2H 4ODSL 4GMSL 4S1QL 4LARL 3QUXA 1A7QL 1X7QA 4Y4KC 2GTZB 4K3EL 4JFOB 4Y16C 4XNZB 5ISZA 3T0XA 3HG1A 1DQLL 2HFTA 4DK6A 2WINA 1P7KA 1WT5A 3X3FL 1RZFL 1MLCA 3UTSA 5FCUH 5B38G 3IU3B 3DUSB 3V6FA 4Z8FH 3OR6A 1T0MA 4UOJA 5I1KL 1IARB 1JGLH 1I1AD 3L3KB 4NM4L 4FP8H 1UWEH 2R1WA 1F42A 3G9VA 2YSSB 3PWPB 4WEBH 3QQ3B 4XP6H 1LE9B 5CFHA 1P4IL 3MLUH 5C0CE 4EI5D 3QI9D 4OZIB 2C4XA 2EDRA 3KWWA 4JFYA 4F7MA 1NEZG 4CVZA 1QSFE 2H2PC 2ZUQC 4L4TE 1D3CA 3GSOB 3ABZA 3T3ME 2V2WA 1F6AB 1FLRH 4XP1L 1MJ8H 3L9RB 4U1NA 5C0GA 3IDGB 3ULVD 4RMTA 4P49A 4RFEB 1NBVL 4GAFB 5BV7C 3RAJL 1TITA 1I75A 4IS6A 3STZB 4X6DB 4N5EC 5AWNL 3U36A 1F4WH 2N7AA 4N0FB 5JOPD 1I1AA 3EYQD 3BGMB 4HK0A 3DTXB 4NKDB 3F58H 3O3EA 4DJMA 5BCAA 1T0NB 1P4LA 5I8EB 4Y1AB 4EI5A 5IBLC 1YEHH 2OSLA 4KKCD 4XXCA 5JHLH 3EYSL 1WWAX 1KGCE 3VFNB 2R4SH 5FYLH 4MNHB 1T22B 2PYFA 2OJZL 1A9BB 2P8MB 2UUDK 3Q6FB 1XGUA 5FUOH 5BZDA 5ICXA 2W59A 5CEZD 1FH5L 4HXBH 3MRRA 2AJZA 2ADJA 5T1LD 5FHAH 4G9DA 3VFPB 1CG9A 3W0WE 3QPXL 3W2DH 1KEGL 2XI9A 2I9LA 2W07A 2XTJC 4I2XB 3F5WA 4M7KH 4WTZA 3MLTA 1JNHB 4TVPL 3ULUE 5GRYA 1LNUB 3RWEA 3U0PB 3B9KD 2ZCLH 4IRSD 1MCSA 3AXLB 4CGTA 2VL4A 3VGGA 4U6HA 1OB1B 1MCFA 4NKMA 3O41B 3I50L 4K71C 1EEUA 3O8XB 2X4QA 1JV5B 4UDUA 4LSVH 2EDYA 4NCDA 5D7JB 4I3RL 3VJ6B 1GH7A 2NZIA 1CT8A 3BT2H 5J13B 3EKCA 2OR8A 5JLZB 4AT6A 5K9OA 4YHYC 1DBKL 2VLKB 1EBPA 2FEEI 1OARH 5T1LA 3UTOA 1RK1B 2BMKB 4HKJA 4K7PX 1JL8A 1DQQA 4WY7L 4C4KO 4G7YH 3MRIB 5HVWA 4KVCH 5GGSB 2C7UB 4NQSB 5HGAB 5D9SA 7FABH 4J8RB 4BM7A 1JF5A 4AMKL 5FB8B 4JE4B 3ZHKA 2B5IB 3B9KA 4HGWA 5EO1A 5C2BH 1EIBA 5I16A 5KANI 2F54B 4IRSA 4ZTPH 4I13B 1AD9B 4JG1H 3QFJB 4JZOB 4RAVB 