1I9JH

Testosterone complex structure of the recombinant monoclonal wild type anti-testosterone fab fragment
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
220
structure length
220
Chain Sequence
EVKLVESGGGLVKPGGSLKLSCAASGFTFSTYALSWVRQTADKRLEWVASIVSGGNTYYSGSVKGRFTISRDIARNILYLQMSSLRSEDTAMYYCAREYYGYVGLAYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into steroid hormone binding: the crystal structure of a recombinant anti-testosterone Fab fragment in free and testosterone-bound forms.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords RECOMBINANT MONOCLONAL ANTI-TESTOSTERONE FAB FRAGMENT LIGHT
total genus 43
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2001-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1i9jH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1i9jH01
2NY3C 4GOSA 2VC2L 2VAAA 2BVOB 4DOHB 1FBIH 1KN4H 2X4RA 4PLJC 1PFCA 2BNUA 2QV2A 4OCLC 4L29B 2YBRA 3LV3B 5F6IC 1UYWH 1DZBA 1V3LA 3QQ4B 5DEZA 3KPLB 4OZHF 4GBXD 3RVUC 5I1CH 2Z91A 5D1QA 5D1XB 1U8IB 2YUXA 3PWVA 3VGGA 2VXQH 5DUMH 4M7JL 2APXA 1KCUH 1EEQA 4PJDF 2CLVB 4X7TA 3LRGA 1IAIL 4HKBB 5KSAA 3QEQB 4YHML 1G7LA 5A1AA 3SDCA 3IDMA 1JCKA 4FFVD 5DQDL 4HIXH 4QNPF 3U83A 4MXQC 2F53E 1AGBB 3PQYA 3FRPG 1KCVL 7FABL 1NCNA 1QVOA 3BWAA 2P44B 1UM5L 4O58H 4QHKJ 1GJIA 3V5KA 1ZLWH 2GYSA 4YIQB 2GJ6D 2F58H 2KDGA 3BKJL 3HE7B 3TT1L 1LEGA 4XNUL 1EH9A 1GCFA 3BKML 5CD3B 4Y4KA 4L4JA 3IJSA 2MNUA 3DV6B 3FB7B 1J1OL 3HLAA 1X7QA 1FYTA 2ZZUT 3QRGH 4GKSA 5E8NA 4PJ7A 3QB7C 4JFFD 4RDQG 4LCCC 1BZ9A 1CFSB 3EHBD 4L8SB 4BKLB 5L2KE 1JYXA 3ARFC 2FATL 3EDEA 4E0RA 4GW5B 5E9DE 1KCUL 4MB5A 2JCCF 4LBEA 4G42B 3RUGF 3FRPA 2NY4B 1X44A 3MLUH 4JPWH 2D03L 4QRPB 5J1TC 1SBBA 4DCQA 4J2XA 2OI9C 4R3SB 1INEH 5DK3A 1FNGA 2X9WA 1P9MC 2DBLL 1VKXA 2B1HH 5EO9B 4XCFH 4UQ2B 5C3LD 5C9JB 2O93L 5D72L 5DMKB 5E00B 4U05A 1MJ7H 1AGDB 3QXUA 2A6KA 4PJAA 1BQLL 5FGCB 3QUZC 1E28B 1RQ5A 4BH7B 1R0AH 5I2IA 3G9AB 1LE9A 4PV8A 4FQCL 3AU1B 1BQLH 1KIQB 4IMLA 3C87A 2V6HA 1QQDA 3MLWH 4DOHE 4FFWC 5ITFA 1M6OA 2V9RA 1N6UA 4WENB 5EZLB 4YX2L 3MYJA 2D9CA 1BZ7A 4G9DA 1E4JA 2EC9U 3JTTB 4HS8H 1JZ4A 3SOBL 4EN3A 2GFBA 5IQ9B 5CMAB 3MGOB 1FNEA 4OZ4B 4P5TD 3EO9L 1YEGH 3DRTA 3THML 3FN0L 5CILL 3K46A 3BPLB 2KPNA 1P84J 2F54D 1CXLA 3PWPB 1KFAL 2JIXB 1U8LA 5DMGD 1FGVH 3LN5B 4X98A 4F37F 2OYPA 5ISZE 3SGDI 2OL3A 2EXWC 4LVOB 1NC4D 2ARJQ 3R06B 4KTDH 4HAFA 5I73C 3Q3GB 1DQDL 4JQVC 4LNVA 5D2LA 2OSLB 4DGIH 5D7IB 1H8NA 2DWEB 5T1KD 1WEJL 3MRMB 1BJ1J 1OARH 1T20B 1KT2B 4H1LG 1WITA 3HNTL 1ZHLB 2MCPL 3CXHJ 3MV9B 4KVCL 1IC1A 5DJYB 3QUYD 4RQQB 2XZQL 1HYSC 3ARGD 3VMNA 4PJCF 3P4OA 1PSKL 3MLPA 25C8L 3BGFB 1CDGA 1FE8H 4UB0H 5HHQB 4LSUH 3EYUL 2JE8A 4P4RA 2JF1A 5BZDA 5F6IB 4WFHD 1S7RA 5D1XC 5IV2A 5SWQB 1LHZA 4WWKD 1A7BA 1JRHL 1L7IH 1ZT7A 2J6EA 3BP4B 4U0QB 4WJ5A 1ZLSL 4F7CA 1QNZH 5I8OH 1NAMH 4NFDA 1S7WA 1YECL 4C57C 3B5TA 5JOFA 2IADB 1X5ZA 3FT2A 4KJPD 4Y4HD 5ELIA 3QDGD 3SBWA 4F7PB 5F89A 3HG1D 4U4BA 1CL7L 1YPZA 2HLFC 4O5LH 4WWKA 5CEZL 4XNZC 1TJHL 1NEUA 5AAWA 1Z9SA 5JORB 4XHJD 2CDGB 4P9MH 3LKOB 3VI3F 1J87A 3JV4B 3UPCA 1RZ8B 4H5SA 3MPCA 4HZAA 4J8RB 4PJ9D 2H26A 4DKEH 1CLYH 1LE5A 3PGCB 3LQAC 1J88A 3HC4H 5JPMB 3V0AC 1WEJH 4RMSA 1CDYA 3X13A 4Y4KC 5K9KA 3VJ6B 3SDAD 3QUYA 1EIBA 2XWBA 4JFQB 4LQFL 4NC1C 3FQWB 3KPNA 3EDDA 4F37K 5KN5A 1G7PB 3SBWC 1PG7L 4Z7UA 4GO6B 3FCTA 4MNQE 1T7VA 1U58B 4NN6B 1ONQB 5FKAA 3WN5C 1T22A 5JQ6H 3TA3A 1NGYA 3V6OA 1A14H 2A9MH 3PHQA 2JTDA 4PJEF 4MX7A 4OZFA 4DTGH 5EO1B 3WEXA 5F96L 4YHYC 1JRHH 1W0WA 5D9SB 3GIVA 2R0KL 1ZA3A 3NFNB 4XP4H 4YFLI 4OFPA 3LV3A 1AC6A 3MV9E 1NEZG 3MRKB 2V5TA 3UAJD 2G5BA 1NGPL 3QNZB 3HHRB 3KYMB 4Y4KD 3PWVB 1YEEL 2LE9A 3CVHB 5SX4I 3UJIL 4HWZB 4BZ1H 2NW2A 3OKMB 5DJ8A 3ULVE 3C6SA 4GUPB 1QBML 2VQ1B 2ID5A 1XF2A 1EJOH 5L0QB 4NDMA 2YD1A 1QLRA 3KPQB 3MJ8B 3CH1B 3ZE2F 2FBOJ 2FZ3A 4JRXA 4RDQF 2VUYA 4JY6B 5H35B 4XCYB 2BDNH 2GAZA 3QULB 2X4OA 5BRZE 1JZ3A 4FZ8H 3MRHB 4P5MA 1Q72H 2BC4B 5DRXA 3QNXA 1C7TA 3DX6A 4Z5RA 2PO6B 4DQOL 1WGOA 1RZJC 1INQB 4HWUA 1HZHH 5GIRA 5CZXC 5E94A 2R1YA 3QIWC 5HHMB 4I48B 2DB8A 4U1NA 1F13A 2BJMH 3R8BB 4X6EB 4QRRB 4K23H 2Y7QB 3DO3A 2LU7A 3O45A 1OW0C 4IRJB 3F58H 2BSRA 1A4KA 1RK0A 2FECI 3S36L 4RRPG 1OSPL 3QEHA 1NBVH 4NSKA 5BVPL 2LFGA 3SDAC 3T77B 4XNYH 3QXDB 5I17B 2YD2A 3MRDA 3RUGA 3T2NH 1ORSB 4M6NH 1NANH 5ICXB 3G5XB 3SGJC 3O3DB 1JGEB 5C08D 5T1LA 4LKCB 3UJTH 3F6IA 4J12A 5GPRA 1MHPH 2AXGA 4HKJB 3T08A 1TDQA 1IAOB 3TYGH 3MRNB 2W59A 2P8MB 5DRZA 4ZTPL 5EN2B 2ZUQB 4BH8A 1N64L 1P5UA 3FTGA 4JO2L 5I8CA 5EBGA 3TA3C 3GJEB 3WFDH 3VE0B 5DRNB 1REIA 3IJHB 4U6XA 4XZUA 5EBWA 2GJ6A 3GBMH 1F4HA 4K94L 1KIQA 4IMLB 3Q6FB 3JWDL 3KAAA 3RBSA 4IIQA 5DJXB 1MI5E 1HHIB 4JY4B 5BVJB 2FEEL 1FV1B 1G7QB 1OGAA 2E9JA 4TVPH 3W11C 2AKRA 2DQTH 1BEYL 3QZWA 2OTUB 5MHSD 3DUSB 4JN2B 3F7YB 3STBA 3WDIA 4JPWL 1MY5A 1PKQA 3BISA 3QHTC 2BZDA 4WHYG 1FZMB 2VC2H 5FYKE 3CMOH 1JGDB 3LIZL 4PGZA 4WW2A 1AGCB 5HYEA 4RIRB 1QLFA 4NHCH 3ARTA 3JWOH 2A38A 2APTA 5I75B 3SQOH 4S1SL 2C1PA 4OFIA 2CLZB 2I5YH 3MYZA 5TDPA 5CZXD 2RJMA 1XIWC 3IETB 5F9JB 3O81A 3KPPB 3T65A 2F58L 3BKJH 3WD5H 3HKFA 1CDCA 1LO4L 4NNXB 4TSAL 5EO0B 