4ZPTA

Structure of mers-coronavirus spike receptor-binding domain (england1 strain) in complex with vaccine-elicited murine neutralizing antibody d12 (crystal form 1)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
216
structure length
213
Chain Sequence
EVKLVESGGGLVKPGGSLKLSCAASGFTFSSYAMSWVRQTPEKRLEWVATISSGGTYTYYPDSVKGRFTISRDNAENTLYLQMSSLRSEDTAMYYCVRDGNSMDYWGQGTSVTVSSAKTTAPSVYPLAPVCTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evaluation of candidate vaccine approaches for MERS-CoV
pubmed doi rcsb
source organism Human coronavirus emc (isolate united kingdom/h123990006/2012)
molecule tags Viral protein/immune system
molecule keywords D12 Fab Heavy chain
total genus 40
structure length 213
sequence length 216
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zptA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zptA01
4LVOC 1QSZA 2HT4D 4JQXA 2NX5B 5B3NA 2GJ6A 2GSGA 1NMCB 1SJHA 4MQ7A 1F3JA 2B39A 1ADQL 1CIUA 4OD2B 4WU7B 1UB5A 3MRPA 2LVCA 4LSUH 1MFEH 4ODTL 4XPAL 4YPJA 1BFSA 1WZ1H 3IS1X 1HKLL 3MX0A 4RGOL 1QBMH 2Q20A 1G1CA 1LHZA 5CIPH 4ZFOA 1ZOXA 4XWOC 3VGHA 2BC4B 1CDCA 3RDTD 5F7DB 1A9BB 4LPWA 2GTWB 3TN0B 4C4KO 3PABB 2CUHA 2IPKA 1P7HL 4NRZA 1FO0A 3T3MF 3ZE1E 3ARGA 4ZDHA 4UT9L 4NZJA 1DBAL 1TJIL 4KUCF 5HVGB 4RFEA 4AK1A 3UZEA 1VENA 1N0XH 3AMLA 3BSZH 5J11B 5C09D 5SWSA 2COQA 4CU7A 2QHRH 3ELAT 3HE6D 4PJ8B 3H9SE 4GQ9L 1IARB 4H8WL 4M7KH 1LE9A 4YX2L 3Q2CA 3M07A 4P4KD 5F70A 3W5NA 1MQKH 4AL8H 3HR6A 3WS6A 3LEXA 4O2EA 4NQCE 3Q5TA 5AWNL 2HLAB 2Y5TB 5J1SC 1EVUA 5L6YH 1VESA 4PJAA 2AJVH 1FL5B 5JW4N 4XBPB 5JXEA 2H6PB 2K3TA 2XXCB 5F1IA 4ZOEA 3IGAA 2E6JA 1UA6H 3K46A 5AZEL 5FOBA 5IIEB 4CJ1A 2DYPA 4GUPB 3U2SB 3U4EA 5F9JA 4N5EC 1N7MH 3SKOA 2PNDA 3BZFB 1BAFH 1PGRB 4XPTL 1FVEA 1MAML 3CX5K 3EHBC 1UWGH 5I1IH 3HNSH 5HGDB 4OGXH 2NW2A 2ARJQ 5IBLC 5J3HC 2ZPKH 3VG9B 1MCCA 4MD0B 4QXTB 4KRMB 5FOBB 4G6AC 4P9ML 1L6XA 4IRSB 1E4JA 1BREA 1OB1B 1IKNC 4JFHD 4WUUA 1RIHL 4XZUA 3SKJH 1IEBA 4OJFH 5JMRA 1MFCH 2QV2A 2XTJB 3PF2A 5HYJB 4D8PB 4H5SB 4YC2B 5I2IA 1X5LA 5L0QB 3BDYL 2VISB 3V0VA 2CKNA 2QADC 4JQVC 4LRIA 4OB5H 1FGVH 3HMWL 4Y1AD 1HHKA 1LP9A 3CC5A 1XF4A 2GIYA 3ECBB 1DQMH 3GSUA 4GAFB 4IRJB 4F37K 3DURB 2ICWJ 1MJ7H 3B9VA 4FQJL 1I9IL 3QXVA 5HHMB 1MY7A 4QRTA 1FZKB 2DTML 4AG4H 4QHKI 5ADPH 3LKPA 4QHMB 3ARGB 2EEDA 4ZDHB 5HBBA 5I18H 2UVEA 5IBTH 3DGGB 4CVXB 2Q1EA 4FP8H 2Q8BL 3GHBH 5EU7C 4Y2DB 5D6DA 2OL3L 4PJ7F 3F7YB 5JXED 4TVPL 4OCWH 4CUCA 5AYUL 1WAAF 1FN4B 1U92A 3VGEA 4MCZB 3HAEG 2NY7H 2E7CA 3PGFL 5DJCA 4X6BA 3EO1A 2Y72A 1N59A 1BWWA 2AAVA 1KELH 3FB8B 2BVQB 1N2RB 2IH3B 2OJZL 3LDBC 1JL8A 1RULL 3C6LC 2R2EA 1ADQH 4QHUA 2ERJB 1EFXD 4HBQA 4Y16D 5I1DA 4FOMA 3VI3E 1SJHB 4RGNC 3P3YA 2YUWA 3LPFA 2ICEB 1J1PL 3VFUA 1CTNA 1A1NB 4OZHA 1D5BA 1JWUA 1VACA 5LGHH 5KJRL 4F7TA 5F72S 5CSGA 2EYRB 1UWEH 2HT3C 1FFNB 3RIFF 4X9BA 1E4XL 1S78C 3TZVA 3B5GA 4BQCA 1O0VA 1ZT7A 5EORL 3RVXD 1OSZA 1KXVC 1TCRA 5EUOB 2GJ6B 3IDXL 5L9DL 4B50A 1QOKA 2VXVL 4KHXH 1GOHA 2IFFL 5SWSB 3DHMA 5CILH 5IVXB 4Z8FH 4PRID 4GFTB 4OQTL 4CADA 3KYNB 1OCWH 3MRHA 3OG4B 4OCXH 4RFEB 4X7TB 2AEWA 1GGTA 3MJ8B 3UXFA 5IB3A 1EVTC 3DECA 5IW1A 1DVFD 4RGMC 2IPKB 3BT2H 5CSZA 3P11H 4JGJA 4RWYL 3EYVA 5I73C 3BN9D 3RY5A 1CFTB 2WP3O 1WWAX 1X9QA 4APQB 3RX7A 3L3IB 2M1KA 3HZYA 4OV6F 1UJ3B 2XZAH 1KB5A 1JRHL 4JO1L 4LEXL 1YNKL 1KG0B 4LLQB 4Z78B 1V7ML 1DSFH 1T1XB 1J7VR 5DMYA 2LAGB 3GJFH 1R5WB 5ACLA 5IHBA 4OQTA 4R7DB 4XCFH 3KXFD 4OLVH 1ZA3B 4UT7L 2DQHH 3EJJX 3TYFA 1AD9A 3IFNL 3VFTA 4IIQB 2HRPH 1NCNA 2EIDA 3GGWA 4HXBH 2AXJA 5C0FA 4X4XB 2E27H 3EYVB 3P40A 5I74B 1P2CB 3S34H 1WEJL 3C08H 1MCFA 2DQCH 3MLWH 4YAQA 4HC1A 2OYPA 5K59F 5L88L 4TUJB 2ZUYA 4L8CA 2C3XA 2D7NA 3ZDXF 3C8KA 3BP5A 5FYKE 1YEFL 4XNXH 4G7VH 1MCBA 3QHZL 1YMMD 4Y4HC 4WHYG 3DI2B 3VFVA 1W0WA 5DVNA 5E1AA 1KPRA 3R06A 2NMSA 2A6IB 4NHUB 1A7BA 1DUYB 3LMJL 2XXMB 3MRIB 5E8NA 4LK4A 43CAA 1RUKL 3WIFB 1A6WH 2HWZH 2VXTL 1T03H 3NH7L 4Y19B 1KB9K 4Q9CA 5T1DH 1M7DA 1TTGA 4P2RB 2VZOA 1G9MC 2VC2H 4WI2A 5CIPB 3S88H 3VJ6B 4X5XA 1WWCA 1I9IH 1JPGA 4K7PX 3SDAD 3SPVB 4XCCH 1DBJH 4HPOH 4TNWF 4NUJB 3I02B 1QYGL 2DBLL 4M8QB 5B4MD 1K5NB 3QSKB 1T5WB 4WFHE 4EBQH 1OAYH 5E6IA 1S5HB 5A40E 5LAXB 4LCYB 5C9JB 2YWYA 2JIXD 3OJDA 4UV4L 3MXVL 1G9NC 4E41B 3E8UL 1UZ8B 4PJCF 2DS4A 1D5ZB 3KPOB 1URLA 3MNVB 1DBKH 4MAYC 4U1GB 1QBBA 4PRDA 3TO4C 1C16B 1FORL 4RQQB 1XGPB 2ED7A 3MFFB 4GG8B 1W72B 2NY7L 3PGFH 5LJYH 3QUXD 1RZKL 3MRCB 4QXGL 4Y5XA 3KS0J 3S3JA 2NY5H 1HHIB 2D0HA 4OCNC 5DT1L 2OR9H 4U0RB 4HUUB 1AE6H 5CBAB 1IFHL 2VDQL 3GK8L 2QQKL 1ZS8A 5GGUA 5L8LB 4NQSB 2VZTA 2XQYG 5HPMB 3SO3B 4PJ5A 5C6WH 3QCVH 5I0DA 1S5HA 2VE6B 3U46A 1MVUA 5C9JA 5TGBA 4L3EB 5IJVB 4R96B 5HDOA 3WKML 1I3RB 5D1XC 4J3WA 1KTRL 3LS5H 4U6TA 3ZHKA 5I76A 3FQNB 3QDJD 4GS7C 3JV5A 4OT1L 2QSQA 2CRZA 1UWGL 5C07D 2ZG3A 2P42B 3B9KA 4X80H 2KH2B 4IEFB 5ESAB 2MCPL 3UTTA 1ZVYA 1GOGA 5GGTH 2G60L 3CVHB 2WK2A 3CH1B 3NOIA 4XP9L 3C5ZA 3GJEB 3QDGA 1P4LB 5EA0H 3CK0H 4F2MA 2QLVB 3OKDA 1T3FB 2CLZA 3HFML 3DMMD 1M7IA 4NOFA 2XN9B 3QUYB 5F6IC 1KNOB 3MCLH 5EZLB 2DAVA 1FVDB 3BGAA 4YUEH 4RMTA 3WXWH 2ICWA 3L3JB 4K3JL 1U3ZA 5KSVB 4Y88A 4JE4B 