4ZPTA

Structure of mers-coronavirus spike receptor-binding domain (england1 strain) in complex with vaccine-elicited murine neutralizing antibody d12 (crystal form 1)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
216
structure length
213
Chain Sequence
EVKLVESGGGLVKPGGSLKLSCAASGFTFSSYAMSWVRQTPEKRLEWVATISSGGTYTYYPDSVKGRFTISRDNAENTLYLQMSSLRSEDTAMYYCVRDGNSMDYWGQGTSVTVSSAKTTAPSVYPLAPVCTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords D12 Fab Heavy chain
publication title Evaluation of candidate vaccine approaches for MERS-CoV
pubmed doi rcsb
source organism Human coronavirus emc (isolate united kingdom/h123990006/2012)
total genus 40
structure length 213
sequence length 216
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zptA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zptA01
1BAFH 4OCNC 3QI9B 4EI5C 3AREB 2IQAB 1P2CA 4XPTL 1P7QB 3BXNB 4TQEH 3P4MA 4BSWB 1JGDA 2E9JA 4MMXC 2ZPKL 3UTTA 4X6CF 4Z5RA 5KSVA 2DB8A 5KVGH 3F7RA 4P9HH 2E6QA 1T3FB 4MYWB 3UDWA 1T7XA 1MJUH 5GS2H 4YBHA 4YHYB 4TPRL 5GS0C 3B9AA 4KDTC 3LS5H 5HGHA 2VLRD 2EH8L 3VRIB 3SN6N 4IOSD 4MX7B 4NQSB 2R15A 3QHTC 4OFYA 3O2DA 1R5WB 1XR8B 2DRUA 1BM3H 2ZNXA 4L5FH 5CSZA 4WHYH 5DJYA 5D1XC 5IGXH 3QI9A 2OSLB 5BQ7B 5MENE 1B2WL 2D7PA 4OCWH 1L0XA 3EO9H 4U1NB 3WCYA 4URTB 4BSWA 3K8MA 4YR6B 5DUPH 4HC1L 4G42B 3GB7B 2XQBL 1QO3B 5D1QD 1CLZL 3QFJB 2P48B 4AT6B 1T3FA 2IGFH 4K2UH 4PV8B 4OZGF 3RX8A 1BJMA 5M95B 2XG5A 1OARL 5T5NF 5IT2H 4EXKA 4RZCB 3VRIA 4MX7A 2R0ZL 4ZS6D 4PYGA 5CEXB 3QXAB 1R5WA 4OZFG 4Y4KC 4KV5F 3X14B 3HC0B 2OSLA 4O4YL 5GS1C 4L3EB 3DOSA 3MMEB 5BQ7A 4XBGB 1ORQB 1F8TH 2ZUYA 4WDIB 1O7VA 4PLJC 4F33B 4U1NA 2NYYD 1CCZA 4NT6B 1D6EB 4G42A 5BS0E 1DLFH 1C5CH 1QO3A 3K8KA 4XC3H 4J4PD 2X4TB 2NY4B 2Y5TB 4XNMB 3MLUH 1RZIA 4Z95H 3EYUL 3GJEB 1FORH 5D2LF 2NNAB 1LP9F 3DSFH 2BVUA 4B50A 2CLVB 2L4OA 1QR4A 1HEZB 3Q6GL 3B8YA 1X5KA 5CEXA 7FABL 2AERT 3X14A 5GSVB 1OCWH 3HC0A 3MMEA 3HMXA 1IEBB 1ORQA 4L1HA 3ZT6A 5CJQL 4C56E 1Q9KB 4NT6A 5HI4D 2Y6SD 3HPLB 2VLJE 3TJEH 4O00A 2X4TA 4HX1B 2Y5TA 4XNMA 4ZTPL 2FBJL 4HGWB 4ELKB 3C2AL 2CLVA 3P4LA 5HVHC 3FO1A 1HEZA 3HC4H 1NC4D 5F3HB 3P77B 3Q3GB 3CFDB 5EOQH 5JTWA 1UKTA 1VEPA 2VC2L 5CBEA 3QUMH 5KS9F 3MPCA 5IB4A 4QHLB 1IEBA 4AQOA 2BSSA 4R4NC 1QBLL 1TTUA 1IM3B 5ESVA 3QAZC 5JMRA 2PR4H 4K7PH 1N26A 2EEDA 3EJZC 3KPRB 2W92A 4IRJD 4HX1A 5KVDH 1NKRA 1RZ7H 3QXVA 2QQLH 1U8MB 2MHAB 5J6GB 1MPAH 3IJSB 4HGWA 4ELKA 2BY3A 5HVWA 35C8H 2HJLB 2P8MB 3TBVA 2ZCHH 1X5HA 3R8BB 4BUGA 3Q3GA 4M7LH 1FYTB 4LLYB 1U9KA 3V8OA 3GRWH 3NAAL 3PV6B 4P3DA 1QFWI 3R0MA 4QHLA 2D03L 1JP5A 2E3VA 5ID0B 1IC7H 4M1DL 2AJYL 1JE6A 4LP5A 1KTKE 4OF3A 1IM3A 4I5BB 4IRSD 4JFPB 4NFBA 4JKLA 5GRJL 1JL8A 2AXJA 2FSEA 2A74B 3O3BB 4P2QD 5CZXD 4OGAD 4XNZC 4ODUB 5I30L 3ES6A 1HHKB 5AEAA 3RUGF 4RWHA 3WXVL 4LIQL 1U8MA 4HWZB 1OAKH 2MHAA 4LKCB 3E3QE 3HAEB 3IJSA 3MJ7A 2WNGA 1BQLL 3L3DB 3HCVB 4UBDD 4HWBH 4K94H 4KHXL 2YBRB 2WBJB 2HJLA 5HHPB 3C5SB 1CG9B 2XICA 5IFHL 4Q6YA 4KZDH 4TOYL 5DMIL 5GGSB 5JHDD 1ZHLA 3TWCH 1CGUA 1EFXB 5I1GL 4EVNB 4FTVD 4MAYC 5ID0A 1YECH 1NGPH 1S7TB 5EZLA 2LVCA 1D5MB 1MVUA 3WFBL 2UUDK 1OTTD 3TBSA 3O3BA 1FG2A 4Q6IC 2ICEB 4ODUA 1RUAL 1HHKA 1BFSA 5DT1H 1MAML 2OMBA 4HWZA 3HAEA 5TQ0L 1U92B 3L3DA 4EBQH 5DURD 3AVEA 4ZTOL 4NZJA 5EC1B 2YBRA 1HZHH 5HHPA 4U1GB 5CILL 1NCWL 1JHKL 1CG9A 4LHUD 1QOKA 4JVPA 4AH2B 2R1YB 4ONFL 2G75B 3DVGA 5GPRA 5GGSA 5F96L 2Z35A 3S97C 2IG2H 4EVNA 2DF3A 2EYTB 1ZAGA 3D9AL 1S7TA 3EZJB 1AKJD 1MFCH 1PFCA 3LRHA 3QIWC 5K9JH 4K3DL 4GO6B 2ICEA 3DHJA 1MCRA 1CXKA 2H41A 4YWGH 1KJ3L 1S8DA 2AJSH 2MSPA 1WBZB 4GS7B 4NPYB 4Q9RL 4FFVC 1A21A 5DVMA 3BKJH 4ODXB 4Z76B 1U92A 5ANME 2AJ3B 4XP1H 4G3YL 5EC1A 3RKPA 1QKZH 3LQAL 2N4IA 5KTEH 5GRUL 3AAZB 2R1YA 4OJFH 5E9DD 2G75A 3MCKB 3V9FA 3DARA 4NQEE 3K2MC 5T5FH 4WY7H 5C07D 3E6HB 2DS4A 1CN4A 1RV6X 3AMKA 1EV2E 3OX8B 3QUYD 1INEL 1TVHB 3QO1B 1UWXK 3S37L 5GGTH 4PJIE 1WBYB 1EGJH 2QHRH 1BOYA 12E8L 3BUYB 1JPTL 4DN4L 1WBZA 2X4PB 3D39E 3H42H 5FGRA 3O8XB 4Z76A 1QRNE 2ZNWA 4NCC2 4JFDE 2QLVB 4NP4L 4BKLB 3BZDA 1OSZB 5KVFH 1WICA 3GKWL 5DHVB 4DUXA 5KVMC 5B39G 3AAZA 4J3UA 3MCKA 1HNGA 3IU4H 4P23A 4QRUB 1DE4B 2YOCA 3E6HA 1T2XA 5EFIB 1AGDB 3MRDB 2PYFA 1HKLL 3EOAA 4LSRH 5CINL 3S6CA 2V5TA 4YFDB 2OL3L 1OY3B 3FHQA 2X4PA 4K8RD 4TN9A 5C09D 4KJPC 5A2LH 1NJ9B 4R2GD 3MV9D 2HTLD 3ZKXB 4WGWB 2AI0H 2X2YA 2CRMA 4BKLA 4EI5B 5FA3B 5DHVA 3OG4B 5T3XE 1N6QH 1ZS8B 3RU8H 1KFAH 2Y36H 1B0WA 4WW2F 3EW3B 3FQXB 3ILPB 3PQYD 4U1LB 3L7EB 1AGFB 3WJLA 1OSPL 5ILTH 1TVBB 4GRWF 4JM4L 4NYLB 5F7LB 1WZMA 4Q9CA 4R90H 2Y06L 5EFIA 4RGNC 3OKMB 2PKDA 1C8PA 3MRDA 5J11C 3VFUA 3FFDA 4PJ9C 3NZ8A 4NDMA 4G6JH 1YEFL 5KSAA 1FL3B 3GMRB 1P5VA 4OM1H 4NKIL 5HHNB 4OZIE 1ACYL 1NJ9A 1WAAF 4KI5D 3U9PL 1KB9J 3DVIA 5D1XB 1SJVA 4R8WL 3MV11 2AK4B 1QSFE 1ZS8A 3B9DA 3U7AA 1KF9B 3ILPA 1BFOB 4U1LA 2YRPA 1AGFA 5CFHA 4FQPA 4NYLA 5D70H 5C0AD 4I13B 2X4SA 1I7ZB 5FCUH 1R24B 3OKMA 4D9RE 5J1TC 1YY8B 4GAJL 3Q48A 1RZ8A 3KLHD 5DQ9B 1Q94A 1CU4L 3HC3H 4KDTA 2AS5M 4YUEH 3GMRA 4WFEE 2E6PA 3LHPL 3O6FD 1GRWA 2XTLA 3HNSL 4JRYB 5HHNA 3OXSA 2DQUH 1J1OL 1ZVSB 4NC0B 4Y4KB 4E9LA 2HLAB 5D1XA 5GS1B 