1HSBB 4IS6A 3EGSB 1E4WL 1KLUB 2XWTB 3CDCA 3QUMA 3R1GL 5JMOC 1AFVH 4QOKA 4KK9C 1IGTB 2UY7A 3RWGA 1IKFH 1A6ZB 4HJ0C 1Q9KB 5C0CE 2UZYB 4NHUB 4G6FD 3FQXB 1GPOL 4ONGL 1YA5A 3S96B 1OAUL 4JR9L 5KSVB 1V3KA 2NY2C 1EV2E 4TNWK 4R7DB 3U82B 2X4SB 3MUJA 4LSTH 1I1YB 1EEYB 4LP5A 4DUWA 1D5BA 1E27B 5L2JA 4X0KA 5DQ9A 4IJ3B 4ESKA 3DYMA 1NMAH 5D7IE 4XWOD 4Y16C 5CSZA 3LPWA 3FT3A 3MLXL 1H3UA 4OD1H 1OLLA 2I26N 1NLDL 2VISB 2Z4QA 3PIQB 2HT2D 5E7FA 1UXWB 3OKKA 1PX3A 1SYSA 4JHAL 2WINA 3U7YL 1CR9L 1E6OL 5CBEB 5F71A 1T1WB 2DWDB 4X9FA 2OLDA 3HI1B 4NT6B 3TEUA 4NO0B 2A1WL 1MWAH 2YPVL 3RGHA 1KG0A 3GZKA 4QF1B 3RP1A 4UMGA 5JPMA 5GS0C 4DK6A 5FECB 1GGBH 1CFQB 3V7AG 4M62H 4ODWB 3UBXA 4Z7NE 1F90H 4P57B 4LSQH 3MXWL 5B39A 4XMLH 3ZDXF 3TZVC 4YGVB 1S8DA 4PRPB 5EORH 3WYRA 1CGSH 3WUWG 3RVVC 2V7NA 1MHCA 2YD4A 5AUMB 1KF9B 1T89A 1NKOA 4D9LL 2RB8A 3MRFB 3THMH 1N26A 1Z5LA 3ECBA 5FUCE 2ATPB 1YEDB 3LKSB 2OXHA 5ESAB 3IFNH 5BRZD 4L3ED 3GM0A 4YNYA 3NABL 1IGYA 5DFTA 1OGTA 3ARXA 3D25A 4JHZA 3RZCC 4DZBA 5A3ID 5KVGL 4IDJL 2AQ2A 1P7QA 3S8WA 1T1ZB 4WFGD 1KYOK 4KJWC 1XCQA 4KK8D 4O9HH 3FHAA 5CLTA 4JRYD 4NPYA 3IU4H 3NA4A 3NZ8A 1NANI 4YZFF 4FMFA 2EXYC 2G5RA 1RHHA 3QDME 1KTDB 2BFVH 3CDYA 4XX1G 1DSFH 1GGYA 4XXCC 3L3IA 2B2XH 1Q0YH 1HOCA 2HFTA 4Z78A 4JRXE 2X89D 4V1DA 4A6YH 4HH8A 5BS0A 5GZND 2B2XL 2HG5A 1ADQL 2JELH 2JJUA 3PNWA 3GB7A 2A0LD 1QSEB 2VLKD 5I1GH 3NAAH 3VFTA 1D5IH 5C08A 1KC5L 1ZLVK 4XRCA 3VWJD 3BN9D 4U6YA 3QDAA 4FQQB 1KYOJ 3GMLB 4KVNL 1PG7W 5JW4M 3W81A 3AREB 4LGSB 3C2AH 4NGHL 1RIVH 5DFWH 4PR5B 4G6AC 1FORH 2AK4E 3K1KC 1MFDH 3GSVB 1WZMA 4MYWB 1U41A 4G8GA 2PW1B 3OBAA 3LQAL 5JXEA 1MNUH 2O26U 1U3ZA 2VDQL 4X99B 3QRGL 4M7ZC 5CEXA 4MCZB 3RA7H 4S1DC 4JAMA 4IDLA 1XR8A 5IVZA 1CT8B 1JIBA 5DA0B 3VDCA 2DBJA 4U31A 4V2CB 3OKOB 5L8KB 5DYOB 1SVZA 3E6FA 3TLRA 2CK0L 2VXSH 5F97E 4HKJA 3RNKB 3QCVL 1TNNA 3VU2A 3CXDL 3IB4A 2X05A 3BH8B 1N5AB 5IESH 4HIHB 4LEXL 5IVXE 1C16A 1LNUA 2BNQB 1T89C 4NQDD 1B0WA 4LRNH 3MGTB 4ZQKA 5E08H 4F7MB 4PRBA 5F8RC 1S9XB 3NTCH 3SKJL 1UWXH 4M7KL 4RGNB 4R96B 5IF0B 5C1MB 4N9GA 2YPLA 4UT9H 4PJXE 1H5BC 1YPZE 1I1AD 1FJ1B 3L5XL 2ZPKL 2JLLA 2A83B 2VLJA 1C8PA 4OZIA 3ISWA 3I75A 4YDLC 1GXEA 3LEVL 3NZHH 3DVNB 4TUKL 1OOAA 5GGRA 4I4WA 3GGWB 3BVNA 2X7LA 4YO0A 5F9OL 3V6OE 3WNPA 3HZKA 1J0YA 5CWSA 3CDGA 3T0VA 4PB0L 5B21A 2A6JA 4ZXBC 3OHXB 2HLAA 5F9OH 2EE9A 4O4YH 3ZHDA 5DURB 3UDWC 4HXBL 4S2SB 2A74A 1IC7L 2AJUH 1GC1C 1OWWA 1YUHB 1BX2B 2V2WA 2CJUH 4RA3A 4FP8L 3TJHD 5EU3B 2WUBL 4PJ8B 4KJYB 3C60D 2A77H 5INCA 15C8L 3GBML 1J8HD 3FFDB 1HI6B 4UAOB 4AIZB 4F15B 1P84K 2BSED 2Y07H 3WFCL 4JDVB 3GMRA 5DMIL 3TBTA 4PJFE 4D0DA 2ESVA 2DM2A 3IJYB 1BD2B 4Z77B 2CGRL 1F3JA 3LVEA 3EGSA 2BCKB 1I9RL 3F65A 3RU8L 4OSUL 3F7QA 2QHRH 4UIKH 3T8XB 3BRDA 1IGTA 4ODUA 1NGQH 4M1CD 4DKDC 3QQ9C 2IGFH 1T03H 4P9HL 1WT5C 1AXIB 3ROOA 4UUJA 5F1KC 4G8EA 4WUUE 3QIUB 2NY4C 2LAGB 5TGBA 3ARZA 4OF0A 1C1EL 3VXTA 12E8L 4ZO8A 4NQSA 3IYLW 5I6XC 3EO1B 5DHVB 9CGTA 3L7EA 4FQXD 4XP1H 5L2JB 1J0JA 1W72L 5C8JA 1I1RA 3W0WD 2Y36H 3FT3B 3WFCH 5KSAB 1XR9B 2EC9T 1UWEH 1Q8MA 3IDXL 1N2RA 3QEQA 5T1DH 2JK5A 2UZIH 1U91B 4KKBD 4LF3A 1OT2A 5I1HL 4LLYA 1KIRB 3OR7B 4NC1E 1DN0B 3ORJA 4MVBD 2PXYB 3DVIA 4GW1A 3O6FA 2CJUL 3O8XA 5C0IB 4OZGB 5ADOH 4LRNL 1DSFL 4LARH 4PRNA 5MP6L 2Y36L 4PJIE 3V7AE 3BEVB 3ULVL 5TPWH 3SE3C 5C0AA 3KPRE 3BPLC 5TQ2H 4FFYH 1S9YB 4HF5L 3UZVB 3GNMH 4CJ1A 3RHWK 4JLRA 1T2JA 2FX9H 4TUKH 2QKIB 3PGDB 1WBXA 1S5IH 4QTHB 5GS0L 5E2WH 4OLZL 1V7ML 3BWAB 4JREB 3UTSD 4MD4A 5GSVA 5IK3A 2DI9A 4N0CD 3ZHKA 1T03L 3QNYB 1NBVL 4G42A 3OXSB 2D3VA 1A14L 3VRJB 4BK5A 1YEIL 4AY0A 4PJIF 3VXRA 1IGIL 1YEDA 4TYUA 5JIKA 5J11B 3TV3H 3KPMB 4Q74A 3T0BA 1U93B 4KRNA 4UTBL 4WO4A 3WXWH 3MO1B 4F9PC 4PJGA 3IAPA 5AD0B 4HEPG 3F5WB 3IXAB 4X5XA 3DETC 4XPGL 4YHIB 3WIFA 5IT2H 3BPNC 3SGEI 5H8DA 4HSQA 1ZWIA 5EUOF 5TH2B 4X4ME 4QHUB 4PJHE 4QHMB 4EJ1C 1BOGB 3VXMA 1LD9A 5IB4A 3ZL4H 3HNSL 2HJLB 3NCMA 4H1LH 3I3BA 5HPOA 4FQHB 1F2QA 4ZPVA 4L8DB 2V2TA 4W68A 4P48A 1YN7B 2YUVA 2WMPA 4K8RH 2BNRB 1SY6L 1GL4B 2IFFH 4GXUN 4WTZG 3CIQA 1AP2A 2CMRL 4Z6AT 4X7SL 2CKBL 2VZUA 1UC6A 1FLTX 3QWOA 5J3HD 4GXVH 1FAKT 1CDUA 2O5XL 1X5HA 4H88L 2C3XA 3DI3B 4XP4L 2BNQE 1FZKB 2NY0D 4JJ5A 2OK0H 3ARFB 4PJXF 3MYJB 3WFEL 3F7VA 1NBYB 3VFGH 3KYAA 3LOWA 4R90H 3I3EA 3VFUA 5IMLB 1TZGH 1M05A 1SEBA 4PJIB 2WP3T 4U0RB 4C55A 1R3JA 5T1DL 4MGXA 2W0FB 2XQYK 3SDXF 3OKOA 2VKXA 4JFFB 4RMRA 4R2GD 1CXEA 1U8NB 4P3CL 4BYHA 3HZVA 4OZHE 2XXCB 4X9GA 1F8TL 3SEPA 1U8OA 3F62A 3IGAA 3W5NA 3WL9B 1BFTA 4OQTH 3SDCD 4OTXL 2GITA 5FCUL 1M7XA 2P5WD 4G7YL 2IPTL 2PCPB 4ENEC 5AG9A 1YMME 5D7IA 4FXLA 5EULV 1CLCA 3T4YA 3NN8B 3HPJA 5DC4B 2CDFB 3R0MA 4PJDB 3UTZA 4U1IB 4Q9RH 5LXGH 2RBLA 5EORL 4JG0H 5FYJE 4OZFG 4Z7VB 5DRWB 4ODXA 5C92A 4G3YL 1IC5L 4C59B 2ADIB 5IR1B 2WQRA 4MWFA 4QRUA 1XF3A 3VGEA 2AXJA 4N5UA 3O11A 3GSNB 1J7VR 4ALAH 4KHXH 2E9IA 5DD5H 3ULUD 2DQCH 4WWKB 4OZHA 4FTVB 1U8PA 2VLKB 3O4LE 1BD2E 2EYRB 1RUQH 4PY7B 4L3AA 4YWGL 3LKOA 1T5XB 2BDNL 3HPLB 1KPRB 1NGWB 4Z7QF 5MI0C 5MEOB 3SDXB 2GTZA 4N8CL 4WUKL 3L5WB 3U0TB 3OJVC 4S1DD 3MR9A 2F74A 4Y4FA 3FMGH 3ZE0F 1MIEL 2IANE 1G9MC 4L4TA 4J3WA 3GKWL 3O6KL 5KW9H 1TZIB 