5C0CD 3BZ4A 4ELKB 1TZGL 3O3AA 1V3MA 3WS3B 2P47B 4WGVB 4GBXB 4Q9BA 5LGKA 5JHLL 1JNHB 1S7TA 5CEYB 4M9OA 4I9WD 3RVTC 1FSKC 4DVBA 5EDXA 3D9AL 4I18B 5JOFB 4NWTH 3ETBF 1LEGA 2W0FB 4TUOA 4CBPA 3TYFB 5F7MC 4UTAH 3NA4A 2P5WA 3L5WA 3ARRA 4N1HB 1X5ZA 4J4PD 5I66A 4GRLC 4N90D 1C5DA 3TPKA 4Y4HD 4NQDD 3KDMB 5HHQB 1WCBB 4L4TB 4NKMB 3MA9L 5KVFH 3HI1A 4G7VL 4KWUA 5I1LA 5B39A 5TDNB 2KL6A 3SDCA 4OBSA 3INUH 4D0DA 5A2JH 1ADQA 1ZLVH 1PYWA 2DB8A 3VXRD 3PDOA 1BFOA 3BO8A 1WISA 4G8GD 1Z6JT 1A6ZA 4UQ2B 4OFKA 1WWBX 3QQ4A 4HWBA 3UBXG 4PJBB 3GMPB 4MX7A 1JF1B 4K7PL 4YEEA 5DVMA 2F74B 3BH9A 5I75B 3DXAA 3S6CA 3GSWB 5HYSG 5CHNA 4FXKB 4Z7UE 1CDJA 4L4TA 2BFVL 4NP4L 4PIRF 2YSSA 1TTUA 1I7ZA 2NR6C 3G6DL 1SBSH 4RX4D 4JG1H 3QDAA 4OCRH 1NBZA 2WIIA 4JRXE 5KW9H 3C87A 4Q6IC 1QHPA 3DSNA 2QTEA 4OCYL 1X5FA 2IQAA 4PJHF 1WV7T 5CGYD 5FKPA 5IEHA 3HE7B 5HDBE 4BZ1L 1NFDE 5I17B 2BVYA 3PG2A 1MRFL 4KDTC 2WBJB 5AUMA 4H0GA 3ULVH 3TCLB 2VLJD 3U36A 1S9VB 5CZKA 2CXKA 5DK0A 1NQBA 3U7YH 1ZANH 4H1LH 1JV5B 1EBPA 1JF5A 5EBGA 1LVEA 4O58H 1U3JA 1QA9B 4TSCL 4KJYA 3RL2B 1I7ZB 3P4NA 1HOCA 1K4DA 4ZNEA 1IFHH 3MZTA 3VXSA 1AXSA 5BVJA 2BMKB 1ZTXL 5H35A 4KAQL 3X3GL 3RWDB 4JPIB 4ZO7A 4BUHA 5EUKB 1PDKA 4L3CB 3CFBA 5H2BA 2NTSP 4PGDB 2JB5L 2CDGA 4DQOH 3MJGX 4W6YB 7CGTA 3NN8A 2DBJA 1CICD 2V9TA 3S35L 5JR1L 4KZDH 1FNEA 1PFCA 3P4OB 2GFBB 2H2SC 4M7JL 1FNGB 4KRPD 3JWOC 2ZCLL 3S4SB 5E5RB 2YK1L 1KJ3H 4J3VA 5ANMA 4F57H 3WDHA 3VFSA 3DVGA 1JGLL 3DURA 3EO0A 5KVDL 4RFNC 4PLJD 2ORBL 4WWKC 5ESQB 1UM5L 1NAML 5DEFB 3REVA 3WNKA 2ARJA 1EIBA 1A2YA 1T4KA 4WHTB 5DJAA 5ISZA 3LV3B 3T08A 4HH9A 3QHZH 2GT9B 2SEBB 4YE4H 3TJHC 5BV7C 2WBWB 1X5IA 5H35B 1XF2B 4FQ2L 3WV0A 1XGYL 1ZHKB 4PREB 4WO4B 4XBEL 3WD5L 2NY4C 4FXLA 1NGXB 3QFDB 2ADFH 4U49A 4YPGA 5C0JA 5JLZA 3ORJA 5DJ8A 3BIKB 5FO8A 2W9EH 2XICA 5LWYL 4ZFFB 3BW9B 1P6AB 4H0IA 4F9PA 1YECL 4MVBC 4R4BB 1TVHB 5DQDH 4OM0H 4PFEA 3CCHA 4HKXB 2KKQA 4NJAL 4L4VD 4F37F 3GKZA 3QUXC 3C8DA 2WIMA 5EUOF 1QYGH 1KB9J 4K3EL 1RU9H 4UTAL 4XTRD 2EC9U 4PRHA 5F7FA 1BBDL 3S36L 3BKCH 3PQYE 5DK0B 3X12A 2EDXA 3L5JA 3Q6GH 1OW0C 1CE6A 4RDQF 2D7PA 2APTA 1MFBL 5A2FA 5GISL 4ZNEE 4M6ML 5K33A 2HA1A 4PJAB 1KTLA 3LH2H 4BQ9A 1DE4B 5ITBL 5MERB 1FL3B 2R0ZH 5FDYA 4RGNB 4P2OB 3GMPA 3OB0K 3PJSA 3IB4A 1S3KL 2Y7QB 2R8SL 4NO0A 3A0OA 4BJLA 4LIQH 5ERWB 2YSSB 1F3RB 2J8UE 2D7OA 3EDEA 4NC2B 4RQQA 4WNQA 3NCJL 2WP3T 4NN6B 5I8EA 3ZT7A 3MR9A 5JPNB 3B2UC 5FDWA 1CN4A 1WCBA 1ACZA 1OVZA 1FO0B 4NFBA 4LHUA 5KW9L 2H9GB 2HJKB 2N7BA 4ONHB 2DMCA 1MRDH 4OGAD 4U2ZA 3CXDH 2LU7A 4FRWA 4ONFH 5F7WC 3C5JA 4LVEA 5I16A 3SPVA 5KSUB 2AKRB 4WDIA 3AS3A 3VFRB 3WFHB 4N8CH 4R8WL 4ELMA 1M05A 1N3NA 4RBPK 1IE5A 4E42B 3FZUD 4POZD 1MSPA 5CD5D 3OSKA 4G9DA 4NNPH 3QXDB 1F90L 5GIRB 2ZNWA 3DTXA 3F7VB 1UJ3C 1BF8A 3T2NL 2RQ8A 3RWCB 1FNHA 4X4ME 1Q8MA 4AL8L 2Y07L 4XPGL 3W82A 5C08E 1LNUA 3BWAA 3OKMA 3LPGA 4HDIA 2F54D 3C8KB 4MGXA 3T0XA 4EI6A 1KIPB 3KPRB 4OIAA 4P5TD 1VGEH 3N06B 3ISWA 2Y9RT 3V6BR 4BYHA 4HEME 3VXQB 2VDNH 5HJ3A 2NW3A 5D7JC 1HXYA 5FYKH 1F58L 1X7QB 3QRGH 5IMKA 4HF5L 4ORGB 1P4BH 5HHNB 4B7IA 2HLFD 3HNSL 1DP0A 4PRAB 4P46D 1PG7L 2VUYA 1NEZB 5E56A 4D3CH 1LDPL 4GAGL 1Z0NA 1UT9A 2PO6C 3SCMD 3BDBA 3PWNA 3RGVB 4WCYH 4KMTL 3UJTH 2Q86A 4JREB 4KK6C 3RBSA 3EOAA 3EO9L 3MRQB 1MFCL 5JOFA 3C5SA 3DETD 5J4MA 1O5DT 1NMCC 4TULH 3T4YA 4I0PC 5DR5L 1JWMA 2VXSH 3MLTA 2YD9A 4Q74A 1MI5B 3W39B 1PBYA 4QTIH 5FDWB 4S1DC 2UUDH 1XEDA 3CSGA 5E00A 4XH2A 1B9ZA 3NFSL 4U1IA 1XGPA 2ED9A 1VEMA 1MJ7L 2VL4A 4NP4H 1X5GA 4GMSH 2OK0L 5T1KB 1S7VA 1FAKT 3LZFL 4KY1L 1Z9SA 2OM5A 2FATH 5CBAA 1QR1A 4QRRD 1A02N 1IGIL 5IBTL 3EYSH 3FOLB 3HTLX 2P7TB 2DQUH 4ZS7L 3TO4B 2ZG1A 4DZBA 5I1HH 5D71L 2A9MH 1BVKA 5FO9A 2EIBA 5EFIA 1VCAA 5C09E 2RGSA 3HUJB 5D1QA 5AYUH 1EJOH 3IDMA 1OAZL 4RIRB 3SQOL 4U7KA 3WLWC 2Z35A 1I1FB 2BOBA 5I76B 3ARTA 5GGSB 1KTKE 2X89A 4EQ3A 4R96A 4Z5RA 3EO1B 1QQDA 3O41A 5JW5B 1WK0A 1GGCH 2IWGA 4Y19E 3UX9B 1T7XA 4OF0A 2DQGL 5CSBA 2P8MA 3AAZB 3OKNB 5IKCA 4LQFH 2EH8H 1YYMH 3FFCB 1IGML 2A0LD 1SYSB 1ZKAA 3D85B 1C7TA 4QWWC 5H37H 5ABDE 4UILL 4YBQD 1XF5A 3VGBA 3WIHL 1W8NA 5EBLB 5DJCB 2F53B 1A6TB 1FN4A 3NZ8B 4XPTH 3IDIB 3FO0H 4MXVF 2NY3D 3WE6B 2KPNA 5FA4A 3IJYB 4XP4H 4X99A 3Q0HA 4P9MH 1W72L 5I19L 1LILA 3U30B 2QR0A 4DN4L 1DQJB 3MJ7B 3ZKMC 2VZSA 4YDVA 2Y07H 3E0GA 1ZVSA 3TBSA 1U91A 4MSWA 1WBYA 4MJIE 2IAMB 3BKYL 1KB5B 1RZJC 4X6DA 3HZKB 4I0KA 4PUBL 4OD3L 2MKLC 5GS1A 4JM4L 5E7BA 3QNXA 1TQBB 1SMOA 2UZXB 4IRSA 1Q9LA 4G42A 3UPRA 3L5HA 1XIWB 3E6FB 4WEUD 2VXUL 4U6XB 4G8IA 4ZUVB 5KG9A 4ZTPL 1GAFH 3WUWA 4Z78A 4OCSH 2QADD 2BMKA 4OM0L 3MJ8A 3S96A 5IB3B 1YEKL 2X4RA 4R9HA 1D9KC 3IFNH 4LPVA 5HYSA 2D9QB 5IGXL 1RPQA 1MHCB 4G6MH 4EDWL 1J05B 5EULV 1CFTA 4M6OL 2AV1B 4J6RL 4KHTL 2IG2H 4RA3A 2KUTA 3OZ9H 2X4PA 4WFFD 4ZPTA 2XWJB 2NW2B 3UTOA 2JJUA 1QFUL 3TIDA 1SEBA 5FYJD 1QFWH 4MA8L 1HHJA 2AXFA 3ULVD 2AQ2A 5FKPB 3V4VL 2B5IC 3QNYA 1PAMA 3MNZB 1YA5A 2WBJD 1YMME 1RZIB 3R0MA 5IEHB 2OZ4H 3HMXL 1YQVH 4MYWB 1T2JA 5FM4A 2GI7A 3LDBB 4WI9A 2IQAB 1V3KA 3LV3A 3H9SB 5CJQL 1I3GL 1Q0XH 4X0KA 3UDWC 4YHOL 3D3VB 3CFJB 3JV6A 3SE9H 1GPOL 5TDPA 4L4TD 4YDKL 5ITFB 5LGJA 4QRRE 3QEHA 1B6DA 1J1PH 5MEQA 2CR3A 3U0TB 