4A2DA

Coriolopsis gallica laccase t2 copper depleted at ph 4.5
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
496
structure length
495
Chain Sequence
AIGPVADLTISNGAVSPDGFSRQAILVNDVFPSPLITGNKGDRFQLNVIDNMTNHTMLKSTSIHWHGFFQHGTNWADGPAFVNQCPISTGHAFLYDFQVPDQAGTFWYHSHLSTQYCDGLRGPIVVYDPNDPHASLYDVDDDSTVITLADWYHLAAKVGAPVPTADATLINGLGRSAATLAADLAVITVTKGKRYRFRLVSLSCDPNYTFSIDGHSLTVIEADSVNLKPHTVDSLQIFAAQRYSFVLNADQDVDNYWIRALPNSGTQNFAGGTNSAILRYGAAPVEPTTSQTPSTNPLVESALTTLKGTAAPGSPTPGGVDLALNMAFGFAGGNFTINGASFTPPTVPVLLQILSGAQSAADLLPAGSVYSLPANADIEISLPATAAAPGFPHPFHLHGHVFAVVRSAGSSTYNYANPVYRDVVSTGAPGDNVTIRFRTDNPGPWFLHCHIDFHLEAGFAVVMAEDIPDVAATNPVPQAWSDLCPTYDALSPDDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LACCASE
publication title Structural Changes Caused by Radiation-Induced Reduction and Radiolysis: The Effect of X-Ray Absorbed Dose in a Fungal Multicopper Oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 139
structure length 495
sequence length 496
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2011-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4a2dA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4a2dA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4a2dA03
1ET8A 1UATA 3QJSB 1E5ZA 1A4BA 2EILB 2AZAA 2CJ3A 2A3TA 5I6KA 2GB2A 1CC3A 3FU8A 1W6WA 2AANA 1I53A 3PAUA 5B1AB 5B1JC 5PCYA 3D12B 1NIAA 3IN0A 4HCIA 2XXGA 2X87A 2VMJA 1JZGA 1X9RA 1A8ZA 2YQBA 4ENZA 5I5MA 5AFAA 1TU2A 4AX3A 1KV7A 1TEGA 2IDTA 3SBQA 3BVDB 4YVNA 3NJMA 3FS9A 1AS7A 4YSTA 1AIZA 1PF3A 5TK4A 3CG8A 1NPJA 1CURA 4N8UA 1SF3A 3X1NA 1AOZA 5D4IA 1OE1A 4AI7A 3NP4A 2OCCB 3S3CB 1KGYE 2IDQA 2IWKA 3U25A 1PNCA 2BWDA 1BQRA 5F7AA 3NJNA 3WG7B 4HCFA 4E9YA 1GS7A 4YVUA 3FSVA 1PNDA 2TSBA 4G7RB 3T9WA 1GR7A 3OMAB 1ZDSA 2EINB 1L9QA 4HCGA 1WS7A 3ZX1A 2CUAA 1AR1B 2H3XC 2GBAA 1JXGA 1GS6X 3UAAA 3CVDA 3NJFA 2VSKB 1BEXA 4YSQA 4E9XA 4QLWA 2OJ1A 2YAEA 2FJSA 1RZQA 3QJTB 3FQ1A 1KDJA 1XB6A 1MG2C 2XV3A 2XXFA 4KNUA 4QKTA 5I26A 4BDVB 3CZUB 1GSKA 2QPEB 3T6WA 2PPCA 1NTDA 1B3IA 4HAKA 1KYAA 3ZBMA 1CYWA 4M4RB 4X4KA 2PPFA 4Q89A 3H4FA 3IEAA 5E9NA 2CAKA 1BQKA 3NSFA 1HFUA 1OOWA 2UX6A 1XMEB 1MZZA 3NJHA 2ZXWB 3DKHA 2UXGA 2LLNA 1ASOA 1XB8A 2VSMB 3ABMB 3ERXA 3FYEB 3DIVA 1JVLA 1JOIA 3QJVB 3PLYA 1PCSA 5I6OA 2IH9A 1JVOA 1T5KA 3CDZA 2DYRB 5EHFA 1OCZB 2R7EB 3OMIB 4G72B 3TA4D 1JXFA 4AKPA 1WA2X 2P80D 2MRYA 2XLLA 3UGEA 4G7QB 1MZYA 1WA0X 2J55A 3IBOA 3V9CA 1HAUA 3FU7A 2CALA 2BW5A 3T6ZA 1ZPUA 1ILSA 1FFTB 2H5UA 4G71B 1AZCA 1KBWA 2JFCA 1A65A 2OV0A 3FYIB 1AS6A 4NB7A 3SQRA 2P80A 2HRHA 2IDFA 2JXMA 2IWEA 1CUOA 1PMYA 3WNJA 4YL4A 2VW6A 3QJRB 1PZBA 3NJJA 1GW0A 7PAZA 3S8FB 4KNSA 2QDWA 2WO3B 5I5JA 4DPCX 4KO5A 2J56A 1W8EA 4L0PB 1SFDA 2X88A 2HLEB 1J9SA 3X1FA 1X9UA 2HZHA 3X1EA 3OMNB 2PP9A 2H47C 4AKQA 2HX7A 3QPKA 2FQDA 3NT0A 1ID2A 4AKOA 1OV8A 4YSEA 1L9TA 4DP8X 4HHGA 3IN2A 3L45A 5A7EA 3SBRA 1KDIA 2BZCA 4A2EA 2RACA 1AS8A 4E9WA 3QJUB 1MDAA 2FT8A 1AQ8A 2WSDA 1ZIBA 3ZDWA 1OE3A 3AZUA 2HX8A 3AG4B 1ILUA 2FTAA 2GHZA 1MG3C 4BK5C 5B1BB 5LDUA 3WIAA 1NIBA 2AZUA 2DWTA 2XWZA 2BP0A 1NPNA 3T71A 2YAQA 4BWTA 4DP9X 1E65A 2PP8A 2XUWA 4KOBA 2DY2A 1AG0A 1OCOB 3CVBA 4Q8BA 4KO6A 4YSPA 4ZK8A 1ZV2A 2PPAA 1TEFA 4NERA 1NIFA 2WO2B 1RCYA 1SJMA 5F7BA 1CYXA 4YSOA 2XX0A 2XVBA 4M3HA 4P5RA 1IKOP 5B7FA 2FQEA 4BWUA 1M9WA 1BXUA 1PY0A 1GS8A 4FA7B 1NIEA 3EF4A 2HXAA 5ANHA 4DPAX 1V54B 2GSMB 3WNIA 3S3DB 3S8GB 4CSPA 1L9OA 3CDZB 2VW4A 2ZOOA 1J9TA 1BXAA 3MX0B 3OD3A 2GIMA 1JZIA 2UXVA 1WA1X 1YLBB 2BP8A 4KO7A 1V10A 4E9SA 2IAAC 3FPYA 4YSDA 1JZJA 5I5IA 3UACA 3X1BA 1AAJA 3FU7B 2XV2A 3AG3B 4DP0X 1IBZA 3G5WA 2BO0A 1BXVA 3H4HA 3JTBA 2CCWA 5IY5B 4E9TA 3QJQB 4WTQA 4G7SB 1IC0A 4GP5B 1PLBA 3FQ2A 4DP5X 2GC7C 3TU6A 2FT7A 1PZCA 2Y69B 3EH3B 3EH4B 4CSZA 4GXFA 2EIJB 2FNWA 3PXLA 1ASPA 4A67A 2B08A 3NSCA 1PAZA 1E67A 3NJLA 1FA4A 1AZNA 3N2JA 2GC4C 2I7SA 1F56A 2UX7A 5FC9A 4GYBA 1BQ5A 1M57B 1AACA 3AG2B 1GYCA 3NYKA 2FQGA 1J9RA 4PAZA 3GYRA 5B1JA 3N55A 1IUZA 2W8CA 2J57A 4EF3A 1SDDA 5PAZA 1N70A 1J5DA 5TK2A 1ZIAA 2FWLB 1JZHA 2VW7A 1KCBA 2W88A 3GXUB 1GY1A 2I85A 1AANA 2EIKB 3S3BB 3WI9A 1TKWA 2VM3A 1NZRA 1OCCB 5AZUA 1QNIA 3OM3B 4KNTA 4A2FA 3KW8A 5I6LA 3TBCA 2YXWA 1PLCA 4K9JA 1JZEA 4PCYA 1RZPA 3AG1B 5AKRA 3H56A 2Q9OA 2Q5BA 3NSDA 3V9EA 4DP6X 4DP2X 1AZBA 1AZUA 2YAMA 3NJKA 2DYSB 1ZDQA 5B3SB 2XYBA 1WAEA 1QHQA 2B3IA 2BP0B 4GP8B 2CBPA 1J9QA 2YARA 4DPBX 1OCRB 3X1GA 3AW5A 3PCYA 4FAAB 1DYZA 3DTUB 3UADA 3JT2A 4GY4A 2PPEA 1KBVA 1SHXA 3ASNB 4F7KA 3ZIYA 1OE2A 2FT6A 4HIPA 1A3ZA 1EZLA 1M56B 3NJGA 4UAHA 3FQYA 1SHWA 1JXDA 2YAPA 1N68A 2NRDA 3PAVA 3EH5B 4YSCA 4HZ1A 4E9VA 4DP7X 2QDVA 3ABKB 3BQVA 3TASA 3OQRA 3FU9A 3KW7A 4A66A 4DP1X 2PCYA 4A2HA 3SBPA 4F2EA 2GI0A 3TBBA 2BP8B 2IH8A 1AZRA 1E5YA 2BW4A 4GP4B 3FT0A 2N0MA 1ET7A 2XU9A 4P5SA 3CVCA 5I6MA 5I28A 2AVFA 2JKWA 4W1TA 1OF0A 6PCYA 1NWOA 1A4AA 1W6LA 4YSRA 4YSAA 4HALA 5D4JA 1AG6A 4W9ZA 1J5CA 2XV0A 5B7MA 2PPDA 1IBYA 4KO9A 4TXVB 1XB3A 3X2QB 4YSSA 1QLEB 2YAFA 1R1CA 2IDUA 3T6XA 1URIA 3IE9A 2DV6A 1ADWA 2ZONA 3NP3A 3EHBB 3NJIA 3RYMA 1VLXA 2PCFA 1BYPA 8PAZA 1FWXA 2BWIA 1L9SA 1ETJA 1DZ0A 3GDCA 3NSYA 1PZAA 1RKRA 3FSZA 4A2DA 2UXTA 4JKNA 4RH4A 2YXVA 2VM4A 2DWSA 1SDDB 1SNRA 2UXFA 2XX1A 1NDTA 4A2GA 1ASQA 4JHVA 2HX9A 5D4HA 2QT6A 2IDSA 2I7OA 2YAHA 3FPXA 1HAWA 2BZ7A 4BXSV 2QPDB 2YAOA 3ABLB 3WKPA 1SF5A 3T6VA 4YSUA 2TSAA 1BYOA 1GY2A 4BDVA 4BWWA 4HHWA 3HEIB 2E86A 5I6PA 1ET5A 5B7EA 1V55B 3UABA 1NWPA 4BXVA 5I6NA 3AY2A 4MFHA 4NAJA 4N4YB 4JHUA 3ASOB 2AFNA 2FQFA 2ZWNA 2BHFA 3WKQA 2PLTA 1L9PA 1E30A 2Y1AA 3ABGA 3FSAA 1WS8A 9PCYA 4E9RA 1NIDA 3MBWB 5B1KA 3PAZA 6PAZA 1L9RA 4G70B 4F2FA 3QQXA 3PPSA 4WKXA 1BAWA 2EIMB 4UF7C 1EHKB 2HRGA 4E9QA 2IWFA 2R7EA 2J5WA 1KCWA 1SFHA 4A68A 4AZUA 2MTAA 3UAEA 1NICA 4DP4X 3FSWA 1PLAA 1A4CA 2VN3A 1JERA 3C75A 2PP7A 7PCYA 4UANA 3HB3B 1JZFA 1NINA 4KOCA