2R0KH 4UDTA 4KUZH 1JK8B 3RGVD 3VXQB 4I3RH 4LPWA 1NGYB 5E99L 4JANA 1IKNC 1CGTA 1RVFH 1U8QA 2PYED 1I9JH 1LEIB 5E2VL 3ARBA 5TGBB 3FKUS 1HHKB 3GIVB 1WFOA 2GSGA 4HGWA 1X6NA 1VGKB 5A2IH 5J13B 1HINH 3VXME 2VXVL 4NCDA 5I15L 5BRZB 3RDTC 1MWAB 3L9RA 5LGHH 5F1NB 3HAEB 2VXSL 1U58A 1FFOA 3GFUA 3KXFE 4MXWL 3HRZA 2X42A 3MRIA 4X6CF 4WV1C 4OUUA 2JK5B 4Y1AE 3RVUD 5DQJA 5LGJA 1QO3A 3CCHB 4NQUA 4OGZA 4R4BA 5KZCD 4JHAH 3NFNA 3HUJF 5EWIL 1XCTA 3K1DA 4H1LA 3NMEA 4CU8A 2VITA 5H94A 3G6AA 4CVXB 5LGHL 1KCVH 1IKNA 3WJJA 4OV5B 3JBG7 3AMKA 1HNFA 5HGDA 5E5RB 3VXRE 5GHWH 5DFVC 1A21A 3BP7A 3FB6B 2ILLA 1DVFC 3PE9A 3WN5B 2BXZA 3EBAA 1XGRA 3T0WA 3RPIA 1RZ7H 1IQWH 2DLFH 2P24A 4Q9CA 5IKCB 1GZQB 4FXKB 1J5OL 4F58H 3MRRA 4XCYA 1D5IL 5GS1B 1J1PH 4QTHA 3OF6A 1C08B 4XBPB 5DSCB 4HUWA 5FO9A 3V6FB 2A9ML 1ZT4B 3GSOA 3SCMC 2NY7L 1OSZA 4LVEA 2HMIC 4JQXC 3OJDA 5FOJA 2MHAA 5HVWA 4WHDA 4L9LA 3H9SD 1VFAB 5DJDB 1X3DA 1JI1A 5C9JA 2IH1A 2V5YA 2AEWA 1BBJB 4YE4H 3JTSB 4WO4B 3GSQB 5FHAL 3VFPB 5FUZL 3ARDD 1YN6A 3K3QA 3WFBL 4N8VG 3U7AA 32C2B 4XXCA 2PXYC 3FQNA 3D0LB 3O4OB 5DGRA 1XIWA 3IAGC 4GAGH 4BFIA 1U8KB 3QPXL 1WWBX 4YC2C 1F4YH 5K33A 4GG6B 2ZUWA 2VDKH 3U36A 5ACMA 1FFPA 4Z76B 2CUIA 2DQFA 4QXTB 3RDTD 3SCMD 3ZDYE 1UJ3A 4ZUWB 4JY4A 3AM8C 2GFBB 3HE6D 4ZPVB 1UACH 4ODVH 3WNLA 3U9UA 3LIZH 1SYVA 5HHMD 2XG4A 4GAJH 4GKZB 5J1AA 3FB5B 3TVMB 1KCSL 2H6PB 2VLRE 4Q7DA 3PWPA 5E1HB 5GSRA 3VXPB 5CILH 2WBWB 1A0QH 2YC1A 1H0DB 5EBWB 3LN5A 4R9HA 3P77B 1AGCA 4JZJC 2PXYD 3BT2L 3FB8A 3SGKA 5DEFB 2EYSA 5IG7A 1N7ML 5LKNA 2CKNA 4KRMB 4ZMAT 4APQD 1MRDL 4FZEL 5LBSL 1A6TA 1XT5A 4MDJA 1F45A 3L1OL 4XC3L 3T65B 1VDGA 1R0AL 2UWEE 1WCBB 1IQDA 1L0YA 3X14A 3VXUA 1T1XA 2VDML 2DM3A 4WW2B 4JCLA 5D7LB 5C0BA 3PWUB 4M02A 3FQRB 2UVEA 3O0RL 3ARFD 1HQRB 1RUML 2O5ZL 1ZHKB 4M48H 4GAYA 4NKDB 2ZCKH 2UWEF 3TFKD 4UDUB 3GI8L 3SCMA 1FFRA 1H3XA 1DTUA 3RZCD 4X4ZA 1D5ZA 1GPOH 1OAQH 4ONGH 5K9JL 2CRIA 2VLRA 1W72B 3RIFF 1OAZH 2F8OA 5IV2B 5E70A 3ULSB 5LXGL 1YEKL 1VERA 3EUUA 1KENH 4ZFFA 2HWZH 4TSBH 2FH8A 1S7XA 2VDPL 3SKMB 5IIEA 1YY9C 5HGGS 1E4KC 1EEZB 2W65B 3HE6C 3KYKH 4WI7A 4NKMA 4K2UL 2KQNA 5FEBA 4X6DA 4UQ3B 3WE6B 1SMAA 5IEHB 3V52H 4GRWB 4XNXL 5EOQH 1PZ5B 4QRRD 3QFDA 2NXZD 1WWAX 4Z7WE 5LQBH 1CDJA 3HI5H 3JWOL 5TDNA 3BWUC 1UKTA 3JUYA 4WIQA 1QBMH 4MA1B 1AC0A 2BY1A 3L1OH 5HGAA 5AG8A 2VDNH 3AREC 1HHGA 5F3BA 5T5FL 3X13B 5K9KB 4QRTB 2NTFB 3RY4A 3S88L 5KOMC 3LQMA 2FH6A 4OQ1A 3U30C 4TVPE 1OAKL 4IHOA 5IHUH 5I1AA 5SX5K 1SYSB 2PR4H 1OTSD 3HN3A 4W6YB 1QVOB 2V7NB 3OZ9L 2FJHA 4MJ6B 4MA3A 1RJLB 4NKOA 5F9WC 2JCCA 2QQLL 3GHEL 4IMKC 4S0TD 3NCJL 1V05A 3S37L 2FYYA 3QP3A 2XZCL 1ZGLM 5BS0E 2FEEI 4POZD 3U4BH 4TNWF 4QWWC 2LTQC 3QR2A 5BJTA 4PJAF 1G9MH 4OM0L 2QSQA 4XNXH 5EOQL 4Y1AA 1AH1A 2YD9A 3BSZH 4EDWL 1MJUL 3PV6B 4LCYA 1RUQL 5IJVB 1FQ9C 2VZTA 2IPUG 3A6CH 3QSKB 3C2SA 3MNVB 3NZ8B 1Y18B 1OARL 3LPGA 2NXYC 3WUWB 1JUFA 2IH3A 5EOTA 4Z0XB 5KTEL 4U6VH 2WANA 4QO1A 4FRWA 5C6WH 4OD3H 5LGJB 4HUVA 4I2XB 3FN3A 4P3CH 3DSNA 5DHYA 5ACZA 5C70A 5GS2H 4W70A 1XIWD 3H9SB 3TBYA 1CBVL 4RISL 1IEAB 5IMOB 1CK0L 2YUWA 2ZP0T 1MIML 3I6KA 3RAJL 3TZVB 3SE8H 3HMXL 3UYPA 3VXSD 4AM0A 4G6KH 1TVBA 4XVTL 5JIPA 2R2BA 3GJFH 3I02B 4P2CG 2OJZH 1V7MH 1KNOA 4PUBL 5GS3A 3IFPB 3PJSA 1K8IA 2X1WL 2O5XH 1MUJA 4NQCE 4Z7WF 1TCRB 1A6UL 2FATH 4JN1L 1DQQA 1MHEB 1PLGL 1BQHB 1SBSL 1UZ6F 2CMRH 4UAOC 3S5LG 5HJ3A 4JFDB 3OKLB 4I0PD 5BOPA 1P4BL 1J11A 1CZ8H 1PZUB 5GGRY 4YPJA 4F9PA 1PW3A 3O4LA 5AZEH 3E6FB 3WKML 2YXMA 3P2TA 5IBLD 5I18H 3CZJA 4HUKB 5ICZA 4E42A 5C09E 5KAQG 5C86A 3KPSE 4NQXA 5GJTL 1UEMA 1UM5H 4O58L 3IXTB 2Y25A 2CKBA 4JZOB 3ZHLA 5HD8C 2KZ1B 3V95A 5IQ9A 3P30L 1A7RL 2OXGA 1S9XA 1D9KB 3CXDH 4K9EL 2X1OA 3RWFB 4JY5H 2GEEA 1YYML 1FLRH 4ELMA 2D0GA 1ODAA 3HC0A 3QZWB 3GSNL 1IAKB 2DYPD 1KFAH 1C5BL 1C1EH 2GW5A 2N56A 2O61B 2QR0B 4ZS6D 3SKOB 3C9NA 3B9KB 4P2RA 4PRIA 1EFQA 2WBJC 1YEHL 2E6JA 3KYOB 1CLZL 1QRND 3H9HB 3N1MC 4CVZA 3V5HA 4LSPL 3LEYH 1EAPA 3MA7A 5C0GA 1VADA 1W2KT 4TULL 2PYEA 2VXUL 5IG7B 4HIIB 5JNYB 4KZDH 2QBWA 4EBQL 1SEQL 1NFDB 5L6YH 4PJ8A 1KB5H 3EOTH 1IGMH 3WXWL 1TJGL 1INDL 4PYGA 4XBGA 5GGVL 3MBED 3FT2B 5I76B 3P9WB 5C0ND 1S5HA 3IDIA 3QDMB 4LQ1A 1Z3GL 5I18L 2HMID 2PTUA 2P45B 4M6ML 1DQML 2DD8L 4PPTA 5DJ6B 4MA7L 1I3RA 1A3RL 3ILPA 4M3KB 2AK4D 4PLOB 3UTPE 4RX4D 2CKBH 4POZC 3MRPB 5A43C 1MFAL 4Q97A 4G8EB 1RIVL 4Q6IA 2VXTH 1ZMYA 5FYKL 2OJEA 1RHFA 4YDIH 4I3SL 4Z77A 5FYJH 1JJUA 1AGEB 4HS6B 1A1OA 3FT4B 1DBMH 2R4SL 3ZT6A 5DFVD 2VE6B 3M17A 1UWGH 1KB9K 4P46D 4APQB 4JPKH 3QG7H 1AD0A 1H15A 2YPKB 3CVIH 3KHQA 1MFBL 2VISA 3SO5A 5I1HH 3RIAK 4KHTH 3HUJB 4ODTL 2P43B 4H8WH 2C3VA 4AL8L 1A6WL 2AQ1A 2QSCL 5FM4A 1KJ2B 1HHJA 1NC2B 4RNRA 2VDLL 4YHNA 3QUYB 1PZ5A 4KZDL 4JFQA 2J88H 1KG0B 2CDEA 2DTSA 1O7SA 3EO1A 1ORQA 1HQ4B 1G0YR 5KN5B 3L95B 5I0DA 3FCTB 4Y4KB 2D0FA 3PL6B 5FYLD 4QXUH 2JCCE 1G0DA 2XA8H 5C09B 1G7JB 5C0DB 2NR6D 3QISA 2DQIL 1FL5B 3B9VA 3HC3H 2D7TH 2JB5L 4OI7A 3EJJX 4PRHD 4QTIH 4M5ZH 4NBXB 2DLTA 3O8XD 3KXFD 1D6VL 4OZGA 5D5ME 4X7SH 1CG9A 4HF5H 1G9EA 1RFDH 5DD0L 2J8UA 1OQOA 1D6VH 2ATKA 4Z5RB 1FG2B 4MXVF 1ES0B 5EUKA 3MBXL 3UC0L 2XG5A 5HXMA 1TJIL 4YHOL 2XRAL 4LLWA 1U3HB 2D7TL 