2R0LL 4WDIB 2NY1C 4N0YH 4ZPTB 2MHAB 1HEZA 1LE9B 1S9WB 4XBGA 1JGEB 1N5YH 3WEXA 1TVDA 1JYVA 1XF1A 4MNHA 2A38A 2ZJSL 3SDXE 4FTVD 4KTDH 4ZFZA 2EYSB 4OZHE 3BO8B 3T0WA 3CFBB 4NO2A 4HFWA 3FN0H 2FJHA 1EO8L 2P8PB 3WHE1 3WHXB 1RUPH 5B3JF 5INCA 4C4KT 1QLFA 3D2UD 3S4SG 3LN5A 5MEPB 4NNPL 3A6BH 3QDGE 4LKCB 2EXYC 4PJ7A 1XF3A 4HCRL 3DRTB 4XCEA 3H3PH 4LCWB 3LB6D 1FFNA 2AJYL 2MOVA 1I8KA 4OSUL 4PB0H 4ESKA 2AQ3A 4HUXA 5D2LB 1EJ6A 3MLSL 4G8FB 5MERA 1F2QA 4EVNA 1TETH 1KCUH 3R8QA 1FCGA 5IF0B 4GBXA 3ZYZA 3QHFH 4YXLH 4XXCC 3PP4L 3EFDL 3K7UA 1YYML 1A3LH 3X3FH 2V9QA 3TYGH 2BSTA 3C2AL 1GZQB 5LXGL 5BW7A 5IEKA 4NFCA 5DFTA 4KK5C 2W38A 1P4LA 4Y4KC 2AEIT 2IPTH 3OKDB 3UTTB 2OMNA 3BW9A 3MV9E 2WMPA 4RMQA 1DL7L 1JPFB 2UWEB 4ENEC 3DGGA 1RZGA 4O51B 2G5RA 5IMOA 4HIEA 4KROB 4U1LB 1UYWL 5HI3C 4YR6B 4YO0A 3RDTB 4V1DB 5GGRY 4R4FH 3P0YL 2NYYD 4JCLA 3EKCA 5F9JB 4IS6A 4YIQB 5M95B 5FYLL 5CJ5A 5D7IA 5TGBB 2QR0B 2G75B 1V7NL 3GMRA 4PJIF 4Y1AB 1S5IH 1YPZE 1D9KA 2NXYB 4L29A 1S7XB 3BFOA 5IUSA 1KC5L 3WE6A 4LLUA 5GRWA 1X4ZA 3AREC 4FA8A 3GNMH 5IHUL 1TPXB 3NFPA 1G9NL 4H1LG 4EOWH 5E6ZA 4F3FA 1KPVA 4UIKL 5IT2H 5T1MA 4HFUH 2GKIA 1OAUL 2VLRD 1FDLL 1CLYH 3MLUH 1HH9A 1RK0A 3A6OA 4GSDH 2WSKA 3P4MA 3WS6C 1JI1A 2NX5D 3RU8H 3JXAA 2Y6SD 1EK3A 3O45A 3LPWA 4F7PA 3DUUB 4I0PD 3H6JA 2NTFA 4P23B 5EBWB 2VSDA 2VN4A 3U4EB 3CDYA 3TV3H 4PJDF 3OV6A 5CZVL 2VZ3A 4U6YA 2EDBA 4F3FB 3PP3H 3FZUC 4POZC 1NDMB 1IT9L 3ALWA 4JO2H 2IF7A 2F5AL 2RR3A 1FNSH 3GSXB 1DN0B 4BH7A 2DQGH 1YEHH 4G9FD 3MGOB 1F2XK 5KS9B 4L4VE 4PJXE 3V4UL 2MWCA 5SWZD 1ZEAH 4X4YA 1NFDB 1A14H 1AI1H 1EHLH 1MHEA 5E8DL 5IBUG 5F3HA 4HV8B 1BIIB 5BOZG 4I4WB 2CGRH 4X98B 4ODVL 3FJTA 2E3VA 1CQYA 1H3TA 3RI5F 1QFHA 5DMIL 4YJZL 3F7QA 3DUUA 2VERN 3HNTL 4LLMB 4C54A 3QA3A 1CBVH 3I6LE 1H0DB 1G7HA 4M5ZH 1JPFA 3GBLA 1T1ZA 5I1JL 5FM8A 3VRLE 4PJFB 2VITA 3RAJH 3OHXB 4N1EA 1W72H 1YPZF 5C3LD 1LP9F 4GQ9H 4DN4H 5K9JH 1NGXA 3QFDA 4GKSA 4QRPD 1S8DB 4YHPA 3U6RB 1KB5L 1O7VA 2W65B 3TWCH 4YHLL 4BM7A 3RIAK 2XY2A 1TLKA 3EDFA 4LU5L 3SY0B 1KEGH 1U0QA 3LRSB 5C71A 5I6XC 3IDUA 5ICYA 3L3OA 2PO6D 3S8WA 1Q72L 2I5YL 2IMMA 2HG5B 3OBAA 4G8GE 1RJZB 2FIRT 3G08B 4JANA 1TMCB 3W39A 2VXUH 5DFWH 1YN6A 5JUEL 3UTPE 1T83A 1F02I 3T4YB 4JFOB 4Y19D 1DR9A 3I85A 3BDXA 4EVNB 1QFWM 4IOFD 1FSKB 3S35H 2GFBA 4KZDL 4PTUB 1TENA 4U3XA 3EOAB 3BN3B 4M7JH 4X5XB 3ROLA 2R15A 1ZT4A 4XCEB 3L3GB 2YA2A 3GMQA 5T1LA 3T65B 4ZFGH 2XY1A 1J8HB 3HC3H 2QEJA 4QHLA 3P0GB 4YHPB 5E5MA 1IC5L 3BMWA 4PB9H 4Y19A 3RWIA 3HG1B 4S10A 2Z92A 1I3VA 3QUZC 5FOJA 5IK3B 1SYVA 1I8IA 3VXSB 4BFBD 1A6UL 2C1OA 3LD8C 2AK4D 3KWWB 5D7KE 3BGFB 4OZIB 5JTWA 4AEFA 4WI6A 2MQCA 4R0LB 1JHKL 3B2UD 5B38B 4WI7A 2EYRA 5CP7A 5KAQG 4JR9L 4YHKL 5BXFB 1SMAA 2X6MA 4OGYH 4LSUL 1SVZA 4ODTH 2Q8AL 4FFWD 4LLWA 4ODSH 5J06A 2R4RH 4QKXB 3QAZB 4WW2C 5M94B 1QACA 4HAGA 4HC1H 2PXYA 3OG6B 3VFUB 3DROB 2VXQH 3SO5A 4J8RA 4I5BB 1M6OB 3FCTA 4N0YL 2R0WH 3JZ7A 4PRHB 3SDAB 5EU6D 2NY2D 4HFUL 1E28A 3STZA 4ONHA 1GGUA 1FFQA 3L3HB 5CJ8A 1CFNB 5DJ2A 4L3ED 4LGPB 4PJEE 3KR3H 4W4NA 3L5IA 5EO1A 3BP4B 5GRUL 1PW3A 2NZIA 4PJFE 2AJZB 4YGVB 3HE7C 1MVUB 1CLZH 4Y7MA 4MAUL 4UAOC 4PY8J 4JFXB 2FEDC 4GRWH 4ZPVB 5CWSA 2DQIL 2EDWA 4M6NL 5GRVL 5EOQL 1UJ3A 4RRPG 3RKDD 4L9LB 5D70H 4PGCB 5DTFB 1OAKL 4GXUM 2Q7YA 3TVMD 3ZKXB 3BUTA 4C59B 4Y5YC 1WFTA 2EC8A 1XGRA 3V7AE 1KJ2H 1FCCA 4A2LA 5I1KL 3HI1B 4U1KB 1KLUB 4WNQB 3T0ED 4KTEH 4F33B 2M2DA 5HXMA 4QOKE 4WJ5A 4AEHL 3R0NA 3JV6B 3G5YB 4I2XA 3ABZA 3OXRB 5E99L 2VLKB 4TNWK 1R5VB 4JEGB 3HZKA 3BPCB 5AZ2L 1ZWIB 3V0VB 1FV1B 1CFVH 1SVCP 1G6RL 1R6VA 3BGMB 5LVEA 2W9DH 1S7TB 2NNAB 4GAJL 4NZTH 3ZL4H 4JJ5B 3HR5A 4LNRA 3P9MB 5I1JH 1W8OA 4UU9A 1CFSA 2C9AA 3K2MC 3IJSA 3VFPB 4AQOA 3ET9F 3JVGC 3VD3A 1S7QB 3QH3A 3T2NH 3SOBH 5FAAA 3X14B 3F8UB 1JJUA 1FFOB 5IB1A 4RISL 3SKOB 1XIWC 3DO3A 2KQMA 3MRFA 3OAZK 4G43B 1DFBL 4LEXH 1ORQA 1G7LA 2P46B 4NSKB 1CFSB 3CIQA 4GBXD 1DQDH 1KC5H 4NQEE 3TA3A 3G9AB 4IJ3C 5C3TA 4XBPA 5IHUH 3MRBA 5D72H 3UZQA 1CT8A 3QDHA 1KPVB 1A7PL 3ZKQD 5ISZE 1IILE 3MROA 3H9HB 4YDVB 2AJXH 4ZFGL 4LP4A 1JZ7A 3CLEL 1IC5H 5IV2B 2EC9T 3DVGB 5E2WH 1TXKA 2J6EA 3K8MA 3FL7A 4J1UA 3S37H 2NLJB 1OPGH 3D87B 2BVUA 4F7MB 5CUSL 3KLAB 1FNGA 4X7CC 5HGAA 3TO2B 1U42A 2FX9L 2HFTA 4LFHG 2GAZA 2J3SA 3FO2B 3QULB 1Q9KA 3FB7A 1F4WL 2CKBB 1CGXA 4XVUC 3TV3L 3VXTA 2D0GA 3LMJH 4XNUH 4PBXA 4BFGA 1T0MA 4QTIL 4XPBH 1LO3H 3RHWF 3ARGC 3M1BB 1EXUB 2YBRA 3QWRA 1F13A 1J8HE 3SDDD 2WUCL 4JRXB 4XNZC 1I9EA 3V6ZA 1HOCB 3KDMA 5HHQA 5LGHL 3GB7B 3TBTB 5C0NC 3MV01 2HYMA 1TJGH 5ETUA 2CKBL 3P77A 2BSED 3QXWA 4G8GB 4MQ7B 5E4IA 2DBLH 3NCCB 3ARDC 4Y16C 4ZS7H 3TCXA 4M3KB 4UIMA 4QRPE 4JQXC 1Y0LB 3HI6H 4MNGE 4FTVE 4WWID 3W11C 3ZMRA 3HUJA 4HQQH 4K3DH 4LDOB 1DEEA 4P2QB 3ZZ1A 4CW1A 1T7ZA 2H3NA 1KACB 5FO9B 2K7PA 5JO5A 3RAJL 3MRIA 1NL0L 5CGYC 3CFEA 1T2QH 4HGWB 4HBCH 3WLWD 3I3DA 1CTOA 2VLRA 1E6JL 3VE0B 3RGHA 4L4TE 4AJ0A 2Y06H 2GEEA 3BXNB 3FB8A 5T3ZH 1U8NA 4YHYB 2ICWB 3L3JA 4YHLH 4ZOCA 5FF6B 4QRQA 4X6DE 4UT6H 1OAQH 3U7WL 4WTZA 4Z7UB 5ISZD 3EYQD 3SDCD 3V0WL 3SDXA 4XMPL 4LL9A 4JFFA 5D2NA 1BFTA 1C5DB 4LVNB 3HN3A 4S2SA 2OLDA 5EO9B 1VGEL 3H9ZA 3KHOA 3AU1B 4N5UA 1FO0H 4MQSB 1A7NL 1NLBH 1MIMH 4HK3J 