4ZPTA

Structure of mers-coronavirus spike receptor-binding domain (england1 strain) in complex with vaccine-elicited murine neutralizing antibody d12 (crystal form 1)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
216
structure length
213
Chain Sequence
EVKLVESGGGLVKPGGSLKLSCAASGFTFSSYAMSWVRQTPEKRLEWVATISSGGTYTYYPDSVKGRFTISRDNAENTLYLQMSSLRSEDTAMYYCVRDGNSMDYWGQGTSVTVSSAKTTAPSVYPLAPVCTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D12 Fab Heavy chain
publication title Evaluation of candidate vaccine approaches for MERS-CoV
pubmed doi rcsb
source organism Human coronavirus emc (isolate united kingdom/h123990006/2012)
molecule tags Viral protein/immune system
total genus 40
structure length 213
sequence length 216
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zptA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zptA01
3HZMA 2XT1B 4YXLH 1MPAL 1XH3B 2CLRA 5FV1L 3IF1B 4M7KL 2CDEB 4PJ5A 1DE4A 5EOCJ 5D1QC 2IWGA 1NSNH 1UZ8B 5CP3H 1ETZA 3AAZB 1FYTA 1RURH 3CFBA 2Y5TA 1FNEA 3BD5A 3ARED 1MFEH 1UENA 4NNXA 3MTRA 4JFYB 3GMPB 1UH2A 4FFVD 5AZEH 2Y4SA 3QPQC 2ZJSL 5A43C 1EIBA 3KR3L 3L7EA 4RAVB 5GGVH 5DZLA 1BMGA 4DUVA 2O61B 5C09B 4PV9A 1FVEB 4RWYH 4L8DA 4M6ML 3N85L 1XT5A 3FRUB 2C4XA 3DMMC 3OHXA 2G2RB 1MCPH 2BSSB 3QNZB 1BOYA 2Z31B 1P1ZB 1CE6B 3MACL 4CRPA 4PB9L 4GRLA 2NY1D 5A2IH 3CCHA 1N64L 2H2SC 5DHVA 4P5MA 5CCKL 2ATKA 1LEGA 3BYTA 4Z0XB 1RZ8A 5D7JA 4HGWA 4PJIB 3RUGF 4P9HL 1UH4A 4WHYH 4X9HA 4DKDC 5D9SA 5T1KB 1EEZB 5HI4C 3CFKB 4DWHA 3TYGH 2DJ4A 1YA5A 2EDRA 4AK1A 5J6HA 4UILH 4IDJL 5IVOA 2ITCA 2P8PA 3RX7A 2NY7L 3KXFD 4RIRB 5CJXC 3WMSA 3BSZL 4WV1A 1IGCH 1RJLA 4P46B 4OGAD 4M1CD 4IBLT 1OT1A 2YPKA 1DQJA 1MCWW 3SDYH 3TT1L 4Y4FC 1T1XB 3OGOE 3ARUA 4UNTA 4OZGB 3DVNA 2C26A 3MRIA 3CZJA 4XC3L 4QRRE 4HFUL 2YUWA 3LKRB 1SJEB 5HGHB 1TZHB 1YEFL 3RU8L 3BKMH 2EDJA 3L7FB 1HN1A 4UIMB 3MV8B 4LVOB 5EUOE 4PRIE 5LGHL 1R5VB 4KMLB 4ODSH 4WHYG 1UVQA 2WBJD 4AZ8A 3GK8H 3TCLA 1U8LA 5DJAB 4GG6B 2F5AL 3IJSA 3M8OL 2VE6B 2YZ8A 3NBNA 2FO4A 4LPTA 2BVTA 4KXZH 3I6KA 4NCC1 2YOCA 2C1OB 4IIQA 3M17A 4XNXL 3JTTB 3G5XB 4QXTA 4LIQH 2H8PA 4JFHD 1U8QA 2DM2A 4XNYL 2VDPH 1A4JA 4X4XA 2CIKA 1YYLH 4GUPB 3QEQD 2Y23A 4O58L 3PL6A 3TYFA 2X89A 4MLIA 3QDAA 1BBDL 5CWSA 5AG9A 1SYSA 1NANI 4N5EC 3TVMC 4JO3H 1MCOL 2ZZUT 3U1SL 1CL7L 4K3GA 1S9XA 3O3BA 3HE6D 1LO2L 1AE6L 4AIZA 5KOVC 3O11A 2BVEA 1U3JA 1ZT7A 4K7PY 3Q2CA 3VH8G 3AREC 3W0WA 5LGJB 5KSAB 1T1YA 4WU7A 2NY4C 2Z8SA 5F9WC 3ZHLA 3IDXH 5EU7C 4PJ5E 4IRJA 4HG4J 5ANME 4GRWH 3UTOA 1VKXB 1JNJA 1I1FA 5ADOH 1NCBL 4XRCB 5D2LF 1NSNL 5JORA 2PETA 2WANA 2DQFA 1RURL 4JO2H 3VXUA 3SHSA 5ILTH 4N0UA 4MDJA 3ZE1E 2X9YA 3EO9H 5HYQB 4HPOH 5CEYA 5AZEL 3GEWB 3MLSH 4JGMA 4JFXA 2VITA 1R3HB 2CGRH 4IMKC 3KPPB 1B4JH 1R5IB 2BSTB 3QA3A 2EE3A 1XGPB 5C71A 4JFDB 5HTSA 1LO5A 3I84A 1MCPL 3BVNA 4JPKH 3REWA 1A3LL 2MKWA 4NNYB 4UV4H 4HIHB 1H3WM 2M2DA 2HT4D 1U6AH 4I2XA 4LLMA 5I8EB 4C54A 4JQVC 1K2DB 1BZ7A 1FLRH 1I4FA 4TVSa 1RJYA 1Z0NA 3PWPE 4HJGB 5FYJE 3NA4A 3L3JB 1LWRA 3DV4A 2AKRB 1BZ9B 3QAZC 4XHQA 1KACB 1QG3A 3TYGL 2FDBP 4WTXA 5IB5B 5E56A 3L5JA 4UILL 5HPMB 4QHNB 4KK8D 4JRXD 5K93A 2JJTA 5EO0A 1WFOA 4J8RA 1KIRB 4OZ4A 5FO8A 4OIBA 1IAIM 5E9DA 4GAYA 4F57L 1PSKH 3VXRA 2PF6A 4M48L 3O3DA 3FKUS 1NUNB 1T1ZB 2P5WD 1P4LA 5J12C 5HHNB 4GKZA 1DLHB 5ICZB 4ZUTB 4DOHB 1IARB 2D4FA 2QTEA 4P4KC 3BKML 3RKDC 2F53D 2B7DT 1H3PH 2ADIB 4D8PA 3RVWD 1UT9A 4J3TA 4NRZB 4X7TB 4BYHA 4DZ8B 4LCCA 4ODSL 5H2BA 2V2TB 1I8IB 3GK8L 1UB5B 4IOFD 5C0FA 3H8NA 3QUKA 5CJ8A 3FOMA 4HS8H 3BHBA 5JR1H 1I3RB 4X6BA 3ULVE 2OZ4A 4PJ8A 4APQD 1MI5A 1VESA 3DUSB 4D0CB 3P4MB 4TVPE 3M1BB 1HXYA 2VDPL 4CVXB 5IOPB 5D7LA 3MLUH 2HG5B 4I13B 4OIAA 3F7PC 3MRFA 3KPSE 5MEQB 5TF0A 1W8NA 3MOQA 3EZJB 1S7TB 1QSEB 2BHZA 2EDEA 1UEMA 3G5YB 3D39B 2XXCB 4JDZB 1MEXL 4OZHF 1P5UA 1EEYB 1G6VK 2KZWA 3TH2T 3QNXB 3IFNH 1MCJA 4FZEH 1T5XA 5T5NF 2CJUL 5CKGA 1WFTA 5TDNB 4NKOA 4WW2A 5DD3H 3WO4B 1TETH 2XIDA 4YHOH 5DXWA 5B3NA 4L4TB 1P2CA 3DIFB 1R24A 1SMAA 3GRWA 3IDXL 4ZFGH 1OTTD 4H5SA 3WJJA 4N0FA 3J7HA 5ADOL 2BNRA 5C0RH 1XIWD 4KJQD 1LO0L 1BIIA 4N0UE 2VABB 4ORGB 4JO2L 1ND0A 1GZQA 5MENB 2OTPA 1WAAE 4ODXA 4XPFH 4HPOL 1IAII 3SKJH 3EO0B 3MLSL 2PYFB 1RIUH 3BXNA 1GAFH 3AROA 2UV3A 2CGRL 2OXGA 1B4JL 2A77H 3UX9B 2XNAB 1ORSA 3IAPA 5IVZA 1IAOB 3KJ4C 1T66C 2CK0H 4WHTA 1QSFD 4NM8H 5I6XB 3TN0A 1J0HA 3ECBB 4NQEE 5CD5C 4I2XE 1A22B 3CXHJ 3SDAA 1I7ZA 4JN2A 3C6SB 1U6AL 4ZTPH 3UTZB 3PHQA 5HBBA 4RAHA 3WKNA 3HAEA 2FHBA 3KPRD 1KB9J 3QIBB 5JA8B 3GSWA 4M1DH 1FLRL 5IUSA 3U79A 3BT2H 1C5DB 5JXED 4PIRF 4NZDA 5CINL 1RUMH 3V4PL 5IIEB 4U1IA 2ICWA 1G7HB 3ZE2E 1HKLH 4KDTA 3SEPA 5JIHA 4H20H 4PJ7A 1N7MH 1UQSA 3R0NA 4XT1C 3LRSB 3L3GB 5FOBB 4RFNB 1N2RB 1QBLH 1J18A 5E9DE 5HVFB 4XVSH 3F65A 4YGVA 1K4CA 2R0KH 4RNRB 1G9NH 5GXBB 2I26N 3WLWD 4D0DA 2P5EB 5ETUB 5DHYB 4NM4H 4Z7VB 1NDGA 4NQDD 3SDCD 4YBQC 3AXLB 2ERJC 5DVNA 1KB5B 3UDWC 5IHUH 5GRJL 3K8MA 1U8HB 5I1HL 2IQ9H 1ZA6A 1H3PL 2YC1B 5F1IB 3VXMA 2P24B 5JW5B 5I17B 4KRPB 3X12B 2ORBH 2EKSA 2P43B 3KYOB 1RJZA 5HGDA 4HS8L 3DVGA 1FLTX 2X1QA 1XR9B 4JY6A 1WF5A 4H26B 4MD5B 4Z78A 1MJUH 4OLYH 2YPLD 4L8BA 2I5YH 4L1DA 