4ZPTA

Structure of mers-coronavirus spike receptor-binding domain (england1 strain) in complex with vaccine-elicited murine neutralizing antibody d12 (crystal form 1)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
216
structure length
213
Chain Sequence
EVKLVESGGGLVKPGGSLKLSCAASGFTFSSYAMSWVRQTPEKRLEWVATISSGGTYTYYPDSVKGRFTISRDNAENTLYLQMSSLRSEDTAMYYCVRDGNSMDYWGQGTSVTVSSAKTTAPSVYPLAPVCTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D12 Fab Heavy chain
publication title Evaluation of candidate vaccine approaches for MERS-CoV
pubmed doi rcsb
source organism Human coronavirus emc (isolate united kingdom/h123990006/2012)
molecule tags Viral protein/immune system
total genus 40
structure length 213
sequence length 216
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zptA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zptA01
1H0DA 3B9AA 4PD4J 2QQLH 1NGZA 1VA9A 1QVOB 5EOTA 2BY2A 1J0JA 3MNZA 5HJ3B 5DC4B 3BIKA 1RY7B 3FHQA 4Y5YA 2MPAL 1EHLH 3GRWL 2PYEA 1DLHA 1GSMA 3ZE2E 1F4HA 4PY7B 2N7BA 1VSCA 5E00A 5IHLB 1HOCB 3PQYA 1B0RB 4HZLA 4DQOH 1RIHH 4JFDD 4G8GB 3TBSB 5GS2H 4N8VB 4YHIA 4NUJA 2BVEA 3D39E 1QSFA 4XC3H 4ZUVB 3STZB 3GSNA 1OGAA 3P40A 4XWOC 4S1SL 4P4RB 5FHBL 1N5AB 4PLOB 5HYFA 4Q6IC 4OJFH 2QSQA 2ZKHH 1AKJD 2GEEA 3TVMA 4E41D 1Z9LA 4QXTA 3TYGL 2EH7L 1HXYA 5HXMA 1WIUA 2YRZA 2NY7H 1WIPA 4YHZH 3MLVH 2ESVB 4XBGA 3KPNA 3DUUA 3BGMB 1NCWH 3MJ7B 1ZLSH 5FK9B 3NPSB 2J6EL 1EAJA 2G2RB 3ELAT 2BMKA 3O0RH 4RX4D 4NNYB 3VWKC 1NC2B 4X4ZA 1P4IH 3WN5A 1DBJH 3SDXE 4EN3C 3KLAA 1CU4L 3BP7B 1MRFH 2IBZY 1C12B 5F6HJ 5IJKC 3KYOA 5CEXB 4LLQA 4PR5A 3EOYG 1QPPA 4X6DB 2R2HA 2DQDH 4PJIA 5D7LA 2R4SH 4UMGA 3AC0A 2Q6WA 2VITA 4P2QD 1MCOH 2E8YA 2VXTL 2BNRE 4U6VH 3EOBB 5HGHB 1LEGA 4YXKL 5EA0L 4MB3A 1GHFH 5HVHB 2Z92B 5SX5K 4XNUL 2ADGB 4M1GH 5ILTL 2C1PB 1CQYA 4WEBL 3C5SB 5JR1H 2KZWA 4YHNB 3GNML 1TTFA 3IRPX 1FFPA 2OJZH 5IEHB 5SWQB 3DYPA 2NNAB 4YJZL 3O3AA 2E5EA 4UZGA 3GJFK 4HMCA 2VAJA 5DDHA 1FDLL 2G75A 5L2KD 3MV01 5GGVH 1XF5B 4X6CE 3TH3T 4NRYA 4TRPH 3QUXB 1CCZA 1NFDB 3VXSE 5KJRL 4GKOA 1T22B 4HS8H 2AI0H 5EU6A 3GIVA 3GIZH 4N8CH 5GGTA 4FRWA 1JNNL 2P5WE 1MJJB 4LSVH 5A2LH 2ZG2A 2JELH 4JKPL 4P0DA 3T2NH 1KPVB 2XKNA 3DLQR 3E2HB 3GUTA 5GS3A 4HMDA 2APTA 1FFRA 2HJKA 4LRNH 4AK1A 2DQFB 3BZEB 4JR9L 5ALCH 4OGAD 1U91A 2HFFB 2HP4A 4KI5E 4JHZA 3K4ZA 1GAFH 1QR1A 4TUKL 4LLWB 4PREA 1DLFL 1YEHL 3CXHK 2XQYK 4XCCH 3S3PA 1TJGH 3VFUA 1K6QL 1E6JL 2FZ3A 4KGLA 5IEKB 2X09A 2DTSA 1MCPH 2V2XA 1Q72H 2GJ6B 4OLUH 3I6LE 4NJAH 1H9VA 1ZT1A 1N26A 2VLKA 1GGCL 3H7BA 3MR9B 1AO7E 4NDMB 3S8WA 1ZSDB 4NHUA 3SDAB 1CIDA 4HQQH 4WFGD 3HC3L 1SQ2N 4JM2B 1QBLH 3L5HA 4K7PH 4P59H 1PKOA 3MO1B 3UJJL 1SJVA 1LDPL 4CNIB 4HJJH 1SVZA 1XH3A 5EWIL 2VISB 4G8IA 1QLFB 1G9NH 4FFZH 1DEEA 1N64L 3IJHA 4RSVA 2X89D 3RWGA 4AL8H 5AZEL 5E6ZA 2YD3A 2E9JA 3GSXB 1EVUA 4N9OB 2A9NH 1W0VA 1FNLA 2QSVA 1EUTA 3BT2H 4GKSB 1E0OB 5B39G 3VRLF 4MMXC 4HWBA 1D5IL 2BNQA 4K3GA 4NCC2 4O02L 5D2LE 1CD1B 1FCCA 1JF5A 4PS4L 4UNVA 1P6AB 1MFEL 2R29L 4PTUB 4JFQB 4ERSH 4MJIE 3CZJA 2AKRB 3RPIA 3RVUC 3B2VH 35C8L 3DUSA 4O2EA 1CGSH 3WHXB 3D69B 4K2UL 4PY8J 5IG7A 1NC4D 4OQTL 5KSAD 1T83C 5IW6B 3U4EB 3ARXA 2EKSB 3CCHA 2OZ4H 3KPSD 3UTPE 1FZMB 5FOJA 2ZJSH 4D0DB 3C60C 2A73A 3FB7A 3P0GB 3V8CA 4LLMB 4PJHA 3GI8L 1ZA3A 5ESAA 1GH7A 3HB3D 3RI5F 3ARUA 2BVPA 4NO5A 3BXNA 1XF3A 3KPQB 5DQDL 3WNMA 2VSCA 1BPVA 3TZVA 3VFOA 3ULUL 1WBXA 3GI9H 2QV2A 4J4PA 4LSPH 1WZ1H 5A43C 3K81A 1JZ6A 4GOSA 3UTTB 5I8OH 4MWFB 2Q86B 1KJ2H 4HUXB 3EO0A 2E27L 3QDME 4HFWA 1LK2A 4I18A 1MREL 3MYJB 4K3JH 1U36A 4NZRH 2DI7A 3LKRA 1IT9L 5EZLB 1W72A 4D9QE 3GMPA 4ZFOB 5A2JH 5B21A 5MHSD 4Q2ZB 3QG7H 3H3BC 3LRHA 1J18A 3BP6A 2CXKA 1JYNA 4X7DC 4TULH 1E4WH 1NGQL 4DW2H 2WUCL 3CFKB 3QR2A 3HHRB 1YEFL 2QQNH 5EO0A 1ZHNB 3FB8A 5L0QC 3VMPA 3T0XA 4PIRF 4GRWF 4Z7VA 3G6JA 4OZIB 4PJHF 3B9KB 5ADPL 5KSBE 4LLAA 1F4XL 5GGRA 3JV0A 4HT1L 1A0QH 2CK0H 3LQMA 1JTOA 2APWA 5DUBB 5DJ8B 5DZLA 1FVCB 4PJFF 3GM8A 4DGVH 2J8UE 1NAML 1U3YA 5EZIH 4OUUA 2ZNWA 4YEFA 3O4LA 2JLLA 2NY6C 5MP6H 4YXLH 1S5HB 4IMKA 1HQRA 5HHVL 3VXUA 3RWJB 4Z95L 2VDOH 4TSBH 1AHWC 1DQJB 2ZOLB 2VUYA 3QO0B 4X6EB 5KSUA 2EC8A 3HMXA 3QDGE 4M6NH 3VFNB 3NCJL 1PYWB 3FB5A 4M8VA 2I07A 3ARFC 2EDHA 5ABDE 3X3FL 2Z35B 3GSWA 5TDPA 3Q0HA 5B38A 2BVUA 1HQ4A 2QHRH 4KJQD 1GZQB 4KQ4H 1E28B 2HRPH 5F7KC 3UTQA 1CFNA 1FJ1B 4XI5C 4MXQC 4AENB 2KH2B 5ISZB 4XBEL 2OXGA 3UYPA 5IVNA 5FDWA 3ZYZA 3P4OA 2CQVA 3ARDB 2D0FA 4W6YB 2KBGA 1T0MB 2RCSL 5ADOH 2F53A 1OAZL 1EMTH 1ZHLB 3RWEB 4XVTH 4ZS7L 1AGDB 4S1RL 4GAGL 4R4FH 2D03L 4FQLH 1L6XA 2ID5A 4Z77B 3UJTL 4NRZA 3V8OA 1P9MA 3BKCH 5GJTH 4F7PA 4OB5L 5K93A 1MFDL 4C56D 4C55A 1CGYA 1RUQL 3L5WA 4KFZC 4KQ3L 5DEFB 2NR6D 2DKUA 4FTVB 2LVCA 3S37L 2D7TL 3MJ8A 5EU7C 4LCUB 2IALA 4NNXB 4PLKD 1FORL 1NBQA 2ZUXA 4NM8H 2EDKA 4XNXH 5DQJB 4QTIH 1YJDH 2Y6SD 2HVJA 4JFOB 5ANMA 3I02A 3KPRD 1YPZA 3GBNL 3HG1B 5F21B 1BZ7B 1TQCB 2FYYB 3LH2H 4U1KB 5DMIL 5T1MA 2NX5D 5HGBA 3WO4B 4F7TB 5CD3A 3D3VA 1OAKH 4Z0XA 3U36A 4YX2H 1FIEA 5IT2H 2WZPD 2DLTA 3FFCA 3PWLA 5GZND 2ATKA 3CX5K 5JOFB 5KAQG 3Q6GH 2ED8A 1PD6A 1U3HB 5JDSB 4O2FA 3O6LL 4W4OA 1DDHA 3B5TA 