4PRAA 3VXNB 2I9TB 3HNTL 2PO6C 2MPAL 1G9MH 2AK4A 2CGRL 4MSWB 1WZKA 4FZEL 1PZUB 1BFOA 2MTPA 5F70A 4UT7H 2QL1A 3SDAC 4PJ5D 1R24A 2A73B 2VLMD 3RA7H 3SCMC 1U3HC 2Z93A 3X3GH 2RQ8A 1WIUA 1XGTA 3KXFB 5DQ9A 1WISA 4YGAB 3BDYL 3LB6C 1E4WL 2ICCA 1SBSH 4DK6A 4PJCE 4APQD 3NA9L 4HV8A 1JPSH 2BMKB 3FO0H 4OD3L 5IW3A 4MDJA 4Y4KA 3HN3A 5EBLB 3GK8L 4Y5VB 5GS1A 4U1KA 2I9TA 3VA6A 1JZ8A 2ZUTA 1WTGT 4PR5B 1BZQK 4U7KA 5D7IE 4KQ3H 4MSWA 1ES0B 1I1AA 3PWVA 4NQCD 1IAMA 1MJ8L 4H88L 2OBGA 5MEOB 4NNPL 3FT4B 2A73A 3H6JA 4W6XB 1QBBA 2W9DH 4U1SB 5HHMB 1A14L 2EYSA 2V17L 3KXFA 4WW1B 4LLUB 4S1DD 5DA0B 2P45B 3QCTH 2D31B 1TZHB 5HVHB 4JRXD 3T1FB 2K7PA 1ZANH 3SKOB 3VRLF 2BMKA 4HGKC 5DJ0B 4U6XB 1BREA 2LAAA 2YWZA 5ANMA 3UBXI 5EBLA 3RWCA 5DYOA 3DJ9A 4Y5VA 2C4FT 1MCPH 3OKDB 3ESUF 3MLRL 1VACB 4G9FE 2P7TA 2ICES 6FABL 1NGQH 3RWJB 1T03L 4CAGA 3VWKC 3QAZB 2ADGB 1KEGL 1KJVA 1MUJB 4FQXC 4P0DA 3WFEL 5MEOA 3P0YL 2XN9B 1F3DJ 2WINA 5H35B 3FT4A 3MGOB 3S4SB 5ACLA 3P4NB 1X5XA 2Z9TA 1H5BC 4WW1A 4OCLC 3PDDA 2E7BA 5DEGA 4PJIA 4X5WB 3EJJX 1OAUH 2EDKA 4J6RH 3T1FA 4KI1A 4JO4L 3I3BA 2ZG1A 1T5WB 3D39A 4U6XA 5DHXB 3ZHDA 1Z5LB 4HJ0D 1M7DB 2DWEA 4QHKI 3AROA 1HYSD 3DGCR 1QRNA 1DQJB 3QWQB 4JFDA 2AJXL 3ZZ1A 5DQDH 1NUNB 5EULV 1VACA 1SQ2N 2YD9A 1MFEL 1KBGL 5E2UH 3D69A 1WGOA 3I3EA 2ADGA 4HCRA 3SQOL 1F3DH 1MUJA 1P9MC 2XN9A 4LMQI 5C3TA 3S4SA 4XNZB 1NC2A 4Z7WE 3K46A 3NCEB 3UPCA 5DA4A 5JPMB 1HHJA 3QSKB 4X5WA 1IC5H 3E2HC 4ISVA 1MHHB 2HA1A 4PJGE 2AAVA 1FP5A 3O3AB 1T5WA 3RGVC 4OZIB 4Q74A 1Z5LA 3HE6D 1U95A 3UTSE 1BMGA 4QRSA 2X4OB 3QDAA 5DWUL 1XF2B 1DQJA 2DQDH 1UB5B 1EEQA 3UJIH 1S9YB 2ZKHL 3HI5L 4ELMB 1BD2E 4QLRA 4MAYB 3LH2L 5SWQA 1DUYB 1CDIA 1YEKH 2Z31C 4M6MH 3OQ3B 4XB8A 4NC2B 4Q6IB 1RFDL 4M7ZC 1F2QA 4KPHH 1YQVH 3ELAT 2APFA 1OPGL 4WW2C 5EOCJ 5JPMA 4HEPG 3N1PC 3PP4H 4X6CB 2IPUG 1H8SA 3CXHK 3U48A 3VDAA 2H32H 1FZJA 1MHHA 3RQ3A 3RRQA 5I1LB 4PGZA 1RK1B 4NRYB 1OLZA 3P11L 4OZIA 3OBAA 1WV7T 5DJDB 2Z8VC 2DTMH 5SWZE 1XF2A 3B4NA 2EXYD 1K6QH 1UB5A 1ZLVK 1S9YA 2VDQL 4ELMA 2BNQD 5T3ZH 3WIHA 4C4KT 2B0SH 3RWDB 1X5GA 2RFXB 4WEUD 1L7IL 3DVNA 3QIWB 1L9MA 3CVHL 3NIFF 4HS3B 5IJVB 2VDNL 4Q6IA 1T21A 5DC0A 4J3SA 4WU7A 5EOCH 1J8HD 3E8UL 1NUGA 1I9RL 2DYPD 5I76B 2YK1H 5KVEL 1RK1A 4NRYA 1GGUA 2VXSH 3S88L 4HZAA 4WV1C 4OZGB 3JUZA 4DQOH 2Z91B 4JR9H 2VDRL 3JV4B 4P4RB 2CH8A 5FYLL 3ULSB 4LSPL 1CR9H 3FN3A 3P40A 1DBJL 1UWXH 4UOW0 5J1AA 2RFXA 5KOMC 3QIWA 2V2XB 4I77H 4NWTH 4K23H 4HWEL 5IJVA 4AL8H 5CP7A 3SE4C 5EC2B 2HH0L 4EDWH 5KSUB 4X4ZA 3CH1B 4ODVH 3V7AG 1NBVL 4ODTL 4XNUL 2ED9A 4KRPC 3MLYL 5I76A 4MA8H 4QXUL 5DGRA 1CF8L 4GRLC 5FXCH 4PJCA 3NH7H 2FB4L 4PPTA 4BFEA 4XAKE 5D2LB 2Z91A 4GG8A 2DM3A 5B3NA 1LP9B 4Q97A 4RGOH 4HQQL 1CD9B 4KAQL 4M62L 2VXUH 4U1MA 3K0WA 4S2SB 4KKCC 4L4VE 1BJ8A 2ZCLL 1KLUA 4S10A 5D7IA 4MNHB 3FO9B 1MRFL 1LHZA 1BBDH 1T20B 4W70A 1IKFH 3T0AA 3VMNA 3THML 4WCYH 1K9TA 2YPLB 3V4UL 1GVIA 2AXHA 5EC2A 5KSUA 3TEUA 3W5MA 3ALWA 2MMXA 3P3YA 5DXWA 3CFKB 1BGXH 3MLSL 4ODSL 3S3PA 5E7BA 1N5YL 4PD4K 4ZNEE 3ARQA 1EIBA 2EIDA 4M4RA 1QEWB 1JF6A 4OCXH 5HYJB 3MV7E 4XMKH 5IBUG 1CICC 5IMLB 2P1YA 2WUCL 4RGNB 3O3UN 2K1MA 5J11B 4ZFFA 4WHDA 1RZJC 1KCSH 2GJJA 4XNYL 1AXIB 3EKCA 1Z0MA 4PJ9B 4G7YL 3BKCL 3D2UA 5BMFH 5BXFA 3KJ6L 3PWNB 2YPLA 1DEEB 1J0JA 2YHGA 3KYKH 3BKYH 4QTIH 2FATH 3PWLA 4ZO8A 3UZVB 4ZPVB 1K5NB 2FO4B 3ARBD 5EORH 1QEWA 2G5BB 1JGVL 5FYJL 1QBAA 1MFNA 1NCAH 3B2VH 2GUOA 4F7TB 1REIA 2YEZB 4PRIB 1RQ5A 3CDCA 5SWSB 3N1GC 5K59E 4KKLC 1QHOA 3GJFK 3UC0H 3BAEH 2FGWH 5IB5A 1C16A 2CJUH 3X12A 4CL7A 4R7DA 1DEEA 2AXFB 5I1EL 3HI6H 4S1SL 4OAWB 2ATPB 5JNYB 3RWEA 3T2QA 1DQLL 1LK3H 3K4AA 4QF1A 3DRTB 5IBLD 2GCYA 3VD4A 3B8SA 1H3WM 1N64H 4A2MA 5DJXB 1CK0L 3K4ZA 1G9MC 4HH9B 4PJGA 3IDNA 2OZ4L 2PO6B 3BH8A 1A4JB 1KIRA 5JQ6L 5DS8A 3RUGB 2D3VA 2FO4A 2XKNB 1QLFB 5T1DL 4MJ6A 2XRAL 3UTSA 4LLWB 1MCFA 2G5BA 3BP7B 4IDJH 5IEHA 3MRBB 1KTRL 3SDAB 3GI9H 4F7TA 3SCMB 3F5WA 1DN0B 1U3HB 2YEZA 3T1WA 3ARYA 4PRIA 4OZ4B 1IZKA 1G9NH 3CNKA 2Y25A 4PGBB 4ZAKC 1ZOXA 1EBPA 3MGTB 2NW3A 3QG7L 2CXKA 4OAWA 2ATPA 1X6NA 3B3IA 1I75A 2VNCA 5C0RL 4LAJH 3WNOA 1RVFH 3DRTA 2D9QB 3FB6A 5BO1L 3TP4A 1UWEH 1ZT7A 1A2YB 1XF3B 1HH6B 3ULUH 5DJXA 4AMKL 4HH9A 2VAAB 2OQJB 5ALCL 4HKBB 5E0QA 3PV7A 2PO6A 1GGCH 3RUGA 2XKNA 2XNAB 5F21B 3B9VA 1CQYA 1HWHB 3VFMB 2R8SH 4R4FL 5SWZA 2EIZB 3QWRA 2DQCL 1E27A 1J87A 3WMSA 2VQ1B 3SDAA 4HPOH 5E00B 4YGVB 3SCMA 1U3HA 1SJEB 3UJTL 3MRCB 1EO5A 4OFYD 3EJYC 2YKLL 2PTVA 3FKUS 4LSDA 4D9LH 4PGBA 3B6SB 3QI9D 1CFQB 1WEJH 3V6OE 3ARED 2W07A 3MGTA 5A3ID 2PUQT 3SE3C 4YDJB 4ZD3L 3HMXL 4M1CD 2CIIB 4Z7QF 2NY3C 3V7AE 3QUMB 2VAAA 4KK8C 4KH2A 4O9HH 4HEME 3ARDC 4R97C 1RPQA 2XNAA 3QUXC 3PDGA 3VA2C 4M7LT 3VWKB 4LSVL 1NCCH 5F9WC 1IFHH 4RMTA 3TIEB 4FQXB 5FM4A 2VQ1A 1FJ1B 3GM8A 2BC4B 1OTUC 4Z78A 3VFPB 1Q9LB 5I2IB 5FDWB 2HMID 1H5BB 1LK2B 3DETC 3B6SA 4OD1L 5TF1L 4JKPH 4UV4L 1XF5B 4NNXB 4OQ1A 2DQGH 4YDJA 1GPOH 3T8XB 3NBNA 4WWKC 2EDHA 2CIIA 4NQTA 3U1SH 3VGGA 4H20L 2FL5B 2IMNA 3QUMA 4IOFD 5EDXA 3O0RL 3BDBA 4NN7C 2OS7A 1T89A 2PXYA 2IPUK 2PTUA 1IEHA 5KJRL 4CNIB 3TZVC 4Z9KB 4HW6A 1QVOA 3VWKA 1Y0LA 3N9GL 4NRXB 4ZUWB 2R23B 1U58B 3TIEA 2XZZA 5K9KB 4FQXA 4KRLB 3VFPA 