1I9JH

Testosterone complex structure of the recombinant monoclonal wild type anti-testosterone fab fragment
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
220
structure length
220
Chain Sequence
EVKLVESGGGLVKPGGSLKLSCAASGFTFSTYALSWVRQTADKRLEWVASIVSGGNTYYSGSVKGRFTISRDIARNILYLQMSSLRSEDTAMYYCAREYYGYVGLAYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords RECOMBINANT MONOCLONAL ANTI-TESTOSTERONE FAB FRAGMENT LIGHT
publication title Structural insights into steroid hormone binding: the crystal structure of a recombinant anti-testosterone Fab fragment in free and testosterone-bound forms.
pubmed doi rcsb
source organism Mus musculus
total genus 43
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2001-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1i9jH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1i9jH01
1C08A 4MNQD 5EULV 1S9XB 3QPQC 1QFUL 4U1MB 2ORBL 2QHLA 3MPCA 2FBOJ 4PRAA 5CSBA 5HHOA 2AV7B 4WFGD 5D1XB 4U1JA 1Z9MA 4XAWH 3FOMA 1HQRA 4PB9H 2EH7H 1F90L 2DTML 4HWBL 4QRRD 3T0EE 5IW6B 1J86A 2ZUYA 2V2TA 4J3VA 1QVOB 4WEUD 1ZVHA 1N6QH 3TA3C 3EOTL 5E24E 2C3XA 2ZP0T 5GRJH 3U9UB 2IPUK 4PRBB 2OTUB 1IILE 5ALBH 4BFEA 3V6FB 3NCFB 1JNLH 2XKNA 3DSNA 1XZ0B 3P40A 2KBGA 4ONGL 4I5BB 4J7RA 1MCFA 3WL9B 2EICA 2D7NA 4JFYA 1IC1A 5F6HI 5ESAB 3VXMD 4H88L 3MXVL 4G8GA 4PJAE 2W0PA 3FO0L 4KHXL 4LKXB 4MDJA 3V5HA 5D7LB 2GHWB 3DGGB 1CK0H 4PGDB 3P0VL 4NWUH 2EDEA 3GSRB 4WI6A 3PHOB 4PBWD 1L7IH 2P5EE 2EE2A 4PGJA 5DDHA 4JRXB 3NGBB 4JFQA 5KS9F 1CGTA 5CBEB 3VRLE 1NJ9B 4R7NA 1TMCB 4PR5B 1FL6A 3N1PC 4C56B 2PTVA 4Y5YA 4TUJA 2DQHL 3QHFH 1ND0A 3OKMB 3S35L 1T3FA 4LCWD 3T3MF 2UWEB 4P49A 1MFEL 1I1AB 2Z92B 1ZLWH 2Q8BH 2CGRH 3F58L 2VDLH 4ODXA 5EBGA 5HBBA 3ARBD 3O6FB 4OLWL 1FH5L 3SDDD 4G6JL 1A9EB 4KZDL 1K4DB 5IQ9A 3FTGA 3VGAB 1MWAB 1D6VL 1HCFX 4KKLC 5CEYB 1G7IB 1ZANH 3U82B 5M94B 3A6BH 5EB9A 4EOWH 4PJIF 4ZDHB 4QHLA 4H1LB 4HBCH 2Q20A 3OKLA 1YEGL 3GBML 5E08L 1F45A 3ZE2F 5E99H 4HKZB 1WIPA 1K8DB 1PG7X 4MB4A 5F7HA 3L3IA 5E8OB 2YK1H 4E41B 1LE9B 4WFFE 3LRGA 1V7MH 1EGJL 1D6EB 2DL9A 1MHCA 2WUBH 2V2WB 3EAKA 3ME0A 1CLOL 3KPTA 2ZPKH 2EDFA 1G7PB 4OCXH 1MFNA 1WFNA 4QRPB 3PNWA 4X6FA 1X4XA 3X13B 4LDEB 3PDDA 25C8L 3V0AC 3WFBL 3ILPA 1K8IB 2IQAA 5EUOF 3LOWA 4QNPF 5EZJB 1MREL 3L3DA 1JIBA 5GJSL 3ARGD 4YC2C 2O5YL 4GKOA 2ZWLT 4K94H 1JMXA 3MRPB 4Z95H 3VFMB 1T1ZB 4MQ7B 2W65A 2P8PB 5FA3B 2XYCA 1U92B 2AABH 4KTEL 5C9JA 3GKWL 3KJ6H 3I50L 4PJBE 3KPQB 5I8KL 2F54A 5D72H 3B3IB 1FNHA 2JB5H 2VDQL 1DEDA 1QSEE 5F97E 4GQPH 2YMXL 2VSDA 4HWNA 4GW5B 4MA1C 3MNZB 4AG4H 2H26B 3QCUL 2NY3C 2IFFL 1M7IB 3GKZA 4L5FL 5D7KE 3BEWA 4HIXH 1NC4D 2BNRD 3U48A 4X4YB 1NCBL 1FHGA 1CTNA 1QUNA 4JKPH 5H2BA 4JFXA 1LE5B 5F7YC 5I18H 1KLUA 2EIBA 2IAMB 4NZRL 2ZUUA 4R8WL 4L4VB 5ISZB 5EWIH 3MSPA 4Z6AT 3BGFB 4S10A 4DAGH 3T09A 5DHYA 5D1QC 1DQJB 4BM7A 2WLZA 4UT6H 4WUUA 3I9GL 1HXYA 3DTXA 3TH3T 2A9ML 4YXHH 4WCYL 2OP4L 4NNXA 5C07A 4F80A 1N2RA 5CMAB 1CXKA 4YAQB 2APBA 2VXTL 3AGVA 3NH7L 2MOVA 3CVIH 1BWMA 1G9ML 1T03H 1S5HB 3NOIA 4XWOC 4KY1L 5MHSE 5KVMC 1MHPH 4KRNA 1FZKA 3FFDA 1MFCL 1AC0A 4G8EA 5FYJL 3WJJA 4AEEA 1XT5A 2FEDD 2JJSA 2Y4SA 5F1IA 3P73A 3C60C 1IEBB 5CIPA 5AWNL 1NC2B 1RJLB 4XAKE 5J9PB 3KYMA 2BRRL 4JDVB 7CGTA 3V6ZA 4I0PA 2FX8L 2HT3C 2DQIL 4U1IA 2UUDK 3EYQC 1PBYA 3BPLB 3QFJB 3ARWA 1A21A 5HYJA 1IGJB 3GMQA 5IIEB 4KK5D 2VZ3A 4WUUE 5BXFA 5J3HD 4LSSL 3T08A 1CBVL 2QSVA 2LTQC 5IMLA 5DJYA 3MA7A 2FO1A 1KC5L 3B9VA 5KSAB 5BZWB 3HFMH 3JSSA 1K3ZA 4GAGL 3HMXH 4KI5F 1M71B 3QDJE 43CAA 1RUPH 3WDJA 3WUWG 2QLVB 4Y19A 4ORGB 2EH7L 1AY1L 1SJXA 4TQEH 3SE4A 2D0FA 1FNSH 1N6QL 2IQ9L 3T3ME 1L9NA 5GRJL 4Y1AD 3SDXF 4ZS7H 4HFWB 3ROOB 5ALBL 2EDQA 4M7ZC 4TVPH 3RVUD 3P11H 1JNLL 3C2AH 4LGSB 3LB6D 5J4MA 3ESUF 4WV1A 1MQKH 4J2XA 5LAXA 4N0UA 4LHUB 2AERT 5LQBH 1M7DA 4FN0A 3GK8H 3MV01 5HYJE 3EGSA 3ZYZA 4POZD 5CD5C 4P46C 1CK0L 4F3FA 1KBGH 1UXSB 1E28B 3ZE2E 1BZ7A 4NWUL 5DZOA 3RJQB 1CGYA 4EIGB 2EZ0C 3QFDB 1L7IL 2EIZB 3RY4A 4PBVC 1GAFH 3QEQB 1FN4B 2C1PA 2MCG1 5IHZB 3BPCB 1IC7H 3BMVA 5HI4D 3EYFA 4Y19E 3QHZH 4MNGB 4TSBH 2EE9A 4C57C 1NGWB 2V9QA 4V1DA 3LPWA 3QHFL 1NFDF 2C9AA 1YQ2A 4W70A 4WFHD 3WD5H 5L8KB 3PP3H 2GK0B 4R26H 5KW9H 3GSVA 1NBVH 5FM4A 2EC8A 4WO4A 2YSSB 2OJZH 5T5FL 2Q8BL 1FIGH 2PF6A 2YC1B 1HSAB 2CDEB 3WFZA 2F53D 1A6PA 5I73B 1G0YR 3Q2CA 1J8KA 2PNDA 2ED8A 5I8CA 2XA8H 1MCDA 4MVBC 4DOHE 4IMLB 4OZHB 2VC2H 2ICCA 3TO4D 1DSFH 3LEYH 4EOWL 4OM0H 2NY5L 1UVQB 1PX4A 3NPSC 4HBCL 5EFIA 4XPAH 4ZXBC 5JW4R 4P9HC 3BN3B 4LVOC 1MRCL 5C0FA 3IKCB 2B1HH 1XH3A 5T3ZE 3KXFA 3H2WA 3GIZH 5J11B 3DUSB 4PJEA 4M62H 2DQEL 1V7ML 2R0LH 1YN7B 1YMHB 4JY6A 2WUBL 4LVEA 1CGVA 4MJIE 4HPOH 2H6PA 2QSQA 2ZPKL 1IVLA 1UJ3B 2VWEE 4YHYB 4OCXL 4LMQE 3BKMH 4L8CB 4M93B 1U8JA 3VXSB 4XPFH 5DGRA 4DKFH 1LVEA 5GIRA 1JTPA 5F8QC 1ORQA 5AD0B 3AREA 3EYUH 3U7WL 4L29B 4WW1A 3B6SB 1DVFD 2A74B 5I9QC 2SEBB 4N0YH 4K94L 4EXKA 5F88A 5FDWB 1NCWL 4EQ3A 1OWRM 1CGUA 2B1AH 4Z95L 3U0TB 4PJDE 1BX2B 1JJUA 1RI8A 2ATKA 4I3RH 4PTUB 1Q1JH 2ZSVA 3DECA 3HR5A 3UPCA 3PF2A 2AABL 4K7FA 3ZE0E 3KJ6L 4ZAKA 3R0MA 5GS0D 5D72L 3QDAA 2JB5L 1T0NB 4PJEE 4MXQD 1H3UA 2R39A 3TNMB 2LV4A 1JNHA 