3M1BB 1T2QH 4Y5YC 4HUKB 3WFBH 3RIAF 3REVA 1RZ7L 2PO6C 3D0VA 4HD9A 2PCPA 4U1JB 4BQBA 1JN6A 2HA1A 3K8MA 3T1FB 4KFZC 5EFIB 4X80L 2JCCB 4PRIE 1FGNH 4MD0A 3PDDA 4J3TA 1YNKH 4MVBD 5CSGA 2VDRH 1F58L 1HKFA 3HB3D 1CXFA 4EI6B 5DT1H 5C0AD 5HD8C 5IVZA 3DV6B 3NGBB 5DMIL 3WD5L 2ESVA 1ODAA 4XPAL 3L6FB 3HMWH 1M6OA 5FDYA 5BRZD 3TNMA 1U8IB 3BIKB 3QNXA 1JGVL 4OLUL 4XRCB 4GRWF 5D2LA 5GHWH 2Y07L 3PWVB 1DTUA 1OAZL 1RZGA 2L4OA 3EAKA 3BKML 3IDNA 1LO5A 2X40A 4X4XA 2KZ1B 4ZNCD 3BDYL 3VXTA 3MV9A 3EO9L 1SBSL 4GMTL 4F2MB 3GI9L 1MNUH 3C9NB 3EZ8A 4ZSOA 3RGVB 4L3EE 4NQVB 4ERSL 4KTEL 4X6FA 1MCHA 5F8QC 3UDWC 5CSZB 4K07A 2GKIA 3V95A 5C0AA 3QH3A 1JPSL 2B1AH 2BRRH 1VGKB 1BF8A 2OQJA 1AXSA 3MYJA 1WBYB 4J1UA 3FO0H 2IWGA 1AR2A 5BRZA 2DJ4A 2BOBA 4OZFH 2VDMH 2V7NA 4IMLB 1OSZA 4NBZB 5MHSD 4MA3B 4D0CB 2P24A 3PNWA 2QBWA 3HRZA 5CGYC 1OP5K 3QQ4B 2VXQH 5M95B 2Q3ZA 4QNPF 4XP5H 1OHQA 1Q0XH 5F70A 3ZSTA 2E7LA 3UCRA 3VCLB 3NCJH 4PY7A 5GS1C 3C5SA 1Y18B 5IMKB 2BVQA 1U3HD 4P9ML 4XAKD 2NPLX 4MA1C 1G9NH 3QZWA 1ZTXH 4NZTL 4P5TA 5F7KC 5FA4B 1KJ3H 3WS3B 2YRPA 1AJ7H 3JZ7A 4PJ9C 2X4PA 5IM7B 2M8XA 3KS0H 5GJSL 5DC0A 1T3FA 1Z9SA 3ULVF 1O7VA 4JRYE 1IAKB 1W2KT 2ATPA 3DRTA 1K5NA 5DVNA 4PJ5E 2FHBA 4F7PB 4JN2A 3CCHB 3GBNL 1T89A 1CLOL 3AFLA 2BSED 3GB7A 4S10A 3PG2A 1CFBA 1JNLL 4G7VL 4WTZG 4HJGA 4ODXA 5IFHH 2A6DA 2B4CH 2D3VA 4G6JH 1DVFB 3RNQB 4KRPD 4MXWL 5K9KB 3GHBH 1T0PB 3MRHA 3RDTD 1HXMA 1CL7I 5T3ZH 2QR0B 4JKPH 1JE6A 1U3HA 4WDIB 2VXVH 4OF6A 4OLYL 3UX9B 3BX7C 3CLEH 1G7LB 4UT7L 3VFUA 3DX9B 4JQXC 4JFZL 4HCRA 1NUNB 1HZHL 5KTEL 4YPGA 1E4XL 4JFPB 2PW1B 2FO4B 4K94L 3RPIB 3X13A 3AB0B 5DJYB 3H42L 1JIBA 3GIZH 5BVPH 3BW9A 