4RA0C 3MV7B 3TF7C 4HIJB 1Q9LA 4L4VA 4N90E 3ZKQD 5FDWA 1Q9WA 3EDJA 1H5BA 5FUZL 1BJ1J 5DFVD 1D5IL 3E2HB 3W5NA 1MIEL 5ISZB 4NNXA 5I16B 3CMOL 1RK0A 3W0WB 3T8XA 3VGFA 2F15A 4WO4C 3RGVB 1U8KB 5CSBA 1UZ6E 3VFVB 5CJXA 4FNLH 2FL5A 1UFUA 1A6UH 3DROB 4TVSa 4QRRB 4LLAA 1FAIH 1YJDH 2W65B 3ZE2F 4Z8FH 1IAOB 4JKWA 5GISL 4MQTB 2Z31B 5BV7H 2R23A 1U58A 2WK2A 5EU5B 1A6ZB 4HDIB 5AZ2L 3MV7A 5I66B 4M7ZB 4HIJA 1SHMA 1CE6B 2C1OB 4WW2B 2ZUXA 2OCFD 1PZ5A 1SYVB 1ZLWK 4QHNB 1BJ1H 4GRWB 3BRGC 3DV4A 5ISZA 3UTQB 3HG1E 5I16A 1W72H 3L9RB 4NQVB 3NIDE 5IHLB 3RGVA 1U8KA 3IFPB 3VFVA 3WHE0 5BW7C 1L0QA 4F58L 1JGLL 4WUKL 4N0UB 3ULVF 4IMKC 4WI7A 5E6YA 2E8ZA 4WI4A 1GHFL 1II4E 1FNFA 2W65A 4RMUA 5CZVH 1IAOA 4M8QA 3DI2B 4OLEA 4Y89A 1X5LA 1UCBH 1OWWA 4OQTH 4HDIA 1JUFB 5I66A 1FV1B 1HIML 1B4JL 2P46B 1SYVA 1G7LB 2IANB 4XI5D 5E99L 4BZ1L 2WIIB 1YNLH 4K9EC 4HIXH 3UTQA 1RZKC 3JTSB 2X7LA 5FOBB 3L9RA 3IFPA 1KJMA 4ALAL 2H45A 4WV1B 4LAQL 4N0UA 3JWOH 2X9YA 1A0QL 4RFOL 1J11A 2WMPA 2Q87A 1CWVA 4LOUC 4L4TE 1WAAA 2L7UA 1DTUA 3P4OA 4HUUA 4FHBD 1JUFA 1FV1A 1AHWC 2R0LH 4U49A 1JYNA 1OD7A 4RAHA 2R1WB 1G7LA 2P42B 3PE9A 4U7SA 4U6YB 2DTSA 4KRPB 2WIIA 4JQIL 5FOBA 1YEEH 3CU7A 3LVEA 3S35L 2ZPKH 3PP3K 1FL6B 2X70B 2Q7NA 2A9NL 3OGCB 5DLML 5C8JB 4UB0H 1B0GB 5D2NE 5IR1B 1IAKA 4TPRH 2PW1B 2ZCKH 5TDOB 5C0FB 2IADB 5C1MB 3LEVH 3KPNB 1EGJA 2MKWA 3OPZL 2EH8H 3SJVE 1PBYA 4FXLA 1H3PL 3BSZL 2R1WA 4PP1C 5B3JE 3U0WL 1DFBH 1A47A 4YZFF 4P2RE 4U6YA 4XTRD 3GMPB 1B2WH 5FDYA 4NQDB 5ICZB 3KG5A 3V6OA 1A6WH 2OJZL 4C54A 5DRZA 4HC1H 1WVZA 4KK6C 5IEKB 3VWJC 1GGBL 2XQBH 4WHTB 4ZPTB 3IF1B 1FL6A 2X70A 3HE7C 3NMEA 1CLZH 3QBTB 4XGZA 3OGCA 3STZA 5C8JA 1CICB 5EN2B 4XCFL 1CXLA 2JELL 5JZ7D 5C0FA 3SDCC 2HKHL 1BIIB 4YHLL 3TESA 1NANH 1IE5A 1XCQB 4QCIB 1KPVB 1IRAY 3OGOE 5CP3H 3MA9L 1EO7A 2XXMB 2X1WL 4GKOA 3CXDL 3WXWL 5JA8B 1GSMA 1P1ZB 3GMPA 5ADPL 4NQDA 5ICZA 3PL6C 3WDHA 2Q20A 4QNPF 3QXUA 3K8LA 4X0KB 3UX9B 3MJ9L 2K3TA 4PJHE 1QNZL 1U8PB 2VDKL 5K33A 4WHTA 1QBML 4B7LA 3HRPA 1X4YA 1ZHNA 2EC9U 5HGDB 3QIUA 4H1LB 5MEPB 4M00A 3T3ME 3EYUH 1I3GL 1CICA 5EN2A 1GOHA 1QTYT 1BIIA 4JJHA 1XCQA 1HXMB 5J0BA 1RUML 4QCIA 1KPVA 3Q6GH 2HT4D 4G8GB 4TUJA 4HXBL 2WUBL 2BNUA 1I1YB 3LV3A 3WEXA 2X4UB 4P23D 4V2CB 1P1ZA 5ADOL 2X09A 3JWNC 4XXCC 4GKNA 2XOTA 1D9KC 5JW4N 5HGAA 5HGBB 5T3ZE 2H2PD 3P73A 1AGBB 1JPST 2J2ZA 5CJQH 3C08L 5I1AB 4NBZB 1PGRB 2YPVH 5CEZD 1JHLL 3OKKA 1E4XL 3P9WB 3H9SB 5DMKB 3AS1A 4E5XB 4DWHA 4AEIL 2L0DA 5C0CE 3O4LE 5HGDA 4OCSL 1N0XL 3HUJE 5IB3B 5GS0L 2AJZB 5GZOD 3KPSB 4WU5B 1GCFA 2OTWA 5C6WH 4ZTPH 2FBJH 3C2AH 3LPFA 1IAIM 3HS0B 1UVQB 5A43C 4ZAKB 4LSTH 5CLTA 2ED7A 3RY6C 1KIUA 5MP6L 3N1FC 4QXGL 4GRMA 2JJTA 4ZFOB 1RHHA 3ZDXE 4HS8L 1EXUB 4LSSL 2X4UA 4Y4FC 2VC2H 3FFCB 1AGBA 1QBLH 3HG1A 2NXZC 2GKIA 5I1AA 2F74B 2VABB 2C3GA 3HRZB 5FYJU 3H9SA 2BHUA 2R0WH 4D0BA 5BRZB 5DMGD 3VI4F 3CSYB 3UYRL 3PF2A 3BPCA 5KSAD 5IB3A 2AJZA 4KKBC 4OD2B 1H3VA 1JV5B 3M07A 1UB6B 2VN4A 3HS0A 1UVQA 3ULVC 4ZAKA 4NWUL 3V5KB 4N0FB 3KYAA 3LKSA 4ZFOA 5E2TL 5TH2A 3QZWB 4V1DB 1EXUA 1MJ7L 5L2KB 2ZJSL 3KPPB 3JV0A 5FGBC 2NY3B 3FFCA 2D03H 3JXAA 5F6IC 3VFWA 3UXFA 2P5EE 1CT8B 4P3CL 4ZG1A 5JHLL 2NW2B 3OL2A 3ARDB 1UG9A 4R97B 4MNGE 2F74A 3QUXB 2VABA 1ERNA 1AD0B 3ET9F 1XMWA 1TXKA 5F9WB 3CSYA 1AIFB 3GHEL 1BQHG 3SKJH 3WDIA 4KFZC 2W1NA 3WXVH 2Z92A 4LIQH 2APBA 1J1XL 2DL2A 1U8OB 4UDTA 1BQLH 1AJ7L 2V9RA 1FCGA 1VGEL 4M61A 3TBYA 4U3HA 3V5KA 3P9LA 5D1XD 2JCCE 5IFHH 2FX7L 2J1KA 3SE3A 1SY6L 5DMIH 2AK4D 4TOYH 5JORB 3KPMB 3BP4B 4GKSA 4V1DA 4WWKB 3UTPD 5L2KA 3DURA 3KPPA 3OJDB 4PRDA 4DK3A 5I1GH 4NN6C 3FHAA 3GI8L 4NN7B 1OAXL 1BFTA 1E6JL 3MCG1 3QCVL 4EKXA 3QUXA 5BOPA 3TZVB 4KWUA 1KC5L 3WFBH 3M1BA 2D7MA 3LIZL 5J4MA 3EFFB 3DVFA 1RUAH 4HK0B 4G7VL 1UEMA 4MA3A 1ORSB 1A3RH 5D2NA 1U8OA 5TQ0H 3RDTC 1CGVA 4ZTOH 5C0EA 3DSNA 2VH5L 4Y4KD 3TJHC 3BISA 1C7TA 5DRXB 3ZE0F 1NCWH 1JHKH 2YZ1A 5LQBL 1HH9B 4ONFH 5FM5M 3MCLH 5E2VL 4HIHA 3KPMA 3BP4A 4PLJD 5F96H 4WO4B 4WWKA 3L5JA 3KYMA 1I1AD 3OJDA 1IGIL 3KPLB 3G5ZB 5HTSA 4ZFZB 4B0MM 4U1HB 3D9AH 4HG4J 1RZGB 3H7BB 2ZOLB 3CUPB 4NO5B 3TZVA 3ZL4H 1RAMA 5EUOE 4K3DH 5E6IC 3ZYOA 3KXFD 4PG9B 5GIRB 1KJ3H 4H5SB 4Q9RH 1ZLWH 3WIIL 4JFEE 4OLZL 4DOHE 4XPBL 3IS0X 4G3YH 1YMMB 4LSUL 4RISL 1FL5A 1HH9A 5GRUH 1FDLL 4IHOA 5E4EC 3WNMA 5M94B 4WO4A 3KPLA 1BIHA 3GUTB 4XB7A 2WWMC 4ZFZA 4U1HA 3BIAX 1KG0B 1FC1A 3H7BA 3DIFA 4XNXH 5H2BB 2ZOLA 1INEH 3CUPA 4NO5A 3S37H 4PJHA 5DR5L 4DZBB 4J7RA 1EERB 12E8H 4PG9A 4H5SA 4DN4H 2EE6A 3RPIB 1YC7A 4KJQD 3D39D 4L29A 3VXMB 4IS6B 1YY9D 3M45A 4O2CB 5HDBE 1QRND 2H32A 3CCHB 3ULUE 4FP8H 4JFDD 1PLGL 3GKWH 1G7QA 3R0NA 5C0BB 4R4ND 3CZFB 4F2MB 4Y1AB 3LMJL 5BW7A 3W39B 2YN5A 4Z0XB 4BSJA 3GUTA 3EJZD 3P30L 4O5LL 2XN9D 1V7NL 2EDLA 3MRKB 5H2BA 1NC2D 4GQPH 2JE8A 1MCBA 5JW3L 2GQHA 4DZBA 3RTQC 1TTFA 4QGTA 5CINH 2OL3H 2ZUSA 3X17A 3HUJA 1C1EL 4YFLI 1AHWB 3VXMA 4IS6A 4O2CA 1UJ3C 4LU5H 4X7FC 3PGDB 4YAQB 5C0JB 4GH7B 4XBEL 5T3XD 3PP3H 1H9VA 3CZFA 4F2MA 1OSPH 4Y1AA 2FLRT 3OXRB 1RUKL 4Z0XA 1JRHL 4I2XE 4CUCA 4XH2B 5KZCB 3S9DB 4ONHB 4AJ0A 3TO4A 2Y06H 3TBTB 1IAII 1MY7A 3B5HA 2FJGB 4OIIL 4GG6E 4CADA 5CD5D 5I8KL 2VXTL 1YEFH 3DPBA 3N06B 3C8KA 5JOFA 