chains in the Genus database with same CATH superfamily
5GGTA 1UATA 2L04A 4LLVB 4IGBB 3AB0C 3V4PA 2A3TA 4G6MH 3KPSA 5SWSB 3P40A 5B1JC 2FWSA 5E99H 1NC4D 1NGPH 2NDGA 5HHMB 3WSQH 4BZ1A 5DEZA 5F89B 3ZZSA 4DUVA 2VMJA 4LLDA 4UI2A 1S7UA 2VR7A 4K4KA 4TUUA 4GUPA 4WKZB 4NIYE 4JHWH 1JTTA 3VTMA 2C7UB 4G9DB 4XC3L 1ND0B 4Y2DA 1P9MC 1TJIL 4PRPB 3BYTA 3CFUA 3QEHB 4G3YL 4M5YL 4XP6H 5BQDA 3KWXA 5DJ0A 1IAKA 4FZ8L 1GGCH 2QSVA 4KI5D 3TX4A 1XF5B 2XBTA 2UYLB 4MA7H 3QR2A 5DT1H 2HPTA 4GW1B 4F15C 1JZ3A 4C55A 5EEZA 2TRHA 4DESA 2C3WA 4WNSA 1QKZH 1GS7A 2A6DA 1OL0A 1NAML 3ESNA 3QIBD 2OULB 3BIKA 4RFEB 3X3FH 4R4FH 5DQ9A 4KK9D 4QTIH 5CJXA 1DVXA 2ZUQB 2K6ZA 4UT6A 5F72S 5E1GA 3Q8EA 5JHAA 2B39A 2ZKHL 4ZMWA 3P4OA 4E9XA 5D55A 2DKMA 2EYTB 1H3TA 4I4WB 4JFYA 4AGQA 4RMRA 2B59B 3PWLA 3GMLB 4PRDB 2WXFA 3V55A 3ULUD 2D3LA 2IQ9L 4WI5A 4YDKH 2G4GA 2XV3A 5I26A 3VGHA 1N10A 1D5MA 3FH7A 1A9EB 1BBJA 3PHQB 4KVNL 2AXWA 2OZ4A 5C0AA 3ZO0A 4ZFGL 1EVUA 2P5WD 3IE4A 4LHQB 2X1OA 4IDJL 1I82A 4TQEL 3VRLF 2W60B 4RLDA 4UQ2B 4CN4A 1OQOA 1YMMA 1N4XL 5IJVA 1A6PA 1HCFX 1VIWA 4QRQA 1R5VA 3Q8CA 1ONQB 1DQMH 3DKHA 5F2FA 3TYGL 3ABMB 1B88A 1QUNA 1NH6A 2CM5A 1ZS8B 2ITDA 2MPAH 4PJBE 3U79A 3VXUD 4PREB 4CGUB 3HA0A 3MNMA 5ITBH 3QUZB 4FL4B 4H5SB 4WWKA 5E8OA 4Z7NE 3PGDA 1T1WA 4ZMLA 1J0YA 2PTVA 1E42A 2H9GB 3M1CA 4J3BA 2WD0A 4KH2A 3TA4D 1JUFA 1UYWH 3K2UH 1R19A 1LILA 4YNYB 1MAJA 2P80D 4JDTL 3TT1L 4J7RA 5GGUA 2XIBA 2PCXA 3MMEA 1OSYA 4H1LH 5IBLD 3VI4A 1HAUA 4L4VD 3QWRA 5F1NB 5JIHA 1ZPUA 4LDLB 2D8KA 3KPLA 3ZHFA 1I3RA 2BHYA 3NFPA 1NCNA 4FXLA 3GMPA 1PMYA 1KTKE 2VLKB 4MA1B 3MRKA 1JMXA 1I3VA 2VDNH 1IGTB 2R2EB 1MCLA 3STBA 4CGTA 1OANA 5CR1A 4JO3L 4YJZL 1OCWL 2F7IA 4FADA 1IC5H 3BMVA 2X9WA 2H2SC 3ISWA 2C34A 5D7LA 4PG2C 1OK8A 2PYFA 3BQUB 3S9DB 2HKFH 4PRNA 2XJLA 2FX9L 5ADPH 1R3JB 4L9LC 2A74A 4KVPA 2APVA 5BVJB 4I48A 1M6UA 3X11B 1HHHB 4JDEB 3VFSA 2FYYA 4FQXB 4L1LA 4KXAA 4OVUA 6TAAA 4L5FE 1WFOA 2Y22A 4RZCA 4U1GB 5FKPA 3DV6A 4FMFA 5D1XB 4F7TA 4OV5A 3L3OA 1FDLH 3NSJA 4R4BB 4NO3A 2OMVA 5CEZH 1L9TA 2PO6A 1RY7B 3VRIB 2ZG3A 2UZXB 3SBRA 1KDIA 4XNXH 1XQ4A 3EG9A 4DZ8B 2PW2B 1FV1B 3ATBA 5BS0A 4KKPA 3EZJB 3RUGE 4XN2A 1IQWH 3FZUD 5TDNB 3C09C 2HX8A 2L4OA 2WLNA 4OTXL 2KZBA 1DJSA 3KGUA 5CP7A 4MSWA 2HLAA 3W81A 5DMJB 3SPCA 4BRJA 2WLHA 1A6VL 5HDQH 1EEQA 1OSPH 4I9WD 5HDOA 3UL4A 3I9GH 4RGNC 1GPOL 4XMPH 1XIWB 5JMOC 3MV8B 4XZUB 2J6EL 2AXGB 3MPCA 4C83A 2V7NB 1P5UC 1FYTD 2QV4A 1T21B 4N2OA 4A04A 5D1ZI 3IJYB 1BVNT 4K55A 4L3EB 4NKMB 4PLJD 5FKAA 3WE6B 4KXDA 4HLJA 3IJSA 1MCNA 1M9WA 1MFCH 1S7XB 4OD3L 4H2CA 3PABA 5ELIA 1VHPA 2E6PA 5EEUA 4DPAX 3L3KB 4XRCB 3R8BB 3HE7A 1N6VA 4MMYA 1F6LL 3ML8A 3T8XB 4BRVA 4D3CH 4H8HA 4M61B 2YR3A 4ZZFA 1A9BA 5MEQA 4NO0A 2XN2A 2DH3A 4MMXA 1PIFA 1ZEAH 1X6NA 3Q1SL 2H8PB 4X4MA 4XPTL 3FRUA 1RZ7H 2JK5A 1FVEA 5JHLH 1I3UA 4IYKA 4PWHA 3ZU8A 1AAJA 1VACA 3QJZA 4NKIH 1H8LA 3AG3B 4P46D 4C54A 1IBZA 4DTGL 1F6FB 3QJQB 4HEME 5D7JA 2X89A 4BKLA 4IOFD 5JHDE 2ED8A 1HL8A 2VTFA 2HG5B 4PGJA 1FVDA 2P43B 4U1SB 4WJ5B 1M3IA 2OSXA 2C3HA 3P11H 3L95A 5ANME 4HGWB 2Q6WB 4HBQA 4V1DE 1G0DA 3H7LA 4I2XB 4PJDE 4LSSL 5EC1A 1HQRA 3TJHC 2CHWA 5ACLA 4B97A 3L1EA 5CNHA 1O75A 2AV7A 5FC9A 4Y4KB 3COOA 2L7UA 2NR6C 3MTRA 4RSYA 3RQ3A 2NY7L 3IDIB 5AUMA 1AACA 3HC2A 2G2RB 3HS0C 2F18A 4AGPA 2R0LH 3L3GA 4JQIL 4C4BA 32C2A 4KDTC 5JW4R 1HVXA 4EF3A 3JTSA 3GSUB 4PJ8B 2ZXGA 4YDNA 2ZF9A 5TF0A 3LN5B 1PJWA 5TK2A 3N1FC 4YDVA 2Q7YA 2FWLB 5C07A 3VFOA 4OSUH 1L3WA 1MFNA 1E6OL 3GXUB 4DGWC 5A16A 5HBBA 1BZ9A 2Q8AL 2QADB 1JN6A 4A2FA 2V5SA 1INDL 5EA0H 5B8CC 3HZMA 4R0LB 2IH3A 2F6AA 2YKLL 2ZX8A 3UTOA 1S9XB 1SEQH 1RV6X 2HVJA 3DX6B 5D2NB 5HGHA 2ZOLB 1MJ8H 1G7LA 2XYBA 4Y5YC 4H1LB 1S9YA 3KL3A 1HYRC 1REIA 3Q5TA 5E2VL 4LQ1A 4HKBA 1MWAA 2WWNA 2Y5EA 4DPBX 5JORA 1FE8H 4XH2A 4GBXD 4JZNB 5F8QC 4GMSL 4V11A 4ATWA 3DTUB 5MHSD 4DO5A 2OLDA 2XT1B 4F7KA 1VFUA 2YKKA 2CR0A 2VDNB 3FT4A 4N2MA 3MV7B 1I7RB 3QDHA 4O4YH 1CD0A 1EZLA 2Y07H 4H13C 1RUAL 1JDAA 1TZIB 3E7JA 1DDHA 4F7CB 1ZHNA 1TTGA 4GEJA 1QW8A 2E7LC 2HFGL 3DX7A 4P57B 3O4LE 4UV4H 4MB3A 4BM7A 1IGCL 4JM4L 3EUUA 4YFEA 3N0PB 4H0IA 5GHWL 2AK4D 4TVPE 4WFGE 4MAYD 3DHJA 4KRPB 3KEHA 3F2LA 3WJJA 1FFQA 4V33A 1E3XA 4LLWA 1FNFA 3P2BA 4FQIH 4K3EH 5DS8A 3LPWA 4ZS6C 3U2SB 3L3JA 4PJFA 4W1TA 4F57H 2FX8L 4XWOD 1ACCA 2C1OA 5JR1L 2IANA 4BK8A 5G55A 3HG1E 5KAQF 3Q3GB 4TVPL 3B2UC 2UY7B 4EZLA 3PFQA 4FQCL 5CBAB 1IIKA 1J05A 2NZ9C 4AXWB 4PGCB 4Z78B 3VGGA 2X41A 1LWHA 4U0RC 4UYPA 1P7QD 1IM9D 1UQSA 1RIVH 2G2PA 3U9WA 3VDBA 1MCRA 2ZPKL 4POUB 2EE0A 1XF4A 3C6LA 4F7MA 4JDVB 4UTAH 2WINA 3SKJH 4P9HH 5D6DA 