4Y4KB 4LARL 5C07B 4U1MA 5CINL 4YZFF 3ROLB 3MFGB 5I1LB 5K9OA 1G6RH 3MACH 1AFVH 1D6VL 4L4VB 4PJXB 5IVXF 3LKNA 2P5WE 4M7ZB 1JWSB 1B0WA 5FIEA 1FLTX 2J8UB 2YRPA 5E9DB 2GJZA 5C0AB 5L2KA 2VLLA 4OD2A 1S7SA 3H9SA 5T3XH 2DIJA 3G9VA 4E9LA 4JREC 4ELMB 4JB9H 2CD0A 2VDLL 2Y4SA 3QEUA 3QO0B 5KSUA 5ADOH 4PRPE 4FZ8L 5FUOL 1MHPH 1XR9B 3NCFB 2WBKA 4I0PB 3ZTNL 4ZUWB 1D6EA 2YA0A 1WAAE 4LCIH 5CJBA 1S8DA 2BNRA 3F12A 1NCTA 3MRCA 1ODAA 2OTPA 3VXNB 4LLYA 3MFFA 1CXIA 5ID1A 3NFSH 3VWKB 2BCKB 2VDMH 3PWUB 4LVHC 3ARED 1J12A 1J05A 4JPKL 3IKCB 3T0EE 1AO7D 1LNUB 4MJIB 3UEZA 1H5BC 3PDGA 2FATL 3D9AH 4HIXL 4JM2B 4ORZC 3V6FA 4P57B 3MXWL 3DUHA 3NABL 4EDWH 2FGWL 1D5XB 3DX9B 4FFZH 3TEUA 4DW2L 2I9TA 2G9HB 5F1KC 4OF3A 1JWUB 1W0VA 5F3BA 3MGOA 5IMMB 5KN5B 4FFVC 1ND0B 3QNXB 3MV9D 3NIFE 1DN0A 3FQNA 2YKLL 4TSAH 5IHLB 4TSBL 1KENL 2FX9H 1AP2A 1KIQB 1PSKL 2HVKA 3BPLB 2NY5L 1N4XL 1A47A 4L3EE 4F7EB 3RNKA 5IB4B 4CRPA 1NGWB 2WW8A 3GSQA 4LSSL 5BRZA 4XPBL 1Q9WB 3IU4L 1M71B 3F7YA 5DA4A 3QWRD 2L7JA 2X9XA 2DQFA 2B4CC 2L4OA 3U1SL 2V2TA 3CD4A 5F89B 3TBYA 2AABL 4ZG1A 1ITCA 1EEZA 1FIGH 5DJZB 1NKOA 3CVIH 4PGEB 1BIHA 2UZIH 2O5ZL 1FVCB 1TZIA 3QG6A 4WO4A 3NIGF 4MS8C 2ZSWB 5E2JA 4KU1A 4P3DA 4HGMA 6FABH 5GS0D 4P4KC 1PZ5A 3ESVF 2Q87A 4E41A 4Z7WF 1MPAL 1T4KB 4WHTA 5DJAB 2LVEA 1C5BH 5C2BH 1BOGA 4PJ9D 5ESQA 2YD1A 3HCVA 5SWZB 4PLNC 3ALPA 1SJVA 2XNAA 3O2DL 5I15H 3GMRB 5I6XB 5I2IB 4A6YL 3SO3C 1X6LA 2EKSA 3HA0A 5T3ZL 5KS9E 5DLMH 4QRUA 3T2OA 1IAIH 1A3RL 3DMMA 4K3JH 1YNLL 4LPXA 2HFFB 3RP1A 3ARVA 2XIDA 1V5JA 4M02A 5CZXC 5GRVK 1G7QB 1CZ8L 2R69L 2BCKA 5EO0B 1MLBA 2ZUWA 4NNYA 4OUUA 3RKPA 4FQCH 1F97A 3B9KD 2CH8A 4POUB 3RVUD 1ZK9A 2A6IA 2BVEA 3CXHK 5JHLH 5A16A 4HJ0C 3DO7B 3KPRD 5D2LF 3ZHDA 1JE6A 5DHVB 1AR2A 4XVSH 1FJ1B 5IROC 2HJLB 2P5ED 4LVOB 4G8EA 3D69A 2YZ8A 1FRGH 3QUZB 4CMMA 1A3QA 2IG2L 1Q1JH 4AEIL 1EFXB 4OGXL 5JZ7D 3GIZL 2DIBA 3NFNA 3WJLA 2FB4L 1YEGH 1T1XA 2HT4C 4E5XA 4N0FA 5IM7B 2F54A 4GQPH 5J1AB 5F7EL 4XRCB 4FQPA 1UEMA 3OB8A 4D9LH 2D7QA 4XNQA 1IAOB 4HS8H 3ZTNH 3MBEC 3TZVD 1T1YB 1A6PA 1Q0XL 1YEJH 1OAXH 1CDYA 1FGVL 3HMWH 4R97B 4IHOA 4ZSOE 4PY7A 1HIML 5FECA 1RQ5A 5GGQH 1HKLH 1HWHB 3OAYK 1TITA 2DI7A 3QJHB 2VDML 1H15A 2GUOA 4Z0XB 4FABH 5KSBF 1NLDH 3EYFA 1QKZL 1SYVB 1SJEA 4FHBD 4FQXC 2BRRH 1Q9OA 1XGRB 1JVKA 4HT1H 4Y8DC 3P4NB 4S1RH 4S1DD 5H8DA 4NCC1 1ED3B 5F9AC 4Q2ZA 5I0ZA 3DOSA 3FFCD 3NIFF 4Y2DD 1PZUB 4MA1C 4WFED 3K2UL 1D7FA 12E8L 4MA3B 4OZIE 2FO4A 2NY0B 4EI5D 5DJYA 1RUPL 1H15B 1SEQH 1RZJH 5MEQB 3MUGB 2ZP0T 1I1AD 1T0PB 3Q3GA 1E6OH 3ULVL 3GM8A 2ADGB 4IHOB 4U33A 2AEQL 1KENH 4DUXA 4PRHD 2VN7A 4E0RB 3PL6C 4X7EC 4C55A 5SX5K 3F65A 4Y16A 3WKNA 3FHQA 5I1CL 5ICYB 1NBZB 1CXLA 5CCKH 1I75A 3SY0A 3O6FB 4UT6L 2R4SH 4FQHB 4PP2B 3VW3L 2M26A 1SY6L 4PRIB 2VWEE 4JFPB 1FNSL 2OXHA 2DLHA 5KBNC 2F74A 3WL9A 1WBZA 1BMGA 1GYAA 1JF1A 3PV6A 5BS0D 4ZQKB 1A3LL 5EC2A 5E8EA 2X4SB 4CNIB 5HGDA 4JZNA 3QUZA 3IDJB 3BQUB 3CFCH 1L0YA 1KCVH 2P1YA 2X4RB 4OZHF 2XFXA 1A4KB 5DRXB 4PJGF 1WJ3A 4RGMB 1XIWA 4Y0GA 3WUWB 3K3QA 1IGJB 2A83B 4U6XA 4LKXB 1WQVT 4DKEH 5C1MB 3BT2L 3G6JA 3PWJB 3KHQA 3PHQB 4XPHL 4D9QE 5C8JA 5IR1B 4MD4B 4WGWB 3HUJE 3N1PC 4WV1B 5DUML 4NJ9H 4F15B 5T3ZD 3GUTB 3H42H 4PG2A 1AO7E 2J1KA 1B0RA 3QDME 2Z31C 1VSCA 2HKFH 2EO1A 3O3BA 4MJ6A 1RJZA 3QO1B 3V5DA 1YDPA 4CU6A 4EXKA 3QJFA 4YWGH 4U0QB 3GSNB 4OZIF 4E41D 1DTUA 3GRWH 5KVEH 1DBBL 1UVQB 4P3WA 5L8JB 4XNYH 3JV4A 4L8BB 4KK8D 2NXZB 5MENA 4HGKC 1F45A 2IBBA 5BVJB 2DTMH 2NY4D 1FBIH 3U6RA 3N1QC 4BZ2H 1SM3L 3U2SA 1QRNA 3WO3B 2YC1A 4I3RL 3G5ZB 4YHNA 3HE6A 1CGTA 3RGVD 1AHWB 4GSDL 5C70A 1RMFL 1BX2A 5DO2D 1L4IA 3B6SB 1MFBH 2LV4A 5DWUH 4ZUTA 4BZYA 1IKNA 5BRZD 5F7EH 3L9RB 1P5VA 1LWRA 4P23C 3STLB 3LKSA 4HS6A 2R0KL 2GT9A 4FTVA 5F6HJ 2APBA 4Q6IA 1I1CA 1XGTA 3EDJA 3VDBA 1RUKH 4NYLA 4L4JA 4YR6A 3A6CL 3RDTA 4OFIA 1T03L 5B4MC 1K8DA 1RJYB 2R4RL 3HS0A 2J8OA 4Z76B 1IQWL 5EOTA 4KMQA 5F96L 2VLJE 4HMDA 4O2CB 3VXNA 5DFVC 4BKLB 3KPNB 5TE7L 3O11A 4H25A 3T3PF 2A6JB 5HGBA 4G80A 3TBVB 1A6ZB 3QQ9D 2EXYD 1ZLUK 2FR4B 1QD0A 1DDHA 4XP5L 2IH1A 4I48A 1WBXB 5C08B 1MIEL 5IFJA 5T3ZE 1D5ZA 3KPOA 2BSTB 3LIZL 4NT6A 5GGVH 3HPLA 4YHYC 4XX1E 3HKFA 4DK6A 4HWBH 1INEH 1J8HA 3WJLC 1R3KA 3W9EB 4NN6C 4DCQA 2JCCB 5I1CH 4ONOA 2YPLE 4K7PY 1KXTB 2JJSA 1XR8A 1CICC 3QEUB 3SKUD 4M5YH 4I5BA 1DLHB 4IIQC 1KJ2B 3AB0B 1ZA3A 2FSEB 3CNKA 5TQ2H 4PTTA 5FHBH 2PXYC 2E7MA 3VI4E 3F7RA 3FQWB 5CEYA 2XA8L 2G75A 2J8UA 4TRPL 4Y4HA 2GJ6E 5FCUL 1IL1B 4JKMA 4IS6B 3DX6B 4Q0XL 1YUHB 4PJDB 2HAZA 1CLOL 4ZD3H 4UT7H 3O6KH 5IFJB 3FO9A 1KPRB 2ESVE 3F6LA 1U8PA 2A74A 2J4WH 3R06B 4RAVA 4V1DA 4Z7VB 5TH2B 1HHHB 3BMVA 2NY3B 4LAJH 1CD0A 2H26B 1KXQE 1AO7B 4MJID 1NBVH 4XB8A 5C0CB 3UTSA 4PJCE 2BY1A 5F6HI 1LO4L 3H9SD 4QOKB 3KJ6H 5GSVA 4F9LC 1NGQH 2OS7A 4XXDA 1AXTH 1I85A 1OGAA 3E3QE 3QEHB 3MRHB 4PRHE 5DD3L 3GSOA 5F6IB 2JELL 1G7HB 3OGOE 2BJMH 3LD8B 4OUOA 3QG7L 4U1JB 3MUY1 1AKJD 3S5LB 1AC0A 3IDGB 1F8TL 4RAVB 5EU4B 4F9LA 2DL2A 2FL5A 3JSSA 5IB5B 3FO9B 1F4AA 2D3VA 3CMOH 4OF6A 1OAXL 4M1CD 4POYA 4P46C 1CE1H 5E9DD 2YZ1A 5GGTA 3LQZB 4EI5C 4JM2C 4KXZH 3TZVC 3PWPA 5F88B 4XWGH 1F6FB 4U1GC 3RJQB 3U9PH 3KLHD 4JY4A 2W91A 4KKLC 4M7LL 5DGQA 4U6YB 3MRJB 