4L8BB 1RZGA 4ZTOH 1IBGH 3G5ZB 3F8UB 3KPMA 3D0VB 4OJFH 3BHBB 4QRQB 5A16B 4RGOL 2MCG1 1MPAH 5DMKA 4QY8B 2QKIA 1XGUB 2ED8A 5JA9A 3MFGB 3QULA 1ZLUH 1UWEL 3IDXH 2XQBL 4AIXA 1VHPA 4N1EA 1RUPL 1QQDB 4CDHA 1W72H 4Q6IC 1R6VA 5ICXA 1A6WH 2R1YB 1PYWB 4UT6H 3CDFA 5C08B 1YQVH 4I1NB 3DUUB 1I3VA 5EFIB 3WJLA 5AYUH 1JNHB 4YR6A 3QAZC 1EO8H 4M5YL 5D7SH 5INDB 4M00A 4XNMA 2HWZL 3NPZB 5I8KH 5KVFH 1I85A 1NAKH 4NRYA 1T5WB 3C60A 4JREC 4JM2A 4K71B 1QRNA 4EDXA 4X5LA 1H3WM 1R3LB 3BQUC 4KI5F 2OQJB 3FOLB 3ROLA 3NCYP 3KVQA 2EH7L 2LU3A 1QFWL 2P4AB 2XQBH 1AP2B 1AE6H 1L9NA 4ZUUA 4D9QE 2NZ9D 4D0CB 2YD6A 4ODTH 3I2CL 1CFBA 4U1JB 3SE4A 2X10A 1VFBA 2HVKB 5GRWA 4NN7C 2NNAB 1ZAGA 3D5OF 4M8QA 4JDTH 4X5WA 3MLTA 2N7BA 1QA9A 1OVZA 3V4PL 1FVCA 4EI5A 1QOKA 3O6MH 4UIMA 3O6FD 3LN4A 4K94C 4PGEA 4P4RB 3EFDH 3KPPA 2FB4H 3MOAH 3BO8A 3IFLL 2EYTA 4MAYA 4Y19D 2NXZC 3CXHK 1MHHB 3CFKA 5CJ5A 2E8ZA 4CAGA 3L3KB 4OZIE 5IJKC 4HQQH 1IAKA 1EK3A 4F7CB 4NQCA 2DQIH 4M1GH 1A0QL 4QXGL 2Y9RT 1T66D 4I0PA 3P4OB 5BVPH 4OB5L 2ADIA 2I60L 4RSVA 2EH8H 3JWNC 4OCMC 4TN9A 5J6HA 2WSKA 5H2BB 2FX7L 3BI9X 4WGVB 5CJXC 3D9AH 1BX2A 2I25N 4GKOA 1LO2H 3OGCB 3O6FC 4N0UB 4OZHB 4YBLC 1JF1B 3TO4C 4DJMA 4N0CC 4TPRL 3TBVB 1B2WH 3L3OA 2G75A 3T0EB 4P99A 3MFFB 2FRGP 4P2QD 3WJLC 4M9OA 2AK1L 4M61A 2YEZA 1SJHB 1RUKH 4N90D 1MHPL 2AS5M 3GSWB 3R8QA 1RUAH 2ZOLA 4QWWD 2AXFB 4N0FA 4XGZB 4CW1B 2OX5A 1A3LH 4Q2ZA 1MJUH 4JCMA 4PYHA 4AJ0A 1FL6B 1EGJH 5I0ZA 4FQ2L 4DKAA 4XCEB 1X5GA 1DBBH 1RU9H 4HWBH 2ESVD 4NZUH 5ITBL 1CD8A 5I1IH 4HCRL 4ZFZB 3CFCL 2B7DT 4ZUSA 4GQ9H 3QUZD 3DMMA 5EZJA 4KROD 1X5JA 2EKJA 4CJ0A 4Y1AD 2EDWA 3B9KC 3QPQC 2HKHL 3VXUD 5F8QC 1L0QA 3QIBD 4PUBH 4WO4C 1HILB 5L7XH 2GSGB 4HGWB 1QUNA 1VCAA 1OAUH 3UO1L 4XVTH 5IMMA 2X4RB 4ZAKA 2HFGL 5C0AE 2XY1A 1KGCD 3VWJC 3DJ9A 4APQA 5DVMA 2K3TA 1ACYH 5CBEA 1H15B 1E6OH 1Q9LB 2XZZA 4YK4C 3CFIC 4LPUA 1IM3A 3NVQA 2X40A 1JL8A 1N2RB 4Z95H 4UDTB 4OZFB 4LEXH 4NP4L 2J8OA 4MAYC 1QSFE 4YUEL 5J57B 4G7VL 5KS9B 2EIZB 4I18B 4FFZH 4HKBA 4TSAH 3PABB 5FB8B 2GK0A 3MXVH 3DX6B 2P8PA 4WU7A 2B8OT 1LO5A 5HHNA 3RI5F 4OLVL 1NMBL 1GAFH 5L88H 4CADA 2AGJL 2VQ1A 2EDYA 1I4FB 1FC1A 5IFHL 3IRPX 3IFOB 3GMPB 5C0CB 3RDTA 1CE1H 3L3GB 5J1SC 2NTSP 1KTDA 4Z7UF 2Q7YA 4JY6A 4JZJB 4CMHB 4POYA 3HMXH 3HR5B 5C7XH 3HE7A 1HCFX 4F2MA 3N1QC 3C60C 3BD3A 3QNXB 2NYYC 2HG5B 3OX8A 1P7QB 2QQQA 1KCRL 5F9AC 2OZ4L 5CIPA 5GISL 3PWLB 1MRCL 1NCCH 3EO9H 1QKZL 4LSRL 1RIHL 1GOHA 2C1OA 3RZCB 1BFOA 5JXED 2JJTA 2WWMC 3OV6A 3EJZD 1JGVH 2OZ4A 1LDPH 1MI5B 4L4VB 2Y7QA 5E5MB 4TTDD 4ZFOA 3KLSA 5CP7B 1MPAL 5EN2A 3QG7L 1DVFA 3MRRB 3PQYE 3ZE2E 4ONOA 2VLMD 1ZA6B 1Y0LA 3OF6D 3VE0A 4IRSD 4U3CA 5JHDE 3C8KB 1IGML 4UQ2A 4Y5XA 4JB9L 4QHMA 4N8CH 4JVPA 5IVZB 2L0DA 3G5XA 4ODHH 3GHBH 3ABZA 1AGDA 1XH3A 2X89A 4V1DD 4YWGH 3RKPA 1G7QA 4TQEL 3DURA 4M5ZL 5TJWK 5I2IB 3VD4A 3ARPA 2DQDL 3LS4H 4YXLH 3OAYH 3F7YA 3BZFB 1Q1JH 3DUUA 4NQEE 1QRNE 1I7RA 3MX0A 3VFPA 3PP3K 4TTDC 3DVFA 4JR9H 4UT9L 5CEXB 2ZCLH 3IJHA 1YQ2A 4TSBL 4EN3B 2ZKHH 3CLFH 1XR8B 2C3HA 1UM4L 5KSBF 3TYFB 1K6QL 3PWPE 2OI9B 1A5FH 1U8KA 5GHWL 3BP6B 4G8GE 3CFEB 5DJ2B 4Z0BH 1S9WA 1NCDL 4IIQC 5C07B 2RCSH 2H9GA 2EYSB 3GSXA 1AJ7H 3GO1L 3ZYOA 3RNKA 2AABL 4NJ9H 3PWPD 4MDJB 5HHXH 2IAMB 5CZKA 4F7EB 1FZMA 1JWSB 1N5AA 3IF1B 5C09D 4DGYL 4LSPH 4LU5L 4D0BB 4LPTA 1JTOA 4D8PA 4WHTB 4C54A 4M6NL 1EZVX 3HE6A 4KPHH 4OFVA 5FUZH 3P77A 3O4OC 1R24A 2W0LA 3D2UA 2NNAA 3EJYC 3EFFB 4JQIL 5BZDB 5DK0A 2D0HA 5IQ7H 2GT9B 1OGAD 4WY7L 1I8MA 2ZSVA 3SGKC 4NHUA 1F5WA 3EJZC 4KQ4L 3F58L 5I1KH 3SDXE 1MFAH 1WIUA 1T2QL 1ED3A 4J7RA 2ICEA 1R5VB 5HDQH 1BM3H 4FHBD 4DAGH 5DUPL 5EZIL 1VEOA 4RQQA 1DEEA 3QFJA 1OAQL 2V5SA 4NO2B 1G9NC 2WBKA 1I7ZB 1WZKA 1HZHL 1KC5H 5I1CL 4BQCA 1TQCC 2DM7A 4FTVD 1MCKA 2GUOA 3G9VA 1II4E 5E8EA 2H8PA 4MB3A 4NQVA 5FM5O 1HQRA 3HI6L 4GMTL 5DC9B 5GRJL 3S5LA 1BM3L 4DAGL 4R4NC 3EJYD 4PJCE 5IHZB 4F33A 1D5XA 4EOWL 3REWA 4WHCA 4ORGB 3HR6A 1IAMA 1NCWL 2ICWI 4JFYB 4QRSA 4NKMB 1QFPA 4EBQH 3PXHA 5ENWB 3TO2A 2H2SC 4KGLA 5IROC 1D7FA 3KPLA 2XKNA 3AAZA 4E5XB 3T3MF 4P9HC 1D5BB 1E27A 1NUDA 3S3PA 1MCEA 1FO0L 1JV5A 4KKAC 4KTEL 1SJHA 1J18A 3QG6B 3CNKA 3DO7A 1ONQA 5FKAB 5FHAH 2F8XC 3RWJA 2GHWB 2FD6L 3EKCA 4GRLC 5B39B 2D31B 4GQPH 3OKDB 5HPMB 3BRFA 3GBNL 3EOBB 2MOVA 3CU7A 4QKXB 3GSNH 4JFFE 4UOW1 2QQNL 4PGCA 4JG0L 5KS9E 3P9LB 4B53A 1EXUB 3LDBB 5DTFB 1HHHA 1XZ0A 3KYMA 2XZAL 5EZJB 1L7IL 1ZLSH 3U9PH 2NW2B 3OKMA 4PFEA 5DJ8B 5FDYA 4DZBB 1IT9H 2GJ6E 3MZGB 5T3XE 5GS0H 1JZ6A 5IBTL 1CQKA 2OM5A 3PHQB 3VD3A 1NFIA 5T3ZD 1BF8A 2IANA 3SDCC 4MX7B 5E8OB 1I1FA 3HAEA 3P0YL 5HHXL 5I71C 4M93B 4S11A 1FFOB 1FNHA 4ZOCA 4YPGB 4U1GC 2UYLA 3O6FB 4GW1B 1AJ7L 3GO1H 5I16B 1AKJB 3U4BL 3MRIB 1JWUA 5DQDH 4PJFF 1CN4A 5IK3B 3MNZA 3QJFA 4P23D 5E7BA 5IVNA 3CFJB 4YAQB 3D18A 4HWZA 1JHLH 3IJSB 3V52L 1AI1L 1INQA 1MRDH 4MA1C 3ZE1E 2E6PA 5IOPA 1MQ8A 5CBAA 4I48A 4NDMB 1KB9J 1OW0A 3MUZ1 5EC2A 2UZIL 4K7PL 5H35A 5F7EL 3TWCH 4BKLA 5T3XD 2BSTB 4OM1H 5EUOB 5FYLE 3X12B 5K59E 4YHIA 2XZAH 2X4OB 3IKCA 3X11B 3WN5A 1Y18A 3PWNB 1FPTL 5TQ0H 4MNQA 4KI5D 3MBEB 1IGFL 1DANT 4I0CC 4NQEA 1G7MA 1CGWA 3VXRB 8FABB 3E6HA 3HG1B 1NAKL 3DROA 5MHSE 1QR4A 1RVFL 1AHWC 3CX5J 