3MLYL 2X3CA 2L0DA 3LQZB 1FWXA 1BDYA 2VXQA 4HWZB 3WDJA 3LRKA 3CQQA 2OXHA 3S35L 1I7UB 1T2QL 1D5BB 3A4AA 3K6SB 5D72H 3U6XS 4RH4A 1OHZA 4ODWA 1G1KA 5HDLA 3GMQA 3UZQB 3GMNB 5C2BH 2ZUYA 1JF1B 1JPFB 3P0YH 3SKOA 3ZT6A 5DSCB 2EAEA 4XNAA 1J8SA 2J20A 5D4HA 3DOSB 1G87A 1J18A 3GSWB 4N28A 3LS4H 2X40A 3MRJA 4BXSV 5A2KH 2DJSA 1FSKC 1X7QB 2XRAH 1B4RA 1SOKA 2C8NA 4PJIB 4A2LA 4YOKA 4YSUA 1M7IA 5DJCB 3K74B 2XY2A 3LMJH 2YLKA 2E86A 5B7EA 1N6QH 2V5RA 1S7WA 5F6IB 3K91A 3QIWD 3KYOA 4JHUA 4MXWL 5SWQB 2FQFA 1FZKB 4ISVB 3QI9B 1F1AA 3EJJX 2WWKO 1U30A 4F37F 2F1AA 4IRZA 3ILPA 3CN0A 3RE0A 3TVMD 1TTAA 3RKPA 2Z8RA 2H41A 1WTLA 5C7XL 4Y89A 4Q6IA 2C3VB 3RIAK 3DROA 5FO8B 1EEZA 3C5SB 3LXCA 3UTTB 5KS9B 4H88H 5KSAD 3CFTA 3E1ZA 4LHUA 4E9QA 4JG0H 1RVFH 3JWDC 4P3DB 1PY9A 3ZGHA 2J8UB 4G7VH 2MTAA 4NWTL 5TE6L 3SOBH 3CZJA 3BKYH 5DMKB 5BXFB 2EDQA 4ZUUB 3IAPA 2ITCB 4YGAB 5GRUH 3C75A 5C0NC 1OB1A 2Z1KA 3I3EA 2BNQB 2PP7A 3BOVA 3MN8A 3FQXA 3MCKA 2R59A 1KPUA 2NY2B 1JRHH 2P8PA 1W16A 5GGSA 5C71A 1FNGA 4DGIH 4KFZC 4XPGL 1UXWB 4LRIC 3SGEI 1WZMA 4FKHA 1ED3B 3U46A 3RY6A 2NUPB 3ZKNC 1U8NB 2IC2A 5JOFB 5EU6E 2BHUA 3B2DC 2KC0A 3SBQA 1H3VA 4YVNA 5C0BA 3B7RL 2ZWZA 4F27A 4OM1H 3ARWA 2E59A 2YBRB 4MQTB 3SYOA 1HOCA 4N8UA 1SF3A 2ETWA 1KFGA 5JQHC 5AWNL 3ZTCC 2LV4A 4HSAC 1I9JH 2WQ8A 3DPBB 5A2AA 1BMWA 3OB0H 2YO3A 2ZZUT 3BDYL 1DQQA 2OCCB 4LRNH 2FWUA 1T0MB 3NABL 2H6OA 3E9UA 3K5SA 8FABB 3KVPA 1AC0A 1FL5A 2O30A 5B22A 1SVBA 5E9AA 3WG7B 5T8IA 1DUYA 1JYWA 2XHNA 5L9DL 2V9TA 2F2HA 2QGDA 1F97A 3ATAA 2DMHA 1WC7A 1VRSA 5TFSL 5MEOB 3WS6C 3FMGL 3EYFB 1QSZA 3BLBA 3SE9H 3S8WA 1BM7A 1JWUA 2HTLC 3M17B 3EOBB 3NCMA 4FJZA 1A25A 4JBSA 3F7YB 3TWCH 2KKQA 3WLBA 5C08A 5E2WL 3NZUA 1N2RA 5JOPE 2B4CH 4XZ4A 3VFVB 3VXTA 2JKIS 1R24A 3QO0B 1PEWA 2UWEA 4PS4L 3TXAA 4N2NA 4OFYD 4JB9H 2J1YA 3IDXL 5DO8A 4J3OF 4M4RB 5ITFB 3GBMH 4X4KA 2PPFA 3DV4B 3G04A 4DGUA 3I75B 4K23L 3PQYA 3WNMA 1BQKA 4PJ5D 4HXBH 2LE9A 3ABZA 4HXAL 4I0PA 2YN3A 1U21A 1ZY9A 3K2IA 1CGXA 4IK7A 1TTFA 1FVCB 1RJLA 4NZTL 4JL2A 3BHBA 5E6UB 4RAVA 3QJVB 3RDTC 3RIFK 3UTZA 1PCSA 3UX9B 1LNUB 1FZMB 1IM3D 4LNRB 1JZ8A 3KLAB 2QJDA 3IGKA 3U4KA 1AGEB 4HIHA 4DSYA 2P52A 3FTSA 1O7DC 1VFAB 5FYKU 1XTLA 5IB2B 1TQUA 2B1AL 3V0FA 5I1EH 1DVFC 2Y2WA 4NX0A 1D3CA 4OKDA 3QFJD 1E3FA 2OMYA 2Q76B 4P23A 2XVLA 1EJ6A 2A4ZA 3O3AA 4RCAA 4RFNC 3R7QA 1JHKH 4HSCX 4JRXE 2DAVA 3V9CA 3CFMA 3DJSA 3VWJD 4GMTL 4R83A 2YOCA 4QR7A 4U2YA 5DURB 2PETA 4NB7A 4PEEA 4HF5L 4HBCL 2JXMA 3BPLB 2VZUA 2CGZA 5F7FA 2K0RA 3FO9B 1BQHA 2AJVH 2M26A 5IQNA 3KDMB 5KVMC 4N85A 4AMKH 2Q3XA 2EDXA 2ERJB 3BJLA 1K5WA 2QGCA 4HIJB 5DZVA 1KCLA 2W9LA 1JZDC 1TU2B 2BP3A 5F96L 4OZIF 3GDBA 3QG6B 4PJDF 5E00A 4JRYB 3HE6C 5DXWA 4ZUTB 5AALA 4WUKH 4DIXA 2VJXA 2N7BA 1S3KL 2VWEE 3R06B 5DJYA 4NHUA 3OPZL 5LKNA 2ZX6A 4RFOH 5CKGA 5ID1B 4GT0A 5EORL 6FABL 5GRVL 3JSSA 3WFCH 1W72L 3GLDA 1EAJA 1U41A 3NT0A 5CGYC 4K7PX 5AQ0A 3CFKB 1OGAE 1EJOL 5I16A 1P4LB 2XPGA 4KAQL 2ORBH 3QIUA 4NRZB 1GXEA 4DVRL 4OCWL 1LO0H 1AVAA 1WISA 4Z7UE 3RTQA 3ZL2A 2ENJA 5LXGH 4FZEL 1MHEA 1QSEB 5LN8A 2EH7H 4N0YL 4GKNA 2PXYA 2YMOA 4H8WH 5KVFL 4WHCA 2E9JA 3FTVA 4NPJA 3PWVB 4OR1A 5AKSA 1AQ8A 1ZIBA 3HHSA 4JCWA 4YHNB 1KCUL 5IESL 3WS3A 3IPEA 2ZIDA 5AW4B 2NNAB 1EJ8A 2NZ1A 4NN5C 4XXCA 3IMVA 3ZTEA 1MCKA 1MG3C 5FYLE 2Y7OA 3WIAA 5AZ2H 4PTUA 4PS7A 4TSBH 3V7AE 3KWWA 4CC0A 2XUWA 1T2JA 2ZCLH 1OTUC 3MJ8A 4XTRD 2CRYA 3AAZA 2IG2L 4XNDA 1LO2L 2IGTA 3B1TA 3BUIA 2H6PB 4DW2H 3V4UL 2BRRL 1A21A 2YUXA 4P2OA 1HSBA 2BSSB 3H53A 3QCVL 1MIEL 3ULVD 3K8LA 2FB4L 4JO4H 5HGDB 1L7IH 2MQCA 1JFQH 4XO3A 5D7IE 5DJDB 3O2VH 3K4DA 3Q8BA 3X14B 1GS8A 3GHPA 1NSNH 1MUJA 2AS5M 4P2RB 1L9OA 4X42A 3VGDA 3ZDXB 4JL1A 1GA2A 3BRDA 2XWTB 4D0BA 1NFDA 3EGXA 1ETZB 2WQUA 5I1JL 3FTXA 4KJYA 1SBSH 4XNQA 4UCFA 3EYVA 1B2WH 4X2UA 2EVIA 5FWQA 3ZDZF 3QGVA 3OGCA 1WAAE 4APXA 2NXZB 4G6JL 4Y5XB 4B0MB 2CJUH 5EN2A 1OTSD 3BP6B 2Y69B 3FTUA 4L05A 4PGBB 1CGUA 5LBGA 1A7NH 1IT9H 1Q0YL 2HJLB 2ADGB 1YEEL 3OKOB 5T5FA 5EZJB 4BA0A 1H5BC 4UBDD 3WTTA 4PY7B 5I76B 5AAWC 3ARFA 4XCEB 2M1KA 3WEAA 1DE4A 2FZ3A 2FUQA 3AMKA 3LKPA 2ICWA 5FA4A 3D2UD 3C6SB 1MFDL 4XMZA 1N26A 2CUIA 3EJCA 1DVTA 2ZUTA 3CLFH 2W81C 3GSVA 4ZUSB 5I0DA 4LEXL 5IJDC 4Y16B 1G0YR 1CDCA 1A2YA 3N3EA 1OY3B 4JM2C 4GFXA 1XF2B 2VQUA 4X98B 1U3ZA 2HT4C 5KYWA 1N6UA 3F58H 1FPTH 3TEXA 2GTWB 3KPSE 3FB7B 3FUEA 4UQDA 2ZF8A 1PVHA 2Z31A 4KTEH 1TKWA 1GSMA 2K8MA 3G5XB 4MX7A 3SE6A 4U6YA 1TG8A 4NRYA 3V8CA 2VC2L 4X6DA 5IW1B 4B9ZA 3BSZA 3CHXA 3S88H 1PPIA 2M83A 5AVTB 3TTSA 4JRWA 2IV8A 3CFBB 4N20A 3WY1A 1HEJC 1JGUL 3V4PL 3VXMD 2YOAA 3FU6A 3P9LA 4FQHB 1AGCB 2DYSB 1LDPL 4YHZH 2WMPA 4PJ7F 4AIOA 1I85A 3EOAA 1LK3H 5K9QG 1QTYT 5AG9A 4P5MB 2CH8A 1AKJD 4PWIA 4R96A 5IMLB 3GO1L 4I77L 1H8SA 2CGRL 5DVPA 2A5UA 1TJMA 3OKNB 5DTFA 4ZAKD 4D2NA 1EFXD 4UT9H 1KXVC 1KJVB 5LGHH 3D85D 4EN2A 1SHXA 3DBXA 2XKUA 1U4EA 3DSFH 5LQBH 3RX8A 2H3NA 3C60D 4NAQA 4MAZA 4EI5D 3TA3A 2FEDC 3GIZH 3QWNA 4G9FA 2ZNXA 3NA9L 1DLHB 1IEBB 3SDDC 4BA8A 1MH5A 2O5YH 4QXWA 4AWJC 5TPWL 3K0WA 1DBJL 3O11B 1G9NC 3RGBA 3GKWH 3KW7A 4LPUA 1S46A 1ANUA 3WHE0 4AZ8B 2LQRA 3LKQB 4A2HA 4XOBA 1DP0A 4HCRH 4IGBA 4L2LA 4NNYB 1JPGB 35C8L 1RZGB 2DBJA 1Z9SB 4UT6L 5SWSA 1PD0A 2LR4A 4OI9A 1CVSC 4QRAA 5ISZB 4IMKC 