4A2DA

Coriolopsis gallica laccase t2 copper depleted at ph 4.5
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
496
structure length
495
Chain Sequence
AIGPVADLTISNGAVSPDGFSRQAILVNDVFPSPLITGNKGDRFQLNVIDNMTNHTMLKSTSIHWHGFFQHGTNWADGPAFVNQCPISTGHAFLYDFQVPDQAGTFWYHSHLSTQYCDGLRGPIVVYDPNDPHASLYDVDDDSTVITLADWYHLAAKVGAPVPTADATLINGLGRSAATLAADLAVITVTKGKRYRFRLVSLSCDPNYTFSIDGHSLTVIEADSVNLKPHTVDSLQIFAAQRYSFVLNADQDVDNYWIRALPNSGTQNFAGGTNSAILRYGAAPVEPTTSQTPSTNPLVESALTTLKGTAAPGSPTPGGVDLALNMAFGFAGGNFTINGASFTPPTVPVLLQILSGAQSAADLLPAGSVYSLPANADIEISLPATAAAPGFPHPFHLHGHVFAVVRSAGSSTYNYANPVYRDVVSTGAPGDNVTIRFRTDNPGPWFLHCHIDFHLEAGFAVVMAEDIPDVAATNPVPQAWSDLCPTYDALSPDDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords LACCASE
publication title Structural Changes Caused by Radiation-Induced Reduction and Radiolysis: The Effect of X-Ray Absorbed Dose in a Fungal Multicopper Oxidase
pubmed doi rcsb
total genus 139
structure length 495
sequence length 496
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2011-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4a2dA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4a2dA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4a2dA03
2XUWA 5I5MA 1M9WA 1BQRA 2UX7A 1J9RA 3NJIA 2FQEA 1NIBA 3WKQA 4L0PB 3ABMB 3WNIA 1J5DA 3FQ1A 3QJTB 4KO7A 3ZIYA 3UAEA 3PCYA 1NIDA 1OCRB 1OE1A 2VM3A 4A68A 3KW7A 3X1BA 2FT7A 1KGYE 5D4JA 1XMEB 4HCIA 2OJ1A 1BEXA 4KO5A 3V9EA 1AZRA 1NPNA 3X2QB 3NSDA 4P5SA 1SNRA 4DP6X 2J55A 5D4IA 1A4BA 3EH3B 3ZDWA 5I5IA 1RZPA 2UXFA 2HLEB 3EH5B 1AOZA 1ILSA 2XX0A 2BW5A 1J9QA 2H47C 4KOCA 3BVDB 5AZUA 1NIAA 3FU7A 2FJSA 1RKRA 1ZDSA 6PCYA 2AZAA 2UXGA 1AR1B 2CAKA 1MG3C 1WS7A 4BXVA 3PLYA 2XX1A 2OV0A 1ILUA 3QPKA 1L9SA 4P5RA 1AZUA 5EHFA 2B08A 3FS9A 2IWKA 3ABGA 3ZX1A 1NIEA 1ZIAA 2PPAA 3WG7B 1NICA 8PAZA 3GDCA 1E5YA 1CURA 3UACA 2I7SA 4GXFA 3UADA 4HIPA 1MZYA 4KNUA 3FQYA 3OMAB 4E9TA 4A67A 2EIJB 2UXVA 1AG6A 1OCZB 3NJMA 1JZGA 2XWZA 1CUOA 1W6LA 3T6XA 2YQBA 4CSZA 1TEGA 1KV7A 2I7OA 2CUAA 2X88A 2AZUA 2XVBA 1DZ0A 2GI0A 1JXGA 4YSRA 2VSKB 4W1TA 3UABA 4AI7A 2VMJA 4E9VA 1PZCA 3OMNB 1W6WA 4GY4A 5F7AA 4HCFA 4BK5C 2B3IA 3IE9A 4PAZA 2CJ3A 2ZONA 4NAJA 1JERA 2YAEA 4DPAX 4NERA 1AZBA 4DPBX 2YAHA 4HCGA 5A7EA 4DP1X 5AKRA 2QPDB 2YXVA 2N0MA 3DIVA 4HZ1A 3FYIB 1KCBA 2BW4A 4N4YB 2AFNA 3WKPA 2XLLA 3ABLB 2IH8A 4G7SB 3NSFA 5F7BA 3WIAA 3EH4B 1PNCA 4GP5B 3SBQA 3T6ZA 5TK4A 1GY1A 2PCYA 1BXAA 5B7MA 1MZZA 3QJRB 4YSAA 1NWPA 4HHGA 1ET7A 2GBAA 4TXVB 1AG0A 2RACA 3T9WA 1SHXA 1L9TA 1NTDA 3AG1B 1HAWA 4RH4A 3NP3A 4JKNA 3FU7B 2JKWA 1NPJA 2GHZA 2NRDA 4QLWA 1TEFA 2Y69B 1IBZA 3NYKA 5I6KA 3SQRA 1UATA 2LLNA 3WI9A 9PCYA 1SJMA 4E9QA 1SFDA 2OCCB 3N2JA 5FC9A 1AIZA 2XV0A 2HX7A 1R1CA 4YSPA 4NB7A 3SBRA 4YSCA 4AKQA 4A2HA 1CC3A 1KDIA 1KBWA 1PMYA 1X9UA 3CVBA 1IUZA 4GP8B 3T71A 3TBBA 1YLBB 2YAQA 2BO0A 4K9JA 1E67A 2BP0B 2CALA 4YSUA 1FA4A 1MDAA 4QKTA 3JT2A 3NJKA 1OF0A 1FFTB 3NSCA 4JHUA 2PPDA 4A2DA 3PXLA 3RYMA 1JZFA 1N70A 3FQ2A 1EZLA 1IBYA 1V10A 3FYEB 2IWFA 2BWIA 3DTUB 4YVUA 5I6LA 1I53A 5I6NA 1EHKB 4N8UA 3SBPA 1TU2A 2YAOA 1PLBA 4WKXA 2FT8A 1ET5A 2H3XC 2PCFA 4AZUA 2Y1AA 2VW4A 4CSPA 1BXVA 1PLAA 3UGEA 1QHQA 2HX9A 2BP0A 4E9XA 4YSTA 3S3BB 1SDDB 6PAZA 1AACA 1JXDA 4HAKA 3ZBMA 1ZIBA 3UAAA 3PAVA 1IC0A 2HX8A 2DV6A 3EF4A 4JHVA 3WNJA 4AX3A 2JFCA 3ABKB 2FTAA 4DP9X 2AVFA 2GSMB 4BXSV 1OE3A 3AY2A 1BYOA 3H56A 1HFUA 1URIA 4EF3A 1ZPUA 2CCWA 1PZBA 1WA0X 1V55B 3OMIB 4G72B 5I6MA 2A3TA 3CZUB 1RZQA 1GSKA 1VLXA 3NJLA 2Q9OA 2DYSB 2HZHA 2EIKB 2P80A 4GYBA 3S8GB 4Q8BA 2XXGA 1E30A 3CDZB 1FWXA 2DWSA 2DYRB 2DY2A 1SDDA 3IEAA 2IH9A 3X1EA 2XXFA 1A4CA 1KCWA 3FPYA 1WA1X 1OCCB 2HRHA 1AANA 1JZHA 1PF3A 4FAAB 1NWOA 2PP8A 4KNTA 1ID2A 4HALA 2R7EB 1AQ8A 3DKHA 1XB6A 1A3ZA 4FA7B 4AKOA 2XYBA 3KW8A 4DPCX 4DP5X 1A65A 3NJFA 3AZUA 3FPXA 3L45A 4A2FA 2TSAA 4YSDA 2PLTA 2IWEA 3ASNB 4E9RA 3HEIB 1BQKA 1OV8A 2BZ7A 1GS8A 1W8EA 3CVDA 4Q89A 4WTQA 3CDZA 3OD3A 1BYPA 2FQFA 4F2EA 1MG2C 4G70B 1DYZA 1QLEB 1JZEA 1OCOB 2PPEA 3X1NA 4UANA 1SHWA 2ZXWB 3ASOB 2GC7C 3QJVB 2W8CA 1B3IA 1TKWA 4DP8X 2R7EA 2AANA 2FQGA 4E9SA 1L9OA 5I6PA 4KO9A 4BWTA 4W9ZA 5D4HA 3MBWB 1BAWA 3NJGA 2FNWA 2PP7A 3NSYA 3NT0A 5B7EA 7PAZA 1JZJA 1GS7A 4YSSA 2P80D 3ERXA 3OQRA 1AZNA 1J9TA 2VW6A 2J5WA 4A2GA 1CYXA 4G7QB 2QT6A 1E65A 1ETJA 1NINA 5I6OA 4M4RB 1GY2A 2BWDA 4ZK8A 2HXAA 2HRGA 2W88A 1JZIA 2XV3A 1SFHA 3H4FA 1NZRA 2IDQA 1M56B 2JXMA 3EHBB 4X4KA 4A2EA 2ZOOA 3FU9A 4UF7C 1IKOP 2VSMB 1RCYA 3TU6A 1E5ZA 1PAZA 2PPCA 2MRYA 2H5UA 1AS8A 4BWWA 7PCYA 4F2FA 3OM3B 2BZCA 3T6VA 5LDUA 1L9QA 3X1FA 2EINB 2IAAC 3AW5A 1JXFA 3JTBA 3CG8A 5PCYA 1WA2X 1WS8A 2GIMA 2PP9A 4HHWA 5AFAA 3N55A 2PPFA 1L9RA 1JOIA 1SF5A 2BHFA 2FT6A 3QJUB 3V9CA 4YSEA 1XB3A 1X9RA 4BDVB 2FQDA 5IY5B 1ET8A 2IDTA 5B1JC 2UXTA 1PY0A 2BP8B 2FWLB 2WO2B 2TSBA 2GB2A 3CVCA 1ASQA 1V54B 3FSWA 5ANHA 4YSQA 5B3SB 2E86A 1PZAA 1SF3A 1WAEA 1ASOA 4YVNA 1F56A 3QJSB 2YAMA 4DP7X 1NDTA 1T5KA 2XV2A 3QQXA 3IN0A 5PAZA 1HAUA 2I85A 2DWTA 1ZDQA 2YAPA 1AS6A 2EIMB 4M3HA 4G71B 4DP0X 2IDSA 2WSDA 1ASPA 2VM4A 3AG3B 4AKPA 1ADWA 2YXWA 3AG2B 3NJHA 4YSOA 5B1KA 2ZWNA 4KOBA 3TASA 1PNDA 3NJJA 3NP4A 2YAFA 4DP2X 1QNIA 1ZV2A 1AAJA 2J57A 3BQVA 4KO6A 1M57B 1GYCA 4BDVA 3T6WA 1PLCA 2YARA 1GR7A 2BP8A 2QPEB 4PCYA 3HB3B 1J5CA 1GW0A 1GS6X 3H4HA 3FT0A 4A66A 5TK2A 5B1AB 4MFHA 5B1BB 2QDVA 1OE2A 3PAZA 1KYAA 3X1GA 2Q5BA 3NJNA 4ENZA 1AS7A 4BWUA 5I28A 1JVOA 3PPSA 1PCSA 1NIFA 2J56A 3S3DB 2GC4C 3FSVA 3GYRA 1XB8A 4KNSA 2QDWA 4E9WA 1A4AA 2IDFA 1CYWA 3IN2A 1BQ5A 2VW7A 2XU9A 4UAHA 1N68A 1BXUA 5E9NA 3IBOA 3GXUB 4GP4B 2UX6A 1KDJA 1A8ZA 4E9YA 4G7RB 2X87A 4F7KA 3QJQB 4YL4A 3TA4D 3AG4B 3TBCA 3S8FB 1JVLA 3MX0B 1J9SA 1L9PA 2IDUA 3D12B 4DP4X 3PAUA 3C75A 2CBPA 3FSZA 3U25A 2MTAA 1AZCA 5B7FA 5B1JA 2WO3B 3S3CB 3FSAA 2VN3A 5I26A 3G5WA 1OOWA 5I5JA 3FU8A 2EILB 1KBVA