2DQJL 1JPSL 4XVSL 3OWEA 1T0NA 4NO5A 4ZD3H 5CUSH 4M6OL 1UCTA 1YNTA 3FO2B 2NY3D 4L5FL 5CCKH 5HI4C 1HH6A 4XP6L 1VFAA 3U2SB 4PV8B 3SDDD 1TETL 2DMBA 3GSVA 4E41B 3QWOB 1U8LB 3R4DA 5JHDA 3RL1B 3TN0D 1LD9B 3WS3A 2R2CA 4Y88A 4G43B 3DYPA 4X4MA 1MUJB 4X83A 4ERSH 2X6MA 4KXZH 3QQ9D 5JW3H 2P5WA 3MUGB 4XWOC 5DI8B 1CI5A 1YEJH 4FQJL 3T2PA 5KVDH 4WWID 4WI4A 4UOW0 3ZKNC 2HVJA 2DQFB 1D9KA 1UJ3B 4ZUWA 3IT8D 4S1RH 4OM1L 3RWHA 4NUGL 4PJGF 2DQTL 4F58L 3UTQB 1LQSR 2I07A 2ZCKL 3QHFH 1GAFL 5L88L 4WW1B 1FZKA 4GAFB 1U8OB 5EPMB 3O2DL 2HLAB 5IGXL 3KS0J 4GAJL 1I7TA 3DGGA 3IFLH 2OSLA 3NA9L 3WIIH 2YPLB 5T1KA 1T20A 4Y8AA 5DEFA 4Z7VE 1F4WH 4NZTH 2CPCA 3K8LA 1YC7A 1A7PH 1H5BA 1VADB 4DEPB 5C0EA 5EC1B 1A6TB 4NNXA 2PYEB 3BN9C 4KROC 4Z9KB 4FQXA 2ZUQC 2GCYA 3LKRA 1QSFA 2Y06L 4HZLB 4PTTA 1J8HE 1NFDA 1UJTA 2QR0A 2DQCL 1JWSA 3IF1A 1OP3K 3TBTB 5IM7B 2DM4A 3TGXA 5HHQA 1A6ZA 3X17A 4D2NA 4S0SD 2GSIB 1F3JB 4K8RD 4DK3A 5LVEA 2YN5A 4TPRH 5ISZA 3J8F7 4MXVE 2FWOB 4BQBA 3QEQE 4HUMB 3A0OA 5K9OB 3TBSB 4NWUH 3KPTA 4KJQC 3CLFL 4HT1L 4BUHA 2BJML 3NIFE 4PJBF 5C7XL 1YJDC 5HYSB 1D5ZB 1C5CH 4YHPB 3AVEA 5MEOA 3NGBB 3RWGB 3SE3A 4DZ8A 3ZZ1A 5B38B 3ZTJG 4OLZH 1CXIA 5IB2B 5JMRA 2YRZA 4RFNB 3PF2A 4NQED 4XCNB 3Q1SH 3FQWA 3KPNB 2WBJB 3GRWH 2VH5H 3L7EB 4Y4HA 5IVXA 2BVOA 1FBIL 2F53B 4MNQD 4RZCB 1MFDL 2EYRA 4L4TB 1UCBL 4V1DE 2QJDA 2BERA 1AXSA 1NEZA 3QQNA 1J0KA 1LP9F 5FV2A 4OCXL 4JFYA 5FKPA 4HWEL 5DQ9B 1ZA3B 4RCAA 4QCIA 1T7ZA 3EYSL 1J0IA 5GGUB 2A77L 4M4RA 3GJFK 2J8UE 5IW6A 3PIQA 4W6XB 4G6FB 4PV9B 1BREA 4LIQE 3ES6A 5D5MA 1YNLH 2XICA 4N5EC 1JVKA 1EHLL 1HHGB 1WAAE 1P5VA 3UDWA 1INDH 4P4KC 1R5IA 3VXSE 4KMLB 4XMPH 4NQDB 1SEQH 5GRXG 5L6YL 2FBJH 3UJJH 3L5IA 4WV1A 1S7SA 4WTXA 5C0DA 1YEJL 3VGFA 4WFEE 1MAKA 5D1ZA 3P9MA 1LEGB 1DQJB 5D5MF 5DMJB 3O8XB 5E24E 4LCIH 2EDKA 4O2EB 2UUDH 1OP5H 3KDMA 3DV6A 2V9QA 2J5LB 1NSNH 1A7OL 3ULUH 1CG9B 4GSDL 3CFDB 4NM4H 5EU7C 5E2WL 1P2CA 1UZ8B 3RWDA 5F1NA 3TBWB 3ZKXC 1MF2H 5EUKB 2MTPA 5FUOL 4WDIB 1NCBH 3TH3T 1NUNB 1L0XA 3ZTNL 3LRSA 3O45B 5IB3A 4ZD3L 3O6LL 4IRZH 3VI4E 2WLZA 5BW7A 4FXKA 1CICC 1G9NL 5SWZD 3QCVH 3BFOA 5CEZH 4ZFOL 4QHNB 2VITB 4CVXA 4Y5VC 5K9QG 3L3JA 3CVHH 4JQXA 3QJFB 2WLYA 3VXMB 3GSOB 3PHOB 5D72H 4C4KT 3BMVA 4P46B 4J3SA 4YQXL 3FFCB 5F72S 3TJEH 3W11D 3MO1A 3AMLA 3HCVA 4LCWD 4M5YH 3I6KB 5D7SL 5ESQA 5DRZB 1FHGA 1PEZA 3M07A 4CBPA 3L3DB 4YXHH 4O2CA 3U0PB 1RZ7L 5CHNA 5FGBC 4L4TE 4V1DB 5AYUL 3GJEA 4G9DB 1NBZA 4NWTH 2APWA 1CIUA 5M95B 1W8NA 4PB0H 4JFHE 2F53D 4MNQB 2AK4B 5GS1C 5J0BA 1PX4A 2IFGA 1DBAL 3IU3B 5FXCH 5IFAH 3PGFH 2P5WE 1DL7L 3QFJD 5HJ3B 3REVB 2JIXA 2B4CC 1T0NB 1YMMD 1N5YL 3QXVA 3OR6A 5DWUL 1IM9D 4LCCA 3QEUA 3C09B 1MCDA 4OLXH 3MGTA 4ZQKB 3GMMB 3BKCL 5FK9B 1TJGH 3Q3GA 3RVXD 1E6JH 4GRLA 2IAMD 3SJVE 3MBXH 5TE4L 3HZMA 4M7LL 1HHIA 3ALXA 4NJAL 3A67L 3CX2A 1FFPB 4Z76A 4PJHF 1CL7I 1LO4H 3IXTA 5MENB 1KLFA 4PS4H 2HTLD 4HBCH 1CIDA 1YY9D 1NH6A 4JHWL 4NRZA 4U2YA 4MD0A 2XTJB 4XPHH 5FFLA 2JB5H 5T3ZL 3T09A 4HLZG 1CE1L 4PIRF 1FGNL 3JUZA 3BO8B 3B9DA 5IEKB 3O6KH 5KW9L 3HZVB 1T04A 3X14B 4IRSC 2BNQD 4UILH 5BZWA 3W9EB 4M7ZB 3LD8B 3MACL 5C0BB 4R2GB 1YMMB 4OGYL 3Q48A 3BESR 3WL9A 2A74B 3KPSA 3DXAD 1A6VH 3CMOL 4X5WB 5I73B 5CGYD 5DJAA 3C08H 2AQ3A 5EZOL 1BVLA 4GAYB 4NKDA 2PCPA 3SJVD 3DGGB 1OTUD 3OGOE 1VGEH 4UT7H 5ADPH 4K7FA 2A9NH 1WZ1L 2X70A 4WJ5B 4CKVX 5C08E 5H2BA 2IEPA 4JKMA 1KPUB 5KSVA 2VR9A 4FNLH 4ZG1A 2FIKB 2Y5TA 1WCBA 5T3XL 2FR4B 3DRQB 4I18C 4BQ6A 4KI5C 3QBTB 1YPZB 1QR1A 3S88H 5FGBA 2GKIA 1HXYB 1RK1B 4HWEH 4YDJB 5E5UB 1AE6L 1IBGL 2FDBP 5JR1H 4IRSA 3OAUH 4LHJB 3QDMA 1BWMA 3N85H 2VNCA 5C6TH 1GHFH 1KXVC 2H26B 5DJCA 4YBHA 4BFBD 2WINB 3AS0A 5LWYL 5I1KL 3V9FA 5L8JB 1PKQE 3MACH 1JF1A 1MREH 3K2MC 4UU9A 3SN6N 1AHWA 5KOVC 2ZPKH 2AP2A 2IBZY 1EGJL 3DWTA 1JWMA 4Z7VF 3BKMH 3ARBB 3HMWL 5IBLC 4ODWA 2HT3D 1AGEA 1VGKA 3S36H 3TA3B 2R9HC 2DQHH 1CFTB 3EYVB 2ADFL 4PB9H 2P48B 5BRZA 4FS0A 1AO7E 2VYRE 1WV7T 4K3JH 5FF6A 4ZAKB 4ZFZA 1B6DA 4AEIL 2X1XR 3V5KB 5L2KD 4OD3L 5D7LE 1A1MB 4HIEB 3TO4B 3UTTE 5E4EC 5K93A 5GJTH 2KL6A 4MD5A 2Z8WC 1V5JA 1D5MA 4NBZB 4FG6C 5H94B 2GY7B 1W0YT 3VFGL 2XTJD 2P46B 2EDLA 4HG4J 2FZ3B 2B0SH 4JRXB 5JIIA 1QBAA 4P5TC 1IGJA 4RBPH 5ILTH 2ARJA 3LS4L 4YXLL 1ZEAL 4NPYB 3C8HA 5A2KH 1KIRA 2G60H 1EUTA 1E4XL 4LHUG 1Z2KA 2X9YA 4ZXBD 1FORL 1SJXA 4KJPC 1P4LB 4H0GA 4PRNB 3EFDL 3UPAA 2P24B 5IKCA 1S7SB 4PRIE 3CJJA 1MCIA 3JV6B 4JQVA 3WLWC 3PDDA 4P2RE 1UB5A 4H1LB 3UCRA 4PRHE 1FNGB 1FNSH 1AXTL 2FYYB 4HUWB 2FGWH 3L5XH 3MJ7A 5JO5B 3QDJE 4HV8A 1ZTXL 3VFTB 4Z7WA 5BJTB 1F58L 4HIJB 1MAJA 4GMSH 3QUZA 4NBYB 3MROA 5MERA 4GG6E 3P11H 3RWDB 3QEHB 3STZB 1K2DA 3G5ZA 4M1DL 4OFYA 2VZVA 1BFVH 5C0CA 3GIZL 4QRPA 4LPYA 5CZVL 3TESA 3JTSA 4I0KA 5LJYH 1WZ1H 2XIDA 1LO2L 4CU7A 5IW1B 1YC8A 1N3NA 2E9WA 1NAMB 5DSCA 2Y07L 2QEJA 3S35X 3WLWD 4MCYB 4QHNA 3P11L 3U4AA 2PYEE 4U6YB 2P5EB 4PJGB 1F4AA 3VFNB 2XN9B 2Z0BA 3C5JB 3K2UL 1NJ9A 4R97C 4YDVB 4BH7A 3B9AA 4DW2L 4C56A 5DZLA 3LD8C 3K2UH 3WXVH 3RX5A 1DBKL 5F7WC 4HKXA 1WIOA 1JNHA 3MJGX 3ZYJA 2E7CA 2DIAA 2HN7A 5JHLL 3G6DH 3FB5A 3JTTA 3RAJH 5DVOA 2BNQA 1ZA6A 1UB6A 5BVJA 4GH7B 1XF1A 4E9LA 1LWRA 4RFEB 1YN7A 3UZEA 1SMOA 1A3RH 3FN9A 3MCLL 