1I9JH

Testosterone complex structure of the recombinant monoclonal wild type anti-testosterone fab fragment
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
220
structure length
220
Chain Sequence
b'EVKLVESGGGLVKPGGSLKLSCAASGFTFSTYALSWVRQTADKRLEWVASIVSGGNTYYSGSVKGRFTISRDIARNILYLQMSSLRSEDTAMYYCAREYYGYVGLAYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RECOMBINANT MONOCLONAL ANTI-TESTOSTERONE FAB FRAGMENT LIGHT
publication title Structural insights into steroid hormone binding: the crystal structure of a recombinant anti-testosterone Fab fragment in free and testosterone-bound forms.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 43
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2001-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1i9jH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1i9jH01
3NGBB 3QDMB 3FB8B 4KRMB 4OD1H 1AGBB 3AREB 4K23H 2V5RA 5IBLC 5HYQA 3EDFA 5FO7A 1C1EH 3EHBD 5B39A 1GC1L 1A6UL 2AP2A 2VL5A 2F5AH 3LS5L 4L4TA 4ODSL 2L0DA 1UQSA 3G5VB 5TDNA 1G7MB 1J1OL 3MJ7A 1V8HA 2WQ8A 4DFIA 3QI9A 3MLXL 2XY1A 4JFOA 5C07B 3GSQB 5B39B 5DYOB 1ADQH 2BNQA 3V4UH 4J4PA 1AJ7L 5E2TL 4KRPD 3MJ7B 4XMPH 4OCWH 1U8QA 1T1XA 4OFYA 5HDLA 3W2DH 2AAVA 4Z7WF 2NY4C 1PQZA 3UTSB 4LSUL 4DZBB 4RDQF 3EDJA 4P5MA 2ESVD 4PLJC 3T3PE 4YHLL 4BH8B 1T1XB 4P5TC 4Z95H 2DQFA 3GNMH 3E6HA 4EI5B 4ELMA 1E4XI 7FABH 3G5YB 1N7MH 5HYSA 4P5MB 1F4YL 5E00A 3GB7B 5AYQA 2VLLB 3L3KA 4Q9RH 3MRMB 1LO2L 3MOAH 3CH8A 5I8OL 5HDOA 3VFRA 2LABA 4LBEB 4YHOH 3EYFA 5ECJE 2Z31D 4ELMB 3ZDZE 4PGJA 4MGXA 3NAAH 1UC6A 5HYSB 3GZKA 2BHZA 5E00B 4RISL 3L3KB 3QIUA 5E6ID 1MJUH 1ZK9A 3MLUH 2X1OA 3C8DA 3DVFA 2FECL 2P5WB 1HDMA 1G9NC 2IH1A 3JWOC 5I66B 5H37G 2ENYA 2EXYD 4Y19A 2Y1VA 4ACPA 2H2SD 5E7FA 5DJXA 2ZUUA 5KVDH 3MO1B 4L3AA 1EGJH 4Z7OF 4NO0D 5CUSL 2QKIA 1I1AC 2OP4H 3U0PB 4KQ4H 4IOIB 4Y19B 4X9FA 5DJXB 2H8PA 3JV0A 1M6OA 4P46D 3MRQA 4NHCL 5GGTA 4L3EA 4FP8H 5DHVA 2D4FA 4P2OA 1OSPH 1MY5A 3MJ8B 5C0BE 1N0XH 1U8KA 1NCUA 3GSWB 2H8PB 3X14A 1OTTD 4XPHH 1M6OB 3PL6C 2LU3A 5DHVB 2JK5B 2R0LL 3L1OL 1BP3B 4P2OB 3PUCA 1MUJB 2GAZB 3LIZH 4U1IB 3ZL4L 3MXVL 1V3JA 3X14B 4XGZB 4Y5VC 4PJBF 4QXGL 1XGRA 4FQLL 1OM3L 5MP6H 2LE9A 5MEND 2VXQL 3EYVA 2HVKB 4RBPK 1DUZA 5GS0H 2R1XB 4OQ1A 3QDJE 5BCAA 3ALPA 1CN4A 3DROA 2JB5H 4CMHC 1ACZA 5CEYA 1XGRB 1XH3A 3VXOA 1JE6A 3QRGH 2D0HA 3EYVB 2OL3A 1DUZB 1E6OL 1TQCB 2D0FA 3UAJD 3LPWA 4TRPL 4LCCC 1OTUC 3ORJA 5J11B 1JPST 4JQIL 3VXOB 3KYNB 3SCMD 1S78C 5F1NA 3WJLC 1A3RL 2Y36H 5AUMA 2OL3B 2BY2A 1UGNA 3JV4A 4XP9H 4RFEA 4UNVA 4OCRL 5D1QD 3VFMB 3SDCB 2NZIA 2QQNL 4K7FA 5F1NB 3AB0B 5JTWA 5AUMB 4XVJL 4WI2A 4HS6B 3MV01 5FYLH 3QFJD 3DMMA 4CVXA 4GRWB 3UMTA 1N5YH 1DE4B 4RFEB 1GPOL 4OAWB 3RTQB 2UV3A 4PJXA 4OZHE 3ZO0A 3CFKB 4K7FB 1CXKA 4PB9L 5E2WL 1B0GB 2C3VA 1F13A 1FZMB 3DMMB 4CVXB 1RUQL 1LE9A 4I3RH 4PJXB 3RWJB 3DTXB 2IGFH 2O5ZL 1I85A 4OGXL 1KPRA 2W38A 3IKKA 5C09B 2RCSH 2LAGB 1V3MA 1X5JA 4GMSH 2J8UB 5CMAB 2FATH 3W39A 4PB0H 1LE9B 1A3LH 2D03L 1BWWA 5GS2D 4KKLC 1IVLA 5KSBE 1OAYH 2DD8H 3FFCA 4PRIB 1F4WL 3ESUF 4N1HB 3W39B 3BIAX 3VXQB 5IFAL 3VFGH 2BSED 3QUXA 2DS4A 1R0AH 5LVEA 1F3RB 3ARBD 3B43A 3SKJL 3FFCB 2HLAA 1CDCA 4N0FB 2V7HA 1OF2A 2YK1H 3R06B 2X9XA 4D0DA 2V17L 2CJUH 5E8EB 2YXMA 4DKEL 3E6FA 2P24A 5F97E 4K94L 2HTLD 3QUXB 3TYGH 2HLAB 4P9HH 1KCKA 4EOWH 3UROR 1I9RL 4D0DB 3GM8A 5I1HH 1AFVH 2DKUA 1KFAL 1XEDA 1LP9E 2NX5E 4DUVA 3KG5A 1ZT1B 2X05A 4JM4L 4KQ3H 3BRDA 2CPCA 4CADA 4XVUC 4MLSA 1JPTL 1VERA 3VRLE 2QQLL 1H0DA 3X3FL 2G2RB 3V95A 5IM7A 1F58H 4TPRH 3C8KA 3UYRL 1XGUA 4QRPB 4LSSH 5CJQH 1CL7I 4LOUD 5ANMA 1INQA 4NRYB 3KPOB 1S7QB 3C8KB 1XGUB 2BJMH 4G9DB 4RWYH 1HH9A 1RK0A 1XF2B 3FZUD 1AGEA 4NC0B 4LHUD 1INQB 1KXQE 3MV11 4Y0GA 2DRUA 1Q9LA 4OIIL 4NQTA 5F9AC 5IESL 3X11B 4Z7WA 4LHQB 2FB4L 2ZCLH 3BKCL 3W5MA 3QWRA 4YBLC 5D72H 5TGBA 3ELAT 3MRRB 4XXDA 3PV6B 1KYOK 2I27N 4Z78B 2ATKB 4Z7WB 3ULUD 3DX8A 4M9OA 3U4BL 4MNGE 4OLVL 1P1ZA 3F58H 2BK8A 4H0IA 5TGBB 4XNZC 2X5PA 3CMGA 3DV4B 4TNVF 4R7DB 5F72S 1HNFA 1YEDA 4RA3A 4Z0BH 5EN2B 2W65A 3ROOB 2JB6B 2ZUQC 3TV3L 2DQJH 5BVPH 1UZ6E 4OM1H 4R96A 4EQ3A 4CVWA 1YEDB 1TVHA 2DQDL 3NA9L 3Q3GA 4NPYB 3GIZH 2W65B 4KMQA 1ZV5A 2KH2B 1A7NL 1IFHL 5F9OH 1J1XH 3GBMH 2YPVL 4YFEA 2WUCL 4AEFA 2EECA 3QUMB 4R96B 2Z9TA 3IFOA 2WIIA 1BFSA 2XIDA 3Q3GB 4YHKL 5CIPB 3T1FB 3VD7A 2OK0L 3EW3B 4JFZL 2DTSA 1MCCA 4PJHF 2VZSA 2EYTA 2XRAL 2FJGA 3ILPB 4O02H 3ILQC 4Y1AA 3EHBC 2EIEA 5F7NC 2R1YB 2R69L 2VDLH 1I7ZB 3EYOA 2HT3C 1EDQA 2UYLA 3OJMB 2D9QB 4F7EA 5DVMA 1RZJH 4MSWA 4Y1AB 5IGXH 5TJWK 3VXRB 3T0DA 1AGCA 3UTPE 4ZSOB 2BNUA 4KKNA 2X42A 1J18A 4NKDA 5DJYA 4MAUH 4KRPC 4H8WL 2VLRA 4X4XB 1P4LA 3QEGH 4UIKL 2AEPH 1F6LL 1AGCB 4LCIL 3AS0A 3P9LB 4NKDB 5HDQH 5DJYB 1ITBB 3IDJB 3LHPL 4YBHA 1FGVH 2HRPH 4PJBB 1I1YA 3K2UL 2FX8H 4Z76B 3DSFL 4KU1A 4MXQD 2VDOL 2OM5A 2VZ3A 5A2JH 3V6OA 4P2YA 5C0RL 4BKLA 1GOFA 4HKZB 4O2EB 2EKJA 1QHOA 3H9ZA 4FQCH 1X5XA 1JP5A 3O45B 3WDHA 1XFPA 2Z31C 3LRSB 1EVTC 1LWRA 4N5ED 4TVPE 1AC0A 2ZG3A 3D0VA 2A0LD 5IVXF 3FT4A 5E6IC 5IJVA 2DF3A 2YPLD 3QEQD 2HJLA 4GSDL 2C4XA 3BI9X 4DQOL 2VDNH 3D0VB 3BGMA 3TT3L 2EXYC 2YEZA 3VWKB 5IV2A 2H2SC 