1KCRH 1FBIL 3QRFM 1U6AH 3CDFA 1K2DA 4PJXF 5FCSH 5T33L 12E8H 5F89A 3TBYB 1WFOA 2XZCH 4YK4C 3HPLB 3QJHA 4IBLT 3D2UA 3WLBA 5HI4C 3GSNL 3IT8D 4LDEB 3VXRB 2HKHL 1EHNA 1MQKL 4CDGC 5DDHA 2R1YB 3NTCH 2PYFA 4PRPB 1JYWA 5SX4H 1I3GH 1AE6L 5B39G 2WANA 1X6NA 4Q9RH 3QUXA 1LK2B 2HRLA 3SDDA 1K8DB 1RJYA 1CE6B 2VDRH 4S11A 1A6VH 2HT3D 2VTFA 1BZ9B 4WW1A 2XQBH 1MVFA 1ROWA 1YY8B 4QHKJ 4G8GA 1Z5LA 1OTUD 1JGUH 3L9RA 1MJ8L 1OD9A 3GB7A 4P23A 5EBWA 3VG0L 1CFVL 3MSPA 3V6OE 1N26A 3B9KC 1UXWB 4HIEB 4O51A 4JKPH 3MV7A 1OSPH 3TNNA 3QWOA 3BSZL 3ULUD 1KPUB 3DSFL 4JDVA 4MXQC 2DD8L 4MDJA 2EDJA 4Z9KB 1DLFL 5IBUB 1U8IA 4YPGB 5GGRA 1AGBB 2P45B 4JZOA 5JLZB 1NC2A 2ZCHL 5KSAB 4WI5A 1BD2A 4UQ3A 4IOFC 2EO9A 4NM4L 1FAIL 4PJCB 4FQIL 3VXMA 3I6GA 4L8BA 1YY8A 5DHYB 1I7TA 4IRSD 1R5IB 3ZSTA 5GZND 4TVPD 1FH5L 1CLCA 1RZ8A 1EHAA 1R3LA 3Q48A 3GUTA 4U1KA 3KYKH 4QXWA 2PTTA 4JHWL 5DRZB 2MMXA 2AK4E 2ITDB 3MACL 4MAYA 1MAMH 4Z77B 4M6OH 2D7TH 2EIZA 1LO4H 4YHIA 3VD4A 5GGRB 5I1IL 5DHYA 5F71A 3KJ6L 4JVWA 4D9RE 3SGJC 3I50L 4P5TA 4IRJD 5D5MB 4AZ8A 1YEEH 1Q9OB 4HPYH 1QRNE 2GCYA 2DJ4A 3EYFB 2FHCA 5BVPH 2XFXB 1PG7W 5EU7E 4JFQA 3X17A 5INCB 3OWEA 3I3EA 3BRDA 2PO6A 5IB4A 3RNKB 3N9GH 1XT5A 4HKZA 4M1DL 3FQUB 4UUJA 2E5EA 5HHXH 1LEKB 2L7UA 3MRKB 3MC0A 4TUJA 3GKWH 1NGPL 2VJXA 4NGHL 4GW4A 5D1QD 3WFDL 4O9HL 3MRRB 4O4YH 5CWSB 2VZUA 1U8QB 4XTRC 4H26B 3PWNB 4Z7QE 1IGFH 4N0FB 3S37X 2JTDA 4ERSL 4JQIL 4DTGL 4OKDA 4AG4L 3GBML 2J8HA 5CFHA 3B8SA 4ODHH 4Y16B 2I25N 4S1SL 1QEWB 3KYMB 2EDOA 4R0LA 5F9OL 1PVHA 2I07B 3UDWA 3FN0L 2F5BH 4JVPA 4MCZA 2C5DC 4LEOB 3OMZA 1BD2E 3QQ9C 3KJ4C 3DRQB 4OD1L 3C60A 4YZFE 5FM5M 4OF5A 5DMGC 1NC4B 1QFPA 3ZE2E 1I1YB 5JHDE 5D96C 5E6ID 4C56E 1R24A 1GL4B 2FZ3B 3HG1E 2GTWA 1B2WL 1MCKA 1Q38A 2V2XB 3TVMB 1JGEA 1WVZA 1R3IH 5E0QA 3MTRA 2X10A 1UZ6E 1UH3A 2UWEE 4M5YL 1N5AA 3B5TA 3EOYG 4PTUA 4XAWL 1IT9H 1DEDA 1CU4L 5E03A 3VXUA 1RZFL 1XCQA 1JRHI 5I66B 2QKIA 4WUUE 3JV0A 3ARWA 3PP4H 2VDKL 4DUWA 2IC2A 5E5MB 2VB5A 2LQRA 1NANI 1TCRB 4KRPC 5E94A 3H7BB 4YBHA 4WUKL 4Z77A 2PW1B 2VLKD 4YHZH 3C5SB 2UZIL 2K9UA 3MREA 2X70B 1AGCB 5LXGH 1CL7H 4QLRA 4EN3C 2Q86B 1QBAA 2FECI 3HNTH 4WWKD 3K8KA 3KPSA 1KJ3L 3U48A 4PGEA 2F54B 5FGRA 5J1AA 3UC0L 1NH6A 2DD8H 4KMLB 1T5XA 5FYJH 4NNXB 1IKFH 2CDFA 5HVFB 5I15L 3TNNB 3F7PC 1UH2A 2YWZA 3H0TB 1HSBB 3S7GA 3NZ8A 1AJ7H 2EH7L 4IM8A 3V2AR 2F53A 3EOBA 5CEZL 4PV8B 1C08B 3BHBB 1PLGH 4LASH 3QFJB 1A5FL 4HGWA 4RMRA 4HHAB 3C5ZB 3GJEA 3QDGB 3D85A 1CZ8H 2R69H 5IG7A 4F2MB 1BIIA 4NNYB 4PJAF 3WUZA 4LGRB 1FL3A 2NXZC 2W9EL 1V7MH 4DVRH 3CH1A 1ETZA 3MLZH 5IROA 1AQKL 1G7QA 4K8RL 5CBEA 1TQCB 3P9MA 3RA7L 1QR4A 3NPSC 4BSJA 3CFKA 3L6FA 3ROOA 1LD9A 2YRZA 1AGDA 4LBEB 3K4AA 1R3LB 3DVNA 4UINL 1FRGL 5I18L 4OF8A 1IL1A 2AXHA 3HG1D 2XTLA 4J7RA 3HC3L 5I1GH 1NFIA 25C8L 4HJJL 3RPIB 4OLXH 2DRUA 1N6QL 3ULSB 4R2GB 4NC1C 2WINB 3P4LA 5I8CB 5C08A 3LRSA 3PNWA 3Q5YA 4BQBA 1OM3H 1KLUA 5ITBH 5B3JE 3V8CA 2XYCA 5GRYA 2OR9L 4B5EA 1K2DB 1KELL 2P49B 3PABA 3SE8L 1D6EB 1MHHA 3JUYA 4ZTOH 3OHXA 1U8LB 4LSSH 3KYOA 4PREA 2OTWA 3BH8B 3D25B 3SBWA 3ZTJG 2ITCA 4JLRA 5I8CA 3D39A 1S7RB 2IH1B 4I48B 3MRDB 4JAMA 2AK1L 2R39A 1WZKA 2Y6SC 3OKYA 4DAGL 3WMSA 1IM3A 2A6DB 1CD1B 3Q1SH 3RBGA 5CS7A 2V5RA 5IFAH 4YXKH 2IPUG 4QXUH 3E2HC 1JGUL 5T1MB 1FGNL 5HHOE 5I1HL 2IAMD 2V7HA 4MNQE 4HLZH 4RX4A 5IHZA 2X44D 2R56L 3BP7A 4PG2C 1OW0A 2VMFA 1C5BL 2DQIH 5C2BL 1H5BA 3VGAB 3DXAD 4ODXA 4JZJB 3QEGH 2CIIB 2CO6B 3CK0L 5BS0E 3MRFB 3HFMH 2X9YA 3RY4A 5KVGL 3BHBA 4O02H 1CCZA 1X5JA 5HHOD 5IMKB 4HHAA 3L3KB 1CD1A 2KBGA 3VXRA 4GBXC 4LU5H 3W81A 3T0DA 3CAFA 3VW3H 1UB6B 2XZAL 2H26A 1XGQB 2QQKH 4NN5B 1RZGB 3NA9L 2BNUB 1JNLH 1CU4H 4DKFL 3ARUA 1I8IB 1U3HA 1V05A 5IFHH 3IJHB 4ZOBA 1YEDB 4OLYL 3TCLA 2G2RA 5C0RH 1NMBH 1T0NA 1EAJA 1FH5H 2H3NB 3MLVL 1JWMB 3KPSD 5MENB 3VWKD 3DVFA 4WEMB 1FZJA 1XR9A 4G8FA 3EFFA 4HUXB 5D2LA 2QJDA 1S9YA 4M00A 4NZRL 4HF5H 2WINA 1I9RH 3ULVE 3RUGF 4NPYB 2P48B 1EUTA 1UKTA 2X1PA 4PJ7B 1MWAL 5F1NA 3VFWA 3O9WA 3WYRA 1NJ9A 4YDJA 4GRLD 5DUPH 4OGZA 3P73B 3UTTD 2FDBP 1FC1A 1FQ9C 4JRXA 1E4XI 5FGBA 4JG0L 4D9RD 3LS4H 2H32H 4WV1A 5HDQL 3GEWB 4U3CA 2OQJA 4XAKD 5GHWH 4Y4KD 4KROD 1FZJB 3ZYJA 4TULL 3BQUA 4M8VA 1A5FH 1T66C 1RUML 2EXWD 2EXWC 4JO3H 4EN3A 3TPUA 4H25B 4JR9H 4YHKH 5MEOB 1V8HA 5DFVD 4Y2OA 1E4WH 2MHAA 4DN3L 2VNCA 4AM0B 5MENE 4ZODA 2D31B 4HDIB 1R0AH 3ZDZE 4OCSL 3RVWD 1HSAA 5IEKB 1SBSL 1A0QH 2P8PA 4ZYKB 3MA7A 5HD8D 4CADB 5IOPA 3IXAB 4X6CF 2DLGA 4NC0B 1KT2A 1B0GA 1LK3L 5BZWB 1T1YA 3GJFK 5E5UB 4P2QE 1RVFL 2WBJC 5MP6H 1FG2B 3CFEB 5I1AA 4G3YH 2NY0C 1NFDA 1D5MB 4YFLI 3B2VH 5JO5B 1E27B 2PCPB 4JFDA 2F58L 3KPQA 2Y5EA 3VXRE 1WTGT 2DJUA 1H8NA 4NKQB 1RJLA 3QZWB 5JQ6L 5D70L 1G0YR 5CLWA 1G7LB 1F11B 1JHTB 2R0KH 1KT2B 3MRNB 3GSRB 1RUQL 2LAAA 3C9NB 4BSVB 4GW1A 3MA7B 4U1HB 1X4YA 3BI9X 1GGCL 1U92B 3DLQR 5GS1C 2UY6A 3ZT6A 1JPSL 5E8OA 2Q7NA 3RUGB 1NBYA 5KS9F 2ITCB 2DMKA 2LABA 2EH8L 5C0DB 4WI8A 3G5ZA 5DMKB 5JR1H 3B9KB 2A6JA 5J6GB 4MJ6B 1N5YL 2BOCA 2IADB 1MELA 3BPNB 4P2OA 1EPFA 5JQHC 4LLVB 5EC1A 3KLAA 5HGAB 4OM1L 5GZNC 4C56D 2B2XL 2IAMC 4BFIA 2JB6A 4MWFA 4X80L 5BV7B 1OARH 4G5ZL 4N68A 3KYMA 1MFAL 3EOTH 4NQCB 2W0FA 4TUOB 1I4FA 5T5FH 