1I9JH

Testosterone complex structure of the recombinant monoclonal wild type anti-testosterone fab fragment
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
220
structure length
220
Chain Sequence
EVKLVESGGGLVKPGGSLKLSCAASGFTFSTYALSWVRQTADKRLEWVASIVSGGNTYYSGSVKGRFTISRDIARNILYLQMSSLRSEDTAMYYCAREYYGYVGLAYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RECOMBINANT MONOCLONAL ANTI-TESTOSTERONE FAB FRAGMENT LIGHT
publication title Structural insights into steroid hormone binding: the crystal structure of a recombinant anti-testosterone Fab fragment in free and testosterone-bound forms.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 43
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2001-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1i9jH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1i9jH01
4XHJC 1F3DJ 4IMLA 3T0BA 3X14A 5FHBH 1YJDH 3KS0H 2GJ6A 2Z91A 3REVB 4D9RD 4S1RH 2F9BT 3PDGA 2YPLE 4GJTB 3S34H 3FOLB 3WJLC 5CD3B 2DLTA 2FATH 1EH9A 4Y19A 2CR3A 4JM4H 2C3VA 1CU4L 3CK0L 3WFCH 1I7RB 4UOJA 2VSCA 1PZ5B 2FIKB 4LSTH 1U3HB 4M1CC 1AO7D 1JYVA 3L5WB 3RZCC 3Q6FB 4GAYB 3INUL 4PG2A 1ZLVH 2WV3A 4NQCD 4QWWD 5I8OH 3WFDL 1SYVA 4OLEA 4OT1H 3M17B 2CDEB 3PV7A 1JPFA 1EO5A 2DQGH 2ICWI 1NC2D 3LH2H 1A6UH 1A7NH 2EDWA 3H9SD 4LIQL 2V9QA 1BAFH 1FNAA 3ARGB 3RIAK 3AGVA 3MLYH 4NZUH 3T4YB 4CU8A 2A1WL 5EUOA 1QYGH 5L9DL 2UWEB 5E2UH 3VI3E 1N6QL 3ZT6A 1MRDH 1UEYA 4YHOH 1RZGB 3HZYB 5ESQB 4LRNH 2VISA 4MDIA 2HYMA 2J5LB 4PGEB 2ICEB 4H20L 4E5XB 1IC4L 4HC1H 3NIFF 1UQSA 4AK1A 1HILB 4PJXB 1F2QA 2WBJD 1BJ8A 1T04A 2GITB 3HG1B 1TPXC 2VQUA 5C09B 1OCWH 5HHOB 4X5LA 25C8L 4N0UA 5F9WB 3MLTB 5DRWB 3QXAA 2HN7A 2XI9A 1AXIB 1AJ7L 2OMBA 3GM0A 4GUPB 4I0PC 4Y5VA 5TDPB 3TO4B 1P7KA 4E41D 4Q9RL 4XRCB 5GSRB 4YHLH 3FJTA 2R0LH 4JO1H 3ARUA 3G9VA 5FYLL 4MJ6B 1TJGL 1YMMA 5MENB 2FHFA 3GMOB 3QUMH 5DS8A 4P46A 1LK3L 3UTSB 4YXKH 3VFOA 1XIWC 4MD0A 2F74B 5GS2H 2J8UE 3MOAL 5CP7B 1IGTB 3C6SA 4NQDB 1RIUH 4OQTL 1DBKH 1A6WL 4D9LL 4PB0L 5IQ7L 3KXFD 4YHKH 1ZA3B 4RFNB 4HGWA 1XGUB 3S96A 5CKGA 3VJ6A 1UXSB 1KIQA 5D2NC 2YRLA 2WBKA 1CDHA 1T66C 5IB5A 4PB9L 5D5MF 3IU3A 3HI6L 3O9WC 3ZKNC 4RAUA 3IS0X 1T7VA 3ULVL 4Y4HD 4X83A 2JJUA 5KVGH 4PJAF 2ARJA 1T80A 1RZ7L 2IQ9L 3F7RA 1FE8L 2FYYA 1RULH 5DF0A 1NMCC 1NKRA 1ZS8A 2GW5A 4OI9A 3VH8B 1AR2A 1N0LA 1NC4B 3G04B 2FJFA 3PWPB 4J6RL 3O2DH 2QR0B 5E5UB 2CKBL 2OM5A 1A0QH 2EO9A 2GSGB 4PJFA 1MFCH 2XPGA 5MI0C 4ONHA 3H9SA 5JO5B 4XMLH 1XH3B 1C16A 1G9ML 3HI1A 2P24B 5D1XB 4XC3L 4PJIB 5DJCA 1YQ2A 3BEWB 5SX4I 2EC9U 3RDTA 1RPQA 3T2PA 3QUKA 1J1OL 1T5WB 2OTUB 4LLMB 4K8RC 5E94A 4LKCB 1T89C 4S10A 5IJKA 4YXHL 4JKKA 3QUMB 1CL7I 1L0XA 5D93B 5ENWA 2WBJA 2NY6B 5EWIH 1YN6A 2LVEA 3BKJH 2ILLA 1J88A 3Q0HA 2D0GA 1BBDH 3VWKC 3WIIL 4OF0A 4BFIB 1F4WL 4MA1C 4OLVH 4YK4C 4OFDA 5T33L 5FO7A 2C1OB 2Q8AL 1WFTA 4E41A 3BPCA 3LD8B 4U1HA 4YUEL 4K9EC 3H0TA 5DD6B 3DMMB 5I1DA 1RJCA 2YR3A 2NTFB 5ITFB 1JTTA 3LZFL 1FZJB 1U8MB 3ZTJH 3TJEL 4JDTL 5IOPA 3ARSA 5I9QC 4FP8H 4G80B 3CXHJ 4QRRB 1KJ2B 3OWEA 4RRPG 4R97C 3NFPB 4F8TA 3HRZA 3SKOB 3KXFA 4MD4A 1EFXB 3GJFA 2Y5EA 1BM3H 3HG1D 3GMPB 3VRIA 5C09D 5HHOD 4K7PL 2BP3A 4U6YA 3P4LA 3EYQC 3GHEH 4U6VL 4XVUC 4OIIL 2C7UA 5FKPB 1YDPA 1IC5H 1RZJL 3BDXA 3A6OA 2OL3H 4L8CA 1SJVA 1KXQE 4Y4HA 3D25A 4HK0A 3TO4D 3ARDC 5FDWB 5DVMA 5KS9F 3WLWD 5L6YH 4NN5C 4KVCH 1GZPB 3UJIH 5E1AA 5MEND 4X4XA 2BY1A 4DZBB 2DM2A 3WNLA 4P9ML 4R96B 4RMRA 2ATKA 4Q74A 1KIRA 3UTSD 5ILTH 1KCVH 2WWMC 4KKLD 1EGJL 1CR9H 1N4XH 1MUJB 2X1QA 4AIXA 4NQDD 3NVQA 3B9EA 4R4FL 4R9HA 5TQ0L 3U9UA 3BWAA 3KLHC 3EHBC 4PJGA 3HPLA 1SM3H 1EO8H 1YEIL 1LHZA 4WEUD 4PJBF 2XWTB 3REVA 1ETZB 1EIBA 3MGTB 1EVTC 4PJCF 3HFMH 1X5HA 3FOLA 1BIIB 5CD3A 3LRGA 1B88A 1I7RA 4POYA 1PZ5A 1QLRB 2FIKA 3UJJL 2VSDA 3NIFE 1U3HA 2FX8H 5FF6B 4AIOA 3BESR 2YUVA 2VRAA 3Q6FA 4IMKC 4N90E 1X4XA 4O2EB 3T08A 4MJIB 1GCFA 4GAYA 1NC4D 3UTZB 1LEKB 3PWPD 1D5XA 2V5MA 4BH8B 3M17A 4PS4L 2CDEA 4J7RA 4TYUA 2D7QA 2Y36H 1UACH 1EZVX 2XZQL 1D5IL 5FYJD 1OM3H 2DQIL 2LFGA 3RVVC 3ARGA 2Z8WC 3RWDB 1A4JA 5I19H 1IC1A 2W59A 1A7QH 4KQ4H 1A7OH 1OSPH 3T4YA 3MV7E 2OL3B 2MQ3A 3D48R 4XX1E 2UWEA 2QL1A 4HMDA 5JQHC 5CS7A 1MEXL 3U7WL 4JN1L 3MV9D 1RZGA 2NW3B 3HZYA 5ESQA 1G9NL 1JGUL 3PWLB 5IWLC 4O9HL 4PGEA 2ICEA 4OGZA 4E5XA 3QEGL 1BFVH 4RNRB 3Q3GB 3U46B 4Z7VB 3WKMH 4OGYH 1HILA 1BGXH 1NBYB 4PJXA 1I9RL 2NY6D 3GNML 2GITA 5HD8D 3HG1A 4OZHB 5C09A 4MAYD 5HHOA 4FQJH 7CGTA 4DK6A 3DX8B 3ES6B 1BFSA 3KDMB 3PXJA 1CXEA 5D5ME 4Q6IC 2VDKH 3MLTA 4M62H 3O41B 4UU9B 1UB5B 3KS0J 1EO7A 4GUPA 3TO4A 5TDPA 4XRCA 4PJAE 5GSRA 5ICYB 2LTQC 3WHE0 3TP4A 3QB7C 4HPYL 2C9AA 1NQBA 3DMMD 4MJ6A 2I60H 5MENA 3IU4L 2RB8A 2AK1L 3GMOA 5L0QB 1RMFH 3V4VH 3REWB 5B3NA 4MMXC 3UTSA 5A2IH 1S8DB 1S5HB 1FSKB 4A6YL 4MYWB 1YEFH 1ROWA 2F74A 4KRPB 4QRRD 5BCAA 5CP7A 1IGTA 4NQDA 5C0AE 2W9EH 5F7EL 5CEZH 3WHXB 4IOSD 4LARL 4M5YL 2FB4L 1S3KH 1EFXD 1ZA3A 2W60B 1XGUA 3D5OF 5A43C 1FDLL 2P47B 1UXSA 2EH8H 4S2SB 4U0RC 3LQAL 3PP4H 5CGTA 1S78D 3GKWH 1YNTB 3T09A 5C2BL 4Y4FB 1QG3A 1ZEAL 2HKFH 3P3YA 4M1DL 4GAFB 1YEHL 3BT2H 2B2XL 2APFA 2CPCA 5E7BA 3D87B 1AGCA 1KELL 4NUJB 1LK2B 3ALPA 3VH8A 