2B4CC 4NKIH 2O5YL 1ACYH 5JXAL 3U9PH 5JIPA 1CL7I 5BVPH 2IPKB 3PGDA 1J5OL 5HPMB 2C1PA 3VWJB 4OZFB 3OXRA 4XP5L 4JGJA 3HE7B 1WC7A 3MYZA 1R3LA 4ONHA 1U8JA 4MWFB 3UBXB 5F7EL 43CAA 4PJAF 4YQXL 4GAJH 1YNKL 2A6DA 3O4OC 1YYLL 4I0PA 8FABA 5DVOA 5JW4R 4FMFA 4JFFB 5EO0B 3SDCB 3HHRB 5J13C 4JFXB 3LHPH 1CTNA 4MDIB 3HNSH 4RQQB 5DFWH 5TFSL 4JDTL 4KU1A 1KN2L 3CSBA 1TJGL 3G6JF 1PVHA 5JQHC 5F9OL 4N1HB 4CJ0A 2IPKA 3SOBH 1NLBL 2CGRH 3PL6B 5HPMA 4PJXB 1FFOA 4FZEH 3CAFA 1VERA 2JB6B 3VWJA 3U79A 3QIWD 4JHWL 3M17A 4P2OC 3MRNA 3UBXA 3MREB 1DVFA 1XGRA 2Y5EA 5EO9B 4FFVD 4J12A 3BDYH 3L5HA 4P48A 4YXHL 4WUUB 4JFFA 2PN5A 5EO0A 3SDCA 4JFXA 1P4LA 4MDIA 4RQQA 3NA9H 2O5XL 2Q8AH 2YXMA 4OD3H 3R1GL 3H7LA 3MV8B 1RJLB 2P5WB 3FONB 3HR5B 4WFFD 4MVBD 4PB0L 1D9KB 4G6AD 3SDDB 3PL6A 1E4KC 4ZXBC 4PJXA 3FN0L 4NZRL 4AG4H 2A6KB 1A1MA 1M71A 2EKJA 2MCPL 2XZCL 4H88H 4XPGL 5HI3D 1X9QA 3F7YB 4NNPH 5IHZB 3V0WL 2FGZA 4JY4B 2A38A 3MREA 2GYSA 1A14H 4QRTB 3KDMB 3BOVA 5EO9A 1NLDL 1AXTH 5IQ9A 2Q1EA 4WUUA 3CU1A 2FIKB 3I2CL 4XX1G 2VITB 2J6EL 4GBXC 4JFEA 3D1MC 4OKDA 2C9AA 4Y4FB 5F9DC 1P84K 3VFOB 2P5WA 1ETZB 3HR5A 3EDDA 1IGTB 3EGSB 4XXCA 3MLRH 4JPIB 4AEEA 1NFIB 3SDDA 1JTOA 4ETQA 1T03H 3HNVH 1XT5A 1RSFA 2NXZB 2J5LC 1KEGH 5DJAA 3WFEH 1BF8A 3P0YH 3RWGB 4BUHA 1EEYB 4LHUG 3V0VB 1FNGB 3F58L 3D2UD 5IVZB 1INDL 4PIRF 2BOCB 5HGGS 2YPLD 1BFVL 4QRTA 3H8NA 4KJPD 4PGDB 5FYKL 5EH1A 1ZVHA 4N8PA 1ZE3C 5IJKC 1K85A 2EDJA 4JO4H 4HFUL 4BJLA 1OP9A 2SEBB 2VL4A 3TPKA 2VITA 4GMTL 5SV3A 3MBXL 5FFLA 4EIZC 3SKMA 3QEQE 4TUKL 2R4SL 4Y4FA 2EO9A 2AJXH 1ETZA 1UYWL 4OBRA 3WFHB 4JPIA 2B2XL 1NFIA 2ED8A 1U2HA 4FABL 1MFEH 1KBGH 5F6IB 3F65A 3O3DB 3MLVL 5HHXL 1ONQB 3U30C 2JIXB 1MHCB 3A6OA 3OKOB 4RGND 4Z0BL 1R3JB 1ZA3B 5GS2D 5T1KB 3SQOH 1TVDA 3RWGA 2NLJB 2VXQL 5DVLA 1EEYA 1FNGA 5IVZA 4ZNCD 4JDZA 2BOCA 4MZ3A 1H0DA 3TV3L 3PHOB 5JXEC 4PGDA 2H1PL 2RJMA 4WVRA 1I1FA 2IALB 2JF1A 3GSOA 3IFLL 5EIVA 2BCKB 2SEBA 5FK9B 4OLXL 3TN0C 4KXZH 3QH3B 5DWUH 3UTSD 5FGBA 1M4KA 1PD6A 2M26A 2ZKHH 3HI5H 1B0RA 3ALPA 4NN6B 2AXGA 3WFHA 1OOAA 3KPQA 3LH2H 5DK3A 3TBWB 1CFVL 4KC3B 3ZDZE 1DQQB 1GL4B 3O3DA 1ONQA 1MH5B 2JIXA 4PRID 3QJFB 3K80A 1RFDH 3FQRA 4L9DA 1FG9C 1OPGH 4PRPB 4PJBF 3PHOA 3FB8B 2Q3AA 5FYKD 3RDTB 2F58L 3W9DB 1X7QA 4BA8A 2IALA 2BCKA 4P5TC 3P11H 2PO6D 1WCBB 3G5YB 3WYRA 5D7JC 2OTPA 1IKNC 4GXUM 5E94B 1N0LA 5SWZD 2VDQH 5TDPB 3TIDA 3QWRD 5HYEA 1OGTB 3TBWA 3T0XA 3SDAD 1L7IH 5B3JF 1MH5A 2W0FB 5AYQA 3SCMD 1U3HD 2AJUL 3AU1B 3CVHH 3JVGC 3VU2A 5E6IB 3OKLB 2VDNH 3QUKB 4CVZB 3KYNB 4PJFF 2GITB 4PRPA 3E8UH 3NN8A 1I9RH 4OM0L 4F80A 2O93L 5GJTL 3RDTA 1I3RB 1V3LA 3LQAC 5KVEH 1EVUA 4XCYB 3RKDC 3T77B 1JF1B 4IMLA 3S88H 4KUZL 5E4EB 1MQKL 4Z7VE 1UENA 4LSPH 1QZ1A 4P2QE 1GOFA 1OGTA 1DBJH 2FWOB 5B39B 5GS3A 3AU1A 2FZ3B 4HWEH 3OKLA 3QUKA 5DO2C 3KYNA 5F7UA 2HH0H 2VUOA 5E5UB 1KCVL 3RVUD 1NBVH 4ODTH 3VH8G 4XNUH 1I3RA 2I07A 3MLYH 4Z7UE 5FF6B 3GSNB 5JHDE 15C8L 4QXUH 1CF8H 1U8IB 3ARTA 4XCYA 4FTVE 4E42B 2FB4H 4CBPA 4LQFL 1ZWIB 2PXYD 1U93B 4JG0H 4I48B 1MCOL 4MA1C 4XX1E 1A8JH 1AFVH 2VMFA 5GJSL 3D87B 4XAKD 3DUSB 3VWKD 1RULL 1I9JL 1IGCL 4HQQH 4KAQH 4M62H 3LEXB 4ENED 3QWOA 4FQXD 1WFOA 2ZCLH 1A7OL 3O2VH 5E2WL 2DKUA 5B39A 3MZTA 4L4VD 4MQSB 1MRFH 4GLRI 1OT2A 3QRGH 4YFLF 1A1NA 3RTQB 2ADJB 2EE3A 1Y6MR 3THMH 3FOMA 5JMOC 4OQTA 4JZJC 4KTYA 3D6GA 1H15B 1LO3L 3QO0B 2FR4B 4Q9BA 4FQQB 1UJ3B 5DK0A 4UTAL 1U8IA 3MLSH 1YNTB 2ZOKB 4E42A 3VXRE 1N5YH 1U93A 2ZUVA 5KSBF 3VJ6B 4M7JL 1VADB 3DUSA 4YEFA 3WE6B 1RIHL 4ORZC 5F44A 3LEXA 3SEPA 4RRPA 1EUTA 4LFHG 4F37F 3ZDXF 4LIQE 3MV7D 2GSGB 3EDKA 4D0CB 2R9HC 3QDGB 4XNYH 3RTQA 2ADJA 5FAAA 4G7YH 3BKCH 4B53A 1H15A 3Q5YA 4OCMC 1I9IL 5ISZD 2CD0A 2Q8BL 4KMLB 4LRNL 3QO0A 2FR4A 5E9DE 3RGVD 1MI5B 3SQBA 1UJ3A 2UWEF 4LPWA 4NUJB 1CFNB 5B8CC 1YNTA 2ZOKA 3O6ML 4Y5YA 3V4PL 1NCDL 3NA4A 5J3HD 3BIKA 3VJ6A 1XF1A 4YE4L 3QEQA 2YRLA 1KCUL 1HNFA 2EE2A 3AY4A 1JGVH 1G0DA 3MOQA 5DD3L 3ZO0A 4HZLB 3DGGB 3BWUC 2GSGA 4D0CA 2V9TA 2AEWA 1HYRC 2P44B 3O4OB 2AW2A 1PEZA 3QDGA 2KBGA 4UT6L 1I4FB 1VFMA 4AM0A 1XGQB 1T66C 2UZYB 1F00I 5J13B 5I1EH 4S1SH 5BVJB 1DQLH 4J1UB 1J9CT 1AGEB 1N4XL 3DBXB 3JV5A 4FFYL 4XVTL 1MI5A 5I9QC 3K1DA 1UXSB 4NUJA 5I74C 1FNSL 3QDJB 1FFRA 2OZ4H 5JQ6H 1A7NL 2XIDA 4GFTB 5T1DH 4HC1A 1AD9A 4QHMB 4U33A 2RBLA 1GH7A 4K3HA 5EU7C 2MOVA 3LOWA 4P2OB 3PWPB 3G08B 5IBTL 2D0HA 5JO5B 5TE6L 4ERSL 3GJFB 3OKEB 1S5IL 1KNOB 1I4FA 3MV9E 1XGQA 5FO7B 2FNBA 5T1MB 2VZ1A 3MJGX 2NX5E 3QG7H 3TCLA 4G6ML 4J1UA 2YUZA 5C0RH 5BO1H 3PQYE 3QJHA 1UXSA 2C7UB 3QDJA 1TMCB 4AMKH 5ALCH 3PGFL 1FQ9C 5IFJB 4ZXBB 3IDYC 3RI5K 4AENB 4R4FH 2DQCH 1I8IB 3LN5B 4YX2L 4KJWC 3PWPA 5JO5A 1RZJL 3UJTH 3GJFA 3OKEA 2FECI 1VSCA 4XPAL 4KK9C 2LV4A 2YKLH 1KNOA 4OB5L 3S36L 5T1MA 4KRPD 1CS6A 4FQHB 4R3SB 3QCUL 4ZD3H 3HMXH 3J8F7 3RL1A 5EBMB 4GBXB 2MKLC 5D1ZA 5D6DC 2C7UA 3ZE1E 3RHWK 2PTTB 4MNQB 5LXGL 3CFBB 2BHZA 3SBWC 1E4KA 4ZXBA 2OXGA 3CSPA 4LSVH 4AENA 1T83A 4X4MA 2J5LB 3CX5J 3BZEB 1TETL 2HLFD 1I8IA 2RCSL 2BNRB 1WFUA 3LN5A 1S7VB 3QXWA 2UVFA 4WIQA 3NFSL 4PJDE 3TFKC 1LO5A 3MRGB 4OD1H 3VD7A 5TF1H 4UV4H 3TA3C 1EJ6A 4MXVF 4FQHA 4NQDD 5B22A 4R3SA 5E8NB 1MCCA 3IGAA 5EBMA 1F6LL 1WFNA 4H20H 4M8VA 