2GBUA

C6a/c111a/c57a/c146a apo cuzn superoxide dismutase
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
153
structure length
153
Chain Sequence
ATKAVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGATSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHAIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLAAGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title The Coupling between Disulphide Status, Metallation and Dimer Interface Strength in Cu/Zn Superoxide Dismutase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 32
structure length 153
sequence length 153
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2006-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2gbuA00
5CU9A 1HL4A 3ECUA 1COBA 1S4IA 1RK7A 1U3NA 2C9VA 1OEZW 3MNDA 1MFMA 1HL5A 3PU7A 2NNXA 1DO5A 3KM1A 1IB5A 4U4IA 3GQFA 1XTMA 2GBVA 4BD4A 1EQWA 4OJAA 1DSWA 1PZSA 3KBEA 1IBDA 2WWNA 2Z7UA 2Z7WA 1SXBA 3K91A 4A7VA 1E9QA 1L3NA 2AQSA 1F1AA 2VR8A 4A7TA 4A7SA 1FUNA 1YAZA 2AF2A 4B3EA 1CBJA 2WYTA 1Q0EA 2E46A 1SRDA 3QQDA 3HOGA 3SODB 5KBLA 2R27A 1AZVA 1Z9PA 3H2QA 3CE1A 2ZKWA 4OH2A 3F7LA 4MCNA 3S0PA 2GBTA 2Z7YA 1N19A 2ZOWA 3MKGA 1E9OA 3GZOA 1JK9A 3GTTA 3HW7A 1TO4A 3GZQA 5KBKA 2ZKXA 1B4LA 5KBMA 3F7KA 1E9QB 2APSA 1N18A 1OALA 3KM2A 3KH4A 2Q2LA 1F1DA 2K4WA 1IBHA 3GZPA 1KMGA 1OAJA 2AEOA 2AQNA 1SXSA 1SXNA 1IBFA 1PU0A 3QQDB 2AQQA 4BCZA 1F18A 4FF9A 3ECVA 1ESOA 1XSOA 1E9PA 1UXMA 2LU5A 2WZ5A 2V0AA 1CB4A 1OZUA 1YSOA 1JCVA 2E47A 3KBFA 4N3TA 3KH3A 2WZ0A 2AQTA 1PTZA 4A7QA 1F1GA 1SDYA 3H2PA 1XTLA 3CQPA 1Z9NA 3GTVA 1P1VA 1E9OB 1SOSA 1JK9B 2WKOF 2ZKYA 2XJLA 1BZOA 4A7UA 3CQQA 1SXZA 2WWOA 2WKOA 2XJKA 3L9YA 1OZTG 3ECWA 1BA9A 1B4TA 2JLPA 2VR7A 1QUPA 3HFFA 2AQPA 4MCMA 4L05A 1SXAA 1IBBA 2Z7ZA 1SXCA 1E9PB 2C9UA 2C9SA 2GBUA 2WYZA 4N3UA 1TO5A 2AQRA 3T5WA 2VR6A 3RE0A 1UXLA 3L9EA 2WZ6A 1SPDA 4A7GF 2JCWA 1YAIA 3LTVA 2SODB 1EJ8A 4BCYA 1SDAB 4A7GA
chains in the Genus database with same CATH superfamily