3FT4B 5FAAA 3FO9A 4G8EB 1GGIH 2HJLB 2DDQH 1YEFL 4AM0A 5KBNC 3KJ4B 2F54B 4IRSD 3BGMB 3T2QA 4I4WA 3VMNA 1ZXQA 2O5XH 4EUPG 2E7BA 2EIZB 4RA0C 4P46C 4ODXA 4AM0B 1EXUB 1PSKH 2Z92B 1KENH 4I4WB 4GG6F 3O3BA 1YJDH 4WWKD 3I9GH 1OTTC 3DXAE 1I3GL 1P2CA 4ODXB 4MXWH 5I1IH 1M71A 3U30C 3HMXH 3SJVD 1CZ8H 3DRQA 4QRRE 2OTWB 3O3BB 3T0XA 1G6RH 2AEIT 1HHJB 5EULV 5BO1H 1UXSB 4BFGA 4X6BA 2VLKD 3HNTH 3MLYH 4R4BA 2E7LC 4LIQL 4QYOB 4AG4L 2VR5A 1EPFA 4QRTB 4GRLA 3KLHD 2W92A 4PJ5E 1L0QA 2E9IA 3SE8L 3WMSA 3A6BL 4I2XE 1EIBA 1T83A 3BZDA 1QZ1A 3IDYC 1JYNA 4WUUD 4MNQB 5J1TC 1SJHA 2ICEA 2NY0B 1YDPA 4NO5B 5TE7L 1DEEA 2BY0A 3K74B 1A6VL 3L5IA 4XH2B 3SCMC 5C2BH 4X83A 3WO4B 3U1SH 4U1MB 2YPKA 2PYED 3DURA 4DKFH 5FV2A 4D0BA 1QR1B 1YDPB 5D1QC 4EI6A 1DEEB 4G6KH 3TC9A 2YPKB 5BOZG 1XIWD 3TBWB 1Q94A 1U3YA 5F96H 1PVHA 4IMKA 1RUKH 5EA0L 5ESAA 3CMOL 2R2BA 4S2SB 3B5GA 3STBA 5GQBA 1AHWA 4FS0A 3H9SA 4JCLA 1AXTL 4K07A 1YYLH 2LAAA 2CSPA 3VI4E 2R2BB 5DQJA 4OB5H 2CH8A 3H9SB 1IGMH 5EZLB 1MVUA 1UM4H 2G60L 1ZLVK 2C1PA 3NMEA 5FUOL 3MRPA 3VE0A 4LPYA 4KDWA 3VFUA 5D96C 4E41A 1FVDA 1NGQL 2CIIA 2D9CA 3IT8D 4NQEE 1D9KD 4JPWH 5EFIA 3WD5L 3RI5F 1MVUB 3TP4A 3NACL 3MRPB 1K3ZA 3O6KH 4JDTL 4M1DH 3VFUB 3WLBB 4E41B 1FVDB 4JFQA 1SBBA 2VISA 1YUHA 5DJ6A 2VKXA 1Z3GL 5CHNA 1CLOL 3ARBC 2AJSH 4HGWA 4UQ2B 3BKML 5EFIB 4NKIH 2QL1A 3LY6A 4HQQL 1MCRA 1UJ3B 4PRHD 3W9DA 4KHTH 2HTLC 5DJ6B 1NDGA 1ACYL 4PIRF 2PNDA 4NGHH 1YN7B 3WSQH 4HJ0D 4NUGH 5KW9H 1QRKA 3BKYL 4U1HA 3BEWB 1YMME 4NN5C 5T3ZL 2ITCB 5IEHA 4ZXBB 2Y06L 4UILL 3MPCA 3OL2A 4Z7NE 3C2AL 4F3FA 3O3DB 2Y7QA 1GGCL 3C08L 4U1HB 3UJJL 4F9LC 5DD0H 1CT8B 4XBGB 5E1AA 3UCRA 3WJJC 4P2QE 5KS9E 1UXWA 2BNRB 2EDWA 1A7QH 2Y7QB 5DA0B 4PJHB 4OZ4A 3MBED 3QZWA 1D6VL 3NZ8A 4MJ5A 4TSBL 3E3QE 1WFNA 1DQLL 4ZFOL 4PTUB 1UXWB 1JCKA 4M1CC 3C87A 3FZUC 3BP7A 4CDHA 4GKSA 4KI1A 4M8QB 4XCYA 2O5YH 2DKSA 1J10A 4XVTL 4HLJA 4Q2ZA 2DI9A 3FO0L 2D7NA 3FONA 3OJDB 2PO6D 1OAQH 2KL6A 1YEKL 4UB0L 5IW1A 3PWLA 3CX5K 2CUHA 1J05A 2HKFH 5AWNL 5HPMA 5JIKA 3ULUC 2F53B 3MACH 4PY7A 1NANH 2XFXB 3W0WE 4TYUA 4JB9L 4NC1E 3KPRB 2V7NB 1FBIH 2NXZD 1J05B 3DGGA 4PGEB 5ADOL 2FGWL 3DUHA 4WI9A 3SDAA 4WO4A 4PY7B 3UZEA 1MFCH 1S3KH 4WU5A 4ERSH 1X4YA 4XNYL 5E56A 5D1XD 2UVEA 3DGGB 5IVXA 4HS3A 3SDAB 4YGVA 4WO4B 1CXEA 3KJ6H 2I60L 4GBXD 1U6AH 5FYJL 3GGWB 1S5IL 5HHVH 3QAZC 2WM0A 1FC1A 5IVXB 4XWGL 2VLJB 3MRLB 1SMOA 1ZS8A 4M7ZC 4J12A 2NXYC 4OQTL 2XV6B 1CGTA 2OJZL 4GXVH 1OT1A 2FBJH 4LLWB 1SM3H 5L8JB 2AQ2A 1NLDL 2XKSA 4FQXB 1X5ZA 2QQKH 3NFSL 2GHWB 3SGJA 1W0YT 3JTSB 3HNVH 1UJTA 4KDTC 4LCWB 1HHIA 5D6CB 4GG6A 1C8PA 4ZQKA 2WANA 1P84J 4NKOB 2FO4B 2VXVL 3QDGE 3ULSA 4N8VA 3CFIC 4JM2D 1JMZA 2NMSA 5F3BA 2C7UA 4OCXH 1BWMA 3BD3A 2W60A 4NN7B 3ZT5A 1XZ0B 4PLKD 2A6IA 5H35A 5FOBB 5K9OB 4GG6B 1A1NB 2YN5A 1NBVH 4NKMB 4V1DA 5F3BB 4S1SH 3UO1L 5JDJA 2DM3A 4GFTB 1ZHNA 2W0LA 1LEIA 4S1QH 4NJ9H 4LSQL 1T03H 4JFFE 1YQVH 3EBAA 5HVFB 4G8GD 5LQBH 2P8PB 4MXQC 1ZHNB 4HZAA 4R4NC 3QXWA 4I18A 1JPSH 3WFEL 3WXVL 3M17A 1TVBB 4W4NA 3OF6A 4LMQE 5DR5L 2WMPA 2WINB 4P2RA 5IWLA 4N5EC 4R4FL 2A0LC 1JMXA 4I18B 2IAND 4U6YA 3U36B 3L7FA 4LSTL 4ORGB 2HJFA 2VH5H 1UM5H 3FN0H 4HK3J 1CYGA 2FNBA 4M7LL 2ATPA 4OLZH 5MHSD 2E5EA 4R3SA 2JJVA 2XZAH 5D7IE 1R5IB 4EBQL 5HHOB 4LQFL 2DYPD 5FYKU 4KROB 1L0YA 3KAAA 1J0ZA 4ZFGL 5IW6A 3OKOB 1X5YA 2FRGP 5D9SA 1K4CA 3QO1B 4JHAH 4Y4FA 3VFTA 4Z5RB 5KJRL 1R3IH 2B8OT 4LSVL 3T0EA 4D9LH 5DFVD 1YEHH 1VGKA 3I6LE 2GK0A 5IOPB 5TQ0H 1AQDB 1CGSH 5DK0A 4I1NB 3GMPA 5IQ7L 2VXTH 3K1DA 4I0PB 4HJJL 2UWEA 5LCVH 4PRPD 1VGKB 3EIFA 4XC3H 5HI5D 4ODTL 4Q0XL 1E4KC 3G6JE 1CGVA 1QG3A 4H5SA 5GS0D 4YQXH 1KJ3H 2Z4QB 3KLHC 1GSMA 1CE6B 4M5ZL 4PJDE 4GW5A 3QQ4B 3QA3A 3FT2B 3BHBA 5DFTA 5I1AA 2CKBL 3DX7B 5LGJA 1A6TB 2P8LA 3O4LA 4M3JA 5AYUH 1ONQA 2H32H 4WHTA 3QXVA 1RJYA 2HYMA 3QA3B 2GI7A 3BHBB 4R90H 4XAKD 3QCTL 4P49A 3L5HA 2VZ1A 4P4KA 5LGJB 2P8LB 4U0QB 2PR4L 3O4LB 1ZTXH 4WHTB 4YDKL 3STLB 3L3DA 1NFDF 1MCEA 1KEML 4XAWL 2QJDA 4P4KB 1XIWC 1K5NA 4G8IA 5FYLD 5E99H 5DJDB 3LQAC 3OJVC 1NUDA 5JHDA 4N0YH 4NM4L 1IKNC 1H5BC 4UT9H 5GISH 4PD4J 2F8XC 4IDJH 5FHAL 4JFXA 1IGIL 4DK3A 5ERWA 2DJ4A 3FO2A 5T1DL 3WYRA 1W8OA 2ZWLT 4HPYH 2AVGA 3PIQA 1HINH 1C5DB 2NY3D 2R9HD 5IHLB 4ENED 3FO2B 2YD3A 4GS7B 1B4JL 4ZD3H 3K3QA 1S8DA 1D9KC 4C4KT 1DL7L 4XC1L 1JGDB 1JWMA 1OAUH 4UTAH 5T5NF 1RU9L 3D69A 3CZJA 1AD0A 1R5WB 1X3DA 3O4OC 4G3YL 2APWA 4UV4L 4XP5L 1QSFA 5D2LF 1R3KA 3VG9C 2Q1EA 4JFEA 4NQCA 4D94A 1AD0B 1A21A 1BLNB 4L4TE 1QSZA 1QSFB 4HJ0C 1GHFL 2BNQE 2CUMA 4KHXH 2YXFA 3KPTA 4Y2DD 2JF1A 5B3JE 3EJZD 4XNQA 1BZQK 4OV5A 1IZJA 4MZ3A 1UACH 4K7PH 4KUCD 3BDXA 4JFPB 1MF2L 4NQXB 4I48A 1MELA 1N5AA 3V4VH 3UC0L 4AT6A 3JV5A 2ZUTA 4U1GB 1IBGH 5FA3B 2C9AA 1NPUA 4I48B 1N5AB 3GSUA 3MBEC 4PRNB 3D2UA 5BZDB 4NP4L 2VJXA 1CICD 1U8LA 4GG8A 3QPXL 5B3NA 1N59A 2C3HA 4E42A 1HQRB 2VDKH 1X5FA 1JTTA 3FMGH 3CSGA 3KPNA 3D2UB 2R4RH 2WV3A 1U8LB 1A7RH 5IB3A 3U7YL 1N59B 4E42B 5EORH 4I77H 1NL0H 2PO6C 1XGYL 1AY1L 3KPNB 3QB7C 1XR9B 4FMKA 1U95B 3TBSA 5IB3B 1QSED 3U0WL 1XGTA 3O11A 5DJZA 1G7IA 5L8LB 1CFSA 1OTSD 4GKOA 4NBZB 1HNGA 3QG6B 5GJTL 4QGYA 2NY4B 3VG0H 3EOAA 5C08A 2NXZC 5L6YL 1BQHG 1WICA 3EDKA 