5C3TA 4LK4A 3U36B 2VAJA 3GIZH 3LMJL 5CZVH 4NOFA 2Z8SA 5CP3H 3OPZL 3MA9H 5SWZA 2PETA 3WHE1 3WBDA 1ZHLA 5DWUH 4BZ2H 4YBQC 1MCBA 4XPBL 2CIIB 1PEWA 3FO9A 1EBAA 5J1AB 4FNLL 1C12B 3BKYL 4GRLD 2A6JB 5GSRB 3C9NB 1PY4A 1S3KH 1CZ8L 4GRMA 4PJHA 3QEUB 3WLBB 1F4WL 4U1JA 4XC3H 4U33A 1F02I 3DX9B 1G6RB 3FQRA 4JO3L 3PWJA 1GGIL 1FJ1A 1R24B 2W0FA 3QEGL 4PP2A 4JPVH 4JPIB 4PLKD 5TE6H 1KEGL 3U0WH 1FZJB 2UWEB 3ILQC 5EU3A 3LDBC 3I75B 1R3KB 4RMUA 1QSZA 1HSBA 3KLDA 4NZUL 1NDGB 3ARQA 4NRZB 2HJKA 1OAYL 5CJOH 5EU6E 4F7EA 4HC1L 1UQSA 4YFEA 3B9KA 3HAEG 5D2LF 4LVHC 5DUBA 2ICWJ 1MREL 4L1HA 4D0BA 3D85B 3QZWG 3LQAH 1B0RB 1YEKH 4MNHA 5ERWB 4HC1A 5FA3A 4PRDA 3FRUB 4HUNB 2ZOKA 1PG7H 3S96A 3SKNB 2E9BA 1G1YA 2H8PB 5D7JC 5SX4H 4WNQB 4LCWA 4U0RC 3RZWA 1JNNH 3ZDYF 1EEZA 1FAIH 4Q9QH 3EYQC 2MPAL 4JM2C 1C5DA 5E56A 5F1IA 5IHZA 5TF1H 3KPRA 1UG9A 1A9EB 3INUH 1MLCB 1K4DA 1MCHA 1FO0H 3NIDE 5E95B 2Y06H 3BIKA 1R5WA 2Y6SC 3KYKL 4A2MA 3B2UC 2XKNB 3AAZB 3U7YH 4E5XA 4HS6A 3ARED 3IS1X 1U3HD 4Z7UB 2SEBB 1GRWA 1RIUL 4UTAH 4CW1A 3BPOB 4XT1C 4ZO9A 5DJ6A 1VPOL 4O02L 2GTWA 4JKPL 3EYOB 1VA9A 5DURD 2ORBH 4M43H 5EOCH 2FB4L 3BJ91 4UQ3A 2VL4A 4LLDB 5EO1A 4LF3B 2G9HB 5JW4Q 3GJFA 2EE6A 4G6ML 4NNPL 3LZFL 4QF1A 1T4KB 4NQCD 3UAJC 1UENA 1MVFA 4MJ5B 4Y4FB 3RRQA 3VFOB 3ETBF 1JPTL 4TVPL 1AHWB 1P6FA 4MJ6A 1Z3GH 4DTGL 2ZCHH 4JVWA 3MLVH 2ITDA 5C8JB 1HHHB 1XZ0B 1VACB 4KUCD 1SHMA 1CGSL 2YPKA 2C4FT 1F6LL 3QO0B 1MAMH 2FO1A 3AC0A 3PL6D 1UT9A 2ERJB 4K23L 5I1AB 4PRPE 3SE9L 5F3HB 4M7LH 4JZNA 5MEND 4XAKE 5JQHC 1F3RB 4LCYB 3MRKA 1NGZA 4HBQA 3O6LH 4R4BB 2ESVE 4X6DF 2FJHB 3TO4A 5F6HJ 2P8LA 3QH3B 5F7UA 1TETH 1AKJA 2D7QA 2EZ0C 4ENED 1CFNB 1UJ3C 3MRLB 4MD5B 2YMXH 1MOEA 4N90E 4JG1L 2F54A 3F6LA 2DMCA 5MEPB 1IE5A 4N0YH 3TT3L 4FQLH 4CNIB 1EPFA 2VLLA 1RPQA 3DNKA 3F5WA 1SVCP 5E2UH 3T2OA 1MCPL 4I3GA 1HOCB 3U1SH 1F00I 4Z78B 4HBCL 3CCHA 1OB1B 1DJSA 5C0NC 1IC4H 4NJAH 4JM2F 2XOTA 4QHUA 3S37X 4DN4L 2B5IB 1ORSA 2AERT 5E94B 5KANI 4R7NA 2VJXA 4N5ED 4FFVC 4MJIB 1BLNA 1U3HA 1TCRA 4L8BA 4X6EA 3AREA 5IHUL 4MXQD 1GOFA 2KH2B 5AD0A 2IH1B 4JFDA 4Z7WB 1FL3A 3OJMB 4KROB 4RWYH 1JGLH 4HIJA 4RBPK 1CWVA 1EDQA 3BEWB 5ISZD 1D3CA 1CD9B 1P69B 5DRNA 4M93C 5FO9B 5JOPD 3IKCB 2XTLA 3U2SA 1OT1A 1O0VA 5DXWA 2ARWA 2M8XA 4JFXA 4NQEB 3U46B 4GLRI 1Y0LB 4GG6A 3QO1A 1XGYH 1JGLL 4PJ5B 2HT4C 3W82A 3DROB 3ELAT 1M05B 2OP4H 2J8UF 1ZK9A 2NY6D 2IQ9H 4X9BA 1TPXB 3MUGA 3MJ9A 3BH8A 4I5BB 4LSSL 2H3NB 4UINL 1QFUH 4YDVA 3G5VA 4AMKH 4GG6F 4NRXA 5HDBE 3S3JA 2Z92B 3Q6FA 4WCYH 5ICZB 4XNMB 4NWUL 3C5SB 1UH4A 4WEBH 5E2UL 5TDPB 5E8PA 5E2VH 3HA0A 3LY6A 5IMLA 4NCC2 3LEXB 1FZOA 4OD2A 1A4JB 5EA0L 1UB6B 5GJSL 3MRCA 4ETYA 1X4ZA 2APVA 3AUVA 3I3DA 4KUZL 1P4IL 2EXYD 3BP5A 3BH9B 5I1DB 3OKNA 1T6VN 1NC4A 2V5MA 5L8LB 3OKEB 4XNUH 4K71C 2H6PA 1BBDH 3KR3H 2NY0B 1VB9A 3CVIL 4MAYB 1R3HB 1KLUA 5IB5A 1MHHA 4J4PA 4MXWH 2ZG2A 4S1QH 2YC1B 4EDWH 5EC1A 5D7LA 3T3PE 5I15H 5K9QI 3P73A 4FQCH 4P5TA 4MWFB 5DVNA 3HS0A 3MLXH 5HHOB 1VSCA 3KYOA 3T0AA 3N1PC 4KQ3L 3P0YH 2NY1B 1AR2A 3O3EA 3DX9A 3RWCB 2IPUK 1TZGL 2FWOA 4PP2B 3M1BA 3MOQA 2W9LA 3LSOA 5BV7L 1NDMA 3QCUL 3SDDB 3V0VA 4XC1H 4Q0XL 3N1GC 4G6MH 1C5CL 3CAFA 4LHQB 4F8QA 3L7FB 3H3KA 4I0PB 4XPAH 2CRYA 4WUUB 1JHKH 3RL2A 1GZPB 4P0DA 1B0RA 3WUZA 2H32H 4ZOBA 1URLA 4L8CA 2X4TB 2CUHA 4FTVA 2Y1VA 5ISZB 5CS7A 1MJ8L 2J4WL 2ZOKB 1MFCH 2VLME 1WWWX 5D6DC 3S97C 2VN4A 5ITBH 4PJ7E 3FN0H 3IDGB 4DGVH 3QQ4A 3ULSA 1Z0NA 3VXTB 1EEYA 1N6VA 2XN9D 2PTTA 4RRPA 2FLRT 2D7MA 3L5WA 4ZFFB 1EVTC 4DGYH 3DMMB 2CXGA 1TZHB 5D71L 4LDEB 3U48A 3BSZL 3C5ZD 4DZ8B 2RQ8A 4K7PX 4DWHA 1NCCL 3CX5K 4A2LA 5FCSH 3MV01 1K8DA 4V2BA 1YPZF 4AENA 2DYPB 2W9DL 1MH5A 1DLHB 2F5BL 3KPOA 1LP9B 2J6EH 3U1SL 1RAMA 1TXKA 2AEPL 4OFDA 1U8QB 3UTSB 3GUTA 1B90A 2ZCLL 4EN3C 4D3CL 1FL5A 3K74B 4YNYB 5FKPB 3TCXA 4QRTA 2LV4A 2EXWD 5CFHA 2AGJH 1T4KA 4PD4K 4AT6A 2EIZA 3H3BC 5GGTH 4O2EA 4KK8C 4XHJC 4HJJL 1K3IA 2VIRA 1XCQB 3L95A 4RMQA 4WU7B 4YHZL 1YEFH 3O3UN 3C09C 1A7PL 3UBXI 1RHHB 1TLKA 3IRZA 2IANB 3O41A 3DHMA 3BN3B 3ARSA 3P9MB 1XCTB 3MCG1 2UZXB 4NN5C 2XN9E 4DUXA 2R2HA 3MRQB 4R90L 1LDPL 1U8HB 4PY8J 4X4YB 1FG2A 3QH3A 4JHBA 1TTUA 2APFA 2X4QB 2WBJD 1NCUA 4LCUB 1LMKA 5BMFL 3QYCA 4NJ9L 3WCYA 1WISA 1FN4B 1JZ5A 4LNRA 2CD0A 2Z31D 3TNNA 1QYGH 4I77H 4KKLD 4LRIA 3L3GA 3QIWB 4G8GB 2H45A 1N6QH 4BK4A 2VL5A 3DGCR 4MB4A 4WCYL 5DZOA 3KJ4C 5ETUA 5IB4B 4WVRA 3SDAB 5T5NF 1DCLA 4ZODA 5GRUL 3QWRA 1ZE3C 1MCNA 1J1OH 4IOIB 2UVFA 1MHEA 4L3CA 5CKGA 1HXMA 4U1MA 4ELME 2MHAB 1NCTA 1Q1JL 3HC4L 2VERN 2XTJE 4BSVB 2W38A 4IMKA 4ZUVB 3VFVB 5J11C 4HG4K 1G1CA 4TQEH 1MI5A 5EFIA 4G8FA 2A6IA 4K07A 1I8KB 4PGBB 5FO7B 1NCDH 4F7MA 1CT8A 4TSCH 4S10A 3NOIA 2Z31B 4ZSOB 4M1DH 5E9DB 2IPKA 2PO6D 1CXKA 1F6FB 3G04B 5C0BD 1WT5A 4GRLB 4MJID 1DFBH 3KPSD 3RWFA 2W0PA 1A64A 2E7LA 3IAQA 4RGOH 5IFJB 2CSPA 4P46C 3UYRH 2K7QA 3HE7D 5GZOC 2DL9A 5AEAA 5GGRB 1WZLA 3LN4B 4PGEB 5JA8B 4DN4H 1ZGLA 3VWKD 4K55A 4NKQB 1ZOXA 5JIHA 3TPUB 4MNGA 4NQDE 3RBGA 5DVKA 3D48R 5JW5A 2J6EL 2E27H 1KLGA 4YXKH 4D8PB 4BFGA 4UI2A 1AD9B 1JNJA 3HZMB 4ZOEA 1CS6A 3RJDA 3IDJA 1KCKA 1IMHC 3LAFA 3J7HA 4XP5L 1F4XH 3QPXH 1AQKH 2VDRL 1PAMA 1CDHA 2HRPL 1TQBB 1VEPA 5HGHA 