1G1YA 3WV0A 2PTTA 3O0RH 1UGNA 4MNQA 1CDGA 4IRZL 2BX5A 5KJRH 4IIQC 3QIUD 2VLME 1CICD 3KR3L 1ZA6B 5C0NC 3U30B 3BZEA 4XZUB 1CFSB 2BNRA 4QY8B 5LAXB 1S7VA 3C5ZC 3UJJH 2EIBA 1DDHB 1N8ZA 4N90D 4XP6L 5C0GA 4GAGL 3MRGA 3C8HA 1TNMA 2NY6D 1D5IH 5EBWB 1MIEH 1B6UA 3CLFL 3T0EC 4NKMB 1MFDL 4P57B 4KZEL 1E4XI 5HHQB 4QO1A 4M1GL 1MCQA 4XVUC 1NEUA 3TN0B 5C6PB 4F7PA 3H0TB 2F9BT 4YJZL 2DM7A 2CO6B 3AC0A 4LEOA 3VXRA 2CK2A 4JEGB 1XH3B 5GISH 3NCCB 4N8VA 1AKJA 1ZA6A 2GTZB 2CKBB 1O7SA 4XZUA 5IV2A 4YNYA 5FKAA 5LAXA 4KKLD 43C9B 3QIBC 3O2WH 4ZOAA 5AZ2H 1FIGL 4JRXE 4L8DB 3GKZA 5EU6E 2EZ0C 2YWYA 2NY2C 5DHYA 4OLYL 1T0NB 5JXEA 2IQ9L 5SX5K 4FQ2L 1KACB 2VWEE 3MJ6A 2FIRT 4NKMA 4MA7L 3FQTB 5HHQA 3HG1D 4P5TB 4YHKL 5D7JB 2HVJB 5DVKA 3TN0A 4F58H 4D8PB 1JGLH 4WUKH 1I3UA 3WFZA 3H0TA 3S5LG 2IC2A 3H9SD 3MJ8B 1FZMB 5DJ8B 5IVOA 1GHFH 1XH3A 2VLLA 4JM2F 3KPSD 4RX4A 3D18A 2GTZA 2CKBA 4IJ3C 5A2FA 1UCTA 5CBAA 3HAEH 4HSQA 1LEGA 4ZAKD 4LLVA 2QQKL 4L8DA 4HIEB 4JJ5B 1S7WA 1T0NA 4BZ1H 4X5LA 1A02N 3HI1A 4G9DB 5IIEA 5D96C 3FFCD 3RY5A 5IOPB 1FSKC 5JIIA 3FQTA 4JANA 2CO7B 2PW2B 1TTGA 4QTHB 5E8DL 4PJAB 1CDUA 3DLQR 3A6BH 4ALAH 2DI8A 4UILL 5D7JA 4D8PA 2X1PA 2C5DC 2Z4QA 4LAQH 1JPGB 4RMWA 2AKRA 1FZMA 1J1PL 3MJ8A 3U0PB 3SKNA 1A0QH 1TCMA 4RFOH 3HMWL 2LVEA 2VQUA 2CLRA 3ARPA 1ADQL 4RAVA 2FJHB 1A6AB 3G6JB 1XCTB 3IT8D 3JVGA 1WITA 1K3IA 3HKFA 2XWTB 2E7CA 4NKDA 5EWIH 2X1XR 5SX4I 4K55A 4HIEA 4JJ5A 3CFIC 4LEXH 2VB5A 4Y0GA 5DRWB 1A6PA 4V1DD 2GAZB 5L2KD 2WP3O 4G9DA 3BJLA 4EIGB 2NY3D 2NX5A 5IOPA 5F8QC 4JQIH 5DD0L 1GAFL 2PW2A 3PWUA 2N1KA 3T65B 4KK8D 3S35H 5I1CL 3OR7B 4MA1B 3TT3H 4OF5A 3QUXD 5ESQA 5AAMA 3KPTA 2A9NH 4AYFA 3U0PA 1OAZL 3QHFL 4JQXA 3BP5B 5DLMH 2F5BL 4YIQB 1OTUD 2FJHA 3G6JA 1A6AA 2XTJC 3BZFA 1DQDH 3VXUE 2XY2A 4JFOB 4DVRL 1WCQA 4PJ7F 4RMQA 5FECA 2A2QT 3MA7B 3OPZH 2XWTA 4EQ2A 1T0MB 4JZJB 1OAYL 3DETD 3KJ4C 3RAJL 3BSZH 5ETUB 3EOBA 1CFBA 3U0WH 1DUZB 4ZOBA 5DRWA 1UA6L 4WWKD 4KVCH 3NACL 3D0VB 3PJSA 3LZFL 1NFDE 5IMOB 2OJZH 3T65A 1NAKL 5F97E 3CK0L 4YHNB 3OR7A 1CLOL 3VI3E 5LGHL 1GGBH 4U0RC 5LKNA 3TZVD 1BLNB 5CEZH 4FQ1L 3T3PF 3F6IA 4HAFA 4F3FB 5JUEL 3V4VL 3OB0H 4YIQA 1J8HE 4FQCL 4I4WB 5CJOL 2JELH 1ZMYA 3ZTJH 4MLIA 2HKHH 1S9KC 4YHLH 1K2DA 1S7XB 3MA7A 2OL3A 3GIZL 1A4KB 2ARJB 2V5MA 3MA9H 2FX9L 5HJ3B 5ETUA 1KLGB 1MHPL 3O6FA 5DHVH 4K9EL 4N0YL 1DUZA 1GYAA 4XRCB 1RZKL 3CXDH 3WXWH 4WO4D 3ZKNC 2B1HL 2ENSA 5ADPH 4TVPL 1DEDA 3D0VA 4QT5B 2OM5A 5B8CB 3JZ7A 5IMOA 2G9HB 4UIMB 3IDXL 4HF5L 4GSDL 4YHNA 1R5IB 5JIKA 1QNZH 2VDKH 3F62A 5AWNL 1QBMH 1HHIB 2HKFL 1R3IL 5JDSB 1MLCB 3I75B 2FHFA 4F3FA 2P24A 4MCZA 1Q0XL 4WEMB 5CWSB 4XMLH 3B83A 5EZJB 1DR9A 4YBLC 1S7XA 2EDWA 1RUMH 3DYMA 1FLRH 4X6BA 3HZVB 1LE9A 2J88L 3QPQD 1KLGA 1ZT4A 4HXBH 5EU6B 2ZZUT 1YEDA 2AV7B 1BZ9B 4XRCA 5I9QB 5B21A 5I74B 5B8CA 1I8LC 1MIML 1CD8A 1T7WA 2G9HA 4JO3L 5T3ZD 4CVUA 3C08H 5C7XL 1R5IA 3F12B 5GZND 1JHLH 1UM6H 2R69L 1XGYL 1RU9L 2YD8A 4N1CA 4LRIC 1NPUA 1K4DA 4UU9B 4XVJL 5FUCC 5JDSA 1MLCA 3I75A 4LHQB 5TGBB 2GFBB 4AEIH 2JJSC 4OCSH 1N0XH 1L6ZA 3N1MC 4OFVA 5GS0H 1CD1B 4S1QL 1KCRL 1ZV5A 1J12A 5AG8A 1N5AB 5DC4B 1ZK9A 3MLPA 1MRCL 2X4NA 4KY1L 1NL0H 2EH7H 3EYQC 3VXMD 4E41E 1T0PB 3Q1SL 5MI0C 5D5ME 4JFYA 5MP6H 4MS8C 4QXGH 1XGPB 4UT9L 3SGEH 5EU6A 2AV7A 4HS8H 5C0BD 1BZ9A 4LSSH 3SGKC 3JTTA 5D72L 4Y1AD 1Q9OA 5D7LB 4WRLA 1QR1B 1NQBA 1RUPL 3C9NA 3MZGB 4YHOL 3MUZ1 2ZSWB 5HVGB 3TO4D 3F12A 4GW1B 4NIKB 3IDYB 5E8PB 2J7LA 1U6AL 4NQXB 2ICWB 3FQNB 4UU9A 1G0XA 4LOUD 2YMXL 3SHSA 4JREC 5TGBA 1C5BL 2DQEL 3EZ8A 3UYRH 1CBVL 5I1JL 3NFNA 1CD1A 2AJVL 4X98B 1OWRM 4BK4A 5IB2A 2YC1B 1N5AA 5L2JB 3ZT5A 3BD5A 1JWUB 5LGKA 4NWUH 4ODWB 1PJ9A 4QRQB 5I19L 4MJ4A 1XGPA 5H94B 1CGYA 5E2TH 4JM2C 2NZ9C 3QFDB 1MJ7H 2JB5L 3HPJA 2ZJSH 3CDFA 3P0GB 4Y2DC 4HHAB 2DQFB 5D7LA 2AV1B 4P3CH 5JHLH 3HFML 2IJ0C 4PJFB 1MAKA 1EUUA 4Q9QL 5E8PA 4NQXA 2ICWA 4I0PD 3QQNA 1EX0A 3GHEH 4O2FB 4X98A 3ARGC 1AJ7H 3ILQC 5FUOL 1WTLA 4NZUL 1VGEH 3O3EB 1JWUA 4PP1D 4Z7NE 1UH4A 4RNRB 4MAUL 4ODWA 4QRQA 1NGYB 3TA3B 2VLKB 2FX7H 1LE5B 1SY6H 1FBIL 5I1IH 3TPUA 1ZGLB 5SX4H 4EDXA 3NIGF 4KK6D 3QA3A 4P59L 4BH7A 5D6DA 3VWJD 2ITCA 4HHAA 1IGFL 3VDCA 2DQFA 2AV1A 3GI8H 1OAXH 3L3IB 1JBJA 2R2HA 1E6JH 3QCVH 4PJFA 1FVEB 3G5VB 4JZOB 4IIQB 1DVFD 1KC5H 5JW5B 2APXA 4BYHA 5IKCB 3F7VB 5JOEA 2BVOA 5I6XC 4QEGA 3LIZH 1FYHB 2J8UB 2E9WA 4JFFD 3SDCD 4TSCL 2FX8L 3VXQA 5C9JB 3S3JA 3C5ZB 4MLSA 5C6TL 4JB9L 2AEQL 1A7RL 2DD8H 1EDQA 3KS0H 3VXUA 1RJYA 2VH5H 2CQVA 3TYFB 3SGJC 4S0TD 4RNRA 1NGYA 3T0EB 5LQBH 5I17B 2VLKA 1LE5A 1RMFH 5E2VH 3PL6D 2HJKB 5D7KD 4F7MB 1ZGLA 5I0ZA 2BXZA 1CVSC 4G43B 1NFDA 5CAYB 2RAMA 4HCRH 3L3IA 3T2OA 1FVEA 1WJ3A 4JZOA 5DFTA 3VFNB 1G7HA 5JW5A 3F7VA 1Q1JL 2WIMA 4H0GA 1KCKA 2J8UA 4WUUD 4NOBA 4LLMB 3QIBB 3RI5F 3SDXB 3WIIH 3QQ4B 4X7DC 3C5ZA 5C9JA 2CUMA 3ULVL 5KSBB 4OLZH 2G60L 5SX5H 2NY2B 4Z77B 4KQ4H 5FV1L 4JFED 2A9ML 4XPBH 3TYFA 4RISH 4M6NL 2P5WD 3T0EA 5D6CB 5I17A 1FDLH 3RNQA 4P5MB 4AEHH 1X4ZA 3SDDD 2BSRB 3HLAA 2HJKA 1S5HA 2NY5C 3HAEG 3L5WB 3GMQB 4HH8A 3U4EB 2AK1L 4EI6B 3EDFA 3ARFA 2X41A 4G43A 3CFEB 1AP2A 1NBZB 1Z3GH 2AQ1A 5HDQL 3RHWF 3TYGH 4B41A 3GO1L 2A6IA 1U8HB 5DR5H 3CVHB 5DDHA 3BD4A 3KYOB 4IJ3B 