1EHLL 3F5WB 4OF5A 5DT1L 3GSOA 4CVZB 4PJCA 2FWOA 4P5TB 5D1XC 4L3EE 3CFCH 5DS8B 3DGCR 4OCYH 4FFYH 5C08B 4X80L 3MLVL 1T4KB 1BVZA 3CXDH 1P7KA 1MWAH 1DBBH 5HDBE 3V5HA 4X7EC 1U3HC 3ULUL 5C0ND 3U9PL 3QXTA 3WIHH 2SEBB 3LMJH 3B3IA 2Z91B 2YKLH 1OAZL 3PWJA 3E8UH 3MUHL 4LRNH 4R2GD 4OCLC 3H2WA 2MCPL 1QA9A 4DTGL 1JPGB 1LO0L 1I1AA 1UKTA 4QOKA 1ZHKB 4CVUA 1R5VB 4RSVA 2FYYA 4FTVD 1CD1A 1PJ9A 1I1AB 1NAMH 4G7VH 4JM2C 1NAKL 2Z8VC 3AU1A 1Y0LB 4PLKC 3SPVB 4BZ2L 3PL6A 3DECA 4AL8L 1I7UA 4O51B 4Y88A 1CGUA 2CLVB 4MAYA 3RWIA 2NW2B 2I9LA 2JCCA 2EDRA 4Y5VA 3PL6B 1A7BA 3D85D 4U1JB 1MAML 5SWZD 1JGLH 1I7UB 5J7CC 5GGVY 5KVGL 4PJXE 5IVZA 4NDMA 1CFNA 1K9TA 3RWIB 3V7MA 5AZ2H 5HYIA 4OF8A 1DBAH 3UBXG 1A1MB 2I9LB 3S34L 2EYSB 4Y5VB 1A9EB 5FUCC 1P5UA 1N6QH 4NJAL 4WEBL 3U4EA 1UH4A 3QISA 1CFNB 3VGFA 4M4RA 1MFEL 4LCCA 3QQ3A 2GY5A 4CMHB 5FGCE 3IJHA 4J2XA 5EO0B 43CAB 5C0AB 3BH9B 4DWHA 3UPRA 3UBXI 2VDQL 3BGAA 3CLFL 2FR4A 3KYMB 4HUUB 3ECBA 4OBSA 2HWZH 4LCCB 5E2JA 1RVFL 3QQ3B 3RGHA 3U7WH 2EDKA 1WJ3A 3Q5OA 3I3BA 5FO9A 1K2DB 1ZANL 2NY6B 2CIKA 3CC5A 1NFDB 1OLLA 2JJSA 1RFDL 1G1CA 1CK0L 2H3NA 2OBGA 4ETYA 2OQJB 3NPZB 3K4AA 4LEXL 3P4LA 5DURD 2CIKB 1KIPA 3MXWH 3CC5B 4L9DA 3DHJA 4C83A 3GMLA 1WUNT 5HI3D 3REWA 3HHRB 4FN0A 1A6ZA 5DFVC 2DM4A 2Q3ZA 2IALB 5F89A 1INEH 1KIPB 3B8YA 1QRNB 4H88L 3LZFL 1NC4B 1D5BA 5HGAB 4G5ZH 4C83B 3GMLB 5I1EH 5EPMA 3HG1A 1QYGH 3REWB 1A6ZB 3OB0K 5L2KB 4ZPTA 3HA0A 5KVEL 1S9WA 1VCAA 5ETUA 5HI5C 1T2QH 3DHMA 4X7SL 3N1PC 1PZ5B 2ESVE 4NO2B 2OMBA 1PG7L 3HG1B 1U3JA 2PTUA 4G9FA 5GS0C 4I8DA 5DJ2B 5ANME 2IPTH 3H0TA 4NO3A 4R8WH 2J5LC 5D2LB 3K80A 1F42A 1ROWA 1J8HB 4U1LB 3P4OA 3I50L 4Y4KA 4NNYA 1G7HB 3VXMA 1EFXA 3DWTA 4I9WE 1MI5B 4F7TB 4YDVB 1QFUH 4Z7WE 5C6TH 5D5MF 3MV9D 4WFEE 3C5JB 4Y4KB 5HGBB 5I1DB 4WW1B 4ZFOB 4FHBD 2ICWI 4OKVA 3MZTA 3C5ZD 3QUZD 2BX5A 2NLJA 3EYSL 5D6DC 3ZT7A 3KWWB 3HS0A 5DGQA 5D71L 3BRFA 1H3TA 1RJLB 4PLOB 4OKVB 3INUL 1UKSA 2GITB 3N1QC 3BO8B 2KKQA 4OF0A 1CDIA 4WI6A 5F93C 4LEOA 4HH9B 3D48R 3P11L 4KTEH 4ZOAA 2YD7A 4IDLA 3BZFA 5I16A 1OP3K 2FX9H 1LHZA 2NY3C 1RZ8A 3TCXA 3JWNC 3RNKA 1A64A 4LEOB 1TPXC 4ENEC 3JXAA 3MV8A 1AO7D 43C9A 1U92A 4YEFA 1DDHB 4E0RB 2ZNWA 1I3UA 2VN4A 3S98A 3BZFB 3TBVB 4XWOD 3LKSA 2X70A 4HCRL 3JWDL 3MV8B 3PDGA 3LQAL 5EOQH 2NY1C 1E28A 2HAZA 1HE7A 3P9WB 4GW1B 4RCAA 2ZUWA 4YBLB 3MOQA 5I1KL 3BYTA 2ZUSA 3LKSB 4Y1AE 3ZHKA 3CK0H 4FZEH 4OQTA 5EU4A 4LSPH 2AK4D 3RWGB 4ZS7H 3MUY1 1T7WA 1E28B 1MJ7H 3VDCA 5C8JA 2D2OA 3IXTB 4XNZB 1DVFA 3S37H 3H7BA 3PHQB 4F33B 3FTGA 4P9HC 2OYPA 3DX9A 2VITB 4X5LA 4RAVB 2G9HB 4Y2DC 3D87B 4JPVH 3EJZC 5I8EA 2ZUQB 5C8JB 3QJHA 3OAYK 1T2JA 2VLRE 1DVFB 1OGTA 3KPMA 4EXKA 2MPAH 3G5XB 4HGKC 3FQWB 4LLMA 1CR9L 1REIA 3SDDC 3V2AR 1GL4B 1GVIA 2MSPA 2WAHA 2ENSA 4YJZL 3D1MC 1QVOA 3AROA 3U0TB 4OCNC 3MX0A 1OGTB 1S7UA 3M8OL 2YWZA 1IAIL 4HMCA 3VFVA 2W9LA 4KKCD 3RPIB 5CAYB 3BSZL 3WFDH 1RQ5A 2BZDA 4PGBA 5DRNA 1CICC 2NPLX 4LLYA 4Z0XB 3UTZA 4LCYA 2FIKA 3V6OE 1S7TA 3Q0HA 5KVFH 5CEZE 5DQ9A 4IOSD 1FYHB 4O4YL 1OW0C 4Y5YA 4PGBB 3UXFA 4M6OL 1KJMA 4LLYB 3GBLA 3AS1A 2FIKB 2WNGA 5DRWA 4N5UA 5MERB 2FLRT 4UIMB 4LSRH 4GT7A 4EIGB 1CXHA 1NEUA 4K71C 1KJMB 5D1ZD 2VZOA 5E9DA 4I3GA 1EV2E 1OTSC 3P73B 2DQCH 4TVPH 4UU9A 3TVMA 4ZTPL 3ULUF 2YN3A 3IAPA 1BFTA 3FOMA 4OF7A 5C9JB 4YUEH 2WLZA 2DIBA 2YMXH 3BP6A 4X98A 5C0IA 1OCWH 5DHYA 3QHTC 4Q6IC 4UU9B 3QCUH 3V6BR 5C2UB 1MIEH 4APQD 5C0CD 3Q6FB 4BZ1L 2X4TA 1CF8L 4LAJH 5I18H 1EEUA 4K3JH 5IMMA 4YLQT 1KG0B 2HA1A 1V05A 1TJHH 3O3AA 5C0IB 1MHCB 1T1ZB 2AK1H 5IJKC 2IADA 4CBPA 1KEGL 1K8IA 2X4TB 5E08L 4MCYA 3RZWA 4UTBH 1L9NA 3QULA 2Z31B 2OTUA 4XI5D 2Y5TA 1GAFH 3MNWB 3O3AB 5JDSA 4R7NA 1QFWM 3FB6A 2OZ4H 1U91A 2B5IC 5E6IB 3UZQA 1KCSL 2HJKA 3QULB 4NUJB 4NZUH 2OTUB 5GGRA 1YMHA 4Q6YA 4S10A 4C58B 3CFDA 1W8NA 5EOTA 4U0RB 5JDSB 5EZIL 4DCQB 4ODBD 4HS8H 2W9EL 1CDJA 4JRXA 3TEUA 1I9JL 4RGMC 1MFDL 2HJKB 1K85A 3OKKA 5GGRB 1YMHB 1RZJC 5BRZD 3RVVD 2EH7H 4NQDD 5E2UH 5BS0D 4O2CB 3VXUA 2CKBA 2VZTA 3O2DL 1I1FA 1N4XH 4JRXB 3IETA 2I26N 1C5BL 2PCPB 3HI6H 1V3LA 4L8SC 4P46B 1YZZA 1IM3A 1MH5A 4LLUB 3UTTA 3VI3F 5HXMA 3VXUB 4KAQL 1I1FB 3IETB 4K23L 3IU3B 5EIIA 2AI0H 4U2ZA 5HHNA 1AI1H 3L3HA 1IM3B 1MH5B 3U30B 2F5AL 3RVXD 1NGPH 3AXLA 2IMMA 3T2NH 3VD3A 2UVFA 5K9KA 5EIIB 2HFGL 3FRUA 3L3HB 1PYWB 4D9QD 5MENB 1EHNA 4HFUL 1ADQL 5HVWA 2VAJA 3J8F7 3V4UL 4O2FA 1A6WH 3ARVA 2VLMD 4JRWA 3CSYB 1G9MH 3IDNA 5GHWH 1SMAA 3W2DL 4MS8D 1PZUB 3IDYB 3SO3C 1TCRA 2V6HA 1OGAD 5DSCB 5KAQG 4LNVA 5D5MB 3IDNB 1FNSH 3SCMB 4Z95L 3RIAK 1MSPA 3QUYC 1VFUA 1X5IA 4AH2A 5E94A 3ARSA 7FABL 1JWSB 1RMFL 1N7ML 3GJEA 3CPLA 2BXZA 2CK0H 3MOAL 4YHOL 5LGKA 4AH2B 3QFJB 3NAAL 1S7RB 1FN4A 1T04A 4NCDA 1MCLA 5HI3C 3WIFA 5SX5H 4QHMA 3WS3A 3MC0A 3BPLC 5T1MA 1MJUL 1TTUA 1Z5LA 2QHRH 4KPHH 1J0JA 1YJDC 3FQUA 2DLIA 4WHYH 1JPFA 1FO0A 1MIMH 3WS3B 5T1MB 5DO2C 1UFUA 3FQUB 4F7PA 3GSVB 1EGJL 3U2SA 1BOGA 2IAMA 2OP4L 4Q58C 5D96B 4GKNA 5DJAA 4KQ4L 1MHPH 5DLMH 2IPUK 5EO1B 1VFOA 3QO0A 1U8PA 3U2SB 3KPSA 3GHBH 2P44B 3MLPA 2DI7A 5TDOB 3OKMA 4PYHA 1OSPL 1NFIB 4GKNB 4JY5H 5DJAB 3ARBB 4G43A 3LH2L 4XPHL 3QO0B 1N8ZA 1U8PB 3KPSB 2E9WA 3N06B 4M61A 2FSEA 5T3XE 3H3PH 4CDGC 1ZVSB 1WZ1H 