1MQKL 3OHXA 4JKWA 4I9WD 4KWUA 1ETZA 5CGTA 3FO1A 3WDHA 5D2LE 4S2SA 1QTYT 4Y16A 1PY9A 1E6JL 2BMKA 2EDXA 1HINL 1N8ZA 2EIDA 4U1SA 3CK0H 4H8WL 4Z95L 1GC1H 3QJHB 3HS0B 3QIWD 5ID1B 3BX7C 1N5YH 5K59F 5C2BL 4BQ8A 2BOCB 5CSBA 4HFUL 5IEHA 1EVUA 2R2EA 2R8SL 3AS1A 3MFFA 4WFFE 3UTTD 3NPSC 2YHGA 2EZ0D 3DRQA 3ESVF 2N4IA 1ZHBA 2QHRL 4UIKL 3T8XA 1ZVSA 1MEXL 4JO1L 2OBGA 5EOCL 3LHPL 1FE8L 2VABA 3N1FC 3RQ3A 4KVNH 3DXAB 2X2YA 2WBJA 2X4TA 1UM6H 3D3VA 1EMTH 5F1OB 4KDTC 1ZANH 4P2OC 4XPFL 1RZFH 5HHPA 2FO4A 3TO2B 1NEZB 3K4ZA 1IEBB 2H32A 5SWSE 3UO1H 2R0ZH 2R1WA 2ZUSA 4PG9B 4R26H 4L9LC 4G9FA 1BJ8A 3VXUE 4PJFA 5MENE 4OI9A 1MWAA 3D6GA 4PRPD 2NY1D 5IW6B 5JLZA 1D5MB 3F12A 4UT7L 5ADPL 3ZYIA 4K3HA 3RWJB 3HRZB 3SJVB 5KS9F 1CE6A 3O3AA 3MLRL 2CK0H 1RZJL 3BQUD 4KDWA 1S7VA 3RTQC 4NFBA 2Z9TA 1DN0A 5TFSH 4JFHD 1NC2A 5FF6B 2BC4A 1KJ3L 4GRWH 4MQ7B 4U1KA 5FHBL 4DVBB 3IVKA 2NY5C 3BZDA 3P9LA 4UNTA 3SDDC 1NBQA 5SWSD 3VA6A 4WI6A 4M9PA 4D9LH 1S7UA 4I18A 2CR3A 2DKUA 5DJZA 2DQDH 1WVZA 5DHYB 5ACZB 1X5IA 1KN4L 1QSEE 1EZVY 3EDJA 4LKXB 3FQUB 4F7TB 5J89A 1H8OA 5DD6A 5ID0B 3IXAA 1T21B 3C2AL 3EOAA 4LASL 4LSQL 4NGHH 4KKCC 4WGWB 3O6ML 1EFXA 1FIGH 1B2WL 5JXEC 4QY8A 4PJXA 1T1YA 4OCWH 1AIFB 4XBEL 3P0VH 3V4VL 1W0VB 2Q7YB 1JUFB 2IH3B 2ADFH 4I8DA 3LKQB 3O41B 3BXNB 4F2MB 4LOUD 1JGEA 3PJSB 5D7KE 1KOAA 4N1CA 3QUKB 4PJ9B 4EI5C 3OX8B 2D7PA 1PYWA 3L3JB 3OG4B 5AZEL 3DV4A 3WKMH 4EIZC 2MQ0A 2BNRA 3KLHD 3PWLA 1BBJA 5FYLL 3PL6C 4MHHG 1BGXL 4TUJB 3MOBH 3MROB 4JO2H 2DI7A 1WQVT 3BOVA 4YR6B 3W0WE 3O2VH 3EZJB 3ZKSD 4O9HL 1F97A 4NUJB 4XZUB 2E8YA 3L5HA 3C6LC 1N4XH 1RJZA 3DUHA 1KCLA 3D0LA 1KTLB 2J2ZA 3MTRA 3IKKA 1DVFB 4E42B 2AJZA 1P53A 3RNQB 1K8IB 2YR3A 4NRYB 5DJXA 4FQHA 1KEMH 1KJMB 3QXTA 1DQMH 4HWBL 1DBBL 1RU9L 4HC1H 4JM2B 3BD5A 1BQHA 5FM5M 2X5PA 3VDBA 1RZIA 4OGXH 2Q6WA 3SO3B 4MAYD 1WFTA 3FOLA 4ZDHB 5HI5C 4HT1H 1UA6L 4OTXH 1G6VK 4OLUL 5DJ2A 4FA8A 3DURB 1HH9A 1OTTD 3KJ6L 1KXTB 4E41A 1EHNA 5E6IB 4HDIA 4YUEH 3UPRA 3O9WA 2HVKA 5BOZG 4Q9BA 4P5KB 3FB8B 2J8HA 3C6LA 2QL1A 1MRFL 2R56H 3VH8B 4TULH 1KUMA 3BKYH 2OCFD 4P3DA 4IOSD 2R4RH 4C83A 4WHTA 2VZ1A 3LS5H 1P1ZB 5KVGH 2R29H 3WLBA 3PDGA 1GSMA 1QFWM 3KGRA 3SDYL 2GJJA 3D2UB 4G8IA 5I30H 3KXFA 3WMSA 3U7WL 1CR9H 3LH2H 5F9WB 4G6JL 2EYTB 4CN6A 5D2NA 2I24N 3GKWH 4F3FB 1T1XB 2CH8A 4OLVH 1KJ3H 5FHBH 3LZFH 3W39A 2EDTA 1CFVH 1CQYA 1R3KA 4NM8H 2C4FU 1SJVA 1F11B 3B8SA 3C5ZC 4M8QB 1G6RH 2BOBA 4MLIA 3UZQA 1D9KD 5J8OA 2WIMA 4G7VH 1Q94A 5JW5B 5HHOE 4HCRH 2FECL 4L4VE 2L7UA 4RFOH 2GK2A 3QHFL 4ORZC 3KPSB 2W60B 4WI2A 3DX7A 2LQRA 3WIHA 5HHVH 3UTZB 4S1RL 4TTGA 2QTEA 3VI4F 3OGCA 4N0UA 1E4XI 1S78C 4CVWA 5KJRL 4XNQA 4XPBH 1MFEL 3U6RB 3H42L 3KS0H 3WIHL 2FJFB 3PGFL 3GMQA 5HY9B 1OP3H 2XRAH 5GISH 4OCWL 5IM7A 5ANMA 1X5YA 2I27N 1G9NH 3TZVD 2GUOB 5CGYC 3KJ6H 3BGFC 1LK3L 1T7WA 3FRUA 3QWQB 1M7DA 4MDIA 4XVJH 5DVLA 3QIUD 4WNQA 3KWWB 2OL3H 2P1YA 3HI1A 2OR8A 1CLOL 4JJHA 4NT6A 4ORGA 1ND0B 5ID1A 3MJ6A 3QFDB 2Q7NA 5HGAB 1HHJB 5I74B 2AXFA 3K80A 4N0FB 2Q86A 4GKNB 1YQVL 3L3HA 4CVUA 3WHE0 1GGIH 1OAZL 1IKFL 4U2ZA 1DP0A 1ZHBB 1KJ2H 4LVHB 1QYGL 5I6XB 5ESVB 1J05B 5HI4D 3RVXC 5I8OL 4EI6A 1R5IB 3Q6GL 5E1AA 5D7JB 4MS8C 3K7UA 4OLWH 1WICA 1CFTA 3WFHA 4PJ8D 1IZKA 1MAML 1BWWA 5D6DA 2IQAA 2NX5D 4X6BA 5D1ZC 3NCYS 1MQKH 1Q9OA 4L29A 1PJ9A 1DQJA 2UYLB 2FO4B 1CXFA 3EYSH 3MMEA 2IAND 3PABA 4PJ7F 5L7XL 5EH1A 1M4KA 5IFAL 3OB8A 4KK5C 5BO1H 2NX5E 1G9ML 3SQOL 2EH7H 3PL6A 1LO5B 5E9DD 5HHNB 3FOMB 4I3SH 5JDSA 1IRAY 1GGUA 3NCBB 4F9LA 4J6RL 4EUPH 3S35L 1IM3B 2ADJB 1U6AH 3BD4A 4KKNA 1NC2D 3BHBA 4QRQA 5A16A 2MCPH 5E8OA 1GZQA 4LL9A 2R0WH 3E2HC 1JZ2A 1NLBH 4R4ND 4XI5D 2YXFA 2B0SL 2H2PC 2VZOA 2R8SH 2GJZA 3I6LE 4L3EE 2PR4L 3O9WD 4HX1A 1MCWW 1OF2A 2NX5B 5FGSA 2HFEA 2XNAB 3MCKA 4C58B 3H9YA 4PTUB 1PBYA 2DLEA 5JXAH 2IAMC 5E08L 1CD1B 3MUHL 4Y2OA 3N50A 1JBJA 3MV11 3QA3B 1KIUA 2NY5L 5FDWA 2XFXB 1F42A 2BNRD 4ZS7L 4HK3N 2I9TB 2XA3A 2VDOH 2NY5H 5B4MD 2CO7B 3U0PA 1I75A 3Q5OA 4JAMB 4P2OB 3D39B 4PB9L 5BXFA 1OCWH 3MBEA 3GRWL 2WUBH 4CMMB 5GGSA 1WLHA 3L5JA 4L9LB 1RZFL 2CLRA 4PJ5D 4G43A 1I7UA 4ZYKA 3H2WA 5E2TL 1EO5A 4R3SA 4Y5YB 1HIML 2XQYG 4WFHE 2BX5A 4M1CC 4PJGE 3IS0X 1RV6X 1FSKB 3QDGB 1EJOL 35C8H 4LDOB 3GM8A 4RMVA 3UTOA 5TE6L 1KEGH 3LHPH 4MA8H 4MSWA 4UT6L 3FQNB 5BQ7A 5E03A 1FPTH 1PQZB 2MQ3A 2X4UB 1ZEAH 1A9BA 5CSGA 5B3NA 4X80H 4MA7H 3WS3B 1U95A 2C4XA 3C5SA 4HLJA 1NPUA 1EFXD 1IAII 4MQXC 2OQJA 2WK2A 4OZIB 3SKJH 1QFWI 3BQUA 1CDBA 5T3XH 1DUZB 2BVQB 5EU7E 1T2QH 3E0GA 1H3GA 4PJDE 4H20L 5D96B 4XXDB 3DRTB 1UXSB 3CMGA 3AY4A 4ELMF 2WIIA 2HT2C 5CEZD 2WWKO 1JYWA 4MJ2A 1FRGH 2Q3AA 4WW1A 3BKCH 1OD9A 2YRPA 1YUHA 1LK2B 3BP6A 3MLTB 5B3JE 5ALBL 3KR3L 5C07A 2R1XA 2D2OA 2Z8VC 5I19H 1FVCB 3A6CL 4EI5B 3D3VD 4C83B 1FO0B 3VI3E 4L5FH 4GW4A 5CCKL 1P1ZA 1CF8L 5T5NG 1OAXL 2EDEA 4XNYL 3WHXB 1JYNA 5CINL 3VXUB 5T3ZH 1FYHB 1KEML 1FVEB 1FVDB 4G9FD 3B3IB 1QPPA 1ERNA 1T04B 3S9DB 5I76A 2EKSA 3WS6A 2E27L 1IAIH 2VZSA 1N6QL 2W91A 1GIGL 1S7XB 3D39E 3P73B 4TOYL 1T0PB 3DETD 4K9EH 5IB2A 3DARA 4IRSB 3RX7A 2ITCB 4FN0A 4XC1L 4D9RE 1D5XB 1UFUA 2YWZA 3H6JA 1ED3B 4DQOH 1W72A 2NY6B 5DJCB 1CTNA 2NW3B 3QFJB 3T0EE 4Z7UE 4KV5E 4Q6IB 1A7NL 2YA1A 