3MLWH 4UQ3B 3VXRE 3E0GA 3MBXH 1KPRB 2AQ2A 2J1KA 1NFKA 4DGYL 5T1LB 3BEVB 3UBXI 2H3NA 1JZ7A 4PP1D 3CLEL 3LKQA 3S7GA 4MSWB 3VG0L 1AD9A 1DBAH 2YKLH 5EC1A 1CICB 2ZSWA 1CDBA 3EFFB 2D7QA 4JFZL 4QNPF 1C08A 2VXQL 3FOLB 4PJDB 5SWZE 4NKDA 2FH6A 2CKBL 1IKNA 1QSVA 4KKNA 2OZ4A 3OKKB 1FZKB 4WY7L 2OJEA 3RAJH 4HBCL 4WJ5A 3KHQA 2FH8A 4H88H 1QNZH 2Z93B 1MJUH 3ESVF 2Y06H 4ISVB 3H9SA 4G8EB 3GJEB 1YDPA 4HIHB 1MCSA 5KS9E 1PX4A 1JGEB 3N1GC 3PL6D 5I75C 4PJAB 1R3LA 3V6OC 5K9KB 1FC1A 3NH7H 3X13A 5DLMH 1A1NB 1SJEA 4KHXL 3MACH 1YUHB 1S8DB 4P57A 4KDTC 5JPNA 2DQTL 3PV6A 4MXWH 2NY0D 1P7KB 3WFCH 5GGUA 3MBEB 4WDIA 2V9TA 3JWDL 4P46C 4PJBE 5E8EA 5I17A 4WHDA 4YUEL 4D9RE 5FGCE 2AJSH 4XWGH 4KUZL 1UJ3B 4I48A 1V5JA 4F33A 5HYJE 4L29B 5GRVK 2PXYC 4Z7WB 4X5XA 3RTQD 2X4TA 3HI6L 4OIAA 4PJCE 4PJXF 4M1DL 4J12A 4U1SB 3MLZH 4GG6A 4DAGL 2F5BH 4ZSOE 5I0ZA 1WBZB 4KGJA 1HKFA 5E7FA 1IGIH 4J6RH 3TBVB 3NA9L 1GGIL 5FYLE 1YYLL 3KJ4B 2AV7B 4JO1L 3DX9A 1ZVHA 3TBYA 1YNLL 1C16B 3VRJA 1BM3L 4FP8H 1LP9A 1FLTX 3HUJB 5DJ2B 3DSFL 3MOBL 4EEEA 3L6FA 1QSEE 2IQ9L 4NQCE 2H9GA 5ENWB 1CZ8H 2AK4D 4ODSL 4ZTPH 1KTDA 5FHAH 3I6GB 1IGYA 2XN9E 1J88A 5C0JB 5GS1A 2APXA 5J11C 3ZE1E 4P5TC 1NANH 3BPOC 4F57H 1DFBH 4O5LL 2JB6B 5J12B 1Q1JH 3GSQB 4Y4HA 5BRZA 3S4SA 1DQLL 4OCRL 1A3RH 1QLRA 3VW3L 2BDNH 5FKPA 2XA8H 4LEXL 3DUHA 4I3GA 3HPJA 5CIPA 1S9WA 1A6ZB 4CMHC 1OSPL 5AUMB 1G7HB 1FNEA 3MYZA 3PXHA 3ECBB 3RVVC 1S9XA 1OB1B 4QYOA 3GSOA 3T0EB 4M8QB 2QEJA 2BY1A 4XP1L 2PUQT 4R97B 2ZUQB 5C0IA 3QJFA 4XVSL 4PRPD 3MFFB 4HUNB 3KNBA 1RK1B 2RHEA 1QHOA 3TIDB 3CSYB 4HKJB 1A4KA 2OI9B 1CE6A 3RKDC 3UAJC 3ZTNH 2FX7H 1S7UB 1EJOL 4H20H 5DHXB 4ZPVB 4MNQA 3HN3A 3T2OA 4RGOH 1I4FA 2R9HD 4HAFA 2J8HA 3MMEA 2AJUL 4X83A 1VPOH 1KN4H 3PGCA 4RMUA 1DVFD 4Y19E 3HE7B 4OSUL 3LKOB 4OZGE 5F72S 5I1GH 5IMLB 1CDCA 3CFDB 4HWUA 1NDGA 4KHTH 4Q7DA 1ROWA 5GGSB 5DHVB 3UTSE 4FFYH 3QUYB 3R8BB 1BWWA 4AT6B 3L3JB 5E0QA 3UC0L 4LP4A 3IAPA 2APVA 1CS6A 4GAFB 5DJCA 1S9YA 5F3BB 1NCTA 1RZ7L 2ARWA 1A9BB 1NLDL 5I6XC 3WIIL 4LLDB 2YUVA 1S7SB 1QRNA 4ENED 1MCWW 2WBJA 2WIIA 1U8NA 4JREC 3ZKXC 5EUOF 2P8MB 4PRNA 4ZAKA 3CFCH 4EDXA 1BFOB 1RMFL 5ALBH 2O5XH 4XC1L 4JN2B 1SBBA 3ULVE 1L0YA 3BKYH 1MAKA 3JTSA 2R15A 2IAMD 1YEKL 4X9GA 2XY2A 4CW1A 1AE6H 4N0RA 3MCLL 4LNRA 3VCLB 2DYPA 3GSVA 2Q8BL 4PJGB 3NTCH 2OBGA 5FKAA 4IRJD 2IBGA 3SE8L 5DO2D 1D5XB 1Y6KR 5MI0B 5BW7C 1WITA 3CJJA 4C54A 4RISH 1UYWH 4ODXA 2QSCL 3DTXB 5D1ZB 5I1CH 5I30L 5J6HB 3RL2A 5FM5M 1F3DH 4TSCL 3O3BA 2FWOB 5I16A 1TXKA 2AVGA 1NCBL 1KT2A 4EIGB 3OJDB 1NKOA 1D9KD 3FL7A 4HX1B 5IB1B 3BZ4A 1FGNL 4QRPA 3G5VA 3O8XD 4EUPG 3O3UN 3MRJA 4QHMB 4X99B 4AM0B 4X6BA 3QUML 1BIHA 4XPBH 2NY4B 5L8JB 5I76A 3NAAH 2MTPA 4O58H 5E70A 5LCVL 2RFXA 4G9FB 4KMQA 5ICZB 4UV4L 4QY8A 3MNVB 4GBXA 1IL1A 1ZT4A 1WWBX 5FYJE 4J23A 3SCMC 2VSDA 2YEZB 5MENA 1UM6H 5DJZA 1H3XA 2WAHA 3VXTA 3GGWA 3L7FA 4MDJA 3JTTA 4XMLL 2NZ9D 2V9RA 5CHNB 2XPGB 1B4RA 1JFQH 4OIBA 3D0VA 1G1CA 1NGXA 2Q87A 3G04A 5E99L 2VKXA 2X4UA 3C8HA 3RWIA 4JG1L 1CGUA 4KPHH 3GB7B 4JVWA 1HN1A 1RU9L 5KW9L 3ZDXF 1JI2A 1FFOB 4HUWB 1OTSC 3FQWB 5CWSB 3DGGA 1EGJA 1FL5A 3GK8H 3WMSA 1VGEH 5DF0A 4OZHB 1PQZA 3BH9B 1M7IB 5JW4M 2J5LC 1UACL 4EIZC 2RJMA 4JFYA 2A6KB 5IW3A 1AGFA 3O3DB 3NFNA 2WWMD 5HYIA 4WO4D 3RKPA 4W6XB 4F9PA 3MCKA 4P48A 4WEUD 5L88L 1D5BB 3KPPB 3P9LA 1KACB 4YHLH 2CMRL 4JDZB 3FZUD 2AJZA 5I1IH 2GSGB 1H5BA 2EXWC 4NHCL 5DURB 5HY9B 3O6KL 3IYLW 2PKDA 4UNTA 2DQUH 5HI3C 1X4YA 5JORB 1Q0YL 3VFPA 1QLEH 4TSAL 3MRQB 4JZOB 4EXKA 4M7KH 4WCYL 4UT9L 1NAMB 5HPMA 4HLZG 1AY1H 4LHQB 3SE3C 5FGBA 3NPSC 3OJVC 4FZ8L 1HCVA 3CXHJ 3V4VH 2Q8AH 3C5ZB 4HKZA 4K3DH 1NGPH 1X5YA 2BRRH 2HT3D 1ZS8B 1LDSA 1RK0B 2ZUUA 3R1GH 4RFEA 5F7LB 2WUBL 3MX0A 1KB5A 3BHBB 5KANG 5F9OL 4X9BA 3HCVB 3SDXA 1N4XH 2DQCL 3D48R 1YQVH 2ZCHH 3K1KC 1BGXL 4G6AD 4S2SA 4ONHA 4D9LL 3DX7A 4DZBA 3STLA 3REWB 4S1DD 4G7YH 2P45B 1J9CT 2FX8H 1IAOB 4LQ1A 4LCCA 3SDCB 5B39A 3L3HB 5BVPH 2BK8A 4FQIL 1NDMB 3GSUB 5HVHC 2BNRA 1MFAL 1MIMH 4WUUA 4YWGH 1PDKA 2O93L 4U3XA 2EZ0C 5ACZA 1HXMA 4KKCD 1EFXA 5SWSD 2CR6A 4BZ1H 4JVUA 1YMMA 2IPKA 3BZFB 3OKMB 3MUJA 1BJMA 3L1OL 1M1SA 4OD3H 2GFBA 2H26A 1D6VH 2X4PB 4U7MA 1R3IH 4XVJH 3O2WL 4ONFH 3QUXC 5F3HA 2CJUH 3QJHA 3DECA 1ZEAH 4R7NA 5DD0H 5JIHA 3CLFL 3UPRB 1A5FL 5FAAA 5C08E 3MJ9H 4WUKH 4X6CA 2C7UB 3RVWC 3MV7E 5E7BA 2IFFH 1JGUH 4HIIB 3VXSA 4BQBA 1C5DB 5GS0L 4OAWA 1AQDA 3KGRA 4OZFA 4U31A 3AREB 2CLRB 4QRUB 4PJ7B 1RUML 1UVQA 2P5WA 3E2HC 1EEZB 4NKMA 2A6JB 4Z9KB 2A6DB 4WHYG 3K4DA 2ICWA 5LAXB 3GRWH 5LG1A 4EZMA 1PSKL 1BWMA 4JFEB 3P4NB 4P3WA 5IWLA 2AXHA 4XTRC 3A67L 3TCLB 5C0AA 3BPLB 1KBGL 5DC0A 4DEPB 2AS5M 4RMQA 5MEOB 4RQQB 5FB8A 3S35H 3FN9A 2R4RL 4JANB 4KUCF 1U8HA 3ARGA 3MUGB 2DJ4A 5DFWH 3V5DB 3X14A 2X4RB 5DYOB 1I8LA 4L8DB 4ZTOH 3TNNB 1BEYL 5BS0D 3CDYA 3PWUA 5E9DB 2VDPL 2ATPA 3LKSA 5EC2A 4JM2C 1MPAL 2HLFD 3TYGH 1CFTA 1ZA6A 5D1QD 1CD9B 2HWZH 5HD8D 3UZQA 1QEWB 3O81A 4OF5A 2J6EH 4E9LA 1ZKAA 4LU5L 1LO4L 2VXUL 1EEYA 1BBDH 2J8OA 5I15L 2EDXA 4AY0A 1UFUA 1G6RA 2ZOKA 4M61B 2CKBB 1MAMH 4XNYL 3QRGL 5IK3A 3GSRB 1JGLL 2IWGA 2KPNA 4PG9A 1OGTA 1XR9B 3VXME 1PGRB 3IGAB 4QCIA 2R1YA 2BP3A 1P1ZB 3NZHL 3KYKL 4JHBA 4HKBB 4X8XA 