4UNUA 5D7LE 5IB2B 1IRAY 4UB0L 1IL1B 3PP4H 3MZGB 5ECJE 1PQZB 3MLUL 3NH7H 4D9LL 2OMNA 1K3IA 3BPOC 3N1GC 5CIPB 1T7YA 4IMLA 2H3NB 4DKEH 1YNTA 3PNWB 1ZA3B 4WFGD 5JO5A 1PAMA 2H6PB 1RHHB 2NW3B 4HEPG 2V17L 2DQTH 1XIWC 4KJQC 4LPXA 4N8PA 4Z0BH 3WS6A 5GGSY 1SJHA 1X5KA 3IFNL 4FZEL 5FYKU 4MD0A 1WCBB 4LCUB 4W4NA 1YY9C 5DD3L 1IBGH 5JHLH 2AS5M 2Q6WA 5B3JF 4ZFGL 4EDXA 4O4YH 4QRTA 1KPVB 5EU6D 4FTVE 4LARH 3UPRA 1G9NC 4UQ3A 5MERA 1HINH 3IGAB 5C70A 4BSWB 1VGKA 3EDDA 4B7LA 3CH1A 3LN5A 1INDH 5MHSE 4XPFL 5A2FA 3SKJL 4R26H 2HAZA 4ODUA 4L5FH 5IHBA 4KKAC 1RIUL 3K0WA 4R4ND 5IEHA 1GAFL 1WFNA 5DUMH 5HI5D 1S8DB 1J1XH 3FFCD 5JXEC 1IGYB 5EU4B 4KI1A 3OKEA 2B5IC 2H45A 1WV7T 3KPMA 2R2BA 2RQ8A 2CK0L 2GQHA 3O6KL 1VADB 4NM8L 2BXYA 1U3HD 4BUHA 3HZYA 4RGMB 4ZTPL 4MJ6B 1DCLA 1G7IB 3MJ8B 5CLTA 3HPJB 1I3GH 3MXWH 4K94H 4XBGB 2ZSWB 4X6EA 1CBVH 3BT2L 1WWWX 4R7DB 4DKAA 3RL2A 2X4RB 4KRNA 3MREA 5DDHB 1RUML 1FNGA 1IEAB 2YN3A 5DFTA 4TOYH 2VWEC 1HKLL 3P9LB 5J13B 4YAQA 3DROA 3SDCC 4H20L 2UY6A 4Y4KD 1N7ML 4LLQA 3R8QA 3QJFB 3G9AB 3WD5L 3IS0X 4I0PA 2IBZX 5CSBA 1OL0A 7FABH 1RK1A 4NO3A 3W81A 3Q6FB 1I1RA 4P59L 4XVSL 3VWJC 2R0KL 4J4PA 1G9NL 3MNVB 3ZHDA 4NM4L 4I9WE 3QPXH 3W9DA 5I1LB 4Z76B 4ZSOB 3OX8A 3QH3B 1M05B 5IHUL 1CVRA 4LPWA 2IQ9L 5FYKD 4TPRL 5LQBH 1A4KA 3I85A 3WHE1 3SGJC 4FA8A 1HXMB 3NCBB 3F7QA 1FFQA 1TZIA 1WK0A 1FIGL 3QUZB 3PDOB 1ONQB 3HRPA 3UYOD 5DJXA 1UXSB 3CVHB 2ZCLH 1S7UB 1B9ZA 4OLYL 4Y1AA 4GLRI 3QUYC 3JV4B 3UJIL 2I5YL 3QDHA 2ZG1A 1ZLVH 3VFUA 3BZDA 4LNRA 5B22A 1I3VA 3EJZD 3LEXA 3WNKA 2WWMC 1Q9WB 2OTWA 3VFNA 1D3CA 3ZMRA 3MMEA 2FEEI 3PP4L 4BH8A 4LCWD 3NH7L 3GMNB 3QWRA 5I18H 4U1GC 4KGLA 3ZDYF 2I60H 4G8GA 3D1MC 4G9FE 4DKEL 1EZVX 1QLFA 1TQCC 5FYKH 4K94C 4WTWA 5J3HD 3V6OE 1CFQA 2A6KB 3QDGE 2DQTL 1KLUA 4Z0BL 1OSZA 1DDHB 4RMTA 5HGAA 2YWYA 2O93L 5GGTH 1IBGL 2JK5A 3G04B 1JJUA 4MD4B 4LSVH 1SJXA 2APVA 4R4NC 1HHKA 1X7QA 1ZLVK 4F7PA 5HI5C 2ZUUA 4JDTH 2R1YB 3C5JA 3NAAH 4O4YL 4U6HA 3G6JF 1NAMH 3P30H 3NVQA 4LARL 3IJHA 4FQQB 1HINL 3O8XB 3HZVA 5HVHC 5I8OH 4PRBB 3MCLH 1DVFC 4R26L 4PJBF 4Z18A 4L5FL 1J10A 1Q94A 4MAYD 4X5LA 3ALPA 2BRQA 3DBXB 4PJDA 5DUML 1IM3B 5EIQA 4QRRB 3QHFH 5L2JB 1J1XL 2IQAB 4J6RL 4KJYB 4HC1H 5E2VL 3V7AG 3QIUD 2NX5D 2RHEA 3VRJB 5EOTB 2UWEF 1AGBB 1INEH 3Q0HA 4PRIB 4PYGA 5EUOB 4KK5D 3L3KA 1FCCA 2G75B 4LL9A 2E7LC 1HYRC 3U2SB 3B6SB 4OI8A 3C8DA 2HKHL 3AMLA 5T1MB 4HULB 1CFTB 5CP7B 1TJGH 1I3GL 3MXWL 4K94L 3BPNB 3K8KA 2B4CH 1CBVL 1QRND 3T65A 4ZPTA 1VEMA 4X99A 2J6EH 2XTLA 5EORH 1NGZA 4MNHA 4U0RB 5SWSA 5C0AD 3CFEA 4N90D 5IV2B 5J6GA 5CMAA 5IJVA 1LILA 1BOGB 3SDDA 4JHZA 5E2WH 1FC1A 1RQ5A 4EBQH 3ZDZF 3PP3H 4U3XA 7FABL 5DFWH 4W4OA 4OKDA 1PDKA 1I3UA 1E28B 1BD2D 1BX2B 4EI5D 4FRWA 1FNFA 4PGEA 2VQTA 3MGTB 1G7MA 4FQXC 5M95B 1DBJL 4HD9A 3SBWC 4HWEH 2A83A 5HYSG 5KVFH 1BPVA 1NFIB 5C86A 1LHZA 1P69B 4B41A 1NBZB 2DKSA 1QA9A 4UIKH 1TCRB 5B38G 4JANA 2HT2D 3QPXL 3RWEA 3I2CH 5TJWK 3ARGB 5TQ2H 1L0QA 4OF8A 1LGVA 4DTGH 1CT8B 4J3SA 4AQ1B 1PG7X 1NBVH 4YX2H 4OFDA 1EUUA 5LQBL 3LCYA 2VLRD 2DMBA 1NUFA 3FRPA 5ANMB 2W0LA 4FHBD 1VFAB 1A0QL 2PXYB 3B5GA 3EJZC 3IXTA 3PP3K 4L4JA 4CVZA 3CU1A 4PTUB 4NNXB 5F7LB 5CBEA 4PG2C 2AK4B 2APFA 3ARFD 5FUZH 3T0WA 2BVPA 4R90H 4Y1AE 1M7IA 4PV9B 3C08H 4DZBB 5J3HC 5EUKA 5FCUH 3QQ4A 1C12B 4OCRH 1N6QH 1A7BA 1UM6L 4HKBB 4PV8B 1ZS8B 2JCCF 3OF6D 4DW2H 1EPFA 5C07E 2DQGH 5DGRA 3VWKD 1MHEB 2N56A 3RIAK 4OM1H 2I60L 4NUGH 1AR1C 5FYKL 5CHNB 4UZGA 4ZXBB 4JDVB 5KTEH 2VLKD 2B4CC 3PWPB 1AD9A 3FT4A 1F3JB 3C60A 2VXTH 3BUYA 1B90A 5ESVB 2XG5A 3JV6A 4V1DD 3O4LD 2ARJQ 5GGTL 3T77A 1WBYB 2HA1A 4LPVA 4HIIA 4LSVL 5TE7H 2P8PB 4CADA 4F80A 4P2RD 4YDLB 5DRXA 3MOAH 4JDTL 1U8PA 2VIRB 4P23B 2Y9RT 2BNQB 3FT2A 3P30L 4X8JB 1JWSA 3QIUC 3ZTNH 4KI5C 3U46A 1AFVL 4KK5C 3NOIA 2ED8A 1XF5B 5KZCD 4PJDE 4AG4H 2F54D 1T5WA 5D2NE 4J12A 3QHFL 2D31A 2XWTA 4XX1G 4WI2A 3UMTA 4PGZA 2YRPA 1INEL 4JZJA 5HYIA 5E5UB 3PQYA 5F1SA 3BGMA 1S7WB 3H7BA 1FG2A 4P57B 2Q7NA 5GRVK 1J0JA 1TVBB 3BPCB 2EIBA 1TJGL 3HB3D 3P4OA 2R23A 3HUJA 3UTSD 2B4CL 4G5ZH 2YMXH 3B43A 2CRIA 4R6UA 4UUJB 1GSMA 5I2IA 4OV5B 1JFQH 3I50H 4U31A 4DN3H 4JVUA 2WBKA 5E2WL 4L3EE 2OK0H 5DEFA 5GGRY 5D70H 5D72H 3FO0H 3OR6A 5IMKA 5K9KB 3S5LG 4NUJB 5KVDH 3WBDA 3KGRA 3KPSB 3WNMA 3MRPA 1JPTL 3F7YA 1EO8H 1EX0A 3RKPA 4I5BB 4XBPB 1JPGA 3O9WB 4MA1C 5GS1A 4LGRB 5JOPE 4HWEL 4OCMC 1ZT7B 5KS9B 1MHHA 2DM4A 1Y6KR 3EYUH 1E27B 2VZUA 3T4AB 3EIFA 1ZK9A 1JNNL 4LKXB 4UIKL 5I74C 1IKFH 1U92B 4E42B 3TBYA 4F37K 1HQ4B 4NQVA 5IFJB 4GBXA 4O2FB 4UU9B 4LLVA 4WI5A 4CU8A 1TDQA 3T09A 4WWKD 1MLBB 3DXAB 3OZ9H 4DTGL 3I02A 3QDME 4WUUB 1NBVL 1YUHA 4YX2L 5J11C 4L4VE 5C0GA 3MRNA 3NZ8A 2DQFB 3TA3B 1S7SB 2ZSVA 4QEGA 4HWNA 1OWRM 3OJDB 4JZOB 3TJEH 4J23A 3VWKC 1A8JH 1CR9H 4HW6A 5FUZL 4AMKH 1A6WH 2ATPB 5F7EL 2SEBB 3D85A 5BZWA 4PLNC 3E0GA 3UAJD 1CXFA 5FCUL 4HKZA 4E5XA 4OCRL 3RGVD 2G9HA 1P5VA 5D1XA 2UZYB 4ZFOB 4NQEB 4LLMB 3MZTA 1FYHB 3NIDF 4NHCH 4JM2B 4OZFH 4OM1L 5F44A 5F9DC 4NUGL 3IFOA 1I4FB 5FYLL 3NCCB 2EXWD 3WIHA 1RJYB 4QNPF 3ROLA 3S4SA 5KTEL 3VXSD 4ODVH 3BWUC 1C16A 4U6YA 5HYJD 5K59E 2VXTL 3MRHA 5JDJA 3B9KD 1C1EL 4H1LH 4XCNA 2ZUQB 1B0GA 5TE7L 1AH1A 2OP4H 4PLJC 3RTQC 1UKSA 