4ONGL 3V6FB 5F89A 1UENA 2FIKB 4P4KB 1ACZA 1KPRB 1R3LB 3BAEH 3N41B 4KKNA 1YMME 3J2PA 1QA9B 2MKLC 1W6LA 4WKZA 4WO4B 1OSZB 4LBAA 1SVZA 2C7UA 4G9DA 43C9B 4ENED 1ND0A 3P4NB 4PMFA 4Y1AB 3VU2A 4PRPA 4TNGA 4UTBH 3QEHA 5FM5M 1XF5A 4GAAA 2UYLA 3X2QB 1YN7A 2G4EA 2R4RL 5DA4A 4DH2A 4HAGA 2AK1H 1UVQB 2CK0L 4G83A 3T0XA 4K5OA 4GW1A 3FN3A 3IKKA 5KTEH 1F4YL 3HAEH 3QUXD 1RIUL 5F1SA 1N9PA 3RYMA 2IPKB 4OLVH 3SODB 2ZOWA 3JUZA 1E5BA 2OR7A 1BREA 2O1AA 3QHFH 5CILL 5JO5B 2LOEA 1BFVL 4RFEA 4FDWA 2DQDH 3TF4A 2ZYIA 5J9PB 1RKRA 2VQ1B 4J6RL 5B39B 3QHZL 1MRFL 3V0HA 3NCWA 2WJ7A 2Z4QB 5DI8B 2XZQH 3FUNA 5JLZB 1SDDB 1UXMA 2D7NA 1YUHB 3VD4A 1BPVA 5T3XD 1ESOA 3K6FA 4YBLB 4R8WH 2HX9A 3BH8B 2QT6A 3CIQA 4OLUL 4P49A 4I4WA 2EYTA 2YAHA 3P4MB 4NBYB 2VL5B 3QE5A 2B59A 1WGVA 3GMLA 4PRDA 3PGCB 4MA3B 4NXSA 3LTVA 4MHHG 4PJ9C 1BYOA 3AXLB 4KQ4H 3VTTA 4NQSB 1A9EA 3PHQA 4XVJH 5D7LE 3SQBB 3D87B 1E5AA 4AIZB 2E7DA 4IBUA 3BVVA 4OLZL 2W60A 1IB5A 2FCBA 4UQ2A 5AD0B 2ZWNA 2VE6B 3N9GH 5I1DA 1EIBA 5GRWA 2GITB 2DWYA 2XA8L 5JPNC 4LOFA 1ONQA 3AC0A 5DD3H 3CH1B 3S0PA 3BWSA 4Y4HC 2MEJB 1ZS8A 3APMA 4YHOL 4XNYH 1EX0A 4PREA 3AXIA 5LNGA 1CFQB 4D8OA 4OJFL 1UWEH 3QUZA 1JGVL 2AQ3A 2W9DL 3FT2B 4FEIA 4GRMB 4H5SA 4F2FA 1MSPA 3GHEH 3UAJA 4LPVA 2H9GA 4PP1D 2IWFA 3VI3B 3D9AL 2FGWL 2R0ZL 4FP8H 1KCWA 5BS0E 2J5WA 4AZUA 1TJGH 1WEJH 3TBVB 4YNYA 4JR9H 2HLFD 1P1VA 5CSZB 4DP4X 2YLHA 1DBKH 4HMDA 2CMRL 3UTSA 5IWLC 1YEGH 5F1NA 2HUEA 3NRPA 3QJHB 1BVOA 7PCYA 3UBXG 3H6AA 4IU2B 3MFFB 1JZFA 4PFEA 5E8NB 4DKEH 4OBRA 3MNZB 3QORB 3KPQB 3EO0A 1CC3A 2VLKA 1KY7A 1I53A 1LDSA 3S5ZA 1NBQA 4KJQD 1IGTA 2X6MA 2R2EA 5E8DH 4Q9QL 1IKNC 3K81A 1LWJA 4LKCA 1ZGLB 2AJYL 4N5ED 2EDDA 4OFIA 4LLQB 1J88A 4NS0A 4QDGA 1MF2L 2FJGA 3BQUA 2JQMA 4NZDA 1KACB 2OMTB 3MUHL 1Y6MR 1R3JA 5I18L 5BVJA 1KGIA 3D4ZA 1QFWH 2GK0B 3P3TA 3X11A 1HHHA 2FLRT 2DQ6A 4JDEA 4KXBA 5FF6A 3U1SH 1QLEH 4FQXA 5F7LB 3V0IA 3WGUB 5AZEL 2P5EB 5ES4B 1KB5L 3CHSA 1DFBL 5D1XA 4PW9A 3H1ZA 4WEBH 4R4BA 1ZOXA 3D30A 4WFEE 3VRIA 2UZXA 2XACC 4Z7UF 1KMGA 5I74B 4DZ8A 5GZNC 2PW2A 2C4FT 1FV1A 1ZDSA 4BSWB 3IPBA 2ZTBA 4ELMB 4KK6D 1OAXH 4WY7H 3D4GA 5ACMA 1IAIH 3DRTB 1O6VA 1KEGH 1KY6A 2A6KB 5C8JB 1HX0A 2YFOA 1RLWA 2J44A 2V8LA 3ULVF 1NC2D 3FQ1A 4N6RA 3TV3L 2VXUH 4MBRA 3T6WA 4GI8A 1XIWA 4HAKA 3G7TA 3OPUA 4IM8A 5DS1A 1WLHA 2YMXL 1USQA 3OLDA 4LKXA 5GSVB 3MLVL 1HNYA 4XZUA 2Z3FA 2AXGA 3MREA 4Q89A 2V7NA 4QF1B 1OF2B 3KYAA 1MXDA 1T21A 3ZT5A 5L8JB 1S7VA 2JB5H 3LXAA 1CU4L 3CE1A 3IJYA 4Y19B 4QRUA 2CQVA 4L3EA 3WE6A 4ANXA 4HS3B 4QXGH 1VERA 4OZGB 3WD5L 2VZSA 3ULSB 5A6LA 3AM8C 2VUYA 4CDHA 5EOCL 3L3KA 4XRCA 4KUZH 4IBQA 3OXSB 1JVOA 3NH7L 1FG9C 1KTCA 1RZKH 1E5UI 1TPXB 3FU5A 4MJ6B 4PV9B 3U7AA 2AJ3A 4M61A 3WNKA 5K33A 3CSYA 4PY8I 1NLBH 5EO9B 3QJOA 3HAEB 4TN9A 4G7QB 2P45B 1THCA 1WA0X 3D8MA 3TZVC 1UKTA 5EU3B 4LCWD 3EFOB 1KTDA 1I4FA 4NC1C 1QUPA 1KELL 3V0WH 4Z23A 4KZDL 3FULA 3HPJB 1WAAF 2JTDA 5KEZA 5I0VA 5DFWH 4K7PY 4IKIA 4XCNB 2HG5A 2QKIB 4U1SA 1RZJL 1YNLL 3IDYB 1OT2A 3KXFB 4WJ5A 4XVTH 2EYRA 3S2AA 3T3MB 4AEHL 4HGWA 2Q6WA 4BH8A 1HINL 1GW0A 4DGYH 2DTSA 4Z18A 4I2XA 1DSWA 2XTJE 5AW3B 3W39B 3BPCA 5JXAL 4DPCX 1EH9A 1GGIH 1RFDH 3VNZA 4KVCL 3Q8FA 3K7UA 4PJAE 4Y4KA 1XXDC 2A6JB 3T0WA 3WLWD 1LEGB 4PYGA 5I6XC 3IDIA 1QBMH 2G2RA 4G8EB 4P5TC 5L6YL 1OP5H 5DDHB 3EBAA 4L37B 4PJ8A 1VJSA 3GSUA 4YE4L 3WFBH 1AD9B 3LN5A 4LCCC 2YRPA 4LPWA 1OV8A 5E4AA 4GG8B 4JHZA 5KBDA 4HHGA 2BS8A 1F4WL 3MXWL 4PJFE 4XMLL 1HNFA 4LDOB 5CLXA 1WAPA 1N0XH 2IANE 1KCVL 4FEMA 3PGFL 4YHLH 2HH0L 3L3HB 3QW9A 5F1IB 4R0LA 4G8GA 1S9XA 2YRZA 1GIGH 3HMXL 5E0FA 3QXUA 3DX6A 1H3XA 4MGXA 2ZOLA 5D2NA 15C8H 1I8KB 3C2SA 2VMDA 5B1BB 1NIBA 3FAWA 1F3JB 4H1LA 4MJ4A 4N6QA 3V5DB 2VMCA 4AGMA 4GPVA 3RNQB 3CVBA 5I19H 3PY9A 4JZNA 3BKCH 4ONFH 2BVPB 5IBTH 4XO8A 1IAMA 1OAYH 2EDBA 3F64A 5A43C 2WBJD 4L8SB 1X5MA 4HIIA 4OCLC 1CTOA 5KW9H 4YMPA 3WJLA 1CYXA 1R3IH 5EIVA 2L7QA 3MV7A 1I7RA 4Q9RL 4AVIA 2XX0A 1TZIA 3ARED 3ZKXC 4F7CA 4YHML 2J25A 4CKVX 4OF0A 2XXMB 2MHAB 2P7TB 1PY0A 3OTTA 4P57A 5CBEB 2O4EA 3DHUA 2OI9C 1QFUL 2GSMB 2YSTA 5IHWA 1UEYA 5CZXD 3WNIA 2XIDA 3S3DB 5FXCH 4IJTA 3EF7A 5HSFA 4FMKA 4GQZA 3FCUB 2UXVA 1WA1X 1CR9H 3CBKB 5INDB 3L4YA 4XOCA 3FW6A 4K73A 2EDKA 4PW3A 4ODTH 4Z3TA 4OFDA 3U2SA 3VD3A 1MEXH 3DI3B 1A6TB 2W80C 3QG7L 2NY3D 1DHKA 4Y4FD 4BFOA 2XWRA 3Q3GA 3WFDL 4XVSL 2UY7A 3QT2A 3IU4L 3HC4H 1IC7H 3NAAH 4QRFA 4CBZA 4DK6A 5CBAA 1QQDB 2BK8A 1A3QA 1PLBA 2ICWJ 5CJBA 3EGDB 4Z78A 1U8MB 1V7MH 2YWZA 1VDGA 2B08A 3KJ6L 5CIPH 5E9DB 5EOTB 1U4FA 1I1FB 2MQ3A 4JDVA 1J9CT 1CFVH 3DIFA 5E4IA 5LCVH 3D1MC 3JV4A 4S11A 2PN5A 3LQZA 4HWZA 5EOQL 3T2NH 1K85A 3I50H 3RG1C 2ZKMX 4G2AA 3SDXB 4A6YB 3QXVA 4W4NA 2WYHA 1J9RA 2DMCA 1D5BA 3RTLA 4PAZA 2J5LB 3VI4F 3K6SA 3SDCD 3X3GH 3JZ7A 3GMNA 5DSCA 1MW1A 1JF1A 1JPFA 3UZQA 4PWKA 4XP5L 4WHYH 4MQXC 4BGLA 4BFIB 3WN5C 3NCXA 1N0LB 3DOSA 3Q43A 5KZCD 1D6EB 4ORGB 1FORH 1T89A 3GSWA 2AI0H 2VCOA 1NCAL 1UASA 4WTXA 4HLZH 4UDTB 2K7PA 1X7QA 4YXKH 4J39A 1DANU 4TVSa 1S7TB 2B1HH 2KPWA 2OBGA 3KGTA 4ODXB 5GJTH 5I6LA 1KCSH 1EPFA 1PLCA 2Z65C 5FUZL 2X4OB 2Y25A 3A4DA 3AQDA 4OIIH 1UD8A 4X5LA 4XPFL 5C0BE 1N59B 3D39B 1R34A 1FZKA 1K5NB 4ISVA 3QI9A 5E70A 5JHLA 5FLVA 3CFQA 1RUML 2Q7NA 3NIGB 1A66A 2BP0B 2CKNA 