3LIZL 3QEQE 2CKNA 3EUUA 1XAUA 5MP6L 4F9LA 4NN5B 1M7DB 4M5YH 5FA4A 1I8KA 3BN9D 3C5ZC 4JY4B 4M61B 1DCLA 3QUZC 1RPQA 1D5XA 1BQSA 4MJID 3RBGA 4ZUVA 3QRGL 4U7MA 1BZ7A 1I8KB 1YNKH 4HIHB 3RL1A 1RZ7H 5IMOB 1D5XB 4OI7A 3ES6A 4CN6A 5GRXG 4G42B 4ZUVB 2Y36L 2AJVH 1BZ7B 1L7TL 5IVXE 1JF1A 4TUKH 1T0NA 2QSQA 4HUXB 4IRJD 5FHBL 2EEAA 5DZLA 2A1WH 2DOCA 4LHUB 3GJFK 4WY7H 1FH5H 5D7SH 3WS6A 2XWTA 3EOBB 2R2HA 5FYLL 1BD2A 4XWOC 1T0NB 1CDUA 3MRBA 1N5YL 3CJJA 2AJYH 4PJ9D 2LVCA 2CLZA 1WWCA 1VB9A 1ORSA 2BCKB 4P4RB 4YZFF 2CXKA 4LP4A 3O9WD 3SHSA 2R2HB 1WBXB 3LEXB 3KHQA 3MRBB 3X13A 1HXMA 4I3RL 2DLFH 1JNHA 2IGFL 4MX7B 4QTHB 2Q87A 1HHGA 4MNHB 4L9LC 1ORSB 2RCSL 4O00A 5EU7C 1WGOA 4GMSL 4GG6E 4ISVA 1C08B 2NR6D 2FATL 3GO1H 3X13B 1HXMB 4UUJB 2YC1A 1VKXA 4X6DA 1OPGH 4N0UA 1HHGB 1OAYL 3KPPB 4ZS6D 5B22A 3BZEA 3UJIL 4P23D 4IS6A 2YC1B 5F6HI 4V1DE 3VFGL 2L4OA 1G6VK 4F58H 4TNWK 3OPZH 1R0AL 4N0UB 2F74A 5CP7B 3SKMB 3QXAA 3ZDYF 3BZEB 3LKQA 2YK1L 3IFLL 5I30H 4D0CB 4U6XA 3QAZB 4HT1H 2CJUL 1DSFH 1QLFA 2BVQA 4NZTL 3SQOH 5JPMA 3TYGL 4P5KA 5CGTA 3F7RA 3RDTC 4B41A 3PP4H 4M7ZB 2PYFA 4WFHE 2NXYB 2A73A 3CXHK 3DX6B 4XHJD 4OM0H 4P9HL 5L2JA 4EOWL 1AFVL 1PLGH 2X4RB 4RRPG 1AGDA 1P9MC 3WXWH 4P2RE 3RGVA 4XB8A 1JHTA 2DQEH 4BFIB 5L2JB 5ICYB 1F58L 1D6EB 4TPRL 3HZVA 4AMKH 2BMKA 3CSPA 2L7UA 3C09C 3HC4H 4LSSL 5DXWA 1UG9A 1X5AA 5D1ZC 5J6GA 3ARFD 2UUDH 4U1SB 1GXEA 4PLNC 3WE6B 4HEME 3HZVB 1DUYB 5HGHA 4RWYL 1BQLH 4KTDH 4YE4H 2OTPA 1A14H 1GZPA 1F4HA 1S9VA 2WW8A 4PRHE 5D2NC 1EVUA 2BOBB 1H3PH 2Q76B 4X7CC 2YZ8A 3WEXA 5KZCD 2P46B 3O8XA 3T0EE 2BRQA 1GGTA 3IDUA 3BVNA 3VFNB 4QNPE 4X4MA 5D72L 5EUKA 5I8CB 2WLYA 2ARWA 3O8XB 1KB9K 2UWEE 4WI5A 5DVLA 3QJFB 1RULH 4XX1E 4UAOC 4XI5C 1O0VA 4XP1L 3RWDB 3T2PA 3F58L 3FQRA 2XICA 3HZMA 3KPLB 4L8BB 2GTWB 3U6RB 1OARL 2YPLB 4HMDA 3TCLA 4Z0BL 5C0BD 4WTXA 2DQJL 4NRXA 5BVPL 3C6LA 1Y18A 5HHXL 4U3XA 4JZOA 4OM1L 3HZMB 4IRZH 5F7HA 3OGCB 3QIBA 1OT2A 4PJ8A 3I3DA 4XPTH 2EEDA 1Z6JT 1DBJL 3LN5A 4JO3H 4QCIA 3RVVC 2VE6A 4JGMA 1ULVA 5F9OL 1J1XL 3GBML 1HCVA 5IBTH 3LSOA 1ZHLA 2HFEB 5JZ7D 4OKDA 3TO4A 4JM2F 2DQTH 3QDJD 4LF3A 4KZEH 2BVPA 5DD1H 5SX4I 3LSOB 4I5BA 3VRJB 1MQKH 2VAAB 1HXYB 4O02L 4RFNB 1NGYB 4LF3B 2EE6A 1EZVX 3SJVB 2VDLL 4BFBD 2BVPB 4ZPVA 4PREA 5E8PB 5JHDE 1X5LA 1RZJL 2FH8A 2B2XH 5IGXL 3TJHD 2VLKB 5IQ9A 5GRJL 8FABB 2OXGA 2Q6WB 3RY4A 4YFDB 4ZPVB 4J1UB 4MAUL 5CD3A 2V5YA 1E27B 3QEGL 4C54A 5CP3A 4MS8C 2AEPL 1MRCH 4WUUB 1K8DB 3C60C 1FVEA 5JNYA 3OAUH 5HDQL 2Y23A 1UWGH 1ZEAH 2XTLA 5CD3B 2H2PD 1KTDB 1FGVL 5DK3A 1J87A 2HRPL 4F37K 1QFHA 2FX8L 2CMRH 2PYEB 4OUOA 4QO1A 5JNYB 3H9HA 2QSVA 1JZ6A 3MZGB 4ZOCA 2MKWA 4JFEE 3VFWA 1T89C 2ZCKL 4U05A 4HCRA 4JHWL 4NQCE 5DUBB 4FQCL 5TFSH 4LGSB 1XIWB 4QHKJ 2J3SA 3HC0A 5E8NA 4HC1H 3VGAC 2ZPKH 3VFWB 3G9AB 1KN2H 3IJSB 4W70A 1BBJA 3QEHA 1EMTH 1IL1A 3VWJA 4L29B 1H5BB 5FDWA 5E2VH 4XRCB 2FLBT 1TJIH 5TF1H 2VDNL 3EO0A 1LO4H 1BBJB 4OUUA 5JXED 4HXAH 5C0DA 3B83A 5FDWB 2XZZA 3OZ9H 2DDQL 3EDDA 2VO5A 4JO2H 4JQXC 3L95A 3HZYA 1EFQA 3SE4A 1ERNA 1TNMA 4DW2H 2ZUYA 4OUUB 3BYYA 2O5XL 4JO1H 1D9KB 3MRNA 5ALBH 3WKMH 2NX5D 2CDFB 2J8HA 1PSKL 3L95B 1UCBL 1Q0YL 3HCVB 3O4OB 1KENL 3OG4B 1CG9A 3VG9B 2QR0A 1JJUA 1YJDL 1HI6A 1U8OA 3I9GL 3MRNB 5BV7H 2VWEC 1U8MA 3OR7B 5FB8B 1IM9A 4MXWL 5I1IL 4M1GH 5L88L 3BJ91 1CZ8L 1LNUA 1JWUA 1BVLA 4PJEA 3ARDA 3BOVA 1Q9KB 4X7FC 1FFNA 1G6RL 1MREH 5GIRB 3F8UB 5A1AA 5BO1L 1IM9B 4CNIA 2XNAB 3HUJF 4GAYA 1NKRA 4TUJA 3MLYL 3RY5A 1KNOA 3BN9C 5MHSE 4JFDA 4X7TA 1ZLUK 3SO5A 3PNWB 2BRRH 3MLSH 4O9HH 1LK2A 4YHMH 5J8OA 4NWUH 5F1SA 4TUJB 3CFEA 5IB2A 4X7TB 4ELKA 1S7VA 1FFPB 3BGFC 5GGSA 4PJCE 5MEPB 1NCBH 4C56A 3U1SL 4LPWA 3MBEB 4DKFL 2YRLA 1CGXA 4EUPA 5IB2B 5AZEH 4IRJC 1UKQA 5GSVA 3D39A 1S7VB 4NYLB 2R0ZL 4JQVC 3RX8A 5C0FA 3LS4H 4G6KL 5DJCA 1U2CA 3EZJB 4PRPE 2WWMC 1NC2D 4EUPB 4YIQA 3D39B 1RUKL 5GGTH 1WITA 4PJ9C 5I2IA 2X89D 2PO6B 4I13B 5DJCB 4ZAKA 4XZUA 1MCHA 3P40A 1WVZA 1LMKA 2B4CH 3O9WC 1A2YA 2EC9U 1KPUB 3R8BB 3K2MC 1A02N 1YYLL 4XNUL 5GSRA 4QOKE 5F44A 3HI1A 4F57H 5JLZA 3GUTB 5I2IB 1WWAX 3KNBA 1JF5A 5EC1A 4OB5L 2WWKO 4HSQA 4XZUB 4Y4HD 1IGML 1UM4L 2NXZB 4HF5H 5TPWH 4B0MM 3L3JA 1I8LC 5EC2A 3CD4A 4JPWL 4ZS6C 5DVOA 3TBYA 2DKMA 5D1XB 1QO3B 3NCJH 4P23C 1U3HA 2A83A 4M1DL 2PW1B 5EC2B 2AJSL 3TA3C 4NKIL 2JCCE 1E4WH 1M05A 4RX4D 3BD4A 4DGIH 4RAUA 4ETQA 1U3HB 5KSUB 2A83B 3UTPD 5B38G 1XGQA 3RUGF 3UTOA 1N6VA 4NZJA 1RURL 1V3KA 3EO1B 3MGOA 4QGTA 2ZUXA 3RWFA 3W82A 4MWFA 5KW9L 4XHJC 2HVJB 1Q9WA 3CVIH 4RAUB 1OD9A 1J1PH 4ETQB 5HYFA 4XP4L 4H26A 3ZT6A 4WHYG 1BX2A 3BT2H 5HD8D 4XCFH 3OHXA 1R3LB 4HKBB 2X2YA 1B2WH 3GEWB 5GGRY 1Q9WB 2YD5A 4H26B 5DZOA 1MRDH 4JDVA 2VMFA 1RV6X 4JM2B 1ETZB 1A7QL 4MYWB 4F8TA 3TNNA 3S36L 1YQ2A 2IH3B 1M7IA 2CRZA 1FL5A 1NBQA 8CGTA 1AKJD 3JTTA 3L3OB 1FYTA 1YEJH 3IKCB 2APXA 2FEEL 4Y16D 3V6ZB 1FL5B 5EUOA 4A6YL 1FFRA 1TQBC 3BIKA 4MJ2A 4RQQB 5A2FA 1E6JH 5B8CA 1P7HL 5FYKL 4QHNA 3C5SB 5GXBB 1BF8A 4XNXH 1OAQL 4G8GB 5DFWH 4OI9A 2QADD 4IIQA 4UI2A 3MFFB 1SEBA 1IAOA 1SBSH 5C0JB 1ZGLA 1JNJA 1FIGL 2PUQT 5L7XL 2WIMA 5DD6A 4QHNB 4M00A 1JRHH 1AXSA 3MACL 5FGBC 4XNMA 1KYOJ 1P4BH 1UH2A 3T77B 4IIQB 4W4OA 5FK9A 1SEBB 1IAOB 1FBIL 