3MOAL 5IJKC 5GRVL 3WDIA 4NJAH 4JFQA 4ZO9A 1REIA 1JGUH 5CZXD 4POYA 2H41A 3D2UB 1B2WH 2YD1A 1NCAH 1OSPH 3TCXA 3RJDA 4GKZB 1CD1A 1XF4B 3L9RB 5IROC 3QEHB 4JLRA 4KJWC 3S7GA 4AG4L 1A6TA 3T3ME 3HB3C 5BO1H 2P8LA 3TO4D 1NKOA 3I9GH 4XCYB 4F3FA 1MCIA 4ZUUB 1MFCH 3MBEA 2VLJE 1L4IA 3PIQA 1KEGL 1UJ3B 4ZOEA 3FQNB 2DL2A 2JJSC 3PQYE 2OL3B 4LCCB 3LEVH 4OZIF 2R56H 4PJGF 1GGCH 1JZ2A 3VRIA 1JK8A 3FOMB 3EGSA 3TBTA 3TNMA 4MS8D 1OF2A 4HH9A 3PV7A 4PRDA 3BDXA 4H1LG 5AYUH 1P6FA 4LLYB 2CLVB 4PB0H 3ULUF 2F8OA 1EMTH 1JPST 1RI8A 3C6LD 5ENWA 5IWLC 1JFQL 1Y18A 3N0PB 4Y88A 3I50L 4DN3L 1OLLA 1X5FA 3P0GB 2OK0L 5D70L 3MRFB 4MB3A 3GKWH 1RJCA 3FO0L 1U8JA 2VLLA 5AAMA 3WO3B 3RWIB 3F6LA 2V7NA 5C8JA 3BP5A 5KVDL 1LO4H 1QR4A 2DBLH 1JRHL 4L29B 3DTXA 4YR6B 3UEZA 1T21B 3Q3GA 3EYUL 2X4NA 3ISWA 4JRYA 1IKFL 3FTGB 4WW2B 4AEHH 3CMGA 4U1MB 3MO1B 4MB4A 3VA6A 1YY8A 4E0RB 3HC3H 1R24B 1HZHL 3KPTA 4P2QE 1QVOA 3OZ9L 4DGVH 5KSBF 1XF2B 2Q86A 2AJVL 3UAJC 1X5JA 4IRZH 3D3VD 4FTVB 5F6HJ 5JTWA 3GSVA 1LP9F 5JNYB 1D5BA 4R0LA 2D7OA 3STZA 3TJEL 5BOPA 1CR9L 2FYYA 2CR6A 5EG6C 3CZFB 5J4MA 4Z9KB 4OF3A 1A6WL 1TNNA 3QUXB 2EXWC 3H9SA 3LMJH 2X70B 2QEJA 4I0KA 1SBBA 4U6VH 2H1PH 1HH9A 1VERA 2QQNL 4R4FH 2KQNA 2AJZA 3WXVH 3FB5A 4YEEA 4NBXB 1LEKA 4EXKA 4J7RA 3BGFB 2R0ZH 1JPFA 4HUXB 3RWCB 3F7VA 3UBXB 2AXGA 4MZ2A 4NHCL 1ADQH 4CVWA 5I15H 1ED3A 2E27L 3VD5A 4S0TD 1C7TA 4L8CA 1CTOA 1EAPA 5GGUA 5CZXC 4ODVL 1KCVH 4TUOB 5IR1A 3C5ZD 3CU7A 1CFSB 4JFEE 5FA3A 1ACZA 2A74A 5DI8B 3O2DA 5HVGB 3VXPA 1I9JL 3NIGF 5SX4H 4N8CL 3A6BH 1KCSH 2CDGB 2A38A 3IYLW 2C1PA 3R4DA 4Z5RA 2OP4L 4OD2A 3TO4C 2DB8A 2AV7B 4NJAL 3BN3B 4MB5A 3OKKB 4ZO8A 2PO6D 3HG1D 3RNKA 3UTTA 2FJGB 1B2WL 5HDBE 4QTHA 1NCAL 1OSPL 1DBMH 4XWOC 1A9EA 1G7QB 5GJTH 5F88B 2PUQT 1RZJH 1VB9A 4UDUB 5FB8A 1WZMA 3QI9D 2AJUH 4LHQB 1L7IH 5JPMA 3ZKXB 5BO1L 5E8NA 4GG8A 3V6FA 3OAUL 3I9GL 1FZMA 3MPCA 1KG0A 1H5BB 3JWDH 3C6LC 4S1RL 3LKSB 2R56L 2YKLH 5GS0C 1GGCL 4QOKA 5IM7B 1QPPA 5J9PB 3DX7B 3LN9A 1A6AA 4G6MH 1SEBB 2AJ3A 4JY6B 4BZ2H 5EN2A 2HKFH 3RZCD 5AYUL 4PB0L 3RVUC 3RWHA 1EMTL 1RIVH 5AEAA 3WYRA 4OBSA 2R2EB 1MCEA 5DJDB 2K1MA 2H26A 5C08A 3G6AA 1CGUA 5F7UA 5D1ZA 1DEDA 1LD9B 1P53A 3GKWL 4NHUA 1NDMB 2BSRB 2MCG1 4P2OD 4IS6B 4AH2A 4G9FB 3V6ZA 1ZHLB 4LCIL 5EU5B 1CU4H 4H25B 3QDGB 4KPHL 3U7YL 1I7RB 1U8NA 1ZT1B 4K3JH 1ZT4A 1ZE3C 2W60A 2AGJH 5FKPA 2Q6WB 1WWAX 2W0FA 4DGVL 3O2WH 1J9CT 2ITDB 2VAAB 5DRZB 4W81A 3T2NH 4YE4H 1BFTA 3QXDB 2NY3D 5GS0L 5TH2B 1IAMA 1UM5H 1S7RB 4Y7MA 1TNMA 4I18A 5C0EB 3NN8B 3CUPB 3PDGA 4RISH 3E6FB 3GI8H 1FFNB 3JVGC 3UZVB 2AEQH 1AHWB 1TTFA 3QQNA 1T04A 5IQ9B 3LN4A 3U4EB 2R2BB 2JB6A 3WXVL 1RUPH 2XZAH 3JWDC 2BVOA 3NCEB 4KQ3H 5H35B 5FAAA 4Q97A 4K7PX 4BQCA 5IHZA 2R0ZL 1EHXA 4G6FB 3R8BB 1YNKH 4L8SA 3PHOB 4LSTH 4P4RA 5DRNA 1ZGLM 1W72A 1ADQL 2QBWA 1OB1B 5I15L 3T4YA 2R69H 1C5BH 3OKDB 4NFCA 1F4WH 1KCVL 1D5XB 3UPCA 3P4LA 5TDOA 3PV6B 5K9OB 5EO9A 5GHWL 2H32B 4J3UA 5E1AA 4YAQB 4HWBH 3S97C 4GO6B 5IW1A 5I16B 2I9LB 4HWZB 1TTUA 4GS7B 1D9KA 3BWAA 3T0EA 4X0KA 4ONHB 3KLSA 1NFDF 1NKRA 1KCSL 3TBWB 5HYEA 3HCVA 2NMSA 1NEZA 3MUY1 1KJMB 3VFWA 3RDTC 4A2LA 5FEBA 3RPIB 1UWXH 5IB3A 4D9RD 2FD6L 4NZUL 4IJ3C 4XZUB 5GJTL 1DBML 4WFFE 3AM8A 4K8RD 2Y72A 2ZP0T 3RNQA 4K23H 3HZKA 4KKLC 3I6LD 1IEBB 2G5BA 2AJUL 3FB7A 4G8EA 1NGXB 3CDCA 2J8UA 2DKUA 5CEZD 1HCVA 3ZT5A 3CDGB 3UJTH 4WENB 3PWJA 4QLRA 5GGSB 3FFDB 3JWDL 3BW9B 2V5YA 5KVEL 3PGFL 1DUYB 2PCPB 1S9YA 4KUCF 1YPZF 3KDMA 2JLLA 2EE2A 2QV2A 1AO7E 2HFEB 4P2OC 3D0VA 4BZ2L 3S35H 2R9HC 1B3JA 1O7VA 1DQQA 2GCYB 1WCQA 4IRSA 4UTBH 1N6UA 3EOAA 4EUPB 2VDNH 2VXSH 4NFDA 4YGAB 1BQHA 2BY1A 2O5XH 4K8RH 5F89A 5C07B 4M8QA 1NCWH 5D7KD 5JXAH 5CEZH 1UA6H 3VGHA 1YEHH 5DHVH 4YFLI 1YYMH 2IAMA 4FXGA 1FH5L 2XA8H 1H3UA 1CU4L 3E2HC 1KLUB 3SO3B 5IB4B 3STLA 4J1UA 3CPLB 4PRNB 2AGJL 1NGWB 1JWMB 3RIFK 4HX1A 1JTPA 3ME0A 4JY4A 3HN3A 3O2WL 4OKVB 4Z7NE 5T1LA 5M94B 1MCCA 3LQMA 3T2NL 1XCQA 3MV7D 1QBBA 1U0QA 2GTWA 2XTJD 5JMOC 4HIEA 2A6JA 2QSQA 3D5OF 1N3NA 4NQUA 9CGTA 3DO7B 4LLUB 5L2KD 1BVZA 1RVFH 4MGXA 4Q9BA 1CG9B 4GW4A 4RISL 3V5KA 5D2NB 1KIPA 2AEPH 2X89D 5IFAH 5TF1H 2OJZH 2D0GA 2RFXA 2AEQL 2XQBH 1ZOXA 1J8HD 2NQCA 4FXKA 3VCLA 4AJ0A 4ELKA 4HXAL 4YBLB 5E2JA 4ZMAT 2IH3A 1RUPL 1U58A 4KQ3L 1QO3A 1YN7B 4RGND 1I9EA 1AQDB 3MBXH 2UWEE 4D3CL 1YNKL 4G3YH 3CX5K 4ZO7A 5E8PA 3U36B 1FV1A 3BQUB 2NY0B 2FHCA 4LOUD 1IC4H 2R69L 1C5BL 3W0WD 4QRQA 3QIWA 4OLEA 1F4WL 3QT2A 4A6YH 5I9QC 4YBHA 5ICXA 3SQOH 4IRJD 4YNYA 4HWBL 5IW3A 1P7QA 4PJFA 1U8MB 4KY1H 4AM0A 2C7UA 5C0CD 2RJMA 4K8RC 4NC1E 5HD8D 4L3EB 3IDYB 2XXMB 4XVJL 4PJIF 5EZJA 4B5EA 5ICYA 3PGCB 4GRLC 1JYWA 1KT2B 4DVBB 1PY4A 4KFZC 4H88L 4KVNH 3UTQA 3PWVB 4NFBA 1ZV5A 1S78D 2PTTA 1E4XH 3EW3B 5D7JC 3G5VB 5ESAB 3AREA 1DFBL 4WO4B 1CICA 3BZFB 4MXQD 1JUFA 2GTZA 3FO2A 3IDUA 5D4QA 3U30C 4K23L 5T3ZD 3QO1B 3DRTA 4YHIA 4U2YA 4OLZL 4PGDB 2X1OA 1N0XH 3QDMB 2HLFD 1KUMA 5I1CH 1RULH 4L4VB 3L6FB 4Y89A 1FL3B 1T0NA 2J88H 4DKFH 3ZT6A 3OJ2C 4TRPH 4WV1C 1QBMH 5CBEB 5KSUA 1PD6A 3VFGH 5A16B 1M7XA 4PR5B 1QLRB 3S35L 3C8KB 4BK4A 3WFZA 4NJ9H 4ZNEE 3T2OA 1UKQA 4UTBL 4GW5A 4GG6F 3IDGB 3EYVA 2VDNL 2VXSL 4EN3B 2ARJA 3S36L 1MHCB 2O5XL 4K8RL 5EBWA 3B2UC 5T3ZH 