4BQCA 5HHOD 4JY5H 3X17A 3L3IB 1RZGA 2NTFA 3WLWC 5C0DA 4XNUH 1L6ZA 1KNOB 2R69H 1VFOA 4RIRB 3AS1A 4IRSB 5INCB 4WEBH 1JZ4A 1NCCH 1U41A 5HHQB 4JFDB 4JPKL 4U1MA 2JCCE 4BK4A 4ZXBD 4IOFD 2FJHB 4HHAB 3EDDA 2H8PB 2FDBP 2BHYA 1BJ1J 1M71A 1CLZH 5E2VH 1AKJB 3W11D 3C8KA 2D31A 3P0VH 4YNYB 1VGKA 2BNUB 5IV2A 4BH7A 3S5LA 3ILQC 3VWKA 3MA7A 4A6YA 3RY4A 3EJZD 2JJTC 5H2BB 3FQRB 1T7YA 4L3EE 2BVQA 4NQTA 4Y5VB 4FNLH 5ITFB 5TQ0H 4EN3A 4WFGE 5GZOC 3O6MH 5CZXD 3V9FA 3LS4L 4MAYD 1FO0A 3U0TA 3QDMA 2RR3A 5ICXB 1MLBB 1EAPB 1V05A 3CVHL 1FRGL 1NCAH 4XCNA 4LVNC 4L5FL 2BCKA 5JXEC 1P2CA 1EEUA 3MRDA 4P2QB 4BKLA 1RUAH 4TUKH 1YEHH 3I3BA 4YDVB 3PDOA 5DJXA 1JPSL 2FX9L 3SY0A 2XOTA 3B9KC 4MA3B 1DSFH 4UUJA 4HS6B 3NFSL 4LRIC 5LXGL 3PG2A 5LGHL 5FYLH 4I3SL 2ITCA 3U46A 4YO0B 4YQXL 3UX9B 5H37G 3Q3GA 3L3DB 4KVNL 1R5WA 5HGAB 3CDGB 1GZPB 4LHUG 1PLGH 4NQVA 2J8UA 3R0MA 5HBBA 1FZJB 5IBTH 4M6OL 4N90E 1CGWA 2HLAA 3TPUB 1RHFA 4JVPA 4LMQE 5L2KB 2IMNA 4YGAB 5IMKA 4YBLC 3FN0L 3QEQE 1K8IA 4MDIA 3ARWA 2E8ZA 1L0QA 3EYFB 3OXSA 3QDGA 4CVZA 1IAKB 3QIWB 4PP2B 3RDTD 1CGXA 4JKWA 2XNAA 1RI8A 2DQIL 2OP4L 2R2BA 5AZEH 2BSRA 4QRRA 1OF2A 4EUPH 2Z91A 4FABL 3CC5B 3ZT5A 7FABL 3ARDC 4PLJC 1V7NH 3DVGB 4PPTA 5L7XL 1D5IH 4O02H 1GC1L 3K74B 3Q5OA 2R29H 1V7MH 5FYKD 3K4AA 2A0LD 2GTZA 1UH4A 2B7DT 35C8H 4FN0A 1GOFA 1HHKA 5ERWB 1NEZB 3UXFA 3BUTA 3CFEB 3WXVL 3ZZ1A 1RIUH 4OIIH 3ABZA 4U6TA 5C07D 3EYOB 1K4DB 3CK0L 2XG4A 3MRIA 4Y2OA 5DRWB 1ZVSA 3UYRH 4NWUH 2WINA 5GXBB 1ZANH 2VXVL 3FRPG 4HFUL 2DLIA 5IVXB 2DTMH 3ZMRA 3BPCA 2OTWA 5I66A 1C5BL 4XHJC 3PWJB 1J86A 2IBZX 5GRUH 3QDJD 1EERB 3WLBB 5ESVA 3MRFB 5CJ8A 3HAEG 5GISH 4JY6A 1QFWM 3DX6B 3PQYD 4HXBH 4WFEE 4GO6B 4V1DA 2W0FB 4K3EL 3AM8C 1H3PH 3GO1H 2HJLA 2YK1H 4RGMB 4YFEA 3D85D 3E6HB 5D93B 1OGAD 1KENH 2E7BA 2BC4B 1CDYA 1NH6A 3CU7A 43CAB 2VXSH 3LKPA 1TQCC 3TVMD 3WO4C 2QTEA 1IT9H 4U7KA 1CFQA 3U79A 4LFHD 2W0LA 1UXWA 4IM8A 4JDTL 2HMIC 4JDVB 2Y36L 1OLLA 1BVZA 4QHUB 3SPVB 2VC2L 1SY6L 1U3HC 1NPUA 1BIIB 1JP5A 1XGQB 3TBTA 1YN7A 3F5WB 1TETH 4B53A 2WUCH 4PGZA 1T83A 1DP0A 3CU1A 5FO8B 1NBVH 2HT4D 1FE8H 3ULVH 3U30B 1NC4B 1WCBB 5HDBF 3KPSB 3VXRA 3C60A 3QUMB 2FGWH 4GLRH 2BOCA 5D7LD 5C2UB 1WT5A 3VD3A 3JV4B 4H1LG 3O6FA 1T7ZA 5ESQA 1NKRA 3DMMD 4NN7B 3PJSA 3GKZA 3WBDA 2YWZA 4NP4L 2R0WL 1GGTA 5BQ7A 5DI8A 5E2UH 2G5BA 2YMXL 3UTTE 4GMSL 5BV7H 5E08H 4ODTH 4QRSA 3NCJH 1K4CA 1TFHA 3LD8B 5GRJH 2P43B 5T3ZD 4C56E 1N0XL 3SEPA 5SWZA 1F8TL 4L9LB 1NSNL 3M8OL 5GSVB 5F7EL 3N1QC 3BZDA 2PO6D 4GS7B 4ELKA 3I3DA 4YHML 1N5YH 1FNSL 4ZNEE 2EYRA 1JHKL 5DJ6B 2HFGH 4C4KT 1MHCB 4UDTA 3C2AL 5KS9A 4YIQA 5CJOH 2YD8A 3OGCB 3QUZA 5EU6D 4LDEB 3U9UB 4FXKB 3FT4B 5IB4B 3MLPA 3KPRE 4OI9A 4OF6A 1UKSA 3JV6B 5FYJH 1IARB 3MRKA 4A2MA 2JK5A 1AI1H 2AJXH 4GXUN 3U4BL 5F96L 4AQOA 1YEGL 4GAGH 4GRWB 1ADQH 3OKOA 4N0CC 1UENA 2PF6A 3P77A 2IH3B 4MQ7A 5I1DB 1UJ3C 3V7AE 2F5AL 2LABA 4U1GB 5TH2A 4PJFB 3OHXB 4JAMB 3CPLB 1MFDH 4ZOCA 2UYLA 3QXVA 2UUDH 5D7SL 5BMFH 5HVGB 5ITBL 1K5NA 2D7TH 4NZUL 1QBAA 4EDWH 5DMGC 1DJSA 3O2DA 4W4NA 2R8SL 1AHWA 4OTXL 4L1HA 4WHYH 5CEZH 1JUFB 3HS0B 4L8CB 1HHIA 1J5OH 5IVZA 3U0WH 4JM4H 4EJ1C 5A3ID 4QRQB 1J1PL 2E6QA 3CXDH 2D7NA 3KYNB 1I9IL 4JPWL 5EBWA 4ELMB 4AEEA 5C0BE 4JKLA 5E6YA 1OWWA 2X4OB 3PE9A 3DNKA 4NWTL 2OL3L 4MS8D 4KMLB 2I9TA 2GT9B 4U1JB 5L6YL 4PB0H 1T5WA 2QL1A 5J12C 2R0KL 3QO1A 4FFWD 1ZT7A 4XNQA 2XN9A 3FO0H 1JNLL 4I4WA 4OFYA 2ZUTA 1J8KA 4OD2A 3VFGL 5IHZB 3MA9L 3QG6B 5EOQH 3ARVA 3LKNA 4YZFE 2V7HB 1IGFL 4MA1B 1HHHB 2BNQD 2VR5A 1PG7X 2VDRL 4IMLB 3T0EC 3ARBA 1TJHL 4YDKL 4OV6F 4R97C 2ZUQC 4GAYB 3E8UH 5IBUB 1DN0A 4GAJH 4RWHA 4NO0A 4GJTB 3ZKMD 4FA8A 4WI3A 5TE7L 3WIFB 1QTYT 2OI9C 4RDQF 5JIKA 2V17H 5D72H 1HDMB 4U1IA 3UTOA 2LQRA 4LLYA 4H26B 4HBCH 2OTUA 3FONB 4M1CC 4XMKH 5C86A 4G9DB 2NLJB 3AVEA 5HGDB 1CGTA 4RNRB 4JRXE 1AXIB 1MFBL 2Q3AA 1P4LB 1KLUB 4FQJL 3HE7C 3T0WA 5E5UB 1J05B 2YSSA 3LIZH 1ND0A 1T1ZB 2HFEB 3ME0A 4YBHA 1I7RA 3BKJH 1DUZA 4Y19A 3OZ9L 4JFHD 5DFVC 2NX5B 5TDOA 5C71A 2PW2A 4PGDB 5EFIA 3V6ZB 1KFAL 2OK0L 4F3FA 2VIRA 4HXAL 4P99A 3IS0X 2DQTH 4WU5B 4ZFGH 1EPFA 4NUGL 5IB3A 3V7AG 3ROLB 1G84A 3EYQD 2VZSA 4XBPB 1FZOB 2GJZA 1YEEL 1ORSA 1XF2B 3LRSA 5I1LB 1G9MH 2NY5L 3B6SB 4HWZB 1PVHA 3A6BL 3DETD 4JY4B 5CCKH 3VDAA 1I1AD 1JPFA 3BAEH 3KHOA 1GGBH 1G0YR 3PIQB 4UTBH 3VXOA 1OOAA 2E7LA 2I5YH 1M7DB 3C6LA 5KG9B 5DQ9A 2X41A 3VFTB 1HIML 2UWEA 4ZS6D 3PUCA 5J9PA 4ODWB 4PYHA 3BE1L 1S7TB 3X12B 2VE6B 1OPGL 2DRUA 4OLYL 4M4RA 3WCYA 3MV8E 4U6XA 2GAZA 5MI0C 1F6FB 3KPLB 4L9DA 3MOBH 1VACA 3P4LA 5JXAL 5DHYB 1IGCL 3RWHA 5D1ZC 4MD5A 1SYVB 5ICYA 3VXUD 3FO1A 1F00I 4PJ5E 5CD5C 2ZCKH 4ZUSA 1U8MB 4KZEH 1QKZH 1WWWX 1F4YL 3PL6B 1I8KB 1OT1A 4O5LH 3OKLA 5E03A 3HC4H 5TE6H 4NKIL 4W70A 1Q9LB 4HBQA 1I7UA 2XACC 2GW5A 3LSOB 4Y2DA 1KV3A 1QFHA 2NY4C 3VW3H 1T2JA 3RVXD 2NY0B 2R1WB 4HJGA 1FYTA 1ACYH 4B41A 3LCYA 3TA3D 2NQCA 3IDIA 4D2NA 1DQML 3TIEB 1YN6A 2I25N 3VMOA 4UIMB 2AXFA 3RNKB 5JHLL 3TN0A 5IB5B 2PXYA 2F53D 5HHPB 3T2QA 3CMOL 4XP1H 4E42B 4GW5A 3HMWH 4M62L 3RTQB 4UQ2B 4J8RB 2X4SA 5L9DL 3G5ZB 5FF6B 5IR1A 1F13A 1LQSR 1QRKA 2VH5L 3MUHL 4JCLA 1UB6B 2L7JA 3HZVA 2V5SA 4Z7NE 5JTWA 1MWAA 3VE0A 1JPST 3ULUC 1JIBA 1AGCB 2DJSA 