chains in the Genus database with same CATH superfamily
4GEJA 1LDPL 2NLJB 1HEHC 4B9JA 1XBDA 1JXKA 4LVNB 5J1AB 3HNSH 4HCRL 1XV8A 1R5VA 2NNAB 1Q0YL 3FHEA 4HS8H 4P3CL 1QLEL 5IVZA 4UV7H 1HHIB 1VZIA 1JUFA 2CGZA 6TAAA 5C0IA 4G8IB 4C56E 3AY4A 5DJ0A 2WXJA 1KGYE 4MQSB 5GJTH 1ZA6A 1AZRA 3DXAB 1RZJH 1NPNA 1JFHA 3QDMB 2FCBA 3OTTA 5TFSL 4ADJA 1SNRA 5BZDA 3NPSB 4U1MB 3QORC 4FABH 3ISRA 1CWVA 2UXFA 3MJ8B 4UQIM 5CKGA 2JKTM 2ESVD 1AOZA 1ILSA 5FUZL 5FYKL 1AO7D 4WI7A 1E6OH 2BWQA 2IXQB 3RPIB 2AGJL 3CFIC 2VLRE 5AZUA 1G7IA 3SKOB 4OCMC 5LN4A 1A7BA 3IE4A 3P30H 4NQSA 2QR0B 2WAHA 4R7DA 3X3GL 4PM1A 3ZSTA 4OGZA 4JFEA 2VT0A 3OXSA 3ZL1A 5G4OA 3QHTC 4XO3A 2DMKA 1FRGH 4YFLF 2EO9A 2UXGA 2NYYD 2YRLA 4BXVA 2ZUUA 1CGTA 3PLYA 5E8PA 1NSNH 1B3JA 4WUUE 3V52L 3ZO9A 5DD3H 1G7PB 1VFUA 1QASA 1DQQB 1IAOB 3MRBA 4C56D 3JV0A 3MLUL 2VDLH 4YPGB 4K8RC 2VSDA 1KN4L 2B59B 3DX9B 1JAEA 1FFQA 1KG0B 3CX5K 2HP4A 1TZIA 4A6YB 4CKQA 2WXKA 1NKOA 4MX7A 3FQYA 3QDHA 4NSKB 3BWSA 4H4NA 1BZQK 4GQQA 4OJCA 2V5RA 1JZGA 5KSBA 1HHGB 1T2QH 5BMFL 2X88A 2ZE0A 1ES0A 1PX3A 2IQ9L 2VLRD 3DOIA 4PVMA 2ETWA 1NJ9A 2V17L 4IIQA 2JQZA 4JFZL 3BIKB 1U33A 2KQNA 3AAZB 3QCUL 4XCYB 1XIWC 2VDNL 2VSKB 3WJLC 5IBLD 3HZYA 4OAWB 5DJZB 2EDJA 4OGXH 2OR9H 3GMLB 5KS9B 1HOEA 2A9AA 2IQAB 1E4XL 5JQHC 5KW9H 1KNOB 2PXYB 4IEFA 4WUUD 4TQHA 5GGVY 5IK3A 2WYHA 4G5AA 3RP1A 5ACLA 5KVEE 2P44B 4MAUL 5G5DA 4GMTL 4DW2L 2GT9A 1A5FH 1KXTA 5JR1H 2QPDB 3D52A 3HHRB 4AENB 1ECZA 4PR5B 5C2BL 3AUVA 1IFGA 5E5MA 3LIZL 2PW1A 2X1OA 1C1EL 1U2CA 4BGLA 3FRPB 4AIOA 1J1XL 5JIHA 3G08A 1SYVB 3R7RA 2VOTA 1ORSA 4XN5A 4OM1H 3IDXL 4HZLA 2IWGA 4HJ0D 3LMJL 5TF1H 5L2KB 4QD2E 2C3WA 2NW2A 3NIDF 2ADJA 5C0BA 3RI5K 4A7QA 5LN8A 3BJLA 2PCYA 1XL6A 4GAFB 3RUGE 2ROYA 3LS5L 1NGXA 5C2UB 1P5UB 5DO2C 4LPWA 3RPBA 2V0AA 2P5ED 4JM2D 1NLDL 4MNQE 4N90E 2VC2H 4M5TA 1MNUH 1QNZH 1TQSA 3PDDA 3VU1A 4AQ1A 2V9QA 4FGMA 4LAQL 1KLGB 5DF0A 3NRFA 3KLLA 3QWOB 2BVEA 4F7MB 1U8JB 5F2FA 3LPGA 5HVFB 3FU7B 5A2AA 4LVOB 3D34A 2X4TA 2P3YA 1U3NA 3TWCH 1WFIA 2Y69B 3GMQA 4BBWA 4XC3L 1SOXA 4N1CA 1D2PA 3D85A 2PTUA 5EG6C 5ITFA 3F8UB 5JXEA 2EYTA 5FKPB 4XN2A 2R1WB 1IKNA 1F4XL 2R56H 3GSNL 1IL1B 2I5YH 1QFWH 3MLXL 3QUMH 2WYZA 4PPTA 3VXUB 3OX8A 2ZYSA 3GRWA 4LCWB 4HLZG 2Q8AH 4QRSA 3ZE0B 1M7IB 1U42A 2OJZH 3TVMC 4ZUVA 5EOTA 4ANUA 5I1KL 1KIQB 1CDGA 3ARGA 4FP8H 1SOQA 1XEDA 4UQAA 1AHKA 1X7QA 1FNFA 2X4PA 5KVFL 1V7ML 1MJJA 1OCWL 4MNQD 3FQUA 4N90D 4ZFZB 5SV4A 3STBA 3GM0A 3WHE0 4EN3C 4YSUA 9CGTA 4BV1A 1S7TB 1HL8A 4P5TD 2Y5QA 4I3SH 2FWSA 2ZKXA 3QCVL 3WMQA 4I88A 1UH3A 1CFSA 3VWKC 4QJ5B 4HSCX 5L0QB 3UZQB 3FTUA 1MCSA 4JJOA 1P6AB 1S9YB 3DUSA 4HHAA 4JFPA 5E08L 1I1AA 1I53A 5I6NA 1OD7A 5IFJB 4NUGH 5K9OB 1UM5L 1BZEA 1MVUA 2WWMC 4Y4KD 5F72S 4U1NA 4HV8A 2BS8A 3PHSA 5FGBA 3W2DH 1SXSA 5HYJE 4ODVH 3UTQB 1MRDH 1NC2A 1PQZB 3D39B 4U7SA 5H35A 3HVDA 1A6AA 3T3ME 2QADD 1GXEA 3OJDB 4K3EH 1GHFL 1ZIBA 3D33A 4RAVA 1OZTG 2FSEB 5EZOH 3V4UL 1AQHA 1TENA 3MODL 1J88A 4AH2A 2B1AL 4JN2A 3FUNA 1YNTA 2MWCA 2FNBA 4S0HA 3CXHK 2YPVL 2GSMB 1OE3A 4KAQL 4PG2A 5FO9A 3VD1A 3H56A 1HFUA 3OGCB 4MHHG 4J8RB 1DQDL 3MV9E 3WXVL 5IGXH 1DFBH 2CO1A 1W0VB 2XWEA 4X6DF 3H9YA 1E6JL 5E00B 3WSQL 4M93C 2EXWC 5FO2A 1DQLH 3UROR 2FWOA 4L8SA 4LSRL 4WEUD 4YDJB 2R27A 4OLWL 2HKFL 1QTSA 1D5IL 1FF5A 4RETB 5IBUB 1ZHKA 1FO0A 3MXWH 4N5ED 3GXIA 1T89A 4KY1H 5HGBB 2C1PA 2IADA 1MH5A 2APSA 3QULB 1PZ5B 3DVGA 2FO4A 2L3BA 3FPYA 1AIFB 1DO6A 1R47A 4TQPA 5C6TH 3WENA 4QY8A 5C07B 2VAAB 2Y7LA 4M1DL 3BISA 3LXCA 4FAAB 1HL4A 1XWVA 2FL5A 2I25N 3Q2CA 4LIQH 2QFPA 1J8SA 3KNBA 2V7NB 4F58H 3DKHA 4ODBD 3TEZA 1HZHH 2XKNB 1QD0A 4X5WA 3GMRB 3MV9D 4NWTH 3NMEA 1JL8A 5I1JH 2YR3A 3AS2A 4K5PA 3D0LA 1T66C 2FHCA 3BW9A 1TTGA 3U4EB 5GSRB 3L4WA 3Q7JA 4HIXL 1OHZA 1RSYA 2OQJA 2C4FT 5I6XC 3CSGA 4G70B 3FB8B 5BVPL 5J6HB 1S4IA 4D0CB 1HKFA 3QUYC 3L4VA 4C56A 4CILA 4UANA 4GAGL 4WWOA 3IDUA 1E9OA 2I60H 3D8MA 4UV4H 2AS5M 2E4TA 4JQVA 3LKQB 4RAUA 4HG4K 5DHVB 4P57B 3DSNB 4CDGC 3RNQA 3MUUA 3W9EA 2VAJA 3NJGA 3O45B 2O5YH 3SE9H 3OKDB 1K3IA 4IIQC 4Q58C 3SE4A 1AR1C 2DM3A 5CO1A 1UJTA 4JHWH 2P80D 2VLRA 3LN5B 3NDZE 5HDOA 1J9TA 4OFPA 3L3OA 1QA9A 2XKSA 1UJ3B 3HRPA 4O2FB 4UQ2A 5D7LB 1XEUA 1NGZB 2WLHA 3FFOA 3FN9A 4AQOA 5I8EB 1Z9MA 2LAAA 4FHKA 8CGTA 4GIOA 2B2XL 2X4UB 4ELMF 5AVSB 4ANWA 1CT8A 3I3DA 2C9UA 4AXWB 4H2CA 2A6IB 1DBBH 3IS1X 5GS2D 2DQ6A 1TYEB 1PZ2A 3MFFA 4U1SA 4XCEA 5DHDA 3LNEA 2C3VB 1Q9KB 3N42B 4UB0L 1E5ZA 4HJJH 4FXKA 5EBWA 4M5YL 1NA8A 5FW8A 1EEZB 5DEFB 5I17B 2E8YA 1OAXH 4AY0A 4IRZA 4OFDA 2X4QA 4K8RH 4LKXB 5LDSA 3HUJF 3IDNB 5EDSA 4W9JC 4OFYD 3ZTCC 4FNRA 4HJGB 1DJYA 1INDL 