15C8L 3D1MC 3IAQA 2IMMA 3FQUB 1NC4A 3G04A 3MXVL 2JB5H 3PWPA 4HC1A 2QR0A 4P59L 4Z7NF 2F54B 3I3BA 5DVLA 2ZKHH 2GSGA 1JZ4A 3PL6C 1Z2KA 3BGFC 2ICCA 4QNPF 1H3PH 5JO5A 4Y8AA 1XH3A 3LPWA 4PJDB 1NBZB 2P24A 5D1XA 2ZP0T 5T3XH 4HG4K 4PJIA 2HTKC 3BEWA 3MJ9H 4XPGL 1MJUH 5FUCC 1MAKA 5CILH 1ZT4B 3RAJH 1IAKB 1JYWA 1T5WA 2OTUA 4HPOL 4KRMB 4LLMA 3RVXD 4HKBB 4LKCA 1X7QB 3BSZH 3CZFB 2OTPA 4IRZL 3VW3H 5LXGH 1OP5K 3QUMA 1GAFL 3BPNB 2OZ4A 4MDJB 2KL6A 5EORH 4MJID 2X9XA 5E8OB 4QHLB 2NYYC 5SV4A 5B4MC 4DGIL 1IRAY 1AR1C 1EZVY 2QTEA 3SQOL 5F7MC 3VGGA 2HFGH 2QHRL 1I9IL 1KFAL 4W4NA 1ZAGA 5EH1A 5J12C 1EUTA 1AXSB 2FGWL 2C1OA 7FABL 5KS9E 4ORGB 2NXYC 2DF3A 5DD6A 3DMMA 4G8GE 2NTFA 3VFSA 5ITFA 3MV01 1FZJA 4XNZC 3CX5J 3MRHB 3SDAD 5EO0A 5H94B 3UPCA 1U8MA 2V5RA 4I18B 2PTTB 3N1MC 4Q6YA 2H8PB 1I9JL 3GSQB 2VWEE 4Q9QL 4G80A 4QRRA 1KJ2A 3EOTL 3NFPA 2FBJH 2GI7A 4FS0A 3O2DA 3SKOA 4GMTH 2HRLA 2D7PA 1EFXA 3FQWB 3GMPA 2JTDA 5CFHA 4PJBE 3QRGL 2F53E 3NAAL 1PVHA 4ELMB 3C09C 4NFBA 1YECH 2YUZA 5FGSA 5FKPA 4PJCE 4WI2A 1CVSC 2NR6C 4GW1B 4F7CB 4XP9H 3FHAA 4MLSA 5FDWA 1CFNB 2P43B 1GZPA 3EYFB 2QLVB 4AQ1B 4DZBA 4N8PA 5FYKL 4RDQG 4BQ6A 5K9JL 4R96A 1A3LL 4Z5RA 4NPYB 1I1AB 3DI3B 4NN6C 1H0DB 2DLEA 2XA3A 3HE7B 4X4ZA 1MUJA 4KRPD 3THML 4V1DB 2NXZB 3FHQA 4U1LB 1F45A 1GGCH 4NM8H 3RUGB 4DFHA 1GRWA 3WO4C 4HIXL 1OTUC 5I1HL 2XWTA 5SWSD 4ODXB 5I18L 1ETZA 2WP3T 3MGTA 4JO4H 3ZDZF 5JW3H 3G6JF 1BIIA 4IIQC 1HEZB 4HKJB 4HH8A 1QLRA 2VC2H 4KAQL 4N0CD 1RI8A 4P2YA 3GMMB 5I0DA 5FF6A 3MJ8B 1NBQA 2NY5H 1I3RB 4O2EA 4X4YB 4MJIA 4URTB 3UTZA 2YD3A 1LEKA 1BQSA 1OPGH 2AJVL 3CLEL 4U2YA 3AS2A 2E7BA 4M6OH 4DCQB 4KZEL 4Y89A 4PBVC 1U2CA 3TPKA 4BH8A 1CF8L 4D0DB 5JUEL 2VZTA 3T0WA 1LD9B 1C7SA 2XFXB 3BE1H 4BKLB 1S9KC 4NRZB 2IAND 4FZEL 5HVHC 4LSUH 3RWDA 1JZ2A 1MCSA 3KPSB 2F5BL 3PP3K 2N7BA 5DMYA 4WVRA 2OL3A 4AT6B 3WNOA 4DKDC 4NHCL 3NIGE 5IROA 2ZJSH 2NW3A 1J1PH 1IQDB 4PP1D 4G5ZL 1P4BL 4F37K 3PWLA 2APTA 3CZJA 2HT4C 4RNRA 4PY8I 3Q3GA 3U46A 1MCOL 4UV7L 4XBEL 4Z7VA 4NWUL 1NBYA 3C2SA 5FEBA 4AENB 3TN0C 1KULA 1NCBL 3P73B 4OI8A 1KB5L 4OZHA 3SGKC 3BKCH 1GGUA 3DX8A 1J86A 3ES6A 3KDMA 3DUHA 3TA3B 3U7YL 4YC2C 3O41A 4UU9A 1AXTL 1UB5A 2R69L 4L5FH 3TIEB 1RUKL 3OKKB 3SJVB 5I8EB 4P2RB 2N56A 5ICYA 2NX5E 5SWZD 3R8BB 4S1SH 4TUOB 3RVUC 3I6GB 1ZLWK 2V5TA 1PG7L 4R0LC 3TGXA 3REWA 1EK3A 5MERB 1S8DA 4CMHB 1S5HA 1R6VA 4Z7NE 1UKTA 3BDYL 4JRXB 4J8RB 3QIUB 5DUBB 4QNPE 5F21B 1R5VB 3BPOB 4M93C 2OJZH 4ZOAA 3WHXA 3DHJA 1N6VA 2W60A 3GMNB 3SDCD 4LSPL 4S2SA 1SEQH 4JG0H 3VFPB 1YNTA 4L8SB 3BOVA 4Y4FA 4RWYL 4JE4B 4NP4H 4JPVH 2EDQA 3ZYZA 2E6QA 5DA4A 1OGAB 1RIHH 1YEDB 4KI5F 4XVSH 1OAKL 2CK2A 1G6RL 2QQLH 3CFKB 3WFBL 4NUJA 5CZKA 1LK2A 4POUB 5TH2B 3FQUA 3L5XH 1VFBB 1I1AD 4NBZB 4UAOB 4P48A 5KZCB 1B0GB 5IGXH 1FORL 5GS0H 2F54A 4YWGH 4V1DD 2NXZD 3HA0A 2CIKB 3F6IA 1YNKH 4R26H 3BGMB 4BZ1H 3TVMD 3QXDB 2YK1L 3CMOL 4FMKA 5D6DA 3NFNB 1Y18B 4PJDA 1HIML 1NBZA 1VGEL 4DKAA 2OK0L 3B2VL 2XWBB 5GGRB 4WUKH 4WU5B 4ZXBC 1ZT4A 1IAKA 3VWJC 1U92B 4RA3A 5LG1A 4HKBA 1X7QA 3CZFA 1G1YA 1Q0YH 4OD3L 5F96H 1YNLH 2X4RB 4I3RH 3RL1B 4C4KT 5K33A 1F4AA 1K4CB 2R2HB 3WS6A 4MA3B 1UXWB 4MDJA 4BZ2H 2VL4A 4LCWE 5TGBB 1I8MB 5E8OA 1JF6A 4QHLA 1FC1A 4UB0L 3IVKB 1OWRM 2HWZL 5DZLA 3AROA 3L1OH 3SKUD 1JZ6A 1FP5A 4OCNC 1XT5A 1YEGL 2VMFA 1WZLA 1AXSA 3JBG7 1RZFH 5IB2B 1KCUH 4WI4A 4N0YL 3ZDXF 4JHWL 1Z6JT 3V6OC 4HEPG 4F33B 4GRWE 3OHXB 4RAVB 1V3KA 3KPSD 3OTTA 1FZOB 4ORGA 1FCCA 3TBYB 4EI6B 5DFWH 5I6XC 4N68A 2Y9RT 1WIPA 3OKNB 2VLJB 5F7YC 3MRHA 5C0FA 5H94A 1N6UA 2H2PC 4I18A 3H8NA 2PTTA 2H8PA 2YZ1A 1MCPH 3GSQA 5A16B 2D0FA 2O5XL 5GS1B 1H3UA 4GG8B 4HCRA 2C4FT 2JELL 2AK4D 6FABL 3FQWA 4IOIA 2HP4A 2Q6WB 4RMUA 3RGVC 2WP3O 1ZHLB 4ELMA 1ZGLM 3ZDZE 3G6JE 5J1AB 4GW1A 1F90L 1FIEA 4X5XB 5IESL 4ALAH 4F7CA 4JZOB 3SJVD 1F3JB 4P2RD 3RWJB 1CFNA 3ZT5A 3NIDF 3WIHH 3DRTB 5D7JC 3EYFA 1E4XL 2XTJE 4PRBB 5I75C 4ODUB 1DSFH 3NCEB 4R2GB 2AJSH 2HT2C 4NPYA 1I1AA 3GSNL 1H0DA 5ITBH 1A6ZB 1FAIL 1M05B 4K7FB 5GRVK 3SPVB 3BJLA 3HE7A 1ZSDB 1F8TL 4V1DA 4JRXD 5I30H 3QIUD 3FO0L 5K59F 5KSAC 4U1LA 2J4WH 5HVFB 1Q0XH 4JFXB 2Z9TA 3RUGA 1TJHL 4W4OA 4XB8A 4FZ8L 4GAJH 3PGFH 2NNAB 3QCVH 4ODXA 5BJTB 2NY3D 1JZ3A 1FYTB 3JVGA 5BOPA 5D71H 4MLIA 1N26A 1HEZA 4HKJA 1LO2H 3MLZH 5ACLA 4DWHA 4KTYA 4JQXC 5CGYD 1OGAD 4PRIE 4HJJH 4ODSH 3GMMA 3BZ4B 3MJ8A 3VI4F 1IL1B 1I3RA 4P99A 4X4YA 3TO2B 2CQVA 3G5XB 4JFED 1BD2B 4KUZH 2DM7A 3T0EB 5KZCD 2W1NA 1B2WH 2IADB 3BQUB 5GJTL 3RWGB 1J12A 2Z92B 4D0DA 1LD9A 2DI8A 3RKPA 4RQQB 1C8PA 1BVZA 4BKLA 3I6LD 4NRZA 4LSQH 4MXQC 3ARTA 4WFGD 4XNXH 5AEAA 3E6HB 1U91B 3KPSA 1RZJC 5EA0L 3W82A 5GGRY 1GIGH 4AT6A 2AEIT 4KK5C 4RAHA 2W38A 1IQDA 4XNQB 1KBGH 1X5LA 3IXTB 4JAMB 1BWWA 3B8YA 4APQC 2DKSA 3KPRB 2DLHA 4WI5A 1MCWM 4OZIF 5D2LB 2HH0H 1XEDA 1BQLH 1MCNA 2C5DC 4U1JB 5IK3B 5IW1B 1S9YB 2C3GA 2CXGA 3U4BH 4AENA 2P5WD 4PR5B 3MRRB 3MUJA 3P73A 5KOVC 1A64A 3TCXA 4G6AC 1DQDH 4U1IB 3O2WL 2EXYC 2EE2A 3V4PH 1R5IB 3TA3A 2AJUL 4Z7WF 4WO4C 3G6DL 4PRNB 4GXUN 1T7YA 3TIEA 2VH5H 3OKKA 5I8EA 4P2RA 4V2BA 1V8HA 4KI5E 5ABDE 4FXLA 5ALCL 4TUOA 1PFCA 3I6GA 5HPOA 1UCTA 3P2TA 3BP5B 1P9MC 2IGFH 3CNKA 1I7TB 1MFNA 2VLJD 1EEQA 5MERA 