4GP8B 5F7EH 5KSBB 2CBPA 1J9QA 2CNZA 5T1KB 4BKSC 4J6IA 3VYNA 1KJMB 3PCYA 2FLMA 5C0GB 3QP3A 1JZ2A 2C3VA 3D0LB 2D0HA 3CJJA 5SWZA 5FO8A 5KS9A 3C5SA 3UTTA 3U1PA 3OJMB 1ZLSL 1L7TL 5T1MA 5JQ6L 2DWXA 3HB3D 1JJUA 4IRJB 4P3DA 1RHHB 3RL2B 1A1MB 2J8UA 1MFAL 3OF6D 3RVWD 5DMKA 2KERA 3GZPA 4YPGB 5DWPA 1AY1H 5DD6B 3ULAB 3UTPE 2ITCA 5E6ID 2A77H 4JCLA 2BNQA 3BUYB 2JELL 3SCMD 3TASA 4OCSH 5C08E 5IG7B 1KJ2B 4A66A 4A7GA 2O6FA 2G60H 1H19A 3C87A 1J1OH 1GC1C 3U7YL 3MNWB 3PHOB 2BW4A 4N3UA 4LB8A 4DN3H 2XU9A 1UXWA 2BVOB 2C7FA 4UOQA 2X6VA 2R69H 1ED3A 4RETB 4NUGL 5DJ6B 3PQYE 1C5BL 2CE6A 4B9CA 2NUPA 3AQZA 4DEWA 1JAEA 1CG9B 1U8NA 5I15L 4DKFH 4OLYH 5JOFA 3ARDB 3QCTH 4B53A 2R2CA 3RY4A 5C0CD 1Q9KB 3EJYD 3ARGB 4AC2A 4G6AD 4QXUL 5KBPA 2YBRA 2ZYRA 4K71B 4UOJA 4IOSD 1NAKH 1S5IL 4KJPD 1KENH 1UT2A 3DHMA 4GS7C 2DV6A 4W81A 1EK3A 3ZL4H 2GJ6B 4UQ9A 1K3IA 3RZCA 3DPBA 4UINL 4PG9B 4BQ9A 2Y1ZA 1U8KB 1RUQL 2LABA 5ECJE 3WYRA 4Q4EA 1HHJA 4IK6A 8FABA 3EXLA 1AI1H 2GEEA 3HI6L 3N85H 2OL3L 2F1BA 1TYEB 4N1EA 5IROA 4M5ZH 2CA3A 2WWKT 1GC1H 3KS0J 3ZKSD 5HYSB 2C3GA 1XZ0B 1UHVA 5MEOA 1EAPA 4HFUH 3EYFA 2X44D 3M17A 3LD8C 2WCSA 2F53D 3F7YA 3PV7A 4M7LT 1GZHC 2BZ7A 2FK9A 2YAOA 3L7EA 2V17L 4FLRA 3RA7H 3S36X 1CZ8L 3VFVA 1WHPA 1QWHA 2WAHA 1CE1L 3QO0A 3N44F 1NCDH 4KKAD 2P47B 4XOAA 1T0OA 5I6PA 5I6NA 3A6BH 1NWPA 1LEIB 3DV4A 2DOCA 3C5ZB 3I75A 3QB7C 3LNGA 4NZUH 2VB5A 1SXZA 2CUMA 3NZHL 2FSDA 3H0TA 2VZ3A 2CR6A 4O51A 1O0VA 1UADC 2WB7A 2D0GA 2ESVE 2EECA 3EFFB 1T7XA 1FVCA 3BE1H 4J8RB 3KR3L 5HYSG 3ZMEA 4QPEA 3HC3H 5IREA 4XR8C 1SM3H 5DHDA 1LNUA 1FZMA 3CLEL 5CU5A 4LNRA 1MNNA 2YGOA 3KLAA 3VA2C 1F3RB 1LMKA 1AGEA 3HZKB 4D9LL 1JNHA 4MXQD 4TL5A 1PZ5B 1JI1A 1IC4L 3DGDA 1X4YA 4ZPTB 1NUFA 4AVJA 1KPVB 4GQRA 1EAQA 3WU1A 1NFIB 1QW9A 2Q76A 3FSWA 3S5LB 4UTAA 3OKDB 3S97C 5FA3B 1QPKA 4FQPA 3DTDA 5I9QB 1TTRA 2B5IB 1NINA 3UP1A 5K5YA 3O6LL 3BT2H 2XWDA 2PWEA 5BNXD 3SZKC 4HC1H 3FO9A 4PWFA 2OM5A 3ULUH 3UPRB 2P26A 1WWCA 3P3UA 3IN0A 2PXYD 2Q20A 2ALAA 2DIBA 4Z77A 2OP4L 4HS8H 5KSVB 1JZGA 4HIJA 1QRND 4TSAL 1E7VA 1TU2A 4MD4B 1QMUA 4ZUTA 3QG6A 3VFWB 4JRYA 2IDTA 3IB4A 3RRQA 4Z7IA 4M6MH 3IRCA 2R9HC 5IMOA 1B0IA 2BC4A 1FYHB 3R06A 3W37A 5CGMA 2J88H 2Y6SD 1XGUB 2F68X 5E03A 3QEQB 4OQTL 1YCSA 3PU7A 3UJTH 4UAOB 4WU5B 3UO8B 5AW1B 1UACL 5AYQA 1INEL 1VEPA 3CFKA 4JVWA 1P4LA 4YX2L 3U25A 4NRZA 3RGVB 3RWJB 2ROXA 4KITB 2ZOKB 1QSEA 1PNDA 4K7PH 3TEWA 5I73B 3OMAB 5CLZA 4FFYH 5C70A 5LO7A 1SXNA 1IQDB 1WS7A 3AWEA 3RFZC 3P30L 5D8JL 2W07B 2XFXB 4G80B 5IP4A 5I1HH 4QUOA 4MKTA 2NNAA 1E90A 3MUUA 3EYUL 3STLB 4MNQA 4DQOH 2DMGA 3FT9A 3GRWH 1MI5D 4B9FA 2QVTA 2DD8H 4HJ1A 4KNUA 5BCAA 2FH8A 1LO3H 3NCFB 4IBYA 1J1XL 3LZPA 1NTDA 1B3IA 3AB0B 4LEOA 1A7RL 4OF5A 2KZKA 1F18A 5EN3A 4HUWB 1AGDB 2BVTA 5DK0B 2A83B 1TCMA 2CAKA 5DFTA 3CHRA 3ZVVA 4Z7OF 1MCBA 1QSFB 1ZVNA 2BSSA 2XTSA 3FCBA 3K6NA 2C9PA 5DUPL 1EHXA 2R0KL 5L8KB 5HGDA 3W3BA 5DJDA 4URTB 1DCEA 2IV9A 4U6VH 3X14A 1ADQH 1BX2B 4MDRA 4K8RL 1U95B 5A2FA 5KVDE 3H9HB 1I8IB 3PXJA 4P2RA 5GGVY 3ILQD 2QSCH 2Z1PA 2XWTA 3DGGB 1CFSB 1RUPL 4F15B 1UH4A 4X6DE 1ETZA 4FQ2L 3U7WH 1WH0A 5DD5H 1CB4A 4NENB 4J3OC 4V1DD 3CFIC 1CE6A 1G6RL 3M45A 5D1QD 3ARVA 1CFNB 3LXBA 4JFWA 1GTFA 2NY1D 1ZLVK 4LVNC 5CD5D 4XOEA 3VYPA 5AW5B 3C6EA 5JW3H 4Y5XA 3L81A 4V2CB 2WYTA 4N24A 4UIMB 3CNKA 3MOAH 5GSRB 3BP6A 4OLXH 4PGBA 4ZQTA 2DPKA 3QJRB 5GZOC 1FCCA 2HJLA 3A4EA 3IFLH 4TUOB 5I1IL 2ADGA 2ODIA 2ZOTA 2ZP0T 3OKOA 2G5RA 3ZMNA 4PY7A 2X0VA 2J56A 2RMNA 3INUL 5I76A 1NC4B 4GSDH 4R84A 4G9FE 4TL4A 4HUKB 5T1JA 5CINL 2MCAA 3PDOB 5L4IA 4JPVH 4S0HA 3DSNA 4KK5D 3C6SA 2NXYC 1GOHA 4POZC 5F44A 4ZUSA 3FUDA 1E4KA 4Y16A 1QP1A 3QNXB 1XF2A 3DTXB 4X98A 5AL0A 1JTOA 3HI5L 5FHBH 4ZYKB 4J3WA 4ETQB 2GTWA 5SWSE 1F90L 3FB7A 4ZS7L 3PS6A 3L1OL 3OKMB 4KQ3L 2AEQL 4ZOEA 3G5XA 4BJLA 2EVGA 1PEZA 4CSSA 5IW1A 1U8PB 4R7NB 4JGJA 1XD1A 2K78A 3ZDWA 1EZUA 3B83A 4LMQI 4APQD 1FGVH 1HZHH 3CFBA 4WTWA 2A38A 3LKRB 4LNVA 3QIBB 2BNRB 1YYML 5L2JB 1AXTH 3KNBB 1AGCA 4FQHA 4PBXA 4R90L 4WI6A 4CN6A 1BGXH 3VXRD 2XWZA 4J4PC 4KC3B 4LARL 5I8OH 2JVUA 4ZK8A 2VAJA 5K39B 2CKBH 4ADIA 5HHMD 3G6JA 1YQ2A 1OZTG 3L13A 4TVPD 3VXPB 3OKNA 5F0LB 3MRGB 1KJVA 4O02H 2C9UA 4G8IA 3MJGX 3SDAD 2ZG2A 4HG4J 1Z9OA 4HU2A 4EIGB 3ILEA 2R15A 3GB7A 3TT3L 1SJHB 1ZE3C 5J1AB 4X6CE 4OGYL 5BJTB 4NQEA 3VB8A 2ZQKA 2X4UB 4EZKA 3ZYJA 4U1IB 5T33L 1MFEL 2FJFB 2P5WB 2OSLB 3QDGD 4QWWC 1KJ3H 4F2MB 4E0RB 2C1PB 1MHPL 4JY5H 1BXUA 1DLHA 1IEBA 4JO8A 3A3YB 1NIEA 3DMMD 3MRFB 1UM4H 1Q1JH 3O11A 5AVYB 5FV2A 1F11B 2K1MA 3CDZB 4JNXA 2WCPA 4AZ8A 3O9WC 5DHVH 3LKQA 1K3ZA 2HJKA 4PWGA 4GSXA 2H26B 5D1ZC 1MKFA 3VXUB 3W0WB 2IFFH 4MZ3A 1JPGA 1V8HA 1RZGA 1Z9SA 2UWEF 5KYUB 3N91A 4M7ZC 2PYEA 2X4NB 5I5IA 5ISZA 1IAOB 4TS6A 4MAYC 3V6FA 2FIKA 4P4KA 1KPRA 1R3LA 2WLIB 4GIOA 4WAFA 4HS6B 3MFGB 1DLFH 4GKSB 1OSZA 4HKZB 3FT3A 4WO4A 3V4VL 4BQ6A 4I18B 43C9A 4CADB 3P4NA 2FJUB 4Y1AA 4ODBD 1A3LH 1TUPA 3ARBD 4L4VB 3ZSTA 1FBIL 2C9RA 4JUSA 4EPSA 1ORSB 3O6FC 2R29H 4JFDE 4OCXH 1UVQA 3MI6A 2DQEH 3STZB 1E67A 4LGSB 5C1MB 1IFHL 3MZTA 4XX1G 4FQLL 3T0EE 4BUHA 1D9KD 1NM4A 2IPKA 2Y2YA 1MAKA 3AU0A 1QABA 2W0LA 2YJLA 4M02A 2VDLL 5AKTA 3PPEA 2OK0H 2QQNH 5JO5A 1PG7X 2Z0BA 3B7SA 2GPZA 3IS1X 3BIAX 3UTSE 2LLLA 3PV6B 2QPSA 3P4LA 