3N9GH 1KCUL 2XTLA 1WFOA 4L8BA 2OYPA 4MLSA 4DVRL 3FO2B 3Q1SH 1KJMB 4DKDC 4Q9RL 2EIZA 5I1AA 4XPGH 4XGZA 1LNUA 1BZ9B 1MI5E 4IIQA 1V3LA 2AK4B 2R1XB 3TJHD 3CVHB 5D9SB 4P5TA 5DJAB 2CUIA 4QKXB 5E4EB 4GQ9H 5E94A 3KG5A 4JN1L 5HI4D 4Q97A 5T3XD 2Y23A 3C87A 2JF1A 5IP4A 4JQXA 3BD4A 1X5XA 4AMKL 1U8QB 1T6VN 4JJ5A 1B2WH 5CSGA 3QIUB 1MNUL 4EQ3A 3D3VD 5IQ9A 4JGUA 3DROB 4X4YA 3T0AA 1KELL 1CK0H 1RZKH 2OR9L 6FABH 5A16B 3OAZH 4O4YL 4RA3A 3MGTB 3ES6A 2FIRT 3EDEA 4PRPB 1UQSA 4WV1A 4NQXB 3QXDA 1GIGL 2BOBA 4L4TE 1T66C 3VD4A 5I18L 1BD2A 1M6OA 2A74B 3PWVA 4YFDB 2WWKO 5IFJB 5C9JB 3T3ME 3TEUA 3BJ91 3SGEH 3U6RA 4WI5A 5C7XL 5DD1L 1DVFB 2V2TA 5F88A 3TBWA 5E2TL 4GUPA 1HINL 1P4BH 4AG4H 1S9VA 3LEYH 4PRBA 3SDCC 3N1FC 5EOCH 3DV4A 4XCFH 1OAXL 3BRGC 4LBEA 1MHHA 2XZCL 4XPAH 1FGVH 1GL4B 1PZ5B 2MQ0A 1D5MA 4JPVH 2WANA 4X8JA 4AIOA 1FAIL 1UB5B 4IDJH 4KKAD 4NC1E 4JO3H 2AJ3B 3WXWH 3QH3A 4YK4B 3TPKA 2GCYA 3H9HB 3O9WA 1CN4A 4KKLC 3MLXH 3QNYB 5LCVH 4PJEF 1YY8B 1FIGH 1JRHH 1CFBA 5C3TA 1R5IB 2MJWA 4TVPD 4G6JH 3NCYP 3MRCB 1WAAF 3CFBA 3QA3B 5CP3H 3RIFK 3SQBA 4UV7L 1X5JA 2IH1A 1K85A 1Z9MA 2Z4QA 3S3JA 2FJGB 5BCAA 3TWCL 4YDJA 1LEKB 3ZL4L 4UINL 4XPHL 1CLYH 1KTRL 3AREC 4GRMA 1T3FA 5KVEH 1B90A 5E99H 1ZV5A 5CKGA 4JG1H 2BFVH 4M7JL 3VH8B 4LSUL 1BQHG 4R90L 5B3JE 2EDLA 3MZGB 3T0BA 1AP2A 2HN7B 4IRJB 3MRHB 1Z6JT 4YHPB 4TVSa 5GRXG 3QFDA 2ARJB 2Q76B 2V7NB 1KLFA 3HA0A 5CFHA 4NYLB 1PKQB 1UKQA 3EFDH 4I2XE 4NPYA 2VDQL 4HCRA 4HWNA 1X6LA 3BPLC 5K9OA 4MD4B 4DEPC 5DK0A 3X3GL 4F9LA 5IKCB 1I75A 4G7VH 4YHKL 1A3QA 2FL5A 1A02N 5H35B 3IVKB 3O8XB 4MQXC 2DLEA 3LEVL 3LPWA 3F58L 1MFCH 1JV5A 4MA7L 5DRXA 2CIIB 2XXMB 3AS0A 4LSQH 4UDUB 4L8SB 4K8RD 2GQHA 3RUGE 2FR4A 4NHCH 1KCSL 3OKYA 3NACL 1RFDL 1A7QH 1B3JA 5C0NC 1DQDL 3FQTB 5DEGA 1AJ7L 5HHMD 1DL7L 5GRVL 3S88L 3B9DA 1T4KB 2F54A 4LEOB 4Y4HD 5BRZD 2D9QB 3BESR 4LHUA 4OGXH 3B2UD 5IFAL 1JPTL 1CL7L 3EHBD 5AWNH 4F58L 3MLTA 4B7IA 3IDMA 3RWCB 1J1XL 5D7KE 1QVOA 1NFIB 1L9NA 2DM4A 3WSQL 5HJ3A 3WD5L 3G6AB 1WEJH 1R0AH 3MRRB 4GXVL 3MV9B 3VXMA 4LDOB 4PY7A 3W5NA 3IU4H 1LE9A 4DKEL 2CLVA 3BDXA 4FZEL 1B0RA 2FBJL 4G8GA 2P4AB 1CE1L 3RWDA 3SGDI 1T2QL 3V79C 4ZDHB 5DUML 3QHZH 2DWEA 4WO4B 4QGTA 1AXTH 2GI7A 4ODVL 4CN4A 4ALAL 3JWDC 2P24B 4Y89A 1N5AA 4R26H 2JCCA 4LK4A 5J13B 4JZJB 2PETA 2CDEB 2J7LA 4LPYA 2VDNH 3P4MB 3FRPA 3UP1A 1TZGH 3GKWH 1EO7A 3CH1B 4U1HA 2ICEB 2ESVA 5CINH 5C0CE 4LQFH 2CDFA 4HIJB 4CN1A 3QEGL 3BGMA 4KXZI 3B83A 3MJ7A 5I8EB 1A5FH 5FK9A 2GJJA 1NC2A 3MLRL 3GJFB 5JOPE 2DQGL 2H2PC 4M43L 3HAEA 4Y5VC 1II4E 3CDCA 3THML 2XTJE 5LWYL 3MZTA 1FL3A 1Z5LB 2WBJD 4L3EA 2WP3T 4MD0A 1HEZB 2C26A 1WUNT 4HUVB 2CKNA 4ZAKD 3SKOB 2BJMH 1IBGH 4RGND 2VKWA 5F7WC 1JK8A 1PSKH 2F8OA 2OTPA 4KZDL 2XQBH 5JW5B 3EYUL 1Q0XH 1C5CH 5HGHA 2VLJE 4S11A 2CDGB 4RAUB 2NW3B 1S7VA 4GW1B 1AIFA 3T0DA 1DBML 3ARYA 2OL3B 2Z92A 5ACMA 2DYPD 5D2NB 2C1PA 3TH4T 3C5SA 4LLUB 1D6EB 4MA8H 1HSAB 1FL6B 4RAVB 4BFGA 1NBZB 4YHNA 1KPUB 5SWSB 1YQ2A 3F8UB 4P4KA 4F2MB 5I1KH 1MJ8H 3ZSSA 2NNAA 4KC3B 4HWEH 5D5ME 4X80H 4XP9L 2VDPH 1MPAH 4P2RE 1P84J 3UBXG 4XNMB 3JZ7A 4H1LA 3BKMH 5BO1L 5D6CB 4HS3A 2QQLL 4EXPX 3IFNH 2MHAB 1PEZA 2MOVA 3QEQA 1G7IA 2OMBA 2XKUA 5M95B 1ZLWH 1EHLL 3BN9D 4X6DF 5EO1B 1JGLH 3GMRB 3K7UA 4GBXD 2DM7A 2EE6A 5MEND 2DQFA 4RBPH 1IQDB 5GRYA 3KYKH 2HFFA 15C8L 2VLRE 1D5ZB 1RIHL 4DQOL 4OGAC 5KZCD 1NLBH 4LLWA 4CAGA 1U8LB 1OD9A 5F93C 2F9BT 3D9AL 5IEKA 5E8PA 4OJFL 4QHNB 3ORJA 2ZKHL 3VFSB 2YRPA 2GJ6A 1W72L 1HSBB 4ZNCD 4DWHA 1BX2A 2XFXB 3FAWA 3MLVL 2DQJH 2ZCLH 1XR8A 4NDMA 1NCWL 1ZLSL 1CL7I 1NFDF 3O0RL 3WL9B 3SDAA 2P44B 3K8LA 4JHAH 3IKCB 1A6AA 2YOCA 3TCXA 5BS0B 4M3KB 1P4IL 4CNIA 1DBJL 4NNPH 2C5DC 4BQ8A 1MRFL 3BEWB 1F4WL 3VA6A 4DTGH 5DWUH 1N2RB 4RGMC 3M1BB 5D93C 1HWGB 2DQDL 5FUOH 3K1DA 2XWJA 1YY9D 1Z2KA 3VXPB 3D39D 3VRIB 1WWCA 5AD0A 2Z8WC 3TNMA 1MCOL 4ZYKB 3LS4H 5TGBB 5EIIB 1N7MH 2AXGB 4U6VL 2X7LB 1XGTB 1YMHB 1FRGH 4NRXB 1GHFL 4JFQA 2AKRA 4QOKB 1RVFH 1I7TB 4M1GL 3WHXA 3D69A 4MCZA 4NO2A 4RRPG 1LD9B 2VR9A 5HVWA 5JR1L 2R0ZH 5BJTB 2R2EB 2UUDK 2OJZL 4G8FB 4UBDD 1I1RA 3U30C 3WIHH 4YDLB 5HHOB 5KSAC 1JPSH 3U7YL 3V6FB 5EN2B 4N0UB 5FUCE 1MVUA 1OP9A 1XGYL 2I9LA 4D0DA 1TZHB 2O5YH 1I7ZB 4JPIB 1NMAH 2EDOA 3LV3A 5GGVL 4LLMA 4LAQH 4TRPL 5TDNB 4NO3A 4NQDE 4JM2F 4LGPB 4K94H 4HS8L 2AI0L 4NN7C 1T1WB 3GIZL 4N1CA 2CO7B 1MCEA 3EOAB 4LSVL 2BNRD 2JELL 3VI4F 4BK5A 2IGFH 3AAZA 4YE4H 1NGYA 3T2NL 4D0BB 4L9LC 3UTTA 1IAMA 2Q86A 1JHTB 1Q38A 2ICWJ 2PYEE 1FN4B 2JJTA 4H25B 2AEQH 4LRNL 3MYJA 3K8MA 2OP4H 2VMFA 3IDGB 4ZFZA 4GS7C 1HCFX 2ED7A 4QXUH 4XVUD 1GAFL 1ULVA 5IF0B 1M7XA 3BP5B 4MAYB 2OR7A 4R2GD 4ZFOA 4WFHE 4MHHI 3LN4A 1QSFE 4XCCL 1KN2H 1JMZA 5DS8B 4Q2ZA 1TJGL 4P23A 4W81A 4Y4KA 3QQ3B 1MCPL 3VXSD 3CFKA 3FQNB 1Q72L 4OLUL 2B20A 3H3PL 2V2WB 2P5WD 3B9KA 1OW0C 3WNLA 2P47B 4HQQL 2UVEA 3CSBA 4HUMB 4K7PL 2VLLA 3GMOA 4P59L 1C5BH 4RMTA 4FQQA 1T89A 3ROOB 3BJLA 1A7OH 1G9NL 4FFZL 3SE9H 2XICA 2M8XA 1CVRA 1Y0LB 4HK0B 4KI5D 4DOHE 4AL8L 3VFNA 1XCQB 1YNKH 1PYWA 3L95B 3IU3A 1JN6B 2A9NL 3IAQA 3BT2L 4RZCB 2Z35A 1RD6A 1GZQA 3IXAB 3OX8B 1WICA 4KJQC 3I75B 3RDTB 5FV2A 3OF6D 4ERSL 2PCPA 3T3PF 3I6LD 2GKIA 3PABB 3B2VL 2YXMA 1CGSL 3W9DB 3FB6A 