3A0OA 1GGIH 1DQML 1TLKA 4XP6H 1MCLA 3O6KL 3RVWD 1WWBX 3VG9B 2CUMA 4TSCL 4JRXA 4J8RA 3QIUA 5DUBA 4PLJD 5C0EB 1O7VA 1R5VA 2C26A 4JFHE 2JB6B 3QWOB 3GMNA 1A4KB 2X9WA 3LDBC 3OJDB 5JHDE 5C0NC 2B39A 1WTLA 4NCC2 1U8PB 2Y5TB 3L95B 5DQDL 4ERSH 1YY9C 3O2VH 2OZ4L 3VFPA 4MVBC 4L8SA 1J0KA 4XNYH 1TMCB 4K3HA 3LKSB 5JPMB 2LU4A 1T1YB 1X4ZA 1QRNB 3H7BB 3OSKA 5DD0L 1MIEH 3CD4A 1QBML 3ARZA 1OGAA 1YEDA 4JCMA 3QDJB 1FRGL 1CLYH 4AEHL 5TE4H 2F5AL 1G9NC 3CFKA 4C56B 4FFWD 5TH2A 1NH6A 4Y5XB 4R2GD 1VFBA 1R3JB 3QI9B 1B0GA 3QWRD 4DKFH 1GC1C 2FX7L 2X4NB 2CIKA 3BGMA 3ZDXE 3C6LB 3QXDA 2W91A 2AEQH 3IAPA 1Y18A 3NFNA 4GH7B 4O5LL 3L3OB 4QHKI 2BRRL 2DQUH 2XWBA 5GGRA 1J0IA 1KJ2L 4WU5A 3A67H 1I3GH 2NY0C 1EHXA 4HT1H 3C8HA 1FYTD 1U92A 1QFPA 4F3FB 3Q6GH 1YYLL 5EZOL 1CN4A 5JOFB 3IXAB 2IG2H 4DW2H 2X4RA 2I24N 3RL1A 5IHUH 1K4CA 3O6FC 4FQIL 2R2HA 1RVFH 4MA3A 1UXWA 1X44A 1LO5B 2FBOJ 1X5AA 4PJ9C 2QSTA 5F97E 5TQ2H 1PW3A 4ZUVB 4OTXL 4CADB 3MOBL 5TGBA 1I8MA 5GGVH 4M6ML 2PO6C 3IVKA 1BD2D 4TUKH 4FTVE 3BQUD 1CTOA 3P0YH 3SGJA 4PP2B 1LO4L 3I9GL 3SDXB 5IB2A 1PJ9A 1S7VB 1SJEB 2V17L 3PUCA 3IDGB 1K3IA 4F33A 5DFTA 3OHXA 3UAJC 3NIDE 4RAVA 1FZOA 5C71A 3NZ8B 2H32H 2UZYB 4EI6A 1WC7B 4YH6A 3N1QC 4YDKL 1GZQB 1BOYA 3PHQB 3T3MF 3R8QA 3OKNA 2VLJA 4JKPL 1PLGH 2WM0A 3HCVB 4O4YH 1NAML 3F58L 5ESAB 1YZZA 4K71C 5C0CB 3KPRD 4YO0B 1WK0A 5A16A 3W9EB 5K59E 3ZTJG 2ID5A 5GS1A 1KLGB 4GG8A 3UTPE 4K3GA 5EFIB 4P9HL 4PJEB 3O4LE 4QHUB 5BZDB 2Q6WA 3V7AE 4EDWL 2BNQB 4LPXA 2PXYB 1ZHLA 2XYCA 2DLFH 1N8ZB 1S7SB 4LCCC 1MCQA 1NSNL 5J1AA 3ULSB 1KPVB 1P6AB 4JZOA 3MRPB 4FFYL 4WFFD 1F3JA 4UBDD 1TNNA 3DLQR 3RWJA 5I1JL 3S4SB 4LLYB 4TQEH 3DRTA 3IJYB 4U31A 1BF2A 1LE9B 3VI4E 2OMNA 1K6QH 4PRBA 4ODUA 4X9HA 1UVQB 4Y2OA 3SOBL 3ARRA 5BOZG 4JPKH 1FL5B 2OTWB 1A6ZA 1M05A 4MQXD 3GRWH 4K7FA 5DUMH 1QHPA 3SPVA 1ZSDA 3QUYB 3H3BC 2OP4L 2A0LD 3LEYH 3LCYA 4JFXA 4QRSB 5I1GL 5GRYA 1GXEA 3E2HB 1GJIA 1QSFB 3PDOB 4XVJL 3CFBB 2NNAA 4NCDA 4WTZG 4PJ8D 5CINL 4M3KB 1WZKA 5JXED 3ALWA 5EU6B 4FQ2H 5BJTA 4EKXA 1FYTA 2A77H 2LQRA 5GRZA 2R8SH 5E6IC 3DXAE 2H32B 1QRND 2FHBA 3QCTL 3EDEA 5F8RC 3QDJD 2VXQH 2WUBH 2AXFB 2M8XA 4L9DA 3BZ4A 4KK9D 3UBXB 3VFTB 1IL1A 4HIIB 4M7ZC 5CJXC 3TO2A 1NAKL 5JOEA 3G5XA 4MNGE 1BD2A 3PQYB 4MXWL 1CL7L 5ANME 3T0EA 3QI9D 5F8QC 4Z7WE 1CDIA 4B5EA 1J18A 2IADA 2DBLL 3BQUA 3RWGA 2Z92A 4RGOH 3V0WH 1KENH 4RQQA 4N9OB 2QSCH 3C6LD 4I1NB 3MZTA 5CWSB 3DBXB 5DUPL 2VAJA 2DYPB 3BIBX 1JNLL 4XAKD 4QXTB 3E6HA 1SY6H 1BIHA 1U91A 2YD1A 1B6UA 5DR5L 4PG2C 2AAVA 3L3KB 5DWUH 1MAJA 3CUPB 5T5NF 3ESUF 4DUXA 4XNQA 3IXTA 1REIA 2LVCA 5I66B 4JAMA 2Y07L 4YGVB 1UYWH 3KPRA 4UTBH 1N7ML 1HQRB 5D2LA 4X6FB 3WFZA 1MLBB 4KPHH 4X6BB 4DOHE 5IK3A 4U1JA 1S9YA 5HGDB 1RAMA 5GISL 3B2UC 3QUXB 4PR5A 1CIUA 3MRRA 1BF8A 4N8VG 3VMPA 2D7TL 4WI3A 1I1CA 2CLZB 4DVRL 4LU5L 1B0WA 4U1IA 4XAWL 1R5IA 5KAQG 3LY6A 2BHUA 4JRYD 2CLVB 3K4DA 4PRNA 5EBGA 3OAZK 2OYPA 3WFEH 5BO1L 4DAGL 4MQSB 3QG7L 4NQXB 2J88H 5GQBA 4IEFB 4WCYH 4QTIH 2R56H 4I8DA 4MSWB 1ED3B 1FBIL 3BP5A 5C6PB 1DJSA 1I7TA 3QAZB 1S7XB 1TJIL 4FG6D 1NCWL 4WI9A 1PKQB 5FYKE 5C0EA 2GHWB 2JB6A 4JKLA 3QWOA 5L7XL 5I74C 1W0VB 1A4KA 4P4KD 2V5SA 3OJDA 4NNPL 3RA7L 5JW5B 1U8PA 2Y5TA 4YJZL 3L95A 4P46C 5CJ5A 5JXEA 2PXYD 3AAZB 4FQPA 4NKQB 4DN3H 3LKSA 1EERB 3V8CA 4J3SA 5JPMA 4QRTB 1IFHH 3MV11 4MNHB 1QRNA 2WANA 4LQ1A 3H7BA 5BV7B 1MFBL 4DEPB 1VPOL 2VITB 1HCVA 3FRUB 1IC7H 3DO7B 2R4RL 3QDJA 3VD4A 2ZUQB 4BFBD 1HKLL 4Z8FL 4G6FB 2IBZX 1P53A 4C56A 1CK0H 1FG2B 3KYKH 5T3ZD 2LE9A 4JM2F 3RX8A 1GGYA 4Y5XA 3IJHB 1JHKL 2GKIA 3U79A 2O5ZH 4CDHA 2PW2B 1R3JA 1VADB 3QI9A 3QUYD 2EXWC 2HMIC 2X4NA 2R1YA 5BMFH 5J1SC 1MREL 1NCDL 5GGVY 3C6LA 1PDKA 3EYUL 4XMPH 5KJRH 3OKMB 3L3OA 1MJ8H 2OI9C 4LVHB 1QSFD 2YKLL 1NMAH 4KRLB 4OI7A 2JJSC 4HCRL 3UYRH 3T3ME 5EU6D 2YEZB 1RY7B 4QWWC 3V52L 4FQ1L 4F3FA 4X7EC 3JZ7A 5JOFA 3IXAA 3MCKB 1N2RB 4W70A 1KJ3L 5L2KE 2HJKB 4G7YL 1LO5A 3LIZL 1GGBH 3RDTC 4ZUVA 4CADA 4FHBD 4JCLA 1TQCB 4UZGA 1ZWIB 5DJAB 3W2DH 3PQYD 4X9GA 1F4HA 2UY6A 2EDDA 1QUNA 4EQ3A 3F62A 3CU1A 1UCBL 3KJ6H 4PP2A 4I0PB 3SDXA 4YIQB 1S7VA 1SJEA 1KNOB 4GLRI 4K8RH 3IDGA 3LS4L 2DYPD 1AO7E 2WBJC 3NZ8A 2X7LB 2MFNA 1GZQA 3PHQA 5E08L 1EXUB 4ZG1A 3KPOB 3HCVA 1J8HE 4D0BB 4JB9L 5ESAA 4CUCA 1OP5H 5C0CA 4KK8D 4YO0A 3WJJA 5IM7B 3W9EA 4DN4H 5C0RL 1KLGA 3UXFA 4QYOB 5DHYB 3OR7A 5EFIA 2Q8BH 5EBMB 1NBVH 4PJEA 3L5JA 4LCUB 4QHUA 5BZDA 2YPLD 3BH9B 2BNQA 3QZWG 4ZTOL 4K9EH 1HSAB 2PXYA 2AJYL 5DJ8B 1N8ZA 2L7UA 1S7SA 2ESVE 3O9WB 2C3WA 3ULSA 4ODTH 1KPVA 1HWHB 3MRPA 2CIIB 4P2QE 5HHVH 5DURD 4LLYA 3S4SA 3U0PB 5J6HB 3IJYA 2APXA 1LE9A 3LAFA 2LV4A 1UVQA 3MCLH 2NTSP 4ZUWB 3UDWA 1FL5A 2OTWA 1NUFA 1A5FH 1OGTA 4ZFGH 3QUYA 4JN2B 4Y4HC 3FO2B 5HHXL 2ARWA 4HBCL 1MJ7H 2G5BB 4QRSA 1QSFA 1IT9H 3PDOA 4J3TA 3CFBA 1IQWH 4JY6B 1AQKL 5LWYH 2AABH 1WBXB 5EU6A 3SGDI 1X5IA 3ET9F 3QHFL 1EA9C 3CFIC 5IW6A 1E27B 1LWRA 3MO1B 2UY7A 2DQDL 1TVDA 2IBZY 3AM8A 2H32A 4ZD3L 3RRQA 3BAEL 4M7LL 2GCYA 1MWAH 4OM0L 4OAWB 1W72H 3NFSH 3UBXA 3VFTA 4HIIA 1MQKL 4HIHB 1DCLA 2MJWA 3PQYA 5C2UB 2GT9B 3JWOL 4YK4B 1O0VA 4UDTB 5KANG 2XQYK 5CWSA 3C5SB 3DBXA 3QDME 5EBLB 4TOYH 1XGYH 1BMGA 1IGIH 1J0JA 2DYPA 4QXTA 2UV3A 1MFEH 