1G6RB 1Q0YH 2FJHA 3MFFA 1J5OL 2OYPA 2NNAA 3TO2A 4OUUB 2NW2B 3KXFA 5JXAL 4HJJH 5CEZL 1UA6L 2X4QB 1Q9KB 5CJOH 1YYML 4U1JA 1WZLA 2ZG2A 2NXZD 1LO3H 4XCCL 1JGEA 4IIQC 3N1PC 4MJIE 1FZJA 4CUCA 4XTRC 1HDMA 2CLZA 4KI5F 4EVNA 3EJYD 1JZ3A 3PL6C 3TPUB 4PRPD 5DD6A 3MX0A 3IJYA 5IBTL 1P6AB 2DM3A 3CDYA 1F4YH 2WBJA 3DYPA 4XBEH 2JIXD 3AUVA 2FGWH 1MLCB 4RGNC 5HHME 3RA7H 4PJEA 3RIAF 3U0TA 3VG9B 1T03L 3G5ZB 1I1AB 1T5WB 1OTUC 3WHXA 3IFPA 3GI9H 1RVFL 2RCSH 1A3RL 4HCRA 2AEPL 2X40A 12E8H 3KS0J 2GAZA 2OJZL 5TF1L 2XQBL 5IMMA 1SBSL 1PZ5A 2K7PA 4HAGA 3S37H 2VLJB 4HKXB 2EC8A 4IRJC 4QGTA 3MBXL 2BCKB 5IW6A 2DN7A 4FQ2H 4EI6A 2R39A 4TTGA 3HE6A 5BS0B 3THMH 4NDMA 1P7HL 1S78C 1V7NL 3MJ9A 4U05A 1F11B 5E95B 1AGDA 3K46A 1WC7A 4I3RH 3BP6A 5E8EA 3VFRB 1QTYT 4KY1L 4MXQC 3QCTH 5GZND 3RX5A 2YD8A 3D25B 4OF7A 1QZ1A 1U95B 5FA4B 3IXAA 1E4XL 1SY6A 1ITCA 5JQHC 4ZPVB 1ZHBA 4TSCL 5C3TA 2BNUB 4OLWH 4NQVB 1MY7A 2W65B 3D0LB 3O0RH 5EU7E 4OZHB 1I1CA 2QHRH 2R29H 1QKZL 5C09D 1MIML 5D7SH 2YSSA 1M1SA 4P2QB 3VGAB 4MCZB 4ONOA 4HS6A 5I1CL 2XQYK 2JJTC 3GRWH 2C3GA 4LQ1A 1IMHC 2J88L 4FQPA 4KRLB 3DETC 3O6MH 4TRPL 1JF6A 1YEJL 2OR7A 1KPUA 1N59B 1QBML 4UT9H 1G9EA 4F9LA 1FJ1A 3VFGL 3K1DA 3KPOB 3GHBH 2XQYG 3EOBA 4M6AA 1UB6A 4NZJA 3D85B 5JIKA 3GGWA 3BN9D 5K9QI 1HQRB 3EYFA 2NXZC 3S34H 5T1KD 3WFCL 1FNSH 5DLMH 5I75C 2WZPD 4Y5VB 5T3ZL 3RBGA 1Q0YL 1D6VH 3KXFE 3WJLA 1G0DA 1BBJB 3EJYC 4O51B 3S4SB 2VDOL 3HAEH 5DEGA 2KKQA 4P46D 4YK4B 4U0QB 2Y7QB 5ISZB 1MFNA 1NLDH 5DURB 2P5WA 4PJ8C 2PW2A 4JFEB 4P0DA 3V7MA 4Y4HB 4L3AA 2FX8H 2YD4A 1WLHA 4YQXH 1D5MA 4F7EB 5E0QA 2GFBB 1QFWH 3HR5A 2F53A 3QUMB 4HUMB 3RUGA 2W92A 3WFEH 1I8MA 3MV8D 5C9JA 5JQ6H 1NC2B 5J89A 4MXVE 4OSUH 4UOW1 5C0IA 4GKOA 1M6OB 4MA7H 4XBEL 2FGWL 3VFSB 5D96C 1H15A 2DQIH 1M4KA 4NO0B 4ORZC 4UBDD 1FZOA 1G7JA 5C0ND 3GI9L 2RCSL 4APQA 1EFQA 4QHMA 4GRWE 5J1TC 1YMHA 4JFHE 5EOQL 12E8L 5F7NC 4F3FB 4N8VA 1VDGA 2WLZA 2WLYA 4U1SB 2XZZA 4IOIA 3QEQE 5EB9A 2MJWA 3HAEG 1IM9B 5CD3A 1DANT 3E6HB 1R3LB 3FL7A 5A1AA 5GZNC 1UFUA 4U1NA 3MLWH 4FQ2L 5IB1B 4MJ4A 3BX7C 3THML 1X9QA 1YEDA 3BPLB 4LBEA 3L3DA 4JAMB 1L9NA 2OZ4L 4R2GC 3CMOH 3MNZB 1BLNA 5IHLB 1AY1H 2P7TA 1BQSA 5HHOE 3QCTL 3OTTA 5KSAD 5C0BA 2CO6B 3EFFA 1GZPB 5E94A 1BVLB 2DJSA 3TN0C 2LAAA 4QKXB 5F7FA 5E08H 3SDAC 3IU3A 1OGAD 5HY9A 1S9VB 1IGFH 3LIZL 2VH5L 3FQRB 1TJIH 4X6FA 3SKMB 3BEWB 4U1HB 3HR6A 2EDWA 3IDMB 3VXQA 4QCIA 4HXBL 3ILPA 1GVIA 3BAEH 5E24E 1E4KA 4KDTC 2QHRL 2R29L 4PRHE 4P49A 5D7SL 3BN9C 4JFDD 1QSFA 3GRWL 1KBGH 2M26A 5F6HI 3A6CL 1H8NA 5EIIB 1RUQH 3O6ML 2VDRH 4NO5B 4F2MB 4UT9L 3KPRA 3QFDA 4LSRH 2X09A 3HI1A 3RGHA 1ZKAA 5JXEA 3GHBL 4Q2ZB 3WN5A 4BFGA 3KWWB 4JHAH 2Z93B 4X9IA 1S7VB 2LABA 4OQ1A 3S34L 5D2LA 2FGZA 2ADJA 1I75A 3WCYA 1K4DA 1KCLA 5F7YC 4U33A 4JRXE 1N5AA 3I3EA 4PJXF 5DLML 3WE6B 5FHBL 1F3DH 5JOFB 2AQ3A 1PZUB 5DT1L 1D6VL 4DN4H 1G9MC 5D5ME 2ZWLT 4XPAH 2B2XL 5AD0B 2J8HA 1UJTA 3NACH 4NQDA 1NLDL 5C2BH 1WWCA 3BZEA 1KCRH 1JTTA 3MCKA 2KBGA 3QNYA 4U7MA 4XP1L 2X4UA 4NQXA 1EGJA 2FX8L 4LHUB 5KVGH 3JUZA 5IESH 3KYNA 4OJFL 4UBDC 4YQXL 5C0NC 5K33A 4MLSA 2GK2A 4X6DA 1JHTB 1QFWL 3LV3A 4L9LB 4TTDC 1MAJA 1IAKB 3OXRA 1QNZH 4YEFA 1I1YA 3FCTA 5JQ6L 3E8UL 4HK0A 2VRAA 4OSUL 2Q87A 3SKOB 3NFNA 2OQJB 4MA7L 1U3YA 4MQ7A 3OKMA 4I48A 3ARBA 4EKXA 3WS6C 5DJ8A 2YPLA 1MVUB 5DJZB 3WEXA 1GXEA 3LKOA 4KRMB 4YC2C 4F9PA 5JA9A 1XCTA 3GSNA 5T33H 3TT3H 1BJ1J 2HTKD 3V4UH 1CQKA 4J2XA 1EJOH 2NYYC 4LSPL 4NKMA 3KHOA 4LLDB 3P73A 3SE8H 4URTB 5K9JH 1MJJB 4NQTA 4XVTL 1G9ML 2CO7B 3F62A 2AJ3B 3KYAA 1KULA 5DMGD 1AO7B 4QHUB 3I3DA 3MLWL 3BDYH 3GDBA 4Y5XA 1AR2A 4P3DA 3OXSA 1QSED 1UYWH 3MR9B 1QPXA 3LKQA 3L3IA 4X5XB 5IK3A 5LKNA 1RAMA 1YJDH 4Y19A 2X4SA 3CMOL 2X7LB 4EIZC 3BKYH 4PP1D 1AY1L 5DJ6A 5C0JA 4YXHH 4UTAL 1FP5A 5SX4I 4N1HB 4U6XA 1INQB 1IC7H 5E08L 3V6ZB 5LAXB 1IGFL 3PJSA 1TJIL 3IVKA 4GXUN 2NY2B 3H9HA 5MEND 1U8NB 3ZDXE 4Y0GA 4BH7B 1DL7L 3ZL4H 2H2PC 5D93C 1U8OA 3BAEL 2JTDA 3DGCR 1SHMA 2BFVL 1J8KA 5FIEA 4S1SH 4GRMB 4XGZA 3QWOA 1A1MA 4ZDHA 4GQ9H 4U7SA 43C9A 2V2XB 4I0PC 1QSFE 3DX9A 4YIQA 1ZGLA 4UV7L 4LMQI 4LSSH 1KBGL 1U3HA 1XAUA 1RUQL 4Z77A 3JV5A 1N5YL 3KPRE 1E0OB 4HUUB 3F58H 2VDRL 3DX6A 2GJZA 4XI5C 4LSRL 3QIBD 1G7LA 3AU1A 1RZFL 4ETYA 4OGYL 3GSUB 2RIKA 3CFIC 35C8H 2IH1B 1ZSDB 4Y4KA 4YHNB 3HE7B 4C4KT 4XMLH 25C8H 1M71B 2UWEB 4DN4L 3WIFA 3HPLB 4OLUH 2MFNA 4NQSA 3Q5YA 3U6RB 2BP3A 1S9WA 2VWEE 4YPGB 4OFYA 4OCSH 2CKBA 2PTUA 3NACL 5IMLB 3V95A 1YJDC 3OKNA 5C2BL 3WUWA 5HGBA 2Z35B 4OFKA 3D87B 5BVJA 3VE0A 3O6FB 3H42L 3DGGB 1D9KB 3L5HA 2F8XC 1OP5K 4Y2DB 3KG5A 3MRJA 4LCYB 4X6DE 4GKSA 5IESL 3NGBC 3QG6B 2BX5A 1AKJB 2X9WA 3S88L 4R3SA 1ZHNB 4NRYB 1CGXA 1E6OH 1QNZL 4KRPD 2HTKC 5DR5H 3JV0A 4PJ9B 3WUZA 3H3PH 2VB5A 3BMWA 4KH2A 2BC4B 2CRZA 4ETQA 4N5UA 2YPLE 4PBVC 1U93B 5MEPA 4TNVF 5GGRA 1Z2KA 5F21B 5D1QB 1QD0A 1NANH 1NAMA 4CNIA 2L7UA 3TT3L 3VFPA 1S3KH 2MOVA 3AFLA 4ZS6D 1LE5B 4LCWA 4Z7WE 2FLRT 4PP1C 1PYWA 3SE8L 2QL1A 3FQTA 4WFGE 1M7DB 3C87A 1KB5H 3C60D 4WU5A 5E5MA 1S5HA 1WVZA 3L3HA 2XACC 3DNKA 4HC1A 4MSWA 5LVEA 1UYWL 3DMMB 2ZUVA 4J3XA 5F71A 3IETB 1YJDL 5D71H 5CEXB 4NRXA 4YXHL 3X14B 3AB0C 5AYQA 2I25N 2F8VA 3VDCA 5EU6E 3SGDI 5F3HB 2E7MA 