1H8NA 4TNWK 5C0BA 5BVJB 1AO7D 3CZFB 1T0MA 2VAAB 4JDTH 4LCIH 1ZHLA 2OMNA 3RWEA 2OZ4L 3C09B 2ZP0T 4BH8A 2V6HA 3V5KB 2EDNA 2GITB 4WWKA 4OZIF 4WW1B 8CGTA 4M9PA 1PW3A 3O11B 1WGOA 1FFNA 4KH2A 3VD5A 3O45A 5C07B 3SHSA 4MA1C 1H0DB 4TYUA 1H3GA 1NGZB 4TVPL 5CBEB 4Y16A 4IHOB 3FJTA 1FBIH 3MNZB 4OCWH 1GPOH 3GI9L 3MGAA 4FTVA 1BZQK 5TQ2H 2WLYA 4LSPL 1WZ1L 4LCUA 2NR6C 3BISA 1JVKA 2CLZA 1JI1A 1OVZA 1DLHB 1KJ2L 4MJID 4U3CA 2D7PA 1XF4B 2C4FU 3QDJB 4GMSH 4PLKC 2W0PA 5DQJA 3VGFA 4OT1H 4V2BA 3RVTD 1K3IA 1TITA 5D96B 4K3JL 4OF0A 3PQYB 1J87A 1FV1A 5T5FH 2Y6SC 4JFOA 4JFFE 3VRLE 4MNGE 5ID1A 3UTPD 1A1OA 3D85B 1KSRA 1OGAB 1GRWA 1RURH 1BZ7A 3HR5A 3QG7L 4U1KA 4OV5A 3H8NA 1FNSH 4JRXA 4ZPTB 1TPXB 4TULL 1I85C 3A6CH 2QQNL 4QXTB 5JOFA 4J1UB 1XZ0B 4XBGB 2VLKE 4Z7QF 3KPNB 3DUUB 5GZNC 3BWAA 5F96H 5T33L 3K3QA 1A0QL 2QQQA 2BMKB 3TC9A 3ZYOA 1A6UH 4DGVL 3MLYH 4OM1H 5EZIL 3CH8A 1BFTA 3WN5B 1X5FA 3KLAB 3BEVA 5T1LA 5MP6L 3QDMD 4YXLL 3VFMB 2EYSB 4MSWA 2VDOL 4TSBL 1I1FB 4PP1C 1CICA 4M6NL 4PJIB 2ICCA 5D7LB 4D9QD 3EFFA 1B0WA 3W81A 2VITB 4O2CB 3OXRA 3VI3E 5IW1B 3QQ4B 1A9EA 3DMMB 3F7PC 4PJDA 4KQ4L 5JQ6H 2HRPL 1LEGB 5B22A 4ORGB 3OKKA 5D1XA 3BGAA 4L3CB 1IGTB 2DB8A 4HUKB 2AP2A 3V6BR 1I9IH 4ISVA 5ADOL 4G8EA 3OG6B 2EYTA 4ZUWA 2B2XL 4M3JA 3V7MA 8FABA 1EMTL 1FFPB 5F9JB 3MV8A 4HIHA 4L4VB 3RGVA 3O3AB 4P2OA 1JGEA 2PO6B 5IMOA 1AC6A 1IC4H 1EXUB 2OQJA 5DDHB 3PL6C 2G75B 5K9KA 4FQLL 4M7ZB 1A1NA 5DSCA 5HYEA 4NRYB 1YUHA 5L6YH 4PJ5A 5CMAA 5B8CA 3MSPA 4PJHE 3BKCL 5GJTL 5T1KA 3QDGD 4HW6A 4TQEL 5EU6B 5CP7B 1P7KA 3ARZA 3MBEA 4NSKB 1RHHA 2NY0C 3OAZK 5SX4H 4F8QA 3UZEA 4JG0H 2O26U 1UJ3A 3M17A 3VWJD 1GVIA 4L29A 2OLDA 2W60A 4NM8L 2G60H 1TJHH 2HT2D 3RTQC 4U1SA 4NT6B 4OCYL 4ONOA 1YJDL 4XP5H 4NKOB 1U91B 3W39B 5EBLB 4FQHA 1FH5L 1WBZA 3IDJA 4POYA 4U33A 1QR1B 3ZKSD 2E9WA 3DXAE 4FQCH 3W2DL 3LH2L 3BFOA 4WW2A 4F7CB 3JWOL 1OAKL 2FZ3B 4YX2L 32C2B 5CBAA 5IT2L 4L3AA 3HUJA 4PJAF 5JHDE 1ZT1B 3FRUB 3Q6GL 5C2BH 2HRLA 3PGFH 1UWXH 4C57C 5F1NA 3I6GA 4Z7VE 3TM6A 1MFNA 3G6JE 4YPGA 3L3OA 1NCDH 3RQ3A 1UG9A 4NHUB 5IB2B 2H32B 3QCVH 4K7PX 2Z31B 4V1DD 3MBXL 4PRAB 1MI5A 4Z78A 1XH3B 1WCQA 4JQVC 3T1WA 1IGMH 3NCBB 4TTDD 3IJHB 3O4LE 1DBAL 1F2XK 1YEEH 4Z7WF 2C1OA 3HNSH 5AUMA 1BQLL 2NY5H 1W0WA 5EUKA 1W0VB 1OB1A 2BNQB 3RVUD 3RAJL 4H88L 1RK1A 3RPIB 1QNZL 4HKJA 1UXSA 4O2EB 1S7UA 1MCLA 2Y06L 3CFJA 3WFEL 2DWDA 4Z7OF 2EDJA 3HUJF 4Z6AT 2RGSA 3ALPA 4DCQA 3VXRD 4ETYA 3RIFF 3DVNB 4J3WA 4X4XB 4L4TA 3P9MB 2A6IA 3IXTA 2R9HC 3O6FD 2GTWA 1YEDA 3FB7B 3NH7L 5DLML 3MACL 3BRDA 4PJ8A 1DVFC 1ZA3B 4XH2B 3CFDA 4LKCB 3WFCL 4NO5B 1G7QA 4DVBA 5DHVA 1GC1C 1SEBA 3QUYA 3NCFB 3KPMA 3V0AC 4N0YH 3L3JA 5SWZD 2F8VA 2AJSL 1WBXB 3VFOB 1M05B 2YPLE 4XWGL 3B9EA 4GMTH 4MLIA 1ZLVH 3NCMA 1I9RH 4YK4C 1B4JH 1NGWA 1VEPA 2ZG1A 1E6OH 1UWGH 3ET9F 3NCYS 1DE4A 3EO0B 1S7SA 4R4NC 4I18B 1LK2B 3MLZL 2HKHH 5D6DC 3DHJA 3AXLA 4QNPE 4ENEC 2WBWB 3OPZH 3LKRB 2XA3A 1IGIL 4WNQA 1W72B 1YEJH 4J6RL 1CDHA 1T21A 4OKDA 3QUZD 5T3XE 5ANME 4HEPG 2Q20A 4JN2A 5LGJA 4O9HL 1I1AB 2O5ZH 1VDGA 3QNZB 3T77A 3NOIA 3RHWF 4Q0XH 1QACA 4MCYA 3D3VE 1OWRM 3T04D 3VCLA 3FB8B 5F9AC 1X9QA 1CZ8L 3FFCE 3W0WB 4ZTPL 5FHAL 4D9RD 5GGRB 1CG9B 1XGRB 1Q9KA 4IRJC 1H3TA 4HJ0D 1OAUL 4Y5XB 5DO2C 4PJBF 4F57L 1DFBL 5HYJD 4NQSB 1ZOXA 1WK0A 4PGBB 4OUUB 1Q1JL 1UA6H 1CXLA 5J6HA 1X6NA 1C8PA 1A3RL 2BDNL 2XA8L 3VXUB 3VGEA 4HX1A 2R0LH 5F89B 5IB1A 5IROC 3SGKA 1I8MB 4UIKH 4JN1H 4H0GA 4QHMA 4I2XA 4X99A 4AM0A 1JZ3A 1KB5L 2CO6B 3O8XC 2APBA 5FYLD 1KCRH 1NEUA 3GSWB 5B38B 4OQTA 4L8SC 1MH5A 4PJXE 3UTQB 1CFNB 4G9FA 5J3HD 1JWUB 4XP6H 5ICZA 1MNUH 3K0WA 3MNVA 5FDWB 3TA3B 1QSED 4AIZB 3P4OB 3P9WB 2YEZA 4JFXB 4O4YH 3ZTNL 3P73A 3BDBA 3QNXB 4H20L 2XN9D 3KYMB 4N8PA 1ED3B 5F7DA 4OFYD 3H9SE 3IAGC 4LVOB 3QIBA 5CHNA 1ORQA 1EO8H 2XPGA 3V0WH 2CR3A 4PJGF 3T65B 2NYYD 2AEWA 2NZ9C 1VPOL 3U9PH 1KN4L 3SKMA 4EI6A 2UZYB 1KCLA 4KK8D 5I18H 5I1GL 5E6IA 2YD5A 5I8CA 3ARBD 1FFOA 4HUWA 1NL0H 3PGDB 4FFYL 3FQWA 3L5WB 4F7EA 5CWSA 2QLVB 2D4DA 5DD1H 4XXDA 5FYKH 5E2TH 4LLVA 4OZHA 1M7IA 3MJ8B 4TPRH 5D7IB 3O3DA 4KY1L 1OAXH 4P46B 1OAQL 2WWMC 1N8ZA 1D5BA 3KPPA 3OTTA 4WO4C 4U2YA 4OZ4B 1T0PB 4GG6E 3AU1A 1UCTA 3CFCL 3NIGF 2GSGA 3TH2T 1JWSA 1RSFA 5ALBL 1G7MA 2O5XL 3BUYB 1YPZB 3FZUC 5J13C 4JZJC 4LKXA 3UYOD 4Y19D 5HGBB 4JQIH 1OQXA 5CD3B 3U36B 4ZUUB 3QWQB 1ZLWK 4OI7A 1NAMA 4S0TD 1K9TA 1MQKH 4NJ9H 2AAVA 3HNTL 2DQHL 3T09A 4OZGF 3NTCL 3UTSD 2IPUG 3ULUF 5C0CA 3ALXA 2Q7YA 3C5ZA 4I77L 4O2FB 3GSNH 4NQEE 4RBPK 1ZK9A 4RISL 3OJMB 1UYWL 1KC5L 1ZS8A 3LN5B 2HT3C 2WIMA 4BFIB 1S7WA 5I1CL 4PRHB 3HCVA 1HKLH 1X5HA 5DVKA 5F1KC 3D18B 1UZ6F 4G6KH 3LKQB 2Q3ZA 3JVGA 4G6AC 4ODUB 5EC1B 1U8PA 3C6LD 4E5XB 2LTQB 2WSKA 1IAOA 3SDCA 4S1DC 4ODHH 3L3HA 4WWID 3ULVD 1C08B 2QR0A 3NAAL 3WJLC 4O58L 1G6RL 4NKDB 5D2NC 3EOTH 3S96B 4X0KB 3VDCA 2IQAB 4WJ5B 4KKCC 5EUOE 3BZFA 1TLKA 3IETA 3GHBL 5FA3A 4PJEB 3OKMA 1UM6L 1OQOA 3KPTA 3U0PB 1UCBL 4NOBA 4CU8A 2X4PA 1YDPB 4UT7H 4EOWH 1VCAA 3NIDF 3SGJC 4MNQE 4GSDH 1JFQL 3NPZB 4YAQA 3P11H 1X7QB 1SJEB 4FHBD 5T3ZH 4Y2DD 4P57B 2EC9U 5JPNB 4HIIA 3PV6B 1C5DA 4B0MM 4MGXA 4F58H 1A64A 1KJ2B 3LN9A 3AREA 5L2JA 4P9ML 3DYMA 1IEBA 3NCCB 1W0YT 1EEZA 5I17B 3STBA 