3ILPB 4LQFH 1FZKB 2BCKB 4K3DH 1MIMH 3L3KA 2AKRB 3CUPA 4JJHA 1XGQB 3C2AH 5I66A 4YGVA 5D8JL 1HQRA 4X6FA 1YEEL 5FKAB 1IJ9A 3ARGC 1MLBA 4X6BA 2VLLB 1W8OA 2A9MH 2B1HL 2GYSA 1B9ZA 4LLWB 5HGDA 4HS8L 1NGYB 3TBSB 3QUXA 3GRWA 2X2YA 5E9DE 3TPUB 3MLUL 2CLZA 3D39D 5FGRA 3LQMA 5A3ID 3HC4H 3UROR 1FG9C 2J5LC 2W9DL 4UIKH 1BJMA 1ZGLB 2CLVA 2FJHB 2QV2A 1UM6L 2VDNH 3OZ9L 4NQXA 5BXFB 2CRMA 4MSWA 1C5BL 4NDMB 4UT6L 1ED3A 3SHSA 3JXAA 2PR4H 4L29B 3ZO0A 4K2UH 1S7XA 1KN2H 4EBQH 5F9WC 1QEWB 1PKQA 4XWGH 1VFUA 3TO4C 4PGBB 5DVOA 1FGNL 2XOTA 1A7RH 3WLWC 4H5SB 3ARXA 2VIRA 3TT1L 4ZO8A 1W0VA 3MV7B 4ODVL 5JW5A 2H1PH 3QUZD 1E4KA 5LCVH 1J10A 4R8WL 3AAZA 1IAMA 3AY4C 4KKLC 4QRTA 4EUPB 1PX3A 1SY6A 5GGUB 4J3WA 4WV1C 4MNHA 1I3UA 4GRLB 1TETH 1FQ9C 5KANI 2VITA 2ADFL 3FRUA 1ZLWH 4YFLF 1JPST 5DD1L 2ZG2A 4RFNC 2NY7L 1FG2A 3MXWH 5TPWL 3IJHA 4LMQE 4OZFG 4XPHL 3GBMH 4EI5B 1TDQA 2PW2A 5D5MB 1VADA 1SBBA 3O3BB 2MQ0A 4L8BB 3OB0H 4XMKH 3P11L 3DNKA 5E8NB 4PJAB 2APVA 5CMAB 2R2EB 3OKMA 5TF1L 1K3ZA 5HDQH 1UWGH 1FAKT 1EJOL 1E28B 1MF2L 3GMLB 1DP0A 2NZ9D 2P7TB 4B41A 1RZ8B 2YEZA 3IFPB 5DQ9B 5GGTL 5GRJL 1ZTXL 3EFDH 2WWKO 4GAGH 5L2JB 3NABH 1DFBH 1G7PB 5EOCH 4ZNCD 5AD0B 5MP6L 4LVNB 2CR6A 3VFGH 3MCKA 1N2RA 4C83B 1OARH 5C0AB 2V2TB 1U42A 2HJKA 2B0SH 2EKSB 2J8HA 3E8UH 2ARJQ 1ZWIA 2BMKB 4JHZA 2XICA 5DJAA 4M4RA 2Y72A 1I9EA 3WBDA 5JMOC 2MOVA 1FV1B 3HN3A 2BOBB 1N5AB 5KVEH 4HFUL 3ZTNL 1S9WB 4I0PA 4LDLB 4YIQA 1CGTA 1KNOA 4C57C 5D93C 2NY6C 2X7LA 5HD8C 1AIFB 3HNVH 4MAYC 3KPOA 4ODWB 2BJML 1FLRL 1FL6B 2EDOA 2E6PA 1XIWA 5F6HI 1RSFA 4HJ0D 4D0BA 4YDIH 3IFNL 4JQIL 4AMKL 4OFVA 2PUQT 4KXZH 3PWVB 5IM7A 3LD8C 3MPCA 4U7KA 4KQ3L 4QYOA 5DHYA 1CGSH 3KHOA 2BK8A 5EBMA 3SKJH 3VD3A 3RNQB 1DUYB 3DMMC 1NGWB 2GTZB 4LCUA 4PBWD 3RJDA 3WD5L 3BH9A 1QQDB 1HSAA 5DJ8A 1JGLL 3O9WA 1RZKL 1P7HL 3FMGH 4PRHE 1HOCB 3TBWB 4QRPE 2CIIA 5DJ2B 4MJ5B 3KR3L 5DC4B 5J6HA 3U0PA 4N90D 2L0DA 5DDHB 1FPTH 3P0VH 1S78C 4ZUWA 3FN3A 1J1XH 2OR8A 4OKVB 2R1XA 2EO1A 4JN2A 3FO2A 5DJYB 4YXLH 1G7JB 2AI0H 4JG1L 2G5BA 5EB9A 5KS9B 3S7GA 1CXLA 2DAVA 3MV7D 4G8GB 3BHBB 4XPBH 4JY6A 1RUAH 3X3GH 3HNSL 2CK0H 4HG4J 3HZKB 4XC1H 3MUGB 1S5IH 1WBXA 1KTRL 1HN1A 2PW1A 1F02I 2B4CL 1T89A 1E27A 2AGJH 3MO1A 4LCIL 5I1AA 1CXKA 4YDLB 4NO0B 4GRLD 2IF7A 2DQJH 3LS5H 2CD0A 4OAWA 1VACB 4RISH 4TSAL 4G9FE 3SCMB 1EX0A 3QDAA 3NCBB 4PJBB 1XGPB 3C08L 4UQ2B 2F53B 4HIHA 1ZXQA 2E7HA 4EI5D 4PJCB 2GT9A 4P9HC 2YPVL 3RVXC 3I3DA 3T65B 3GSVB 3UJTL 2DDQL 4UDTA 3C5SA 5EBLA 4GG6B 1V7NH 2BXYA 1A7PL 4JRWA 3ILPA 1JPGB 2BCKA 5LQBH 5DMGD 1RJYB 2AKRA 4X8XA 5D1ZB 1Q72H 1XGQA 4WI6A 3V0AC 3S88H 4XXDB 5C0AD 2RQ8A 3HMXA 4HKXB 5FKAA 4QXWA 1YYMH 2VLLA 1L6ZA 4LLWA 3TBSA 1NGYA 4NOBA 5IFAL 3OV6A 3QPXH 3E3QE 3PWJB 3HAEG 3TPUA 4LL9A 1ADQA 1A21A 3SDAC 4G3YL 1U8JB 5JLZB 5IF0B 1ZGLA 2FJHA 4E42B 1FO0H 4XCCH 1EMTL 1FCGA 2UZIH 1INEH 3NBNA 4NKOB 2I5YH 3DSFL 5DEFB 5BXFA 3SKMB 4NDMA 3B83A 5LGKA 4LLQB 1F4YH 1RFDL 4L29A 4NN6B 5HTSA 3MQIA 2YUXA 5SV3A 1QEWA 3CSGA 4GKSB 4ZTPH 1CE1L 2VKWA 4PGBA 2DLIA 2XRAL 4GMSL 2BHZA 1R5WB 4H5SA 2YWYA 3MLPA 4E0RB 3BRDA 2XKUA 3MV7A 3I2CL 1FYHB 3WL9B 5JDSB 5CJOL 1QFWI 4HLJA 5L0QC 3ROOB 35C8L 4ZUSB 3OB8A 3EDDA 1FSKC 2YD5A 4TNWF 4OCRH 5DQJB 3CK0H 4EUPA 4KRPC 2MNUA 5GGUA 4GRLA 4EOWL 3SE3A 5EULV 1IAOB 1CGVA 1T1WB 3INUH 3U82B 1NEZG 4M9OA 2DS4A 3WFDH 1U8IB 1ZANH 4EI5A 2NZIA 1H8NA 4JFZH 4UT9L 4Y4FC 5D5MA 4KU1A 3O3BA 4L8BA 4LIQH 3CPLB 5C9KA 5E8NA 3MLWL 4PJAA 1TZHB 4JY5L 4N0CC 5CMAA 2R2EA 1XCTA 1CT8B 4GT7A 1MHCB 2XZAH 2A1WH 4G8GD 4ZQKB 1CFSB 4QRUB 4U7SA 1E28A 1N6QH 1P5UA 5J57B 3GMLA 4YR6B 2P7TA 3LKQB 3MRQB 3IFPA 5DQ9A 1UM5H 3VXNB 3T4AB 5L2JA 5CUSL 2EDRA 4H20H 1G7PA 1IC4H 4NO0D 2YMXL 5FA3B 5AD0A 3S98A 4C83A 2V2TA 5C0AA 3V6OE 1QA9B 5D6DC 2DB8A 3LPFA 1G6VK 2FL5B 2EKSA 3SCMD 3M8OL 3Q1SL 1PQZB 2BMKA 2F53D 4GRWH 4HBQA 3QNYB 5DC9B 2VQTA 4PP1C 1FV1A 2BOBA 5FOBB 1N5AA 5C6WH 5HGBB 1AJ7H 1IGFL 1L7IL 4Q9RH 2A83B 5IMOB 1S9WA 3MLRL 3WS6C 3NCMA 2XKNB 1X5JA 2I26N 3BPNC 1HH9B 2YZ8A 5FYLH 4OJFL 1TJGH 3FFCE 4YBHA 4C54A 2KDGA 4PD4K 1UJTA 1AIFA 3CH8A 5TJWK 1RUPH 1C1EL 1LK3H 2VUYA 4ODWA 5JA9A 5D1ZD 3B9DA 1JYNA 1FL6A 3MOAH 5CSZB 3H7LA 2EDNA 1KOAA 4OQTH 3PWVA 2EKJA 4D9LH 4PB0H 4AQOA 1E4WL 5FHBL 1YJDL 3LN9A 1MFAL 4LHJB 4HXBL 4UTAL 1F4XH 5ADPL 4NHUB 3RNQA 1DUYA 1MCFA 1NGWA 2GTZA 4OGXH 3RJQB 5HYQB 1QQDA 3HI6H 1A9BB 3ULVH 2A6JB 1HOCA 1Y6NR 1JZ5A 3TBWA 5ELIA 1QVOB 1RZ7H 2IQ9H 1MFDL 1PY9A 5DJ2A 4MJ5A 1FE8H 4CKVX 2VZUA 4LCWB 3K2UL 2Y25A 1RUQL 5EOCJ 5DDHA 3SDCC 4J6RH 2CKBH 3VFUB 2UVEA 3NGBB 5BZWB 1OAZL 4OKVA 4HK3J 2N1KA 4KHXL 3WNKA 2YHGA 3VXTB 4KKNA 3S36X 1ONQB 3PXHA 5DJYA 1G7JA 4M43H 3MX0A 5KS9A 4GRWB 1JF5A 2EYSB 5MEQB 4I13B 4K3EL 3G9AB 4G8GA 3UO1L 2Z35B 3GDBA 1J1OH 3HZKA 3TYGL 3MUGA 1I1AC 3DYOA 4FABL 1U2HA 3GMQB 4HK3N 1I1YB 3QRFM 1AHWB 4NO0A 2NXZC 3AREB 1DDHB 1P4IL 3TVMC 4H8WL 2L7JA 4X6DF 2YD8A 1VACA 4UV4L 2VB5A 4W4OC 5E2WL 5ALBH 1FNLA 3V7AG 3SCMA 3DUSB 3KLDA 3SE9L 4PJBA 1XGPA 3UTTE 4UQ2A 3WIIH 2F53A 4B50A 1WTGT 3QQ9D 4PJCA 1ZLSL 3JVGC 3G6JB 3T65A 4H1LH 3GSVA 2Q8AH 2F19L 1HHKB 2NX5D 3L3IB 2R9HD 4GG6A 3RHWK 3IRZA 2XTJB 4TUJB 2AJ3B 5CIPB 5JTWA 3G6AB 4A2LA 5C0DB 3NCYS 3VXOB 1JPGA 