1LE9B 3V6BR 2X10A 4E9LA 1BEYH 5E03A 1IGTB 4G43A 1OGTA 4P5TA 4F7CB 1HHJA 2VN7A 1H9VA 2J6EA 3VD9A 4QRSA 1HHGA 4K3DH 3ULSA 3P77A 3RVXD 1I8KB 1AXSB 2CKNA 1HSAA 4MJIB 5H37H 2FIKA 3MCG1 4JQXA 4MAYA 3FFCE 1EK3A 3FRPG 4KKCD 4S1SL 1Q9LA 3SDDC 5INCA 3EYQD 3RWFA 4GQ9L 2NY6D 3GMQA 5EPMA 3ZYZA 3BH8B 5I8CB 4BSVA 1ZGLP 2VDKH 4LSSL 1C08B 4Y4FB 5DD1H 4OD3L 1PG7H 4HIEB 3A6OA 1MHPL 2QKIA 5HHMB 3RWGA 3RHWK 1JGVH 5I1AB 3LQAH 3V5KB 1QRNA 2DLTA 3IB4A 3DSFH 2RFXB 3TIDA 2GW5A 3TZVA 1VPOH 2FH6A 4WI8A 4O2CA 2QQKH 4GW1B 4F7MB 3ZE1F 2QSVA 4S1DC 3CSPA 5DQJA 2UUDH 1LK3H 4XXCA 4Z7QE 25C8L 4YDIH 2HMIC 1K5NA 5H37G 3OB0K 1QP1A 4EI5A 1GH7A 4OLUL 1A6ZA 5BJTA 5BQ7B 1URLA 3UO1H 3VFMB 4GBXD 4OCSL 5C9KA 1QR1B 1TMCB 3TEUA 4X9GA 5J06A 3LKNA 5TDPB 1FAIH 4NSKB 5CFHA 2JJWA 1K9TA 3M45A 4GKNB 1BFOA 3TVMB 3V7AE 4XWGH 1HEZB 4ZUSB 5FYKE 3CLEH 3FQXA 1CDBA 2D0FA 2NXYC 3HLAB 4C56E 5E7FA 5EZLB 2VLRA 3BZ4B 4O02L 3QDJE 1QSZA 3X13A 3I6GA 3L5IA 1E6OL 2UUDK 1OCWH 4UMGA 3AREB 5DR5L 4ZS6C 3B5HA 2F15A 3H3PL 1CLOL 4GSDH 1T3FA 1B6DA 2NY4B 3ARFA 5DMYA 2GK0A 5F9WB 5EBLA 3C60C 5D1XD 3QUZD 3EDJA 3MJ7B 3DVIA 4U4BA 3MLVH 3PHSA 2Q20A 2Q3AA 3U9UA 2X2YA 2CH8A 1A7NL 3FB6A 1S3KL 1A7PH 4CMHC 4M61B 2A73B 4Q9QH 2YPVL 3VD4A 1LQSR 2Y07H 5JIPA 4POZD 4JPIB 1P7QD 4QHLB 2Z91A 3QG7L 2VLKA 2ZOLB 1IQDA 5HJ3B 2Y1VA 3SDXE 4QY8B 1KPRB 1EV2E 3J8F7 4Y2OA 4Y16A 5D71L 1EO5A 2R15A 4V1DA 3O4LA 4QXGH 3VXNA 2EIZA 3ARDD 4S1QH 5EULV 2OR9H 3MRRA 4FP8H 5CJQL 4JZJC 3ULVF 4KKCC 3EYOB 2APWA 2A9ML 4M1GH 1IAIH 4M7LH 3EYQC 1CDHA 1FFPA 2NY6C 4MWFA 3W39A 3RL1A 3QAZB 2VYRE 1RIHH 1U91B 4ZAKA 5IQ7H 3WIHH 4K3DL 2H9GA 3O8XD 2MCPH 2BXZA 1A14L 1JN6A 4JFFA 3MBED 2OM5A 3GJFA 3QO0A 2WMPA 5GIRA 4X7EC 2NX5E 3KAAA 3BIKB 4KI5E 3RWJB 1Z9OA 5E70A 5I1DA 3KPLB 5DJCB 3FOLB 2VDKL 1BECA 1YEGH 2FWOB 4MX7A 4PRID 3TLRA 3W11D 2J7LA 5DD1L 5J12B 1H3TA 1CQYA 2X1PA 1PG7L 2ADGA 5GS1C 4DCQB 4CN6A 5FYJU 3BYYA 3GSXB 2ICES 3KPNB 3UTSA 1QRNE 1JGVL 2AK1H 3QXVA 4RWHA 4P4KB 3VFTB 4HFWA 3FQUA 1OAKL 2ICEB 4D0BA 4LEOB 5C0AE 2APTA 4N90E 4GBXC 3OL2A 4HF5H 1VPOL 2R4RL 4RA0C 2CIIA 3QEQB 4WW1A 5EBMB 4BELD 5DK2B 4LFHD 1TLKA 1RZKC 5JZ7C 5HDQL 3S4SG 3LVEA 5I19H 3EBAA 4YDIL 4PJBA 1Z3GL 1BD2E 2YRLA 4OF6A 3RVVC 2ADFH 4R7NB 5E00B 1TQBC 5F6IC 3MRQB 3PWUA 3UO1L 2K9UA 3UTPD 1WIUA 1WEJH 2ZCKH 5DMIH 3EYSL 4XX1E 4OZFA 5HHOB 1PLGH 4XWGL 5D1XC 4WWKA 8CGTA 4LF3A 3V79C 4K07A 5GSRA 1AC6A 3WS3A 4MNGA 5C6TH 1DUZB 4PJAE 2EIDA 4MDIA 3ZE2F 1OCWL 3S96B 2PXYD 1EERB 3H9SD 4KROC 4GSDL 5ESQB 2AK4D 3LH2H 1U8IB 4ALAH 2P45B 4HS3A 3EDFA 2VNCA 4JG0H 4POZC 4F7TB 5JW4Q 3INUH 2QR0B 1G0XA 1FFOA 4PRHB 4HUWB 5DS8A 3U0WH 3RGVA 2J2ZA 1ZEAH 1XFPA 4PTTA 1KYOJ 5JW4M 1CDCA 3FHAA 4QF1A 1MWAA 3L95B 1A7PL 1NGYA 1RZKL 1LDSA 5TGBB 4I3SH 3ARDC 1ZLWH 1MRFH 4BZ1H 1JHLH 3K8LA 1HH6B 2Y07L 5GQBA 2VLKE 4JJ5A 1LP9B 4ZXBD 2EXYD 4OFPA 5IF0A 1QOKA 4YXKH 1ZWIB 2Q76B 3KJ4B 1OW0A 1JP5A 5F97E 3MUJA 1FN4B 3O4LE 3B9KA 3GB7B 5FXCH 3QRGL 1BM3L 3CC5B 5FECA 3MBEC 4P2RE 2P44B 4S1QL 4JRXB 2OR9L 2ZUWA 4FP8L 3TH3T 3S9DB 4LFHG 1NAKH 1EXUB 4N0CD 4KTEH 1OAYH 5KN5A 4M1GL 3NA9H 5D5MB 1IAIL 3BIAX 1OD7A 2R2HB 2BNQD 5HHPB 4WDIA 3GJEA 2FLBT 5IQ7L 1UXWB 5JLZA 1ZLWK 1F4XH 3WIHL 3W11C 4X7SL 3BGAA 1RK0A 2JCCA 2CMRH 2MCPL 1CGVA 3NFSL 2F54E 4CW1B 2EO9A 3OGCA 4TYUA 2OSLB 2O5ZH 1W0WB 3QQ3A 4JKMA 4EZMA 2MHAB 3SPVB 4NCDA 3QFJB 3U9PL 4OTXH 3CVIL 1PY9A 1KIQB 1FORH 5GISL 2EEBA 1J86A 4WW2F 3F12B 4NQCA 1N0LA 4MNQA 2ERJB 3MLXL 3OJMB 4FFZH 1Y6MR 3KNBA 5ID0A 3UTSE 4CKVX 3V5DA 4Z7UA 2AK1L 4Y5YA 1KNOA 5CSZA 3T1FA 2A0LC 4F15C 4BQBA 3FO9A 4JZNA 5CGMA 3W2DL 2C3VA 1OAXL 3AMKA 5DJYB 4HF5L 1UZ6E 1AIFA 2OI9C 5ITBH 5CD3B 4HH8A 4G9DB 4MJ5B 4XNQA 2A6DB 4X98A 2R0WH 3SJVA 2EDQA 3TBVB 5I19L 4OF5A 2IFGA 3B3IB 3DRQA 3MUGB 3GMRB 3Q1SL 2ADFL 4RFEA 1B0RB 4R0LC 3T0DA 3AS2A 3O9WD 1XGQA 1EEQA 2LU3A 1VENA 1IQWH 1YNLL 1BLNB 3BPOB 1WEJL 4HUVA 2ZCKL 4G8IB 5DMIL 5I1GH 3K2UH 4XCEB 1PLGL 5E94B 1YC8A 1KJ3H 4ZUWB 4G6KH 3DXAD 3M07A 4WUUD 2IANE 3QULA 5HYFA 2XZCL 2DYPB 5HY9B 2F58H 1XIWB 2WINB 3GKZA 1AP2A 5HHQA 3FO1B 1J05A 1OARL 3TA3D 4EQ2A 5FM5O 2X4PB 4GLRH 3CX5J 1F6AB 5CJ5A 3CSYB 2DI9A 3LH2L 4S0SD 2APBA 4JG0L 1RZGA 5TE6L 1MFDH 4X6CE 2EXYC 3INUL 1ZVHA 2GY5A 5EFIA 5HDOA 6CGTA 1T4KB 4I4WA 4YHZH 4WHDA 3U0WL 4E41E 5ACLA 1BF2A 3IU4H 1ZEAL 2EYRB 2HJKB 4PGBB 2EDFA 1NCNA 4I3SL 2ZPKH 5J0BA 3KPRB 1JHLL 4JM2D 2ZUXA 1DBBH 1G84A 1MCFA 2DI7A 3VXSE 1XZ0B 1KTDA 2MNUA 2B5IB 3T0ED 4HPYH 5HYJE 4YXKL 3HHRB 1R3KB 4X4YB 3C5ZA 1UM4H 1IZKA 2E5EA 1D5ZB 5E2UH 4UAOC 5E8OA 2Z4QB 4LU5H 2BOCB 2HVKB 4O00A 4BKLB 3ZYJA 2XWJA 1NAKL 5T3XD 2AVGA 3DVFA 4KTEL 1HHHA 1OAYL 4OLVL 4OLXH 3CFDA 1W72H 2PO6A 2X44D 3HG1A 1WWBX 1KC5H 1MUJA 1RUKL 1XGUB 3D2UD 1MCKA 4P5KA 4DVRL 4U1LB 3SDCB 2DRUA 1A3QA 3QNYB 2PYEE 2X4UB 3FB8A 2VDMH 2O5YH 3QI9A 5EZIH 2B1HH 5IVXE 3O2DL 4YDJB 4FFYH 1MVFA 3VWJB 4DAGH 5D1ZC 1CFNA 2JB5H 4OTXL 4ZYKA 5BRZA 4HK0B 1FORL 4ACPA 2FL5A 4Q6YA 5LGKA 4FFZL 1DR9A 5T3XH 4Z7UE 5I0DA 1N8ZA 3RZCA 4X4MA 5DJ8B 2VISA 2AI0H 1AGEA 3G6DH 1GC1H 2GSGA 3D18B 3RY6C 1JF1B 3LRHA 2EYTA 2V6HA 3ZTJG 3UP1A 5AUMA 5ITBL 2DLIA 4K9EH 4PRAB 1I9RH 2N4IA 3O3AB 1DN0B 2R0WL 4Z7WB 1PW3A 4RQQA 1O7SA 1PKQA 3JTSB 5EZOH 