5AYUH 4JZJB 5EORL 4KKBD 5FGRA 4QRRB 3HAEG 1OAQH 2VLKE 5E2JA 3MGTA 3VRJA 4RFOL 4HIXL 3QXVA 1WK0A 3QA3A 4HUWA 1CQYA 4K3EH 4JKPL 4PYHA 1NDMB 2WZPD 4CN1A 1GZPA 1YQVL 2NXYD 2PXYA 4G9FA 3RL1B 5EU5B 4DAGL 1CXIA 4MAYD 2CUHA 3RU8H 4UT6L 4UUJA 1MCOL 5ACZA 2J5LC 4KI5E 2DLHA 4DN4H 3CIQA 5IMKA 4JPIA 5SX4I 3B9KB 3AAZA 1B2WL 1P2CA 3OR7A 1A7PH 3CVIL 1FJ1A 1T03L 5HPMA 3M17B 3O8XA 5CP3A 5E95B 5I76A 4X9IA 4ZMAT 4KJYB 1MHPL 5KVFH 2Z31B 2FYYA 3X3FH 3SDXE 1ZT4A 4PJHF 1A1OB 5DJZA 3I85A 4JGUA 3GI9L 2JE8A 3S5LA 3TBSB 3N1FC 2E6PA 1KJVA 3PHSA 1EEZA 2FZ3A 5EZLA 3T0WA 3QEUB 1H8SA 3BP5A 4M02A 2AI0H 3CH1A 5C08D 3ARPA 4G9FE 5TQ0L 1VACA 4LAJH 4MD0B 4YFDB 3V0VB 2BVTA 4Q7DA 3ARVA 4C58B 2OR7A 1VCAA 1LO0H 2G2RA 4IRJC 4KDTA 3OXRA 4CVXB 5E4IA 4Y4KC 3BEVA 1T0MB 4X80H 1F3DH 3C8KB 1EHAA 3HFML 1U42A 3BPOC 3D85A 4XC3H 4PREA 1WITA 5D5MB 3HMXL 1CDCA 5GRYA 4EUPA 4UBDC 3QUKA 1CFQB 4QXTA 1RUPL 2D4FA 5DUBB 1IM9A 3QDMB 2VIRB 4AEIH 2W59A 5ICZA 1H5BA 4D9RD 2J6EA 1FNSL 4CNIB 1PYWB 2DM2A 2XWTA 2PYEA 3DO3A 1G9EA 4ZS7L 5IROC 4TVPL 3OKOB 3P11L 1LK2B 2V7HA 3C2AL 4I18A 1FO0A 1MAKA 1WCQA 1P7QA 1FZOB 2Z93B 5HI3C 1BBJB 5KANG 4GRWB 1RK0A 3REVA 4Z5RB 2FBJL 3MLUH 3L1OH 3FQWB 5DK3A 2YHGA 2VR5A 3IS0X 4GLRH 5I1EH 3VD9A 2LE9A 1BQHA 1KBGL 4L8BB 4J3OC 3ZTJG 1NUNB 2OTWB 1T22B 4P5TA 3T1FA 4J1UA 2ZCKH 1UB5A 3TO2A 3PWVA 4MZ2A 4CADA 5AG8A 1N4XH 1IC7L 3KJ4B 3LQZA 3QHZL 4TSBL 1KXQE 4J8RA 1WZ1H 2DS4A 3TP4A 2K1MA 1FNEB 3WD5L 5DRNA 1LNUB 4R26L 2DQFA 2KL6A 3LPGA 5KW9L 2EC9U 3QIUA 4RGNC 4C55A 4OKVB 1HHIB 4PJXF 4I0KA 5DT1H 5F9OH 3OTTA 1HHJB 3STZA 3ZMRA 2OJZL 5IB4B 1FIGL 2FSEB 4CL7A 1ZA3B 4I4WB 1UWXH 3U7YH 4YK4B 1NFIA 2BNRB 4MYWB 3VGHA 4AH2B 2XA8L 3ZYJA 4ZSOB 3D48R 2A2QT 4W81A 3MFFA 2VZTA 2GJ6B 1FPTH 2FWOA 2VC2L 1DSFL 4KK8D 4OM0L 1GJIA 2BSED 1VFUA 2NXZD 1NLDL 3GMOB 4NQEE 2APVA 5L0QC 4MLSA 2IPKB 4XPAL 4C4KO 3WJLC 4LSUH 3RX8A 2VMFA 1TETH 2B1HL 3TIDB 2EDOA 3FB6B 3MRFB 3GIZL 2NY2D 1UM6H 2IC2A 4HZAA 5HJ3B 4WJ5B 2COQA 2VZSA 4M62L 3ZDZF 3NTCH 2DKMA 3CFIC 3G08A 3PWJA 3FT2B 4GJTB 4HPOL 4M1DH 1TCRB 5FOBA 1T5XB 3RTQA 1QR1A 4MA8H 2EYTA 2GSIA 3QNYA 4XPFL 3VXQA 4OT1H 4LSVH 3RUGB 2FJHA 1SEBB 2BC4B 2EXYD 5E1AA 1P4LA 3NA9H 4L3ED 4X6EB 1MHHB 4JN1H 3EYUL 2ZG2A 4C83B 5C3LD 5IB5B 4NDMB 3G6AB 2VB5A 4XP1L 4N0YL 1HHGB 2OR9H 3TT3H 1XFPA 5CLTA 1AGCB 2B1AL 3OB0K 4KGLA 4LK4A 4I3RL 1Q1JL 2DQJH 3UTTB 4KVCH 3DUUB 3VFUA 5IB2B 1TNMA 3OWEA 3GB7B 3EOAB 4N5ED 2NY4C 2P5WA 3EFFB 1WC7A 1KIRB 1S7SB 2KZ1B 3MROB 4BYHA 4AENA 3JV6B 2HMID 1ORSB 4P2OA 4YX2H 3ZKQD 1JHLH 1ONQA 2W9EH 4WI5A 3EUUA 5AYUL 1AQDB 1QO3A 4P9HL 3SY0B 4KVNH 1BAFH 3WFHA 4MLIA 1HH6B 4EN3D 5IMOA 1OAQL 2VZ1A 3WDIA 2FGWH 5E9DA 4K3EL 3FT4B 4QTIH 2V6HA 4HFUH 1AGFA 3MV9D 3R06A 5I15H 4L3CB 4ODVL 3F7YB 3WHXA 2Z35A 1ZS8A 3U0WL 4Y5XA 3BX7C 4L4JA 2ARJA 1SHMA 2HLAB 4RAUA 4KJPC 2WBJB 3TNNB 4A6YA 1XF5B 3O2VH 4BK5A 2MQCA 3NAAH 4X6CF 1TENA 4ZUUA 1ZT1A 5EO9A 5EU6D 4DN4L 4PJ5A 2HJFB 2ZCLL 1A7PL 1S9XA 2AXFB 4QXGH 4U1MA 5CZXC 5FUOL 2P5WE 4RWYH 5DK2A 1S7UB 3ULUE 2BVOB 4JY4B 2AV7A 3M45A 4WDIB 5D1XA 4WU5B 5KVFL 3IYLW 4BZ1L 3X3FL 4GUPB 5E00B 1ZLUK 2DDQH 4JVPA 1HWGB 1KF9B 4BH8B 1R0AH 5IW6A 1KTDB 3WHE1 3LN9A 3VRIB 1CL7H 1QVOA 3QO0B 4S2SB 4WVRA 4YWGH 1WFTA 2UVEA 4HWUA 3U9UA 1GL4B 3DXAD 2AI0L 4PRBA 2OTUA 4ERSL 2A73B 3V6FA 3V4VL 1G84A 1XZ0A 3QSKB 5C92A 3VE0B 4PIRF 3JV5A 2F53B 4I5BA 3ULVC 4F7TB 1KN4H 3RWFB 3WL9A 1JL8A 3DNKA 5ESAA 1U3JA 3BPNB 3EO9H 4KTDH 5HD8C 3DI3B 1IZKA 3O6MH 3TVMD 4LKXA 4XC3L 3CU1A 1WBYB 4NRZB 5D7LA 3DGGA 4LEXL 4PGDA 1ZLVH 4N9GB 1Z0MA 3GSRA 3W82A 4JDZB 5J6HB 2DIBA 3PHOA 3WJJC 4YXLL 2JJSC 3HZVB 2YPVH 1CGSH 1CFNB 4OFKA 2VXQH 4JRXA 4I48B 5L2KB 5CBEA 1NJ9A 2UZIH 4PR5A 5DMGC 4C56A 1MRFH 2J8UB 2A83B 5HHVL 1LGVA 1SJVA 5DZNA 4UILH 4C4KT 2E6JA 3OKMA 1G7JB 4X0KB 3MV7B 2UWEA 1AC6A 5FUCE 5FAAA 1I1AA 2Z92A 3LDBC 2APTA 1DJSA 3MJGX 4M48H 5I16B 1MIEH 1TQBC 3KPSD 4XMKH 3MLUL 3WFCL 3L1OL 5HYEA 2FLRT 3O6FA 3N1QC 1A9EA 5I1EL 1K4DA 3SE9H 2UVFA 5MENB 1MWAA 3VH8G 4CN6A 5CEYA 1G7IA 4PJ8B 4CUCA 3UDWA 4ZDHA 5C0CD 5B8CB 5F7UA 4H1LA 1CQKA 1DLHB 4FNLH 2MFNA 3RZCD 3JWOC 1J18A 2GEEA 4FQQB 5IBTH 1N4XL 3WUWB 3ZDZE 4O2EB 1CFBA 1OAKH 3RPKA 4HKZA 1V3JA 1K8DA 4CJ0A 1V3MA 3E3QC 1WZ1L 5E8OA 1NCCH 1J0ZA 2NY0B 4E41A 1QLEH 1LE9A 1L0XA 3LKQB 1BP3B 1D6EA 2R4RL 2YEZA 2XY2A 4CMHB 1VERA 2V2WA 4G7YL 1UWXK 5DT1L 5F9OL 3G04B 2UWEE 4U1NB 1G7PA 3U7YL 4PJ9B 4QRPA 3QUZB 3X13A 1DBBL 1QYGH 3LKOB 5DURB 3KVQA 4NQCD 4Z7NE 1K8IA 1FPTL 2G5BA 4N0FB 1AJ7H 5EBMB 5EZJA 4MAYB 2QQNH 1U8IB 3E2HC 4OI7A 3LMJH 3UTSB 5CGYD 1YEDB 3MRPA 1N0XH 4UT7H 4LSUL 2D7TH 2HKHH 1H8OA 3VFMA 1TETL 1T1ZA 4MQ7A 5ACLA 2WP3T 5ITBL 2P8PA 2I25N 5FA3A 3Q0HA 1U92A 1UM6L 1ZT7B 5MP6H 2XXMB 1R3JB 2HFTA 2JCCB 3IFNH 3KPQA 3NTCL 5FYLD 5C09D 4E41E 5FFLA 3B3IA 2F5AH 2PR4H 4NO2B 3BIBX 4RX4D 3BGMB 4GW5A 4X4MA 3MNZA 2H26A 3QUYD 4QEGA 1M7IA 4MA8L 4NC1C 3D9AH 4OT1L 3GBNH 3GI8H 4LSVL 1OQXA 1B0RB 4RFNB 4X4YA 2FEDC 3NA9L 4U49A 1LE5A 4AIOA 4J4PC 2IAMA 3S34H 3P77B 3P9LB 4L4VA 4X6CE 5ISZA 3WS3B 1ED3B 1DANU 1YC8A 4GRLC 4RDQG 1DQJA 3H9YA 4YDIH 1P4IH 3TT3L 1F42A 5EO1B 4JEGB 4NN7C 3GHEH 4LSQH 4KK5C 4KVCL 1FNFA 4KWUA 5CMAA 4YAQA 3FHAA 5K93A 