4UM9D 1BG1A 5DZ9A 2F5AL 1DTUA 3QHFL 3FQNB 1JYXA 1LLAA 1OTSC 3LHAA 5CSBA 5HVHC 3EJRA 1RK7A 1BD2E 4NOFA 5EO0B 1JZ3A 1WIUA 3V0EA 2RFXB 2Z0UA 5HGBB 3MV9B 1AG6A 1PZ2A 1AMXA 1A6AA 2G75A 5IBLC 4XNXL 4GQRA 3FO2B 1A4KA 3LKSA 4L8BA 1DYZA 2KZ1B 1ERNA 1AC0A 2R69H 3DETD 2Y2TA 3SJVE 5FYLE 5IJBC 3FFCB 3QIWC 2YPVL 3KR3H 4PRNA 3PHSA 5FXCH 1GY1A 4WI4A 1F4YL 1G6VK 3ZRSA 5I24A 5BQDA 3T6WA 2CO7B 2YLKA 1N4XH 4PTUA 2CLVB 3TH3T 3SYPA 1NFIA 1AI1H 5FV2A 5DC9B 4MD5B 4B96A 3QQDA 5EZIL 4DKDC 3K6DA 4K8RL 3QXWA 1A4JB 3RGHA 2FR4A 3BQUD 2WQ8A 3QUHA 4JFFB 4XNUH 3ZE1E 4AY0A 4FYTA 4KX8A 3GI9H 3HMXA 5L6YL 2QKIC 3AREA 3H3PL 1YNKL 1TPXC 3DUUB 1A4AA 1UACL 3TN0A 2X4OB 5JHMA 2B0SL 1I3RB 2YSSB 3HBZA 4LPWA 4ZW6A 4K9EH 1EHLL 5BZDB 1BXAA 1BIHA 3DMMB 3HBGA 2HT3D 5HYJE 4KK6C 1TTUA 2YPKA 2IH8A 3S8GB 2PCFA 1HIML 4KNSA 3NRQA 4TULH 2LV4A 2AEPH 3V4UH 4NNPH 4FD0A 4JZJB 4OZGE 4EI5A 5HYQB 4KXDA 4PRDB 3WJMB 4Q6IB 5C6TH 3FH7A 1SLWA 2VDRH 1JFQH 4P57B 3VX1A 3RPKA 5FLUA 4C4KT 3CN4A 2EYSB 1GC1H 1IM3D 3FK3A 3UG4A 3HS0C 4Z18A 4G83A 4WAFA 1R1CA 1GYUA 5GGVL 4GAGL 4H40A 5D1ZC 1IC0A 5E1GA 3D12B 4PJBA 2PXYD 5BV7B 1INEL 4LAQL 4TQIA 4AV0A 1Q9LA 1JTTA 4OD1H 2ZCLH 2WD0A 4PWFA 5FW6A 1FFPA 4PTTA 1P69B 2MOQA 3NAAH 1IL1B 3LD8B 1U92A 3S88L 3US9A 2C3GA 3NSDA 3QNZA 2I7SA 5D8JH 4ORGA 2J1WA 5CIPH 3VGFA 3VXMA 3WYRA 1NANI 2VLLB 4R7NB 4S1DD 1XCQA 5F88B 3SSGA 4NT6B 3L7FA 5FKPB 5KSAD 4UV7H 5JIDA 2NY7H 2OZ4L 3VVWA 4I89A 1Z9LA 3Q7JA 4FZ8L 4KDTC 2FWLB 1NAMH 2AEQH 2W94A 4JKNA 4JUTA 5AOJA 5J3HD 3AADB 2OMXB 2M8XA 2NT0A 1OSEA 5CZKA 4QRRA 2GSGB 3TM6A 1DBMH 4NKIH 3EG9A 4A6YB 3CVHH 1X5AA 2GK2A 5C0GB 4U1SB 3FQXB 4QHKJ 3IJHA 4BFIA 2IPUG 3P0YL 5K59E 2L8AA 1HT6A 1QW9A 4BKSC 1MJJA 3OGCA 1CF1A 1SMAA 5JHLL 2Z34A 4Y2DA 1JZDC 3LOWA 2E7CA 1U8PA 4DT2A 1CGUA 2EZ0D 4OSUH 2GCYB 1OCWH 2UXFA 3BUIA 3WUWB 4RA3A 3GMPA 2PTTB 4AYSA 3DURB 4WO4B 2XWEA 3B9VA 3ZU8A 2B14A 3DYPA 4TSCH 3RLSA 4LHQB 4Y5VC 4M7KL 2X38A 4LASH 5E6SB 5JXEC 1QW8A 4Z3FA 2P5WA 2MOVA 4CW1B 3AU1A 3JYBA 5MHSE 