1VACA 4K2UH 5FO7A 4Q0XL 4XCFH 3SKNB 1QUNA 2HLAA 5IVNA 4I18C 1RZIB 3QUYB 4K7PH 2MTPA 2P4AB 3GSQA 4PD4J 3REVA 5I1JH 1IQWL 1NEZG 2AERT 2F74A 4OZIA 4PJGA 5EOCH 5T1LD 3FT3A 4MA3A 5IKCB 2YEZA 4U1GB 2EEAA 5I1GL 3P9MB 3K2UL 3QEUB 1TQCB 3D69A 1KJ3L 4G6KL 1NGQH 4IHOA 4OCLC 5EU6B 3D3VE 1X5ZA 5LXGH 2MPAH 2LVCA 3MJGX 4L8SC 2F58L 4FQHA 4LVNC 3PABB 5ERWA 3OJVC 3BP4B 1A9BA 1AC0A 3G08B 5BXFB 4HZAA 1U8OB 5MHSD 1EFXA 3OKLA 4H8WH 1TPXC 3FFCB 2FEEL 1MFDL 3QWOB 5F3BA 3IDNA 3B2VH 3T0EC 1SMOA 2CUMA 4B7IA 4YHZL 2I9TA 3IU4L 1MELA 5HVHB 1KJVA 4HQQL 1JNLH 1DVFB 5JHDE 4CDGC 3O41B 1LNUB 3MYJA 2VERN 3ILQC 5DYOA 1DBBL 1JZ4A 5HI3D 1L6ZA 1I7UB 3AM8C 3ZHKA 1BQHG 3BO8B 3GM8A 4HPYL 5I0ZA 4LMQE 4M43H 1GC1C 3MOBH 4PJCE 4ZFFB 3I75A 1UM4L 2V2WA 5FDWB 3W9EA 1XGRB 3TBSA 3BE1H 1W8OA 5E2UL 3OR7A 3LKPA 2D0HA 4K9EC 1HSBB 3MLTB 1U8KB 2Z0BA 5BV7C 5DA4A 5EO1A 3RVTC 3GNMH 4OLXL 1CICD 3HG1E 1W72L 2YBRA 4LAQH 3BJLA 2CXKA 2XKNB 4GXUM 2GITA 1G1YA 4M93C 5IBUG 1NJ9A 3GM0A 3V0VB 2IF7A 4L3CB 5CILL 1FZKA 4LGSB 4I9WD 2V7HB 4IRSC 3V5HA 2AXFA 2VDML 2BVQA 2O5YL 3QZWA 5EZIL 4GKSB 4FFYL 1ACYH 1FSKC 4DAGL 4FQXB 4R3SB 3ZSSA 1HIMH 2ID5A 4C56B 1R3JA 3H0TB 3QDJB 1BVKB 3GSOA 2I07A 3B9AA 5EIVA 2DBJA 2YK1H 2IAMC 2VDLH 4QYOA 4MQXD 3C09C 1X4ZA 3DURA 4PJHA 1FPTH 3CSBA 3TFKC 3EO1B 2XFXB 4AIOA 2Q7YA 2AI0L 3PWLB 1GC1L 1KGCE 1GOFA 1N6VA 4JFPB 4K9EL 1F13A 1I9IH 1JWUB 3MRMA 5DZNA 3ARRA 2AV1A 1KJ2B 1PKQE 5FKAB 5BV7L 5ID1B 4PJDF 3HKFA 2YZ1A 3BRDA 1WITA 3DO3A 3LHPH 2VSDA 4K2UL 5LJYH 4XCFL 3ARQA 4G9FD 5HYSB 4K7PL 4NBYB 2BOBB 4YDVA 1AGFB 3NCJH 2GEEA 5B38B 3SDXB 2FATH 3IKCB 5I1JL 4KKNA 5F8QC 2GJ6A 5EOCL 4C55A 1J0KA 4U1KA 5JOEA 2R1WA 2XPGB 4R4BB 5SWZB 1T20B 2YD2A 1A6UH 3P4NB 1MIEL 4F8QA 4KJPC 2ICWJ 5LXGL 1YMMA 5C6PB 5DSCB 4ODHH 4LLWB 3MV7A 1SYVB 1XR8B 4A6YA 1AD0B 2OTUB 4ERSH 3NMEA 3QIWC 2ZCHH 1QQDA 3DHJA 2EH7L 4PGCA 5L2KA 4MQTB 3EHBD 4NZTH 32C2A 3TJHD 1DSFH 5HHVH 5B39A 5HI3C 3HRZB 5DC0A 3CFJA 1J8HA 3B2VL 3QIUB 2C3XA 4HG4K 2NX5B 4HZLA 3IDJA 2ZOKA 3TNNA 3K4ZA 4W6YB 3N50A 3GMMA 2CPCA 5E6IB 2VZVA 4UQ2A 3O81A 1JNLL 1U36A 4BFBD 4WNQB 5JDSA 4ELMA 2XWBB 1HOCB 5EDXA 4UNVA 2CUHA 1I85A 3R1GH 4FFVC 4LRNH 1MY5A 1CICC 4OQTA 4RZCA 1ROWA 4YXLL 4NT6A 3B83A 1MCNA 4M43L 3MOBL 5DVOA 3GIVA 4HCRH 5C0AB 2RAMA 5E2TH 1GYAA 4BFIA 1KTLB 4G8FB 2WIIA 1FYTE 5C0CA 4RRPA 3DSNA 1HILB 4YHPB 1LVEA 4RAUA 3SY0A 3P40A 4F33A 2NY1C 1MFEL 3TIEB 2V5RA 3MNWA 4I3GA 1BD2B 2DWDA 3GNML 5LBSH 1KLFA 5DK0B 1A6VH 4D9RE 4KUZH 3S37X 3MRLB 3GMLA 5GGVL 3DV6A 4EOWH 2IPKB 5DUBB 4RWYL 2EDKA 2ESVA 3MJ9H 3I6LE 5KSVB 3RHWF 3CLFH 2VZSA 1HHIA 5CEZE 4ODWB 4HV8A 5I76A 2FZ3A 4MA1B 4CMMA 1X5AA 2YXFA 4M6OH 3X13B 4G7YH 1NMCC 3MODH 4PJAB 5K59F 2YK1L 5I74B 3O2VH 4OGAC 1SY6H 4M1CC 5SWQA 5IG7B 1T89A 1FPTL 4OCYH 3QXAB 3SO5A 5J11B 2FJFA 2NTFA 1FO0A 1E4JA 4EJ1C 4ZFZB 5DF0A 2HN7A 5B4MD 1HE7A 1LK2B 1JZ8A 5KJRH 1FAKT 1IGCL 1I9IL 3S5LB 3VWKB 5D7KE 4HDIB 5C07D 3SDYL 2EDTA 2WBJC 3T3MF 1GPOH 5EU3A 3FQWB 3LHPL 4ODTH 5ACZB 2HJFB 4ZUVA 5CBAB 3P3YA 3E3QC 2WK2A 1MJ8H 4CBPA 4PY7B 8FABB 1IC1A 3NCJL 2FATL 5B8CA 5D6CB 2YD6A 5DJ0B 4NN7C 3MGOA 4G80A 2F5BH 4RSVA 4AT6B 1YPZA 1FL6A 3EHBC 3HUJF 5FK9A 4P2RB 3TJHC 4PRPA 5JPNB 3IDIA 2EYSA 1A6UL 1FFPB 4FNLH 3MV7E 4X7FC 4EUPH 2XTJE 1G7PA 1RZ7H 2NZIA 4OGZA 4LASH 2JIXA 4MA8H 4OD1H 4WWID 4ONFH 1JL8A 1T22B 3HE6C 4LIQL 4NNPH 4ERSL 5KZCB 1ZVSA 5L2KE 5F1NA 2F54B 1K6QH 1YYLL 4KV5E 3RTQB 4BK5A 1DSFL 5HHVL 1ES0B 1XGTB 4TSBH 1J8HE 2ENYA 5DJ2A 1DEEB 4QRUB 5DRWA 2X4OB 4JO3L 1MQKH 3T04D 5EC2A 4OCXH 3SE3C 2MKLC 4RGNE 5IEKA 4N68A 2HJLB 3HMXH 4Z8FH 3VMOA 2FR4A 3LQZA 5J1AB 1LDPH 4NN6C 2CDFA 4ELME 1Z0MA 1H3VA 4K3HA 1YN6B 1A7OH 3BIBX 3T08A 1D6EA 3W0WE 3KHQA 1ORQB 4M62H 3BQUD 2CSPA 1W2KT 2NY0D 3VXTA 2DQJH 4O2EB 2MQ0A 2QADD 4PREB 5C0BD 2A6IA 3BDBA 4JEGB 3LDBC 2J12B 1U3ZA 3CH8A 3OV6A 4HCRL 4O5LH 5E2TL 3DX8A 2V9TA 5C0CE 5H94A 1VFBA 2DQUH 2EDYA 3HI5H 3VFOB 3CXHK 3VXUE 5FO9B 1XH3A 4L3ED 4CJ0A 5ILTL 2XA3A 1KB9K 3EO9L 2HT4C 3IF1A 5DMKB 2CDEA 1WBZB 1A6VL 4HLJA 4XAWH 2RGSA 1NUDA 1UZ8A 1XMWA 4FFWD 4KUZL 3JSSA 4F9LC 3AAZA 5I1KH 4EOWL 4X9FA 3JWOH 5DQDH 4KZEH 3PE9A 4WO4D 3GMPA 4KKBD 1V3MA 3MJ9L 5T3ZE 2XY2A 4JPKL 2BJMH 4RAVA 1HNGA 5T1DH 4OZFB 4UV4L 3MA7B 2O61A 5C09A 1FVEA 3WLBA 5GSRB 1H0DB 2BMKB 4YUEH 3FRUA 4KK8C 4HHAB 4OAWB 2G2RA 3QNZA 2IANB 2Z31A 1IT9H 1K8IB 1P1ZA 4KMQA 3WJLC 1CE6A 4L4VD 4YHMH 5F93C 5B4MC 1AGCB 3O2VL 4LKCB 1SY6L 4H1LB 5FV2A 4Z0XA 4N8VG 3DUUB 2YR3A 4HS3B 4PJIA 1JGDB 2VJXA 3N1FC 4MVBD 1A1OB 1Z9SA 4AIXA 4NZRH 4X6CB 2A9NH 2EKJA 3KLAB 5T1KA 3W82A 4E41B 5ITFA 3CFKA 5HDBF 4B53A 4EN3D 4K7FB 3VXRE 3CD4A 3RVWC 2E6PA 1PSKL 4QRPB 3T8XB 1K8DB 4IOFC 3Q48A 5CJBA 1GPOL 4ODTL 4RIRA 4JJ5B 5F1KC 3VXSB 1MJ8L 4P46A 2NZ9D 5GSVB 1T1WB 2VXUH 5HYJB 1CVSC 3BRFA 4XC1H 4APQC 2UYLB 4YO0B 5E6ZA 2Y06H 1T1XA 5KG9B 2CR3A 1YEIH 3GSRB 3KPQB 4JO1H 1A6PA 2F5BL 4OZGA 1PG7W 3LKRA 3NPZB 4PRPE 1SJEA 5DQ9B 5HGHA 1FVDB 1TZHA 5GRZA 3LPWA 5KN5B 3L7FA 4GOSA 2DWEB 4UIMA 2EDDA 3MRGB 4PJXB 5JR1L 3MV8A 3QJHB 4XP4H 2OJEB 1R5VA 3ARBD 1MI5E 4WI3A 1RZ7L 4X7CC 1C5CH 4LASL 5FGRA 2OXHA 4TUJB 4MA8L 4OD1L 4GG6A 5DJAA 4ONFL 4EEEA 2VE6A 3JWOC 4NNPL 4LHJB 5CLWA 1G6RH 4AY0A 