1S5HA 1RULH 4YX2L 3MBXL 1JHLL 1H3WM 2W9EL 5T3ZH 4LCCC 1AHWB 5J7CC 3DV6B 4HUKB 1U3HB 1RUQL 5EPMB 1WLHA 3SGEI 5EN2B 3KS0H 4K7PX 2HVKB 2FGWL 5J1SC 1IEBA 4L9DA 4QTIL 3B5GA 4HFUL 1JF1B 1AI1H 1NC2A 1RJLA 2DI8A 1XMWA 2FIKB 5J9PA 5I15L 4OQTA 4JDVA 4MQTB 1F6AB 2HFEB 4JQIH 4MD5B 1URLA 3RVUC 5I8OH 3MRDB 3VGBA 1A4KB 3O2VL 5IJKA 4U6YB 3QFJA 3X11B 5B39G 3NAAL 3NIFE 1IGJA 3N0PB 5IIEA 4MD4B 3B9AA 3KPMB 1GGTA 1IAOA 3PDGA 4POZC 4NO0D 5AAWA 5KSAA 5BZWA 1MCBA 4QXGL 4OLXH 4Z7VE 4RWYL 3DV4B 1M71A 2CIIB 1QA9B 4I3GA 3U4EB 4JREB 4MWFB 5ALCL 1MFDH 2BHYA 2DDQL 4ORGA 3MBED 1R0AL 1J8HD 3HAEB 2PXYC 1CL7L 4XVTL 3O6LL 5HI4C 4HKJB 3LD8C 4JAMB 3FZUC 4MJ6B 5C0AD 1A0QH 1BQLH 5FGBA 3DRQB 4HFWA 3ROOA 1A6AB 5JXED 5DJ8B 1A1MB 4JRYD 1WTLA 1EDQA 4LHUA 3CUPB 3WNLA 1HI6B 4GG8B 1KN4L 2XTJD 3VFWB 3QFJE 3WFEH 4LFHD 4KTDL 5SX5K 1Y6MR 3O6ML 1HILB 3O8XC 1ZLVK 5DI8B 4G42B 3HUJE 4PRPD 1UXSA 1E28A 3RVXD 2NXZB 4U1LB 1DN0B 4RMUA 3TO4C 5DMYA 2XTLA 1IAMA 3QFDA 4WW2C 4GO6B 3DVNB 2EIZA 2R2EB 3MNWB 2A0LD 2YPVL 1FN4A 3QEQA 1R5WB 4LLVB 2YBRB 5D2LF 3ARQA 2VXQL 1LDPH 4W6YB 5IHZA 3BPCA 3QR2A 1EHLH 3WIHH 2UZIL 2EXWC 4ESKA 4MNGA 1MRFL 1NGWA 4ETYA 1FP5A 4NSKB 3U83A 4F9PA 1BM3H 1I7RB 4GMTH 1AXTH 3I75B 4RMWA 4X5LA 2GK0A 1U8HB 1OGAD 5F7LB 5C86A 2YSSA 3FHQA 5T1LD 4TNVF 4M48L 3MRHB 2YC1A 2CDEA 4K2UH 1MIEL 2APXA 4ONOA 1TITA 5DF0A 2AJVL 3T0DA 3GJEB 5E4EB 3ULVF 1X4YA 4IMLA 4OZHA 1UVQA 3LN5B 3LVEA 1FCCA 4FNLL 5H37H 2WIIB 4KKNA 4R2GB 3S97C 5IBTL 3HE7B 3N9GH 3IKCA 3QEQE 4KXZI 1OAKL 2VLRD 4KUCD 5CP3H 5EA0H 2IF7A 5B4MD 1NCCL 3H6JA 4MNGE 3O2DA 3DUSA 1UKSA 1QLEL 4OZIB 1YN7A 2QQKH 4W4OA 3S37L 1YMHA 4I3SH 1GOGA 3BAEL 3MRLB 3S36L 4KZEH 1DZBA 1IGCH 1UJ3A 4FG6D 5FYKU 3AS2A 4L8CA 3IXAB 4KKBC 3VXSA 1H3XA 2WWMD 1FFRA 2ZOLB 5DSCB 5AD0A 5D6CB 2DIAA 1PAMA 4JHWH 4P5TC 1AJ7L 1KNOB 3LPFA 4L29A 1NLBH 4DJMA 4OZHE 3B6SA 5E5RB 2A74A 2SEBA 4WWKB 1MCLA 1IT9H 1N0XL 4UT7L 5DEFB 5FDWA 2D7TL 2HKHL 2C26A 5DVMA 4P99A 5CJXC 3U0TA 4OFDA 4NJAH 1F8TH 1BX2A 4PTUA 1X5JA 5E8PB 3VDCA 2ZUTA 3E6HB 5MP6L 3O3AB 3RBGA 1FVDB 3FMGL 3QIUC 3LS4H 3IFNL 1EIBA 3SBWA 4UOW1 2F5AL 1UZ8B 1T0NA 3FO9B 3QG6B 4XGZB 2J6EH 2QTEA 3TNMA 3FN9A 1OAZH 4JZJA 2WQ8A 3H9SD 5JXAL 5HXMA 3LQAC 4AEHH 4QRRA 3D9AL 3GI8L 3WMSA 1EV2E 1FO0H 1LP9B 5I1JH 4GFTB 3DXAB 4G6KH 1NDMA 3S34L 3DX6B 1AD9B 1DUYB 5EU5A 3RL1A 4G80B 3MLYH 1I8MB 3Q3GB 4YDIL 1P4IL 2DQGH 2EYSB 4P4KC 4LSQL 4NKMB 4OIIH 3ARFB 3WSQL 3TVMB 2DJ4A 4ZOEA 3B9KA 4HPYH 4ONHB 5JHLL 4MNQE 5CEZD 4PUBH 5ICXB 3M17A 1RULL 2W92A 2IJ0C 4UAOB 5T3ZL 3QP3A 5ADOH 3RTQC 4KAQH 4TSCH 4KJYA 2VDRH 2Z31A 1NANI 4JFED 2N1KA 3GFUA 3HC4H 1A1OA 4UOJA 3TBSA 4QRRE 1AR1D 1AI1L 1OTUC 3QEUA 4DGVH 4G8FB 4JQIL 4ODHH 2XKUA 3KPOB 4MD0A 4AEFA 3V0VA 1FYTD 3WNKA 4GKSB 4EIZC 5K59F 4CVXA 3L3GB 3LH2L 1T0MA 4NZDA 3MMEB 3VXME 3C8KA 1S7WB 5D5MA 5AZ2H 4AK1A 3TH2T 1D5MB 5D2LE 5HYSG 4NQTA 4XCYB 3ARTA 2ARJQ 4F7EB 1CFQA 5C6TH 1IKNC 3QG7H 2ZUWA 5DUBA 3ARSA 3QDMA 3W81A 2VIRA 1MFDL 4RBPH 1T89A 1JK8B 2R23B 4Z18A 3ZSTA 1PYWA 4CNIA 2Y7QB 5GGSY 1UEYA 4URTB 5EZOH 4Y5XC 3T4AB 1A0QL 1BQLL 1CTOA 4WY7H 4BFIA 1JPSH 4M61B 3SKJH 2D03H 3OKOA 1LK2A 4R90H 4DEPB 5DWUH 3JWNC 4HIIB 3RGVD 3RKDC 3QIWD 4LCWE 5SWSD 3PL6B 1FZOA 2Z93A 3BZEB 3MRGB 1BBJA 4ZYKB 2YRZA 3GM8A 4Z5RA 3DRTB 5IMMB 2GTWB 1DL7H 2AVGA 3WFEL 1MCEA 3FQWA 3IT8D 3IJHB 4L8DB 1T2QH 3QQ9D 4JQXA 2GY7B 4L8BA 2BERA 1T7VA 4KK8C 5D5ME 2OTWA 1T22A 2C4FU 4L9LB 4U1HB 5C7XH 1QBML 1OAUH 3ZYOA 4UINH 1LDPL 4NJ9H 1EHLL 1EXUB 1WBXB 2I26N 3ULUH 1MH5B 3AMLA 2WWKT 4FZEH 2NY2C 2V5TA 3Q48A 4Y0GA 5JDSB 1BM3L 5BVJB 1AXTL 1FNEA 4GOSA 1LNUA 2NTFB 3QT2A 3ARXA 1IQWH 4OKVA 1HHIA 4E5XB 3L3JB 5T1KD 5EIVA 3H9HB 5IVXB 1A5FH 1UWEH 1HHJA 3PJSB 3RAJH 4MQSB 3CFJB 5IB4A 5CAYB 1ZA3A 4I4WA 4K2UL 3GNMH 2F58L 4H8WH 2BNRA 3GMMB 4FFWD 5GRZA 3CXHK 4OLUH 4AH2A 2AQ2A 4ZSOA 2GJ6A 4A6YH 1XF1A 1X5XA 3IJSB 3BYYA 5IR1A 4OFYD 3VMPA 3GMOA 2D2OA 2X4OB 2IPKA 1FQ9C 3ZSSA 3FN0L 1YY8B 4X7DC 5BV7H 3N9GL 2A77H 2XT1B 4GBXD 5BS0B 2D7OA 4OM1L 4WW2F 3TIDA 3FB6A 3MRFA 1JWMB 4YDJB 1GZQB 4NFBA 5B22A 4LRNL 5HJ3A 4ETQB 3AS3A 4WJ5A 5HVFB 5KJRH 1BD2D 1OP5K 2HMIC 4I3SL 2VL5B 3IAGC 3FT2A 1TCRA 4KZEL 2HTLD 4S1QH 2LABA 3SDAD 1IGCL 2D3VA 4KV5E 1T5XA 4EN3C 3I6LD 4PB0L 4POUB 4LCYB 3IDJB 3Q5TA 2CH8A 4WI4A 3RUGA 1SEBA 2BC4A 2BNRE 4P23D 1U8KB 3UDWC 1HSBB 4Q0XH 3F65A 2DKUA 1FLTX 3NCCB 4YBQC 4UU9B 5HY9B 4X6EA 1MHHA 4C83A 3VH8B 1NLBL 1U91B 2R69L 5IB5A 4NDMA 3G6AA 4XB8A 1IT9L 5J56B 1HHGA 2VAJA 4Z7WE 2VQTA 3NFNB 4QKXB 4MAUL 1AGCA 3QUXD 4NJAL 4I13B 3UTTA 4NO0B 3DUUA 5IB2A 4OKDA 3GB7A 3EOAA 4Y4FD 1D9KB 1BQUA 2V7NB 3BQUD 3EFFA 3LS4L 1KIRA 1S7SA 3MROA 3JV6A 5C0BD 1ORSA 4XXCA 1QEWB 5DFTA 2J6EL 1OAZL 1AQDA 3MRQB 2VITB 3SY0A 1RZGB 1HH6A 4AEHL 2YD1A 2Q7YB 3ARDD 3QI9B 1FO0L 3QXTA 3FT4A 15C8L 3RUGE 5I74B 4G6KL 1QSFD 5DJ6B 2XI9A 2X9YA 3K4DA 4L3CA 4RRPA 3SGJC 3F7YA 1X6LA 1T66D 2W07A 3MLYL 4HIHB 3GSWB 1KTKE 2HLAA 4ZS6D 3TNNA 2WBJA 3S3SA 2DQGL 1XF5A 3U1SH 5D9SB 4OIIL 2OLDA 2YUVA 4LVHB 5CJ5A 2ITDB 4D0CB 2HJFA 3ZKMD 5DMIL 3UTTE 2XOTA 2O5ZH 2AXFA 3PWPB 5D6DC 4DZBB 4TUKL 2W9LA 2Z8RA 5D93B 1S7UA 4RA0C 2OL3H 2BVOA 4KAQL 4JY4A 4FQHB 2DYPD 4GXUM 4TSCL 4WDIA 4U2YA 2VDRL 