3QXTA 2CLZB 2VQ1A 5B39A 4IBVA 2W8CA 2Z4QA 4LMQE 5JLZA 1SDDA 2GFBB 1YUHA 1NFKA 4NN6C 3LKSB 3BH8A 2NNRA 4HDIB 2G9HB 2VLKE 3P4MA 4IRSD 3ARXA 2VL5A 3QPQD 4JFHE 2YIHA 3VM7A 1S78D 4MD0B 3PGCA 1B4JH 5AZUA 2X4PB 1GHFL 1RZ8B 2MOGA 4NQSA 1IGIL 1EMTL 3BKML 1NMBL 1A6AA 5DK2B 1JXKA 1UM6H 3I74A 3MRIB 3SQBA 3CSBA 2ZXBA 1CIDA 2FD6H 4YDLC 5DMGC 3V9EA 4AIZA 1F58H 5AD0A 2QQLH 1FH5H 2VE6A 3OHXA 3MRNB 2GITA 2G3MA 3QVAA 3QPXL 3CH1A 1HKLL 4N90D 3P77B 3PUCA 3VRJB 4N3TA 2GW5A 5D1XE 4NUPA 3U6XA 1CFQA 1B6UA 4GRMA 3HMWL 4MRCA 3BVTA 1KBVA 2FO4B 4Z8FH 1A5FH 3TPUB 3ZIYA 3UJJH 1KUMA 4XMKH 3VI3A 1ZXKA 3BQUD 3QUYC 1KIRB 4GKZB 1YN6B 3H3PL 5IHZB 4FYRA 4AYGA 1PDKB 2WK2A 1A3RL 1MFVA 4H20L 4ICXA 4U0QB 4YHKL 2IPUG 4QAMB 3TBVA 3DNKA 4GSQA 4XPBH 4JPKL 5CJ5A 4FQXD 4NJAL 1C9SA 1F8TH 2LHAA 2X1QA 5LG6A 5EU6D 1KN2L 3RVVD 1GMIA 2COQA 2I24N 3HS0B 4IU2A 3MFFA 4UB0H 3MBEA 5E8NA 5IR1B 3TV8A 1SLVA 2GI0A 1OD7A 3D3VA 4YDZA 2F8IA 3QORA 1TFPA 1V5JA 1E5YA 2HT2D 3KPQA 3OLEA 1A1OB 5AVQB 1TEYA 2A4CA 4FNLH 2VR6A 4AIEA 2HT3C 2QPFA 5HD8C 4GH7B 4OFKA 3PP4H 2V5TA 4J12A 1ZGLA 8CGTA 1AHWB 3NUKA 3WXWH 1SUJA 4ZD3H 4LLQA 5GS0L 5J57B 2OSYA 1BLIA 2OMTA 2VZ1A 4RMSA 3EZ8A 3S96B 3LZNA 4UMGA 2E4FA 3CU7A 2EZ0C 5A3ID 4N0CD 4P46B 2DI8A 2WXGA 2GK0A 2KH2B 4FQJL 3JVGC 4G6ML 5AOIA 4JG1H 2P5EA 4URKA 3MV8D 1ACYH 2FH6A 1T1XB 1MJJB 3MLZH 3NJIA 1YHPA 5I0XA 1AR1D 4FQ1H 3HRZC 4YZFE 1NFDF 1TNMA 2LTQB 4JHWL 5E24E 5E8EB 2NTSP 1CS6A 2ATPB 1CDUA 2YA1A 4O02B 4UT9A 3VD5A 3JWOC 4NHCL 1D5IH 3WIIL 5FDYA 4G1MB 4ELMA 3QARA 3LQAH 4N87A 5CSBA 3RVTD 2FECL 4GAJH 4S1SH 3DRTA 3QZPA 4MA7L 3W9DB 4RA0C 2B8OT 4EE2A 5EC2B 5DT1L 5C8JA 1HAWA 4MJIB 3MCLH 2W91A 2CK2A 1ZWIA 3IJHB 2L7JA 5DJAB 3APCA 2WTOA 4I2XE 3RHWK 3SO3C 2GBTA 3TO4D 5JXED 2FEJA 4WW2F 1KTLB 1PKQB 3LZFL 5DHVB 1ET5A 4HCRA 1H3GA 1Y6KR 4QTIL 5GSVA 4QF1A 1OF2A 5AVZB 4XNUL 3MJ7B 4FG2A 1H15B 1L9PA 2WTRB 1DFXA 4Y19A 2V2WB 4GRLC 3BGAA 3T04D 1PBYA 1MCJA 1FGNL 4N2IA 1UT9A 4HS3A 5JYLA 4K3DH 1RMFH 4OZGA 1P2CA 3ULSA 4UTBA 3SKNB 3G5ZB 3RJQB 2BOCB 1X5KA 4G70B 5DJXB 2GIYA 1JIBA 3OXSA 4OJCA 2ADJB 4PV9A 2AEOA 1KBGH 4GW5A 5EO9A 1NCWL 1FCGA 3EXJA 12E8H 3HAEA 4RGMC 4G8GE 1N64L 1PLAA 3DJTA 2ZXQA 5EU3A 1LLAA 4ZX4A 1SVCP 1W0YT 3EFOA 2MQGA 5D2NE 1OIOA 5C0DB 1ET8A 1IKFH 3TYFB 2D7QA 4OBSA 3HPJA 5HI5C 5I6KA 4XP9H 1DJHA 3A6CH 3FFCA 3PAUA 4XCNA 5KANI 2NX5B 2Z93B 2QADD 2AK4B 2QKIA 4XO5A 2ATKB 3KXFA 4GI6A 4R26H 3SDYL 1FSKB 2Q1EA 2MH4A 1B0GB 3B9KC 5EZLB 1K72A 1OGAD 1Q90A 1A8ZA 2COVD 3MYJB 3MV7E 5EF2A 3WY2A 2VXSL 3WEXB 1AH1A 1A1NB 4PB0L 1E2VA 1RD6A 4HPYH 2DQHL 4TULH 3W39A 2AQPA 4XE5B 4AITA 3NJMA 3V79C 1AS7A 1MAML 4ERSH 2A6JA 1U8LB 5EIIG 1LEGA 4HUMB 5LJYH 4EZMA 1WIUA 5M7QA 1TCRB 2YUZA 3LQMA 4RGOH 5D4IA 4BE6A 4LSQH 4TSCH 1IBGH 4L37A 1HJCA 2VDNL 1AD9A 5I23A 4MTMA 3ZKMC 3AUVA 2XKSA 4XCFH 4QNPE 3KLLA 5EB9A 4GG8A 3ZOAA 5I30L 1BHGA 4MZ2A 1P7QB 5FHAL 4EN3D 5I1KH 2WQXA 2FIRT 5D70L 1VEOA 4QRTB 3G5YB 4OCNC 2X4TB 3OKKA 4IDLA 4JO2H 5IVZA 2BY3A 3I6KB 3L3HA 3TF7C 5F1IA 1XBRA 3MJ9H 2VSKB 1KB3A 5CCHE 2YAEA 4YC2C 5J6GA 3M8OH 3ESVF 3QCUH 3B5GA 2ISDA 4Q74A 1F3JA 3QJTB 2GSIA 3MV9B 4WCYH 3V5DA 2VOTA 4QKTA 4ZODA 2KPNA 4HMCA 1MFBL 2WNXA 3RNQA 3IT8D 2WZPA 4K94C 3ZBMA 3T5WA 1NEUA 4L8SA 3U2IA 1E4JA 2Z92B 4CVZB 4F3FB 5E1QA 2EIZB 4S2SB 5J1SC 4FOMA 4JFUA 4WLCA 5DD1L 3REVB 3UCQA 3NJHA 3PL6D 4D8PA 3LAFA 1XB8A 1UWXK 2YA2A 3FYEB 5EPMB 2BJML 2GBUA 2MHAA 2P7TA 4XCYB 5CBEA 1MPAH 4GQ9L 3CZKA 4PHXA 5AW7B 3SY0B 3WAJA 5ABZA 1JOIA 1M05B 3N42B 1UKSA 1UM5H 2VH5L 3TN0B 1I1AD 1URLA 5MENB 1T66C 3F7VB 2OJZH 3TVMB 1OCZB 2BSED 4BQCA 1BFTA 5INDA 2ZKYA 3WY4A 4D94A 5C09E 5K9KB 3VG0L 2J55A 4JN1L 4XC1H 1BMZA 5KSAB 1A6TA 1U93A 1ILSA 2Q2EB 1JMZA 5M95B 1MFCL 3RWCB 1ZK9A 3FB8B 1HEHC 4JY6B 4Z7VB 1T83C 1DN2A 3IMTA 4HZAA 1CUOA 3F83A 5CZRA 3SYQA 3UJIH 1QQDA 2W0FB 5JHBA 3EGDA 3MUGB 3EBHA 1UC6A 4D3CL 4RWYH 5DF0A 3O41B 1AJ7H 1U8MA 5F6HI 4P48A 2HTKC 3AXHA 4JFTA 3L4UA 3NJJA 3KLQA 4NZRL 4AGNA 1ZEAL 5SWZE 5KS9E 3TURA 2LU4A 4YPJA 3FTGB 2O5ZH 1BWMA 5E9DA 5EOTA 2OMBA 1I1FA 5JHLL 1X5IA 2K3TA 4NT6B 4P8QA 1BBDH 2HLEB 5AVVB 1E3ZA 4KUCD 3K4ZA 3JWNG 3X1FA 2JLLA 2E9BA 3ULVH 4XB8A 3D52A 4A6YA 5TH2B 2FBJH 1X9UA 1ZT7B 2BNQE 2EXYD 2W65B 2VDPH 3OHMB 3M7OA 5IHHA 2B14A 3FRPB 1N0LA 1D6EA 4ORGA 4DP8X 3GC3A 4UDTA 4HJEA 1P4IH 1PZ2A 2KUTA 1U91B 3AY4C 1DEEA 5KVGH 5HHNA 1WWWX 1NFAA 1S7TA 3WFEH 2P8MB 4ODXA 1HN1A 3UO1L 4JFZH 4QHKJ 5FX3A 3GLZA 4HOMA 1OXYA 3RVXD 1YO4A 1XL4A 5DQJB 2X4OA 2HUHA 5EBWB 3PNWB 1TIUA 1N59A 3D39A 3HBZA 1K5NA 2NY2D 2YGVA 2VDOL 4KPHL 4BFJA 2BP0A 3H8NA 4N2EA 1G7MB 1IGFH 3D08A 3VD0A 5T1KA 1A4JB 3HBQA 3ZYIA 4YFDB 5GS2D 3WGVB 2BY1A 1EXHA 2PPAA 5C0GA 4TKWA 3D0LA 4YZWA 3X17A 1G84A 4RMVA 2HKHH 3W2DL 1CDIA 5HVHC 5EA0L 5JMRA 1A7QH 2DKUA 2V9QA 2CM6A 4CSTA 4KTDL 2L7EA 2VT0A 4IRJA 5E08L 1RHHA 3RL2A 3EGSB 2DL9A 4RX4A 4Z95L 5DRXB 1GJWA 4U1HB 1SLXA 4YPGA 1JZ7A 5DD6A 3QRBA 4OT1H 2H1PH 1IEHA 1F13A 2B15A 2L8AA 4PJ5B 4Y2DC 2NNFA 2K4AA 1EZVX 5IG7A 2LAAA 1NBYB 4EI5C 1ZTXH 4JHBA 4L4TD 1MRCH 2CIIA 4IS6B 3D25B 3TNNB 3BT0A 3K6IA 4LCVA 4ZFZB 5KJRH 4J2QA 1UTDA 3MNWA 5H8DA 3FPYA 3PHOA 1CXKA 1KCRH 1MCQA 2BVOA 1IM3B 3MLSL 2TAAA 4ZMAT 2DM3A 2IGFH 5IMKB 1YEJH 3BCFA 3JYBA 3LHAA 1W2KT 4I3SL 4PGZA 5DJ6A 