3MBED 2X89D 2FO8A 4S10A 5E24E 3KJ4B 4Z7AA 4BK8A 4D9RE 5E8NA 1JF1B 3EGXB 2BSRA 2WXPA 1CMOA 4FNTA 1BREA 1KCKA 1W8OA 2DWDA 4AQ1C 3Q43A 5KYYB 4M3KB 5IBTL 2P5EA 3ZSSA 4F7EB 4F8TA 2NXZB 4JPVL 1O6TA 2VGLM 1QWHA 4XBGA 3ZXAC 5C0CA 3GRBA 3QA3B 3LSOB 1KBGH 4XNMB 3VRIA 4B9GA 2DWTA 5LB1A 1JPSL 4LLVB 1YZZA 2Z7YA 2QJDA 4XVTH 2DQFA 4PREB 5JXEC 1FZOA 1JPFA 1IGIL 1IKNC 3LAFA 3MRJB 1TZGL 5D7SH 3KLAA 4O2EA 3TA3C 3TASA 4OI8A 3BC9A 5FO7A 1RP9A 4G43A 4NIYE 3Q6FB 3H2QA 4PJAA 3ZTNL 1MCEA 3W11D 3U0PB 3ARGC 1WBXA 5HGAB 1QFWI 4LSQL 1B9ZA 2ZP0T 1YNKL 3EJSA 4O4YL 2QPEB 4ZFGL 4WU5B 4D9RD 5FAAA 1WZMA 1MFEH 5B1AB 4XHJD 5CLYA 3K2UL 1B0WA 1OE2A 4LLDB 2EH7H 4LVNC 2ISDA 1P7QD 5EZJA 3AU1B 3R19A 3MDJA 4N2LA 3KPRB 1RLBA 4P5TA 3MLSH 4AGOA 4NLHA 3QNZA 3GYRA 4KK8D 1M1SA 5ESQA 4QRPE 4M5ZH 4KXAA 1BQ5A 1QEWA 3ZHNA 2J8OA 2X4NB 4D0BB 2ADIB 5I73C 4I77H 4MMYB 3MYJA 4NKQB 5JOPE 1CVRA 4ODUA 1DBKL 3FCSB 4RWYH 3BT2L 2AJUH 5EPMB 3TA4D 4B9IA 1XF4B 2MPAL 2PO6A 4DQOH 3CH8A 3LKOB 5C0JA 4OV5A 4YBLB 2YD4A 3N0AA 3FSZA 1CE6A 4HEPA 4O5LH 1XZ0A 3VWJC 1IMHC 1J18A 2WO3B 1TLMA 4MASA 1U3HC 5K9KA 5GS1A 2CU9A 4PJ7E 3OKLB 4OZFA 1J05B 5ADPH 4URKA 2WC7A 1M9WA 3SPJA 5CZXD 2H0JA 1NIBA 4LLMA 5I1LA 4IDJL 1M7UA 1OSYA 4J5VA 1U8IB 3FQ1A 3VI3A 4Z1PA 4LSUL 3UG3A 2APBA 3GIZL 4LE8A 3K6OA 2ZG1A 1FFOB 4QRPD 2GG1A 5M95B 5D96C 1R5IB 3QQDA 2VXQA 4H8VA 5GRVK 2WVTA 5C08B 1WK0A 3KPPA 4R0LA 3ZZLA 5E4EB 1HH9A 4R3SB 5JOPD 3HS9A 3R06B 4KKAD 1T1XB 4XN7A 2NDFA 3MACL 4KZEH 5FX3A 1A21A 4MA8L 5H37H 1ACZA 3ALPA 4FQ1L 1TQTA 2J73A 4JY5H 1A9BB 2XQBL 1WISA 2CO6A 5DRZA 3MRHA 1J5OH 1ZV5A 3BHBB 4UQ9A 3G9VA 4P5MA 1GH7A 2DWEA 4OCSH 3IFLL 3PHQB 1FNAA 3GJFA 4YDVA 3ZKNC 5HYQA 1MAJA 1HK6A 2UZIL 1RKRA 5IM7B 1NCNA 1TETH 4JY6A 2VXSH 3VH8G 2YO3A 2WXMA 3MLRL 3HUJB 3LXBA 3U7AA 3MV9A 5ADOH 4R8WH 4HXAL 2FGWL 1HQRB 2IG2H 4H25B 4U7MA 5F3FA 4BKSC 4H8PA 4F92B 4OLUH 4HFUL 2JIXD 4MKTA 3K1KC 1FNGB 1EEQA 4U1HB 3NGBB 4YHIA 1DBMH 4C57C 1CFTB 4O00A 3U0WH 1OCZB 5F9WB 1FGVL 4QRQB 5FYKE 4F91B 4LNVA 2AQSA 1A1NB 3BRGC 4FRWA 4Y16D 1QI5A 1JGUH 1WT5A 2XVBA 1IFRA 4K5OA 2A77H 4ZPTB 5DJ2A 3WJMA 12E8H 3SE4C 4L05A 3B43A 4W1TA 5IV2A 2HTKD 2JCCA 3FB5A 4FZEH 1ADQA 4EDXB 5DVKA 5E2TL 3SDDC 1FZJA 3DBSA 4E9VA 3L3OC 3MUZ1 2QGCA 4KQ0A 5AVUB 4XMLL 4M8QA 3RTLA 3TT3H 1JK8A 4I4WB 3T5WA 2DQDH 5EF2A 5F71A 2BCKB 2NTFB 3ILEA 4U6XA 4G11A 4M1GL 5ICXB 1QFUH 1N59A 3APFA 4Z7WE 4LVOC 3VXMB 1L9MA 5J6GA 5HI4C 1MJUL 5FA4B 3QUKA 4NI3A 2JK5A 3U30B 4FFZA 3S8WA 1W8NA 2VDLB 4L4VE 5D5MA 3J27A 2FBOJ 3HBQA 5EU6E 1H8SA 4JQIL 1KTCA 3APMA 4X6DA 3OKMB 3IJSA 5FYKD 5F0JB 3B3IB 4TTGA 3Q8CA 3TYFB 3T0EE 4QTHB 4KVCH 1DDTA 2WWNA 2IH8A 3VFRB 2AKRB 3BE1L 1HCFX 2R8SH 3E8UH 2BY3A 1UTDA 3S35L 4PRDA 1F90L 1TLKA 3ARPA 3HHSA 3WFBL 1OD9A 2CBTA 3L5XL 5BVJA 5C8JB 2XPZA 4L29A 2D7TL 3D05A 5DI8A 5B7MA 3EYFB 1U8OA 4OFYA 5EU4B 5EULV 5TH2B 4CW1A 1EEUA 2W94A 4C59B 4LLYB 2ARJQ 1JGEB 4KVNH 3EDJA 1I7TB 3N91A 3MBEA 1CGYA 3RWEA 1VGKA 1GOGA 4TNVK 5CP7B 3ZT5A 1J0ZA 1D5BA 4P23B 4Q9BA 1GGCH 2JKWA 4QLWA 2P5WE 2DAVA 2OMTA 4P2QB 4HISA 2AEIT 2DJ4A 1YUHB 4L4VD 5BO0D 2HKAA 3LRHA 4G80B 2EXYD 3X17A 1TVHB 2XZCL 3JYBA 2PYEA 3RWGB 3C5JB 5EWIH 4QGYA 3Q1SL 2HX7A 1B6DA 3T0ED 2C9QA 3CHSA 2B0SL 3IBEA 5EEUA 4NC1E 3UOAB 4LRNL 3MMEA 3HE6D 5IROD 3QO1B 2R2EA 3WTWA 2UWEE 3KVDD 1X9UA 4PJFE 2WCGA 5CJQH 1XBRA 2L7JA 2F53E 4BH8A 3APNA 3B2PA 3NVQA 2ATPA 2VDRL 4JFFA 4GO9A 1E67A 1OIOA 3BVNB 4PG9B 2NUTA 5DJ8B 5DWPA 5I0DA 3PL6D 4OZHE 1FFPA 2KZWA 3B9KD 5HYEA 4X0KB 2EJ1A 3MNWB 3ZT6A 1BECA 2X1XR 3EYSH 4Q9RH 2HJLA 2LGNA 3O2WH 3UDWA 2CZNA 4XPBH 4OM0L 1JZFA 3OJMB 1AC0A 5BQ7A 4MB1A 5F7EL 3FQ2A 1KCLA 3H9SB 2IC2A 2P5WD 4MMXA 2QEJA 4LT7A 3HNTH 3CDGB 4WW2F 1BVOA 3S37X 3IPBA 3UEZA 3FCBA 2HWZL 4HD5A 2DEWX 5BOPA 2OMYA 1P7QA 4PUBL 2MOQA 3X13A 5J13B 4YHNB 3BGFB 4LSPH 1JPST 2EEFA 1V3MA 3CFJA 1RHFA 1N5AB 3OKKA 3UGXA 4V11A 3NFSH 1E8XA 1ZS2A 1KCUH 4WKXA 2FT8A 2BM3A 2EH8L 2CG9X 4NHUA 1SRDA 4FA8A 5I0YA 1BDYA 2WD0A 1ZVSB 1S7XA 5JHLL 1N6UA 2PO6C 4PCTA 2F53D 2G3ZA 5EBMB 1AACA 1UWGH 1OTSC 4HAKA 4Z8FL 3GMPA 1FAIL 3HAEG 4IBTA 1HSAA 3T09A 3MJ9A 4NKDB 5D8JL 2AERT 2AVFA 4UILL 1EGJL 3GRWH 4JO3L 2DIBA 4HDIB 2W0KA 3NBNA 2CCWA 1IC7L 1RK0B 1SN0A 3L48A 4P06A 3Q44A 1NC4D 1D6VL 1QACA 3DRQA 3O2VL 4HUXB 4KXZH 1NFDF 4QHLA 4R84A 5C9JB 2HFFA 3KVQA 5I6MA 3CZUB 4NRZA 1YYLH 5KEZA 1VLXA 4XPFL 2WLLB 4PP2B 2MHAA 1QSFB 4JPIB 1LDSA 2I9TA 3N43F 2ZOKA 4LOEA 4R0LC 1VZHA 4P4RB 3HPLA 4NRYA 1K8DA 3VA6A 4G6FB 4HKXB 3U0TB 2R51A 4NBXB 1HHKB 4CMMB 2DLEA 2XXFA 3CX5J 5FDYA 1WC7B 2SEBB 3C8KB 3ZRFC 5EC2A 4OJYA 1OCCB 2XN2A 2ZKYA 2BXYA 3PWJA 25C8L 1PF3A 2GUOA 2WXHA 5GS3A 3EUUA 2M26A 2XN9A 5D93C 2Z65C 1GYUA 2J72A 3SO3C 2NY0D 2EDTA 3L9YA 5ITBL 2GFBA 5LXGH 3AWGA 1SN2A 2G2RB 3QZLA 4PB0H 1IQDA 3B9EA 3KW8A 1BLNB 3H3BC 4YGVB 4Q6YA 4FFVC 1GMIA 4YSDA 3IF1B 3MCKB 5T3ZL 1BX2B 3FW6A 4D9LL 3FU6A 1N8OE 1RJYB 2XQYG 3VG0H 5LCVL 3T4YB 4ZMPA 4C58B 4GINA 4Y2DA 3OD3A 2XA8H 2F18A 3OAYK 5TDOB 5J57B 4W9LC 3TFKC 1U2YA 5J11B 2B77A 4J2XA 1FYTA 2BLFA 1RVFH 2K8QA 4K3DL 1ZE3C 4NO2B 5DZLA 1SXCA 2MIZA 1CK0L 3BO8A 3JWNE 1S7VB 4QPEA 3D18B 1IIKA 3TBSA 1JYNA 3PDOB 2E6JA 2EDHA 2YPKB 1QO3A 4E0RA 5LBVA 2Y07H 2ICEB 4Y5VB 2Q76B 1YAZA 3OZKA 1P9MC 1M2OA 3GBDA 3U4BL 