4WU5A 3RVTC 1BF2A 3UJIL 4GUPA 1GXEA 3QAZB 1RURH 5E00A 3HC4L 5JLZB 4BH8A 2ZUSA 1KTDA 2IAMC 2Y23A 1FL3B 3VRIA 3QO0A 4TTGA 4S2SA 1KB5B 2YRLA 3PWLB 2G75B 3RA7H 1NDGB 4Y1AE 1OQOA 3MV8B 1S7XB 5IBLC 4DGVL 3KLHD 4ODHL 2A73A 4Y2OA 4B50A 2ERJB 2OS7A 4LLAA 1XR9B 4JM2D 3TZVB 3OG4B 1FGNH 3LQAL 3VE0A 3SKOB 1J1PH 2F53A 1KENH 3CDGB 4F7TA 3RWFA 3OKNB 3HS0B 5LCVH 1X3DA 1PSKH 5FO9B 2GUOB 1B90A 1WBYA 4NRZA 4MS8D 5AZ2L 1SYVB 4N9GA 4JDZA 5J6HA 5C6TL 3D2UB 5GGTH 2A1WH 3QG7L 3HZVA 4PP2B 2RFXB 3RZCC 1CFNA 1K9TA 4I48A 5K9JH 5L2KA 3NCBB 4FFZH 4GMSH 1FNAA 4KMQA 4D3CH 2XA3A 2J8UA 5EZOL 2A83A 2QL1A 4WY7L 2EKJA 4D8PB 4M6OH 4X4ZA 1NBZB 1JPSL 5ENWB 2YOCA 3SKJL 1Z0NA 2D03L 3BPLC 4R90L 3WYRA 4WFHE 1G7JA 4X0KA 3MV7A 4FQXB 3VGDA 4Z0XB 3CDCA 2FR4B 1PZUB 3L5JA 4M6MH 2PETA 5KSAC 5B39B 5I16A 1DL7L 1P84J 2F53E 1MVUB 5IWLC 4Y2DD 3NCMA 4X9BA 4H25B 3O3DB 4D2NA 5MENA 4XNXH 2JB6B 2RCSH 3QB7C 4U33A 4PJ8A 4ISVB 5B8CA 3DLQR 2GIYA 1DLHA 5C7XL 5KTEH 5FHAH 1OAUL 1N64H 4UINL 5F6IB 4FQQA 1PG7H 3VG9C 3WUWA 1GGYA 4O2EA 3ULUL 4FZEL 4LCUB 1LQSR 3ZLQC 1TPXB 4YHLH 5JQ6H 2VN4A 4K55A 4EI5C 4NP4H 3LKQA 1WF5A 3LZFH 3B2UD 2H2PD 3C87A 1A5FL 1HYSC 1UWEL 3G04A 3MV7E 3RAJL 2IG2H 5GS1C 4U1NA 1RJZB 1JE6A 3GNML 4QXUH 4PJ9A 3MREB 5J13B 3QUZA 4OQTH 3G5XB 3H3PH 3F6LA 2VZUA 4OLUL 5TF1H 1XGRB 4JKKA 3QIBD 3LKOA 4FQ2H 4H0IA 2VR9A 4A6YL 4N0FA 5EBMA 3BKJH 2EEAA 1OPGL 4KMTH 1QPPA 1GPOH 1U8IA 1JPGB 4EEEA 1RMFH 1I9EA 3UTSA 1YEDA 2AJUH 3WXVH 5BV7L 3IFOB 3QH3B 3V4PH 2A77L 4LNVA 4YDVB 4LPYA 4F9PC 1SMAA 4QT5B 3RVVC 5I6XB 4NZTH 1ZT7A 2DJUA 5D7IF 4BKLB 2XN9D 5KJRL 1V05A 1R3JA 3OF6D 2JCCA 3OKEB 3PXJA 2I27N 1NMBH 5C0RH 3IFLH 2VLJB 4FXKB 5AUMB 3OJVC 4NO2A 4PS4H 4JG0H 3BGMA 1FCGA 4JFEB 2DQCH 5CCKH 5J12B 4K07A 4OLEA 2RB8A 1E6OH 3AB0C 1WT5A 5H35B 5D2NB 4O00A 1B0RA 4Q0XL 2NZ9D 3K81A 5DFWH 1YJDC 5AZEH 4G7VH 3P77A 4N8CH 3P9LA 2P8LB 2XQYK 3WS3A 4K3DH 2ESVB 4WI2A 1ED3A 4QY8B 1UQSB 3OPZH 5EO1A 2YD4A 1FFNB 3VD7A 1KPRB 5CILL 4NQXB 5J11C 5ID1B 5DUPH 2H2SD 4YHKL 4JN2B 4UT9H 3VG0H 3S9DB 3U30C 1QD0A 3HTLX 4PLJC 5T1MB 4HD9A 5EZIH 5SWZD 1UJ3C 1QFHA 3TT1H 4PV8B 1AHWA 1MSPA 2AEWA 3DV6A 4N90D 5D1ZD 4M93C 1JVKA 2E7LC 1U3HA 5EPMA 5EN2A 1F13A 3O4LD 5T5NF 2HVKA 3STBA 1LK3H 1KEMH 1YMMD 5KSVB 4U1KB 2YPKB 1JF1A 1MCQA 2FIKA 2XXCB 2X89D 4G6MH 1F6AA 5IV2B 5HYQB 2HFEA 5TFSH 1GC1H 4MD5A 5C08E 3RGVB 5KZCD 3MRDA 1I8IB 1A4KA 2HKFH 3U1SL 1P9MC 2R0WH 4U6YA 2PTUA 3X11A 3BHBB 3S6CA 4MD4A 1BEYH 2XTJC 3KPMA 4P4RB 2FRGP 1N26A 3V8OA 3JTSB 5DMKB 2L7JA 2MQ3A 3FFCD 2Q8AL 5JIKA 2EEDA 3DV4A 4X7TB 3RVXC 4JZJC 4ZPVB 2BDNH 2OL3L 2CIIA 1QA9A 4KQ4L 1E4XL 4P9MH 3MX0A 1NCNA 4XP9H 3U4EA 4XH2B 4MWFA 4I0CC 1G7QB 1NKOA 1RURL 1TZIB 3HAEA 4D9RE 1ULVA 4Z7UF 4HKJA 5AYQA 3TBYB 4JAMA 4MJ6A 3RA7L 3DRQA 1A6AA 5DJ8A 1A1MA 4YHNB 3J7HA 4L4TD 2CK2A 4NQDD 3VFNB 1FGNL 3CUPA 1J1PL 1KENL 5MI0B 1HI6A 4GG8A 2ILLA 2VZVA 3VFWA 5GJTH 2DOCA 5FK9B 3X17A 2AAVA 5LCVL 4DFIA 5CD3B 5KSBB 2NQCA 1PSKL 4X98B 5ETUB 1HILA 4N0CD 4XB7A 1CGWA 5TE4H 5DI8A 4G42A 4QHMB 4YE4L 1CGXA 3D1MC 1DN0A 2Z31C 3MNVB 4U1LA 5H37G 3HR6A 3RWEB 5FM5O 4Q58C 3DVNA 2R2EA 3MNWA 3D3VB 4LLVA 4GBXB 3BYTA 1R5WA 4P2RB 2YBRA 1I8LA 5K9JL 4FFZL 4D3CL 3DVFA 4YHOH 4NSKA 1MUJB 2UYLB 2B2XH 1I7RA 3I75A 3MGAA 4IDLA 4XX1E 1U8HA 1EO8H 1B4RA 4RGMB 4J6RH 4M6ML 3MRHA 1X5ZA 3CPLB 4FG6C 3VMNA 4S1SH 1PD6A 4KK9D 5K9QI 1MY5A 5EC1B 3ZHKA 1E4KA 2WWMC 3GJEA 4DWHA 4XNXL 1J88A 2RCSL 4X7EC 3VFVB 3VWJB 5HYSB 3LN5A 4U0RB 4XMPH 4NUGL 3HNTH 3ECBB 2WIIA 5FHAL 1N64L 5HGHB 3DSFL 1PG7L 2EECA 4Q6IB 3HE7A 5DD1H 2Y36L 5CINH 2CMRL 3BSZL 2IPTL 3SQOL 4U0QB 3IDNB 2G60H 5L7XH 5I17B 3VD5A 4YHLL 3O0RH 4NP4L 3T0EB 4BZYA 2GI7A 4OZIA 1EGJA 1C5DB 1ACZA 2D0GA 3CU7A 2LQRA 3MRLA 4XCFH 2IG2L 4FFVD 3BP7B 3UBXG 3N1GC 1MJJB 3DOSA 4QXUL 4X83A 3IXAA 4OQTL 3H3PL 2VN7A 2HH0H 3QWOB 5GSRB 4HUMB 4NKOB 4RISL 4JQXC 5E70A 2AJXH 1QSFB 3NACH 2O5XH 2WLYA 2ZOLA 5DSCA 5D6CA 3N50A 3MZTA 1KNOA 3BKJL 3IVKB 4L3EE 4KMTL 1GPOL 4PJAB 4PLKC 3SGKA 3QWRD 4WWKA 3DVGB 5DEFA 2DM3A 5EH1A 5E2VH 2AJUL 1XIWD 3WXVL 3V4PL 5LGHH 5C6WH 3E8UH 1KYOK 4WUKH 2P5EB 5E8PA 4ZOAA 4NZTL 3E6HA 3O3AA 1ZXQA 1FVDA 1I9IH 1KIQB 3O6KL 4ZFGL 2DWDB 2NZIA 4Q6YA 1A3LH 1NMBL 5C0RL 1UZ8A 3FO9A 1GGCH 3QG6A 1Z9SA 4OZIE 4XGZA 4YK4C 5FM8A 5CCKL 2ITCB 2BP3A 1E6OL 4JR9H 5FV2A 4GAJH 3LEXB 1LP9A 1AR1C 3DXAA 4NM8H 4PPTA 3G5VB 3MV9E 5AZEL 2Q7NA 3DX6A 4G7VL 4HEME 3D39D 1SJHB 1AD9A 1DUYA 4K3DL 3UTPD 2GITB 1OAYH 4G80A 3WN5C 1IBGH 3OPZL 3Q3GA 4CW1B 1C5BH 1I8MA 2EYSA 5FF6B 3U9PH 4KHTL 5DJCB 1QTYT 4NKMA 3ARFA 5DUPL 3TVMA 4UT9L 2CLRB 3VG0L 3VFPB 3RDTB 3OKYA 3LSOB 4ONHA 3GGWB 4RCAA 3ABZA 5ICXA 5EZIL 5JW4Q 1ZOXA 5F6HJ 3TT1L 3L3KB 4PRID 5GRUH 3SDYH 4ZTOL 1CLCA 4Z7UE 2QQLH 1TVBB 1X9QA 1OP3H 1H9VA 1NMAH 3HC0B 2OMNA 5F1NB 1UM4H 3Q5OA 4I2XE 1QHPA 3DXAE 1UEMA 4G8FA 5TFSL 1GC1L 2ZKHH 2X1XR 3KPOA 5IW3A 4PFEA 5GS2H 2R0WL 3QIWC 1MJUH 5DK0B 1RY7B 4GKSA 3L5IA 1AXSB 3L3GA 1YEEH 5FDYA 5CS7A 2B7DT 5HGAB 3MMEA 1A3RH 1T83C 5BCAA 5L6YL 1QSVA 3SE3C 1S7WA 1D5MA 3C6LB 3G6JB 4NCDA 2BDNL 4U6TA 4XCYA 4B41A 4RMTA 4YZFF 1QBLH 4F7EA 3DBXB 3AS1A 4KRLB 3OV6A 2R8SH 4PJBB 2BXYA 4XP9L 5JORB 4OCSH 3O2DL 3W9DB 1QSEB 1JK8A 1WCBB 5I75B 