3QDMA 1BF8A 1YAIA 1J1PL 2ADFL 5K1VA 1CG9A 2W1NA 3CVHH 3LS5L 2B9AA 3FQTB 5IY5B 5ACZB 1YQVL 2O5XL 3ARDA 3QFJB 1L0YA 1KGXA 2P46B 5GGTH 5F88B 5ABAA 1SN0A 5CJXC 1MIML 2DEYX 3ARGA 1MLCB 1G7QB 1PZCA 1WBYB 2BXYA 3VWJB 3BO8A 3KHQA 3T3PB 4BFFA 1JRHI 1NUDA 2GJ6A 3NSCA 5J7CC 4WSGA 3CXDH 3UBHA 3F65A 1WF5A 1CDGA 2ZXAA 1AZVA 1NCOA 4PG9A 4WGVB 1OVZA 2HVKB 4F57L 2DQJL 5HI4D 4AQ8A 4MBOA 1IE4A 2NCMA 4YZFF 3H9SD 2O6CA 4PWJA 4GUOA 3ZIMA 1OM9A 3MJ6A 1HJBC 3Q9PA 4AG4H 2Q10A 2UY6B 1XZ0A 4Z7QE 3Q1EA 2DBLH 4PP2B 4ETYA 3ATEA 1LP9E 4QMEA 1BD2B 5CHNB 2APFA 3GMMB 3WI9A 2VM3A 1QNIA 1RSFA 1TETH 3L5IA 4X9HA 3PREA 2EC8A 4KNTA 4WWKC 3TBCA 2CPUA 5I2IB 1M2VB 2KLRA 1OKEA 3SHSA 2WXOA 3C12A 3EH1A 1NOAA 5C7ZA 3S36H 3LHPL 3H56A 1LEIA 1XV8A 4FABH 3P3RA 1IC1A 3C5ZA 3SGKA 5DURD 1J8HD 3NJKA 3QH3B 4Z7AA 1U2YA 4NPYB 4ODHL 5HYIA 2D03H 4WUUB 3EFFA 2OX5B 3L5XH 3LS4L 3P9MB 4N25A 4J8RA 5HYJB 4AMXA 4DK3A 3MRCB 1TQVA 1NJ9B 4PYHA 3VX0A 1QWUA 1QSEE 3LMJL 4K9EC 4HIPA 3HZKA 4A7VA 1UOWA 2GKIA 1PZ5A 4AIXA 3GTNA 3QWQB 4ZPTA 1KPVA 3I9AA 5CIPA 3PG2A 5IOPB 1NFIA 1R46A 4FG0A 4PJXB 3S5LA 3NJXA 4A2MA 3BZEB 3OKDA 1U8JB 5LCVA 1A64A 1W9XA 2BIIA 1T20A 4I88A 5T3XH 4L8CB 4B41A 4MNQE 3AS0A 4FTVA 2A74C 2IPTH 4XXWA 4DP1X 1IZKA 2WSPA 2GAZB 1Q9LB 2X2YA 3DYPA 2XQYK 2VDPB 3UPRA 4GP4B 1PLGH 4YR6B 2QMJA 1JK9B 4M6OL 1NBZA 1R0AL 4R7DB 2V3DA 4NCDA 3KJ4B 3L3OC 2P5PA 4JZOA 2X28A 4YSRA 1IGMH 5D93C 1L9NA 2NY0C 3ZLQC 2PO6C 1AG6A 1NCBL 4WTZG 4MD4A 4CN1A 2FR4B 3VFWA 4WWID 5JW4Q 1PD6A 1W15A 2PPDA 3U9PL 1MREH 4GSRA 2XPZA 5F7KC 5MI0B 2M2DA 3Q6GH 3PXHA 4HULB 1DL7L 1R47A 4UNUA 4UM9D 2YAFA 3SYCA 3T6XA 2G5BB 4JFEA 2ADIB 4N5EC 2KZ1B 1JNNL 1R5WB 1XGUA 3QEQA 3FH5A 4N1HB 4QRBA 4QRRD 4KRLB 4B7IA 4DGIL 4JJHA 5BV7H 3POHA 4WU5A 1W0WA 5DZOA 1UB6B 3U4BH 2A9CA 5E23A 5J1TC 3T8VA 3RGVA 2YQGA 3VA6A 3RWJA 4PSPA 2CO4A 2ZOKA 3GBNL 5LWYL 4Z6AT 4I0KA 3GUTB 3VQ1C 4KWUA 2W07A 2XFXA 2VLJA 4G80A 3NEXA 3JWDL 4Y7MA 3D2UB 3PWUB 2Z64C 1F86A 3STLA 4LRNL 5C86A 1BZQK 4CMHC 2N59A 5IQMA 1AO7D 4L8BB 2Y0SA 2CG9X 1FLRH 1D6VH 2NY6D 3HE7C 4JM0A 3Q2VA 2H32H 3KPRB 4LIQH 4HUWA 1AGDA 4MMXC 5DK0A 2A83A 1HCVA 2R69A 4UIKH 4NSKB 3S4SG 3SE9L 1BQLH 2ZCKH 1UFUA 1O9VA 3CZNA 2B4CL 1KZQA 1JPTL 2AXHA 3H3KA 3LRSB 4PRHE 1AGBB 1K8DB 3MZGB 1P84J 1KT2B 1U95A 5D7JC 3H9HA 1I8IA 1BAWA 4QT5B 4YL9A 3MLPA 1WK0A 1YECH 1AKJB 2N56A 4LSDA 1GOGA 1CFSA 4PJIF 4UOW1 3LH2H 5J3HC 4HQQH 2BOBB 3O3EB 4ZAKB 3PHAA 2DB8A 4QHLB 2BSCA 4G5AA 4B0MM 3T09A 1NA8A 3IXAA 2XTJD 4Y16D 3L2LA 1SYVA 1MHCB 5JHMA 1CFNA 2AV1B 2DQGL 5DVOA 3LJ3A 4H44C 4Q0XL 1R6VA 3QJSB 2EO9A 2H4EA 1UD2A 4LLUB 3N40P 4UIMA 3FU8A 4O2FB 5GSRA 3G6JE 4OCRL 3CSPA 1A4KB 1WZ1H 5INCB 4R2GC 1UZ6E 1K4DA 3FNKA 4TUOA 1EZSA 3E38A 3EOTL 4OFQA 4QJ4B 2Z91B 3S5YA 3VXQB 3NIFE 4LF3B 2E8YA 3L5JA 5KS9F 4ENZA 3BPNB 4CILA 1JHKL 4JN2B 4RMUA 4M1GH 4NQEE 2IOIA 2D7TH 2YHGA 1NC4A 5DRZB 1FL3B 3DGCR 2WWMD 2J8UF 3PDOA 4Q56A 4CJ1A 3FFDB 4JFOB 5DVKA 3EKCA 4EXPX 2BSTB 3X1NA 4FG4A 5LXVA 1OE1A 3DTXA 1OARH 3RKDC 1O7DE 4I5BB 5CEXB 4A7GF 1XH0A 4I89A 4ZYKA 5BUPA 3F00A 2PCFB 2CUHA 3EYSL 3PWNB 4O00A 1FZJB 2E5EA 3ESUF 1QFHA 2PYEE 4KDVA 4KKCD 5F9OH 3OKMA 2XQ0A 5BQ7B 1USZA 3QUXB 4M8RA 4WUKL 1L9QA 1PG7W 1FRGH 3KVQA 4FFVC 4R7NA 4KKLC 3FXIC 2H3XC 1CK0H 3DJRA 4Y1TA 2AQ1A 4N8VG 3CVDA 3NTCL 4B5EA 3LKRA 3QIBA 5JIDA 5L2JA 3WFCL 3U83A 3KNBA 3CN4A 4F33B 4HMEA 1YYCA 3DA0A 1BZOA 2G3NA 3REWB 2XFGB 4ZOAA 2EIEA 3N43B 2ORBL 3HZ3A 2EKSB 4D0CB 5K39A 2QPEB 2APSA 1WP6A 4LSVH 4WK0B 3GRBA 4PJHE 4UOW0 4N2DA 4XAWL 3HW7A 3MRGA 4LSRH 4XP4L 3WJJC 5FCUH 3R4DA 4HC1A 3Q48A 2DLFL 2VERN 5EZOL 3UERA 3Q01A 5FV1L 2X4QA 2UX6A 1GVIA 3ZE2E 1SJHA 5J1AA 5I1CH 3FH8A 1RU9L 4LESA 3MKGA 5JUEL 2X4UA 1CFTB 1NLDH 2X3BA 3FOLB 2DS4A 4U1IA 4U7KA 2FJFA 1FO0L 2KLSA 2N0KA 2P5WA 4R6UA 4F2MA 4E0RA 2C1PA 1RJZB 3MRFA 3MLWH 4QTFA 1GGUA 1F11A 4JE4B 3CDZA 1FNHA 3FCTB 2YEZB 4NWUL 1KGWA 3V0VB 2YK1L 2H26A 3VXUA 3L9YA 2JH2A 5DJ2B 4G72B 2OA9A 5CZVH 3QAZC 4YAQB 2GABA 2WP3T 3F84A 5BV7B 1XGYL 5KYUA 2IO5A 2R4SH 4DCQB 2X4NA 2XA3A 3GTTA 4NCC2 3DETC 2BNUB 3C6LC 3IBOA 4S1RL 1M1XA 3S34H 2CDGB 5AB9A 2WLIA 4J1UA 4PVMA 2ZCHH 2EDNA 4HS6A 5D6DC 2JJTA 4GKSA 4HKZA 1TQCC 4PJEB 3EDEA 4CADA 4I18A 5I75C 2P80A 2IWEA 1QBAA 4ZMYA 5CAYB 1P4BH 1FC2D 4Y5VA 4L4VA 4UYQA 2DIEA 2YC1B 1ORSA 3G5VB 2NYZA 5CCGE 1ZSDB 2B1OA 3STZA 2N7SA 2WLZA 3F8UB 4YWGL 3GRWA 4NKDA 3TEZA 3NZSA 2HWZH 1HEZB 3VDAA 5DFVC 3U4EA 2JJVA 1WBXB 4TV3A 5C0FA 5GJSH 4W4OA 3PV6A 2XWXA 3ZRSA 1DCLA 2NZIA 4BZ2A 2I9TB 2CLZA 1SOXA 5J8OA 4ZX6A 2HX7A 2WQSA 1PG7H 3A24A 3RP1A 1RULL 4NFBA 4XP1L 5EF1A 3LKSA 2VQTA 1KC5L 3D3VE 3ZTNL 3NN8B 3WTSA 4HDIA 2G9HA 2HPOA 2R56H 5EUOE 3BSHA 4FI8A 4M7JL 1ADQA 4MD0A 2X4PA 5GQBA 4ZXBD 4Q6IC 2OYKA 1RZ8A 3K1DA 3RIKA 3CZLA 3MRIA 3QYCA 4HUUB 2CJTA 3CLFL 2QKSA 4QHUB 4PRID 4ADJA 2MQ0A 4G42B 5BO1L 4OCYL 4X7SL 5FFLA 1KIPB 2HJFB 4NM4L 2BHZA 3D06A 1J10A 1EZVY 2IJ0C 2PKDA 5JW4N 5H35B 3GNMH 1K8IA 4FQQB 3EYOA 2P5EE 1WWBX 1AG0A 1E8WA 3VRJA 4O2EB 1MLBA 3MGTA 1M2OA 2F5AL 3MDJA 3QQ9C 3KPMB 2Q0ZX 1OAQL 4BFNA 4N1CA 1Q72H 1NC2B 2FO4A 4GQPH 3TPUA 1EJFA 5AVUB 1YY9C 4NNPH 1KIRA 4GKZA 4X50A 1DJXA 4XBPB 5EULV 1PDKA 4Y7OC 4Z0BH 3RY6C 1EO8H 2P8LB 3B5TA 3NPZB 5ESVA 3H3BC 1FYTA 3A22A 5KVEL 3N04A 4NYLB 