3AS0A 3JWNC 5EIQA 1OY3B 4PJ5E 4KKCC 4F15C 1UWXH 4RMSA 5J6HA 1GGYA 5BV7L 5KANI 4XMPH 3T1WA 1BM3L 2Q7YB 3VG9C 4Z7NF 5C0IA 5I8OH 1VFUA 5DQDL 4HUNB 1UA6L 1KPUA 3QA3B 4GRMB 4C56A 1YEKH 4HKZB 4OFYA 5EIVA 1G7IB 1NLBL 5D7IF 1FVEB 4XVJL 1FFOA 3BISA 3PGDB 1Z2KA 4K3EH 5FV2A 3F62A 5L0QC 3V5HB 2YK1H 4K94H 5TFSH 4CNIA 4FP8L 2HVKB 5CEXB 3D6GA 4U7MA 2DF3A 3FCTB 3HRZA 1ERNA 1U9KA 5EZIH 3TH4T 3U36B 5D9SB 4UU9B 3GSXA 4M6MH 3NBNA 5ENWA 3BUYA 5J6HB 1OPGL 3O8XC 2QQQA 3HR5B 2ICWI 3GO1H 5JA8B 3D3VE 2B7DT 4QRSB 1LK2A 1F8TH 4MD5A 3INUL 4GW5B 5BO1L 5FUCE 2YN3A 5D1XA 1BFVL 3U46B 3MODL 4E0RA 2A6DA 4KDVA 1FHGA 1XF3B 4HX1A 5GS0H 4WFGE 3MQIA 2XKNB 1MFDH 1JF6A 4RIRA 2CJUL 2YXMA 1YNTB 1DVFA 2EEAA 3FN9A 4LSVL 4ODBD 3LSOB 2AK1H 2V5MA 4XC1L 3TIEA 1BHGA 1WFUA 1QBML 1A0QL 1AIFB 5I1EL 3GIVB 1K4CA 3I75A 1C1EL 4YXKL 3RWIB 3QXUA 3N85L 4UQ2A 5BS0B 1IRAY 2CIKA 1A64A 2VIRA 3IDXH 4IDLA 4UDTA 2ERJC 5FGCB 5BJTA 3OKOA 4ZQKA 3MRJA 4ZFOB 1FG9C 2BC4A 1INQB 4XH2B 4FMKA 4WHDA 5FECB 2JK5B 2HTKD 2HTKC 5E9DA 1M4KA 3ARBC 5D7SH 4KZEL 1KG0A 4LLQA 3MNWB 4Y5VC 5I8KH 5FYKD 3H3PL 3L3HA 3SDAA 3DX8A 1RZIA 3B83A 1BBJB 5AWNH 1F6AA 2LFGA 3QUML 4KRNA 2QBWA 4DGYL 2Z93B 5I1AB 3B9EA 3TIDB 1QSEE 2BNQD 3F12B 3RQ3A 5D7JB 4XCFL 3O3AB 4BK4A 3QFJA 3TYGL 3OKEA 4LCUA 4PV8A 3SN6N 5JZ7C 4L8SC 3LCYA 3U83A 5J9PA 1LO0H 3KWWA 1LE5A 4ODVH 1DANT 4G8EB 2NY3C 4D0DB 4APQC 5FYJE 4KROC 1VKXB 4OCMC 5B39B 4LGSB 2PO6B 2YD4A 3H8NA 4YXHL 3QQ3A 1BJ1H 3VCLB 1UACH 1GIGL 3IFLH 1F90H 5JW3L 1FYTA 3IU3A 3P11L 4CW1B 4JFEE 1F6AB 2Z91A 1U95A 3VXOA 1LEGB 1IGYA 1KB5H 1ZMYA 1KEMH 2DIAA 1EGJA 2BX5A 1ZLWH 2ZWLT 4LRNL 2BXYA 4GAYB 4HLJA 4KKCD 4GG6B 5I74C 3UTZA 3VH8B 1TQCC 4M4PA 3KAAA 3QIWC 3DBXA 2R9HC 2JCCA 4P46B 2V7NA 5E6YA 2E8YA 5I8OL 1P69B 4EI5B 2OI9B 3DV4A 3R4DA 4TTGA 1QLFB 3HB3C 5DD6B 4KV5F 4JY5L 3QQ3B 5SV4A 3RPKA 4R3SB 1TNNA 4Z7WE 1S7RA 1MRCL 5L8KB 2NW3B 4EIZC 3OKOB 3ILQD 5IVNA 2ID5A 4HK0A 1U6AL 3PWPE 4PP1C 4QRPA 4R2GC 4O2CA 4KKNA 4AMKH 3S9DB 5C92A 5HYIA 3O11B 1T2XA 4UOW1 4R7NA 3MXVH 4LIQE 2IMNA 3OPZL 5EOTB 2XZCL 4Z76A 1LQSR 5CLTA 3C60C 4NBZB 5C09A 3GHEL 2IANA 4FQXD 3BP6A 2O26U 1BP3B 3MJ9L 2HFFA 4I77H 3AC0A 5JQ6H 2O61B 3EZ8A 4R0LC 3EO9H 4LLMA 3EW3B 4X6CE 2D4FA 4LDLB 4MNGB 3QUKA 3RWCA 3O81A 1OTSD 1T1WA 4WY7L 3H9HA 2H32A 3QXDA 1H5BB 4X4YB 5FYKU 1A6WL 1CT8B 2HWZL 4O5LL 3U9UB 3RWEB 5IHZB 3K4DA 4HWZB 4G9FA 5EZOH 3ZE0F 3MCG1 5C0GA 3CPLA 3BP6B 3PWUA 3HRZB 5GPRA 3SDAC 3C5JB 2NZ9C 1BX2B 2R2EB 3O2WH 4AH2A 4V1DE 1ZLSL 4HPOL 4YBQC 3VRIA 1WC7A 4JCMA 1Z9MA 1PQZA 5DDHB 3VGAC 4UTBH 4OGAC 2VQUA 1K4CB 3LVEA 4HJGB 4MDIA 5D8JH 2EE9A 4R90H 3NCMA 3T4AB 3FT3A 1KCLA 2VH5L 5GJTH 5IQ9B 1NCDL 5FHAH 4KK5D 5CD5C 1B0RB 4N8VB 5KSAC 5I8KL 1TQBC 3FQXB 2XN9E 4RRPA 5EG6C 1NCCL 3QDJB 3N1FC 2A9NL 1Z3GL 1YNLH 5ANME 4H1LA 5BMFL 3WXVH 1U8HA 3TA3B 4TNVF 5EBMB 3IAGC 1A2YB 5ISZB 3EAKA 2I5YH 4U7SA 5LG1A 4NQCA 3AM8C 3QPQC 4ZTPH 5K9KA 4O2FB 4KC3B 4NQEA 1U58B 4EUPB 3DNKA 3NCYS 3IDIA 4UILH 2GSIB 3FB5A 4AYFA 1LD9B 2DQHL 3LS5L 5I71B 3HZYB 5EBLA 2BHYA 4HG4J 2VO5A 1VKXA 4KHTH 2UY7A 2XG5A 2V2XA 2C3VA 2IANB 4KVCH 3S34L 5TF1L 1AHWA 2XZZA 4WU5B 1II4E 1J0IA 2GTZB 5EZIL 4JPIA 1AY1L 5HGHA 5DMJB 3AS2A 3QAZC 4JFXA 4V2CB 3O3EB 4AT6A 3H7LA 4S0SD 1GZQA 2W0PA 1ZT7B 2EDQA 1JHKH 4BUGA 3GSVB 5DD6A 2ARJB 3ZE2F 3ARFB 1EBAA 4PJAE 2WLYA 1C7SA 3QZWA 1RJLB 2CJUH 2V7NB 1KBGL 5LCVH 1GCFA 4LSVH 1CS6A 2ESVB 3QIUA 4LLAA 2PF6A 4RAUB 1CG9A 4E42A 2PCPA 4JFDB 4GAYA 4NHCH 3LEVH 3I6KA 3FTGB 4Y2DC 3WNNA 3DARA 5K59E 1F4YL 4G6JH 5IVZA 5HI4D 2X4PB 4NWUH 4UUJB 4NCC2 1YMHB 5E08H 5TE4L 1RSFA 4WJ5B 1R3KB 3VDAA 4TUKL 4LHUB 3W9EA 5C0DA 4UT9H 3MRLA 1YEIL 3KPTA 5INDB 1ORSB 5KTEL 1P7KA 1WZMA 3SDCB 4TYUA 3C6LB 3SDXB 1AIFA 15C8L 3DWTA 3C60D 4AM0A 2RAMA 3SQOH 3MO1B 4ZO9A 5D7SL 1U8NB 3QQ4B 3FOMA 3FT2B 4NQTA 3SDYH 3WNOA 1IAOA 1QO3A 1ZVHA 4HCRA 4KV5E 4ZTOL 1U8JB 2R23B 2O5XH 4MD5B 4P2QD 1DE4A 5IM7A 4PR5A 1E27A 5ITFA 2BHUA 1QSFD 2W0KA 2DQJH 2C4FU 3QCVL 1IEAA 3O2WL 4NQUA 1DQQA 1VB9A 4WVRA 2UUDK 4NPYA 4Y4FA 1TJGL 1N2RA 1IC4H 4AIXA 3IDGA 4U1SA 4KTDL 1UG9A 4H5SA 4XMLL 2YD3A 3AY4A 2YPKA 4F57L 4OFYD 1FYTD 3QXAA 1IEBB 2IPTL 3JWDH 4K3DL 32C2B 1OB1A 4NQDA 5F7KC 1FC2D 3TPUB 4HS3B 4XCYA 2G60H 2D03L 2YPLD 5FHAL 3U7YL 3BWUC 5FGCE 5TQ0L 3SKJL 7FABL 1BQHA 3CGTA 5D2LE 3OQ3B 2VLKE 1Q9KB 5CKAA 1IMHC 1KN2H 3MV7E 5DK2B 2PTTB 3CX5J 1DQLL 3FFCE 4G7YH 4H20H 4JM2D 3LKRA 3G6AB 2H2PD 2LU3A 5CJXA 2FX7L 5HYJD 4O2FA 2MKWA 4AEEA 3T0AA 1MHEB 4HG4K 3U4AA 1HZHH 3IFPA 4DVRL 4UOW0 4K8RH 1CDIA 2H1PH 4OLYH 4UZGA 1YQ2A 1U2HA 3SDXF 1QZ1A 1U8HB 1U91B 4GW5A 4Q9QH 4YH6A 3S4SA 4WO4D 4LHJB 1OP5K 1CLYL 5KSAA 2W1NA 3FQXA 3VRJB 4NZRH 4XZUB 4J6RH 4I3SL 5TF1H 3CLEH 1VERA 4AQ1B 5KVDH 2ENSA 5E2WL 2W60A 2NXYD 4TVPH 3MGTA 1JTTA 5FYLE 5DJDB 3UYPA 4KTYA 3IDYB 1D5IL 2FR4A 3QISA 3B9AA 4XNZB 1MCOL 3QI9B 4M1GL 5DHVA 1T20A 4U1HA 4YGVA 4WI4A 5E6IB 1VA9A 1QA9A 1JHLL 2FBJH 1RZ7L 1RZKC 1W72A 1MCHA 1U3HC 2XTJE 3MRQA 1OTSC 1Z9LA 1ZHNA 4JJ5A 5C0GB 5ID0B 35C8L 3FHAA 2BFVH 3FFDA 3EIFA 4DEPC 3Q1SL 5GQBA 4PRIA 4C58B 4UB0H 4PJFF 1BQLH 4HIXH 5H37G 5D1QC 4DZ8B 5E08L 3MLRH 3TJEH 3BN9C 2DL9A 3S3SA 1BWMA 5CILL 4Z8FL 1Y18B 1A1OA 4JRWA 2DI9A 4J8RB 4OQTH 