3WN5C 5GRYA 4G9FE 4TQEH 3RKPA 1FP5A 1MFCL 1S3KL 2AJ3B 4ERSL 3F6IA 4MDIA 3G08A 3QCVH 4ZFZA 1HHKA 4FFWD 4UINH 3FHAA 4QRRD 4GQ9H 3RVWC 4BSWA 1MFNA 2DYPB 4WI8A 5F6IC 4J3UA 3VXME 4PR5A 1U6AL 3TT1H 3ZSTA 3ARRA 3GSNA 4MDIB 4DGYH 5L9DH 5CEXA 3MBXH 5HHVL 1HHKB 2GTZA 2YD9A 4JJ5A 2CO7B 4LKXB 5JZ7C 1YEEH 4BSWB 3VRIA 2BVTA 4PJ5D 5SV4A 1U2HA 3HPJB 4N9OB 3PP3H 2WBWB 2XN9A 4OJFH 2GTZB 1IAKA 4JANA 4WRLA 3MNZB 1QSEE 3BP4B 2NW3A 2FBJL 4JJ5B 2FH6A 5CJXA 3NABH 1SM3L 3D3VA 4M03A 1QFWH 3VRIB 3QFDB 4FQ1H 3IDGB 1QLRA 4PJIF 3L5WB 3BIBX 3HNVL 3QXDA 3GHEH 4LLDA 2NW3B 4F15C 1EH9A 3TJHC 2VTFA 4XBPA 3HE6D 1JK8B 5CBEA 4WNQA 4DOHB 5LAXA 3VXNA 2EKSB 2J5LB 4XMLH 4MVBD 1NBVL 1P7QA 1FNEB 2YOCA 4X8XA 4XBPB 3ROLA 5F9JB 4PTTA 4S1SL 3S3PA 1I8IA 1JV5A 5CBEB 2A6KA 1J5OL 4WNQB 1QPPA 3GJFA 3PGDA 5LAXB 3TZVD 1RZIA 2LV4A 3CFJA 4PGZA 4ZO7A 3Q6GH 2W0FA 4S1QL 4NJ9L 2H2PC 3O2WL 1PKQB 1A0QH 5FYJE 1T5XA 4LFHG 4W6YB 5AD0B 1YQVL 4PTTB 3QNZB 1FZJA 3HUJB 5EBWA 2A6KB 1W0WA 2VN7A 1JZ7A 4YDJB 4HG4K 4HW6A 3B9KA 2GSIA 4TN9A 3BEVA 5D8JH 1FZJB 3N50A 1WIOA 5EBWB 4HX1A 4NQED 1W0WB 1XF1A 3MYZA 5E5MA 4X9HA 5GRWA 3LCYA 4FTVE 1J8KA 5FV1L 3PQYA 1ZOXA 4M6MH 3MJ6A 5HYJA 4JO4H 3BEVB 1YC7A 3ZKXC 2VH5L 1KBGH 4HX1B 1UM5L 3FN0L 4S1RH 1WIUA 4JRYA 2DTMH 3ZE1E 3OXRA 2X10A 3LKOB 4X9BA 3L5JA 3LQZA 3PQYB 3NIGF 5JXEC 5EU3A 5HGDB 2GJZA 2NY3B 4P3DA 1S5HA 1TPXB 3V8CA 4XCCH 3EDEA 3ETBF 3HFML 2MNUA 1YMMD 3IFPB 3SQBA 3DUUB 5EU3B 1WCBA 4LMQI 2GJZB 4KV5F 2X4OB 3ARGD 2YD4A 2W59A 2NY1B 5ALCL 2F58H 1YEHL 5TQ0L 1DZBA 4P2QD 1YPZF 2VXTL 3TM6A 5LCVL 2CGRH 4H25A 4XC3L 4FG6D 2CDGA 1KLGB 2PXYD 2VRAA 3QPQD 3GSXB 1F02I 2FJFA 2RAMA 1UVQA 3RL2A 5DWUL 4EN3C 4Y2DB 5E9DE 1HIMH 1KJ3L 3D0LB 4G7YL 3SDDA 4QTIH 4YQXL 5CEZH 1UWEH 4X4YA 1YN6B 4NFCA 2JKXA 2QLVB 4JFYA 1HHHA 4X6CA 1F90H 3RL2B 5GS2H 2FD6H 4MD4B 3SDDB 3RUGB 5AYUL 4X4YB 1CLYH 2Y07H 3UJTL 4JFYB 4HDIA 1HHHB 2AEWA 4R90L 2X4QB 1F11B 5HJ3B 4Z7UF 1CICB 3MRHA 4MJ6B 1DQDH 1VFBB 3K7UA 1RJZB 2V5TA 4HDIB 5C9KA 3O81A 3GK8H 2OR7A 1UB5A 3L5XH 2CDEB 5E99L 3MRHB 4OSUH 4B7LA 1MCDA 4N0YL 2J88H 2R4SH 3OX8A 4UT9L 3DYPA 5GISL 5FECA 3N85H 3SE3C 2E9JA 2R2EA 1NUGA 4IDJL 4Q74A 5CZVL 4QKXB 3LEYH 4K71B 5CSZA 1U8IA 4ODHH 4HPYL 2YUWA 4B5EA 2J4WH 4Y4HC 4L8DB 3GI8H 4OZIF 5FECB 1HINL 5DC4B 2R2EB 3PXJA 5CSZB 5JO5A 1U8IB 2R29H 4ZG1A 5TH2A 4ZD3L 2XQYG 1CTNA 4U1NA 5IMLA 2GUOA 1BBDH 9CGTA 3WL9A 1OAUL 4UTAL 4G6AC 3UTTE 4JG1H 3WHXA 1ZHBB 2X4PA 3MODH 4JKMA 5AAWA 2GUOB 1WAAF 1FNGB 3MROA 2ZSWA 1NSNH 3QDGD 1SYVB 4XBEH 3V4PH 4ZFFB 2P8MB 3MREA 1G7PA 2JIXA 4M7KH 3HR5A 1R3JA 1WC7A 2ZKHL 4LFHD 1FAIL 5HI4D 3AM8C 3MROB 2B5IB 1HWGB 5D7JD 3VGHA 3R1GH 2VABA 4AIZA 3S97C 1KIRA 5JIIA 3MREB 4HWBH 2Z8WC 5I19L 4FQJL 3TYFA 3HR5B 3PDOA 3MRCB 2ZSVA 3HE7D 3OAZH 4RGMB 1YEGH 2VABB 4JFFD 5GGQH 4JKWA 2DQUH 3V4VL 1P53A 4BZYA 2N1KA 4JEGB 3TYFB 5AG9A 3IS0X 5CS7A 2EICA 2ZSVB 1IBGL 4FFZL 2C4FT 3GMOA 4ZUTB 3KLSA 4L8SB 5CBAB 2D7PA 15C8H 5CWSB 3BQUD 2W1NA 2YUZA 2VDKL 3QIWA 1P4IL 2X4SB 3GMOB 2J7LA 4Y16C 4PJIB 3FMGL 1QPXA 5BZWB 2X44D 5A43C 2R4RL 3D85B 4HUWB 1Z9MA 5SWZB 3QQ9C 1N26A 1N0LA 1A7RL 2A9MH 4TTGA 5EORL 1A7PH 4NWTL 4I77L 1AH1A 3KLAB 5ENWB 2QADC 3OSKA 4KXZH 2FBOJ 1MHHB 5KSVB 4NM8H 5T1LD 3I6KA 1W0VA 5D7LA 5ESQB 3KYKH 4HUVA 3C9NA 3SDXA 4HFWB 4PRAA 5AG8A 2F9BT 4MQ7A 5J12C 3HMWH 3HAEH 1UB6A 1I7RA 4PJFA 3SO3B 1GC1H 3VG0L 1ORQA 1RZKH 3LS5H 3QUYA 5HPOA 3JVGA 2C1OA 2P43B 4RMTA 3I6LD 4MQ7B 1NBZB 3P77B 3V9FA 5FUZH 4PGCA 1WFUA 2B39A 5DMKA 3CFCL 3L7EB 3WUWB 1A47A 1SJVA 4JZJA 4OCYL 5IK3A 1ORQB 4FFWC 4HLZH 4QWWD 4OGYH 5D7KE 3O6FA 3QUYB 4L3CA 1WBYB 3CXDL 3MV7A 4WEUD 4X8JA 4MB4A 1MWAL 2XWJA 3WNKA 3MLRH 5D70H 1WBZB 1FQ9C 5DURB 4MD0A 5J6HA 3MRGA 4L3CB 2HH0L 3WIHL 2GSGB 3MV7B 3LMJL 3UDWA 2XWJB 2YKLL 4TSAL 3E8UL 3K81A 3T8XA 3BPLB 4D9RD 2D7TH 4LRNL 5J6HB 5IFJB 3MRFA 3MRGB 3GMMA 1G6RA 1CIDA 1QSVA 1W72A 1B0RB 1HSBA 1F4YH 1LQSR 3T8XB 3KXFA 5T3XH 3MRFB 3MLZH 3RWCA 2MJWA 1G6RB 4UDUA 2DMKA 1HSBB 4G7VL 1NAML 4PG2A 1YPZA 3NN8A 4Z77B 3HE6C 4AIXA 3KDMA 5C0CE 3G6DH 2DWDA 3HLAB 1BQHA 1KC5H 3KXFB 2X1WL 3LEVH 2VDPH 4UBDD 1MLCA 1G9MC 4BA8A 4X99A 5BW7C 1F2QA 5DDHA 1YPZB 1SYSB 5SWSA 3TZVC 3CH1A 3WNOA 4DVBA 1FL6A 1BD2E 4HK0A 1F3JA 1J11A 5CINH 1JGLL 4FMFA 5BVJB 2CUIA 3NPSC 3MV9B 2MQCA 5J13C 4YWGH 1DBAL 3RWEA 2ZCHH 3RHWK 4DVBB 4PJ7F 1JZ4A 1N6QL 5T1KD 4YHYC 3PWVB 4QHUA 1TTFA 1VFMA 4YDLC 3C5ZB 4WIQA 2IC2A 3EYQD 3QUZB 3RA7L 5JW5A 3RZCD 4UZGA 4XXCC 5GS1C 3RWEB 5MI0C 3TN0A 2ZNXA 3BJLA 5BRZE 4BYHA 4L4VA 4NQDE 4WI7A 4ZO6A 3L1OH 5BS0E 5INCA 4YNYA 4X6DE 1M1SA 5DMYA 3U7WL 4QLRA 4Z7UB 4QXGH 3VFPB 5JR1H 2Z35A 4EDXA 1MFAH 1KULA 3V5KA 3ZE2E 3B2VH 3QH3A 5INCB 4L4TD 4YNYB 5KTEH 1XF3B 3IJYA 1AO7B 3QI9D 1S7SA 2Z35B 5HHQA 3PJSB 4ZYKA 2BNQD 1E6OH 3LKNA 3KYAA 3MXWL 4J4PD 5KSAA 3ZE0E 5CKAA 5FM5M 2EO9A 2QTEA 3ARGC 1D5IH 3B9VA 5HHME 4JQIH 4QT5B 1BVKA 1S7SB 3F12B 4OFYD 3TNMB 4IMLB 2FEDC 2APTA 1INEL 3F7YA 2XKNB 2VLME 3VGBA 4MD5B 1GJIA 4LGPB 3UBXA 4G5ZL 4OZIB 4OCRH 1JL8A 1NGZB 2AK4B 2GY7B 5JORA 1QYGL 3GIVB 1BVKB 3VI3E 4L9LB 5HHPA 3OB8A 3U4AA 3S96B 1U8HA 2XY2A 3DBXA 1GIGH 4FG6C 3F7YB 1T2QL 3CCHB 1J0KA 2PXYC 3E3QC 3QPQC 4M7LT 4RZCA 3P2TA 5JORB 2I9TB 