3D18B 1LK3L 4QYOA 2NW2B 4U3HA 1XFPA 4MMZB 3ATDA 1SXAA 5BOJA 4CSPA 1DSFH 3VGBA 2C9VA 5IR1A 1KGCD 3NCJH 2WQVA 1U3HD 3AS3A 4Z0XB 2VLRE 5AB2A 5L7XH 4HWBH 4JY4B 3FQWA 1ZGLM 4LDCA 4WW1B 3U36B 5I0ZA 1A1OA 2EABA 5LQBL 4DZBB 4GLRI 2C3XA 3V4LA 3NA4A 3WBDA 1PS3A 3QNYB 1AHWA 1BXVA 3EOYG 2PCPB 3TO2B 2JJSA 3ESPA 4Y19E 4CU8A 4KXCA 4HUVB 5F9DC 5LGJB 1CF1A 4M5SA 1U92B 3S96A 2VITB 4P46A 3K5RA 5J4MA 4WWPA 1PU0A 1PD1A 3OV6A 1T4KB 4AUYA 2HRLA 3FUIA 4N2AA 4ATTA 4KDWA 2I7SA 1TJIH 1T1XA 1MJJA 3CN1A 3EJYC 3ZDXF 2UX7A 4FZ8H 5IEKB 3VB9A 2CKBA 2P48B 2IAMD 1VEMA 1CFBA 5E8EA 1NEPA 1YEIL 2ATPA 1GYCA 3IJEB 4O02A 3DRQB 4UTBL 2XOTA 2RR3A 3WMSA 1LTXA 4G1MA 4NJ9H 3CGTA 1N70A 5JNYB 5IVNA 2Y5TB 4HHAB 4JHAL 2AXFB 2LU5A 1J5DA 2J1XA 4HIXH 3W9DA 2AK1L 2X53A 1QFWI 1A7PL 3FFCE 5EC2A 3ZYZA 3I3DA 4UZGA 2IBGA 3BEVB 1LYQA 2OI9B 4X7FC 1GY1A 2EUXA 3KXFE 4O58H 3IJHA 4BH7A 4EOWL 1PFCA 3WAKA 1IZJA 1D5RA 1S5HB 1G9NL 4F8TA 3TBTB 1FZOB 5DHVA 1KTLA 1PKQA 1YMHB 2ZKHH 2DQDL 5AAPA 2VN7A 3O6MH 4E5XG 3KAAA 2W59A 4KROD 5FWRA 4W70A 4TPRL 1S7RB 3MJ7A 4LOUD 2WTRA 4P23C 5GS1B 4NM8L 2V2WA 4Z76B 1T7WA 4IIQB 4ANWA 2VKWA 4KVNH 5DRNB 2E4TA 4ZFGH 4WSJA 3FQNB 1SLUA 4IDJH 3L3IB 4TQEH 3SKNA 3G5ZA 2BOCA 3HZVB 5DJXA 3KL5A 3ASNB 1N4XH 2ADJA 4PLKC 1LEKB 1U3JA 2UZPA 1AYRA 3NJGA 2R29A 2O93L 2WW8A 3FQYA 1QHPA 1URZA 1WUZA 1YEFL 3QJXA 4GBXA 4QRSB 3TYGH 2AITA 1A6ZB 5AVRB 5T1DL 4YSCA 2WBJB 4PR5B 3AU1B 4PUBL 4N0UE 4HZ1A 4E9VA 1G7HB 1PQZB 3FQRA 1P53A 1N18A 4LAQH 3FK3A 3FU9A 3BVXA 3AREB 4LSUL 4XNYL 5C0DA 1SMAA 5E4EC 4YXLL 1RURL 4NOBA 2PCYA 1BIIB 1A02N 1UWEL 3TYFA 3TL5A 2BY2A 2F1EA 4BCZA 3Q05A 1JK8B 1HH6B 3GHEL 2W9EL 3TFKD 1CICD 2A1WH 2NX5A 2Z93A 3ARQA 2D7OA 4DQAA 5CCKL 2AK4A 2ATKA 2PF6A 3SPGA 4MAYA 4AV0A 1OF0A 4AMWA 4AH2B 5J6SA 1UZ6F 2YPVL 3HI1B 2K4WA 4S1QL 1B0GA 4HJGA 5EZLA 3MYJA 3QIUC 4TVUA 1G9MC 3WEXA 1TQSA 3NIFF 3RTQC 1J5HA 1EERB 2MCMA 3NJVA 2ROYA 4FMVA 1UWFA 3T1FB 2W0KA 2VN6A 2Q8BL 1OD9A 2PXYC 4UT7L 5DC4B 1E27B 1U8LA 2NY3B 4Y4FB 4JQXA 4JS7A 1TCRA 3ECWA 4JO3H 1HYSD 5KJ4A 5C2UB 1I1YB 1Q9OB 4XXCC 5HYQB 4R9HA 5E8DL 1F1DA 3WNPA 2W0PA 2FX9H 2OMZB 4PCTA 4NCC1 1G5GA 3VH8B 4ZZKA 2KYIA 4M7LL 8PAZA 5DC2A 1P7QA 1EDQA 1IM9A 3EYQD 4JMNA 4NKQB 2X2IA 4U6XB 4RWHA 3NSYA 3QISA 3CUPB 2FEEI 3G5YA 2X4TA 4WF7A 1CMOA 4FG6C 3N41F 2DQUL 3CFEB 3I6KA 4GXVL 2WZ0A 4LL9A 4PU2A 4P2OC 2JNZA 2E7CA 1QLEL 2YZ1A 4XVUD 4EKJA 4JFSA 5F7MC 3I6LE 4NN7C 3SDCB 3H2WA 4ELDA 4WEBL 4HKXB 5L2KE 1I7ZB 1KN4L 1RSYA 1AR2A 4QRPE 3MCG1 5E9DE 4FNRA 4ABVA 5KZCB 4HEPA 1G5AA 2FE0A 4NKOB 2W5PA 4Z7WE 1V55B 1VFMA 1Y1UA 3E6HB 1TO5A 3II2A 4ZPVB 4QHMA 4ZTPL 4FCAA 4NAJA 4KGLA 2Z92A 3VH8G 4CVZA 4F3FA 1CD9B 4S2SA 1OAXL 4TUKL 5ERWB 3REVA 1Q1PA 4OAWB 4PW4A 1OTTD 1T7YA 4M9OA 4P3CL 3O3DA 1TZ8A 1BSIA 5EPMA 3QIWA 2EYSB 3JTTA 2JI1A 4AYFB 2I69A 2OJEB 1ETA1 1F5WA 3SY0A 3OC5A 2J6EH 3DXAD 3QAQA 4ZOCA 4Y9GA 1Z66A 4M1DL 1P0SE 3TN0A 3BWUF 3F7VA 3TVMA 1SFHA 4JGNA 1YJDH 3IM1A 2PMZA 2C4FU 3UAEA 1VGKB 2DDQH 4XO4A 5IQ9B 4WW2C 4OD3H 2JB5L 5K9KA 1RZFL 2WNGA 3EHBC 3ETBF 5KSAA 3B34A 1PW3A 4PJGB 4Q4IA 3ARFC 1VADB 3HB3B 1IAIM 1JTPA 1J8RA 4PJ7A 3NIGE 2JCWA 3RWCA 3FB8A 4JY6A 4Z7VA 3CC1A 2P28B 4QI3A 5K59E 4XPTH 2W0FA 5E6IB 4FFWD 1RZKL 2CLVA 3MUGA 5DHYA 3VXNB 3O41A 1Z6JT 3ESOA 3HNVL 4OJDH 5CD5C 4PVNA 3CXHJ 2MCG1 1NAMB 3FTGA 4JRFA 2KL6A 4FNPA 2YQBA 4MJ2A 3RX7A 3UC0H 4DTGH 1LE5B 2CDEB 2HA1A 3Q2NA 3BAYA 2E27L 4CKQA 4NT6A 2Z31C 1G0XA 3VI3F 1XGPB 1PF3A 1QLFA 3KLHC 3OG6B 1ZLWH 1CURA 5ICYB 2F54E 3V0WL 3ARSA 5TH2A 3VMPA 1XTMA 4IW4C 4KNQA 1AOZA 2EEDA 4P2AA 3U48A 5EUKB 4WI2A 2VABB 5C0CB 4AI7A 3LNDA 3FRPA 2AERT 2G3ZA 4KK5C 1BQRA 5ESQA 4DGYL 4KZ0A 1VCAA 2D9QB 2R51A 1P1ZB 4G7RB 5GGRY 1RFDL 3L7FA 4ALAH 4NP9A 2P8MA 3X13B 2E7BA 2ENSA 4OZFG 2JB6B 3OR6B 3QDME 2VXTL 4O5LL 4H8VA 5CP3H 2GBAA 5DQJA 2OSWA 1XH3B 5EBWA 1YEHH 1KBKA 1R17A 1KULA 4W9IC 3TA3C 3RGHA 2OS7A 3NFNB 4X6FB 5EU4B 3DI2B 4NQQA 3WTYA 1G7MA 2GJ6E 3U30C 4K3GA 1AIFB 3HG2A 1INDH 4JFXA 1A4JA 3NCCB 3BPOC 3US9A 4IKNA 5CLYA 1QR4A 2YKLH 5TGBA 2NY4B 5KOMC 2G0KA 4IGBC 4PJBB 3IEAA 1INQB 1NMCB 4MD5B 4MS8D 4YK4C 5ALCH 3SZ6A 5HI3D 4OFYA 2ZXWB 3DVFA 1YC8A 4Z7NB 2LLNA 3B9DA 3E3QE 4ZX5A 4E41E 4EI6B 3EGSA 3KBFA 3DJ9A 1O7SA 4GMSH 15C8L 1JVKA 4ELMF 1R33A 2NYKA 4PJ5A 4MVBD 5I19L 2VRKA 3VD1A 3BKCL 4P2QD 1NBYA 5GRYA 1UB5B 1RUAH 4IS6A 2R7EB 2VISB 3D25A 5AVXB 4NQCE 1DR9A 4ZFZA 4Q6KA 3HN3A 1G43A 3RVUD 3TM6A 4QIRA 4JFDD 4R7LA 1IM3A 1C8PA 5C0RL 4JM4H 4CRPA 5IMKA 4IEFB 5GHWH 4PV1C 3QNZB 3UYRL 3T0ED 3LDBB 5JOEA 1AZCA 2AQTA 4HJSA 1C12B 2JFCA 1BXXA 4IMLB 2XSKA 5D7HA 2XQBH 4KH9A 1LK2B 5CKAA 5ACZA 3QFJA 4NOFA 3WOVA 5F88A 1HL4A 1BYNA 1G7QA 1WBYA 3VWJA 2OTUB 3MJ9A 3OLGA 3TBYA 2BVQB 1CR9L 1E9PB 4DEPB 3GXMA 4OZGF 5I1GH 2DJMA 3I02B 1K4CB 4TVPH 3W11C 2B7DT 4OGAC 1GAFL 1KWGA 4X6BA 3FOMB 5HY9B 4FQCH 2P3YA 2HVKA 3R8QA 3KEDA 1J9SA 3VUAA 2VSDA 3SQOH 2OMXB 3EJQA 4M1CC 2HZHA 4I1NB 3UDWA 1JD7A 1ID5I 2ZPKH 4A55A 5A1AA 4JGUA 2H47C 3LIZL 1N5YH 1EO5A 2A99A 2UY6A 4FTVE 1V7ML 4KRNA 4PP2A 3MLYH 4ZO8A 1BD2A 5EBLB 3RUGB 3ARZA 4QYAA 5CHNA 2WLKA 4WI0B 3GMMA 4G5ZL 1ZLWK 3LB6D 2APWA 2AP2A 2LT9A 3GSNL 3ZE0E 1T2QH 5LCVL 1MDAA 3QUZC 4FL4C 1R3HB 3T3MF 2XN9D 3MGOB 3T2NL 1M2VA 3MROA 3R0NA 3UAJC 3I50L 1ZVSB 5E2UL