2UWEB 4HUNB 1NBQA 4LLMA 3QIBA 4ZUUB 5GGQL 3SDXA 2ZG2A 3H3BC 3QQ4A 4GAFB 5ITFB 4Z77A 1N6VA 3S7GA 1FFQA 3U0TB 5KN5B 2F19L 4ZS7L 5TE4L 5CSGA 4Y4FD 3VDBA 1PLGH 4MZ2A 5D96B 1EFQA 2JKXA 5C86A 3ULUD 1FSKB 3I9GL 4P5MA 2NYYC 4HS6B 3UZQA 3QFJE 2BSRA 1DBKL 3SY0A 4M03A 3L5WA 1H8OA 3GMQA 3U4EA 3LMJH 1ED3B 1A22B 1MWAL 2DWDA 5K9QI 1QA9B 3P30H 3CFEA 2PYEB 4CU8A 4H26B 4O5LH 4Y16C 1NBZA 1V7NH 4R0LA 1JZ5A 1T7ZA 2ARJQ 2P8PA 5JW3H 1U8HA 5IK3B 5BZWB 3CVHA 4AIZA 3KYOA 2UWEA 4U0QB 1ZLUK 1U8NA 1FE8L 1C1EH 3IXTA 4L3EE 4K3EL 4HK3N 5ITFA 1KOAA 1OHQA 4E41A 4X6DF 4MHHI 5C08B 3ZTNL 4WI3A 5FGCB 4Y19B 4LCUB 3CFCL 4EJ1C 1QFPA 4XBEH 2CDEB 5HI4C 2ITDA 3K81A 5L7XL 2DICA 1ED3A 1RJCA 3DHMA 1FVDB 1RUKH 2JIXD 5T1KD 3KHQA 1JRHH 2PYEA 2ESVB 4H26A 4ONGL 2GI7A 1FFPB 1HCVA 2CDGB 5F6HJ 4UINL 4ZO7A 3AM8A 4OIIH 5CEYB 2XTJB 5BZWA 5I8KH 4KMQA 2OP4L 2VXTH 5HBBA 4TYUA 5I18L 1LD9B 3RBSA 4OLVL 3F6LA 4O02L 2O5YH 3KJ4B 4QOKB 5JXAH 3UMTA 1P4IL 3D85B 4PLNC 2F5AL 2IBZY 1VA9A 3RP1A 5C08A 3JUYA 4NO0B 2QSTA 1JWSB 4NJAL 1BHGA 1J5OH 5KAQG 3IDMB 4LCWB 4OGXL 5J89A 4LCUA 1G7MB 2CDEA 3QPXL 4LCIL 4U6TA 4BH8B 4KI5F 4RGMC 5HD8C 4U0RB 1FVDA 4U6VH 1U2CA 4XP5H 4PGJA 4IRJC 1FFPA 1GIGL 5F7EH 2R39A 2X1QA 1JHTB 4XWOD 4YQXH 1YNKH 2EDEA 3MXWL 2C4XA 4PRPD 3ZE1F 1OLLA 3RDTD 1LD9A 4RDQG 4JFQB 3HZMB 3TJHD 5TFSH 4JDTH 3GSNL 1KN2H 3G9AB 4NSKB 1AY1L 1TJGH 5F9OH 3D85A 3K1KC 4ZOEA 2HJFB 4NO0A 5J6HB 1CQKA 4PP2B 1NLBH 3L3GB 3IDMA 4LCWA 1RZFL 3KPRE 5GGUA 1G7MA 3ARUA 3NVQA 4P9HL 2W91A 4IRSC 4BH8A 5FCSH 1MJUL 5B4MC 1LQSR 4WI2A 2DMCA 3O41B 4JHWH 1ZVYA 5CZXC 4DUWA 3TH3T 5B38B 3P9MB 5LCVH 3LS5L 1JHTA 5D93C 4XVSL 4D0DA 3MROB 5F93C 1TJIH 4OI7A 4YXHH 4UBDC 3RY4A 4YBLB 1FYTE 3TT1L 4L5FL 2HFFB 1R5VB 3C8DA 5E1AB 5GRZA 3R1GH 1UZ8B 1AGCB 3EO9L 3SO3C 2PCPB 3BP6B 4MXQC 4ZO6A 2HJFA 5J6HA 4HBCH 4PP2A 4O2EB 4PB0H 1C5DA 1YC8A 1XFPA 3FN0H 3RIFK 4NZRH 3SKUD 3MUJA 4HJJL 2IWGA 2Z8SA 3VFTA 2V5RA 2XZCH 4A2LA 3O41A 4JPVH 4L1DA 3V0WH 5B38A 4CJ1A 3LKOB 2E9BA 3MROA 2D7OA 2D4FA 3N85L 2H9GB 4Z7OE 1GC1L 1NLDH 2B4CL 5FO8B 3D5OF 2EDQA 5MI0B 2CPCA 3I2CH 2HFFA 1R5VA 1BX2B 3QNYB 2J6EH 3AREA 2IQAA 1UZ8A 1L7TL 1P7QA 3BXNA 3BP6A 4K3GA 3CC5B 1EEZB 4G6FB 2APTA 2IBGA 4O2EA 1I8LA 1KYOK 4XC3L 2OZ4A 4UOW1 3IVKB 1A3LH 4NHUB 4JDVB 3EO0B 4Z95L 2IH3B 4LRIA 5HHOB 4M02A 4JKKA 3RTQD 4JREB 3LKOA 3F58H 2JJSA 1INDH 2DBJA 3BMWA 3NPZB 3QEGL 1PW3A 1T2QH 2H9GA 3KLAB 4NQSA 1LMKA 1F97A 5FYKH 1XR8A 3OR6B 1BX2A 4HFUH 4UUJB 3QNYA 3VFRB 4N8CL 4JM2B 3MBXH 2XFXB 1BVZA 3LQMA 4TUKH 2R4SH 3MUHL 1EEZA 1FZOB 4YR6A 2QSVA 2BY1A 3QEQD 1MCIA 4Y2DB 1UYWH 5A40E 2DLEA 3GB7A 2B2XH 2YD3A 4NUGL 4ORGB 1P69B 4XCCL 4FABH 1EMTL 2QADD 3IVKA 2R4RL 3QUYC 4YBQD 3MLVH 3OAZK 3IRPX 3QFJA 5HHXH 4AT6A 2A0LC 3EO0A 4Z0BH 3SPVB 3WO3B 4PV8A 1QSVA 3QDGD 2VXQH 4KJYB 5HYSB 3TV3H 3DTXB 4RZCA 3KLAA 3ARGB 4L9LC 2H1PH 2ORBH 3QXAA 1MI5D 1MVFA 5EOQL 4ZUVB 4DAGL 1JYVA 3OR6A 4EEEA 3IFLH 2BHYA 4UUJA 3S3SA 5CGMA 4L3EA 1TLKA 4JO1L 4OLXH 4XBGA 3VFRA 1CDYA 2XYCA 4WDIA 2XFXA 5BJTB 4F33A 5CEZE 4PJEF 1D6EA 2C3HA 2PR4L 3FJTA 4ZOCA 3VXPB 2QQNL 2GY7B 3SPVA 5L6YL 3GJEA 5GGVL 3PUCA 1E6OL 5I6XB 2NNAA 3DECA 1UKQA 3BE1H 4KJYA 5HYSA 4HFWB 2V9QA 4K8RC 4HXAL 3DTXA 1KTLB 2GJ6B 3ARGA 4Y4HC 1WIPA 2F58H 2VR5A 4QYOB 4ZUVA 3QDJD 3S4SG 5GSVA 3GRWL 2BSED 2XZQH 3ORJA 1HHGB 2DLTA 1IC7L 2CR3A 2WBWB 5BJTA 3S37X 3VXTB 3AGVA 5J06A 1Q9KA 4PJ7B 3HPLA 4LNRB 2QJDA 3BDXA 2L7JA 1LVEA 3U36B 1O5DT 3G5XB 3PWPD 3QR2A 4G8EB 2BXYA 2AJUH 5CUSH 3VGEA 4K94L 1O0VA 2VLRB 4OM0H 4D3CL 3OG6B 3OF6A 1KEMH 4KI5C 5GJTH 5F3HA 4QYOA 3MUGB 3P77A 5D1ZD 3SGJA 3CFDA 3GGWB 2J3SA 1JZ4A 1P7HL 1HHGA 4KUZH 1VCAA 4QRPB 1MQKH 32C2B 4ZXBD 3TVMC 1NGPL 3VXTA 1W0VB 3MNVB 4X9IA 1KENH 3KPRA 4M9PA 4LNVA 1EO8L 3G5XA 5EZIH 1UKSA 4G8EA 3D25B 3RZCC 2BJML 5J6GA 1V3KA 1S7QB 1HCFX 4EOWH 4LCYB 2P8MA 4RWYH 5E56A 1KCVH 2AK4E 2RHEA 15C8H 3RVTD 3UTPE 5IW6B 4XAWL 1FYTA 4LLYA 4XT1C 2WM0A 1AQDB 2R29L 3H2WA 1Z9LA 3PV6A 4LQFH 4MNQD 4F7EB 1MCOH 4QRPA 32C2A 1CGSL 1RULH 1I9JH 1IGCH 1MFCL 4I5BA 4JFPA 3UROR 3MRPB 2BNRD 4Y16B 2CKBL 4CN6A 5ICXB 1A7OH 2A74A 1CD0A 4YWGL 1PEWA 3D25A 4JRYE 3WFCH 2VUYA 4LASL 1ZLUH 2Q7YB 1ZXQA 4LKCA 1FNHA 3L95B 1OP5K 4WWID 4P5KB 1S7QA 2E5EA 3HCVA 1LO3H 1DZBA 4LCYA 2WBJA 5H37H 4GRWH 3C5SA 3IKCB 5KTEL 3I6LD 3K74B 5IW6A 4OZHF 4PRBB 3U4BL 4UTAH 1U8QB 1AQDA 1EFXA 3MLTB 4YPGB 3W2DL 5T5FL 4F7EA 4WY7L 3OKNB 1ND0B 2OK0L 3VXRD 1RIHH 3MRMB 3MRPA 1D5MA 4NC1C 1T1WB 3KXFE 5GGTL 4Y16A 3B9KC 5ICXA 1U8LB 4O58L 2HVKB 1P4BL 2B8OT 5IFAH 5L88L 1JK8B 1I85A 5F3BB 3BHBB 5JXED 4P5KA 1I9IH 1J0ZA 1IBGL 1FO0B 4LRNH 5KVFL 1OVZA 2XQYK 3IKCA 3M8OL 3MLWL 4AH2A 1EHNA 4A6YL 3TN0D 1CXEA 3O6MH 1GZPB 1U8QA 4OV5B 4X9GA 3V4PH 1P5UA 4YPGA 1NCDH 3BQUC 2EYTA 3MRFB 5GSRB 2B20A 4CMMB 4YE4H 3V6FB 4RX4D 3MRMA 4RGMB 1KCUH 5HHME 4B5EA 5DD3H 2MQ3A 3F7QA 1T1WA 4IRJB 2XI9A 1QSZA 2QTEA 1U8LA 2HVKA 4V2BA 1M05B 1NDGB 2HT2C 1B4RA 4OLUL 4X5XB 3A67L 4NPYA 1JK8A 2FEDD 4UT6H 1KGCD 5F3BA 3WSQL 4M48H 5D7SL 4ODXA 5E7FA 2YD2A 5CLWA 4DGIL 2AJ3A 4DN3L 3O6LL 1WLHA 1FO0A 1N6QL 4XVTH 3U7YL 1HYSC 2VSCA 4FQLL 5D7JD 1N2RB 1FNSH 1C08B 2JK5B 1GZPA 4OV5A 4DVBB 2XN9E 3GMMB 3MRFA 4CMMA 3ZDYE 4JZNB 