3K46A 5JPNA 5ESVB 2IPTL 4R8WL 4PJAF 1JN6A 4OZGA 1MVFA 3GRWL 5J1AA 1XF5A 4C59B 1FZKB 1OLZA 1AR1D 5CCKH 2YHGA 1CIUA 1I1CA 1IC5H 2O5ZH 3IAQA 1NJ9A 2WBJA 3QIUD 4OGXH 3RDTA 3CUPA 2H1PH 3U79A 1VADA 5J1AB 1XF5B 3QBTB 1QFUL 1SY6L 4AQ1B 5C6TL 1WT5A 2AXFA 1OWRM 4Y19D 2DM2A 4OBRA 4X4ME 3RDTB 4A6YA 3CUPB 5I0ZA 1XCTA 2VC2H 4NC1C 1C12A 5F7EH 1I7TA 4AQOA 5IFAH 1OAXL 4PV8A 2AXFB 1H9VA 3AS2A 2ITDA 1GOGA 4BSVA 4LKCA 4L3ED 4FQQA 3K8LA 4P2OD 3NIFE 2PTTA 1GYAA 2AJXL 3C09B 5JOPD 1RZFH 3VXSA 1ND0B 3EJYD 5D1ZB 1N6UA 3O3EB 4X6FB 2NZ9D 4LKCB 5D2NA 4DVRL 1IC4H 2GT9A 4F7MB 4KTEL 4FQQB 4UDTA 4WFGE 1KFAH 2DN7A 4X5WA 3VXTA 1FGNH 4PG9A 5IKCA 1CLZH 4J6RH 2QQLH 5IIEB 3X3FH 2PKDA 5D2NB 3BPNC 4KK5D 2K3TA 4UDTB 5I6XC 5C3LD 2GQHA 2ICWA 4NHUB 3UYRH 4J8RB 3C6SA 5K59E 4X5WB 4PG9B 1AR2A 2GJ6A 3ALWA 5E8DL 1X7QB 3D9AL 1X6NA 3W5NA 2ADGB 3L6FA 3S4SG 3GMRA 2AKRB 4MQSB 1HZHH 1DN0B 3VFOA 3CK0L 4FZEL 5JA8B 3H3BC 3VGGA 4Z9KB 4GW4B 2MFNA 1LEKA 4UAOB 2EE2A 3P4MA 5KAQF 3L6FB 2X1QA 3HNSH 3GMRB 5HI4C 5FXCH 1KTKE 3H3KA 4KK6D 1YA5A 2IFFL 3MOBH 5ILTH 4JPVL 3P4MB 4CUCA 3LOWA 3TIEA 4LLVB 3QG7H 3DMMD 1SJEA 3HE7C 4CU6A 1GGBH 3TFKD 2MPAL 3T3PF 4OLVH 3DV6A 3TIEB 1D5ZB 1SJEB 2LU7A 4Z6AT 2XG4A 5DJ0A 3WFDL 3CNKA 2CK2A 5DTFB 4Q97A 3TV3H 2Y72A 3DV6B 2ADFH 3BQUC 5A3ID 3QDMA 3FB8A 3OV6A 1NCAH 3F65A 3TIDA 1IAMA 3ZDZF 5KVFL 5CFHA 2K7QA 2IWGA 4N8CH 3T3ME 3AAZA 1AGBA 3AREA 3FFCD 5I73C 1JTOA 2YPVH 5FFLA 2WUCH 1A6PA 3FKUS 1C5CH 4CJ1A 4AYFA 5IROA 4LSRL 3TIDB 2IQAA 3QRFM 1B88A 4KMLB 4HWNA 3S3JA 4J23A 3QUXD 4TNVK 3AAZB 1RHHB 3G5VA 4IBLT 4YHKH 1G7MA 2AW2A 5F7DA 5C3TA 3C60A 5F8RC 5C07A 3GSQA 2Q20A 5DYOA 1HK6A 3U7AA 2BVEA 2IQAB 1H8OA 2DQCL 4OIBA 4YZFE 4TVPL 1EEZB 1CTOA 2ARJB 4HAGA 5F7DB 2O61B 2R69H 4YAQA 1OGAB 2AXHA 3C60B 4AEHH 4CMMB 2VNCA 1PW3A 4YUEL 4KKAD 2YMXL 3UTSA 4DZBA 1OCWL 3P3YA 2X1XR 2H9GB 3QCUL 1U93B 4W81A 4OCMC 1MIEL 4QY8B 2W0PA 4YAQB 4PJ7B 3ZKND 5I18L 4QWWC 4BH8A 5I76B 4K3JL 5TE4L 4MA3B 1YEIH 1TJHL 2QQQA 4EI5A 3F6LA 5GGUA 3G5YA 5ISZA 1FG2B 4F9PA 3GB7A 2VLLA 3NH7L 4LCIH 3MRMA 4PJEE 2M8XA 1GAFL 4LBEA 3RKDD 5GGUB 4ZUUA 2F15A 2HT4D 4NFBA 5ISZB 4JFDE 5H8DA 2DJSA 2VDOH 4BQCA 4I9WD 3OKLA 1BQUA 2P5WA 4HS8L 4HZLB 4ZUUB 4H20H 5I66A 2CRYA 3HRPA 2AJZB 3OR6A 4WFED 2P5EA 3RHWF 3QWRD 5ITBL 2EH7L 2EXWD 5E2UL 3MO1A 1MCOL 3BPCB 3JV6B 3OKLB 1K4DB 1N4XL 4XPGH 4DEPC 3GMNA 4C56E 3U0PA 2VQUA 1T1YB 4WHDA 5EU6A 4UBDC 3OR6B 4IOIA 2P5EB 1JGVH 3W81A 2X7LB 5SWQA 3V7AE 5GRZA 2JE8A 4LHUG 2HLFD 3GMNB 2Q86A 3MJ8A 5EU6B 5CGMA 1AI1L 3GSWA 2H32B 4OZHF 3N1MC 5SWQB 5F7MC 2JK5A 3T2NL 1A4KB 2PETA 2IBGA 1JZ2A 3EO9H 2Q86B 1MUJA 4NOFA 3VFSA 2GAZA 4W6XB 4U1IA 4PJAB 4XGZA 2UZIL 1QFPA 3EYQC 2RR3A 1A6WL 3RZCC 3REVA 2HVKA 1G9ML 5GHWL 4BELD 4MJIB 2R1XA 1NCDL 3VFSB 4XCEA 1EO8H 5KSBF 5EBMB 3REVB 1F4AA 2Q7YB 3BGFB 4L5FL 4Q9BA 4EVNB 4XCEB 1FNSL 4Y1AD 1FHGA 1JNLH 1LE5B 1T1WB 4GLRI 3KYNA 4K9EL 3L9RB 4AG4H 4IRJB 1PAMA 1F6FB 4H0GA 4BK4A 3QI9C 1IILE 2YD8A 3RNQA 3SDCA 3VFMA 3WNLA 3H8NA 5DQDH 2IFGA 4J4PC 1MCNA 3GFUA 4Y5XA 4I0KA 1LD9B 3IFNH 3EGSB 5FDYA 4HS6A 5IMKB 1DLHA 2VLRD 1JZ3A 4PJ9B 1QACA 3CLEH 1A6VH 1DE4A 1LP9F 4OAWA 3RTQA 3RNQB 5I15H 2QHRL 2IMNA 4KPHL 3O9WB 3CFKA 4DUXA 4Y5XB 5BV7C 1G9EA 3VRLF 1B0GA 4HK3N 1FZMA 1DLHB 3U83A 3TESA 3HAEG 1MIML 2A77L 3DTXA 4KRNA 4MB5A 2VUYA 3RWJA 2J8OA 5C09A 4DN4L 1MCKA 4KXZI 4M48L 1J86A 2J8UA 5CMAA 4YXKH 2YWYA 3TA3A 3DYMA 1KIQA 1MHPL 5CSGA 5DLML 5CEZD 5D93C 2Y6SD 4GAJL 2XXCB 4PRIA 4P23B 3GHBL 5EG6C 2VQ1B 1AR1C 1FYTE 3R4DA 5ACLA 3UP1A 3VXQA 5HY9B 2NTFB 3QIUC 3TA3B 1KIQB 4NOBA 3S5LB 5EUOE 4M8VA 4TSCH 4G6FD 4N0FA 3RWHA 4HIIB 5GZOC 3QZWG 1NGQH 3R06A 3H3PL 4KZDL 4A2LA 1WZ1L 5E8EA 1HQ4B 4JGUA 4PJGE 5ITFB 1O5DT 3ABZA 2VDRH 4M5YL 1EA9C 3ET9F 3MCG1 3RWHB 3RY6A 4ZUWB 1CLOH 3FHQA 5IFHH 1VEMA 1MY7A 1ZT1A 1S9YB 1NMCC 2ADIA 2Z93A 4KJPC 1NEZG 1CFBA 2G2RA 1RZ7L 4TUOB 1UZ6F 2B4CC 3EJYC 4QRPA 1VDGA 5IR1B 4P59H 3RI5K 3F7VB 2ADIB 2Z93B 1CQKA 2BSRB 4TUKL 4HD9A 4NRYA 3KPOA 1S7QA 5MEOA 3VGEA 3C2AH 2AEQH 4G9DA 4CKVX 1XF2A 4WY7L 5E70A 4KK5C 3TPUA 1FH5L 5D7SL 4YXHH 4LPUA 1TQBB 4JZNA 4GRLD 2NY0D 5KZCB 5JW4R 5MEOB 2AJYL 2XN9E 5K9JH 2BVYA 3X11A 3MYJB 3WIHA 3TPUB 1MWAB 3D3VE 3P0VL 2H26B 4JZNB 4TSBH 4N9GB 5KOMC 1OD7A 3MR9A 1F3DJ 2DLFL 3I2CL 3MRRA 3PV6A 5H2BB 2W07A 4Z78A 2ATKA 1IGTA 4F7CA 4XVTH 3GO1L 3WN5B 4DKDC 4K7PX 4KK6C 4K3EH 3MR9B 5J89A 4LGRB 3DV4A 3PWPA 4R7DA 5C0BB 1QBLH 4OFVA 2VDMH 1IGTB 4F7CB 3ZYIA 2OI9C 5EN2A 3ROOA 3DMMC 2JB6A 2R8SH 2Y4SA 3TFKC 3O6LH 2IBZY 3SDYH 4MQXD 4F58L 3PWPB 3OPZL 3LAFA 1CFQB 4N8VG 4NPYA 3H9SD 3HKFA 3LN4B 1NAMB 5I30L 3V0VB 1DSFL 3QWQB 2MCG1 3SQOL 5ADOH 3LPFA 3QUMA 1I85C 3QDJB 5E24E 1L4IA 1Z9LA 3PP4L 4NC2B 4GO6B 3T1FA 5CIPA 5A3IC 4OM0L 4ONGL 2E7MA 4M4PA 4E41D 4U7SA 5CILL 1JGUH 3ILPA 2DQEL 3PQYE 5CGYD 5FYJH 5HYJE 1WZLA 2R1YA 4MXVE 1I7ZA 5F1IA 3QUXC 4AMKL 1L7IH 4F15B 1IT9H 4JRYE 3HC4L 1KN4H 1FZOB 3VXRA 3ULVE 2OJZH 4ZSOA 4R97C 2HTKD 5F1IB 2YA2A 2BXYA 4X4XA 1BQLL 2UUDK 6FABH 3NFSH 4KTDL 4OZHB 1A14L 3AUVA 3P4NB 4WUKH 1H3PL 3P9LA 4YC2C 2HN7A 5C71A 7CGTA 4KVNL 3IDJA 3HPLA 3LRGA 5KSBA 4PJBA 1UADC 3IDIB 4Z76A 3VW3L 5C0EB 3BUYB 5EOCJ 2D31A 4QRQA 2HN7B 5IG7B 4P3WA 