2Z8RA 2DQEL 4KMQA 1DBJH 2GY7B 5C86A 1RJYA 1X6LA 5D1ZA 3T1FB 3TJEH 4JDTH 2R4SL 5FUOH 3S5LG 1WUNT 1C5CH 4XXDA 3MRCB 4HKXA 2CKBB 3GI8L 1NCAH 3AVEA 3LB6C 3MLSL 3QR2A 5KVFH 3UC0L 5BV7L 3PWJA 2HG5B 3GSWA 3K4AA 1A6TB 1RZJH 3N9GL 4MHHI 1U8JA 4U7MA 5JLZA 3ECBB 4WGVB 5IF0A 3D3VE 4E42A 2BNRE 1CDJA 2CO7B 3KLAB 4PRIB 3SN6N 2JIXD 3L3HB 4U1NB 4NKOA 3LOWA 5DEFA 3SKMA 2ZNWA 2BY3A 2BVEA 4LLQA 1H3WM 1EGJH 2X4SB 1TZGL 1KN4L 1MFCL 4PJ7F 3QEQE 4GKSA 1U9KA 2WAHA 5TQ0H 3W39B 2HRPL 4OBRA 1R5WA 2GK2A 1YEIH 4E0RA 3JWOC 1N0XL 1LEGB 4H1LB 2OXGA 4HQQL 5JDSA 3WL9A 3ROOA 4ZUSA 4CMHC 3OAZH 3JV4B 5DQJA 5HYSG 1WIOA 3UJJH 3ULUF 3JWNC 2SEBB 3QIUC 1F97A 3FKUS 1IAOA 2EECA 1L7TL 1U6AL 4LCWD 5GXBB 2VDPL 5EWIL 2W0FB 1X5XA 5M95B 3TV3L 3BN3B 1T1WA 4K55A 1AQDB 3RPIB 3NH7L 1BBDL 1U8IA 4L8SC 2NY3C 2NMSA 5DMIL 4PS4H 3K3QA 4RA0C 3VFWB 2XZQH 1D5IH 3CPLA 1QBLH 5GGSB 5GIRB 4P5KA 1TZHA 4XWOD 5CGYC 3RWHB 3KYAA 3RTQB 4LSDA 5D7SL 5HI4D 1CT8A 4CVXB 2AXGB 2OBGA 1MHCA 3EJYD 1DBBL 4K7PX 4ZQKA 1CFSA 2H2SD 4QRUA 1MEXH 3U7WH 4JN1H 2PYEE 4YR6A 3LKQA 1G9NH 3MRQA 4UAOC 4X7SL 4J3XA 3QQNA 1JGUH 5JOPE 3VXNA 3T4AA 4O9HH 5C0JB 5FA3A 3QQ4B 5FUZL 3Q5OA 4Z95L 3T8XB 3ARED 1QA9A 4OSUL 1I9RH 3LRSB 1GC1H 2FL5A 2IH3B 2H45A 2EH7L 1INDL 1PQZA 2N7AA 1X5ZA 3QNYA 2IEPA 3IDIB 4PJFF 1F5WA 5FOBA 2FNBA 2OR9L 1B0RB 2A83A 3U9PL 5IMOA 4AEEA 1CE6B 2XKNA 2Y1VA 1HH9A 4Z0XB 3IU4H 2AK1H 1I75A 4NQVB 4XPAL 4R3SB 5JHLH 1T7WA 4NRXB 1C7TA 4A6YH 2DI9A 1N4XL 1TFHA 5CEYB 4LASL 1VKXA 5CSZA 4JFDB 2DQCL 5F7EH 2OXHA 4LNVA 1GH7A 3LKNB 3VXSE 4LARH 4M5YH 1EO8L 2FB4H 4WEMB 1WISA 2Q7NA 5B39G 4BSJA 1FDLH 4NC1C 3MRJB 3TH3T 3LQAH 2PCPB 4RIRB 4NHUA 4I3SL 1HH6B 3M45A 4LSSL 1OHQA 3F8UB 4ZSOB 5C2BH 1ZEAH 5HYQA 3OAYK 2E8YA 4NO3B 1A9BA 4M1DH 1MCRA 3RVWC 1YEHH 2B2XH 2A6JA 4WHDA 4LKXB 2HJLB 1C08B 1U8QB 1UZ6F 4P4RB 1QVOA 1F42A 2PYFB 2FX8L 4PLJC 5B8CB 1HZHL 4X6DE 5B38B 2O26U 1KELH 4X9BA 4LCWA 1FNSL 15C8H 2PN5A 3K1DA 2P5WE 3MXVH 1RUMH 1WJ3A 4J1UB 2IMNA 5J11B 4FTVB 4NGHH 5GJSH 3VFUA 1CGWA 1ACYL 2BXZA 5EN2B 5BZWA 2Y36L 4PLOB 3FQXB 4J23A 4ISVB 2XTLA 3VXTA 1ONQA 2JK5B 4KDTA 1CBVL 1IGML 5C1MB 2EYSA 1UB6B 5MEQA 4GW5B 2AV7B 4XPGH 2KKQA 4OD1H 2Q7YB 3IYLW 1D6VL 1OSPL 2GJ6E 3V6FB 4FFWC 2Z35A 2NY0B 2W0LA 2EIBA 4R2GC 3TBVB 4HPOH 3UP1A 2XG5A 3GMQA 4QHNB 3ARBB 1I1YA 4IRZH 1SHMA 2E9BA 1AHWA 2X1XR 1RK1B 3IDUA 2AERT 3AREA 1DDHA 1GAFH 4JFFE 1MNUL 5HI3C 2ZSVB 4OGYL 3WKML 1ADQL 1MRFL 4A6YB 5EU7E 3DSNA 3O4LB 3DUSA 3U30B 4DGIH 3T04D 3SQOH 3C60B 2QQKL 4OQTA 3MLXL 3O81A 1I9IH 4OV5B 5DYOB 1T2JA 4M62L 3G6JA 4L4VE 2FGWH 3UYPA 3GI9H 2P5EE 4D94A 5GGSY 1HHKA 4KI5D 3RTQD 2AP2A 3I50H 2WMPA 2VDLL 1D5ZB 3D2UA 4TUJA 5CIPA 2AJ3A 4I4WB 3U7AA 3G6AA 5C0DA 3SQBA 1E6JL 3VXOA 1HINL 1JHLH 3HR5B 5EPMB 2JJVA 4BUGA 5DD3L 1KTLB 3T1FA 1EHNA 1I9JH 4OCXL 4K71B 4Q9QH 3BQUC 3KPLB 4KJPD 4PJ7E 1A8JH 3EOTH 1RD6A 4OCSL 1AE6L 1SJHB 3MRCA 4L3AA 4JFHD 3S6CA 2VXTL 1BVKB 5ERWB 3NPSB 4BQ9A 2CKBA 1ZA6B 5CBEB 3ZE1F 5IVXF 5JHDD 2EH8L 3FFDA 3NN8B 3GKWL 3WE6B 5T5NG 2HG5A 1A6TA 3DXAB 1NANH 3ECBA 4Y2DD 3ULUE 4GKNB 2XQBL 4PBXA 3KLAA 4PRIA 2YA0A 4BSVB 3L3HA 4U1NA 2UWEF 1A3LH 1DLHB 4MNGB 1MCWW 3IRPX 3T3PF 2BSTB 4Z7WB 4CDGC 2X4SA 3THMH 4BH7B 4KHTL 4KGJA 4L1HA 4F7TB 4XP1L 1E4JA 1H3PL 3W39A 4UBDC 2J12B 1NGPL 3BMVA 4RGNE 5E6YA 3MJ9L 5I1HH 5HYIA 1G7QB 3N1FC 1LEGA 2YD6A 4H1LA 4LBEB 2D9CA 3K74B 5J9PB 4XP4L 5GHWH 3JV4A 4MQXC 2AXHA 1F58L 1A1NB 3VG9C 5D9SB 2SEBA 5T1LB 3QJFB 2A0LC 3MODL 4IHOB 4DOHB 4G8EB 1T21B 2W0FA 1CQKA 3D69A 4DZ8B 1MY7A 3RPIA 3U36A 1AQDA 2AJVH 3CLEH 1V3LA 4FTVD 4PJ8C 1KUMA 5JXEC 4KZEH 1FC2D 3H9YA 1JK8B 3EOBB 1JRHI 4PJFE 3J8F7 5JUEH 2QQQA 3VFWA 2PF6A 3MNZB 3RKDD 4QXGH 5FHAH 5GGSA 4Y5YB 5GIRA 1PYWB 4FZEH 3RWHA 3RTQA 3DJ9A 2EC8A 2XXMB 4CVXA 2AXGA 4KK9C 1RU9L 2CDFB 3JV0A 1SEBB 4NHCH 4RMTA 1WBYB 2DIJA 3Q2CA 3EUUA 3VGAB 4G5ZH 4EIZC 3QI9C 3ARBD 1P4BH 5CSGA 5C0JA 1RIVL 3QQ4A 3TT3L 4NYLB 3T8XA 1MCOH 3GO1L 3C6LC 4UV7H 4XBEH 2FBJL 4NWUH 3UTPD 4U3XA 2J6EA 3LRSA 1NCBH 2ZUVA 3PWUB 4X98B 1KB5H 3O4LD 3OXSB 2IH3A 2OQJB 4NN7B 4WGWB 3MRIB 4KKAD 4B0MM 5CBAB 4RWHA 4NQTA 3PWNB 4X4ME 4IM8A 3BRGC 3U7YH 3IDIA 1F6AB 3HS0B 1AXTH 3RI5F 1B0RA 4LGPB 2R69H 4QXUL 3UTQB 3RU8H 4QOKE 1OAUL 3R06B 1UZ6E 2PTVA 1CE6A 4PJIF 3IF1B 2YOCA 5T1KB 4Z0XA 2FSEB 3R0MA 4NZJA 2AV1B 1KTKE 4NQVA 3ELAT 1PG7H 5JZ7D 4R3SA 3TNMB 2XT1B 2Y06L 4WHCA 4NRXA 3MA9H 2EIDA 1JJUA 1Q9KB 3GB7B 2ITDB 3BDYH 5CEYA 4JFDA 5GZOD 3DURB 1GGCL 4NM8L 1P84K 5I15L 2BDNL 3LKNA 3C5ZD 1TVBB 5EIIB 5F70A 3U1SL 4LSPH 3MRJA 2PCPA 4RIRA 1HH6A 4ZSOA 3ESVF 4RWYH 4JGMA 4NO3A 4HAGA 4RX4D 1HXYB 3IDNB 3DXAD 4KRNA 3WJJC 3EYVB 2VC2L 4LKXA 2HJLA 1C08A 1U8QA 2PYFA 5L2KB 5J8OA 4HWZB 1G6RH 5B8CA 3OF6D 1WIUA 5B38A 1NLDL 3TESA 4YNYB 1D7FA 4P4KC 4J1UA 5JDJA 1IILE 3CDFA 1OPGL 3FRPA 2RCSL 3V5KB 4FTVA 2PXYC 1FORH 2EYRB 1XF2B 1D6EB 2HVJB 5EN2A 2V7HB 3FQXA 3LPGA 4RGMB 1K85A 1KB5B 3BE1L 4ISVA 2YK1H 2A38A 2JK5A 1LO0L 1HIMH 5C6TL 1QTYT 1AO7B 4KTDL 4Y4KB 2OK0H 1YC7A 2B1AL 3B2VH 1UB6A 4GW5A 2AV7A 1NCCL 2CLRB 2Q7YA 3OAUL 4LHUG 3V6FA 3QA3B 1FVEB 1K5NB 3ARPA 3TBVA 2ZJSL 4NQCB 3GK8L 4UINH 1J8HB 2PETA 3UDWC 4QHNA 4OD3H 3ARBA 5T1DL 5EU4B 1QLEH 2QADD 3AC0A 