5AW4B 5G5DB 3WD5H 1AO7A 5BRZB 3LQAL 1DO6A 3DX2A 3B9KB 2DIAA 3FT1A 3OKKA 4YDVA 4RMSA 1YUHB 1DSYA 3S37L 3PGFL 3T6QC 2GFBB 3M6DA 1ODUA 5BV7C 1KGCD 1PPIA 3VU2A 2H1PL 3HRZA 4KC3B 1X5XA 1UZ8B 5C2BH 1IIKA 5CD3A 1PX8A 4J1UA 5FHAL 1YEDA 4FMFA 1IAOA 3LD8C 3DOIA 4M43H 4UIMA 3ZTEA 2ZF9A 5I75B 4ZD3H 3H4FA 4FTDA 4NJ9H 3I9AA 4ZTPL 1L4IA 3NJHA 3MN8A 5LGYA 4DCQB 1PCXA 3GMRA 1XR9A 4QRBA 1GPOH 1A6WL 4JO1H 5IHLB 1N6QL 4WWKA 1U8NA 3AITA 1KCRH 4YSPA 4PS4L 1XT5A 4XXCA 4Y4HB 2H2PD 1MVUA 4ZO9A 2DS4A 1TJGH 2CUIA 3U6RB 3GDCA 3R19A 4JY4B 4YZWA 1GHFH 3IF1B 2XQ0A 4KRPD 3HNSH 4KJWD 5DSCB 4DPCX 4TLKA 3JUYA 4N87A 2J72A 1FORL 1D6VH 1U8HA 3U7WH 1FQ9C 5EU4A 2VLJB 4Z7VA 2V5MA 4K7PH 5CINH 1NOFA 4PJAF 1KULA 1QHQA 5T1KB 5FOBB 4E42A 2DQCL 3LAFA 5D7IE 1CF8L 5LNEA 5JIQA 3PP3K 3V5KB 5BOJA 5JZ7C 2J44A 1HZHL 2GY5A 3KDMB 3CFEA 3BP6B 2F08A 4R8WH 3UDWC 1U21A 4G8GB 3UX9B 4OU3A 4GUCA 1WDAA 2IGFH 5D1QD 3MNDA 5D72H 3T4YA 4H1LG 5C08A 1LWJA 2OM5A 4PRBA 3II1A 2WINB 2J1XA 4X80H 5EBMB 4N2AA 4ATWA 3I6GA 2DQHH 3B9KC 3V0GA 2WLIB 5KANG 2BY0A 4Q9QL 4HH9A 4JHAL 5AAWC 4QWWC 1IFGA 5DQDH 2F2HA 1BAWA 4UV4L 1EQWA 1U3HD 1FFOA 1EAPA 3HEIB 3I9GH 3QWOB 1FO0L 3MUJA 1C8PA 3STZB 4LDOB 3KBHE 4A7VA 3E7JA 1KGWA 5CD5D 3MRCB 2QPUA 3SQRA 4UI2A 5TE7L 2YFOA 1WBXB 3QE5A 4M6ML 4L1SA 5BV7H 4LCCB 3RIFF 4N8VA 2FBOJ 3MLYH 4MASA 3DROB 4K23L 1XGRA 2IAMB 3WXWH 1JPTL 4L0ZA 1PIGA 1Z9SB 2VRQA 4YJZL 5EN3A 2K3TA 3HHSA 4APXA 1JCKA 1YY8A 1ZT1B 1D9KA 1JL8A 2HG5A 4Y4HC 3ES6A 4XRCA 1F3JA 2ZOWA 4JFHD 3MKGA 2FLRT 4Q58C 4NO5B 1YEIL 3DV4B 4MNQB 2UZXA 1AFVL 2PPEA 5D2NC 5FUCC 2VLKA 3SO3C 2J3SA 4NERA 2VDMB 4XPBL 3RP1A 3ME0A 1YPZA 1MAJA 4CBPA 3TGXA 4HA1A 4JR9L 4BFGA 5DJ0A 2YMOA 4A6YH 4OFKA 1F4AA 3QZWG 1CYWA 2NY1C 1MOEA 3CLFH 4G80B 4K3EL 4QRPE 5F7EL 4M48L 4PBDA 4KKQA 3K1DA 3FTSA 2P8MB 4I48A 1MCWM 2CDFA 1N8ZA 2FO8A 3NPZB 4TKWA 3BWAA 3CSBA 3HUJB 3U79A 3HAEH 4DOHE 2VLRD 3SE3C 3UMNA 3MV7E 5CEYB 3SCMB 3BUBA 4PJ5E 3HR6A 3W9DA 1NCBL 2X1WL 4MFHA 1ET5A 1PKQA 2W65A 3KPRD 