2ERJB 1VGEL 2A6JA 3TN0D 2C4FT 1R3HB 2AXJA 4D3CH 5D7JA 5IESH 4KMTL 2X4TB 5FYJD 3P4NA 4YBQD 3ZKND 4ZQKA 5GGTH 3H9YA 1QRNE 4PUBL 2E7HA 3GMMB 5I1IL 3VFWA 4FZEH 5KOMC 3WNKA 3TV3H 2A1WH 1CE1H 3MRPA 4DUXA 4ZO7A 4JANA 5DUMH 1CTOA 3VGDA 1FO0L 2DQUL 3DX9B 1AFVH 5EBMA 1QLEL 4OFVA 3OR7A 3VRJB 4M7KL 3V5DA 4KTEH 4Z7UB 4PV8B 3HNVH 5DJ0A 4L8DA 4N9GB 3TNNA 1AY1L 2XT1B 4HSQA 2O61A 2NY5C 3V4VL 2RAMA 2Q8AL 3FTGA 4K3DL 1KTDB 1NGPL 5JNYB 2IC2A 2BRRL 1KXVC 2HLFC 3R1GL 5HHMB 1INQA 5D1QC 4HAGA 5HD8C 3L9RB 1QG3A 4PJ7F 4Y4HB 5BRZB 3WJJC 1WLHA 1N4XL 2CGRH 2DQGH 1YQVL 2ZCHL 3ZDXE 5FKPB 5KBNC 3O3EA 4M61A 1PG7W 3HPJB 4UILH 5CIPB 2CKBA 3S4SG 3GSRA 5ID0A 4G7YL 2K7PA 2ZSVB 4QRPE 1XR9A 1FNEB 5BVPL 3MV9E 2VQTA 2UVFA 4MAUH 3FFDB 5IQ7H 3IGAA 1P1ZA 1R3JB 4GXUM 4CDHA 3GSOB 1MIML 4YWGL 3WFHA 1CDUA 4BZ2H 3OB0H 3WDIA 1OSZB 3AMKA 5C0IB 3QJFB 1I1CA 4F37K 4HKBA 5BOZG 1IE5A 4BZ1L 3KNBB 3L3IA 2WQRA 3RKDD 2V5RA 4KVCL 3GMLA 3NBNA 1A4KB 3BMVA 2NW2B 4OD3L 1CE6B 4OFPA 4OD1H 4G80A 4RIRA 4DFHA 4IRSA 2LVEA 1D6VL 3WNNA 1RZJH 5HHQA 1SM3H 4JFDA 4P9HH 1R3IL 4HWBH 4XVJL 2FJHA 2H2SD 4HHAA 3NN8B 4LARH 2CJUL 4S1QH 4ZXBC 1S5IL 3PGCB 5DD0L 5ETUA 3MJ9L 3EBAA 4NQDA 2IFFL 1JGUL 1NDGB 1B0GA 3RIAK 3W11C 5CGYD 3VA2C 5BOPA 4G3YH 1KIQA 2RQ8A 2VDKH 4RMSA 2E6PA 5FO9B 5H2BA 3O9WD 3EJZC 2DM2A 1S9YB 2DICA 4P5KA 3RZCA 5ICXA 1MLBA 4TUJA 5CZXC 2J5LB 2WBJB 3VXNA 2WIIB 4MAYC 4CMMA 3PDGA 3TESA 4M48H 4PRNB 15C8H 2G5RA 1BVLA 3S35L 3J7HA 4RGNB 5BZDA 1YYMH 5C08D 4CW1B 1NUNB 3MV7D 1IC1A 3QEUB 4MA3A 4ZTOL 3D9AH 1R24A 4TNWF 4HS6A 3N85H 2DYPB 1O7SA 4WHTB 1W72H 4OF3A 5FKAB 1VKXB 3MNWA 2VJXA 1A21A 1MCKA 2HWZL 4TNVK 4YO0A 1ZAGA 3L3DA 1EDQA 1GZPA 3CDGA 1XFPA 3CMGA 2DLFH 1FZJA 1BBDL 2B4CL 3RL2B 3O3BB 5I16B 4YC2B 2HYMA 4HUUB 4KV5F 1KT2B 4EKXA 3RJQB 2NY1D 1MAML 5IHUH 1F4WH 3BZ4B 3G5VB 3EYFA 3MRJB 1MHPH 1A14H 3QIWA 4PP2A 4JFPA 2XWTB 3DRTA 4MJ5B 4ONGL 3RDTC 5I76B 1U8IB 2IPTH 3D1MC 4WUUE 2D7OA 1RZFL 3I6KA 4NC2B 3DVGA 1S7RB 2DBJA 3IFLH 4JY5L 1S3KH 1DCLA 3FCTA 4GBXB 1RZIB 1IL1B 3HZYA 2H41A 3HMXH 4LCWE 2R69L 1YMME 5DJZB 3QEHA 3C09C 3GBMH 3GGWB 3L7FB 4LHUD 4Z0BH 4NM4H 1NCCL 2A0LC 2HG5A 1NEZA 3JTTB 2EIBA 4MDJB 3CFEA 3CFIC 4PGCA 5KZCB 3PWPE 1SJHB 1K4DA 3U7YH 1NGXB 5DRWA 2IANE 2R2CA 5I1JL 1YNTB 4PB9H 2X4UB 3RWIB 1XGYH 5HHXH 3VMNA 1CLZL 1TNNA 5IUSA 3O41B 5E2VL 1OTSD 3P0VL 2XZQH 5MEPA 3RP1A 3VXMD 3DGGB 1IAII 3WLBA 3MRFA 2FB4H 3SOBH 4R0LA 1PQZB 5C0EB 1X5IA 3KJ6H 1M4KA 4FNLL 5TQ0L 3BW9A 4G8GD 3NFNB 1VFAA 2W0FA 3I85A 5D96C 3O6ML 1ITBB 3E6HA 3HFML 3MCKB 2VWEC 4ZFFB 1URLA 5E1AB 1NCAL 1HI6B 2EXWD 5MEQA 3HI5L 5C3LD 4JFFA 4DZ8A 1H5BB 4MNGA 5C0AE 1J1OH 3D39B 1TPXC 4QOKE 3TVMC 1RUAL 4JDVA 3ULSA 1Z3GL 4QHUA 3SPVA 3GEWB 1BIIA 1DSFL 2DAVA 1XGQA 3ARTA 3F5WA 1BHGA 2PR4H 3H42L 5T3XH 4N0UE 5FYLL 5FO8A 4KDVA 5IVXF 3H3PH 4HKZB 5CJXC 3WN5C 2HT4C 2XQYG 4HPOH 2BVTA 4L3ED 2X1WL 5EOCJ 1RZ8B 1PLGL 3F7VB 1KB5B 3QUMA 4KRPD 3SDDA 5IBTL 5L8LB 4OF7A 3SDXB 3VGHA 1E4XI 3JV4A 4EVNB 4NBZB 1MIEH 5AAWA 4R96A 3DX7B 3IJYB 4DZBB 4G43B 1CDGA 3DMMC 4LCYA 1S78D 4W68A 4LIQE 3F65A 3OR6A 5B39B 4ZMAT 2MFNA 5EZJA 2QSTA 1AR2A 2BNRB 1UWXK 2E3VA 2FLRT 4L9LA 4JRYE 4OGYH 3I50H 3WUZA 5FA4A 1HXMB 1V7NL 3DARA 4P4KD 1F3JA 5FM8A 3MOAH 1V7ML 3D0LB 3TJEH 2ADIB 2GFBB 2P5EE 2NY2D 1KIPB 5DJ6A 2PO6C 5GSRB 1TCRA 3CNKA 2ADJB 1RIUL 3HTLX 4OIIL 2NCMA 5J89A 1MCIA 4M7ZC 3OGCA 4R2GB 5IB4A 3U9UA 1WSST 4FXKA 4YGVB 3UYRL 5E8NB 4N90D 4NWUL 4R7NB 3VFRB 1Q8MA 2JIXA 1ZANL 3HRZA 4X6CB 2DTML 4DKAA 3QEQD 1CT8A 2FBOJ 2BVOB 3VXSB 3U48A 1A1MB 1BVKA 1OCWH 1IM9A 1AQDB 4QHKI 2IH3A 3FMGH 2VQ1B 1IFHH 1OW0A 1AH1A 4GKNB 4PJFA 1UVQB 2P5WB 5GRUL 5CJQH 3IKKA 2EXYD 2A77H 3CPLA 4NKMB 4TVPH 1DUYB 4HIEA 5GISL 4OZFG 4HXBL 3BDYH 3UDWC 2ICWB 1H3PL 3EKCA 3GO1L 4CN6A 2YK1L 2P42B 2R56H 4WGWB 2YZ8A 4PRIE 1KENL 5HDQH 4PRDB 1JUFA 2ZUVA 4L8CA 2E9BA 1QBMH 12E8H 3PHOB 2VXSL 1MF2H 4HKXB 1VADB 5CJ5A 5FB8B 3DXAA 4N5ED 4QRQA 4MX7B 3KYNA 5A3IC 1U8HB 1U9KA 3TO4A 3QPQD 2NXZD 4LVNB 5DR5L 5F1OB 3X14B 1ZLVK 3SDAD 4QF1B 5FIEA 1T0NA 4IEFB 1TETL 5JHDA 1RJYA 3KVQA 1NBVL 5EC2B 2Z31C 1FE8L 3ULVL 3BI9X 2GT9A 1ZA6B 4MS8C 1AO7B 1QD0A 5EU4A 4OM0H 5AYUL 4FFVD 1HZHH 3IDXH 5FYJU 4FFWC 4WFED 5T33H 3I84A 3JBG7 5J06A 4KJYB 1NCNA 2FGWL 1EEYB 1BQUA 5IHZA 3MGOA 2DD8H 3QG6A 1CFSB 1G6RB 1IGJA 2HJFA 4K8RH 2LU3A 2V7HA 3HE6A 1RZJC 2EIDA 3TFKD 4IMLA 1PG7H 5E2UL 4PG9B 1T04B 1NMBH 3LOWA 5BV7L 5E08L 3MLUH 4ODTL 3OB8A 4QCIB 2R1YB 4X98B 4YBLB 5GRJL 2X40A 1QBBA 3WIFA 5D2LB 4QRRE 3ZKMC 1G6VK 1BREA 4XAKD 2EEDA 5CIPH 3MXVH 2OXHA 4MJIB 1HNGA 2NTFB 4RWYL 4H26A 5E2WL 4ELMF 3FONA 3O2VH 1N5YL 1MQ8A 4G9DA 1HILA 5E4IA 2NLJA 3ZKQD 5K9QI 2BERA 2HFGL 4U1MB 5C0FA 1P4LA 1KLUA 2FCBA 5F6IB 2K3TA 2B2XH 1J05A 5CJOL 2Y25A 3TGXA 2E9IA 4A2LA 1DEDA 1Y6NR 5FYJL 1L7IH 2EC9T 5F8QC 4I0KA 1AI1L 2AJXL 3B43A 1MJ7L 4H5SB 2YD9A 4NN6C 1ADQL 4OCSH 5CLTA 3WNOA 1INDH 5HDBE 1JWMA 3UTTD 3SO5A 5IV2B 4BH7B 4TQEH 5EPMA 5C6PB 3MA7B 4K3HA 4LSRH 4Z18A 1CF8L 3V5HA 2YPLA 5BMFL 4J3UA 4I18C 5I1LA 3EYQC 3S5LG 4ZOAA 4EDWL 4HWZA 1DBKL 3SBWA 2KL6A 1LO3L 2FD6H 4V1DE 4WFFE 4J3VA 5C09E 1FO0B 4FXGA 3DX8A 3QDMB 5CEZL 3DETC 5C0RH 1J5OL 3U0WL 1EHXA 1I1AC 3MPCA 4OCYH 4P23D 