4IRSB 3OX8A 2GSIB 1TVHA 3QO1A 1JCKA 2YZ8A 2IMMA 1T6WA 3REVB 1A1OB 5TE6H 4BELD 5IBTH 3WS6A 1WBYA 4ERSH 1M05A 5D93B 1NDGA 3VFSB 1S5IH 3BUYA 3C6LC 4TRPL 4HKJB 4YDVB 3O8XA 3BPOC 4CVWA 2XV6B 1CZ8L 2NX5D 1I7RB 1I8MB 1OSZA 1F90L 2VR4A 3WHE1 4JHAL 3I6GB 1VB9A 3GNML 4U05A 1SEQH 1N2RA 3VFGH 1C08A 3C5JB 4QRUA 2JK5A 1DE4A 2H6PB 3PGFH 3CPLB 4DVBA 2X4RB 3EBAA 3Q5OA 3MJ9A 3JV6B 4JZNA 1AGDA 1CLCA 2GSIA 4WHYG 2YUXA 4XBPB 4YX2H 3REVA 5EOTB 3TC9A 1A1OA 4Q0XL 3C60C 1RZJH 1QYGL 3LDBC 1HINL 4XHQA 4XPAH 5DO2D 3VFSA 1BZ7B 2NXYC 4OSUL 4OB5H 2IEPA 3V5HB 2DQUL 5EPMB 3QCUH 1U36A 4ELME 4EI5A 5FA3A 2EXWD 5F8RC 1FZKB 2OR8A 2EXYC 1NSNL 3FQXA 2H6PA 5LXGH 3L7EA 3CPLA 1TVBA 2HN7B 3DRQB 5IF0B 3JV6A 1B88A 4H1LH 4POZD 4H25B 4L4JA 1TETH 1QFWH 4OKVB 2P8LB 2RCSH 4XBPA 1QSEB 4X6CE 5EOTA 5AYUL 3NFSH 2E7HA 3ZKSD 1FL3A 1PX3A 4MCYB 1BZ7A 3UYPA 1W8NA 3V5HA 3G6AB 5EPMA 2KPNA 3MX0A 5GRVL 3NCJL 1T1ZB 5C07B 3K7UA 4DFHA 2HN7A 3DRQA 5IF0A 3QUYB 1AI1L 1I7ZA 1OTSD 4JKMA 2W9DL 5CD3B 2P8LA 1YY8A 3GSUB 5INCB 2R9HD 5ALBL 1F02I 1QSEA 4UNUA 4WJ5B 1UADC 5TQ2L 1LNUB 2IFGA 3CSGA 4GAGH 4JRYA 4L9LB 1N6UA 1CDBA 4F7CB 3BKML 2VXVL 3CLFH 4OZGE 1DL7L 1ZVSA 1MFDH 4KZEH 4D2NA 4WFFE 1T80A 2HLAA 3PNWB 1L4IA 2I25N 4LGSB 3VXNA 4M1GH 4BM7A 3JWDC 4QWWC 1T04B 4KV5E 4RA3A 4XWGL 1HOCB 2HG5B 3G9VA 2ADFL 5CD3A 2M1KA 3GSUA 5F88B 3RVXC 4X6DB 5J9PB 3RIFF 4LCCC 4WJ5A 1FIGH 1PG7W 5C09B 2LE9A 2BVPB 1LNUA 4XHJC 4EQ3A 4OLYH 5EU6D 4L9LA 4Y4HB 2IQ9H 3MBEC 3T04D 5D2LE 4FQ2H 2YXFA 2W0PA 4MA7H 3N50A 1LP9E 3RBGA 4W6WB 4MQ7B 1SY6A 4M5ZL 4YHKH 2FCBA 3CDGB 4PR5A 4AIOA 2Y7QB 1ES0A 1JYXA 5I73C 5IVXB 1U3ZA 1VKXB 3O6KL 4PRNB 2HG5A 1QRKA 2YPLE 5I8EB 1IGYB 4U1SA 5CGTA 5F88A 1YPZF 4OGYL 5J9PA 4LLUA 4MXWL 2QQKH 5JR1L 2DKMA 2D31A 1TZHA 2BVPA 5CIPH 2R2BB 5F9JB 3SKOA 4Y4HA 5DJ0A 1VDGA 3RZWA 4KKAC 3S34L 5T33L 5HY9B 2XA8H 5D7LD 5E8DH 5HYJE 4MQ7A 3ARBC 3OKDA 3CDGA 5CCKL 1TZIB 5C71A 1Q0YL 3TVMB 5C0DB 1HHHB 2Y7QA 4RGNE 3RWJA 4M6ML 1J1PH 5C0AB 5IVXA 2DBLH 3HMWH 5KS9E 4PRNA 1ADQH 2UZIL 5H35A 2BDNL 3MGOA 3SO5A 4LGRB 1OM3L 3P4NA 1IGYA 2XWBB 3RZCB 2GK2A 2WV3A 4YO0B 5IG7B 4X7SL 3VD3A 1BBJB 4YDLC 3L7FB 4PJ8C 2R2BA 5F9JA 1VFAB 1ZLSL 1M7DA 3MRIB 1WFTA 4HLZH 5HY9A 1PKQB 1GAFH 1S7RB 1AQKL 4G6KL 5I1CH 2WLZA 1TZIA 3TVMA 5C0DA 2UUDH 1HHHA 2RGSA 4NHCL 1IGJB 4PRIE 3U46B 3V0AC 4OFKA 5SWSE 2Q76B 1OAZH 3QHFH 4J8RB 3EYVB 4PJ5B 3RX5A 2VYRE 5L0QC 4EUPB 4DVRH 5IMKB 3VXUD 3RZCA 1MNUL 4YO0A 5FYKE 5IG7A 5HI5D 1IAIL 3L7FA 2VDML 1YN6B 2VLKD 3VXOB 5ID1B 1A9BB 3O3AA 1UA6H 1VFAA 3RUGE 3NACH 3MRIA 4NFDA 3LZFH 1RIUL 4XPHL 1KIPB 2X4OA 1PKQA 2MQ0A 1NAKH 2A1WL 3CK0H 1U3YA 4MQXC 1CLOH 3ZT7A 5A2JH 4PLOB 5LGHH 4MAYA 5FHAL 1NMAL 1DUYA 4NQCB 1CL7L 4PGEB 4FQ1H 5IUSA 3U46A 2Q76A 5JUEH 4NWTL 4CU7A 3B9KB 1I9EA 4AL8L 1V8HA 4FQCH 3FN9A 5L9DL 3C5ZD 2CR6A 4EUPA 5IMKA 4X6CA 2FX9H 3T0ED 2ZP0T 1MHPH 2DQJL 5I1LA 1YN6A 1SEBB 3VXOA 4M1CC 2NTFB 1P53A 4K9EH 1A9BA 3DUUB 4N0YH 5F7MC 1LDPH 5ITBL 1RZKH 2G5RA 1R3HB 4TVPH 2OJEB 5DJDA 1DJSA 1YDPB 3ARFD 3IDXH 4M93C 4HF5H 3T08A 3ZHKA 4GSDH 5C70A 1JVKA 4RGOL 3MYJB 2DLFL 3BQUB 4OUOA 3RWDA 1VPOL 2HKFH 1R3IH 4NM4L 3H9ZA 2D0FA 1Q8MA 4JAMB 4HS3A 4Y88A 3BUTA 3QIBD 1Q0XH 3FO2B 2QHLA 2AGJL 2YA0A 3WKMH 2EZ0D 1A5FL 2Y9RT 4XNQB 2J88H 4MB5A 2NTFA 3DUUA 4YDKL 3K2UL 5L8JB 4L8BB 1R3HA 2OJEA 1IGML 1MIMH 3JSSA 4OZGA 1J0KA 3JV4A 3FAWA 4P4RA 4TNWF 3MYJA 5C7XH 3L1OL 3ULSA 3BQUA 2APVA 1XGYH 2R69H 1RU9H 4U3CA 4N1EA 1G1CA 3CH8A 1EHAA 4JAMA 1OAQL 2V2XA 3EDEA 4NJ9L 3GDBA 4S1QH 3FO2A 3BRDA 2H8PB 2YD1A 3C6LB 4QTIL 4K7PY 3Q1SH 4PJEB 4PRHB 3CH1A 4E41D 1X5YA 2OR9L 3BPOB 3FB7B 4PBWD 2D2OA 4UT9H 3DO3A 4PTTB 2KL6A 4KROD 4Y7MA 1MCWM 4BZYA 4HULB 2R2EB 5GGVY 3L5XL 4L8BA 5D72H 5D2LA 4GXUN 1KB5L 2DLGA 3WLWC 5FYLD 1RUPH 1LP9A 2PYED 3GMOB 4OZFH 4YHOH 1QACA 1X6LA 5DJCB 4S2SA 1J10A 4QHKJ 1U6AH 3EYSL 5J57B 2YMXH 4FXKB 1KPUB 4MNHA 1C5BH 2DQEH 3FO9A 4PUBL 1CBVH 1T20A 5I1JH 2XKUA 2AJVH 3C60B 1UWGH 5KS9B 5ISZE 5IP4A 3LDBB 2VN7A 2H8PA 3HI6L 4R4BB 3W0WE 2NXYB 3C6LA 4ZSOB 1QQDB 4PJEA 4PRHA 3SE8L 5I19H 3FB7A 5C08D 3AS2A 3QNXB 1JNLL 5F7WC 4PTTA 3CFKA 4LSQL 4QRRE 2R2EA 2JB5H 3FOLB 4DJMA 1UEYA 3RPKA 3LKPB 4XP4L 1YUHB 2Y07L 3GMOA 4QXTB 1IT9L 2BNQB 2HT3D 1NFKA 5HYJA 4UNVA 4Q9QH 4YHPB 4G5ZH 1FFNB 3DV6B 5I15L 5IMLA 4PS4L 4XCNB 1KPUA 4NCC1 3STLB 1SVZA 1G9NL 1JNNH 3NTCH 4LPYA 4GRWE 3C60A 4HPYH 4PJ9A 5KS9A 3PWNA 5FUOH 4R4BA 4ZSOA 3D85D 2COQA 4MAUH 3SGDI 4WEBL 4NO0D 1UWEL 3QNXA 4N0UE 2HYMA 1FBIH 2J6EA 4LCWD 4ZPVA 2GK0B 1K5NA 3OHXB 2VTFA 4P59H 3FRPA 1IGFH 1WAAE 3TM6A 1FH5L 1KXQE 2P47B 4I3RH 2GW5A 4CU6A 4ZFGH 4YHPA 3DV6A 4JY5L 3DX6B 4OFDA 4XCNA 3MACL 3LCYA 4LPUA 3STLA 2IANE 4TSCH 5SWSA 2FX8H 1JZ7A 5C6TH 3RIAK 1SJHB 4JB9H 2AEQH 5CZKA 1A7RH 1EZVY 2AXFA 1GXEA 2WZPD 5JNYA 3ZKND 1HKFA 3U6RB 5LG1A 5EO1B 1YEGH 3OHXA 1A4JA 1QLFA 3OTTA 4LLWA 3BP7A 3BGAA 5FYJD 1IFHL 3GEWB 2V7NB 1K4CB 4R9HA 3MRBA 1KSRA 3BPNC 3ZKMD 5F7NC 3DX6A 1Q1JH 2BVYA 1RIVL 2RB8A 1DN0A 4OZHB 3VE0B 4OZ4A 4LCCB 4M43L 1S9VB 1JZ2A 1VFOA 3ULVH 2G60H 2A9MH 5E5MB 3WL9B 1P7QD 5MERB 1FGVL 4XTRC 3MBEB 4M6NH 3VW3L 2WW8A 3U6RA 1A2YA 1AC0A 1XF3A 3GHBL 1HH6A 4IBLT 5LVEA 3MFFB 5GHWL 2OQJA 4HKBA 3SE9L 1DQML 