1FVCB 4NIKB 2EC9T 7CGTA 1K6QL 1I1AD 2C1OA 2PYEB 1JNHB 5H8DA 3MA9H 3JTTA 3TO4B 3G5XA 4K71C 4TSBL 5IVXB 1P4BH 5EH1A 2QADC 3WHE0 1EGJH 1IGMH 5A3ID 3U83A 1QHOA 4OCXL 4R8WH 1CXHA 5C2UB 2VLJD 3HMXL 3O3EB 4GUPA 1OTTC 3O45B 4NKDB 5D7IA 1LDPL 4NWTH 2D7TH 1A7OL 4FQIH 4Y19D 5GPRA 2NLJB 2DQJL 1NC4B 1IEHA 1TETL 2GJJA 4YHOL 5BS0D 4ZQKB 4FFWC 2WBWB 5JMRA 3C6LB 4NYLB 1E4KC 2VL5A 4O5LL 2BNRE 4KK9D 2DQUL 4MAUH 3GSNH 3HI5L 4Y8DC 4FABH 5C0RL 5LGJA 5KSAA 5MEOB 4GXVH 3QQ9D 1WBXB 3NTCH 3LS4H 2HFFB 1NBQA 1VKXA 1OGAA 3K80A 4Q6IC 4XAWL 4XRCA 1JF5A 2HYMA 4H0IA 3WN5C 3JWOL 3L3OB 2A77L 4YZFF 4KZEL 5HYQA 1KN4H 4QTIH 2EDOA 1ZXQA 1EHLH 1R3HA 2IG2H 5C09E 2J5LC 3KPPA 1R5IA 4QGYA 2BSTA 2W1NA 3C5SB 1A5FH 1RUAH 1XGPA 4MVBC 1NBYA 4YUEL 4JFDA 4P2QD 2W0KA 3D3VB 3S8WA 1P7KB 2NTSP 4M1DL 2VAJA 3VW3H 2DTMH 4NNYA 4HIHA 4YHML 1MAKA 4UDTB 5I8EA 4WFED 4D9QE 5GGQH 3WLWC 4I0CC 1N4XH 2DI8A 2GSIB 4PJ7E 4N9GB 1TVHB 4HJGA 2N7BA 3L3JA 1JVKA 4NZRL 4I4WB 2AKRA 3U0PB 1BZ9A 2A9NL 3GUTB 1QBLL 5F9JB 5FM5M 4BZYA 1ZHKB 5CGYD 3MV9B 5IB5A 2EE9A 4OFYD 5HPMA 4QHNA 5JHDB 1JYVA 1OAZH 3B8YA 2KDGA 3FONB 1KIRA 2AJYH 2IADB 2OX5A 1A1NB 1JV5B 1PX3A 3ARBC 4XH2B 4M5ZH 5ISZD 1T1ZA 4XC1L 4R9HA 2B8OT 3BEVB 4MZ3A 4PJCB 5DURD 3VXME 1A2YB 2Y06L 1QSVA 5HHNA 4OZGE 3U4BH 5ALBH 4JFED 1DLHA 4F9PC 2EDXA 2X4TB 5ICZA 4Y4HD 4ZUTA 2ORBL 2FHFA 1FCGA 5EWIH 1G1CA 1Q8MA 3MV8E 1MFAH 1S7QB 2ADIA 3EZ8A 4XP4L 3HG1B 1X5GA 4NRZA 4X7TA 2ZG3A 2XN9D 4DZ8A 3BH9A 2V2TA 1NC2D 5DTFB 1C5CL 1I8IA 4XAKD 1MJUL 4P2YA 1UB5A 4Y5XC 1OVZA 2CKBH 4CL7A 3ARZA 3OKOB 1I3RA 2DQCH 2FNBA 1TCMA 3EJJX 1OWWA 3AVEA 3RDTB 3MA9L 2HVJA 4HIJB 3DUSA 2R1XB 4PG9B 4GAGH 1EGJL 4D0CA 3P4MA 3M1BA 3ELAT 1NMBH 5LG1A 3TC9A 4IJ3B 4CVXA 5IOPA 3C9NB 2CRYA 5D7IE 2EICA 4KK9C 2HG5A 4TNWF 4XMPH 3V0WH 4NWTL 2D7TL 5MEQA 3QQ9C 3EFDH 4FQIL 1GHFH 5F9AC 4MHHI 4JB9H 1S7TA 1F4AA 1QSEA 3QUMH 3T2PA 3MRKB 3G5YA 3D39A 5SV4A 2W9EH 4Z7NF 4JDZA 3CDFA 3X3GH 1MRCH 3O4OC 5JHLL 3F5WB 4QT5B 2E9BA 4MCYB 4GMTH 3MRDB 5AUMB 4WEBH 5TDNA 5TE4H 2ZKHH 1OQXA 3GSNL 4FABL 4P5TD 4JFOB 4HSQA 4GXVL 4BQ9A 4L4TA 3LS4L 4P2OB 5E5RB 3DIFA 1U3HC 4N0YH 3HC4H 1OGAE 3VFVB 5BZDB 1INDL 2OLDA 3WUWG 1KLGB 3GFUA 1AI1H 3D6GA 2VABA 4ORGA 1XF1A 5MENA 2D03H 3ROOB 5F7DB 1KN4L 4QTIL 4FQJH 2IBGA 4M9PA 5KBNC 1ZAGA 1OOAA 2PYFA 2X42A 2IG2L 1FBIH 4CN1A 4Y4KC 1GJIA 1V3JA 1PKOA 1A5FL 5DHXB 2XNAA 1IAOA 4ISVB 4NWUH 5MP6H 3E2HB 3X11B 3EOTH 4XVUD 4FQHB 3ECBA 3MRBB 1Z5LB 3UTZA 1A9BB 3C6SA 5CGYC 4Z95H 1U42A 1N4XL 4TOYL 3TZVD 4WJ5B 3QIBA 3LAFA 2D9CA 4R96B 1C5DA 3U82B 3L5WB 4TSAH 2VQ1B 4MMZC 5IIEA 3ES6B 4EXPX 2DLHA 1ZVYA 2DIJA 1CGSH 1G7HA 4G42B 3WDHA 3BKJH 4XXDB 1GGBH 1Q0XH 2C5DC 4S2SB 3LRSA 3L3GA 5FOBA 5HVWA 1FL5B 1N2RA 2J8UF 4KHXH 1OAZL 1NQBA 2AJSH 4RNRA 3HZMB 2CLRB 2P5EA 4Q58C 5ETUA 1TJHH 5DHYA 4Z7VA 3MV11 4M5ZL 4M7JH 4PJ5B 1DE4B 1UEYA 3U4BL 3AXLA 5ALBL 4DOHE 1ETZB 3CFBB 1FYTB 2KPNA 1KB5A 2Y5TB 1FNEB 1LEIA 4LHUD 3C8HA 2CD0A 2DL9A 1L0YA 5EO1B 1U8HA 4BQ6A 2QHLA 1UADC 1B4RA 2YC1A 3FZUD 3L7EB 2P24A 5F1IA 5I17A 3WFDH 5JW5A 5I9QB 2W9DH 3X12A 2ZCLL 4U6TA 5KANI 4L8DB 2X05A 1CDJA 3KYOA 2MQ3A 2CKBL 3OHXB 2DQCL 1P9MA 3MQIA 4H26A 3RFZC 4GRLB 4MD5A 1VSCA 3CCHB 3B4NA 4P5MB 5DHVB 5I18L 4G8GE 2ATKB 2ICCA 1LEGB 1RZ8B 5D7JB 5DVMA 1NL0H 1QHPA 1NMBL 4HGWB 4NN5C 5IB2A 1IL1A 1P4IH 1PQZA 3S3PA 1T7VA 3U30B 5D9SB 5CIPA 4P5TC 2H3NA 4Y16D 5D6DA 3PNWA 1QSEE 3EFDL 1GHFL 1ZA3A 3T3PE 4S11A 1AO7D 4KHTH 4M4PA 4JB9L 5J6HB 2H6PA 1RHHA 1BJMA 2W9EL 1RD6A 2ITCB 4JQXC 4MAYC 4M02A 5A2KH 3NAAL 4WEBL 4WV1B 1NAML 1WCBA 1RJLB 1EJ6A 4LCUA 2ZKHL 5TE4L 5F9OH 2YPKB 1DQJB 4ZAKD 1FGNH 4XPTH 1YEKH 4DK6A 5GZOD 5I8OL 3ZYOA 1OM3H 3MCLL 4Q74A 5B21A 1KPVA 5I1IH 1NCUA 4JFFD 3DVNB 3MRIB 5EA0H 1AI1L 4OM0H 3IGAA 3WFHA 4BSWA 4HC1L 2NY2D 1MCWM 4FQJL 3UBXI 1K85A 2PR4H 3TZVC 1UVQB 3P0VH 5HPOA 3DYMA 3TCLB 1FBIL 1U8LB 4PLOB 1S8DA 3IJSB 1IGYA 3WKMH 2FO4B 5EU4A 4XXCC 2ICWI 4NWUL 1AXTH 3I6KB 4IIQB 2Y6SD 2LQRA 3M17B 3MV7B 1VADA 3EOTL 4QXTB 4EI5C 1B6UA 5I71C 2H8PB 4MJ6A 5SWSE 1U8QB 2J6EL 4Z95L 5EORL 1G7IA 4AEIH 3HPJA 4X4XB 1A4JB 2WNGA 2CIKB 3HMWH 3LOWA 4XBGA 3TYFB 3PL6B 2ZSWA 4R7DA 4BFEA 3NCMA 2HT2C 3AGVA 5CWSB 4TSAL 2X4RA 1SYSB 5DDHA 4EBQL 4HGKC 1IEAA 3GJFH 1CDGA 3DARA 1CGSL 3BKJL 1S9XB 3P9LA 1G0YR 3O3BB 4RGNB 4P99A 2V5TA 1GGBL 1Q0XL 3HE7D 4AIZB 3QJFA 1NCDH 3O11B 5KVFL 1EH9A 1T0PB 1DBKH 2YXMA 4LVEA 2OMBA 4KHXL 1CF8H 3W0WB 3Q6FA 1F42A 2AJSL 3RI5K 3I2CL 1T1YB 4WU7B 3FZUC 3ARFC 3MNVA 4Z7VE 3RX8A 5TQ2L 3MJ6A 1TJHL 1A64A 2VZTA 4IRJB 4M7JL 1I1FB 4Y8AA 1BQLH 4JG1H 4LP5A 2FO1A 5I1LA 5JORB 1MPAH 1NCCH 4Z76A 1F45A 4ZSOA 3VXUB 1T7ZA 3QH3A 1M05A 4N0UB 3GJFK 4MDJB 4GAFB 5C1MB 2D4DA 2DWDB 2GYSA 5CEYB 4JFXB 2VITB 3WFDL 4XPHH 4R90L 3QA3B 3R06A 3C08L 4PJ9D 4DEPC 4U7KA 1LO5B 4ZG1A 1UACH 2ZJSH 3BVNB 3REWB 1F6FB 3KR3H 1N6QL 4Y16C 3QUZA 3PDOA 1ONQA 4DW2L 1UXSA 3CVHA 1S7UA 4I2XB 2DQGL 1KN2H 4RMSA 3N85H 2FZ3B 4JE4B 3JV4A 1BZ7B 1KXTB 4N9OB 5EC1A 2E9WA 3ORJA 1NL0L 1Q9WA 2HTLD 4PB9H 1WT5A 4DK3A 1N64H 3DV4B 3GMNA 3QPQD 4ZAKC 3SKUD 3TH4T 4KHTL 2A6KA 2NTFB 5EO0B 1CTNA 4MXVF 4J8RB 3GBLA 1DDHA 4OZ4B 5FO8B 2H2SD 3ARDA 5E9DB 4GAYB 5F9OL 1JYNA 3VXRB 3G04A 3TGXA 3ZTNL 3O3DB 