2R23A 3L95B 5JR1H 2Y7QA 3L6FB 2I60H 5JHDD 4OLZH 3CLFH 3T4AA 5F1KC 3OGOE 4M61A 2WBJC 4BFBD 4U7KA 1T1XB 2EDXA 1CE6B 1OTSC 4HIIA 4GLRI 3PL6A 2MMXA 4PG2A 2EO9A 3FKUS 3BZEA 3MRGA 5GJTL 4ZYKA 1NSNH 3DRTA 3V9FA 2GTWA 5IMMA 3BZFB 4PJGB 4G9DB 1RIHH 3KPSE 4OCYH 4ZFOB 4FFWC 3ZDXF 3IJHA 4D9QD 1U8MB 4L8DA 1RZKL 2NY1C 1HXMB 3LKRB 5FO7B 4YQXL 5C0CE 4L9LA 4U1HA 4Z78A 3WLWD 5DD6B 1EXUA 1WBXA 2BY2A 3MCG1 1MH5A 3I3EA 1CICD 2HJLB 4M7LH 3OAZK 1EZVX 4YHOL 1QRND 5JDSA 3V52L 5BVJA 4UTAL 3DGCR 2B4CC 2P8MB 2NTFA 4NC2B 1XCQB 1EO8L 1S8DB 4E5XA 3L3JA 3H9HA 2FATH 2BY1A 1XGPB 3MUZ1 4J6RL 5IVXA 3PJSA 4RGOH 2D31B 3BPNC 3CFJA 5KVDH 4NUJA 4S1SL 4J3TA 5F7FA 3GMMA 1EJ6A 1QFOA 4P23C 5IK3B 5HVHC 4OD2B 5HHXH 4EI6B 2EDHA 3IJSA 1A6VH 5HDQL 3FRUB 1I9RH 1VADB 5C8JB 1LO2H 2X4OA 2XQYG 5F9WB 1EZVY 4Q74A 5DFVD 3EJYC 1HKLH 1YY8A 5DD1L 1T20B 3QDJB 5KS9B 1VHPA 1P84K 5CINL 5BS0A 3C5ZB 3BDYH 2YKLH 1JWMA 2G60L 4QWWD 5L7XL 4YDJA 1GZQA 2EDLA 3CLEH 1P1ZB 3HI1B 3O0RL 3ZT5A 3IXTB 5B3JE 3DARA 1YEJH 4ETQA 4HS3B 2NY3D 2R2BB 4PJFF 4DCQB 3L5XH 5FYLE 4FMFA 5C09E 2VL5A 4TNVK 1KPUB 4KUCF 2DMKA 5FUZH 5IEHB 1I3GH 3D5OF 3NZHL 2OX5A 3O9WB 3DROB 5I2IB 4AIZB 1M6OB 1MJ8L 4S1RH 1GYAA 5GXBB 2HH0L 1AP2B 4LCYA 3IDJA 1EBAA 4U05A 2AJXL 3NACL 4PJ8C 5D1QD 1U8KA 1HSBA 2E9BA 2ICWB 3EDDA 3KYNB 4UU9A 5HY9A 5DS8B 5KZCB 3VH8A 4PJIB 1U91A 1NCDH 2Y5EA 4XNYH 2ARWA 1DLFH 4P59H 2FO4B 3QQ3B 5E2VL 2VDOH 1KB9J 3NFNA 2P46B 2AEPH 1IQDB 3E8UL 5LGHL 3A6OA 3DYPA 2AK4D 4WUKL 4XWOD 1DQQB 4TVPD 4NO0A 3B8YA 5E8NB 1T0PB 1D9KA 1I9IL 2V7NA 4CMHC 4WIQA 1DBAL 1CIDA 1A3LL 2QADC 3VXOB 3W0WA 2ADJB 1QEWA 1GGCL 1MFAH 2R9HC 4PJ9C 3C60D 1U9KA 2BSRB 3KNBB 2HT4D 3MRQA 2VITA 1RZGA 3V7AE 3SEPA 3GJFH 3UROR 2Q7YA 2HT3D 5SV3A 4GAJL 3QI9A 5IFHH 3EYQD 1MCRA 3WKMH 4NM8L 3ZYIA 5DJ6A 5CSGA 5JXEA 3VU2A 4YO0B 4NBXB 3PV7A 4KH2A 4F15B 1AQKH 1PY9A 1OAYL 2NY6B 4HIHA 2X4SB 3GSWA 3SE8H 2CIKB 1C5BL 5ILTH 2F74B 3U9PL 2QSTA 3MRKB 4JM2C 5D9SA 4YJZL 2ITDA 3SCMD 4D0CA 2HVJB 3BFOA 4YZFE 3OZ9H 2ZJSH 5HHPB 5GGRY 3PWPA 4DZBA 2PO6B 4MS8C 2CQVA 1CL7I 2FJGB 3AY4A 4FQHA 1CXEA 4HXBH 3L3OB 2YZ8A 1IAIH 5GS0H 5JLZA 2A6IB 2IALB 4JHAH 2FNBA 3BZ4B 4MJIB 4B0MM 1NBYB 1J8HE 2BNQD 1FL3A 1UM4L 5T3XD 1KB5A 3PWLA 2G75A 2X5PA 4XBPB 1NDGA 5C0AE 4KRPD 3MV8A 3D69B 1S7XA 3M1BB 3MOAH 3RIAF 4Q97A 2ZKHL 5CD5D 1Y6NR 5I1AB 2NCMA 1XR9A 1DQDH 1MJUL 1K4CB 3TZVA 3ZDXE 1Q8MA 3SKOA 3GDBA 2DAVA 5FYKD 4LCIH 3CDGA 5FV1L 3OKNA 1YEEL 3HS0A 2EZ0D 1VSCA 4Y2DC 1A3RL 4Q9QH 5KSUB 1I7UA 1LEGB 5FO9A 2GUOA 3V6OC 1JYXA 1AHWC 4PJDB 4LLDB 3HA0A 3HMXA 4PRPE 4BSWB 1SYVA 1U3HC 2NX5D 1TTFA 4JZOB 1QBLL 3D2UA 4RFEB 1VKXB 1F4YL 5GGRB 4OCSL 4PP2A 2RFXA 1IFHH 1KJMB 1KEGH 1V7NH 3T2OA 5IFAH 4OZGF 4PLNC 4OLZL 3E6FB 4D8PA 2VLKB 1NBZA 5ENWA 2X4NB 2VDPH 3G9VA 4FQXA 2IAND 3B2UC 4Z0XA 2H2PC 2FJFB 1QG3A 2FR4A 1T7XA 1CZ8L 5B39A 1NSNL 4Q9CA 1WEJH 1N3NB 1MVUA 1F4AA 4OCYL 4H25A 4AM0B 2HRPH 3CGTA 5HI5C 3QIBC 2B0SH 3O3DA 4ZXBD 2JB6A 4HJ0D 5DJ0B 4ISVA 5F3BB 1A02N 3MRRB 3HZMB 3QPXH 4OD1H 1F4WH 1Q9LB 4P5MB 4APQD 4PJFE 2P4AB 3RHWF 2JIXB 4GXVH 3TBTB 2VLRE 4LCUA 5L8JB 2DQDH 5DRXB 1NUDA 2V5RA 3SDXB 4QCIB 1NMCB 1TDQA 1UM5H 3HE6B 5JOPD 3TN0B 3SDCB 1GRWA 4DTGL 4R9HA 5FCSH 2VTFA 4RGOL 1VEOA 3ORJA 5KVDL 3S4SG 1RJZA 2IFGA 4EXPX 3MREA 5DGQA 3G5XA 3KPNB 1EMTH 1XGRA 2CR3A 4YR6B 1L0QA 5MEPB 5HHXL 4XRCB 1XGQB 1A6VL 1I9RL 4FOMA 1LO2L 1JPGA 4FQCH 4WTWA 5DQJB 1HKLL 1R3KB 3IFOA 3QH3A 3UZEA 5BOPA 3GBLA 4YDVA 5EOTB 2ZCHH 3BDYL 1YPZE 2YKLL 4QT5A 4U31A 1UJTA 2H2SC 2DLEA 3CLEL 4BKLA 3EYSL 4R0LC 3OKEA 1I85A 1I7TB 3S8WA 3L5XL 4UQ3B 4AIXA 1X5KA 2VLJA 5FUZL 3TA3B 4FXKA 5AUMA 3W9EB 1I3GL 3HAEH 1JF6A 2KPNA 4KJQD 4JFEA 5JO5B 1S7VB 3H9SE 1HH9B 4KQ3H 4AMKH 5H35A 5D2NA 2AV1B 1I1RA 4Y4HB 1W0YT 1MQ8A 5D4QA 4RA3A 1BQSA 2P8LA 3VW3L 1TTGA 5IG7B 1NCDL 3BKYL 4XNYL 2ESVA 3HE7C 4P59L 3L5HA 4QY8A 2D9CA 1UQSA 3QO1B 1TZGH 5FCUH 1D5ZB 2AEPL 1FFNA 1L0YA 1KPRA 4NQXA 5BJTB 4GAYB 1O0VA 5ID1A 4JN2A 3IGAB 4YEFA 3GHBH 5T1MA 4ZD3H 3TC9A 5CEZE 4Y16B 4K8RH 4PV8A 1MFAL 4XI5C 3PQYD 2Y6SC 4K7PH 4P2QB 1IGFL 3UBXB 4JFEE 1CR9H 1TZHB 5JHDB 5KSVA 4U1KA 4GW1B 3WKML 2YPKA 5GZNC 1NGPH 4D9LH 5D2NE 5C0IB 2Q87A 3RFZC 2HAZA 4IRJD 2J8HA 5DUML 2LAGB 1BJ1J 2AJSH 5IV2A 5HYQA 4Y4KD 1I8IA 4M4RA 5ILTL 2AP2A 1FYTE 3K1DA 3BHBA 3QXWA 4NQEB 2NW2B 1IC4H 4S0TD 4P4RA 3WIIH 1XAUA 2MSPA 4WHTB 5K9KB 4GG6E 1HQ4B 3P30H 4PJ7F 2ZJSL 3JTSA 4N0CC 3PHQB 5DMKA 4U6VH 4XPBH 4KMLB 3S96B 1SM3H 4FQIH 4X7TA 4ZPVA 5TJWK 1I4FB 2ZUQC 2YWZA 2AEQH 2X10A 3PG2A 1IKFH 4HXBL 3L7FB 4XH2A 3A6CL 1G7QA 1IAIL 1NEUA 1TZIA 4JHAL 4XBEH 5IQ7H 1QRNB 4XVSH 4AY0A 1VEMA 3TBYA 1P69B 3VFSB 5L88H 1D5XB 5HI3D 4HJJH 2X1PA 2XICA 4MX7B 4YHNA 5JZ7D 5TH2B 1DQDL 3VFNA 5SWSE 1OTTD 4LCIL 4O2CB 5HHOD 4PJCF 3FQTB 4CDGC 5FK9A 1LEIB 3KPRD 3QULB 4YC2B 1N6VA 5CD3A 1INQB 5KSBA 1G9MC 1X6NA 4X98A 5ETUA 4JM2F 1UXWB 3IDYC 4QHMA 2OJEB 4ZPTB 1CE1H 1YEFH 2YN3A 2EDNA 5EU7C 4Y8DC 3MNVA 2JCCF 1EAJA 3EW3B 3RWEA 5D71H 1OOAA 1HINL 5LKNA 3FJTA 1J87A 1IFHL 3D3VA 4GBXA 4P2RA 4KKAD 4ZO6A 4OGAD 1KEGL 1R6VA 5DYOB 5EOCH 5IFAL 4MA1B 5GSVB 5JIPA 1X4ZA 1MUJA 2UYLA 2AXJA 4G8GD 1NKRA 4IOSD 4NNYB 5DMJB 3OHXB 2VDPL 3HNVL 5I1HH 1YN6B 3HG1D 3TYGH 