1Q94B 2YS4A 2LU3A 4J7RA 3ZW3A 4OQTA 1GSMA 1WT5C 4KZDL 1NM4A 4ZPVA 1H0DB 4QXGL 3K2MC 3FQRB 2ZT9C 4MLSA 4XCNB 5ICZA 5IB3B 4OZIE 3EO1B 2FX8L 1T7VA 5FECB 5HBBA 2W1NA 4X4YA 2J5WA 1F6AA 1IFHH 1RY7B 1W0WA 1LNUB 4S0SD 1PIGA 1EHXA 3GKWL 4Q9CA 4WF7A 1AHWC 1E65A 4HCRA 2A0LD 1B4JL 2WBJB 2B4CL 3IKKA 2AJYH 4AW7A 5CD5D 4NRXB 4XCCL 4WJ5A 5F1NA 2Q7NA 2XV3A 3G6DL 1C5DA 1M56B 2C1OA 5CCGE 4Q6IA 1H6FA 3IS0X 2WZ6A 4A2EA 1MXDA 5EFIA 3NACL 3CFDB 4LHUD 4MBRA 1IKOP 5GISH 3BP4B 4V1DB 1ZHBA 1W91A 1QSZA 4ZUSB 4Z95L 3ZO0A 4ABQA 2I24N 43C9B 5LDUA 4BCZA 1L9QA 1YSOA 1F6LL 2IAAC 1UVQB 1MREH 3ECVA 4ZOAA 2AXGB 1UYWL 2AXJA 3ARWA 2PPFA 4JKPL 1L9RA 5GGVL 2G60L 5TDNA 1U91A 3B83A 3P40A 5K39B 4PJCF 4JPWL 3HKZA 2IDTA 4ALAC 1MHPL 1RUQL 2BSBA 4GPVA 3MTXA 1OAQH 1FL5B 2XN0A 1JZ6A 3PWPB 5GZNC 4K3JH 3QIUD 4OLXH 4Y5XA 4GKNB 3PF2A 1HINL 1RZ8B 4HT1L 5GGSB 5I1EH 4N2EA 3QXAA 1YMMB 5JW3L 4XPTH 3W5MA 4Z7WA 5DEJA 4KVPA 5AZ2H 5JUEH 5KSUB 3C5ZB 2ZCHL 1LL1A 4LHQB 2WSDA 1UXWA 1C08B 5BZWA 5AWNL 15C8L 4XCFL 3SDAD 3IGAA 4JG9A 5HPMB 4AEHL 4DCQA 3O6MH 4XX1E 3W5NA 4CMHC 3PU7A 3T0EA 1GYCA 2CJSA 3WEXB 3RA7H 4CRPA 3N43B 3EJQA 3HE6A 3P77A 3VD4A 3WL9A 2XQYK 4HC1L 4IRZH 4W6YB 5DJCB 2BNRB 2R1YA 2OTWA 3L3KA 1CGUA 4FQXA 4OZFG 2A6JA 2PTTB 4OGQC 3UDWC 3GHBL 4ENZA 4YQXL 3R1GH 3TOPA 1AZZC 2FJHB 2WOBA 3B9KA 5JQ6H 3ATEA 3K71A 2C8NA 4G6AC 3U2JA 1A25A 5F70A 3S3DB 2CLRA 4KWUA 2GC4C 4XRCB 2WN2A 3LKRB 2BOBB 4JDVB 1CYWA 2AK1H 1F4WL 2VZ3A 3GBLA 1AKJA 4UBDC 4PRNB 2V33A 2F8OA 3NZ8A 3IBOA 3PHAA 5CCHE 3U83A 3UYOD 1BZDA 3LIZA 1AGFA 5M94B 3S5LA 4YL4A 3GSQB 2NSXA 1U8NA 1UOLA 4Q0XH 4HUVA 3KYNB 5L8JB 3MXVL 5IOKA 4OR1A 4YIQB 3MZGB 4PJFA 4Q97A 1GC1C 1HL5A 2F53A 3NZSA 2O5XH 4LCVA 5KYNA 5IOPA 3VFSB 4OLVL 3BOVA 2BY2A 4K5MA 5SX5H 4HIHB 1CI5A 3DTXA 3ELAT 4OZHA 1U8LB 1BBJA 4CGUB 3UG4A 3QUZD 4BSJA 1ZSHA 3IJEA 3LVEA 4KHTH 1C5CL 1UM6H 4FNLH 3BVUA 2B16A 4EIBA 4KXZI 5CJ5A 5KSVB 2QSTA 4FTVB 3PP3H 4CU8A 2EYRB 2VDMH 1BEXA 4R97B 4ENED 3GSNA 2ZYIA 5F8QC 2YGVA 3FQXA 4D3CL 1EFXA 4MB3A 2MFNA 3QFDB 2HVJB 4DTGH 2NY6D 3RVTD 4ABWA 4N2BA 2OZ4L 3U1PA 3ME0B 1I7UB 1RU9L 4NM4L 1OTTC 1YPZE 2X6CA 5BPPA 1MAML 1QATA 4HG4J 2HVBA 4G8FA 5IW1B 3HPJA 3BLPX 4U0RC 3WUWA 1AGBB 2J1KA 1NFIB 1MJ8L 1S3RA 5A1AA 5J12B 5LG6A 2MCPH 2VLKA 5BO1H 4LP5A 4ZD3L 3F3HA 4WKZB 2B8OT 4JKWA 1ZGLM 1O75A 4HJEA 4I3RL 3U48A 1YYML 1ILUA 4H8WL 1KIUB 4J6RH 3LKPB 2I07B 2HT2C 3RDJA 4Y2DC 1L7IH 3ZX1A 2XC8A 2ENSA 5JW4M 1FDLH 3WG7B 4PEEA 2XT1B 4JPKL 1E5YA 4I18A 2BDNH 1R24B 5F3BB 4WGKA 2KT6A 3R7QA 4PBWD 4AWJC 1MHEB 2OYPA 2NNRA 1GW6A 2VXQH 4WW2A 4YZWA 3MRGA 1MXGA 2BVQA 2GK2A 1L4IA 2XZQL 1XGZA 1IM9D 2IGFH 3EXLA 5F21B 3RVUC 2EE2A 1YDPB 3OKOA 4Z0BL 4ZYKA 5AVTB 1K3ZA 3IK2A 5KG9B 5DSCA 1ZS8A 3G3LA 3NCEB 2GI0A 2GJ6A 2YPVA 3II1A 4GSRA 4XMPL 3TL5A 4B3VA 5ENWA 4L1SA 2VLJB 4LKCA 5BRQA 1V3KA 4PTUA 5DURD 4ZSOB 2F68X 5F7AA 3S88H 1CFBA 1NCOA 2ZPKH 1JERA 2KL6A 2DLHA 3AU0A 1FLRL 1TVBA 2IAMC 1UZ6F 2NZ9C 3W39B 3DMMB 3KPTA 5DUBB 2Y7NA 1UA6H 3ZHFA 4JAMA 5HYFA 3B7TA 3UPRA 1PKQE 2R0KH 4F37F 2ZWKA 4Q6IC 3MJGX 4MNGA 3DVNA 3WOVA 2Y2TA 2VJXA 5F3HB 3GJFK 5FO8B 1AGDB 1FVDA 4PV1C 5EIQA 4L8DA 5EZPA 1ZE3H 2BRRL 2H2PC 1JUFB 1JD9A 3UYRL 4KRPC 4U1IB 3H54A 4GP5B 2E74C 1AGCB 4RLDA 3WUZA 1XH1A 3ESOA 3PGDB 4IOFD 4JLRA 1ZA6B 5MENB 1BMZA 1DVFA 4ERSL 3BUIA 3I2CH 3T3PF 2EIEA 2UZXA 1SXBA 3Q8FA 5AVXB 3WAKA 4U1JA 4R5TA 1N7ML 5FYLL 1UFGA 1Q4NX 1Z1WA 3VUAA 1UKQA 3VCLA 5KJRL 1UM4H 1UQSA 3FQWA 1GOFA 4N0UE 3IM1A 3LEYH 1N0XH 4RZCA 2F58H 4LL4A 4NZUL 2RAMA 1N64H 1OPGL 1QLRA 5ESVA 4TUOB 5C1MB 1F11B 1G7IB 4JKNA 3TP4A 4Y5XC 4LOUD 4NQSB 4PRAA 3LKNB 5MEPA 1ADQH 1FE8H 4R7DB 1H15A 4QHKJ 3ALXA 3SOBH 4YHKL 4JFEB 2F19L 4RMUA 3VYOA 4NKOA 1G1CA 4CU6A 3QIUA 2HMID 1YEFH 1IAIM 5CSBA 1TMQA 4PIRF 4Z7UE 1NM9A 2NR6A 3C9NA 2YK1H 3MUY1 3NJVA 3ZKQD 2MCMA 4XC1L 3THMH 4HGWA 1CZ8H 1MY5A 4H2AA 2V9TA 3TWYA 1UT1A 4XWOD 4FFZH 2AEOA 1WGVA 3VACA 1Q0XH 1F4YH 3VGFA 1RUKH 3SDAA 2CKBB 1QMUA 2K4AA 3BZDA 1TZIB 4Y89A 3K72B 1RK1A 2QKSA 3GK8L 4MX7B 3ARZA 2YN5A 3LQZB 2MSPA 4OSUH 4PWEA 1T1WA 3GIVA 1HH6A 4FQXC 3IMRA 4AM0B 5KSBB 2BFVH 3MV7E 5DXWA 4DEPB 1N6VA 3MA9H 2FH8A 1E2WA 4K7PX 1IBYA 2DJMA 4O58H 1CLCA 4IW4C 3BIBX 2YOCA 4YOKA 5I71C 2BWIA 3DTUB 1LP9B 5AYUH 3IJ8A 4PV9A 4YR6A 4ALAH 5I6LA 2J5LB 3HZYB 2CGRH 1KYDA 4HEME 1JF6A 3SQOH 3N40F 4DVRH 1TU2A 3U9UB 4IS6B 1QI4A 4JRWA 1YY9C 1G6VK 4BUQA 4C4BA 5G5DB 2Y1AA 2R0ZH 5BW7C 4JO8A 5I30L 3WFCH 3A47A 1RJZB 5HHPB 1ZGLA 2HUEA 1OAYH 3AC0A 3O8XC 3HB3C 4M29A 1NEUA 5C0GA 2KMWA 2VTFA 3GBEA 3LHAA 3EF4A 2FEEI 3VXRB 5E5MB 5IMOA 2WNKA 2PW1B 4Y9EA 4DP9X 4XWGH 4BXSV 5AW7B 3AY2A 4OJEH 1BM3H 3KCPA 1S9XA 1Z9PA 4LSVH 2XTJE 1DP0A 1ORSB 3MV7D 1TJGH 2OJEA 4YFLI 3P0VH 4KH9A 4XAWL 3WLWC 2LFEA 5I2IA 2ADJB 3I6SA 3Q3GA 1L3WA 4MCYA 4XMUA 1PFOA 2QSQA 5IJVA 4KX9A 3STZA 3B8SA 3EUDA 1NEZG 4CSTA 4AQAB 4FQCH 4B97A 2EIKB 1NFKA 3QUZA 5H2BB 3W1ZA 3O6KL 2VM9A 4OGAC 5DJ6B 1BLIA 5DCCA 5I76B 1SDDA 3BSZL 4AVJA 4DGYH 4UWQB 4BA8A 4K2UH 5CXPA 2QQNH 4DK3A 1R3JA 1X5AA 2X4TB 1RERA 1YECH 4NNXA 2X4RB 4PRHA 3S36X 2HRHA 5DQ9A 1H3XA 1JZHA 1DE4B 3GMQB 4JDEA 3VYPA 2I27N 1AGEA 3V0DA 2P46B 1GAFH 3D85B 1CQYA 1DSYA 3F58L 1BZ7A 3QEHB 2EYTB 1RZGA 5BV7B 2WGNB 1T04A 1A3ZA 4QWWD 2XTJD 3OX8B 4M8UA 