1MI5D 4MJIE 3D69B 1J8KA 4UU9B 2AV7A 5DEGB 4ZTOL 3KLAA 2DQJH 4QRPD 5E8EB 2E7MA 3GSWA 1B6UA 5HYQA 4WRLA 3Q2CA 4OCNC 3QAZB 1AD0B 3QDHA 3QWRD 4X6DE 3GSRA 2W1NA 4F33B 1WIPA 1GZPA 2V2XA 3RKDC 3WNNA 1PLGH 3T0DA 4IHOB 4OBSA 4OFKA 4X8JB 3ZDZF 2YSSB 2YA0A 4ETQA 3P4MA 3KJ4B 4ZUSB 1SM3H 4PGCB 5BV7H 4H5SB 3KHOA 3UYRL 1WJ3A 4ACPA 3B2VH 4R8WL 2FSEA 3F7PC 5IW3A 1X5XA 2PTTB 5GRUH 3MLSH 3BEVA 1T3FB 1C5BH 4QCIB 3SE8L 1GIGH 4FQJH 3OAZH 1S9YA 2ZUVA 5FB8A 25C8H 4KQ4H 2GI7A 1MCPH 2VLJD 3ES6B 5D5MB 3IDNB 4HPYL 2AI0H 4EQ3A 3PV6A 2HKFH 1PKOA 1P2CB 4R6UA 1ZSDA 5IFHH 2F8VA 1I4FA 1TMCB 4APQC 3ZKND 1HSAA 4WV1B 2AJYH 3ZTNH 5D7JA 1A1MA 3LRSB 1RJLA 4HIEA 4HJ0D 4ODSH 3FAWA 4R4FH 4JZNB 1JWUB 5DTFA 3GUTB 1HYSD 4X6FB 4ZUTB 1FFNA 1DL7H 1LGVA 5CUSL 4P9ML 3TNMB 1DQDH 1RJCA 2DDQH 2HTLC 3SKUD 3MMEB 3B4NA 1L6ZA 1MCFA 1BMGA 7CGTA 3QIBA 1P4BH 3S37H 5IJVA 4HUUB 4X6CA 1PVHA 1TVBB 3FFCA 3ULVD 1ZKAA 3N85L 5CJQH 3VFMA 4KY1L 2W92A 4O2CB 2CXKA 2AEQH 3MV8E 3FJTA 5BMFH 1J0HA 2VL5B 5I1GL 2XKSA 3H9SA 3TBYB 1GYAA 1IQWL 2DLFL 3TCLA 2FIRT 1TQBC 2O5ZH 2R2HB 1X4YA 5CIPB 1BQUA 1OWRM 3PHOA 3EO0A 4R7NB 2F5BH 1Q0XH 1HXMB 2C1OB 4U1MB 1JF6A 3RZCA 2XN9A 2N1KA 2X4NA 4ZUVA 4YH6A 3VFVA 3ZSTA 5I1IL 1Y6KR 4ONFL 4P2QA 4HKXB 3IFPA 2ZNWA 3ARFA 3UTPD 5JHDB 5I8EB 5IW1A 1I8LA 2VH5L 1FCCA 1MVUA 5KZCB 3UYOD 4LU5H 1I8KA 4PGBA 4QT5B 1LILA 5KSBE 4URTB 1I9IL 5EU6B 3ARGC 4KFZC 2Z31A 2C26A 4JFXB 1RIHH 3RUGB 4DGVL 2I5YL 2CLRB 4NZTL 4WW2F 1JFQH 1QBLL 2Z35B 4MS8D 1P7QD 3KYNB 4Y19B 3EOYG 4YHMH 5F9DC 3RVTD 3TVMC 3RWHB 2P8MA 4M6AA 4KRLB 4ZXBB 4P2RB 1YYMH 1JPGA 3GBNH 3ME0A 1EAJA 1T2XA 1EX0A 2OR7A 4GRMB 4EI5D 1P7KB 4JO4L 3ARYA 1BEYH 5E9DA 5DF0A 4UIMB 5I1LB 2DJ4A 1DE4B 4A6YB 3TT1H 2CDFA 3G6JF 1NCAH 1K4CA 3GSXB 3U0WL 1OY3B 3FQTB 1FZJA 5D6CB 4KV5F 3W2DH 2DN7A 5M7QA 3UTQA 1RULL 4LAQL 3RGVA 4NQCB 4P23C 1DEEB 1PKQB 5KSUA 4MNGB 1QBBA 1IM9A 5TDOB 2JKXA 2YD3A 1XGPA 2Q87A 4OI8A 1RY7B 2VQUA 4LSDA 1K9TA 3WIIL 4EXPX 4NN7B 1PG7X 3Q0HA 1IL1A 4DFIA 3HI6H 5DK0B 4CMHC 3EIFA 2GY5A 1V8HA 1O7VA 3RTQB 3VMOA 3BT2H 2V9TA 1INEL 5C0EB 5D8JL 2QSVA 1QKZH 1KELL 4HK0B 3NIGE 1FO0A 2FNBA 3VH8G 2W9EH 1HDMA 4IOFD 4LMQI 5IROA 1NL0H 1IC4L 3QQ3A 5KVDL 3LKPA 1SQ2N 2DICA 4KI5E 3TH4T 1KULA 4H8WC 1IILE 2NXZB 2WV3A 5FO8B 2XWJB 1A1OB 4MNHB 4JRWA 1TVHB 5B39G 4XCNA 3R1GH 4ZSOE 2K9UA 5J9PB 5EWIH 1BAFH 4PJEA 2R69L 2H1PL 3LRHA 4IM8A 1J8HB 1L9MA 4GG8B 1BVKB 1HN1A 4NKIL 2DLGA 5HYSA 2QQKH 4YHPA 4ODSL 5C9KA 2VUOA 1W8OA 3S34L 2X44D 1V3MA 4HEME 1S7QB 2AABH 3H9ZA 4IOFC 5E8DH 4JFOA 2VDPH 4NHCL 4R0LA 1A1NB 4P4KA 3JWDC 3LPFA 4X0KB 3CFBA 5DD1H 2HJFB 3VGDA 1UZ6E 3OAYK 4W4OC 4UV4L 4KAQH 3VXOA 4U1LB 3OKDA 1NFIB 4OIIL 4OAWA 4XWGH 1IGCL 1AGFB 2MWCA 3OSKA 4YPGA 4Y5XC 4P59L 5IUSA 3P4MB 5D7LD 5DUPH 4KAQL 2ATKB 2BRQA 1AO7D 2P8PB 3TM6A 1XGQB 1AI1H 1WFNA 2QQNH 3ZO0A 4LLWB 1VPOH 4O02H 4CADB 1LP9E 3MJ7B 3WO4B 2EDHA 4H0HB 1N64H 5KSAC 3TN0B 2CR6A 1IGJB 1FYTB 4E41E 1F4YL 1BVZA 2ZG3A 5BV7C 3VG0L 1A7NH 1MHCB 3WNOA 4Y5VA 4LHUA 2NZ9C 5AUMA 5D93C 2JB6A 4GW5A 1FNFA 2BVUA 5CJBA 5MEQB 1OSZB 4WI5A 3OJDB 5IT2L 3DVGA 1UB5B 1QFWH 4X6FA 4UNVA 4TNVF 1JNNL 4XH2A 3D39D 5EBMB 4P46A 5DJDA 5CLWA 4LFHG 4UOJA 4MCYA 4IRJC 3MV8A 5B3JF 4ZNCD 4CNIA 4JFDD 4PRAA 2FX7H 1SJEA 5T1LD 1FL3B 3CLEH 5C6PB 3C5JA 3CSYB 4KDVA 1JFQL 1QBLH 2HAZA 3C5ZB 1KBGL 5ALCH 2J3SA 2A6KB 3WXVL 2C5DC 4WTZA 5FYJU 1G7MB 2HYMA 1CVSC 1IAIM 4WO4D 3M45A 3SY0A 1N3NB 4LLAA 3VGAC 2ICWB 3C60B 4C4KO 1LO0L 3HG1A 3NFPB 2J5LC 4HS3A 1BZ7B 5D2NC 4X7CC 3TCLB 4LP4A 5LAXA 4XX1E 3LQZA 1OGAE 4RWHA 1RZIB 4GFTB 1I9RH 3MGOA 2AV1A 5E00A 2EIEA 2DQUH 3NCCB 2OTWB 5SWZB 1FH5H 2HH0H 4I5BA 1LO3L 4XI5C 4D0CA 5KSBB 4IBLT 5LGKA 2YD5A 3QUXC 1HH9B 4OGAC 3RI5K 4U7MA 1G7IB 3RWIA 2AJZB 3RNQA 3ZDZE 2PTVA 1AQDA 3I6GA 1NGPH 1QA9B 2DKMA 3ULUF 3Q5YA 1M7IA 1TVDA 5J6GA 5H37H 3U9PL 2BFVL 1HK6A 2JJWA 4PBVC 2A9NL 1N0XH 5F21B 3MNWB 4XP1L 2AEPH 1L7TL 3RUGE 2E7HA 5B4MC 1G6RL 3QIBC 1AKJD 1Q38A 5IB5B 2G60L 4UTAL 1CFVL 4AG4H 4LLUB 2VDKL 4LSSH 1KLGB 5J56B 5MENA 4HKZA 3W9DA 3HNSH 4ZAKC 2MQCA 5EU6D 1I8MB 3TA3D 4BA8A 1I85C 1GH7A 4EVNA 5DA4A 3GSUA 5FCUH 4K7FB 1NC4B 1R5VA 1OLZA 3FMGL 5LWYH 1F8TH 2P42B 3G6JA 3TF7C 1MRFH 2R56L 2G75B 3T0EA 4NO2A 3QI9D 5D1QC 1YYLL 1FLRL 3U79A 1JPFA 2VDOL 4OF6A 5JHDD 2VXVH 4H25A 3K81A 1GGBL 1U8MA 4PJCB 4R0LC 5DJYA 1MLCA 4U1HA 1BFVL 4JGMA 4EN3D 4YDJA 4EOWH 1LDSA 5B38A 1IGFH 5HY9A 4LCWE 3MRJA 1R5WB 2R0ZL 3NIFF 1JTPA 5ERWA 5GS2D 4M7JH 3JVGC 3AB0B 3ARUA 3H7LA 4POUB 1ZXQA 3I6LD 3O3EB 3RWCA 4BJLA 2FHCA 2W60A 5GZNC 3TBSA 1UVQA 5L9DL 3W5MA 2B39A 5ENWA 3VFSB 4OKVA 2D03H 4K3EH 1AXSB 1NLBL 3B8YA 4KY1H 2ZSWB 5TDNB 3QUXD 4OGAD 4IJ3C 4RA0C 2HP4A 4LLDA 4J8RA 3EYUH 2PUQT 2DJUA 2BSSB 3GMQB 3T4AB 4ODHL 3PGCA 1FNLA 3VRIB 3BGMB 4WUUA 3LKPB 2X1QA 3TN0C 3ARVA 4OZFH 5IQ7L 4Z7OE 3HB3D 4KVCH 2DQGH 1RULH 1WK0A 2G2RB 5A3IC 3LH2L 4I0PC 3ZL4L 3VFRA 3I50H 4AENB 3HNTH 2VTFA 5FOBA 4BSWA 1NGQL 4OFYD 1J05A 3G08A 5F7FA 2V7HB 3CH8A 1J8HA 3CPLB 1A22B 1JGVL 1OPGH 1EXUA 3WSQL 3GK8H 3ARGA 2IQAB 4HK3J 1UGNA 2APBA 4P23B 4RGMB 1FRGL 3MCLH 5EA0H 1KB5L 3EOTL 1NGXB 2GK0B 3SE9H 4AT6B 1MCWM 4P3WA 4Z7OF 3L3HB 4X7FC 4G9FB 4IRZL 1T66C 3CFDA 1CTOA 3QUYC