4W4OA 1EO8H 4OZIA 2CSPA 2JB6B 2NY0D 1UQSB 4YDLC 4OF7A 1X5YA 5GISH 3HE6B 4PJ8D 4JZJC 4PRNB 4H0HB 2P7TA 4TSAL 4MAYD 2AV7A 2YN5A 5MEOA 3UTSB 2BSRA 4PJHA 2R8SH 3SJVB 3BAEH 3CSBA 3FONB 2VABB 3S36X 5F9WC 4K9EC 1WLHA 1HSBA 2A9NH 1NBYB 3G6JF 3RJDA 3OGCB 4LSRH 5D7LB 4R4ND 3WXVL 1EMTL 2FRGP 1M71A 5FGSA 5DVLA 2XOTA 1YYLL 1IEHA 1MF2H 9CGTA 4YHML 2NQCA 3LEYL 2YXFA 4PR5B 1OLLA 1EHLL 1VPOH 1A1MA 3UTZB 3VH8A 2EDKA 3BQUD 1A7RH 3ARYA 3BEWB 2XPGB 4M43L 1NUFA 3PWPB 5F88A 4NRXB 4P3CH 1LMKA 1MNUL 2HJKA 3PGCA 2DQCL 3MLWL 1RK1A 1I85C 4G5ZH 4PG9B 3QCTL 4WCYL 1UM5H 3ZKMD 3S97C 4KGLA 3VXUB 2I9TB 2VR4A 3VWKC 2DWDB 4APQA 2HJFA 3L7EA 1JMZA 2VXSL 4JZNB 4GG6E 2XWBB 5I30L 3OJMB 4MNHB 2H2PC 5EC2B 1H3UA 1JK8A 3BKJL 3QIWD 3QUMB 4OBRA 4I3GA 4RNRA 4NQED 2H45A 4QOKA 2Y36H 5SWQB 3AGVA 5F93C 1TDQA 3U7AA 1U8OB 3QPXL 5ESVB 4BQ8A 4YLQT 1PKQE 1P2CA 5JPMA 1ZT4B 2B0SL 2R0WL 1EDQA 1G9NH 5MHSD 1P1ZA 1RURH 4IIQA 1S7WA 3B9DA 4P4RA 4ZXBD 4WFFE 3NABH 1AGEA 1JZ6A 4I4WA 1A7QH 5D7IE 3TJHD 4N8PA 4TUKH 2ADGA 1CF8L 3L1OH 4WHCA 3W9DB 1YEIH 3V6ZB 4K07A 5L7XH 2EDHA 1INQA 4QT5A 3K4ZA 1IM3B 4GAGH 4JHAH 2F58H 3BRFA 4K8RC 5EOQH 5HPMA 4U6HB 3CX2A 1PZ5B 2X4TA 1A6UH 3GSNH 5KAQF 4XVUD 1DDHB 2AJUH 5D6DC 1MCOH 2E7BA 4WU5A 4TSBH 2YUXA 1Y6NR 2FHFA 2R0ZL 1PSKH 4EUPG 1IGTA 4GKSB 5DR5H 5EU6E 1RK0B 1A21A 4S0TD 1MHCA 4P4KA 3IDNA 4NRYA 2ADIB 1KGCD 1RZ7H 4TN9A 4LIQL 5FB8B 3PQYA 2NLJA 2ZUUA 4NKMA 3DX7B 3A67L 4FQXB 1I1AB 1XGQA 4AEHH 1DVFC 1QLEL 3ZO0A 4EKXA 4F7MA 2DQJL 3DUSA 1QSEA 3LRHA 3RHWK 1QLRA 4UB0L 3LZFH 3O0RH 1FIEA 3WKMH 1QNZH 1IC4L 4HS6B 1T5WA 3BPNC 2XA3A 4ODHL 1HQ4B 1MRDL 3IFOB 3LKSB 2M8XA 3FTGA 3O4OB 1T89A 2A9ML 2WUBL 1A1NA 2OSLA 2DLTA 4K3HA 5JHDA 2ATPB 3QIUD 4E5XB 3WN5C 4FXGA 1JTPA 3GSUB 3JWOL 3MRMA 4M6NH 4Y1AA 1QTYT 1OD7A 4ZAKA 1P5UA 1DQTA 1ORQB 3G6JE 3MRKA 3NIDF 1FYHB 4P49A 4RWYH 4LFHD 3ZDYE 1J11A 4WI3A 3O6FD 5IG7B 5C0EA 1QRND 1WCQA 2O93L 2H2SD 3LKQA 3L3DA 3PXHA 4OZGE 3G6AA 3LKRB 2F53D 4XPGH 4P5MA 3V6FB 1IAIL 3SGKA 2HLFC 1KEGL 5A16B 3DO7A 2OJEB 1ZGLB 5F44A 5A2LH 1ZHBA 1XF5B 2YD2A 3JV4B 4PJIB 2GCYB 3BJ91 1SYSA 2E9JA 3U79A 4OFPA 1MF2L 3NCYP 1JP5A 2R1XB 3AAZA 3OKNA 3PP3K 5IKCB 2AV1A 1FP5A 4FXGB 4WUKH 3BGMA 3QIWA 3T77B 1SQ2N 1OL0A 5D1ZC 3F6IA 4GXVL 4WWKB 3SE3A 3DYMA 3QYCA 3PXJA 2QQNL 5DD5L 2VLKA 1Z5LB 1DQJA 3BPCA 2A2QT 1GGIH 1CQKA 2C26A 1BZ9A 4GLRI 5SX4I 4TPRH 3QNZA 1U3HD 3S37L 2H6PA 4OLWL 4HPYL 3MA9H 5DO2C 3MV11 1BQHG 5JXAL 4JPVL 1S7UA 5CHNB 2IAMA 3QCUH 5CGTA 5EC1B 2ZSVB 2VAAA 5SV3A 5C0AE 2FD6H 4PJEA 3PUCA 4X83A 3T2PA 4Q97A 4F7CA 1TVBA 2B1AL 4MJ2A 1AGBA 2CLRB 4L8DA 2DYPD 4U6VL 4Z7WB 4JM4H 1JGDA 1RHHA 5DTFA 2YD8A 4MA1B 5DZLA 5J0BA 1KLGA 1NGPH 4YWGL 2WUCH 4ODSL 1I1YA 2IBZY 2VQ1A 1DQDL 1MEXL 2MTPA 2UV3A 3ARDB 3PL6A 1J10A 4EI5A 1NFDF 4CL7A 2Z0BA 2NPLX 2IJ0C 1YJDC 4XCCL 1WC7B 4GW1B 1VEPA 4UINH 2ZJSH 4YBLC 5IWLC 2CK2A 3C9NA 4NM8H 2BP3A 3QP3A 1GZPB 4EBQL 4JHBA 1IEAB 5GJSH 5ILTH 3MRMB 3V7MA 2F5BL 2QQLL 3K8LA 3HE7D 1SEQL 3PDDA 1EO5A 2HVJA 4IDJH 3MBEA 1JYXA 3D39D 2NZ9D 3SHSA 2FWOA 1FORH 1JPST 2HLAA 2Y5TA 3BESR 1MCWM 4I77L 2V17L 3ARBB 4X0KB 2VLRE 5L2JB 4OZ4B 2F8VA 1K8IB 3UTQB 3HZVA 3QEQD 5DK3A 1S7WB 1MJUL 5BZWA 1KJ2L 2X4NB 2X42A 4J3SA 5C08D 1KCUL 2P8LB 4P9HC 5IJKA 3A67H 3D2UB 4FXKA 5SWZE 4QOKD 4DGYH 1DZBA 3CDCA 3BH9B 4R26L 2CDEB 4WTWA 4PY7B 1EXUA 4NRYB 2AEPL 4R4NC 4XMKL 3TT1H 3HG1A 1EAPA 3C2AH 1QNZL 3VXPB 3H2WA 1U8KA 4XBGB 3NZHH 3O9WC 1MI5E 3BKML 1HK6A 4WV1C 3T8XB 2OQJB 4OZFB 4R7DA 1JGLH 1YN6B 5ALBL 3RL1A 4LCCC 3RI5K 4JFOA 2ORBH 5K93A 1QSFB 1JZ4A 4XP4L 2MFNA 3IAQA 4HIIB 3O3DB 4HWBL 5HHNA 2WNGA 3SOBL 3LKOA 5IW6B 1N6VA 1XGYH 3VXMD 5JORA 1CICB 2Z31D 1NANH 2VISA 3GI8L 1YY9C 2JCCF 2X4OA 4NJ9L 3PWLA 4KI1A 1BD2D 1FVCA 1JYNA 3MLSH 5JPMB 3MLPA 3O6ML 1NC2D 2Q76A 4YEFA 1E4KA 3MRBB 1EEZB 5DJZA 2C1PA 5EN2A 4JHZA 5D2NB 1F3DJ 4YNYA 4PJFA 5C0AD 1T7VA 3GMOA 3ILPA 2DQEH 2X05A 2LTQB 2D2OA 4PJ9A 3ULVC 1N64H 5EOCL 3SE3C 4L1HA 4U4BA 5FCUH 1MWAA 4TQEH 3MUJA 5KSVA 3RA7H 1W2KT 5J57B 3MPCA 3S35X 2XN9A 1MAKA 2NY5C 4HX1B 3MRGA 4N0UB 5ICZB 1RU9L 5TJWK 4OAWA 1HKFA 2XNAB 1KIQA 4AH2B 3ILQC 4JO4H 4Z0BH 4ZXBC 2VDOL 5HHVH 1AY1H 3EBAA 1DL7H 4HKJA 4L1DA 1F4XH 2YKLH 1JN6B 5DD1L 3JVGA 1Y18A 2APVA 4LSDA 2FD6L 2VL5B 1KN4H 4EIGB 1HWGB 4DZ8A 2FO1A 1CXHA 3NPSB 4P2OD 4OI9A 5GGSA 4GKZB 1I1FA 2BOBB 4UBDD 4DEPB 4K7PH 3MOBL 5FUZL 5D1QB 5HY9B 4R4BA 1MCRA 5C09B 3BP5B 4PJHE 1H3VA 4HUUA 1HINH 1YC7A 1IAII 1HH9B 3L5XL 4NDMB 3CVIL 3EGSB 3FMGL 2PW2B 4JZOB 4P4KB 4JDTL 3O8XA 2YD7A 1RVFH 2B4CL 3AXLB 4FZEL 4Y5XB 3FN3A 4YQXL 5HY9A 4HKBA 2FJGA 4BZ1H 2OR8A 3O3DA 3PWPD 1ND0A 3MV9A 2XRAH 5A3ID 5IMMA 1ZAGA 2CQVA 3O2DH 3MLYL 5F9WB 4PGBB 1WT5A 4OCLC 4DKDC 4HBCL 5KVGH 3D0VA 3LOWA 2BXZA 1LDSA 4LAQH 2FL5B 4HMCA 5IB5A 3V8OA 1KUMA 5B8CA 3BPOB 2O61A 2RCSH 1AKJA 2W92A 1MCQA 4BH7B 1O7SA 3TA3C 4WHYH 2Z8SA 1NFKA 1TETL 1WIUA 1WITA 1WZLA 2DLFH 3PWJA 4M61B 1EAPB 3CH8A 2PYEB 1YEHL 3DIFB 4OZGB 5FO8B 5MI0C 4DKAA 1NMBL 5KSAD 1CGSH 4OAWB 4P5MB 2CGRL 3OAUL 4HW6A 3ZLQC 3EZJB 4MJIA 1K3ZA 3O6LL 1XGUB 3DPBA 4K9EH 4P59L 1W0WB 1F58H 2FH8A 4TTDD 3RL2A 3JUZA 2HJFB 1C5CL 1J0JA 3VWKA 4GRWE 6FABL 5IQ7H 2YPVH 4LPUA 5GRXG 5E8EB 1F11A 3ULUL 