4K3JL 2AK1H 5MHSD 1R3KB 3VFMA 1CDHA 2GJZB 2W9EH 2EIZA 5I73B 1TDQA 5HDQH 4D94A 4KUCD 5DEZA 3GO1H 4Z6AT 1L6XA 4GMSL 5J56B 5JZ7C 4D9QD 4G80B 2ENYA 5E00A 2IH1B 4YGVA 1SJEA 3UAJC 3MRCA 3VE0A 3EYQD 1VFUA 4J3OC 5GGQH 4LCCA 9CGTA 1T1YB 3UCRA 5DK2B 1S9VA 1NAMB 1MFAH 4NQDE 1CFQA 4MS8D 3S35X 2KZ1B 3O11B 4CW1B 5E5MA 4M7KL 5MERA 2F19H 4ZS7H 5TE4H 3MBEA 5DEFB 4PJIF 3MRHB 3CZJA 3IAQA 4JN1L 1DBKH 3H3KA 3QP3A 2LU3A 1HE7A 3ARBB 4I9WD 3QFJD 2VZOA 2XWJB 1MWAH 3VRLE 1HQRB 1Y18B 4X9BA 2GJZA 2HTKD 4KVNL 1QP1A 3HZKB 1V5JA 4H8WL 3UTOA 1FJ1A 2XPGB 2BC4A 4HUMB 1TITA 5I2IA 2A83B 5FO9B 4KK5D 4N9GB 1AR1D 3I02B 1WT5C 2BP3A 1FE8H 3CXHJ 1LK2A 5DK2A 4K3EH 1H3UA 5J1SC 1JPFB 1LO0L 4YDLB 1XF5A 3NCBB 4L3ED 1W72L 4PJ8B 1WZ1L 4HMDA 2NZ9D 4P23C 1ZHKB 1HI6B 3ZTNH 5DEFA 1IL1B 2VDLL 3PHSA 4CDGC 4WI5A 5L8LB 1X5ZA 3CFCH 4XMPL 4UQ3B 5L7XH 2NY4D 2XWJA 5DJ2B 1QFWM 3INUH 4CNIA 1OGAB 1HQRA 1Y18A 3HB3C 4JLRB 3NZHH 4ONGH 4NRXA 4ZUWA 5K9KA 1P9MA 2NCMA 3PHQB 4LDOB 4UINH 5JLZB 5L0QB 4G8GE 3ARGD 1PDKA 2OP4H 5I18H 4N9GA 3ILQD 3QQ9C 3I02A 3R06B 4OLVH 4O02H 2Z8WC 1X5AA 5CS7A 1P4IH 1GZQB 1M7XA 3MV01 2F5AH 4PJ8A 3W0WA 5M7QA 1HI6A 2KUTA 3UTTB 4NJAH 1IL1A 5E70A 3WJLC 4Z5RB 5KSVB 2NY5L 1ZLVH 4OGXH 3H9SE 1CXIA 3QPXH 3DROA 3DXAB 1NCBL 4QRRA 3IFNH 3KPSE 4OZIF 1DBAL 4EN3C 1OGAA 4JLRA 2Z31A 1GIGH 3L5IA 5KSAC 1V3JA 1F4XL 5EU5A 3MXWH 1URLA 3PHQA 2CMRH 5JLZA 1A6ZA 4KTEL 3BH9B 1UM4L 4UDUB 2R0LL 5IVNA 5DUML 3OF6D 3D48R 1CE6A 2C1OA 2DI7A 4WW2A 5CSZB 4F57L 5DJYB 1SBBA 4QHNA 1FNAA 3GSNH 3LPWA 3FFCE 3QDMB 1AY1H 1DSFL 1GZQA 1YEEL 4NQVA 4QGYA 2CRIA 2EEBA 2VDPL 5KG9B 1RZFH 3F7PC 2V2WB 4M93B 5BRZE 3DXAA 3SGDH 3KPRD 2J4WL 2LU7A 2VL5B 4CKVX 4MJIE 4UB0L 3RVVD 3TGXA 4LLDB 2ZCKL 5K93A 3LEVL 4XVSH 2YUWA 3OWEA 4U2YA 3ARZA 3BH9A 3MUY1 4UDUA 3E3QC 3EFDL 2FYYB 4OCRL 3TT1H 3H9YA 4V1DE 1DFBL 1F11B 1ZSDB 1MF2L 2IANA 5L2KE 1FYTD 3NIFE 3QDMA 4XPTH 4H0HB 1A6WL 3JTSA 4GRLB 4DKAA 1UT9A 4PD4J 4QRPD 4F8TA 3GZKA 4YFEA 3B2UD 2BVTA 5KG9A 4WV1A 2V2WA 3C87A 3WUZA 1CIDA 2VL5A 4PJCF 1RZIB 4HJJH 3BYYA 4LLDA 5GGRY 4I8DA 4TSBL 3N85H 2WBJD 1GC1H 2B4CH 5D7IF 3SE4A 1FO0L 1S7UB 2FYYA 3ZYZA 1F11A 4UOJA 1ZSDA 2X9XA 1KB9K 2DM2A 2Y23A 3KWWB 3UBXG 4L3AA 1EFXD 2FECL 1FPTL 1L7TH 1MAJA 4GRLA 1Z0NA 1I1AC 4DTGL 4YXKL 4Y16D 1B0GA 1E28B 4F9PC 5IR1A 1HILB 2PW1A 2BVQB 1D7FA 1K8DB 5TDOA 4FFWD 1OARH 2IADA 3KPNA 3HR6A 3QEGH 1Z9SA 3FO1B 3D0LB 2R0ZH 1S7UA 1NMBL 3OJVC 3DUHA 1F42A 3WNLA 4Y5VC 5CBEB 5IB4B 4O4YH 3FZUC 3KWWA 4NM8L 2BSSB 4N8CH 2BRQA 3IAPA 1VFBB 1HN1A 5EU3B 5GRVK 5ESVB 3PXHA 2YPVL 3LEYL 5IEKA 1YPZB 4NUGH 4ZPTA 4XCCH 2VQTA 3IF1A 4IEFB 5E8OB 1EMTH 3DYOA 2C26A 2R4RH 4JQVC 3BEWB 3FB5B 1E28A 3GJFH 1HILA 2BVQA 1K8DA 5TDNB 1YMME 5F1NB 2EDOA 4LSTL 2QSCL 2DJSA 3D0LA 3AMLA 4KJQC 4OT1L 3TBVB 4CVXB 4BZ2L 1YY9C 3OJMB 7FABH 4DAGH 4P3DB 2YRZA 4JO1H 4Z7WF 3MRQB 1VFBA 4R6UA 5EU3A 4JGUA 4X0KA 2I5YL 4FXGB 4H0IA 5HD8D 1U8PA 1YPZA 2QQNH 5E8OA 2FSEB 4X80L 2R0WL 1LEIB 1PQZB 4PJGF 5F1IB 3ES6B 3BEWA 4H1LA 2X4QB 5MEPA 5L6YH 3FB5A 5GGVH 3W9EB 1E6OH 1INQB 3MJ7B 3VXME 4BSVB 4DCQB 3VG0L 3O8XD 5TDNA 1C12B 4HXAH 5F1NA 1NGXB 2FH6A 1HXMA 4CVXA 1RI8A 5DD5L 2YD6A 5C0BE 4G8GA 4TVPE 1ZHLB 1I1YA 2HWZL 4Y1AE 3NPSC 4M5YL 3MRQA 5HGBA 4PB9L 1LDSA 2EDBA 5EZLB 2UVEA 1MVUB 4FXGA 5B4MD 4S1RL 3TBSB 1FG2B 1NBYB 5DMKA 1LEIA 4E5XA 3MSPA 1PQZA 5F1IA 3SKJL 2X4QA 3BPNB 4MJIB 3KPSA 4WTZA 4WU5A 3W9EA 1INQA 5CD5C 1IMHC 1MREL 4BSVA 4DCQA 4XP9L 1H3TA 4OF0A 1C12A 1QFUL 1NGXA 1P6AB 4D3CH 3QT2A 2JJUA 4NZTL 5F89B 4EI5D 1KJ2L 1MCHA 3DVGB 1UJTA 1KULA 1BOGB 1A64A 2Z35B 4BQBA 4MXQD 3W81A 2WLYA 3NAAH 5MENB 4OF8A 5CJ5A 5I8OL 4M1DH 2AJYH 1QD0A 4NBYB 4NKOB 2ERJC 5GRJH 3HRZA 1NBYA 1EO8H 3MXVL 5BRZA 4DFIA 5GS0D 3EUUA 1S8DB 5I30H 4MJIA 2BJMH 1A3RL 4OD2A 1JV5A 1UB6A 3GSQB 4KHXH 1ZGLP 4DKEL 1EPFA 5CIPB 4DGYL 5E8EB 4JFHE 5F89A 4N0FA 4HK3J 2A6JB 3MCLL 1BOGA 2B1AL 4XAWH 3QZWA 2E6JA 2R29H 1VESA 5MENA 4AEFA 1ZT1B 1IC4L 3BYTA 3MR9B 3ISWA 1CT8A 2NW2A 1CGSH 3ARDA 4U1JB 2X05A 1KN4L 4NKOA 5D71L 3ZL4L 3DX8B 5BS0B 2CKBH 1AD0A 4Z7QE 1QSED 4JFFE 2BRRL 4TSAL 1AIFA 3W11C 3AUVA 4LASH 1MAMH 1HSBB 4K8RL 4JRYD 3GSQA 5CIPA 5CILH 5E8EA 1I1CA 1IM9B 2A6JA 5D7KE 4PJXE 3U4BH 4P23B 2Z8RA 5JORA 3RIAF 4F37K 4MD0B 4MVBC 1FRGL 4G6AC 3W2DH 4Y5XC 1ZT1A 3MR9A 2OK0H 4ACPA 4WENB 4LLQB 3IDUA 4XNXL 3PIQB 4C56B 4U1JA 3G6DL 4YK4C 5DZOA 1UXWB 5HI3C 2A0LD 1U42A 2PYFB 1T2JA 3DX8A 5BS0A 5E95B 2VLJB 3EOAB 5I1KL 4WUUE 4O58H 1AXSB 2VKWA 3EFFA 1ADQA 3BRFA 1P4BH 5L88H 4HK0A 1OB1B 1HSBA 4LMQE 1ORSA 4W68A 4M9OA 3MV8E 4PGCB 1WT5A 1S9XB 1IBGH 1MCEA 4FP8L 2P5WE 3LQAH 5DRXA 3M8OH 5F7YC 3MLWH 1IM9A 4A6YH 4MD0A 3G5ZA 2EYRB 2B39A 4LLQA 4ZUSB 1RZGA 3PIQA 4C56A 1UXWA 3VFUB 3FFDB 3RWIB 4EN3B 5HHMD 2VLJA 1NCNA 2A77L 3NZ8B 4NDMB 1AXSA 5KSAB 1FHGA 4OLUH 5GIRA 3A67H 2OMNA 1JPTH 1T4KB 4ZUTB 3ZE2E 1OB1A 3WSQH 2D7TL 5EA0L 4Y4HD 5D7SH 2VIRB 4PGCA 4DGIH 4DN3H 1S9XA 3O6LH 4LU5L 4RRPG 1YMMA 3RVWC 4NP4H 4DKFL 3U7YH 4FQLH 1PX4A 2NR6C 5K59F 4BK5A 3CD4A 4P9HC 2EYRA 2X4SB 4IMKA 4ZUSA 1KG0A 2YPKB 3KNBB 3U2SB 1RZ8B 3LQZB 1HKLH 3RWIA 4EN3A 2FO1A 1Q94B 5CJBA 4RMSA 3ULVE 2J8HA 2DIAA 4TRPH 1T4KA 4ZUTA 5EIQA 3OXSB 3RPIA 1ITCA 2VIRA 1CZ8H