2LVCA 2XJKA 2YD9A 5E56A 4HLZG 4OUUB 4G6FB 1SY6L 3B1UA 3FQTB 1GJIA 1XCTB 3E8UL 2H32B 2WVVA 5D7KD 4PHXA 3T4AC 3NIDF 4XCNB 3TXAA 5C0CE 3U2SB 3PGDB 1IGJB 1G7JA 2UWEA 3IBOA 3IPEA 3KVDD 3NJKA 2BMKA 4LZKA 1XGZA 3GSRA 2O5YH 3NJGA 4R7VA 1V5JA 1JGVH 3EW3B 4JRYB 4LCCC 5E7FA 1H3PL 3DGCR 2F5BL 3PWVB 5FA4A 5L4IA 1NTDA 1UT1A 1WK0A 5DUPL 2A1WH 3U4KA 43CAA 3OC5A 4NNYB 2EYRB 4Y1AD 2BFVL 3G6JE 2QSVA 2CRYA 4EDXA 3WKPA 2VL5B 3S5YA 4JM2A 2WYIA 5KVEH 3PP3H 5SWZB 4WI0B 3UEZA 3BRDA 4KNTA 4Y7MA 2G5BA 2YAFA 1WCBA 4LLQB 4HIXL 3WNLA 4DQOH 5ENWA 1ZIBA 1DQLL 3B83A 1F58L 4AJWA 3I6SA 3LCYA 4QLRA 3TWCH 4L8CA 1UCTA 3TV3H 5GQBA 3CWGA 5H35B 4RFEB 3X14A 5D1XA 4UQCA 4ZS7L 2C7UA 1N8OE 3O6FB 4XN2A 4NWTL 1G6RL 1F8TL 2CBMA 1BW8A 3EGDB 1MCOL 3BPLB 1CK0H 2AI0L 4HS6A 5E70A 2CO3A 2NDFA 5BZWA 1C16B 1Z5LA 2BCKB 4I77H 2GG1A 4DEWA 5K93A 1E65A 1Z3GH 4PQXA 4XCCH 4DFIA 5EFIA 3SCMC 2FLMA 5FR3A 2XBTA 4H44C 2JCCB 4ODUA 5CLTA 1T7VA 2BJMH 4HX1A 4ONHB 3IXTA 3WIHL 1JZGA 4OZ4B 3QAZB 3F7KA 4I2XA 1PS3A 3B5GA 5ICZA 5LDUA 2PWFA 3QK0A 4E9WA 1MUJB 3BKMH 2OTUB 3M1OA 2ZCKH 3IDNA 3PLYA 1MFCL 4FF9A 5GPRA 4NZRL 3IRPX 2OJZH 2WTOA 5DMGD 2VC2L 2ZKMX 3FCUB 3MSPA 4M6NL 4ODSH 2IQAB 1YMMA 3IDUA 4YBQC 4A55A 5IB1B 4H8UA 4F2MA 2XRAL 3EO1A 3KHQA 1OP3K 3CNKA 1UM4H 3SQOH 1R75A 3NJIA 2ROXA 1PCSA 1PYWA 3AMKA 1F2XK 4KZ0A 4XN1A 3IFNL 5FIEA 3N44F 2H9GB 3EGSB 1N2RB 4KKNA 5DR5H 5JYLA 2X87A 3I9PA 1M6OA 1QSFE 2DWDB 2K8QA 3BE1H 4WV1A 2A4ZA 4DKEL 3H55A 4JDEB 4XWGL 4HIIB 1SXAA 2ZYIA 5CJOL 4YOKA 3ALXA 5C0JA 3RPIB 2GBUA 4LNRB 4UANA 4PY8I 2PCPA 1CYGA 5C0AE 1CGYA 2WPGA 4F7CA 1PG7X 4UT7H 2UX6A 1ZA3B 4B27A 1ASOA 5AYUH 3FU8A 4PU2A 2ZWNA 4N4YB 2HPOA 1F13A 4OCLC 4G8IA 1KCUH 4TUKH 3BPLC 3V4VH 2A74B 3MVSA 1NFDF 4AUJA 4AYDC 3Q1EA 4R5XA 4AQAA 1QFWL 4YL9A 3LRSB 2BLFA 4FRWA 2H7WA 3PNWA 1EWHA 5DVPA 5I74B 2OMTB 2XVBA 2OXHA 3EOTH 2R9HC 1DQJB 1VACB 1OPOA 3CZEA 1V05A 3N41F 5FYKD 5ICUA 3KWTA 1CFSB 1U4FA 1Y0LA 3M7FB 3IJ9A 2E7MA 3QAZC 4MJ4A 1WT5A 4WKXA 4AQZA 5E1AB 5I6PA 4TVPL 