4MD4A 5BVPH 1FGNL 1MWAH 4XNZC 1UG9A 4NBZB 2NY7H 3BOVA 1P4LB 1U41A 4GRWF 2R1YA 1OM3L 4ZUVB 5I1IL 5EA0L 2NXZB 1WSST 3ARYA 4FQQA 2Y6SC 3O8XA 4OZFG 5HI4D 4PRBA 4D8PB 4MJID 4RA3A 2PR4L 5H2BB 4HFUH 3P0VL 1VEPA 3DBXA 3MROA 5L2JA 1IM3A 2UY7A 3JUYA 4QRRA 5C0FB 1YEFH 2IQAA 3QUKB 4NQCD 4KJYA 4MNQD 3WKML 3BHBB 2I24N 3HUJE 4X6BB 3VRJA 1OT2A 5EOTA 1AGBA 1G7PB 5EUOA 4PRIA 4PJ8B 1MI5B 4Y4FD 5J7CC 1C8PA 4G5ZL 2YMXL 3U2SA 2VLMD 4XNMA 4YPJA 5T1MA 4AEIL 3F7RA 2FB4H 1HXYB 4HWUA 5FFLA 1CFTA 5CP7A 3HMWL 1X5HA 2BSED 4KZDH 1WTGT 5D7LB 3BD4A 3NPSC 1V3LA 5E4EC 5D72L 3SJVD 3F6IA 5L88H 1FE8H 4PS4H 4WWKC 1KENH 1BOGA 1EO8L 1VFOA 3KLDA 5D96B 2FEDD 1NCDL 1BQUA 1MCOH 1DBKL 3U1SH 1T5XB 1CF8L 4NKOB 4N1EA 1E28A 1BX2A 1LO2H 1TIUA 4AQOA 3MGTA 4ZODA 3CFCH 1P2CB 2A6IB 3H7LA 1OHQA 5F7WC 3QB7C 1NBZA 4H5SB 4N0FB 1P84J 1TCRA 1BQLL 4JG1L 1ZLUH 2BNRB 4ZSOE 1RFDH 1J0ZA 3RGVC 1BIIB 1NCCL 4N5ED 3ARGA 3TVMD 1ND0B 1GZQB 4PLKD 4WY7H 5TQ0H 4ODXB 1CT8A 4X7DC 1NCBH 2P46B 5MI0C 5ANMA 4R2GB 3BXNB 4UI2A 2EO1A 1VFAA 2PXYA 4AMKL 3LPFA 4XPHL 4FQCH 2HTLC 4PTUA 1ORSB 5KAQG 5IVZB 3U48A 2AK4A 1KCKA 1OW0C 1UACL 4WHTB 2NY4D 5FUCC 3TN0B 5D5MF 1T83C 2EDNA 3SDAB 3B9KC 1I7ZB 2APXA 4JN2B 4DZBA 3PHQB 2FRGP 1KN2L 3WLBB 4Z6AT 2PNDA 3HAEB 1C12A 2G5RA 3GSWB 4XP6H 1A3LH 1ZLUK 4HKBA 4PV8A 1GOHA 1ZS8A 4KDWA 4P3CH 4U1IB 3V8OA 2ICWB 1MHEA 4YHYC 4R97C 3Q6GH 2V9QA 3ZT7A 4PJ7B 1UQSB 5CHNA 4ZXBA 4JDVA 1T2QH 3CX2A 3V2AR 3PWPA 3GO1H 1F3JA 4LSUH 2E6JA 3SGKA 1Q38A 1DJSA 5ITFB 5ESVA 1YDPA 4YGVB 1K4CB 1JGUL 2W38A 2CQVA 2KH2B 1A7QH 3JBG7 4D0DB 1WBYA 2UZIH 2ENSA 3ZKSD 1NDGB 1RU9H 5BVPL 1MWAL 5DGQA 3DUHA 4HIXH 3SOBH 2VIRA 4P23A 2BNQA 2FECI 4MS8C 4X8JA 4F57H 4AENA 2YA1A 1CDUA 4M48H 4Y5YC 2C4FT 3BP7A 1ZA6B 1XF5A 4WI4A 1MFCL 3VXMB 1CD0A 5BRZD 3LEVL 5FHAH 1OQOA 5CZKA 1CGTA 2EKSB 1FDLH 1WISA 1RJZB 4HT1H 5HGDB 2VKXA 1PJ9A 4OFVA 5L7XH 3DVGB 1EBPA 4LP4A 3DWTA 2WM0A 4ZTOH 4Z78B 1S7WA 2ZUYA 2MMXA 4L8BB 3CK0H 4P57A 2FEDC 1TVBA 2FB4L 3BPCA 4KZDL 3RKDD 4P4KD 2X1XR 4IMLB 2BZDA 4HBQA 1YNTB 4UUJA 5L88L 4OV5A 1LO4L 1FE8L 4PS4L 5JO5B 5L9DH 1KENL 2DBLL 4YFEA 3ZDXF 5D7IB 5K9KA 3HI6H 4NUJA 4JRYE 1SJHB 3KPSA 4PLKC 4MD0B 2GHWB 4I5BA 4YC2B 3RY6A 4XBPA 4AEHL 3O9WA 1MEXH 2OCFD 3UTPE 3CFCL 3HC3L 5KS9A 1KIUA 2VL5B 4LRIA 2P48B 1E27A 3T4AA 4EDXB 4QRTB 2CJUH 3MLPA 4LKXA 4E42A 1U92A 1UCTA 4IRZL 1HQ4A 3UPRB 4D2NA 4UQ3B 3ULUD 5IFJA 1RFDL 5MERB 4O2FA 4UU9A 3ESVF 5HHOD 1VGKB 4WY7L 3CH1B 5TQ0L 3LN5B 1MLBA 3DXAA 4FZ8H 4WUUA 5I73C 1OGAB 4TUKH 1WTLA 4ODUB 1GL4B 1RZJC 1IE5A 5IEHB 3H9SE 1LO0H 3TA3A 1EFXD 4FQCL 1S7SA 2HWZH 3LMJL 1BF8A 4JN1H 4U6VL 2AK4E 3OKEB 2H1PL 4R4FL 3OJDA 4HKJA 4JZOA 2EDBA 1WAAA 3KPMB 3C5ZC 5FM4A 4YZFE 3HZYB 2ATPA 3N06B 2SEBA 1NBYB 4NKIH 4PRHD 4XP6L 1VFMA 1RY7B 4X6EB 1L9MA 3L1OH 3RL2B 4ZFOA 3QWQB 4NQEA 3MREB 1TITA 1FNGB 1WICA 3ULUH 2PO6C 4P3CL 5D93B 3ALWA 1V7MH 4JM2A 1NLBH 3Q6GL 2M1KA 4X6DF 5F72S 3DROB 4LLQB 1SQ2N 1T2QL 5CINH 1R6VA 4I0PB 3V4PH 1RSFA 3A6BL 3GO1L 3BESR 3QI9C 4LSUL 1RK1B 1T66D 3SGDH 4NO3B 5CD5D 1FFRA 3UTTE 1Q9OA 4FQLH 1A7QL 2UZIL 1RU9L 4HIXL 3SOBL 2BNQE 3QEGH 4Q9CA 1RZJL 3W9DB 2VO5A 4UT7H 2HRLA 3OX8B 1L7IL 3D2UA 4WRLA 2IALA 3RZCC 2CRMA 4Z7WF 5GGVY 3LD8C 3DI2B 3L9RA 1XF4A 3QEHA 1A4KB 4QOKE 5FHAL 2YKLL 1FDLL 1Z6JT 5GRJH 1TZIB 5I1HH 3MLRH 4HT1L 4XCYA 2QSCH 4G6ML 2BK8A 4ZUUA 5L7XL 3H3BC 3QFJD 1UJ3A 1UWXK 3FQNA 4ZTOL 5DJXB 2HKFL 2OL3A 3R0MA 3BH9B 1QFPA 4OF0A 4Y1AB 4YBQD 3RBSA 3CK0L 1RIVL 3VFUB 4LNRB 3SCMD 3LEXB 2OTWB 5C08E 3VFNB 3NGBB 3MMEB 4LLYA 4BH8B 2HVJB 5IFHH 2CLVA 5DK3A 3GIZH 2PW1A 4G8GB 1QLFB 2NCMA 3BRGC 2KUTA 4JY5H 3T0BA 5L9DL 4UB0H 3V4VH 1CFQB 4D9LH 1X3DA 4LVHC 3ULUC 2NY3C 3HI6L 3RWIA 1OSZB 1T2JA 3GMOA 1CD9B 4K3JL 4YFLF 5HGAB 4M7ZC 1Z9LA 4YJZL 2GJ6D 4KGJA 2JK5B 5KS9E 2LU7A 4L29A 2V17H 4F7PB 1HHKB 1X7QB 3DJ9A 4YR6A 3S98A 1T21A 3C5JB 2D3VA 4U6HB 3FTGA 1YMMD 4U1MA 3MO1A 3IJHB 4YE4L 3HS0A 3UYPA 1J88A 4E0RA 3DXAE 1UM5L 4WUUE 3HZVB 4ODBD 1XF2A 4FZ8L 1C7SA 1DBAH 4TUKL 1JZ7A 2DYPD 1F6LL 5FGSA 1Q94B 4PJDB 4FTVA 5HSFA 2HWZL 3GI8L 3QZWG 5DC9B 5JNYA 4JN1L 3AB0B 1YY9D 4Z7QF 1JZ5A 2XZAL 1DANU 3CZFA 2OR8A 3L3KB 2DS4A 3QUXA 2X70A 2RB8A 4JREC 4C83A 4LSTL 4NKIL 5CZVH 2VC2H 4OCWH 3N1MC 3O6KH 3L1OL 1F90H 3T65B 4HJ0D 4ZPTB 4HUXA 4X99B 3ULUL 3RWCA 3UBXA 1NGZB 4MNHB 3VA2C 1V7ML 5SWSB 4KKAD 3CFEB 5J6GB 1NLBL 5CMAB 5IJVB 2XRAH 1V3KA 3SDDB 3T0EE 3RZWA 2QQQA 4TUOA 1KELH 5F7MC 1YEEH 1DZBA 1CFSA 1IGIH 4X5WA 4RFOH 5DI8A 4PGEB 1G7MB 3VXOA 3WD5H 5T3XE 2A83B 4FQLL 2CDGA 1I8LA 4XNUH 4JCMA 4ZNCD 1QA9B 2J3SA 4JANB 2ESVD 4HMDA 2AV7A 3RWEB 3ZZ1A 3QEGL 4P59H 3OKKA 4UT7L 3UROR 3JXAA 2J8UE 3VMPA 2FJGA 3FAWA 4OQTH 1G7QA 5JIIA 5F88A 3UJTL 1IGJA 4WFHD 2Q8AH 3SCMC 4UDUA 2Q1EA 1LEIB 3IXTB 4CVZB 1QFUH 2PKDA 4BJLA 3MLRL 4TPRH 5DMJB 3C2AH 3VWJD 2QSCL 3SDXF 1H5BA 2BVPB 3LKSA 4A2MA 1M7IB 1OPGH 2DLEA 4ONGH 5EUKB 5IM7A 5B39G 3KS0H 3DX7A 5J9PA 1FIGH 3QQ4B 1JIBA 1KOAA 1SVCP 1SEBA 2HFGH 3RWDA 2NXYB 4U2ZA 5IFHL 3DOSA 3UJIH 5KW9H 3GIZL 1NCWL 4B50A 5T5FH 1YEHL 4JY5L 2R2EA 5DJDA 1AD9B 3V4VL 3FT4B 2XA8L 1LD9A 3C60B 1NDMA 2BSRA 4WVRA 3BUYB 5LWYH 4IS6A 1GGYA 2XTJC 3VI3E 3UZEA 3JV6B 4G9FA 5L0QC 4OI7A 1ZHLA 3T77B 1II4E 5L8LB