3UAJC 4M43H 4JHZA 3PV6B 1MVFA 3CPLA 3MUGB 3MACH 4KPHH 3WBDA 1A8JH 1WEJL 2UV3A 2YD6A 3LY6A 2ICEB 5EC1A 4NOBA 5D1QB 2HRPL 1F11B 4C54A 2B0SL 4HF5H 3FQXB 1A7OH 3VFVA 4MHHG 3H42H 3VWJA 1MNUL 3OGCA 3MJ9H 5HYSA 1N5YH 4X9GA 3ECBA 4OI8A 3QPXL 2O26U 4OD1L 5DTFB 1KLFA 4UV7H 1F4WL 4JO3H 5HGHA 4Q6IA 3VFGL 1U2CA 4GXVL 3D3VE 4YHMH 2VXVH 2VRAA 3IDNA 1H3PH 4GKNB 5A2IH 3QCVH 5I17A 2VDKH 3EZJB 4DUWA 2BRQA 3T0EA 3PL6C 1IARB 4JG1H 1BD2E 1UT9A 4U7MA 4UIKL 3AS0A 1C5DA 1G1YA 3C60B 1FGVH 3IRPX 4YLQT 4ZO7A 5EIIB 3BMWA 1PX3A 3BP7A 1J0YA 1MJJA 2GTZB 3QWOA 5GSRA 3I6LE 2Y9RT 3IAQA 4NKOA 2GKIA 3P2TA 1EMTL 3DIFB 1QSFA 4M03A 3DMMB 3DO7B 3ZTNH 1WFUA 3IVKA 2UUDH 5HHMD 4DQOH 4PJAA 1ZTXH 4FA8A 3CFKB 4NT6B 5INDB 5GGUB 1SVZA 3DVGA 2NY4D 4XPHH 3V2AR 5BV7B 1SQ2N 1W8OA 2J4WH 2R0ZH 2Z0BA 2P5EA 4YXKH 4LLWB 1KELH 4Z7QE 1DR9A 3CFDB 1KIQA 1BLNB 1T04B 2DWDA 1TJHH 3MYJA 3AM8A 2X4PB 4NZUL 3K74B 4DFHA 5C0BE 4JM4H 5D7JB 3MLRH 1ACYH 4LRIC 4IRZH 3BP6B 3MUY1 3TJHC 3TWCL 2ITCA 4PG9B 4LVNB 2DI7A 4KQ3L 5A3ID 4NZJA 2BNQB 3LEXA 1CN4A 4UTBH 3J8F7 4KJPD 2NY5C 2VKXA 5HSFA 3ZDYF 3G5YB 1FL5B 3G5VA 3IF1B 1QSFE 1SJHA 2ATPB 3WUZA 5J1AB 1SBSH 5E5MB 2GITA 3RY6A 4G43B 4BQBA 4P46B 4FMKA 2F54D 3MRIB 4BUHA 4CW1A 4PJ7E 2WNGA 5FF6A 2DTSA 2PYFB 4Z7OE 4FQLH 4YDLC 5D70H 5DJCA 4QHUB 3EYOB 5CZXD 4XNMB 5SX4H 3VXNB 5I1IH 2GT9B 1KSRA 4HKXB 1CFVH 5GRWA 2CLRA 1OT1A 4R97C 5F7MC 3VFPA 1YEHH 3RDTA 3GHBL 3LSOA 3GGWA 5AEAA 4ZD3L 3RL2B 4ZUVB 4IRSB 4BQ6A 4K8RL 3L3KA 2ED9A 3CDYA 4K7PL 3BE1H 1TVBA 4L1DA 5FYLH 3HC0A 1ZLSH 4WUUD 4OGXH 5F1NA 1NGPL 1IEAB 4D9LL 2LU7A 2FB4H 2V5YA 4IOFD 4JHBA 5C07D 3HMWH 1RZJH 2X40A 43C9B 2AK1H 1C7SA 4K94C 5I1LB 2AJSL 1QSZA 1T1YB 3ULVD 1CT8B 2IANB 1FYHB 3M8OH 3CX2A 5HD8D 4F2MB 2CD0A 2PUQT 4WTZG 2XKSA 4X8JB 5DK0A 2OQJB 4XNUH 1AXSA 4G3YH 4FXLA 1IC4L 3WIIL 4ZUSB 5IKCB 3P30L 5HGAA 4GSDH 4AT6B 3PDOB 4XPBL 1EEYB 4BSJA 1OAXH 3C6LA 1W0VB 3G6JA 4FQIL 2OL3B 3N85H 4F57L 2AEQL 5DMGD 3LKNB 3DBXA 1LWRA 2K9UA 2X41A 4XWGL 4PJBA 5CWSB 2ENYA 5JORA 3WLWC 4FQPA 3ALPA 1IZJA 3MA9H 3W9DA 2DBLH 1QSEA 4XBEL 4Y5VB 1WCBA 4XVSL 3L95A 5F9DC 1CICC 3L6FA 1NL0H 1GHFL 5L88L 4HJJL 2J1KA 1T1XA 1CE6A 5TQ2H 5E6IC 4L8SB 1KV3A 4M7JH 2IBBA 4LVHC 4AL8H 4RRPG 4X6CB 4HMEA 3WO4C 1T7YA 3BZFA 3OKKB 4G9DA 4KROD 4PJGA 5DD0H 5I9QB 4ZFOA 5CJQH 4Y19D 5CLWA 1MFBH 1U8MA 2YA0A 3V6OE 4M6NL 1BVZA 3AY4C 4HIJB 4JKMA 4OUOA 1CE1L 1YEFL 3MRBB 5GGQH 2IGFH 3VXTB 1HXMA 3LKRA 5FO7A 5D71L 1PY4A 1B6DA 3G6JE 3QAZC 2CXGA 4XZUB 2ZG1A 5E2WH 3OAYK 4OF5A 5DD6A 5DFVC 1KFAH 1V3LA 2PCPB 2VL4A 3U0PB 2CLVB 4LDOB 4OCLC 4MZ3A 2HJLA 5EOCL 4NQUA 4QWWC 4O58H 1ES0B 4PV9B 5E94B 2N7BA 2P8MA 1TQCC 1XCQA 1S8DA 5I1HL 4WEMB 1XGPA 2BFVH 1RFDH 2D31A 4P3WA 1Q38A 3C09C 5A40E 3MACL 4KPHL 5F70A 1ZHKB 1Z5LB 3QYCA 3P4OB 5KOMC 4PJGE 2X2YA 4O4YH 4HF5L 5IK3A 5E2UL 1A7OL 5K9OB 4OD2A 2J5LB 3H42L 4EI6A 5DO2C 3EZ8A 4V1DD 2WV3A 3FRUA 4OZ4B 1VADA 3RWGB 1F2XK 5C8JA 4QHKJ 2FDBP 4Z7VB 4JO3L 1T20A 3JTTB 3QDJA 1JGVL 4WO4D 3VWKB 4M1CC 5KS9A 3C5ZA 4YHML 1F58H 2VXVL 4ODUB 1H3PL 2FECL 3QCVL 2VDKL 3QRGH 1P1ZA 4OV6F 3HI1A 4FQXC 3IXTA 3WE6B 1YYLH 2XN9E 4HS3A 2R2BA 4WHDA 5DJDB 4DCQA 1FGVL 5HDBF 1KPUA 3TV3H 5IEHA 1TJIL 3O9WA 5ADPH 3DROA 5I2IA 5ESVB 2HT4C 1KB5H 4AIZA 1CDGA 1M6OA 4J4PD 2OI9B 3I6KB 5C2UB 1AP2A 3MR9B 4LIQH 2Q76B 3O2WH 3ZZ1A 1U8OB 4GRLD 3WDHA 1OT2A 1L4IA 2ICWA 2X1OA 3KYNA 1NGYB 4NYLB 1RZFH 4V2CB 4Z0BL 2BMKB 3KXFD 3ZTNL 5DS8A 4PJIA 4DQOL 4HULB 1H15B 4ZTPH 2JKXA 1ZTXL 1FG9C 2FO4A 3HUJB 1RV6X 7FABH 3QQ3A 4XPHL 1IQDA 1QFWH 2J4WL 2R0ZL 1TJGH 1TPXC 3FQRB 1DQQA 3U6RB 3PGDB 3SCMC 5KS9E 5E6YA 5F44A 1KELL 3HHRB 5E8NA 1JPST 5GISH 5I30H 1TJHL 3I3BA 1RZ8B 4XAWL 4PB9L 3VA2C 3VXOA 1FSKB 4TSAH 2ADJA 5JA9A 4S1DD 4HGMA 5SWZE 4JM4L 3EIFA 4PGCB 3MCLH 1H3TA 3KNBA 2BSRA 4MA7H 3MLRL 1ACYL 4N90E 3WS6A 1PW3A 5DR5H 3BT2H 3S4SB 1BFTA 3O4LE 4HGWB 3TEUA 1LO3H 2WBKA 3K2UH 4UTBL 4NFDA 2BSTB 5C0JB 1FFOB 4YO0A 4N8VG 4PD4K 2OSLB 4KRPC 1SBSL 5IW1B 1KG0B 4HQQH 4ELMF 2X4SA 1LDSA 4CMMB 4PJIE 2CIKA 2F74A 2EO1A 3MRKA 5D70L 3KPRB 5I1IL 5I6XC 3RJDA 4HMCA 3UJTH 1F5WA 3H0TB 4OCWH 1VENA 2HVJA 1I85C 1E4XI 2VZOA 1YEHL 2CDGB 5HHPA 2V2XB 2X4RB 3GSQB 1UYWH 2PO6A 3FFCE 2FJGA 2PXYD 1U3YA 4G9FD 2GJJA 3SOBH 4I8DA 3BE1L 2YD7A 1U6AH 3EDEA 3IRZA 3FZUD 4TOYH 3L3OA 5IVXF 3FQUB 3GMNB 5I66B 5FYLL 2A6IA 4RGNB 1ZLSL 1A22B 2WW8A 4OGXL 2IALA 2E9WA 3BZ4A 4MJIA 1NBYA 4EZMA 1TLKA 3VI3F 5FEBA 1ERNA 1Q9WB 2GFBB 3HMWL 1U8PB 1RZJL 4XBPA 2AK1L 2X9WA 3D69A 4LPWA 3M1BA 5EUOE 2CGRL 2VDLL 4QNPE 2VH5H 5FM5M 3FB5B 3M8OL 3HG1B 5I1AA 5FA4B 3DPBA 3O8XD 4L4TE 1K4CA 4Y7MA 1NGXB 4XNUL 1YNKH 3U2SB 1ZANL 3A6BL 1NAMB 2C3HA 5KSUA 3LIZH 1LEGA 4PJDA 1EUUA 4OLYH 4LLDA 1OAXL 4HJ0C 4BSWA 5BW7A 3OMZA 3N85L 5E99L 2EXWD 1PKOA 4JZOA 5BMFH 1AD0B 2Y72A 3NZ8B 4RFEA 3PE9A 4MXVF 3RZWA 5GGRA 1VKXA 2YK1L 1O7SA 4R4BB 3RWDB 5CEZH 5CBAB 2HLFD 2B5IC 4APQC 2Q86B 1KJMA 5J1TC 4F9LA 2EE6A 5D96C 1Q94B 1VFOA 3E6FA 2JJWA 3EDKA 2VLKA 4DZ8B 2X4NA 3D85D 3VXRB 1XGYH 3OAUH 2P45B 4M7JL 1AGEB 3KR3H 1RQ5A 2FJFA 4BQ9A 4RMRA 3QNZB 4MNHB 1G0XA 3HI5H 4NFCA 1IM9D 4X6DF 1N3NA 1SEQH 5DD0L 3QRFM 5IJVB 1Z9LA 5CJQL 2F5BH 3RWHB 4AM0A 1MFBL 4B7LA 2VE6B 4D94A 