1EZVX 4MJ4A 3RTQD 1K72A 3EOAB 4ZW6A 1GC1H 2CGYA 2Y6TE 2YXFA 4HUMB 3SPHA 4L4TE 3MJ9H 5EDXA 5EOTB 1EX0A 1NPUA 5LGYA 1CLYH 2WBJC 4WTQA 5KJ7E 4Y4FC 2MKLC 3QXWA 2D31A 2EDDA 1X7QB 5HI5D 4XI5C 3DHUA 5CEYA 4F8PA 2DMCA 3FQUB 3QT2A 4NN5C 4YFEA 1FIEA 1M2VA 4QRAA 3VRJA 4UTAH 4X4ZA 2ZUSA 3BIAX 3OWEA 2YRBA 4G6KH 2VO5A 2FLBT 2J2ZA 2NTSP 4HKBA 2COQA 2ZXWB 4JFDD 3O4LB 4F7TA 4TMPA 4JJ5A 4WW2C 2IBZX 1NBVL 4UM9A 3DUSB 4HHAB 1I1AB 1ORQA 5H4ZA 3HC3L 3HNVH 3DGGB 1CJYA 4N6RB 3X14B 4GXVH 3B8YA 5IB5A 1Z7JA 5D4HA 1P84J 2E8ZA 4U1NB 1G9NL 1A6UH 3QI9D 4XVJH 5LWYH 1IM9A 2B9AA 1CQKA 4HUNB 1DLHA 4XNBA 1NGPL 3TO4B 2ZOUA 1DR9A 5H35B 1NQBA 4DO5A 3F01A 4L4TD 1FBIH 2VDQL 1CYXA 4ONHA 3WE6B 4Z7IA 4NT6B 4S1RH 3FAWA 4RAVB 1CL7L 4LCIL 5TPWL 3POCA 1H9DA 1TMCB 5AW0B 5CU5A 3BMVA 3HFML 4ZK8A 3CFBA 4HJUA 5FO9B 3US1A 4R7VA 4RGMC 4MXVF 4L8CA 1HN1A 3C5ZC 2VDPH 3G6AB 4IU2A 4LLQB 4X4KA 5GGQH 2X6UA 4BA0A 2DH3A 2VQUA 4N0RA 4ZOEA 3REWA 4BWWA 4KKQA 1BG1A 1MY7A 1R3IL 3VMPA 2FWOB 2DLGA 4L8SB 4P05A 5E2VL 3IYLW 4ZNEE 3MA7A 3ZT7A 3AT9A 3S3SA 4EI5D 3AADB 5MI0C 2DLFH 4NQDE 4G9DA 2RFXB 5IQ7H 4U2ZA 1UCTA 3KMDA 5DUJA 1ZHKB 1FO0B 1DVFC 3WEMA 3QNYB 5T3ZD 2FT6A 3RUGF 2Y6SD 5KYXA 1MH5B 5F1IB 2B5IB 4W70A 3DVGB 1Z6JT 3C6SB 2APXA 3E1F1 2OCJA 4QY8B 4EI6B 1T21A 4OQTH 2UY6A 2WVVA 2QLVB 3NCJH 3HAEB 4RFEB 2R4RL 1VJSA 3FO1A 2FL5B 1BJ1J 3KNBB 1XGTB 1IVLA 2QPUA 3RVXC 2PR4L 2ESVB 1LDPH 4Y8AA 5D1QA 1AO7B 4X5WB 2H6PA 3I50L 3IETA 4Z18A 1FL6B 4HCRH 4HPYL 5C3LD 2VM4A 4P3CH 3K6NA 1QLEH 2CIIB 5IVXF 2NR6C 1BV8A 2WW8A 3B2VL 3SCMC 1HWGB 1J1PL 4WLCA 2WTRA 1IBHA 4NQDD 2OQJB 2C9VA 3KYMA 2VUOA 4DIXA 1QPXA 4X9GA 4AOFA 3QNXA 1HSBA 1LMIA 1YNLL 1PLCA 3FO0L 3MKKA 4FMVA 4C56B 2PYFA 5KAQG 2B20A 3BDXA 2RR3A 1D7CA 3H4HA 4K5NA 4RDQG 1NMAL 4HX1B 4E9LA 1OGSA 1CFVL 2AGJH 3RNQB 1U8MA 3HW7A 5E4IA 1I82A 1KCSH 2G5BB 2XACC 4N28A 3X3GH 1ZLWK 3FSVA 1KLUA 1X4XA 3TGXA 2V5MA 2VLRB 2KC0A 1XCTB 4ZS7L 4ZMTA 1EHLH 2HH0H 5E9NA 5F97E 1OGAE 4S1DD 3V52H 5DD1L 4GMSL 1YEIL 4JQIA 4G7RB 4F7KA 2QSCH 4JRFA 4AVKA 5I1AA 2VZ1A 3C5SB 2OYLA 4C83A 4OZ4B 5CSZA 4LEOA 1KN4H 4WUUB 4ZTEA 1ODUA 5T5FL 5EOQL 3T3MF 1OAZH 2CBPA 3CZGA 3RIFF 3E9UA 4U1SB 4A38A 4PJ5E 4D8PB 4XCEB 3O9WD 3VQLA 3ZDZE 1NDGB 3HC2A 4FXKB 5EBWB 5CHNB 1D9KA 5I5JA 1OWWA 4MJIE 5BMFH 1KBVA 5LJYH 5C92A 1R0AH 2IQ9H 2ZSWA 4OF6A 5DRNA 1TJHL 3PWVA 4JFZH 4F5CE 3QCUH 1A3QA 2VDNH 5I0ZA 1S8DA 1S7RB 4NUQA 1OE1A 1MN4A 4IMKA 1E4XH 1HZKA 4HF5H 2WUCL 4Z76A 4LCCB 4GAJL 1K4CA 5E8NB 2BSRB 3TM6A 4NQVA 4KX8A 4MAUH 2ADGB 4GMTH 1I1YA 4DW2H 1DVYA 3X2QB 2P5EB 3QRFM 4JM2B 3N85L 4NZTL 5D2LA 4MJJA 4AG4H 4XBGB 1X7SA 1N0LB 4ELKA 1DVZA 3HZVA 2I69A 1BVNP 3P4OA 4N22A 1JJUA 4PB9L 3EH5B 3VRIB 4PJ5D 3D50A 4F8LA 1UEMA 5DLMH 1C1EH 4I1RA 3CVIH 1J1XH 3H8NA 2AV1A 1FZOB 1JPFB 1JNLL 1LE5A 4X6CE 3KH4A 1DQIA 3IDXH 3KLAB 4HZAA 3LMJH 4OCXH 2BJML 4Z7NB 5FO7B 3QQ9C 4Z78A 4WTXA 3V5HB 2NY3C 2YEQA 3QPKA 4M4PA 3L1OL 2NCEA 3VXSA 5EHFA 2VJ0A 3JT0A 3DMMC 3VFVA 1NLDH 5KYWA 1QPPA 2A4CA 2O61A 2P8PA 2Q20A 2NY2D 3RUGB 3O6FD 4DZBA 1ETB1 5EOCL 2QVKA 3ESVF 1H19A 1J1OL 5JIPA 3EOTL 3BUDA 4BRJA 1JBJA 4MNQB 5EZJB 4M7LT 1HNFA 4MA1C 4Y7OC 3WYRA 3BAYA 3PNWB 4FXTA 3JWNG 1SM3L 3R0NA 1HHHB 4P5TB 5JHLA 2C9XA 3QNZB 5J56B 5ESQB 3F65A 1CUOA 5FUOL 4LHUG 4N2GA 2JWYA 4JFDA 4XNZC 1F4XH 4TNFA 5HI3D 1T6WA 2JJUA 2N0KA 4AIXA 4MYWB 4G42A 4F3FA 3WFDL 3HI1A 1QEXA 3CSBA 3EO9L 4ZX3A 1U8HA 3RY6C 4Y4KB 3FQTA 3QHZH 5I1KH 2H8PA 1KYOK 3QI9A 4GT0A 5HDQH 4BK5C 5GZOC 2ARJB 1GPOL 5JO5A 1JTOA 4DPAX 1HCVA 4PLJD 4NUJB 3HN5A 4XZ4A 2FECL 1OCWH 3H7LA 2QADB 5M7QA 1PKOA 1S7SA 5C0NC 1BF5A 5GS1B 3GLDA 2PETA 2HLFC 3CV5A 1E27A 3G5VB 4OZFB 3QCVH 4JO1H 4HZ1A 2VH5H 1IEAA 2NX5A 4LGPB 4Y19A 5EN3A 1ZTXE 2WLZA 5GRWA 3BRDA 3WKPA 3FUIA 3CUPB 3EDKA 1AQKH 1E9PA 1HZLA 1NCWL 5MERA 4ZUUA 5E08H 1Q1PA 4ZAKD 1LEGA 1G7LA 1KELL 5KANG 1UM5H 3KPPB 1BFTA 3MC0A 3ZDXE 1HH9B 3ETSA 3V0WL 4TLKA 1G1KA 1YEGH 3EJTA 4EI5A 3BPNC 2IIJA 4YS4A 1OT2A 3OJVC 1QRNE 2CO6B 4HHGA 3FT1A 3TTYA 1GHFH 4JS7A 4L0ZA 5AAMA 4P5MB 3MODH 4F80A 3AREC 2B1AH 2G30A 3GJFB 2YPVH 4YDVB 3T3MB 2OPCA 4OD3L 5AOZA 5LCVA 5DUML 3CHXA 1KPRB 1OM9A 5FM8A 3GJEA 3TXAA 4Y1AE 2ZNXA 4JKLA 5D1QC 1ESOA 3WXVH 4LVEA 3ARTA 1A6VL 1I85A 3L9EA 1E6JH 4PJXA 3WSQH 4J4PD 4MMZB 4IQHA 4LSRH 2HT3C 5LNEA 1KGUA 3MV9B 3RL2A 2DQGL 3UMNA 3NZUA 4OLWH 4PS3A 4AKQA 5GRXG 4A2HA 2F8IA 1SBSL 3BD5A 1D5IH 3QJOA 4XNQA 1H9VA 4IBLT 4HUWA 4XX1G 4X8GA 1SXAA 5FYLE 3DURA 5EIIG 1UWEH 1R5WB 1DANT 1QRND 4L5FL 4M5SA 2JJSA 1XHHA 1X5FA 1THAA 4IOIA 3WHXA 3M17B 1A1OA 3I84A 5D7IA 4HS3B 4J3WA 1WCBB 3BAIA 4DUXA 3CMOL 1J0JA 4LP8A 4OW6A 4TS6A 1BVKB 1IGJA 3VFPA 4JHAH 1TTCA 4ZI8A 5DJ2B 4R7LA 4Y1AD 3VB9A 5IV2B 4YC2C 2G9HB 3BYYA 4N8UA 5DJXA 2F1BA 3WN5B 1RMFL 4G1MA 3MBWA 2WWKO 1WAPA 4QF1A 5E2UH 4HAFA 2E27L 5F6IC 2EDYA 5CEZE 2C26A 2OLDA 4HIXH 5IB1A 4MA7L 1N59B 4ZW3A 4IMLA 2KPNA 1M3IA 4XZUB 5J6GB 4P49A 2ICWJ 3QUKB 5BVPH 1VEMA 4ATWA 4XBEL 5SWQB 2ZKHL 1MCQA 3JTSA 1BCIA 5D5MB 3QJZA 4GAGH 5FYLD 4AIEA 1EUUA 1B9KA 3L9BA 3VI4E 3DK0A 3FSOA 3HS0B 3L3DB 4XN9A 3UCRA 1U3YA 5FKAA 4JZOB 4WI3A 1D9KC 4RMSA 1DZBA 4B9KC 3O9WA 3HIZA 3UCQA 4PJIE 3HHSB 2ZAHA 3DO7A 2OX5B 2YRZA 4KJPC 3RAJL 3NJLA 4L29B 5HD8D 1T0OA 4OVVA 2AEQL 4NN7B 4HYTB 1LD9A 