3QUYC 1NC2B 2QKIB 1CFTB 1RK1A 4AZ8A 5T1LD 1KACB 2ZSVA 2X44D 4JO2H 1K4DB 3E2HC 4A6YA 1CWVA 3ZE1E 5HDBF 5IVXE 4TVPE 3O4LA 4LMQI 4UB0H 2HWZH 5IBUG 1QSVA 3C60A 1JWUB 2IC2A 4OV5A 1YEGH 5DYOA 2ESVB 3HE6B 3ZSSA 4HLZH 1N64H 2C1PB 3AM8C 3IB4A 5EO1B 4P2QB 4P49A 5BS0E 2ZPKH 1U95B 3MRKB 5A1AA 2C3XA 4HGKC 1D5ZA 2BERA 4I4WA 2UWEE 4KXZI 1OW0A 3GSRB 4XCYB 3HR5A 5EPMA 1KTLA 5DA0B 3T3PE 1G6RB 3KPLA 2O5XH 5FYKD 3FT4B 1XF1A 1SJHA 2OJZL 1BVKA 2JELH 5ERWA 3C8KB 5F1OB 5CBEA 2FLBT 4NJ9H 3NN8A 3KJ4B 3WE6A 4O02L 3TH2T 1DVFB 3MGOB 2XACC 3X11B 4HUVB 5IESH 4RX4A 4KK8C 3V0VB 3VD7A 4GKNA 4L8DB 3KPQB 2QQLL 5T1KD 1E4XH 3OF6A 4BSVA 4I2XE 3QUXC 5IP4A 3L5XL 2OX5A 1DLHA 4MNGA 3B3IB 5DJZB 4H8WC 1FAIH 5IGXL 1ZOXA 1D9KB 1E6OH 2BSTA 4Z7WA 4BH7A 4YWGL 1F8TH 3IDYB 4F7TA 4R26L 4BZ1L 4S1QL 1DN0B 2NLJB 2AVGA 1UH2A 4JREB 2DMBA 3QDMB 1WCQA 4LPYA 3OKOB 5IB1B 4JFYB 3WXVH 1TJHH 1VFOA 2XNAB 3O6ML 2WIMA 4FZ8H 5CJ8A 4YHNB 4TNVK 1G7QA 1CXHA 3GIVB 4QRQB 4GKOA 4LBEA 1N3NB 4F7MB 5FO8B 2N4IA 3DECA 4YHYB 5J9PA 1SYSB 1ES0B 3P0GB 3OL2A 4ODBD 5A2KH 5FDYA 1YNLL 4PV8B 4I3RL 1A1NA 3U0TB 5D9SA 5L2KD 5T1LA 3QJFA 4JO3L 1T20B 3MFFB 4IHOA 4NKDB 1U8HB 4G8EA 1WLHA 1T21A 1JPSL 4DZ8A 5AG9A 4U6XB 3RVTD 5E9DB 1E4KC 5CJXA 2DTMH 5LVEA 1CDBA 5AAWA 2XWJB 1JK8A 5FCSH 3EOBA 1CQYA 2ZNXA 3RX5A 1RZFL 5AWNL 2D7NA 5FIEA 1KCUL 4TRPL 5GRUH 5FFLA 3MNZA 3H42H 2CRIA 5BV7C 4Y5YA 4DEPC 1PYWA 4Y4KD 4PJIE 2ZUQC 1VSCA 3L7EB 1WZ1H 2CDFA 5IIEB 1SVZA 4JM2B 1SEBA 3I02B 3QXWA 1U93B 3CXHK 1WBYA 1J8HD 2QHLA 2LU3A 3HZVB 3HTLX 1R3IH 3CCHB 1X6NA 3RIFF 4NYLA 4LFHD 5INDB 3PJSB 2EDTA 3GSNB 4LVHC 1CS6A 3PWUA 4X98A 3OXSA 2OQJA 4N5ED 1K8IB 5C07E 3MRIA 3F5WB 1KV3A 3O2WH 5CBAA 3PWNA 2AJUH 1MLCB 3G6DH 2ESVD 5H2BB 4NQSB 3HE6D 2LAAA 3L3GB 1F6AA 2WW8A 2NY4B 3HS0A 4UIMB 3B9KB 1Y6KR 5KAQF 3UTQA 3E1F1 5EZJB 4KWUA 3AS0A 4P2QD 3R06A 3S36L 5ALCH 3WIHL 3IF1A 4BSWB 5T1KA 2FSEA 3HZMB 3WXWH 5D4QA 5CHNB 4PIRF 4XI5D 5FYJH 1TQCC 3EOAA 4CGTA 2AJSL 3TNMA 3R0NA 4PFEA 5A3IC 1DQMH 4PGZA 4Q2ZB 3O6KH 2DWEB 4JHAH 1JE6A 1Q9KA 3GB7A 2ITDA 4TSCH 4IDLA 1T4KB 1F3RB 4AEFA 3DURA 4XBGB 2AEWA 1TVBA 5CCKL 4GBXB 5EIIA 1IM3B 2I27N 3SGEH 3BD5A 5FYJU 5EO9B 5DQDH 1BECA 2DBJA 3QCVL 2OR7A 2OZ4H 1DVFD 4UOW1 5DXWA 1R3LB 1HXYA 3IDNA 3MLZL 4WV1B 4JDZB 5DD0H 3N85H 1QBMH 1NMBL 1QFWL 1FRGH 4HJJL 5L2KA 4YFLI 1JP5A 4HWZA 2F5AH 3NCYP 2DM3A 2CRZA 2V2XB 2A2QT 4YNYA 5DGRA 4ZAKD 5HDBE 3LSOB 5DK0B 3A6BL 3V5KA 4Z6AT 2RAMA 4KC3B 3D39E 3GMRB 4LP5A 1XF2A 1B2WL 2EYRA 1D9KD 1D6EA 3BW9B 2HVJA 1FNGB 2V7HA 1KB5A 3EFFB 3QDMD 3HR6A 4O5LH 1DTUA 4LSQL 1AO7A 4Y4KA 3KPMB 2CLRA 3FAXA 1KJ2H 1GL4B 4X7TB 4DFIA 5FGCE 3QA3A 1FVEA 2NQCA 1K5NA 2JJSA 2V2WB 4LHUB 4ELMF 1JMZA 4NQCA 1KBGL 1YYLH 5EZOH 1J8HA 1RV6X 3UMTA 3WV0A 5EU4A 1NC2A 1RJLB 2QKIA 1CFTA 2HH0L 5E24E 5HJ3B 3O8XD 1K4DA 1TZIB 2XG4A 3MOBH 3Q5YA 4BFGA 5I1LA 4M6MH 1XGRB 5E9DD 3VXPA 2EDXA 2JJWA 1JFQH 1JWUA 4UILL 3TZVB 2NZ9C 5IBUB 3MV9B 5C7XH 4PLKD 2ESVA 2KQMA 3HE6A 2P49B 3HRPA 4S0TD 3I9GH 4PRHB 4HS3B 2AQ1A 1TVHB 2C1PA 2V17H 4LDEB 3FQTB 4QRPB 5EO1A 4WJ5B 3KYMB 4P2QA 2YBRB 4M4PA 1U95A 3MRKA 4P3WA 4CRPA 3OKLB 2HT3C 4H26B 5I1EH 4UUJB 4YDKH 2IGFL 1TIUA 4JM2D 1KJMB 2NY1B 3GSRA 4MAYB 4XCYA 4JKPH 4F7PB 1CG9B 3SY0B 1NAMH 3V2AR 1G6RA 2QEJA 1NDGB 3EYSL 3FT4A 2AS5M 5LBSL 1W0YT 1IGJB 3VRJB 1YEJH 2O5YL 4FFVD 4LSVL 1RJZB 4P9HH 2FX9L 3C8KA 2JCCB 1U8OB 3FCTB 1QOKA 4EDWH 4OB5L 5AYUL 1DVFA 3DGGB 3MGOA 4TTGA 4G6JH 3X11A 4HUVA 2NY4D 3B9KD 4HJ0C 4ZOCA 2ICWB 4FFYH 3V0VA 3MV8E 1U8NB 4X6CE 2GJJA 4L8DA 1I4FB 3KPQA 3MACH 2UUDH 3RY4A 5I1JH 32C2B 3QDHA 1JNNL 3WSQL 4G9FB 4M7JL 2DLGA 4P3DB 3SOBH 2VKXA 3B3IA 2HFFB 5DJZA 1X5GA 1D9KA 2OP4H 1DN0A 2NLJA 1EAPB 1FZMB 4DGVL 1H15B 3QDMA 3OKOA 5IB1A 4OLXL 4JFYA 2XNAA 4GBXD 2DQUL 4PTUB 5JQ6L 4YHNA 4XVJH 3ZT7A 1OQXA 5KSVB 5CINH 4LPUA 1OQOA 4K07A 1V7ML 3GIVA 4QRQA 1N3NA 4F7MA 4WFEE 1DEDA 5BVPL 4ONOA 1URLA 2COQA 2J6EL 2MMXA 1SYSA 1ES0A 2IG2L 5SX4H 1JBJA 4PV8A 4NM4L 3U0TA 1Z3GL 3VMNA 4YPJA 1U3YA 3I6KB 1DEEB 4X99B 4RMVA 1T20A 3MFFA 4NKDA 1U8HA 3KPPB 1NAMB 1HCFX 4U6XA 4X7CC 1NAKH 5E9DA 4MXWH 1CL7H 2XIDA 5E56A 2XWJA 2F54E 2DBLH 3DWTA 3P0YL 4IOFD 4AIZB 4M7LT 4NQUA 1QACA 1B6DA 3T1WA 4GRLC 5CGMA 1ZVYA 5DUPH 5E4EB 3SE3C 3H3PH 1JNLH 3DVIA 3L5WA 1M7IB 1F2XK 3L7EA 4ZODA 2WQRA 5IIEA 4LHUD 4JM2A 5E5RB 3I02A 3DOSA 1U93A 1KEGL 4KJYB 4NJAL 4O4YL 4EI5C 2Q3ZA 3HZVA 1A3RL 2DWDB 1AFVL 4UMGA 3CCHA 1N7MH 3MBEB 5INDA 3W81A 3PJSA 3GSNA 1VEOA 4BELD 5GISH 2QJDA 3VGHA 3U48A 3SDYL 2D7TH 1K8IA 4DVRH 1WWAX 4LU5H 3F5WA 4ONGH 3TZVD 5CEZE 4XAWH 5DMGC 1Q1JL 1MLCA 3RNKB 3SDAB 5H2BA 4NQSA 1L9MA 3L3GA 5I8KL 4L4TD 4MA7L 4UIMA 5DLML 3B9KA 4PRHD 4LVNC 4YDJB 5BO1H 4DAGH 5EZJA 4QRPD 3QG7H 1G0XA 4TQEL 4BSWA 1MHEB 4LEOB 1CLOH 3HZMA 1FBIH 5CHNA 2ICES 2NY1D 4FNLL 4RFOL 1QD0A 4F9PA 3FTGB 4ZDHB 5J7CC 5E2TL 3F7VB 4ZOBA 1TJIH 5F9JB 1NCWH 1IAII 4Q2ZA 1EEUA 4GO6B 5DRWA 2DWEA 5TF0A 2O93L 1X5KA 1QKZL 2FJGB 1T4KA 4KMLB 1ZVHA 4XBGA 1JPTH 1Y6MR 4H0HB 5L7XH 4GBXA 4AG4H 4NNPH 5HYJE 1IM3A 1YC8A 5H37H 2IBGA 5EO9A 2YRZA 3K1KC 4FQ2L 4R4ND 5DT1L 3GGWB 1R3LA 3AY4A 5T3XE 1BQUA 5EZIL 5EG6C 4I77L 4WV1A 4JDZA 4R6UA 1VPOH 2R4RH 3UZEA 1A1OB 5L88L 1NGXB 1HKLH 