4JM4L 4Y4KD 1PX3A 4I0CC 1FH5H 4X7SH 3VFTA 2NZIA 2RIKA 3MRDB 1YZZA 3IDNB 3CXDL 2GK0A 1K3ZA 2DQEH 3X12A 1KCKA 3PHQB 1CLOH 2D3VA 2VE6A 1VEMA 3B9KD 4XXCA 3W2DH 3UCRA 2J4WH 5DJXB 1WV7T 4JKMA 2Q7NA 1KULA 5MERA 1LK3H 2DL2A 3JWOH 4UUJB 3OKEA 3QCUH 3JSSA 4Y5XC 4MYWB 5DHYA 1CFVH 2C9AA 4PB0L 5KSBB 2FEDD 1Q9WB 1SYVA 3Q3GB 3FO0L 2W1NA 3MRGB 1X4XA 1R5WB 3SN6N 3BQUA 4NQVB 1U8MA 2J8UB 1J8HE 3W9EB 2BSSA 5HPOA 5J6GB 4M5ZH 1N6VA 2VDMH 3Q6FA 2HLAB 5EOQL 2EE3A 1Q9LA 5I19H 1K8IB 3LSOA 1E27B 1QA9A 1A2YA 3OXSB 3QDGB 4CVZB 5IFHL 3W5MA 3RVXC 1UEYA 3E8UL 2R2BB 4GAJL 1BQLH 3TIEA 5DVOA 3TA3C 2Z91B 5C0BD 5HI5D 1CD8A 4PJXA 3RNKA 3QFJE 5IB5A 4AEHH 1S9KC 5HHPA 3VWJB 5GGQH 2V17L 5D72L 3RTQA 4J8RA 4I13B 5J57B 4WWKD 2GTZB 4LVOC 5F71A 1BP3B 1V3KA 1MRDH 1UB6A 4XMKL 3QI9A 3WDHA 4N5UA 3WFEH 3GMNB 1AGCA 3LIZL 4P49A 1P9MC 3MRIB 1ZVSB 3RU8H 3BKJL 4GRLA 2WINB 3F7YB 4Y16D 43C9A 4CADB 1P7QA 5SV3A 2R23B 2FIKB 2P8LB 3T4YA 3BPCB 2DM3A 5T5NF 4AYFA 1KJMA 2AV1B 3G5XA 4R6UA 4TUOA 4GLRI 1BZ9A 4XB7A 4ZFGL 2R1XA 3CVHA 4PFEA 5ESVB 2CUHA 5DJAA 1H8SA 1QFUH 3LB6D 1G9ML 3N1PC 4MJ6A 2Y5EA 2HJLB 5HI4C 5CCKL 5HSFA 2ENSA 5BZWB 3BAEL 4LL9A 5F7YC 3V0VA 1GGBL 2X9YA 3LHPH 4UTBL 1PY4A 1EGJH 1UZ8B 2Z8VC 3QIUA 2I5YL 4JRXD 3LKPB 4N0FA 1QFOA 3DROA 2OM5A 4N68A 3NCEB 4NFDA 1CR9H 1UXWB 1LEIB 2M2DA 1LO2H 4O9HH 2CIKB 3MGTA 1BLNB 5ELIA 3ESUF 1G9NC 3BH8B 3IF1B 1YN7B 2Y7QA 2L4OA 4W4OC 1WC7B 2B5IB 4GQPH 5I2IA 1P5UA 4X5WB 5KN5A 5KTEH 2WNGA 1BBJB 4CJ1A 4NQEA 3ISWA 2A74A 3QQ9D 2ZCKL 2E7CA 4XAWH 3VXRB 3E3QC 4KZEL 1QKZL 1CICD 1OAUH 2BOCB 3ZDYF 3HC4L 5TE6L 3O6FB 1DVFA 2LTQC 3AUVA 1NCUA 5ESQB 5I8KH 3PJSB 3MUY1 5BQ7B 1PZ5A 2G5BB 3U4AA 1ACYL 3BP4A 5D1XD 2P49B 1K4CB 1KB5H 1UB5A 4WTZG 1N59A 5SWZB 3SJVB 3KXFE 1MCJA 5EU7E 1XIWA 4KKAC 1A7RH 3MV8D 3QNYA 4XPTH 1UGNA 3HMWL 3RGVD 5I71B 2JE8A 4RAHA 5EUOA 4P2OD 2A2QT 1T20B 5D6DA 4EI5A 3BN3B 4ELKB 3UPCA 1JZ5A 4ZUTA 4PJ5D 2SEBB 3U2SA 5KS9B 1L4IA 5TFSL 5T1KD 5I0DA 2ZUYA 3N9GL 2DMKA 1F6LL 2FJGA 2GSIB 3D2UD 3ILPA 1RUKH 3MBED 2X9XA 4D0CA 3MRKB 3RI5K 2JK5B 4OLXH 5H94B 4Z76B 3IFPA 3OB0K 2ITDB 3OKOB 3Q1SL 3VH8A 2ERJC 1XGPA 4XPGL 1I3GH 1MUJB 4POZC 1KOAA 4PJBB 4BSVA 5FGCB 2UYLB 4GQ9L 4NZDA 1UADC 2V7NA 5CUSH 1K5NB 3S37X 3NIFF 5HYJB 1PKQA 1FSKC 3B4NA 1AGEB 2Y1VA 4PJCB 3MV11 4XCEB 4KY1H 5IROA 4OZFH 5IKCA 4UAOB 1B2WL 1OAQH 4ZSOB 1SY6A 4MHHG 4LPTA 4OKVA 1FNGA 1TQBB 4FQXD 3O8XA 5FUZH 2YD7A 2PTUA 1CK0L 1RZKL 6FABL 4UDUA 4Z7NF 4L8SA 4LOUD 3BD3A 4F37F 1NQBA 1VHPA 2UWEE 1VFBA 5EBWB 1G7JA 4IS6B 4MXVF 4K8RC 1TMCB 1QFWH 3QULB 3T8XA 1QSEB 2DN7A 4NQCB 3TLRA 2I9TB 1MI5D 1MCCA 3HNTH 2DQHH 5JIIA 4OI8A 1T5WB 1ZT7B 4XNQB 4Y4HC 2XN9B 4DN3H 4APQD 4I77H 4I4WB 4MB5A 3HC0A 3B2UC 2ADFH 1DANU 1KC5H 4HC1A 3RGHA 3V6OE 2NY3D 4I3RH 2E7MA 4LDLB 1NFIA 1P4BL 3LKNB 4EUPB 4EQ2A 4AG4L 3LEYL 5CLWA 3RIAF 5EOCL 3V4UH 3G6AA 4XCFL 4XPAL 4PJ9A 4R4BA 1FGVL 3WKML 4I0PA 4JPVL 4KDWA 1WVZA 3MV9A 3OBAA 4IDJL 1FYTE 4JB9L 1DN0B 2B1HH 4JO3L 3WXWL 3VG9B 1G6RH 5HYQB 3MLXL 1FIGL 4XCYA 1JRHL 4LIQH 4U1IB 3S36H 4ZDHA 4LLYB 2K7QA 4G6JL 4KK9C 3REVB 4L4TD 1TENA 4YR6A 3NZ8B 3GHBH 5IOPA 3GFUA 4GT7A 1UCBH 1HWHB 3J8F7 4PJ8D 5DTFA 4GW4B 3ETBF 2A9MH 2VQUA 2YSSB 5HGGS 4CGTA 1G9EA 4LSSH 1TIUA 1XF1A 3R8QA 3CH1A 1DUZB 4Y19B 3QUYD 1CLYL 2RB8A 4HIJA 4OZGB 5KVEL 5I8EA 5EFIB 5DVMA 2BFVL 1EHAA 2VIRB 1YJDC 5GJSL 3GJFA 3EO9H 3UTSB 3QWOA 2C3VA 2AJYH 4P9MH 1LHZA 4MNHA 4WU7A 3WEXB 1Z5LA 2GJZB 1ORSB 4QO1A 4P5MA 1HEZA 1RJZB 2WBJC 3E6FB 1KIRB 1UWEH 3JWOC 4HUVA 3EFDL 3SKOA 1JHLL 1LGVA 1DQQA 1KGCE 4KMTH 4ZAKC 1G1YA 4G7VL 1HYSD 1NAKH 1DBBL 4RGNC 5JW5A 4ETQB 1B88A 1WIOA 5F6HI 4A6YH 4PUBH 3C6LB 4RAUA 5DQ9B 3QISA 4GW1A 1MFCL 4LSQL 3EZJB 1U8KA 3ZHDA 4PJEE 4GFTB 4Y4FA 4LLUA 1D6EA 1FO0H 1A7QL 1FL6A 4RAVA 4QTHA 5DMYA 1NBZA 5SWSA 1ZMYA 4F2MA 3PP4H 4U6XB 3CDFA 5AZ2L 3ZSTA 1VACB 4AQ1B 3RWHB 4J7RA 4MD5B 4OGXL 5ICYB 5AWNL 4ZUSB 4YC2C 1BD2E 5J1TC 2HH0H 4QWWD 4X7CC 5D6CA 2X44D 3L3GB 5BV7B 2YRLA 3OKLB 3GDBA 1MVFA 1ES0A 1OAYH 4D8PA 4Y2DB 1WEJL 4FQ2L 4Y8DC 3GMQB 1R0AL 4HJGB 1G7PA 5JO5A 3GMRA 2YZ1A 3BN9C 4HF5H 5GIRB 4QXGH 3IDIB 2ARJQ 4GBXC 3IU4L 4LASH 2AXFB 2EECA 3TN0B 4OCLC 1IQDA 4X6FB 4GW5B 3LAFA 1AR1D 4Y1AB 3QIBD 2IPUK 3QHZL 4M4PA 2X4SB 2CD0A 4LCWA 1AXTL 4KVCH 4U6HB 2XYCA 3HZVB 3INUH 4R26L 1MWAB 3VE0B 4QHNA 5E6ID 1OTTD 4JGMA 4HGKC 3PWPA 1CXKA 2VDNL 3B8SA 5JUEL 4OLZH 2D0HA 1TZGL 3GKWL 5D7KD 2IANA 4M6MH 5CINL 4LQFL 1S5IH 3WL9A 2VLME 3IKCA 1T6WA 5I1AB 4XGZB 5DD3H 1LNUB 5JDJA 2QKIA 2XKSA 3BEWA 1SVCP 4HPYH 5E94B 4F9PC 3MODH 5DUPL 3UJIH 3WFDH 2BJML 3VXPA 1IBGL 1ERNA 5DURD 4LSTL 1LO0H 1H5BC 5DGRA 5ACLA 1YY9C 5EIIA 2XQBL 3MLSH 1Q0XL 1C5CL 2OCFD 5T1DL 4RMRA 1YMHA 2B1AL 1TZIA 4NRXA 3FKUS 1EK3A 1JRHI 4NZTH 4X5LA 4D94A 4QOKA 5GHWH 1EV2E 5C0CD 4I9WE 4MA8L 3C5ZD 1LD9A 1S7QB 1U58A 5BJTA 2R2EA 3G6DL 5DEZA 3MC0A 5IM7B 4G8FA 5I1KL 4WV1B 4WI2A 1MJ8L 4HWEL 1MELA 1WFTA 4K9EL 5JOPD 2F8XC 3QXDB 4N0UA 1QSZA 4X80L 1U93A 2F54E 4ZOBA 2XTJD 1I3RB 5KSVA 4PY8I 1FYHB 4U6YB 3PWVB 5TDNA 2A83B 2YS4A 5JIPA 3BKML 3ARSA 3C5JA 4UU9B 1T1WA 1G0XA 1Z0NA 3TBWB 1QQDA 4GUPB 2B4CH 3IFNL 3EOAA 4PLNC 4URTB 3SE4A 4UT6H 25C8H 2MMXA 3DV4B 2VLJD 4LBEB 1MHHB 3PNWB 4D0BA 