2F08A 4M6ML 4ZBJA 3MBEB 4CVWA 3BUQA 1VGKB 2NZ1A 4X83A 3NFNA 1EXHA 3G5ZA 3LCYA 1A7QL 5CEZD 3V0IA 2B2XH 2DYRB 1NUNB 3ZQWA 1IAKA 2L4OA 3N5AA 4QIRA 3B34A 1A3RH 2W95A 2YD2A 1AANA 3FU0A 5CGYC 1LWHA 2M1KA 4Z77A 5CCKL 4GG6E 3BZ5A 3FN0H 3L13A 2FR4A 4KFZC 2VR8A 3C09C 4HC1A 1G9ML 4F1SA 3A23A 2A6KB 4AKOA 3MMEB 2XYBA 5DS2A 5IVXA 2R2EB 3AZUA 4RSYA 1INDH 1RJCA 1SVZA 3MOAL 2PLTA 4ODSL 1KBKA 3ARFD 3LNGA 5DQDL 1ERNA 2KLRA 5AOLA 2A9NL 1IX2A 1QR4A 1XGQB 2NUTB 3NTCL 1DSFH 3WLBA 5HGHA 4A2MA 2FEDC 4FNPA 4AYID 3UBXG 1KTLA 2HJLB 4N5UA 1DQJB 3GSRA 1DYZA 5IBTH 5EU5B 1UXMA 3BPLB 2IFGA 2ZTBA 3HVNA 3NIFE 4MMXB 1B6UA 3AXLA 5L4MA 1G7MB 3MV11 2JXMB 3QJVB 5AAWC 1UWXK 3GBNL 2OMYB 1P7QB 1JPSH 4K73A 4OQ1A 4X4XB 3X13B 3CFJB 3OKKB 1CDCA 1IGIH 3O3AA 5T1DH 1BJ8A 4AGNA 4A55A 1KJMB 3NT0A 2V8MA 3JV6A 3ERXA 3MLVL 4PVNA 2DTML 4OF3A 2W07A 1FSKC 1T4KA 4A2GA 3ZTNH 2IVFC 4GBXA 2JELH 1R33A 2DICA 2G2PA 1NINA 1XO8A 4LSQH 4O4YH 1L5GA 1X5LA 4M61A 1URLA 3ETTA 4PJDE 2A9ML 2F61A 4YHLH 1JZIA 3K2UH 5C0FB 3B7SA 3LNHA 3FRUA 2LR4A 1I3RA 4ONGL 1QUPA 5D2LB 3E3QE 5DK3A 2HFFB 2CDGA 3B2MA 4NRZB 1U21A 5AVZB 1F3JA 2BOLA 4X6BA 1JGIA 2H5UA 4AGLA 4MQXD 5AB1A 2MHAB 2EEXA 2JLPA 4JZJA 2I9TB 2ZOKB 2OZ4A 1JHKL 4TNWF 3QDJA 3HPLB 3LZFL 4QRPB 3KLSA 4ZAKA 5AYQA 4AEEA 1O0VA 1T7WA 2B15A 5EORL 4DGUA 2EYSB 3BVTA 3ULVL 3FTXA 4CVZB 2A74A 5EC2B 2WBWB 4MSWB 4ISVB 2GUOB 5AAMC 3F2LA 1E28A 1BM7A 3FSWA 4BCYA 2GFBB 1WAEA 4L9LC 3RG1C 2X7LA 1IQDB 5DU7A 3ZIMA 4IDJH 4OCWH 1I85C 1GIGH 2P8MB 4LSUH 4PJ7B 2VDPB 5DZJA 1KPUB 5GPRA 1ZJAA 5F7LB 1NEZB 1WTLA 2EO7A 1NCDL 2YAFA 1ZV2A 3HNSL 5JIMA 4IBUA 2UWEF 3OB0K 4BDVA 4K71B 4UQCA 1ICTA 1U8CA 3TBSB 5E6ID 2DWXA 1QO3B 2BP8A 4RDQF 3VMNA 1KSRA 2JIXB 3IDJB 2JJSC 4EDWL 1KTDA 2R2BA 1SN5A 1EHAA 3ZE1B 1FYHB 3UZEC 3D9AL 3IFLH 4L1DA 1RZJL 4PYGA 4BQCA 4KJQC 1DLFL 5JIIA 2YEZA 4FABL 4XOBA 2R2HA 4ZPVB 4AQZA 4HJ0C 3BP7A 1DUZA 4KNSA 4Y16B 1BIIA 5ICZB 1T7YA 1H3GA 3SODB 1H8NA 1E6OL 4X4YB 3MLRH 4NC2B 2X2YA 2D2OA 2JTYA 3M7OA 2JJTC 5K9JL 5IHHA 2VKXA 4R2GC 2FGWH 1U36A 5AW9B 1FRGL 1VA9A 4MZ3A 5LAXB 1MFDL 5DR5L 4HFUH 3ARSA 4QUOA 2GSIB 1NOLA 3KBFA 5F1NB 2N3JA 3Q48A 2G0KA 5LHDA 5CBAA 1C5DB 1MCKA 1S7WA 2C1OB 4K55A 1MKFA 5G4MA 5DD3L 4D9QE 2EICA 5EFIB 1JWUB 2TRYA 1PS3A 1OL0A 1FGVH 2VN3A 1NCGA 3ZDYE 2QPFA 1UFUA 4BE5A 1GJWA 3QWNA 1RZKC 4KFMA 4ODTL 3F04A 1ZLVK 4DKDC 2ZIDA 3BLBA 3V0GA 1M7DA 2NDGA 5E8OA 3WKQA 4F2MA 2APFA 3ABMB 2NY5C 1UADC 1JHTA 4PRBB 3MV8A 5IQLA 5E2TH 2XPYA 1U91B 3OPZL 2AI0L 1LK2B 2FT7A 4N9OB 4WFFE 4PMEA 2AJ3B 3P9MA 3QIBD 4QHKI 4XMLH 5JLZA 4MXWL 3UO1L 3MX0A 1E40A 1EBPA 3IDIA 5T3XH 3WNNA 3WTVA 3D06A 3JTTA 4GAYA 4YNYA 1NGQL 1XGRB 4YN3A 2OR9L 3IXAA 4BSVA 1MJUH 4IBVA 4NFDA 3TYGL 3OR6B 2W65A 3MU3A 4HS6A 3GMMA 3W0WA 2HFTA 3QXAB 4Y9BA 1ZXKA 1INQB 4ADIA 4D9QD 4Z7WB 5I1GH 1B90A 4E41D 4NXKA 3B3BA 2L7EA 1T0MA 1F13A 5F88B 3S37L 5JR1L 3BE1H 3L7EA 2AJZA 4L4VB 5DD5L 5CFHA 3IGAB 2FSDA 1QVOA 4P2OD 1LEIA 2Q7YA 3CVHL 2JKSA 5E70A 4MD4A 4OF8A 4W4NA 4AE0A 3SDXE 1E9QB 3WFBH 1VFAA 3L5XH 3T0EB 3F12A 4M48L 4P2RE 4PWFA 4F33B 2X6BA 1COBA 3HE6B 1DVXA 2CPCA 3L8QA 3F7LA 4OM1L 3FS9A 3GMNA 4WFFD 4FN0A 5TF1L 3WY3A 1GKOA 2QL1A 3QPXL 2R1YB 4MLIA 1ZIAA 2DM2A 2EUVA 4FQHA 2A6JB 4HK0A 4JDZA 1JPEA 1SYSB 4G6JL 3ZKMD 3PL6B 1RV6X 1UA7A 3K71B 3B9KB 3V5KB 1I9JL 3NSXA 3BUBA 3TJHD 4E5XA 1CDHA 2EIJB 4U6HB 1MNUL 3CIQA 3H6JA 1TO4A 3ZQXA 2XZCH 1YAIA 3P9WB 4EI0A 5L88L 5DJYA 1QWUA 2GTWB 2P5WB 5CGMA 3PWNA 1CXKA 2OM5A 3Q1SH 4OLEA 1A22B 5FM5O 3OKEA 3VGHA 2IOOA 2YD0A 1V7NL 3LEVH 4PVBA 4MXQC 1AGFB 3QUGA 3CXDH 5IREA 3S5LB 4KTYA 3H6AA 4LCWE 2X38A 1NMCB 4OZIF 4N68A 2ZOLB 3T2QA 1NGWB 4XNDA 4HCFA 2R56L 2VDRH 2Z1KA 3QUML 2B3IA 1QFWL 4NQXB 4P2RD 1SLVA 4GBXC 2EE0A 4PJFB 5DQJA 2Q8AL 4Q52A 2CM6A 3HG1E 1XQ4A 4U1GC 2F53B 4ZFOB 1MNNA 1FH5L 4WFGE 5IOPB 3GD1C 5AKRA 2HN7B 3DTXB 3DIVA 3QH3B 4OM0H 4FP8L 4YH6A 1MWAL 5F7EH 4OZHB 1BBJB 1JFQH 2Z3FA 2DIJA 1OSPH 5JPMC 1KCBA 1X5IA 2A6DA 3GMOA 4JO5A 4XXCC 4YUEH 3BSZA 4OI9A 2A9CA 1FP5A 2HWZH 3CFKB 5D6CA 4U1LA 4DUWA 4CJ0A 2BVPB 3I02A 4NCDA 4PUBH 1AFVH 1R6VA 1NC4B 5DA4A 5T33L 4WWKC 4CL7A 3CC1A 3P9LA 2AAAA 4TV3A 5F9OL 2QKIC 2EH8H 1Z9LA 5KVDE 1BXAA 3GSNB 4IJTA 1TVDA 5JHLH 4NUGL 1UD2A 5I18H 1EPFA 1IILE 4XNAA 4MDIA 3ZYIA 2XHNA 3P2TA 3SGDH 2GBAA 4Z8FH 3CQFA 4YDLC 1A1MB 3IFPB 1FAIH 1KXVC 2F5AL 4QRUA 5D8JH 2XWTB 1MRDL 2MNJB 3HG1D 1WEJL 2IH3A 1QYGH 4RQQA 3PY9A 2ZCZA 4U6YA 2E9GA 1IC7H 3AMLA 2J44A 5EZOL 1D6VH 3KWXA 3O2VH 3QEGH 2NY0B 1LMKA 4ONFL 2B9BA 2LLNA 2ZKMX 1OXYA 4PGBB 5H94B 4FD0A 4XPFH 2XDHA 2IV8A 2WV3A 4OCNC 3CBJB 4RSVA 4TLSA 2RQ8A 3RWIA 5HHME 2JJVA 4JUSA 2R0LL 5FOJA 3MPCA 3IMSA 4IIZA 2VXTH 3ZYOA 3QEUA 4Q74A 4E36A 4I18B 2XICA 4LB8A 3UMTA 3UX9B 4B27A 1MCBA 4J3OD 1HE8A 1D2OA 5JOEA 4PRIE 1AXIB 4ZDHB 1T22B 25C8H 3D25A 5DWUH 2BVQB 5E6IA 1YEJL 2F5BL 3NSCA 4KQ3L 4BFIB 5LKNA 5LXVA 3F7YB 2K45A 1D7FA 4KDTA 2HFEA 4KY1L 4HVBA 1X7TA 4CUCA 1U2HA 4PV8B 5ITBH 5AOIA 5KSAD 2YBRA 4ONOA 5DSCB 1MCJA 3OR7A 5BS0D 1W9XA 5BXFB 2BPBA 5EU3A 1LXMA 3D4ZA 4LKCB 4YLQT 4PTUB 3WFHA 2OXHA 2DTSA 5E6ZA 5LCVH 3MRNA 3GUTA 1AD9A 2J88L 5HHMD 1NBZB 4ABVA 5DDHA 4UNTA 1TVBB 3R8BB 3ARDC 4NWTL 3ZTJG 4LNRA 4K3DH 4WQOA 4JAMB 4PWJA 1CK0H 5D1ZD 2XY1A 3UPRB 3ECWA 3LRKA 1XCQB 