1K6QH 5EIVA 3HPLB 2EDXA 4HKZA 4O2EA 5JW3H 5KSBB 2V2WB 4EEEA 2GFBB 3O45A 4ODVH 1RY7B 2E6PA 3V6FB 4RRPA 1KT2A 1KSRA 3LRSA 1OB1A 3I02A 4LSQH 2HT4C 5C70A 2D31B 4OZFG 5ID0A 4LCUA 4QRQB 5EZJB 3U46B 5I74B 4WCYH 4K3DH 3MLWH 1KT2B 2BVOA 1IAII 1OB1B 3I02B 3WFEH 4XX1G 5ID0B 3MUGA 4LCUB 3L3GA 4X6CE 5T3XD 1LP9A 3VWKA 3BUTA 5E1HB 4LDLB 1NQBA 4JO3L 4G8EA 1DQML 2EXWC 3GRWA 2BVOB 3VMPA 4L8CB 1VGEL 5IBTL 2F54A 3T1WA 3MUGB 4HPOH 3L3GB 2NX5B 1LP9B 4JY6A 2DQHH 2DQTL 5GJSH 2EIZA 4M7LH 2OSLB 4KZEL 1KB5H 5DD1L 5DJ8A 1MJJB 1SY6A 3VA2C 3B9AA 1EXUA 2HLFC 1OP5K 3SKUD 5ICXB 5A16A 2Z92A 1MQKL 3UPCA 4JY6B 2YS4A 3SDAD 3WFCH 4FQ2L 1BAFH 4WO4D 2QV2A 5DJ8B 3LB6D 3QHZH 4EN3A 1IGJB 1R3HB 5A16B 2OTWA 5GRVL 1DLFH 5KN5A 2B2XL 4AY0A 1I9IH 5KJRH 3VI4F 1X9QA 1HHJA 3CAFA 1G9NL 2X4NB 3JWOL 1UXSA 4EN3B 1NGXA 4WU7A 3FO1B 1MCQA 4QYOA 4QRTA 5KN5B 4JLRB 2GW5A 3OKDB 5IQ7H 1MRCL 2BSTA 1NGXB 1AP2B 2W91A 1UWGL 1T0PB 4MNGA 5GPRA 4WU7B 4MNQA 1LILA 1OSZB 1ZEAL 1JNNH 1T6VN 2DL9A 4ODTH 4Q0XH 4NO5A 2CMRL 2MQ3A 1FNHA 4JN1L 4XH2A 2BSTB 4JAMB 2XQYK 4JR9H 4MNGB 4U1MA 1HEZB 1G7QB 1RIHH 3UAJC 4YHIB 1QR1A 1YNLL 1BM3L 2CKBH 4MB3A 5TFSL 1XCQB 2NYYD 1NC2B 1UM6H 4JKPH 4OF6A 4HC1L 3RP1A 3VH8B 2P45B 2ZPKL 3TBWA 1KN2L 5E8OA 1EMTL 4V1DD 5CJOH 4Z7NF 4S2SA 2DLTA 3M45A 5TF1L 1LO4L 5IT2L 2APFA 5E8OB 4HXAL 4KJYA 4Y4HB 5KS9F 4XAWH 1A6AB 4JO2L 4WFHD 2CR6A 5EZLA 1BIIB 3V6OC 4DW2L 1CD0A 4JO1L 1X4XA 4KJYB 5ALBL 3OF6D 1HH6B 1LK3L 2Y6SC 5F1OB 4P2RD 5T1DH 4BJLA 5LWYH 3WLBA 5BV7L 4NT6A 4Z7VE 1DANU 4UQ2A 3MLTB 4M1GL 4KROD 4NQUA 2AXGB 4X6EA 3TGXA 1UJ3A 1IC1A 4IOFD 4M3KB 4NT6B 4PGDA 3EYUH 3BP5B 5D7LE 1RU9H 1YN7A 1C7SA 5DEGA 2AXJA 4MZ2A 3ZDXE 3SDXE 2J6EL 3O3UN 4X6EB 3BEWA 3HI5L 4NN6B 2ITCA 1UZ8A 2ZOKB 2BRRL 1MEXH 3MLSL 4ZXBA 5JIPA 4O9HL 4PGDB 5T5FH 2A6DA 4Y4FD 4PJFE 4H1LH 1WISA 5DEGB 4YHML 4NWUL 3T0ED 3O3DA 2X41A 2M2DA 1BZ9A 5FEBA 1CD9B 3DUSB 1CT8A 5DI8B 4XBGA 1UZ8B 4X7DC 1L9MA 2A6DB 1NCBL 1FO0H 3WV0A 2BNRA 3BE1L 1G7JB 5I1JL 2XZQL 1BZ9B 3IGAB 4PJHA 4R26L 3O0RH 1AKJB 3MNVA 3FFDA 3LS4L 1BMGA 4PTUA 4Y16B 1XR8B 2WK2A 1E4XH 2JLLA 4LOUC 4M8QA 5HSFA 4GRLC 2NY0C 2EZ0D 3UC0H 4URTB 4M62H 3MNVB 1F8TH 5GGTL 3FFDB 5EDXA 1T83C 1LDPH 2B0SH 3O6MH 2QADB 1T0MA 1KXVC 2B4CL 3OJDA 4FQIL 2X4UB 4NP4H 3O4LD 1UWXH 3S37X 4F57L 3LKRB 1G0DA 2I07B 2WP3T 3VCLB 2R39A 5J12B 5E4EC 1T0MB 2A74B 3DXAA 4P4KD 2F53A 1PY9A 2XFXA 2GJJA 1T80A 3QDAA 5EO9B 4JVWA 3KPRA 2V7NA 3MGTA 4PBWD 4PGEA 1A7OH 3DXAB 3NCJL 4ODUB 4G8FB 5DD5H 3EOTH 4N0RA 4IMKC 3IDMA 5SWSE 4QRRB 3MGTB 2YD2A 5H37H 4G6ML 5JHDD 1E4WL 3IF1B 1AHWC 4MLIA 3CZFA 5GJTH 1IKFH 4DGIL 1JIBA 4O58H 3X17A 4PRBB 2F5BH 3GGWA 3IDMB 4IHOA 4PJ5B 4U6HA 4KI5E 2DLHA 3CZFB 4I2XB 2VLJA 3MRLA 3CVIL 1J1PL 4X80H 3GBNL 3NIDE 3CXHJ 3BT2L 4DUWA 1X44A 4OCSH 4IHOB 5HBBA 2KZWA 4U6HB 1ED3B 4LLWA 4U6VH 5CGYC 4FQXA 4R6UA 4L4VE 5JXAH 1IEAA 4L1DA 1VACB 3JTSA 1MRDL 1MOEA 1QSFD 4LCWA 5D6CA 3GM0A 4I3SL 4JFED 2ICES 1FCGA 2A6JA 3HE6B 4NKOA 1H3GA 2FO4A 1OAZH 2YRZA 1FNFA 5D7IF 4NQCD 4XCNB 3TF7C 4WTZG 1IEAB 2HTKC 1XZ0A 4CN1A 5FOBA 5K9OA 1A1NA 3W9EA 3Q48A 4KC3B 1GC1C 2A6JB 2GK2A 1RZKC 4NKMA 3TZVB 4BH7B 1NUFA 4ALAH 3KPQB 2MWCA 1NGWB 2BHUA 1T66D 3FOLA 1IQWH 1E6JL 4RIRB 3W9EB 3NPSB 1B90A 2GIYA 4XNXL 5J13B 2ED8A 5GS1A 5B38A 4OD3H 4LVNB 2P8PA 4YHYB 1SBSL 3FOLB 4YDLB 1RIVH 3WKNA 2R2CA 5GS1B 4XPFL 1TVBA 5MI0B 5B38B 4EDWH 4LARH 3D2UD 1KB9J 3G6JF 1L6ZA 2WINA 5DEFB 1CDBA 1MAMH 3KYOA 5F3HB 5J56B 1I3RB 4TULH 3ESVF 4MMXC 2PTVA 3U36A 1T21B 4PJDF 4ORGA 4RGNE 1BPVA 4OZGE 4HKJA 3FB5B 3KYOB 3GKZA 4WEBH 4UINL 4X4ZA 1JGEA 3QT2A 2BDNL 2AJUL 1JHLH 5MEQA 4GQ9L 3S35X 1BJMA 1MFEH 3CDCA 1F6AA 3LQMA 1R5IA 3TT1L 5HHOA 4NNPH 4DGYL 4X9IA 4HKJB 1YMMB 3KS0J 5JW4N 1IGYB 1Q72L 2BOCA 2APBA 1JGEB 4U31A 3OKOA 1YEEL 5K93A 5MEQB 4RWHA 3WNNA 1Q9OB 1F6AB 3ARGB 4OLEA 3QO1A 1Q0XH 4Z5RA 5FYKE 4LRIC 5C08D 2BOCB 4IRSC 1ZANH 1VPOH 3FT3B 3NABL 1QFWL 5KS9B 4XMKH 5IOPA 1MFBH 1RFDH 1DBKH 4FQ1L 1AQDA 5K33A 3MRKB 3LB6C 2ADJB 3WLWD 1WIPA 4I0PA 2GEEA 3WFHA 2G75A 4BK5A 2V9TA 2PXYB 4WWKC 3E2HC 3VXSE 5ACZB 1CFVH 3BDYH 3WFHB 2G75B 4XMLL 2Z4QA 3G5ZA 1CE6A 1CL7H 1FSKC 4TOYH 3QQ4A 5DMJB 2XPGA 3FT2A 4RGOH 3B8SA 3DX7A 1A6TA 3Q6GL 4OV6F 3W0WA 1KELH 3G5ZB 1A0QL 2YD6A 4JVPA 1I1AD 32C2B 4LVOC 2GJ6E 3EFFB 4QOKD 3SGJC 4D9RE 2XPGB 4NN7C 4KWUA 3W0WB 1ZLSL 3C8HA 5D8JL 2EDTA 3STLA 2NYYC 1FRGH 3PGCA 2VYRE 4U3CA 3PL6D 3B2UD 4M6ML 1TLKA 4JO4L 4LL9A 3FB7A 5B3JF 1KLUB 5DJDA 1KBGL 4MAYD 4S1RL 3PXHA 1TXKA 5IEKB 4PY8I 2DTML 3PGCB 1QOKA 1XGPB 3JUZA 3OKEB 1W2KT 3FB7B 1S9KC 2XTJE 5JA9A 3MSPA 3T4YB 3EYSH 2HRLA 1AGFB 4XCCL 1C5DA 35C8H 4B53A 3BPNB 3DVIA 5FKAB 2X1PA 5I6XB 3QHFH 1MCFA 5CD5D 3QXUA 5IWLC 5EBGA 1OP3H 1JGDA 3PDDA 5CP3H 3QDME 2DB8A 2F58L 1UH3A 1EO5A 1ZT4B 2HMID 1R5WA 3P11H 2NY6D 4OLYH 1INDH 3QDGB 1OAKH 4PV9B 4KROC 4PYGA 5JMRA 4IOFC 4UT6L 2DBLH 1BLNA 2A2QT 1ZSDB 4YBQD 1IMHC 2IPKA 2PW2B 3RX7A 1JHKH 1F3DH 3JWDH 5C07E 1HIML 3T0WA 4S1DD 1RUPH 4QTIL 2YBRB 5LGHH 1UWEL 1T5WB 3AC0A 2IPKB 3HE7B 4Y4FC 2R56H 3LDBC 3G04A 1BJ8A 4JFFB 3T0EC 25C8H 5DUPH 4JFPA 2FD6L 4NQXA 2R0WL 3UTSE 3WUWG 3OAYH 3G04B 4KRLB 3P30L 4KKLD 4QRUB 4NRZA 1IZKA 3HG1D 4FQHA 5FA3A 3SKOB 