1Q94B 2UZYB 1OSPL 3X11B 4D3CL 3DV4B 3PV6B 1HQRB 1OGAD 2APXA 5IVXE 5K9QG 5MHSE 2HN7B 1G1YA 4OLWH 3HAEB 4PRBA 4JDZA 2RJMA 1FZMA 4L5FL 1L9MA 2I9LB 5K9JL 4EUPH 3BWAB 4M48L 1AGCA 1QRKA 3UYRL 4D9LL 2AS5M 4FQ2H 1DQLH 1R5VA 1CXKA 3CSPA 5JDSA 5IW6A 2EDRA 3UPCA 1I7UB 3G6JB 5ETUB 3UBXB 2XV6B 1HZHL 4X9HA 4DN3H 3DV6A 4HC1L 1S5IL 4Y5YA 1N64L 3G08A 4JANB 5EOCH 1A4KA 3LEVL 4KKBC 5DJYB 4LPTA 3V95A 3FQRA 3QWQB 4Q9QL 1BVZA 4PJBA 5HJ3B 3LRGA 5BJTB 1VFAA 4RMVA 4KJYB 2B1HL 1BQHB 5BQ7A 4JGMA 1AD0B 4PGCA 1GC1H 1LEIB 1NC4A 2AV7B 3GIZH 3GHBL 3BEVB 2ZOLB 4JO4L 1BGXH 1I7RB 4XCNA 1DBKL 4Z0BL 5T5NF 3KYNA 2AVGA 2JIXB 1IBGL 2YRLA 5IVXA 4R2GD 1U93B 4QXGH 2I60L 3SGEI 2EECA 2HKHH 3I9GL 5ICXB 5EU6B 5BO1H 5J13B 2PR4L 4K2UL 4M1DH 1PJ9A 3L95A 1MJUH 4OZFH 1S9VA 3OKLB 4WFEE 3ESUF 1KTLB 3ZYOA 3FFDB 3CLFH 2EE2A 2A6KB 2JF1A 5FUZH 3HAEH 1HHJB 4O4YL 2Z8WC 4KGJA 1I8LC 4LQFL 4YDIL 2EYTB 3B6SA 2BNRD 2VZVA 1DBML 4MXVE 4HULB 3EYQC 3RTQB 5J12B 3DXAE 3WIHH 4KKAC 2CIKB 3VXTB 5DMGD 1VFBA 2FGZA 3NZHL 1U93A 4CU8A 2HJLA 5FK9A 3EYOB 2D31A 1Z9OA 4JFED 1I8MA 1P7QD 3HPJA 4HH8A 1NDGB 2E8ZA 3FB5B 3P9LB 2ZUTA 1P7KB 4FMFA 3VFOA 1Q9LB 4G42B 1S9KC 4P5TC 3DSFH 1GRWA 1TJHL 3PV7A 5GS1B 1YDPB 3WEXB 4WTZG 5T5FL 3KNBB 4YFLF 3KPNA 4F58H 2E6PA 4JRYB 4RDQG 4LAQL 5CCKL 4I18A 1FFPB 1HQ4A 3IFOA 1YPZA 2IBZX 3TNMA 3IKKA 4HH9B 2JE8A 1MUJB 1S7UB 3QNZB 4I2XB 3TA3D 3EYUL 3ES6B 4HWEH 3VWJC 3PHOA 2L0DA 3LEYH 4JQVA 4LRIC 1CIDA 2GITB 3KPRE 1ZV5A 1A7PH 2QADB 1JBJA 5CJXC 3MZGB 3MNZA 1P9MA 3O6LH 3KYKL 1AHWC 4K23L 4M43H 1SM3H 4ZUTB 1A6TA 4IRJC 3WFBH 4XT1C 2AXFB 3KNBA 1TVHA 4N9OB 3WHE0 1V3LA 4HLZG 3IJSB 1RIUL 3VFPA 1WEJH 2E9WA 3E3QC 2YUVA 1PG7X 3I50H 4FS0A 5LQBH 5EUKA 2BNUA 1YEGL 1L7IL 1BPVA 4U6HA 4MVBD 4PRDB 5DWUL 1T22A 5CD3B 3DI3B 4GOSA 4XPHH 5IB1B 3HMXH 3U9UA 3TT3L 5DJ0A 4RISH 5KSBB 1MI5D 2PTVA 3O6FA 3K80A 2X89D 5SWSE 4EXPX 1NMAL 1AP2B 2JKXA 3LQAC 5IESL 4JVUA 4X7FC 5IMLB 3GSNA 3ZTJH 3UPRB 3CPLB 3GDBA 3EO0B 4D0CB 3IYLW 4RA0C 5C6TH 5GGQL 2MPAL 5DVKA 4NQSA 3DYPA 5I17A 4GKOA 1HXMA 2IQ9L 4P3DB 3B43A 2OSLB 3CUPB 3NCEB 1J0KA 2RBLA 1C1EH 5BXFA 3FMGH 5D96B 3N85H 3O8XB 1DUYA 4JDTH 2VE6A 4HIHB 5DD0H 4LCWA 1QR1B 1KV3A 2BSSA 4S1SH 4PJGB 3QB7C 5FXCH 3D3VD 3FT3B 3IKCA 2DWDA 2EE3A 2ENYA 4MDIB 2OBGA 1IBGH 4OLUL 3MJ9H 4NCDA 1BZQK 3PQYD 2QL1A 2FIKA 3G5VB 3PIQA 1UM4L 3MLYH 4PJBE 1BZ7B 3BP4A 2ADIA 1RZKH 1IGTB 3CMGA 4M8QA 2DM4A 4RZCB 4QTHA 3ULUC 3KPSB 5MEND 4HUWB 3SE8H 2Y1VA 1CR9L 3RY6C 4MA7L 4HUVA 5EZJA 4PY8I 2RCSL 1ZTXH 4JY4B 2DDQH 3B5HA 2LU4A 2VR5A 2MQ3A 1U2CA 4KAQH 3X3GH 1IGYB 1ZGLM 1OP5H 4HIIA 4NOBA 5KN5A 3W9DA 3LB6C 4TRPH 3D85D 4P46A 4Q0XH 3UO1L 4Z5RB 1YY9D 2HG5A 1FO0L 4PLJC 1AQDA 2FX8H 1JUFB 1A7NH 5E99H 3DVNB 2CKBH 1N7ML 4N0UE 4AY0A 4NO3B 4FNLH 1FGNH 3CFKB 4K9EL 3WDIA 4U3HA 4GMTL 3RWGB 2Q3ZA 2ZUQB 4P99A 1KIRA 2ATKB 2UWEA 1IAMA 4P0DA 4U1JA 3S5LA 4NZTL 1H8OA 5BW7C 1MWAB 3O3EA 3V7AG 2YS4A 1M1SA 2R2HA 3C5ZC 4HMEA 1MLCB 1AXTL 2O5YL 2KZWA 4LPCA 4U1NA 3W0WA 3UCRA 2BY3A 4XP9H 2YOCA 3MRGB 4JB9L 5ICZA 2YPLB 1EH9A 3GMQB 5T1LB 4ZUUA 1E6JH 1T04B 5DUMH 1KIRB 2ATKA 3MCLL 4QY8B 5J9PB 1MOEA 4QNPE 3BXNA 5I30H 1Z3GH 4GRWF 2BNQA 1CE1L 1UFUA 3ZKND 1R5WA 1YUHA 4BH8A 5CP3H 4KJWC 4Y4HB 5J7CC 4RGOH 2CUMA 4G9DB 2FSEA 1QVOB 5TDOA 1OT2A 3U4BL 3MLTB 1GAFL 2AI0H 1QSVA 4XNYL 4FQJH 4UV7H 4P48A 4WW2F 2J4WL 4XHJC 1B4JL 4U1MB 3MXWH 2YMXH 4FQ1L 3C8HA 5M7QA 1J0HA 1WFNA 3H7BA 3EDDA 5JIIA 3BD5A 4KFZC 4AMKL 3MO1A 1GC1L 1N59B 2ZCKL 1NGQL 2X40A 4X5LA 3MR9B 4YGAB 4F7PB 5TF0A 4JHAL 5JXAH 1VFOA 2FJHB 4XVTH 2FJGB 4JN2B 2P8LA 1IAKB 3B3IA 1MCSA 4XNMB 4HJGA 1FZOB 4XB7A 2OTWB 3BH8A 3K1DA 1OM3L 2JLLA 3ZSSA 4MZ3A 4NO0B 3VXQA 4M7KL 1A6AB 3L3KA 4FZ8H 4WRLA 4L3AA 2EIZB 3C2SA 4YHIB 5JW4R 2VLRB 4GG6F 4MAYB 5DHVH 4M62L 3CMOL 4WY7H 4PRNA 5JOPD 1REIA 2XKUA 1CL7I 1MFEL 1UQSA 3CUPA 4XPAH 4IMKC 2ESVA 1H0DA 4FQLL 1JPGB 3MNVA 3E6HB 1S7XA 3FQTA 4HKJB 1IM9A 3DX8B 4W70A 3U9PL 5D9SA 4OV5B 2AABH 4ETYA 1GZPA 1OWRM 3O0RL 4FTVB 4DGIH 4HK3N 3WIFA 4GH7B 4NM8L 5C0BD 3CXDL 3DTXB 3DX9A 4NHUA 2W0LA 4Q58C 4QF1A 2HH0L 2FWOB 4DUVA 2NTFB 4G3YL 3WNPA 2XWTA 3HI5L 2VLJB 4WUUB 1EEYA 1M7DB 4XPFL 4NSKA 2P44B 1RY7B 1KLGB 2EDNA 2V2WB 2B20A 4HUWA 2FEEL 1JGDB 4X6DF 2V17H 2A0LC 1JGVL 2E6QA 4X8XA 4UOJA 1NAKL 1NCBH 1U8MB 3BZEB 5DLML 3I75B 3F5WB 3GIVA 4C56B 3WFCL 2DQFB 1Q72H 1J0ZA 1S7QA 3R1GL 4Q6YA 3K74B 1QPXA 4M93B 5DI8A 3AREA 3X13A 4RMUA 1XF4B 5IFHL 4YAQB 5JUEH 1D9KD 4KDWA 3V5KB 3VRJA 3PE9A 3V5DB 4XMKH 3TT1L 5E2TH 1WSST 3DBXB 1FL6B 2GJJA 3UTSD 2P5EA 3DVIA 2NYYC 3T1FA 5ADPL 1YPZB 4XXCA 2QSTA 3BKMH 2E27L 2XZQH 4AIOA 1G9EA 8CGTA 4EDXB 1GGIL 3JWDL 3KLSA 2X4UA 1QLRB 4G6AD 4PGDA 2QKIB 2DQTH 2MQ0A 4NFDA 1XCQB 1ZLUH 4Z7NE 2PETA 1I8MB 1SY6A 2B8OT 1NDGA 1X4XA 5J89A 3LKQB 1EGJL 1JCKA 4GO6B 3VXPA 4OFVA 4OKVB 1T04A 1R3JA 2YPLA 4LHQB 5LBSH 5BV7H 3RVWC 2J7LA 4Z95H 4LOUD 3RUGA 2X4TB 4IRZL 2BVPB 1OP9A 5DJ8B 4F7TB 4X9GA 5DJ6A 2XT1B 4FABL 4MJ4A 2ICEA 4ZUWA 3U0WL 3OKLA 2H32B 2Y25A 1CGYA 4PGJA 4M9PA 4YBLB 4A2MA 1C12A 1MCPH 2GITA 2Z8RA 5F9OH 3MBXL 1DQQB 1HILB 5DXWA 2OTUB 3S36H 1OQXA 4OCXL 5CMAB 1N6UA 4ZO8A 2I27N 3WDJA 1D3CA 5DRWB 3FO1A 2W59A 5SWQA 4LQ1A 3L3IA 5C07E 1TFHA 3O3UN 5EIIB<