3PAVA 2CNYA 3QXTA 4FMKA 5IB2A 2HTLC 1JP5A 3QAZB 4GQRA 5DYOB 4PRID 3WGUB 1FVDB 4L8DB 3STLB 1P1ZA 4I0KA 3Q06A 3T6QC 4LHUB 4G72B 3HRZA 1RZQA 4QXGH 4FZ8H 2FX8H 1KFAL 1OTUD 3K81A 3JYCA 3OLDA 1BA9A 4OI7A 1TCMA 3DJ9A 5LQBL 3U4AA 3GKWH 5I16B 4AL8L 3SE9L 5DFTA 2ATKA 2JB6A 1UQSB 5D7LE 3FQWB 1B4JH 4ZMVA 4JX0A 5B1CA 3U7YH 5CNHA 1QLRB 5ESVB 1YJDC 3QIBA 3HJEA 4ZFFA 4HUKB 1G4RA 1HQ4B 3ATDA 2QQKH 3ZHDA 3WGVB 3KBEA 3FUJA 5BRZA 1MJ7L 3MFGB 3NACH 3QIUB 4TQ8A 1T1ZA 5HGGS 3CFMA 2N59A 4RX4D 1YPZF 2CBMA 3DBXA 1LM8V 4EIZC 4E41A 3NK4A 4U3HA 3EG9A 1DN2A 5FDWA 2HPTA 3FUDA 1G7JA 1G0DA 2P24A 4JRXE 5CIPA 4HJJL 2JH2A 1UYWH 2P48B 1OW0A 3SDAB 4JKPH 5GGVH 1FG2A 1GS8A 2G60H 1EWHA 4K8RL 5GGUA 1RK1B 2JKNA 1RZKH 4YO0A 1FORL 1S5HA 3MNDA 1MHPH 2P26A 4JFHE 3GIVB 1OGPA 3CCHB 1CG9A 5GXBB 2NY5H 3FB7A 1JZEA 4IRSA 4PHZA 4RVBA 4LL1A 2YGPA 3ASOB 4UM8A 4OIAA 3GGWB 1K5NB 1SVBA 2D03L 5JW3H 4DP8X 1QUNB 2VLLA 5T5FA 5F6HJ 2KZ1B 4BJLA 1TSHA 2GK0A 3EOBB 4ETQA 1V8HA 5E1AB 5AWNH 15C8H 3FQ4A 4OH2A 4XCFH 3FNKA 1A3LL 1V3LA 3LKSA 3UTZA 1GS7A 4AEHH 2P7TA 2GY7B 1KBGL 3OQRA 4AIZA 3LNFA 1BBDL 4XVTL 1R9FA 4JRXD 4W93A 3CC5A 1C8PA 4WZ9A 1ZGLB 4AJVA 1UXSA 2D0GA 4TL5A 5C0GB 4Z7VE 2UY7A 1CXFA 2V5TA 4H8HA 4HC1H 4KK5C 5EIIB 1LWJA 5IMOB 2VDOB 2R1XB 1ZLUK 2Y4SA 5C09E 1UC6A 3VTAA 4WV1A 3IJHA 2BH0A 5LGJA 3GHBH 2OJEB 3K4AA 4FQPA 3VYNA 4XNYH 1G9EA 5T1KA 3BQUD 1WTGT 3VD7A 5I2IB 2C4FU 4MCYB 1MFEL 2NQCA 4WAFA 4GKSA 4F2FA 4PLNC 3OHXA 1O7DC 3QUZB 5B3NA 5CINH 5DRWA 1G7QA 2CE6A 3ECBA 3FFDB 2PP9A 4UCFA 3KBHE 5F96H 4FC3E 3ILQD 4M5ZL 3E80A 5FA3A 4OF5A 4APQA 1I8AA 3MXVH 4NNXB 1PD1A 1FVCA 4J23A 1W72B 2UXTA 3H9HA 4JDEB 4O02L 1PDKB 1FNSH 1KENL 4RWYL 3DOHA 1RIVL 2AJUL 4NJAL 1A7PL 4U0QB 3SDCA 4NQCE 4PGJA 4CC4C 4C8XA 2NY6B 2F9BT 2X12A 3KPNB 5C09D 1T04B 2VQTA 2GQHA 4RNRA 3BEWA 3KXFD 2N7SA 4PRPA 3SGJA 1RZFH 3RJOA 2Z35B 2YUZA 2R83A 2ZUTA 2C3HA 1VESA 3CN4A 5CGBA 1DJWA 2Z31D 1FJ1B 6CGTA 4Z7UF 1YY8A 4RWHA 1MQ8A 1KEGH 4DZ8B 2D31B 3DV4A 2ZWNA 3DJTA 1IKFH 1PNDA 3NJJA 5CEYB 3RL1A 1GZQB 5IWLC 1M2VB 4GUQA 4KO6A 1M57B 1IGYA 3VRJB 1EBAA 5DJAB 3SE8H 2YARA 4D3CH 4YJZL 1ANUA 2Z4TA 2X0WA 5L8KB 2J2ZB 4F7TB 3RJDA 2C7UA 2OZ4H 3CZFA 5E95B 1E4JA 1ORQB 1RU9H 2G5UA 4NM4H 5BUPA 5TGBA 3ZOAA 2Q5BA 4B7LA 1MAMH 4JY5L 3H2WA 1PBYA 4NQCD 3WY2A 1BZOA 4KDTC 1S7UA 3VG9C 1FIGL 1ZLEA 3G6JE 1XT5A 4N2KA 1RZ7H 5C0EA 1MJ8H 2J6WA 4LDEB 4F93B 1J5OL 3KE0A 2DEYX 2CDEA 1A4KA 1IM9B 2VCOA 3LDBB 4U4BA 4Q9QH 3ARBD 2QDWA 3QZWG 4P3DA 3FUHA 4PJBE 4ZD3H 2VR3A 1P7KB 5AEAA 2KERA 1IGTA 2WQ8A 1I9RL 5IMKB 5BS0A 1ACYH 3OF6D 1EIBA 3M1OA 4H8WH 3MUGA 4JREC 3JSSA 2APVA 2BIIA 2FK9A 1MFUA 3BUYA 4OTXH 3QDGA 2VXSL 4KK9D 5D2NA 5DURB 5C0AD 3RWDA 3WNKA 2Z8WC 2ITEA 4F7PA 4JPKH 3MO1A 4JHZA 2CNZA 3UBXB 4L8CB 1U6AL 4G9FE 3VJ6A 4IU2B 4BUHA 1U58A 4IBSA 4J1UA 5IG7A 5EEYA 3KD4A 4RGND 2IG2L 2R9HD 1TFHA 7FABL 5D1ZA 2O1AA 3REWB 5JDSB 2OKMA 4LLWA 5KN5A 2XZQH 1JK9B 1AXSA 1ODAA 3K8KA 4HLJA 4Z0BH 3U4KA 2OMXA 2CRMA 2OMZB 4GRWF 4G9DB 4DKFH 4MZRA 3HRZC 3QJTB 4MAYC 2YLKA 5ABDE 4LU5L 4XVSL 1NDMA 1D5MA 4GO8A 4OFKA 4WFHE 1NIDA 1O7SA 4QMEA 3CZSA 1CGWA 5DFWH 5SWZD 1JGUL 2GW5A 1QX1A 1A66A 2GAZA 5C3IA 2IMMA 5SX4H 4HCIA 3PL6C 2WVVB 1CICC 1ZY9A 4WRLA 3TEXA 5HHNA 3BP5A 3FO1B 4FZEL 4E5XG 2X1WL 3A0OA 3LQAL 1HI6A 2NNXA 3PXJA 5DMJB 4ZUTB 1K2DA 4IHOA 3TT3L 3ZDWA 1RZPA 2DQDL 1VFMA 1ND0A 4G9FD 1E3ZA 4JO4H 3N1GC 3HMWH 4K7PL 3BVDB 5BUAA 4KUCD 3LH2H 1AXTH 1PKQB 5DMKA 4XO9A 4EPSA 3VFWB 4RRPM 3N41F 1VEPA 3V4VL 4HKZB 4OD1L 1IJNA 5BJTB 3QNXB 4WFHD 2R8SL 3DX7B 4OVUA 1N7MH 1DJSA 2CM5A 3ABGA 3RHWF 1IC4H 1MFAH 4LQ1A 2PPAA 5KJRH 1R3KB 3RGVC 4A2LA 1E2ZA 1NICA 4NZUH 3FXIC 3DWTA 1GJUA 4XMTA 1TSRA 3V55A 3V10A 1EQWA 3IDYC 4IRSC 3TN0A 4KVNL 3FCTB 5IVOA 3RWCB 3VFOA 1EAOA 3DGCR 4CVUA 1JZ8A 3HG5A 1AG6A 4N0UB 4YHKH 2F19H 2F2HA 1WQVT 1CFNB 5T8IA 3ZGHA 2X09A 2WZAA 5CJBA 3TEUA 4B50A 2ICWI 1YJDH 1WAAE 1WDAA 2VZVA 4XC1H 5DC2A 4I0PA 1L7TL 3UABA 4C83B 4J8QA 4Z7UB 4POYA 3UAJA 5IW6B 1XSKA 5EWIL 1W6WA 3BFOA 4P0DA 4I3GA 5B39G 4MWFA 1YN6B 4R4ND 4JL2A 3QJXA 4X2UA 3GK8H 2LU5A 2YAEA 3L4CA 1S9WA 4NERA 5AENA 2ENJA 2YAHA 1M3JA 4M3JA 4X4ME 5CJQL 5A3IC 4RFNB 3S36L 3WKNA 2YA1A 4YHOL 2EKSB 4F24A 2ZSWB 3D4GA 3CDFA 3MNVA 4Y5YB 5A2IH 2AFNA 5IVNA 4NO5A 1KLFA 1XTMA 4P46C 4AVIA 1EJOL 3EYSL 3MV7B 4WJG3 1W0YT 4R7NA 4ACPA 4CSSA 4Q9RL 4XPBL 3OHXC 5J4MA 4Z76B 5JPNA 2WNXA 5TK4A 3HNTL 1FI8C 1A7RH 3MREB 2FYVA 3D08A 2JQMA 3QIWC 4LSPL 3P0GB 4IGBC 1LO3L 2ZUQB 1UZ8B 3QJRB 5HHQB 4APQC 3ZR6A 1ZGLP 5A43C 4ELKB 5CLZA 3Q8BA 1PGRB 3P4OB 4EVNA 4WHYH 1L9TA 4I85A 3HE7A 4JUTA 3K8MA 4QLRA 5EEXA 3GSUA 3SDCC 3CLEH 5DK2A 3FTYA 3WEAA 1E90A 1Q72L 1BJMA 1GZHC 5IB4A 5ALCL 1WUZA 4M7ZC 4QRTA 4XAWH 3ZRSA 3BFQG 4LPUA 4Z7QE 3WHE1 3HFFA 4FE9A 3N2JA 2YGOA 4DQAA 2XTJB 3KXFA 3GLEA 3AROA 4GUPA 3BP6B 3RTQB 1OAUL 5E9DE 1QSFE 3MGTB 3O6KH 4QYOB 5E7BA 3S5YA 4DK5A 1N3NA 4ILDA 1KDIA 3G5XB 1IUZA 2A4ZA 2P8PB 2Z31A 4OZGF 4P4KD 2A0LC 1YYLL 3VRLE 5HYSG 4YHML 1AKPA 2X9ZA 3BSZH 4FYQA 1M71A 5AW8B 2YC1A 1XZWA 2WQRA 3LJ3A 3BZEA 3DJRA 2PPDA 4WO4C 4DGVL 3CH1A 3OVUB 4JFDB 5KBMA 1VDGA 2VABA 1N8ZA 2GUYA 2XWXA 4G42B 4XB3A 2IOIA 4LCUA 4KJYA 1FNLA 3HI1B 3M8OL 2NUPA 3QJFA 4O9HL 4PJ9A 2J12B 3FQTB 3ROOA 3VNZA 4BE6A 4GUOA 2H8PB 