3QA3A 4TULH 3IDMA 1PFCA 1BM3H 3CX2A 1OTSD 2V5TA 3SBWA 3L5JA 1SQ2N 1R3LA 5A16B 1CVSC 3BEVA 3KPQB 4FZ8H 5H94A 1MVFA 4F7CA 5SWQB 4TTDD 3CVIH 4PRHE 3IDUA 3I3BA 3DIFA 4OCMC 2MQ0A 5E8OA 4M8VA 1SJVA 3ARFB 4WIQA 5CGTA 1RULH 5E6ID 4POZD 1F4YL 4FFZL 1NSNL 1G9NC 5IB2A 4IRJC 3L95A 3U0TA 4RA0C 3WCYA 3LOWA 4P2RB 3ARPA 4F7TB 2JJTA 3P40A 3A6BH 5MI0B 3JTSB 4OCSL 1WFOA 3WV0A 4I18C 3LKQB 3OAZK 5BQ7A 4M8QB 4IMKA 5C09A 4MJ2A 4Q9QH 3FQXB 1UC6A 4ETQA 3SDDA 1WTLA 4YHIA 3U4AA 5D1XD 2AQ3A 2R2HA 2GJZB 3ULVL 2BNQB 4N8CH 1GGIH 1G7HA 1HK6A 1I7ZB 4GRMA 1D5XA 3FB7A 4ESKA 1CCZA 4EXPX 2FBJH 1WZ1L 1AY1L 1G7QA 2CUHA 3MSPA 1U41A 4KI5E 4LMQI 5E6IA 4PGDA 3UTTE 4HUXA 2APWA 3W39B 4NN7B 4PB0H 1YEEH 1OAQH 1R5IB 4HXAL 5C6TL 1HYSD 2HT3C 4J6RH 5DI8B 1S7VA 1EMTH 4EOWL 3MLYH 3G5VA 1R0AL 2X70A 5C0BE 4G6MH 3OKYA 3ZL4L 4KC3B 5ICZB 3C5JA 5D7LE 1NGWA 4CBPA 4YBQD 4Y19E 1WTGT 3PP3H 1I9RL 1NCAH 4XC3L 5D1XA 5FUZH 5CEZL 2ZSVB 1BZ7A 5DRXB 4PJXE 4YEEA 4ZPTB 3U4EA 1HEZB 2NY4B 2JELH 4YDLC 4JY4B 1Q0YH 3TZVB 2WIIA 4QRRD 5GSVA 1MCOH 4ONGH 1KC5L 4LNRA 4ODWB 3O6KL 1VFBB 2LE9A 4OQTA 5FUCC 2XKUA 3QZWG 4MXVE 4ONOA 4ORGB 4R0LB 1YJDC 1ITBB 4KGLA 1QYGH 4P5MB 3OKMB 5DJXB 4DKDC 4ZFOB 3C8HA 3O2DA 1VFAA 1RJYA 3GSWB 5F9OH 5AUMB 1JFQL 2CRMA 3JV4B 2C3HA 5BMFL 3U9PH 1KJVA 3O6FC 4XCEB 4D94A 5AEAA 25C8L 4BSJA 1P1ZA 3E6HA 3TJEH 1RZIA 4WEMB 1NLBH 4QRRA 5CP3H 4MNQB 2VISB 3GK8L 5FV1L 1A1NA 1MAKA 1S5HB 4H0HB 1IQWH 5E4EC 4ZG1A 2CLVA 1ZSDB 1BBJA 1X5XA 4YFLF 3FMGH 1V8HA 1DL7H 4V1DD 5C0CB 4Y0GA 3VFWB 3FFCE 3HMXL 4JFXA 3TH3T 2NW2A 1QSFB 3TV3H 1BQHB 2QQLL 2H8PA 5EORL 2IPKA 5E08H 1BFOB 4NQEE 1U8OB 1CGXA 4X8XA 5IGXH 1CK0H 4WNQB 5KZCD