4G6FB 5CJ8A 5DJ0A 4RAVB 2PYED 5GGQL 2IGFL 5EU7E 1JNJA 4WWID 1NUFA 5F3BA 2JJUA 3MRRA 2NY4B 3HZMA 1UWGH 3OB0H 4MNQB 2BVPB 5MEQB 1Q9LA 4P5MA 4ZODA 1CD0A 3S37X 1P7QD 3WIHA 2JIXA 2R15A 2CUMA 3S36X 3TBTA 5HDBE 5ERWB 1IEHA 5DRXA 4O58L 5JDJA 4XPTH 2APWA 1GCFA 3SDXA 2XWBB 4QCIA 4AG4L 3REWB 3HE6A 1JFQH 3TN0A 3SDCA 1UZ6F 1RHFA 4JE4B 4X7FC 1RFDL 3MTRA 4KJQC 3BN9C 4XX1G 4P5TD 4RZCB 5I18L 4Q2ZB 4POYA 3KPNA 2IPUG 1NUGA 5EWIL 5E2TH 2DM7A 4YR6A 5MEPA 5ELIA 1UB6B 3NFPB 1XGQA 3PGFH 4XRCA 1TFHA 1KCSH 1A7QH 4UNVA 3VXMB 4YXHL 3KYKH 2R1XB 3RWCB 3NABH 4OAWB 5DQJA 3QIUD 3BDXA 1VFAB 5D2LB 1R3KA 3S3JA 5EOTA 4WNQB 1F58L 2WUCH 5CHNB 2UZXB 1S3KH 3D0VB 4XP5H 4HG4K 1F3RB 2FH6A 3QRGL 1NGQH 1YYLL 4P2YA 1I7TA 3W39B 4UQ3A 4KFZC 4H26B 3TV3L 3TA3A 3W9EA 1FAKT 5ADPL 1JWSB 2VYRE 1ZLUH 4JPWH 3QDGD 1KB5L 2C5DC 5JO5A 1S7VA 3AU1B 5GRVK 1HH9A 4RDQF 5HGBB 3QXAB 2X9XA 4LIQL 4LCWB 2AV1A 4DW2H 1CF8H 4Y4HA 1P7KB 4NM4H 1RZFL 3BW9B 4P4KD 3D39E 4ZTPL 3CH8A 5IG7A 3ARBB 1JGUH 4Q6IC 3SDDB 3UTPE 3T2PA 1UKQA 3QO1A 5DHVH 1D5ZA 3BD3A 4QTHB 1QFWL 3MLVH 2JJTC 5BJTA 4GAYA 4ODBD 4LAQH 1TJGL 4CDHA 1FVEB 2BSSB 3RTQD 3T0EC 1SY6A 3IGAA 1C8PA 5I30L 5GISL 2E9JA 4TSAL 1NFDE 5I1GH 4Y16A 3SGEH 4YBLC 4PRIE 4TQEL 5DVLA 5J8OA 4MA7L 1OTUD 2X6MA 3VI3E 4P2QA 4JZNB 5DR5L 3K3QA 3BT2L 3UBXA 4HAFA 1LO3L 1TVDA 3K2UL 1TZHA 5JHDA 2CK0H 3ZE1F 4HC1A 4GW1A 3LDBB 1MQKL 3BESR 3U79A 4K9EH 5C0IA 1TQBB 3DX7B 1GOHA 5LQBL 4JFDD 1F6LL 2QEJA 2C4XA 3GSNB 4HQQL 4IIQC 3GK8L 5TE6H 4N1EA 2D7QA 2CRIA 4CVWA 4ZG1A 2MPAH 3I84A 3V5KB 4WI3A 4NBZB 5TPWH 5JZ7C 1T21B 4HMDA 43CAB 1CG9B 1HN1A 1OTTC 1YY9C 3VGFA 1KIPB 5KVGH 1DBKH 3ARGB 3UJTL 4NQEA 2NW2A 4WHTA 5K9KA 1HQ4A 4UQ2B 5A2FA 3PHQA 1GAFL 3LCYA 1FBIH 1UYWL 4MXVE 5E9DD 5MEOB 2C4FT 3C8DA 3S96A 3K1KC 1I4FA 1EERB 3SOBL 2IMNA 4TOYL 1U6AL 4KKCD 3L7FA 5KAQF 2DMCA 1H3GA 4KKAC 4FHBD 3EO1B 4P2QE 4XC1H 4OGAC 1QRNA 3RKDD 1NBVL 5DC4B 3BWAB 2GCYB 5JHDE 4PJ5D 3VFSA 2CUIA 1D5XA 4K71C 2GJZB 1PGRB 1WSST 4MX7A 1NC4B 1WICA 5TH2A 3ZT6A 1YNKL 4O2CA 2DI9A 2Y1VA 3FQTA 3E2HB 3GMLB 5D1XD 1LEIA 3QULA 3RDTC 5IHBA 5CKGA 3LEYL 1INQA 4Z7WB 1J0KA 1UXWA 5FB8B 4OUUB 1S78C 4OLYL 2OJEA 4ZPTA 2FL5B 3UC0H 1XF4B 4U6XB 4Y5YC 4LEOB 3CVHH 3VD4A 4RSVA 3KYAA 5CEZL 4LARH 5IEKB 2R0LL 5DYOA 1RJCA 1UZ6E 1E4JA 5GSVA 4EDXB 3RIAK 1DUZB 1QRNE 4NNYA 3OHXA 3BKML 1XGYL 3OAUL 5D7LD 4JKLA 3KR3L 4KK6D 1YN6A 4DKFL 3PV6A 4ODTH 3HI5L 3MUGA 3W5NA 1SEQL 3R1GH 4ZFZB 1JV5B 4GRLB 2ICEA 4M5YH 5D1QA 2F5BL 3VXPB 4JRXD 3C6LC 1F11A 1RUAH 4NIKB 2VDNH 4NN7B 4FXGB 3FQXA 5C0EB 1U41A 4C56D 1MJ7H 4W68A 4KJWD 1WAAF 4E42B 1UWGL 5DTFA 4GRMB 4YEEA 4XTRC 5A2KH 5DRWB 4LCCB 1I1AD 4PJHE 4GKNA 5IESH 3VJ6B 1DTUA 3O6FD 3N06B 2AQ1A 4QOKD 4NCC1 3C60A 3I2CH 3HNSH 5LG1A 5EIIA 3NMEA 5E03A 4OB5H 4Y1AB 4MB3A 3T3PF 4YBQD 1YA5A 2GTZA 1VDGA 3GMPB 3RNKB 5A3IC 3DIFA 3A67H 5E2TL 1NEZG 3WXWH 5FYJU 3DMMA 3RU8L 3DO7A 4OV5B 1KCKA 3PGFL 5F21B 1KCRH 3IDGB 1KCSL 1A7QL 3THMH 3CFKA 4NT6A 5INDA 5GGUA 1JMZA 3RHWK 3NABL 2LVCA 2VKWA 1JNHB 4PRDB 1OHQA 3LRHA 4LHJB 5I71C 2WUCL 2AK4E 4XP5L 4LLWA 1M1SA 4JFZH 5B3NA 4QRPD 5DZLA 3CFDA 1NGQL 1BLNA 1J0JA 1T04A 35C8H 2YXFA 5HDOA 1G6RH 2X4PA 3OJ2C 3Q6FB 2OZ4A 5LGJB 2PXYB 4GKZB 5B38G 1LMKA 1Z2KA 2BXZA 4J3XA 4YPGB 5D7JA 3JXAA 5JOEA 3ZE1E 4JPWL 4XNQB 3BP6A 5C71A 4PG9A 2BNQA 3T04D 2BVEA 1PG7W 4DW2L 4QRSB 2DJSA 1CF8L 4CVUA 4QF1B 4NM4L 1HIMH 3G5YA 1FL5A 3IF1A 4JCLA 4IOFC 5F9WC 1LO0L 1OSZB 1WZKA 4AZ8A 2ATPA 3U36B 1QFUH 5J1AA 5E5MA 4OFVA 4RIRB 1JGUL 2N56A 4G43A 3MXWH 4P46A 5DA4A 3MRIA 4X80L 3C5ZC 2PYFA 1QP1A 3KLDA 1JYVA 1J9CT 4QHUA 3EYOA 4XNMA 1EJOH 5SX5H 3VXNA 1IE5A 4LAQL 2GT9A 3TO4B 4WW2B 3L7EB 4HKXA 1ZT4B 1YZZA 3RVTD 1TXKA 3EJZC 3RL2A 4ZUVA 2WINB 3O9WC 4IRSA 4AEIL 1RUMH 2IAMD 2CDFB 4H0GA 4L4VD 4I0PC 4PJXE 3DI2B 4EBQH 5ISZD 5C9KA 1MCCA 1OSPH 5CP7B 5IBLD 3GJFB 3FAWA 1CDYA 3QUMB 2FEEL 2HJKB 1DFBH 3V7AG 2BNQE 6FABH 1IEAA 1G6VK 5T3XE 1GGUA 4K9EL 2GSGB 3AMKA 3FO0H 43C9A 2W38A 5I1LA 1T1YA 2H32H 1CT8A 5DXWA 2IANA 5TE6L 4WI9A 2MPAL 4F2MA 4PTTB 5F71A 5TPWL 2X05A 4X8JA 2OQJA 5KVGL 5FYKE 1DBKL 2YD5A 1KULA 1S9VB 4PY8J 4ZUSA 1DVFB 5IB1B 4KROC 5IKCA 1M05B 4NNPH 3V79C 1Q72H 2ZCKL 4JPVH 4AT6A 3PDOA 2VAAB 1FBIL 1EEYA 3SE4C 3TBWB 2DQHH 1W0VA 1NC2D 2OL3A 3WKNA 2YD8A 3LKNA 3LRSB 5CWSA 4MQXC 3JV0A 1HHKB 1BBDH 1NH6A 4WV1C 4Y5VA 3OSKA 3P9MB 2NR6C 4OLWH 1FH5H 1ZVYA 4JO1H 1ZHLB 4N9OB 5H94B 5I0DA 5KSAD 4S11A 4M9OA 4N8VB 3JUZA 1D6VH 4IJ3C 4JPKH 4L8SA 1JGLH 2IANE 2GAZB 1UB5B 1YEGH 2NXYB 4X6CA 5FO8B 5E08H 5C0ND 4M8VA 3OKKA 4XXDB 1T2JA 3TCLB 3OJDB 3TM6A 3LQMA 1TVHB 4U3CA 5KOVC 4HIJA 2H8PB 4LFHG 3MRBA 3UC0L 4JLRB 3VXTA 4YHIB 3WCYA 3HN3A 3LV3B 5GGTA 4XZUA 2YWYA 2YD3A 2EDTA 4LARL 4EI5D 1CLOH 2PCPA 2VWEC 3U0PA 2CLVA 4LHUD 4WO4C 1Y18B 3X3GH 1PKQE 1HYSD 2BOCB 4M1DL 25C8H 1ES0A 2KZWA 4PV9A 4YGVB 3LKSB 3T0AA 3DX9B 3T3PE 5E94A 5JOPE 2RR3A 5GJSH 4WI8A 3QDGB 4ODTL 4L1HA 4QHKI 4RAHA 5C08B 4F37F 3R1GL 4JN1L 1ZHKA 1Z5LA 4UDTB 3QEQD 4QGYA 3P4OA 5BW7C 4A2MA 5J0BA 1N7MH 1RUAL 2VDNL 3QBTB 4JO2H 4P4KB 5K9OA 2OR9L 4TULH 4OZ4A 2DQJL 3RWGA 2XZAH 2F8VA 1UCBH 3T4YB 3RVVD 1IGIH 2VDQH 1KTLB 4B53A 3O4OC 2YZ1A 4Z7VA 1B0WA 2VQUA 3JTTA 1WZMA 3VWKA 2QSCH 