5FCUH 4U1KB 3VMOA 5HDBF 2V2TB 1NKOA 3BQUB 4PRNA 4ZUSB 4GAFB 5BZDA 2ID5A 2BY1A 1HQRA 4NRZB 4FQHB 4G9FD 3L5XL 2EZ0C 3I3EA 5I73B 2BFVL 4OSUL 1YY8B 3DSNA 4ELME 4FXGB 3HZKB 5HVGB 2ORBH 1JFQL 4HWZA 1T7VA 1TETH 2J88L 2R4SL 5D7IB 3VU2A 3BSZH 3N85L 4Y4KD 3QP3A 5T1LB 3LEYL 1UA6L 3QUKB 3VXMD 1EFXD 1XR9A 1U95A 2P5WE 1U36A 2NTSP 4HWZB 3T65B 4PBXA 4M6NH 2FJHA 1V7NH 1V7ML 5F88A 4WFFE 3T0AA 5J0BA 3O41B 2VB5A 3QG6A 3NCYP 2R29L 5C6PB 1II4E 3DRTA 4EQ2A 3CDGB 2XQBH 2COQA 1BBDL 3HN3A 2FJHB 5EU6E 4Y19E 3TO2B 5F88B 3F5WA 4HJGB 4JG1L 1RUMH 3WFBH 2XWBB 3G6JA 4CVZA 5E7BA 4P5TA 1LDSA 3MODL 5DS8A 3DRTB 1T4KA 5JOEA 5L8KB 1IE5A 4PJDA 1XF4B 4U7KA 3MCLH 4PJXF 1NSNL 1I8MA 3IRPX 3G6JB 5C86A 4X5XB 4M7KL 3TH4T 5EOCH 2R23B 4EUPH 1TIUA 2SEBA 4PJDB 5JOPE 1MCBA 1I8MB 2Z91A 4Q9CA 3R1GL 4BZ1H 4GBXC 1CF8H 3MV8D 1I75A 4WFGD 4HWBL 1FNLA 2B1HL 1NH6A 1JUFB 2J2ZA 4M43H 4V2CB 4DGVH 5I17A 4QXWA 5IVNA 1JPGA 2EE9A 5FYJD 1ZHKA 5E08H 1EHAA 4JN2B 4WV1C 4ZDHA 2QSCH 1R5VA 3RPKA 1CVRA 2FZ3B 2MOVA 5I1GH 4Z18A 3DETD 5DD3H 5I17B 1EJOH 4W6WB 5I75C 5DF0A 1EEYB 1KCSH 3HTLX 1MQ8A 4YPJA 4ZDHB 1Y0LA 3SPVA 1URLA 5EZIH 1DVFD 3QR2A 4LNRB 2D4DA 4KY1H 1MFDH 4O51A 2CLVA 4YHPB 5E6YA 1CE1L 3RJDA 2NW2A 1BFOB 4MMZC 1T66C 5IB5B 2ZOLA 2XA8L 2A9ML 4NQSA 4U1JA 4GRWE 1A7PL 5DK2A 1WCQA 4DAGH 1RD6A 1C5BH 4DN3H 2UZXB 4HC1A 4NM8L 5T1KB 1A1MA 3AVEA 3KYKL 2EYSA 1A9EA 2ZOLB 4NQSB 3WHE1 2FO1A 4KAQH 2IQ9L 4J3TA 3RZCB 5DK2B 1ZE3C 4HWEL 1NCCH 3HMWL 4H1LG 3RVUD 3R8QA 5C09E 3ILQD 3GSRB 4QHLA 4PRDA 2J8UE 1RZKL 5C1MB 5EO0A 2HT3D 43CAA 5C0AA 3BH9A 1CXIA 1OHQA 1F4XL 3GI9H 1CGYA 1F2XK 3F7QA 4JVUA 1DFBH 2HFGH 3KYMA 4HUUA 5FUZL 5HYQB 2RB8A 5FO7B 5B21A 4QHLB 4PRIE 4HFUH 4PRDB 4OGYL 4KJWD 4L1HA 2VL5B 4L4TB 3WJLA 3BMWA 1UQSB 1K2DA 5TDNB 1ZT7A 5IVOA 2Z0BA 1WV7T 3QI9B 1NFDA 2BHYA 4JFOB 3MLRL 3FFCE 3ZYJA 5D70L 2BNQB 2VR4A 2OQJA 1H8SA 5E9DD 3MJ9L 1ZT7B 3SGDH 4JGJA 1U8QB 3TVMD 2EDLA 2ICWJ 4HMEA 2D7TL 5TE6H 1PQZB 5BV7B 2IALA 2XYCA 1RMFH 2X6MA 1QRNA 5HGAA 1NC4A 2J6EA 5TQ2H 1WWBX 3WLWC 5T3XL 4ZNCD 2DQFB 1FFQA 3FRPG 3MLZL 5L2KA 3E6HB 4M93C 4WDIA 2FEEI 4QRPE 1K3IA 3G6DL 1PZ5A 1QP1A 4NO2A 3I84A 1KC5L 4HWUA 3VFRB 3LEVL 5D93B 2VDPL 3EYFB 5JIHA 5DJ2A 3QDHA 2DQGH 4WDIB 3RU8L 1BEYH 3D25A 5D2LA 4K3HA 3DO3A 5CKGA 1J8HA 1Q1JH 3QIUB 4U1LA 4Z8FH 4O5LH 5E4IA 3PG2A 1IEHA 4MA8H 5CINL 1G7HA 3MA9H 1HDMB 4J3SA 3ZTNH 1H15A 2IH1B 3D25B 1NANI 1MI5A 4F7TA 4YDVA 4JRXD 4KUZH 4YWGL 2GCYA 4BQ6A 2ZCHL 3C5JA 3FAXA 1WFTA 4FRWA 4AEEA 4WW1A 5HGBA 5I1DA 4ZFOA 1H15B 3GSNH 3ZHLA 2QKIB 3RAJH 2UY7A 3VXUD 1DR9A 4HG4J 3ZYOA 3BESR 2GCYB 3LH2H 5DUML 3VD4A 4FABH 2WWKT 3MRQB 3RJQB 3B2UC 3IU4L 3KWWA 4L3EB 3UTTD 1NMCB 4JG0H 1RJLA 5I8KH 2ZJSL 3PWPE 4MAYC 1U8KB 1MPAL 2GITA 2R15A 1IGCH 4IJ3C 3BO8A 5JR1L 1MFAL 1KGCE 1U58A 3B2VL 4JREC 4HH9A 5KTEL 1BHGA 4F8QA 1ITCA 3HR6A 4D3CH 5JHLH 1CI5A 1U58B 3FN9A 4OI8A 1FV1A 1DDHA 1L6XA 4E0RA 1UEMA 5CD5C 3VD9A 5EZOL 3DROB 2F8OA 1D5IL 4MCZA 4N1EA 4LASH 1XH3B 5CEYB 3TBVA 2R9HC 2HMIC 3BXNA 1AE6H 2NY6C 1L7TH 4M7JH 4KMTL 1FV1B 3GJFH 4MHHG 4GW1A 5FHBH 4MCZB 1WSST 1EK3A 2FX7H 4PS4H 5GS3A 3ZKQD 3BXNB 3RWGA 4YBQC 1GIGL 3JV4B 4Z7OE 3IXTA 2JJSC 5JW4M 3PHQA 4MHHI 1CS6A 1P69B 4F33A 3VXRE 4S1DC 2E3VA 1KTLA 4ZSOE 2VITA 4RAVA 2OI9B 4CW1A 2G9HA 3S9DB 2Q8AL 3MJGX 1RZGA 1BFVH 5CCKL 1IC5L 2EDNA 1QKZH 1YYML 1Z9OA 3TWCH 3IXAA 2N7AA 1KTLB 3G5XA 3FQWA 1T6WA 2H1PL 2C3VB 4CW1B 1RZGB 2EYRA 3N9GH 3U0TA 4G6JH 4C57C 3ULVH 2K1MA 4NZRH 4PJBE 1KPRB 3IXAB 3RPIA 5FGCB 2VC2L 4MA7H 1T22A 1Y6NR 3UJIH 2Q8BL 4Z0XA 2IAMD 5F7EL 2EYRB 1OQOA 3H6JA 1SEQH 3IDXH 4XVSH 3TPKA 2RGSA 3IFLH 1T22B 3KPSD 5D7KD 4NZTH 5MERA 2P49B 4UIMA 4Y4KC 1RZFL 2UY6A 2V7HB 1OF2B 2V9QA 1QBML 1IC4L 4R97B 3E6FB 2P24B 4OGZA 1AC6A 1DQQA 1FGNL 3P73A 1CLZL 4J6RL 2VXSL 4Y7MA 2F54E 3SE9L 5C9JA 4LAQL 2V2XA 4KRPB 1DQQB 4YC2B 2BERA 2ESVA 4CADB 2XZCH 1H0DB 3Q6FA 5IM7B 3U48A 1KG0A 1DN2A 4J3OC 1HZHL 2V2XB 1MHCA 1T1ZA 2ESVB 4M1CD 3S88L 5F71A 5KVMC 5ANMB 2D7OA 4AJ0A 5JQ6H 4NIKB 3A6CL 3HNSL 2Z31A 4XPAH 2Y5EA 3MNWA 4PUBH 3S8WA 1HH9B 1RK0B 3MOBL 5E6IA 5ILTL 1AGEB 1FE8H 4OF3A 1A5FH 2XA3A 1T7ZA 3I6GA 5C0NC 4IEFB 4NUJA 4F80A 2W9DH 3QG7L 1BD2D 2P48B 1LO5A 1Q9LB 1GGBL 4DCQA 1JBJA 1J0YA 1ZVHA 4FZ8H 4J7RA 1KV3A 4XP1H 4MNQE 3I6GB 3NOIA 4R2GC 4S11A 3DETC 3WUZA 1LO5B 4NO0A 4XXDB 4O2CA 3OQ3B 1OARH 4OFDA 2OCFD 1MCSA 1KPVA 2NY5H 3IYLW 3DX8B 1NDMA 2PCPA 3RRQA 1P1ZB 5HYEA 3KS0H 4P46A 2ADFL 5IHBA 3ARZA 5HHXH 1DVFC 4LLUA 4GAGH 1NCAL 4NO0B 2R0KH 1ZLWK 4CRPA 4N8CL 1KPVB 1YNTA 4FXLA 3V8OA 1DBJH 1NDMB 3IU3A 3S35H 3S4SA 5BJTA 1MCPH 1VEPA 3F62A 5IBUG 1C5CL 4GOSA 4OD1L 1TVHB 1YNTB 1MJ8H 1JI2A 1MLBA 3K4ZA 3S4SB 5BJTB 2NXYD 1PYWA 1C1EL 1E0OB 1MNUH 4CU7A 5MENA 5IHUH 1JYXA 3R0NA 2P4AB 3IFOB 1EAPA 2WIIB 4ESKA 2E7LA 3RVUC 5CJ5A 3CSYA 4BQBA 1MLBB 4YK4C 3H9SE 5HHMD 4AEHL 2E8YA 4POYA 4N90E 2EYTB 1MCWM 3DI3B 3DO7A 1EAPB 5DSCA 2MTPA 2FJGB 3DVNA 1QQDA 5D5MA 4Y5YC 4XMPL 3RGVD 5GRJH 4OCWL 12E8H 1HCFX 2HFFA 3EYOB 4KJWC 3SCMA 1PDKA 2UYLB 4JPIA 5EH1A 1YEIL 1FORH 3S5LG 4F7EB 3DO7B 3ARXA 4E41E 1NFKA 4MSWB 3DVNB 1JWSA 1QQDB 2RFXA 3UTQA 4P3CH 5D1QA 1QNZH 2BNUB 2HFFB 4JPIB 5I1CH 3QSKB 3GNML 2VLRB 3QFJA 5CLWA 1P4LB