4P3DB 4X8JB 4PTTB 4CBPA 5B3NA 1JHTA 4H25A 1FG2B 3Q5TA 1FN4A 2AK1H 2CRMA 3N50A 2VL4A 4ONGH 3QH3B 3UROR 4JRYA 3IDGA 5CZVH 3TT1H 3RA7H 3QWRA 5LQBH 4LHJB 1RZFH 5IF0A 4G8GE 5CEYB 1NLBL 2IADB 4WHCA 2FATH 2W92A 2P5EA 4WVRA 3CFBB 1MCHA 3FOMB 4R2GC 4PG2C 4NKQB 4P2RD 2IH1B 1CLCA 4HH9B 3AGVA 2Z4QB 5DMKA 3FQNA 5JW3H 1KXTB 2PTTB 2RBLA 2V2WA 4M7LT 3QSKB 5JPMB 5C08B 1KEGH 2P7TB 2DQJL 2ZCLL 1T3FB 5I1JH 3MV7B 2EDWA 2ESVE 3QZWG 4Q6IA 3V4PH 1A3LH 1RULH 4JHAL 1F11A 1JTTA 4YHOH 2HTKD 5D7JD 2W91A 1TCMA 4E41B 1AP2B 4G6FD 4NNPL 5F1IA 4OLEA 3ROOA 3IDYB 4DTGL 5DWUL 3EIFA 4J2XA 2VLRD 4UI2A 2W07A 4HK0A 2X05A 5FUOL 1OARH 3BMWA 1NBYB 2BSTB 3L95A 5K9OB 5DK0B 2DDQH 4KI5C 4X6DE 3WFZA 4PRIA 5F7UA 5IJKA 1IEAB 1N7ML 2NY1B 3HFMH 2FL5B 3FQXB 4JHWH 3I75A 3QXWA 5DRXB 3HI5H 1SMOA 1RVFL 3PABA 1I8LC 4GG8B 4YDIH 5BVJA 3O2DH 1T1YB 2R0ZL 2EH8H 5TPWH 5DEGB 1Z3GH 3WIHL 2D7MA 2EDFA 5EU5B 5INDB 3V5KA 1GGYA 1TVHA 2B39A 2YPKA 3TF7C 1EJ6A 1JZ2A 1UKTA 2P8PB 5FM5O 1SYSA 3H42H 2O5YL 1U95B 4LHUB 4WW1A 1NMAL 1YA5A 1FP5A 4LAQL 1SBSH 3DURB 2EDDA 3MLTB 5E5MB 4K94L 3LQZA 1NFDE 2I60H 3U82B 4Q9CA 3DRQA 1W8NA 5CBEA 3MJ6A 2DOCA 4IHOA 4B5EA 2IGFL 4YE4L 1ETZB 2VYRE 2VN4A 5GGRY 5DJDA 3VXMB 5C8JA 1XF4A 1K2DA 2AEQL 3QDJA 5DJYA 1UH2A 4Y8AA 1LE9B 3OG4B 4YLQT 4IRSD 3DBXA 2CLVB 3RVTC 4GKZA 4BA8A 4QXUL 4PGJA 3RWDB 1OY3B 3S34H 2DWEB 3D85A 1HHJA 3F62A 5F6IC 1KN2L 4N8VG 3T0VA 4ZPTA 3H0TA 5CZKA 3SKJH 1AQKL 2JCCB 4NQDD 2KZ1B 4PV9A 1MAJA 2GJ6E 4J1UA 1XZ0A 2M26A 4U1HB 5A2IH 4XP4L 2CDFB 4NGHH 3EYVA 1BJ8A 4MQTB 4RFOL 3FQUB 5AG9A 1FLRL 2H2PD 5GGVY 1CBVH 1UM5H 2CUMA 3CUPB 1Q9OB 3KLSA 5CJXA 3HAEB 2PYED 3AY4C 1IEHA 1MCFA 4IBLT 3RZCD 1A7OL 1FL3B 2EYSA 3VFMA 4NFCA 3SE9L 2K9UA 4L3EB 5DK2A 1P69B 1I1FA 4MD0B 4FOMA 4KRPB 3VI4E 2AABL 4Z8FH 4XRCB 1YNKL 3QCTL 5C09A 4KKBD 2AEPL 4O2CA 4WFHD 4C59B 5IW1A 1JK8B 1O0VA 2WLZA 1QSFD 3DMMA 3QQ4A 5LBSH 3HPLA 3S6CA 4ORGA 1S7VB 3IS1X 1AIFB 3BYYA 5EULV 1KB9K 4KJWD 4FG6D 4L3CA 1IGTA 5EORL 4LCIL 1AGBB 5F9JA 4P4KB 4NOFA 5DR5H 1P84K 4L4VA 1X5GA 4QRTB 4XAKE 2BZDA 2PO6A 3IDUA 1EXUA 3ZE0F 2NY2B 3MRNB 1DANT 3UZVB 5HHNB 1G7LA 3C6SB 5KSAB 3PWNB 4OGZA 1FVEB 5AYUH 1UJTA 4H1LB 1J8HA 4HLZH 4XZUA 3D6GA 3QIWD 5CP7A 1TTUA 4HS3B 1WWAX 3QXUA 2D0GA 4NSKA 4K7PY 4IRZH 4FQ1H 4ESKA 1FBIL 1FVDB 1GPOL 3QEQB 1G7IB 4OCWL 4BSWA 3VGAB 5TQ2L 2XWBB 3WO3B 2W9DH 3P0YL 3ZT7A 4N1HB 4PJIF 4WTZA 5DFTA 3D25A 3MREB 1I1YA 4G6ML 3VWJC 5LKNA 4OT1L 5SV4A 4NT6A 3QFJA 3UDWA 2BX5A 2HT2C 4NKOA 1F6AB 2AQ3A 2VL5B 3W39A 5T5FL 5EBLA 1K8DA 3CVIH 4JJHA 2I27N 1IQWH 3NABH 5F7FA 4RWYH 3MROA 1RURL 5E2WH 3T3PE 4XPFH 4F7CA 2XZAL 3FT2A 3EO1B 3KWWB 4XHQA 1KEMH 32C2A 5E8PB 3WE6A 4M03A 4AIXA 5JMOC 3A6CL 3WS3A 3MJGX 3FRUA 1BX2B 1QPXA 5DRZB 1CD0A 2NXZB 4JZNB 1XR8B 4S10A 1QO3A 3LZFH 1MJ7H 4OZIE 3C9NB 1XEDA 1OLZA 4OCXH 1A6UL 2H32A 3SDYH 5IB2A 2Z31A 1A6AB 1KXQE 3MLYL 5EZOL 4OM1L 1MWAH 1MCDA 3RFZC 4PRAA 1ZHBA 3WUWB 3DVFA 2GIYA 3KS0H 2ZPKH 1CF8H 5M94B 4TTDC 4JFFD 5FO7B 1BOGA 2XWJB 5KVFH 4F7MA 5AD0B 3TNMB 1DBKH 1MEXH 2B0SL 5D70L 1LO3H 1P7HL 1GOGA 3FAXA 5J1AA 5JQ6L 3DV6A 3BO8A 3VXQA 1JF6A 5JA9A 1KTLB 3K46A 3ARFA 1QYGH 2EO9A 5ISZE 4U1LA 5KVGH 2EDBA 4U1NB 4BFEA 2VLKD 4MCZB 2B4CC 4NO2B 2B5IC 3BVNA 5IMMB 5FV1L 4UB0H 5EU3A 3SO3B 5GRZA 5JLZB 3SQOL 4HGWB 3SDDD 1UEMA 3DVNA 1KUMA 1MVUB 4X4XA 3KLHD 2I9LB 1IC4L 3P9MA 1J7VR 3LV3B 1WT5C 3O6FC 5FOBA 4NO3B 4OBSA 1FHGA 4Z7QE 4XH2A 5IBLD 4LKCA 2YUXA 4E0RB 3B5GA 4JG0L 3WS6C 3AAZB 1G0DA 1M05A 1NGYB 5F7HA 4FTVE 3VI3F 3IRZA 3OAUH 2G60L 5IFHH 2XZZA 4C56B 5I71C 3FT3A 3U83A 3KXFA 4XP5L 3AROA 4ZFZB 1JTPA 1WBYA 4BUHA 1ZTXL 1DQTA 4DGIH 3BPNB 4HDIA 4RA0C 5CSZA 4FQCL 1I1AA 3QNZA 3LN4B 5C6TH 4WTXA 3QUZC 2JIXD 3HG1E 1IM3A 5IJVB 4P23B 3RWFA 1MLCB 2WWKT 1HK6A 4Y4KB 5EO9A 1IM9D 1F58H 3HZKB 5AG8A 3KPRB 3TYFB 1JF1B 3MTRA 5C2BL 3W0WA 2DLHA 3PGFL 3KYAA 2VB5A 2ENYA 1IC5H 3CIQA 3BIAX 1A6TB 1CG9A 1NCDL 1XGRA 3TZVD 3QCVL 4ZODA 1JGVH 4Y5XA 3ZLQC 4NQSA 2VLLB 3GMOB 4PGBA 4J4PD 3ZYIA 4HJ0C 5HYSB 3HI1B 1WZMA 4FQQB 2HA1A 1IGML 1F3RB 3WYRA 5D8JL 3X11B 1J0ZA 4BYHA 2FSEA 5F89A 3N1MC 3G9AB 5E8OB 5CGMA 4UAOC 1I8MA 5D71H 5FCUH 2X4NB 3HNSL 5DRNB 1TQBC 1F5WA 1Z0MA 3IU3B 3DXAD 2X4QA 3TO4D 2EKJA 1J0KA 3L3KB 4PJDE 1JWUA 2NXYD 1V3JA 2I26N 3WFBH 2PCPB 5J3HC 3TA3A 5JHDD 2OR8A 1ZLUH 3OMZA 4AIZA 4LGRB 1HHGA 3TT3L 5TE4H 3FB6B 4HCRH 4JFXA 1ZWIB 5C0BB 3QNXA 1WFNA 3KYMA 3PDDA 3RZWA 1ED3A 1U8JA 1ZGLB 4BH8B 2X1QA 5FM4A 1X5LA 3T65A 5DZNA 4HK3N 4WWKB 4Z7VF 2Z8SA 3G6JF 1A6VH 4PJAE 2VZOA 4M7LH 2NYYC 1I8IA 3VJ6B 3O4LD 1XAUA 3HE6D 2YC1A 3DJ9A 1FFNB 1LO5A 3O45B 4LPVA 4KK8C 1U3JA 5HVFB 3V6OA 3PGDA 2J88H 4JO2H 2H6PA 4JGJA 4Y16B 1LMKA 3ARBC 4R8WL 4N0YL 5H37H 4C58B 4KDTA 2HTLD 5EB9A 4GMTL 2F74A 4HMEA 3OAYH 2CLZB 5D7IA 4Z5RB 3HLAB 3VG9C 1I9RL 4P46A 1B4JL 1MY7A 1E6OL 1UWGL 1T03H 4Z7WE 4M02A 3VDBA 1TJIL 4CUCA 1KG0B 2H1PL 2HKHL 4LF3B 3HR6A 4KRLB 4OZ4A 1FV1B 3OPZL 4ZD3H 5GS0D 5I1EH 1YEJL 5ID1B 3BUYA 4C83B 1A1OB 2O5ZL 4LVEA 1ACZA 3HR5B 3A6OA 4OV5B 2UZXB 5K9JH 1TVBB 2FO1A 4JRXB 3RPKA 4Q0XL 4ZUUA 4JCMA 3VGBA 4Z7OE 5TFSH 4G42B 3HUJE 5F7MC 3LS5H 4Q9QH 1A4JB 3UO1H 3BWAB 2YPLD 1F2QA 1OHQA 3LN5A 1KJVA 2MWCA 3FO9A 4BFIA 1UA6L 1XCTB 4PRHA