3D18B 3LN4B 2V2XA 4G9FD 1V05A 3LSOA 1JHKH 5BRZE 4OLUL 5DK0A 4CN4A 1OD9A 5SWSB 1UA6L 3GMRA 5F1IB 2J1KA 3BW9A 2ERJB 3S37X 1FNGA 2VOTA 1MREH 4LGSB 1NCDH 2QSCL 3EFFA 1OOAA 2VAAB 3EYUH 4NZRL 4ZPTB 4M7KL 2YKLH 3KPMA 3DO3A 2WUCL 2W9LA 4X7TA 2V2WA 3OAYH 4HCRH 4LHUA 4FQCL 4JGJA 3V52H 2BSRB 5M94B 3IDXL 5B3JF 4NQEE 1KJ3H 1RJLA 1DLFL 2F8VA 2YN3A 2CGRH 4PRAB 3STLB 2IANB 1DN2A 1G7IB 3DUUB 4MNQE 4U1SB 5HJ3A 5ECJE 2R29L 3DROB 1TZIA 4KY1L 2K3TA 1XGRA 3EO1B 4YX2L 1EBPA 3FN0L 1FNEB 3TZVA 3NA4A 2YUWA 1WFNA 3MV9A 2VWEC 3LV3B 4OLWL 4YDLC 4PRHA 2DJUA 4HS3A 1TVHA 1HHJB 3FQTA 2DKUA 3LS4H 4QRPA 2E3VA 4WJ5A 3KYMA 5GGQL 2AXJA 2YBRA 5F44A 1KIPB 1U3JA 3DHMA 3HUJB 3OKLA 2R2BB 4H26A 3SCMC 4UUJA 3ARVA 2HLFD 1KJMA 4MAYA 1J7VR 4CU6A 4FMFA 3G08B 4F7PA 1NFDF 3SY0A 3EJZD 5HHME 2IPTL 3I85A 4PD4J 4JB9H 4BFIA 4NO5B 3PNWB 4JKMA 3BKMH 3MBED 1NDGA 5C0RH 3O3DB 1A22B 1MCDA 2RHEA 1IGJA 3NOIA 3VRJA 5F1KC 1RJZA 5SWZB 2CXKA 2JCCA 1IEHA 3AMKA 5C8JB 1YQVL 1TENA 1U8OA 3FCTA 3UCRA 3NCFB 3S3PA 2BC4B 1JIBA 2AJYH 3DGGA 2FEEI 5D1ZC 2DQTL 1TCRB 5MHSE 2FDBP 2ICWJ 3PDDA 2H6PB 5I0ZA 2ICWA 1U8NA 1I4FA 1DQTA 1OLLA 2AJXL 4UNVA 2XQYG 32C2A 3DYMA 1CK0L 4G9FA 4YBLC 4WHYG 3SDCB 4P3DA 1FIGL 2G2RB 3F12B 4MZ2A 3LMJL 4PJ5E 4S0SD 4L9LB 1VERA 2HFFA 1PZUB 3NCCB 2P46B 2YA2A 4LRIA 5K9KB 4WUUE 4BJLA 1LP9F 1OTTD 5I1IL 4HBCH 1JGVL 1J5OH 2WIIB 1EAPA 2HFEB 1FZMA 1H15A 4G42B 3GEWB 4PTUA 3FB8B 5KSVA 1AQKH 3QNZB 3N06B 3RGHA 2MKWA 3CFJB 5JA8B 5FM5M 3ZKXC 2DQDH 1Q9WB 2XV6B 3ZYIA 2ZZUT 3LN5B 4EXKA 3BAEH 1CICB 1GOGA 4LEXL 3TVMB 3I6KA 1DEEA 4X99A 3F6LA 3KPPA 1NAMA 4V2CB 4OFPA 3ZKQD 3S9DB 4LSRL 1MQKH 5D1QB 3W2DL 3AB0B 3GJEB 3JWOH 3W11D 2GSIB 4YAQB 1QSZA 5I16B 4AIZA 5T5FL 2X9YA 3D3VB 2ZUSA 2BNRB 4K8RL 3MRDB 1E0OB 3G5ZB 1XMWA 1DBAL 1M7IA 3FFCD 4M5ZH 3QG6B 3QH3B 1B4JL 4O58H 1I7UB 2LABA 3BYYA 4OFYD 4QKXB 2D03L 4FQXB 4KJYA 5IHBA 1WAAF 4PGCB 4U1GB 1Q38A 3QQ9C 4IBLT 2DWDA 3QEQB 2CO6B 4GSDL 3MBEA 4Z77B 4DN4L 2E6JA 2HKHL 1YEEH 5DHVH 4JVPA 2QSVA 4L3EE 3ME0A 2R9HC 4DQOL 2B1HH 4QY8B 3VRLF 4M9PA 3NCJL 3DVGB 1UT9A 3N1PC 3WO3B 4HWNA 3MLUH 5K9OB 3BISA 3VXRE 1MJJB 3RNKA 3SDAA 2X42A 2W9DH 1T1XB 1OY3B 4ODTL 4NUGL 1UM6H 2Q86B 4YDJA 1WEJL 3OZ9H 4FQQB 3BPLB 4MS8D 2B20A 1MHEA 1FFQA 2AK4B 5CD5D 4UT6H 4LEOA 1MAML 3M07A 1ZHNB 3V4UL 3RIAF 4BUHA 4XCFL 3QULB 1BQHG 3FTGA 1PG7W 4ZDHA 4Z9KB 3F7VA 5F9JA 1M1SA 2WLZA 3J7HA 4KJWD 2FJGA 1P7QB 1FGNH 2VDRL 5DZNA 4XXCA 1F11B 3TT1H 3QBTB 1KIUA 1QP1A 1IQWL 3DX9B 4R8WH 2PYEB 4EN3B 1KCLA 4LLDB 3GGWA 5IJVB 5B3JE 3HNTH 5F7FA 4CAGA 2ADFH 4BZYA 1A1OA 2LAGB 1NGXA 5DD1H 1W72L 1QHOA 3D18A 2ZCLL 3LN4A 1MCEA 2VXVL 5TPWH 2IFFH 3UTTD 3O0RL 1NUNB 5SWSA 4J4PD 5DHVB 2NY3B 1VFAB 1BJ1J 2BVTA 3MRGB 5F1IA 1DQLH 3EO9L 2A6KB 3V7MA 3DV6B 3B9VA 2VAAA 2A9NL 4XBPB 4ZPTA 5TF1H 3VD5A 4S1DD 1JRHL 2F8OA 1MF2H 5EIVA 2XA8L 4K3DL 4OFYA 4JFEB 1KYOK 5GRJH 1NFDE 4ESKA 2BSRA 2QQNL 3C2AL 4NNYB 3I75B 3EBAA 4OD2B 3WLBB 3NGBC 4OM1L 5MP6H 1CLZL 3I3EA 1UM4L 3ILQD 2DQHH 1CICD 4KK6D 4KDTC 3X17A 2X1OA 3VXSB 4XWOC 1CD1B 4PRAA 3STLA 2IANA 1G7IA 3DUUA 3VE0B 4U1SA 5I1CL 5HI4C 3TWCL 4QT5B 3EJYC 1BLNB 1MRCL 1F13A 1I1RA 2H2SC 5D1QD 5HYFA 3EO1A 2DIBA 3T0EE 3WDJA 1FNEA 4YDVB 5DGQA 4OF5A 5JORB 3LV3A 4HFUH 3ZTNH 1QFOA 1AHWC 1ZT7B 3D3VD 4XB7A 1CDYA 2BNRD 3AREC 2VDNL 1HHJA 4KROB 3OGCB 1KIPA 4X6DB 3HUJA 4M61B 1MVFA 2X4QB 2R2BA 2P5WB 4OFIA 1FVCB 4MAUH 4FQXD 2BJMH 3G08A 1FLRH 3JUYA 5HY9B 4NO5A 3QEQD 3PNWA 3IFNH 4JQIH 4AMKH 1GPOL 3MSPA 5E6ZA 1LP9E 3S8WA 5AZEH 3O3DA 4FQHB 4KQ3H 1CD0A 5SWZA 4UDUB 2XTJC 1OAYL 1VEPA 1H3TA 5C8JA 1QPXA 2H1PL 3ULVC 1LO3L 3WD5H 4HZLB 5DD5L 3QNXB 4I48B 2BC4A 5E0QA 1JGLH 1TCRA 3HKFA 1RZKH 2IH1B 2H6PA 2VXSL 3MRBB 5IT2L 1TETL 4JFFB 3KR3H 1HYSD 4RRPA 1T7ZA 4WW2F 4HUNB 3SDCA 1QPPA 4CJ1A 3IKKA 3F12A 2G2RA 4OUOA 4L9LA 1UKQA 4J4PA 2KPNA 1G9MC 1SMAA 4Y8DC 1I7ZB 4L4VB 5E2VL 5K9KA 1EVUA 4MD5B 3HMWH 2VXUH 5EC1B 1P7QD 2P5EB 2WIIA 1CGYA 2HFEA 1KEML 1OF2B 4G42A 4OGAD 3GSXB 5D7IB 2RBLA 5ID1B 5IEKB 1UGNA 3FB8A 3JWDL 3HNSH 3QNZA 1FH5L 4TPRL 4U6HB 2PYED 4EN3D 3CFJA 4OFKA 4HX1B 1WAAE 4WDIB 4GAGL 5JOPD 1Q9WA 3NABL 5EOCL 3LN5A 4PJ7B 1W8NA 2X40A 1CICA 5KTEL 3TVMA 4Y16D 5H8DA 2PKDA 4C56E 5FAAA 4TSAH 3VRLE 2EDLA 4MJ4A 1KC5H 2ZUWA 3C08H 2X10A 1QZ1A 2ED9A 5D1QA 3PHOB 1MI5E 3IETB 2YPVH 3GJEA 2GSIA 4YAQA 3LKRB 5KVEL 5I16A 3UJTH 3D3VA 4Q9CA 2BNRA 4W6YB 3MRDA 4QEGA 4CU7A 5CZXD 1J05B 4ONFH 2MSPA 4HF5L 4BQCA 2D7MA 2RR3A 3QG6A 3QH3A 2ZUXA 1I7UA 3U4AA 4FQXA 1LNUB 4DCQA 3QEQA 2XFXA 4YFDB 4Z77A 4IDJH 4H0GA 3VXSD 3MGAA 5J13B 4KI5C 3RTQC 1LDPL 4QY8A 5HDLA 4RGNB 3SKJL 3HC3L 3KPNB 4U4BA 5DEZA 1WWWX 5IFAH 3DVGA 4NFDA 5DO2D 1OP3K 5L8LB 3DRQB 1ZKAA 4XH2B 2RFXB 5K9OA 4RAUB 4G3YH 1MJJA 1X3DA 1T1XA 2G60H 1DBML 3FMGL 2Q86A 4KJPC 1C5DB 4Y1AE 2DD8L 1OP9A 4KROD 3VH8G 1ZK9A 1EMTH 4FQQA 4L4JA 1WFOA 4HXAL 3DSFH 2AK4A 4HMEA 3P0VL 1ZHNA 5DJXB 3QULA 5E5MB 2PNDA 1BQHB 1A14H 5C0CE 3D0VB 1AI1L 5BW7A 1BFTA 3T0VA 4ONHB 1CE1H 1P7QA 4YXLL 4ACPA 4Y2DC 2XRAH 4GMSH 3SJVA 1F11A 2EC9T 2GJ6D 1QSEE 3I2CH 1KPUB 5CJOH 3RBSA 1A47A 1CIDA 2BNQE 2CDGB 4Q9BA 35C8H 3DX9A 2PYEA 4EN3A 2OJEB 4LLDA 5GZND 3P9LB 5IJVA 5JW4R 2DQJL 4EOWH 3PF2A 3RQ3A 4JFFD 