3N41B 3QI9B 3TZVC 3DO3A 1M4KA 5LXGL 2EXTA 4ZUWA 3B2DC 2ZG2A 3VW3H 5E9DD 1MLCA 2XWJB 5AW2B 2J25A 4AEFA 1PLAA 4L4TB 5D2NC 4QOKE 2DQUH 1S7SB 3OF6A 3AACA 4FNQA 3TCLA 2CHXA 2H1XA 3IU4L 5DZOA 1JRHI 3N04A 3VG0L 4WK2B 3P3RA 5EU7E 1HYSD 3V0AC 3VD2A 1CFMA 2HX8A 4WNQA 5C0AA 5JZ7D 2ILLA 3P11L 5EUOA 5HJBA 1F00I 3L3GA 1D6EB 1KXQA 4S2SA 4N2IA 3IWVA 1E9PB 1NBVH 5D7JD 5HY9A 4BFNA 3DROB 4KROC 5MERB 4QDGA 4ZUUB 3ZDZF 1JNHB 3HC3H 5A2KH 1ZPUA 2XI9A 2AV7A 1OK0A 1V55B 3MLTA 5A6LA 3OMIB 2Y07L 2WMPB 4U2YA 3RDTD 1G9NH 1KCVL 1GSKA 3AQDA 1IQWH 3GSXA 1NGPH 1DN0A 1QW9A 2CO7B 2HZHA 4I8DA 4LIQE 4EI5B 3KWWB 4A6YL 3QG6B 5IFHL 1G87A 1XR9B 3LV3B 4QRBA 2VDQH 3L6FB 4UAOC 4JDTL 4Y4HD 1E4WL 4JVUA 3QDAA 3ZK0A 5J3HD 3PQYA 1TG8A 5SWZA 1EXUB 2OMVA 3HFMH 4LXFA 5GHWL 3VMOA 4QOKD 3QCTH 4QXTA 5DD0L 3OKNB 2XG5B 3DX6A 4MDJA 3T0XA 2X6MA 5E51A 4BSWA 2CUIA 3T2OA 5AW6B 2DMGA 5E6RB 4YZFE 3X3FH 4KNTA 4N9GB 1ACXA 3MJ7A 1TKWB 2R7EB 4BZYA 4V2BA 1CXLA 4GRLD 4G9FA 4V1DE 4ZO9A 5E2VH 2AK4A 4PJHF 4X6CF 4N0FA 4XVOA 5E5RB 1R17A 4FYRA 4WW1B 2YFNA 3RFZC 1Z5LA 2OFQA 2H26A 3SYQA 4RDBA 3FC8A 5GISL 5JA8B 4HUWB 1W8EA 3DURB 4NQDB 1UT9A 1UUSA 5DFVC 5JORA 1KMGA 4IOIB 2Y7OA 4ZOBA 1G84A 1ECYA 1UWYA 5IHUL 3OQ3B 5D7IB 3OG6B 5C71A 2R4RH 3GSVA 1ZHLA 1DBJL 3GUFA 4N0CC 3UTPE 1IGJB 3S2CA 4JFXA 1OP5K 3TN0C 4CADB 4M6AA 3VXNB 2PR4H 4ODWA 5SWZB 2W8CA 3GS0A 4HULB 5LLIC 3QC6X 2KLSA 4YXHH 3I50H 4JFOA 3TIDA 5I6PA 2EE3A 4RMWA 4HPYH 3V8OA 4G1MB 3OJ2C 1TQWA 1M1XA 3TNMA 3MBWB 4XE5B 3V4LA 4PJ8A 1J1PH 1T5WB 1XGYL 4I0PC 5AZ2L 1DQMH 1UD3A 4IMLB 4PLKC 5JUEL 4DN4L 2X44D 5F7HA 2BY1A 1CGSL 5IMMA 3KGRA 3LPPA 3RX9A 1WGOA 2WNGA 1I7ZB 1VCAA 1KIRA 4F8OA 2HYMA 3U36B 4CC0A 3M1CA 2NY6C 1FZMB 3RVTC 3QORD 2H32B 4UMSA 2EE9A 1C16A 5CZKA 1NMAH 5FKAB 4FERA 3RA7L 1SFHA 1BGXL 5CIPH 4JW3A 4POZC 1CFVH 3O9WB 3UTPD 2UYLA 1K8IA 3FU9A 4JG1H 1ZHNB 4CC1A 1RUAL 1PAZA 4JFYB 3TU6A 2MRYA 1TITA 4CN6A 4Z7OF 4ZS7H 3T6VA 1HXKA 1WWBX 5JPNC 4GMSH 1EZSA 1YEIH 2QVIA 3ZDXF 5I1IL 3NFNB 3G5ZB 1TOXA 4Z0XA 1H5BA 3SE3C 4NQEE 3ULUL 3V9CA 1OGAB 1WBZB 5T5FH 4K8RD 5EOQH 1T3FB 3M1BB 3CVHA 1HDMA 2IO5A 2FEEL 1BPLB 2FWLB 1KGWA 4J3OG 3HE7C 4K3HA 4Q0XL 4YSQA 2EP6A 2Y06H 3LH8A 2FGZA 1VACB 4UDTA 2JI2A 4PJ5B 3RJQB 1TJHH 1QFHA 4ORGB 4OFQA 4PY7A 1UB6A 4LBEA 5FFLA 4G71B 4EQ2A 2PMZA 5D7KE 1XIWD 3L4UA 2E75C 2WUCH 3L9RB 1KTLB 4KHTL 1ROWA 1UM6L 4FNLL 4NQED 3GSRB 3OAZK 4KKLC 2EDWA 1MEXL 3ZYZA 2GEQA 4NZTH 2NY2B 5E8EA 3O6FB 3VGAB 4ZZFA 4DGIH 1CS6A 4PB9H 1KB5L 2BSED 1AP2B 3QUMA 2XG4A 3GSOB 2X9YA 1KGJA 3I75A 4CKVX 5IQOA 3O3AB 4E2OA 3CDYA 3WS3B 1RURL 4DTGL 2BNQA 3QZBA 4Q6KA 2BJMH 3JV6B 1WBYA 2IDFA 1TQBB 2CHDA 4PJ9C 2W07B 1TCRB 1CB4A 1MWAA 2OSWA 3T4AA 1OANA 1WSST 5D7KD 3T8XA 3BZ4A 1Z3RA 3L1OH 1WIPA 4NFBA 5ANME 3GZOA 5DO2D 2MCPL 4U1KA 2X87A 4M61B 4PJEA 1N4XH 5BO1L 1EUTA 1QSEA 3D12B 1AHMA 1BFOA 2CLZA 2GIYA 4NPYB 3VDBA 3EOTH 3FRUB 5E9DA 3QUXC 3LD8B 2BVOA 4J6RL 1I3RB 4OIIL 1X5ZA 2V7HA 4GXUM 1JGVH 2YPLA 3KCWA 1RQ5A 2VERN 3FSAA 5I26A 4X6BB 4KZ0A 2NW3B 3WIFA 1MFBH 5FUOH 3QRLA 2BDNL 4JZJB 4LP4A 2VITB 1I8IB 4BZ1L 1J9RA 3SJVA 3DRTA 1Y18B 4RMBA 1V27A 3EJCA 4PJIF 4ZAKB 1BD2E 1F2XK 2BX5A 3C60C 1JWSB 4XWOC 2IGFL 1OCRB 4XAKE 4ZXBC 3FJTA 4H1LA 1ITCA 2J3SA 3TVMD 5EF0A 4YHZH 3RDTA 2A5UA 4GW4A 4EAEA 1QW8A 2WYIA 5D4JA 1HJCA 4XN1A 1E28B 2V2TA 1PAMA 4EN3D 2EIZA 2HSIA 1JD7A 3DOSA 1QG3A 5INCB 3T1FA 3S88L 1Z2KA 3FMGH 4OGYL 5D1XA 2OSLA 4ABUA 2D0HA 5HDBB 4QOKA 4ZMAT 3VWKD 4MGXA 5JQIB 1NCWH 5BOZG 1YEWA 3TLRA 4KITB 4Z3GA 1KELH 1KC5L 1LK3L 4GS7C 3T2NL 1JYVA 4GKZA 4AQEA 4G2AA 2WWMD 1D7DA 2ERJB 4OZGA 3T65B 3ZTEA 1X5XA 1BD2D 1WWWX 1IE4A 1U8CB 1FCGA 4XAKD 2B14A 2QGDA 2YZ1A 2JNZA 3ZDXB 5KBDA 2JF1A 3BN9D 5H4YA 1NIEA 4PYHA 3KPOA 4H20L 2R2BB 2DEXX 1O6SB 4M1CC 4X6EA 3VFNA 1R34A 1U9KA 1QRNB 4OD3H 4Y5YC 4X6FA 5DRXB 5DUMH 3UACA 3UJTL 3SYOA 2C4XA 2GJZA 3IDMA 3OMAB 5AW3B 3T8MA 3OZ9L 4E9TA 2R2HB 2FAUA 5A2JH 5JNYA 1G7HA 2L7QA 1DUZB 1BIIB 2YD1A 5E1HB 1N0XL 4JFEE 3T6XA 1A6VH 3ZMEA 2XWCA 1N64L 1TJMA 1Z5HA 2CK0L 2PKDA 2ZXEB 3CFNA 4NC0B 5DVPA 4Y1AB 4OCRL 2V6HA 2EXWD 3SOBL 1MSPA 2DQGH 4PJ8C 3RNKA 1MCIA 2HJFB 1SBSH 2DN7A 4FULA 1NGYA 5I15L 4LGSB 1PZCA 1QLFA 5CBAB 4FG6C 4M02A 3MRLB 5C86A 3IFNH 1BPVA 4GI6A 4TVPL 3V0HA 1MHHA 2Q3ZA 3BPOB 1Q0XL 2W60A 4PJDF 4PJ6A 2WBKA 1RUKL 3GHEL 3CMOH 2H6UA 3SZ6A 4OLYH 1N19A 1QBML 3EFOA 4NHCH 3QORA 1M7DB 3SY0B 1TQCC 4P04A 4QWWC 4KXBA 2VR4A 1GGBL 5D55A 4XP5L 3VFTA 5D4QA 1Y6NR 4EUPG 3ABLB 1LHZA 3QZWB 3RZCC 1RMFH 3JV4A 3MA9L 2JKIS 1B2YA 5KUKA 4O58L 1T66D 3IDIB 2FUQA 3CJJA 4YEEA 4GW5A 4MA7H 5AYUL 1IM3D 4RCAA 3EFFB 2IEPA 3JTTB 2CGRL 4YNYB 4BSVB 3IXAB 4DVRL 3QS3A 5AG9A 4PI0A 1Q9WA 2W65B 3EJYC 1CBJA 2X70A 3GMMB 1ZXQA 2Y9RT 1AG0A 2ZKHH 2LTQC 2R0ZL 3CQPA 3I9AA 4TUJB 5AOJA 4JGJA 2IPKA 1HAWA 4RH4A 5T5NG 3EH1A 3R4RA 4FEMA 1JWMB 3NCYS 2GHZA 2UUDK 4G8GD 1J12A 1E5UI 1TEFA 3CXFA 1SVCP 1QVOB 5I9QC 5KVGL 2J8UA 3SQRA 3L81A 4PJHA 2J4WH 3VI4B 2J71A 3WI9A 4Z3TA 2XNAA 3MRIA 1SJMA 1VFAB 4XWGL 5CF3A 1I1FB 5C0BE 4JE0A 1AR1D 3L4TA 4ZS6C 2DDQL 2AEQH 4FTDA 4LSVL 3S4SA 5EBLA 1TJGL 2KKQA 4RRPG 5F7MC 4M6MH 5K93A 3BDBA 4ZX5A 3ARFB 4MQ7A 1A7QH 4FQHB 1MRCH 5F6HI 4HK0B 3WJLA 4JK0D 3OAUL 4UZUA 5JW5A 4FQCL 1U8KA 3L5HA 3RLSA 4E5XB 2JB5H 1PCXA