4ODUA 3X12B 2N7AA 2OM5A 4JJ5B 3WE6A 4DVBB 4KVNL 1BAFL 5DJDA 3Q6GH 4F7CB 5J89A 2YS4A 3HNSL 4S1DC 3EDJA 1KCUH 4XVJH 4YDKH 3AREC 5ESVA 1OARH 3I6KA 3CFEB 3I9GH 4JFPB 3MR9A 2Q76A 4XNZC 2C1OB 4P3CH 3A67L 1U8OA 4MB5A 3WXWL 2D0HA 3IETB 4NYLA 1NGYA 3UYPA 2BMKA 2DQTH 4JFDB 1UH3A 3RWJB 1H15A 3THML 4OZFG 1KTRL 3GO1H 1FVCB 4R3SB 4ZAKC 5HHNB 3HUJA 2CJUH 1K2DB 4PLJD 1J11A 4PJBF 2E27H 2EIDA 4FTVD 1Y6KR 4KI1A 5GGVH 3FQRA 3ZL4H 4J3UA 3JV4B 3TYFB 3U6RA 3PGDA 4K7PY 3HE6C 1G9NH 3BVNB 3TN0C 4LBEB 3VXSD 35C8L 1RZ8A 2ADIB 1T5WB 3MCKB 4W6WB 4PGCA 2P43B 3PQYE 4JJHA 2DQIH 3SO3C 4YWGL 3EHBC 5IROA 3S4SA 4ZNEE 4HGWA 4HH9B 1CBVH 1I3RB 5JQHC 2BSTA 3CK0H 5C0JA 1HIML 3BP4B 4O9HH 1KC5H 1FFOA 2XNAB 1FV1B 5KG9B 2OSLA 3F62A 5IW1A 1KG0A 3JWDH 3MXWL 4GAGH 3EO9L 5DK2B 4CMMA 1F00I 4ZFOL 4LGRB 1MAJA 2MJWA 3GRWA 4KUZH 3KPRA 1EJOL 4M7LT 1EA9C 5CUSH 5DJ2B 4Z77B 1NCUA 3H0TA 2XFXB 1AY1H 4HEPG 5D7IB 2E9IA 2CDGA 2X1QA 1W72B 2V2XA 1IAII 2WM0A 2IQ9H 2X4RA 3EDFA 3GSQA 2FH8A 5ICYB 1CGSL 1RUML 1UH2A 3QCTH 1S7QB 2NY2B 2V5MA 3KPPB 2Y07H 1A2YB 4GS7B 1RUKH 4EBQL 3ARRA 1I3VA 1OSPL 3K8KA 1NFKA 2GYSA 3FQUA 3GMNA 5I66A 4Y4HC 5ACMA 4UILL 2HLFC 1S5IH 1DFBL 1JCKA 6FABL 4KDTC 1Q9WA 2GFBA 1IMHC 1BF8A 1U8PA 3B9KD 1HSAA 4OGYH 3V7MA 4UZGA 3FB5A 5EDXA 2EIEA 3GSXB 4XMKL 1VEPA 3HG1A 5FA4A 1QLFB 3AC0A 3T0XA 1NGXA 4L3EB 3SE9L 3U2SA 5HHOE 2MHAB 2Z31D 3KPRE 5FHBH 1NAMA 4NNPL 3WJLA 3C2SA 1Q72L 3B5TA 4JPVL 4Y16C 1H5BC 4PGBB 3IDXH 1A3QA 1U36A 1N8ZB 4YNYB 1T1WB 1AD0A 3IJYB 3NZ8A 1N59B 1N6UA 4WI7A 4I18C 4LNRB 4R4BA 3RWDA 1BBDL 1Q9OB 1Q0YH 5CBAA 5T5FH 2Q86A 1MCHA 2EDKA 3DHJA 4RGNE 4JQVA 1WISA 1Q94A 4JO1L 4EN3B 1OP5H 4QOKB 4G8GE 4GAFB 4DZ8A 1GGBH 1QRKA 3VXRA 4JPKL 1QYGL 2NY5H 1JGLL 1AGEA 1ZV5A 4IDJH 3RNQB 2HYMA 3MV9B 3HG1E 5HPOA 3QNZA 4MNHA 2AKRB 1NQBA 3QDMD 1MRCH 2CRZA 5IJVA 2QQNL 1CD1B 3RWHA 3LMJL 3HZYB 2VE6A 4RAVA 3O45B 5EU6B 2DQEH 1BOGB 1MCWW 2EDWA 2YEZB 1CU4H 4PLOB 4MNQA 2BVPA 3OKDB 1SY6H 1U8QB 3HCVB 3PWUB 1OW0A 5MEQA 3W11C 1I1CA 4M8QB 5GZOD 2R1YB 4Z76B 4QRQB 1FNGB 3X3GL 3PGCB 1KN2H 2PR4L 4Z7UB 1VESA 5ERWA 2EEBA 1LD9B 5T33H 2XWBA 5L2JB 4LASH 3ES6B 2W0FB 3REWA 4HUXB 2G5BB 4JFFD 3GBNL 8FABB 4I2XB 3U7WH 1U8NB 3VXRE 3HB3D 1WJ3A 4HC1H 4RZCA 1NCWH 4Q2ZA 1J10A 5I1DB 4PLKD 1W2KT 1EO7A 1N7ML 4JO2L 4EDWH 4TULL 1UB6A 3NFPA 2FX9H 3SJVD 1K6QH 3GHEL 3PXHA 2XZAL 1UCBL 3VXMA 5HHME 3ZKSD 5J57B 1IGIL 3WHE0 1A7BA 2R1XA 1A7RH 3RWCA 4OAWA 2EKSB 1VFAA 2YA2A 5D2LA 4WEBH 5IOPB 4HUNB 1CDIA 2C3GA 5EORH 2Z8SA 2QSCL 1I1FB 4WNQA 5CHNA 3JVGA 3D0VA 4RFOH 1BWWA 2QJDA 3JUYA 1KGCD 5GS2D 4WFGE 3ARYA 3W39A 4H26A 1YQVH 3Q6GL 2GJ6D 1JRHH 4XVJL 4YDKL 1KCUL 3ESVF 1JWSA 2QKIB 1HEZB 4OCRH 5TDPB 3AU1A 1OARL 5DC0A 1OCWH 3RVWD 5HGBA 3QXAA 1MCOH 5ITFB 4PRHD 3MUHL 4P3CL 4LCWA 5I8OL 5HGGS 3QZWG 1P7KA 2DQTL 3WNMA 3BW9A 4QRTB 1B2WH 3KPSB 4PJDF 1DQMH 2BVYA 3ARBA 3GO1L 3SDDA 3ULUC 2CJUL 2F54E 3TESA 1DQTA 2G9HB 4P2OC 3ZE0F 1QBAA 4ZO8A 1VPOH 4QTHA 2VSCA 2OCFD 5C0DB 4OLXL 4HAGA 2E27L 5GGVL 3ZL4L 1DP0A 1F3DJ 4OF7A 1FVEA 5C0CB 2BSSA 4PJEF 3GI9H 1G9NL 1NGZB 3RZCB 4HK0B 5KBNC 2R1WB 1JHKH 4LDLB 4HK3N 2R2HB 4H8WC 3MJ7B 5TQ0H 4X5XB 2MNUA 3AXLB 4JZNA 4KKCC 3VXUD 3DMMC 1CDUA 2RBLA 1INEH 4NQVB 4NN6B 4X7CC 3IAPA 1IAOB 3FOLB 3UTTD 3CK0L 3RWIB 4O9HL 1NEZB 4NHCH 2VLLB 5C07E 3DX7A 3ULVE 3GSNA 3JWDL 5BV7C 2A6KB 4TNWF 1EX0A 5ESQB 4PGEB 3V5KA 2A9NH 4NQCB 1T21A 3NVQA 5I0ZA 2X4QB 4KUZL 1CG9A 2H3NB 1KIPA 2R29H 5CUSL 3ARGA 3CAFA 2BCKB 4R7DB 5D1XC 4Y8AA 2BX5A 4UQ2A 1BIIB 4HS6B 3VG9B 2QV2A 1D7FA 5D7JC 5MEOA 4LHQB 4N5UA 3QCTL 3TCXA 2CR6A 3WIHL 3QXUA 2Y07L 4LVNC 3VDAA 5B38B 1RUKL 2JK5B 4F7MB 4EI5B 5FUCC 2IADB 3TIEB 4JANB 5C09B 4GMTL 2WBJD 3EO1A 1S5IL 5KANI 1OTSD 2FBJH 5GS1B 3LAFA 3UO1H 3BWAA 1ZA6B 1R24B 2GCYA 2VERN 3QUYB 1VGKB 2NMSA 2FSEA 3VFRB 4OGYL 2GJZA 3BIKB 3F7QA 4BH7B 1NC4A 1AE6H 1RAMA 1X5HA 3H3BC 1OP9A 4X9FA 4KK6C 1MPAH 5A1AA 4BZ2H 4O2FB 2J7LA 3GMLA 2NY1D 3BISA 5FHBL 1HYRC 1B6UA 4IRSC 4Z7WA 4NPYB 3DHMA 2NW3B 5FB8A 4OUUA 3NGBC 1KLGB 3IDXL 5FECB 1ZSDB 2FL5A 3D0LB 5LVEA 1A6WH 1QOKA 1XF4A 4U6XA 3INUH 4LEOA 1SBBA 3UPAA 3WNOA 5EA0L 4YHPB 4CKVX 4KJWC 1ZLWK 3NCJH 3BUTA 3E3QE 1Q0YL 5IEKA 3H7BB 2XIDA 4N0UE 1I1AC 2QQKL 2OZ4H 2YD9A 1E27B 5EBLB 3KWWB 4K3GA 1A47A 4EDXA 2MKLC 1DUZA 4LQFH 1GIGH 1T7ZA 3RX7A 1MI5D 2C7UB 3AB0B 3O6FC 3DX8B 1GGBL 2CSPA 5FIEA 1BGXH 3PIQB 3VGAC 5T3XH 4XBGB 4IDJL 4OGZA 4W6XB 1NLDH 4J4PA 4WTZA 3EOBB 1UENA 5JIHA 4JHWL 3MYZA 1XGTB 4ZFZA 1XF2B 4LPCA 1JV5A 4GRLA 5DEGB 3MJ6A 3VXPA 1BMGA 5L2KD 4LLUB 2HA1A 2NYYD 1JN6B 3EJYD 4FXGA 5C0EA 5FYKH 2YUZA 2IH1B 4MCZB 1WIUA 1F8TL 5F9AC 4V1DE 1SYSB 2AQ3A 2Z4QB 4FQ1H 2FECI 3U30B 2JTDA 4E42A 1CU4L 1XR8B 4Y5VC 4G8IB 3MV7D 1SY6L 2WANA 4HZLB 4GRMA 4FTVB 5DRWA 1LEKB 4LCCA 4RQQB 1HWHB 2ADFH 1KN2L 2HP4A 1RIUH 4MGXA 4NWTH 4XT1C 1MRDH 3VJ6A 5T33L 4PP1D 4LASL 2V5SA 4L8SC 4UDUB 3FAXA 3MBEB 1J8HB 5MEND 4NC1E 4F8QA 1QQDB 4ACPA 4PJ8D 5F1OB 5I1JL 4Y1AA 5C0AB 4XP1H 4HC1L 5KVEH 5F7EH 4YFLF 1ZHBB 5IP4A 3GMPA 4JRYB 4UV4H 3RNKA 5K59E 3CDFA 3RGHA 4EDWL 3CFBB 4JO4H 4XMLH 4IM8A 4OV5A 2FX9L 2VISB 2XTJB 4OSUH 1K6QL 3KXFE 1NBQA 3M07A 3IDGA 1ZAGA 2NY0D 4J3WA 3RIFF 2MWCA 1A7RL 4PRPB 4P9HH 4PRDA