4F57H 1BX2B 3M1BB 3TFKD 4RISL 2CMRL 3QFDB 4Q58C 3CLFL 2HFTA 2YRPA 4MWFB 1KGCE 1IEBB 2BSSB 3JV5A 3P9WB 3P4OB 1L0QA 5IVZB 4PJ8B 5DK3A 1X4YA 4IRJB 3T2OA 4UT9H 4M1GH 5DHVA 2ZOKB 1MOEA 1VFAA 3N1GC 5JXAL 4L4VD 3MRGA 3V6BR 5IHZB 3DI2B 2ENSA 1VFMA 4PY7B 4C4KO 2A6KA 2P5ED 4QOKB 3QIBB 3MLWH 5IQ9B 1BEYL 4JY5H 2DL9A 2W0PA 3DV6A 1EEZB 4XBPA 4BK4A 1MVUB 1V7NL 2WINB 5B8CC 1XFPA 4NKIL 3ZSTA 5J11C 4JFEA 4HWEL 4NNYA 3I75A 5CUSH 4OD2A 3WLBA 1AC6A 3S88L 4QGYA 4H88L 4G6KL 4JFPB 3RKDC 1MCKA 3VXSA 5A40E 4KVNH 5ACZB 1CD1A 1NGQH 3VE0A 4JQVA 1OTSD 3M8OH 4QT5A 3Q1SH 1BLNA 3X13B 1FN4B 3K0WA 4YDVA 3WKNA 1GYAA 3ARBC 2IAMB 3ZLQC 5T3ZH 5JORA 1IGFH 3MJGX 1ZT7A 3KAAA 3MLRH 3ULUD 5LGHL 3ZE0F 4CN6A 1ZV5A 5E4IA 2HJFB 1FO0L 3FQNB 3OGCA 4X6DA 1INEL 5E8DH 4M61A 2X4QA 3RWEB 2D2OA 2P5WA 3U30C 1FVCA 1C1EH 3QFJE 3C60C 5DEGB 4KKAC 3RWFB 5HY9A 1OD7A 4JRYB 1I8LA 3LQAC 2FD6L 3VMOA 4FQHA 1E4WH 1MFAH 4RGND 4HXBH 4UDUA 4UTAH 3VGBA 5ADPH 3O6LL 3TBYA 1P84J 1OW0C 5TDOB 4U2ZA 4HZLA 4GFTB 4UI2A 1YPZF 3QNXA 4I48A 1U3ZA 5J06A 5JZ7C 4BA8A 1NUGA 5KW9H 2EXWD 4OCRL 2HMID 5IG7B 2IH1A 3MRBA 5GZOC 3SDDB 1MFDH 4JFFA 2C4FU 1MCCA 3OPZH 5CJQH 1PSKL 3C5ZC 3K2UH 3MRFB 3NPSC 5DRXB 1RUQH 5GGTA 5IVXB 1IMHC 4P4KB 4U05A 2W92A 3A6CL 1D5XB 1G84A 1ZANL 4JFZL 1OAZH 1PKQE 1A7BA 4KHXH 1I7ZA 4D2NA 2QSQA 4L4VA 2Y7QB 5EC1A 4MD5A 4X5WB 4X5XA 1IKFL 2P5EA 4L1DA 5FV1L 4PY8J 2BVUA 1A4JB 1HI6B 3RY6A 1OF2A 5BS0B 3RDTD 3GSXA 4K3EH 2XZAL 5D7IA 5IEKA 4I9WE 5ID1A 2VR5A 3FZUD 2X6MA 3UO1H 3O3UN 4U6HA 3TYGH 4FABH 4DKEL 1UM5L 4HX1A 4WDIA 3QWRA 4Q0XL 4KZDH 4PJ7A 1VB9A 4QLRA 1P4IH 2FHCA 1HQ4B 5FM5O 4H8WH 4POZD 4UV4H 4AL8L 5E2WH 4YQXL 2C3HA 2IFGA 3W9DB 1W2KT 5IUSA 3TC9A 4R90L 4AEIL 3SE9H 4WFHE 4IRJD 1EUUA 4LAQL 3PHOA 4NSKB 3IETA 1ZLSH 3CDCA 3GSUB 3NTCL 3MLVH 3LKRA 3VFNB 2F19H 3FB6B 4QOKD 3QIBD 2QADC 4OZIE 2ZG1A 3KVQA 1J05A 2VN7A 5BVJB 1MPAL 4GS7B 4I2XB 4MCYB 1JI2A 4TSBL 4HIEB 2FGZA 2DQEH 4JZNB 1RUPL 4YGAB 5C3TA 1SMOA 1LNUA 2R4SH 3WDHA 8FABB 2AJZB 2ED8A 2VZVA 4EQ2A 2WQ8A 4NIKB 4Y5YC 3GI8H 3NPZB 1NEUA 4P0DA 2Z8VC 1F4XL 4JJ5B 3MLSH 3KPNA 4ENED 3UC0H 3UPRB 4OGXL 5TE6L 5BV7H 3HLAB 3DRQA 5EUKB 1DL7L 4N5UA 2RFXA 2VLRE 3N9GH 4XH2A 3VGAC 2P44B 2IAMD 2XZCH 1PGRB 2R1WB 3S37L 1CD8A 4FQLL 4KI1A 1C5DA 3BP7B 1GOHA 1AGCB 5IW1A 3QHZL 4NN7C 1XF3B 4P2OB 5DJXA 1CI5A 2YPLB 3ZKSD 3BX7C 5E5MA 1TZGH 1BQHA 1KN4H 4R4BB 3VA6A 3D0VA 4EZMA 2HRPH 4WY7L 4M43L 4F37F 3IS1X 2GUOB 1DUZB 5DURB 1N0XH 5D2NE 2F58L 5D7KE 2P45B 3VDCA 4HQQH 1KPUA 2CDGA 5IBTL 2ZUUA 3O45B 4PGDB 3ZL4L 2OJEA 1P5VA 4XZUB 2MQCA 4YHMH 5GRWA 5H37G 3P9LA 1FFNB 4WHTB 4MB4A 4HS6B 5FCUL 1KB9K 3CU7A 1U3HD 3SDDD 5JPNB 4U6TA 1BX2A 3M1BA 1L7TH 1U6AH 2VDPH 5ALBL 3QFDA 3TV3H 1Z9MA 4MWFA 4TVPD 2Q76B 4U33A 5K93A 1IEBA 1FGVL 3NH7H 4TN9A 2BSSA 5C07B 3P4OA 4G8FB 5IVZA 4PJ8A 4IRJA 3GBNL 4X4MA 5DMIH 3KNBB 4YE4L 2ZOKA 5IHZA 1T1YA 2VE6B 4PY7A 4QOKA 3QIBA 3L6FB 1T0PB 2DICA 3ARGD 5IQ9A 3FT3B 5BS0D 1EEZA 5D7SH 3ZE0E 1MVUA 2X89D 2WINA 4Z7OF 1DBBH 4YHZH 1XZ0B 3VFSB 4M6AA 3RVTC 1DBJL 4JVWA 2X5PA 5EO0B 3X3FL 4X7SH 1S7WB 4HWBL 4UOW0 5FUOL 1C5CL 1RURL 3BD4A 4JDVB 3BD3A 3DTXB 5FUZH 4Z95H 5D72L 3LEXB 4RGMC 4JFPA 4M3JA 4OSUH 4ZFFB 5ACZA 4Y4KC 5F71A 2X09A 3K8LA 5ISZE 5J4MA 1NCAL 2EH7H 1INDH 5KVFL 1P4LB 4O51B 4F58L 5C08E 1VDGA 2Z31B 4OLYL 4LP4A 4P5MB 3X13A 4DTGL 1YPZE 4F9LA 12E8L 1FN4A 3WYRA 3K7UA 2OR9H 5TDNB 3VXQB 5L8JB 2IAMA 2OLDA 2J8UB 3U9PH 4D3CL 3HB3D 3RL2B 2DJ4A 1ACZA 2HJFA 3FQNA 5FO9B 1QFUL 5HVGB 5IMLB 3RWEA 3OGOE 4XPAH 4Z5RB 1QFWM 4N5EC 2Z93B 3CVIL 4X80L 5DEGA 3D39B 4RMQA 3RWFA 2J2ZA 3HE6C 4LASH 2MWCA 1LQSR 2DQCH 2P8MB 4JRYA 3GHBH 3T0XA 5I17B 5E8EB 3STBA 5I1KL 1AD0B 3BP6B 1IEAB 4N8CL 1T03L 3QJHB 1IAIL 3AXLB 4I3SH 5FGCB 1WC7A 4LSSH 4LK4A 4XI5C 5TDOA 2J3SA 4WWKB 2Q3AA 4BQBA 1OT2A 4OIAA 1OAQL 1T6WA 5IG7A 5L8KB 3SE8H 4JR9L 4GG6F 1F00I 3SDDA 3ZE2F 1HZHH 4KJQD 3X12B 3MRFA 5DRXA 1FNSH 5E7FA 3GFUA 5IVXA 2YC1B 3GBLA 4P4KA 3KJ4C 4JFQB 4MA8L 3QUZB 4P2OD 4UT7L 3WN5C 1DVFC 2IPKB 4PUBL 1ACYH 2CKNA 2IQAB 2Y7QA 2H9GB 4X5WA 1QBLL 3EIFA 4XPTL 5F7KC 2ADJB 43C9B 4Z76B 1CBVH 5D1XD 2A74B 1IGMH 3BKYL 1HI6A 1YN7B 5BS0A 5FECB 2AQ3A 2X89A 4NNXB 1D6VH 3KYNB 1U8LB 4ZAKC 1NFIB 3HMXH 3MBXL 2K7PA 4J12A 1H3VA 3HPJB 1D9KC 5I2IB 5HGAB 4F8QA 3IDYC 2FECI 3U4EB 2BNUB 4XNUL 4NWTH 1HQ4A 1MNUH 4JREC 1ADQH 1MRFH 5IW3A 1GC1L 3DVNB 3W9DA 5GS2D 5C07D 2QQKH 4RCAA 1MHPL 5TFSL 3KPTA 2AW2A 3MLXH 1T83A 3DGCR 4YHYC 4NSKA 3K46A 2HLAB 3GSUA 3EKCA 3CVHL 2VDML 4B7LA 3VFNA 3FB6A 3DX7B 3MV8B 1MY5A 4X6CB 2IJ0C 1NCTA 2V6HA 1K2DB 1HHIB 2VDLH 2AXFA 3O8XC 4UNUA 5BVJA 4I2XA 1FVDB 4MCYA 4LLAA 4PPTA 1KLFA 1E6JH 4HIEA 1HINH 3NIGF 4JZNA 5LJYH 5JHLL 1N59B 1ODAA 5DD3H 4GLRH 5E03A 5F89B 2VDOL 5GSVB 5CZVL 3MMEB 4OCXH 4XTRD 3D9AH 4PLKC 8FABA 5ESVB 2AJZA 3CAFA 1CZ8L 1EDQA 2ADIB 4OCSH 1UJ3C 1AE6H 2VXTH 2X4TB 1N5YL 4EUPH 4JJ5A 5C92A 2VZOA 3UPRA 3QCUL 4HUKB 1BZ7B 4JM2C 3HLAA 2Z31D 3UTOA 5EUKA 1ZVSB 5KVDH 3BZFB 3MR9B 1VENA 3JWDC 2R1WA 2W07A 4Z7UF 2XQBH 3BP7A 5TE7L 4FFVC 2FEEL 2VR9A 4X9FA 4QHKJ 1PAMA 5IFHL 2H3NB 1RUML 1XR9B 2VLME 1XF3A 3R1GL 3D0LB 4NGHL 4P2OA 5GJSL 2YPLA 4CW1B 4N8VB 2ENYA 5KN5B 4KHTH 4R4BA 5J89A 1HNGA 2NY4C