3ARZA 4OM0L 3K2MC 3LNEA 3QJSB 4PY7B 1AQMA 3ETTA 2BP3A 3FB7B 3MLUH 4FA8A 4AJ0A 4XMXA 3HC0A 1J88A 1J1PL 1XO8A 3OAUL 4HH8A 4Q9BA 4W93A 5A7EA 2BVPA 2CRZA 2FEDD 1I3GL 3ARDC 4JY5H 3U7YH 5DJZB 3VXSE 3Q48A 4XN5A 5JPNA 5DMJB 5ID1B 3ZE0B 2H32H 2JXMB 4J3OF 4JPQA 4D9QE 3BW9B 3D4YA 2X53A 1BAFH 1FAIL 3D50A 4LLDA 1QD0A 2IPUK 1OTTD 3CVBA 1ZHLB 3PF2A 4F2FA 1CL7L 4MHHI 2DI8A 4FNRA 4I7ZC 2AJ3A 2XN2A 1QA9A 1ZT7B 5IHWA 3U0PA 1WE5A 2EDLA 3P73A 2N7AA 1W9XA 3GZPA 4R7LA 1WA2X 3B7TA 3KYKH 2X1XR 2Z8RA 3CFKB 3EOBA 1RUQL 3MA7B 4Z7AA 1R3LB 1TG8A 2D31A 1M4KA 2X3AA 1YG9A 2OCCB 4RAVB 3WSQH 4H8VA 3UTZA 1RVFL 3GLZA 3A4DA 4LCUB 3FU7A 1KN2H 3NFPA 3DSFL 1FLTX 4LBAA 3BP5B 4HOWA 2PPFA 4RDBA 2A74C 1Q1PA 3BP4A 2A9NL 2AXHA 3O6LL 2WLLB 4E41E 3BJLA 4QUOA 3PWLA 3C2AL 3NCJH 4JQIA 4AM0B 4FN0A 4L29B 5I15H 3N42B 2RD0A 3GMQB 4X9YA 5I74C 1FE8H 3GHBH 2G9HA 4X9FA 1A9VA 5ABDE 5KBPA 3UZVA 5JPMB 1QYGL 1OP3H 2TRYA 3EJYD 1RP9A 2XBZA 1WCQA 5MERB 4R5TA 3TF4A 4JDTH 3DRQA 2VABA 3BPCB 1F3DJ 2IALB 1AOZA 3NJLA 3R8QA 1PG7W 3FN0H 4WFFD 4HUMB 1ZS8A 2ETWA 4H8PA 4PW9A 1DBKL 2HA1A 5IOPA 1MCRA 2EICA 4FAAB 1FNSH 2P43B 3BVDB 4NO0D 3BPOB 4I85A 2RJMA 4XMZA 3KLLA 4XGZB 5IROC 1ZVHA 4E9YA 2IBGA 1G9NC 4DFHA 5F7HA 5TE6H 4FEIA 4ERSH 2R0LH 3FC8A 4P59H 3ULVD 3FO1A 4ZFQA 3IJEB 1BXVA 3MOQA 4PJ8D 5IB3B 3W37A 3Q3GB 1JPGB 2A9CA 2YKLH 5DVKA 3L3OC 4W9KC 1JD7A 2W9LA 3VG9B 3SDDD 3VA6A 4AENA 4BSWA 3QDJE 4E0RB 2CRIA 1WGVA 3QSKB 4R4BA 4YPGB 4MAYD 4MA1B 1E9QA 5ANMA 3MCYA 4WW1B 4PJGA 1CD9B 1NDMA 2HFGH 1F4XL 5DHVB 2W0PA 4EN3B 3MFGB 3CPLA 3DO3A 2H5UA 3TIDB 4PJHF 4XP5H 3RWJB 2YD8A 4JO5A 1IAIL 1KIUA 2HRHA 5I8KH 4X50A 2F1BA 1FFQA 4LSPL 2VW4A 1WWWX 3RFRA 4GRWB 4WHTB 1F90H 1BQSA 1DQKA 5GRUL 1ORSB 3VH8G 5K1NA 3L3JA 1J05B 3OXRA 3CFJA 3SKJL 4ONGH 4BWTA 4LBEB 1AS7A 1TU2A 5DD5H 2YQBA 3LZNA 5JPMC 4PJCF 3PWPB 1R3HA 4C56B 1AQKL 1CZ8H 2DLGA 1XCXA 4N0UA 1A7RH 3QNXB 5DRNA 1RZGA 1JSYA 3RNQB 2BOCB 1QNZH 1IQDB 2JVUA 2LU5A 2YQGA 4ZSOB 3P9WB 1J5CA 4NQVB 3MNZB 3Q0HA 1UA3A 1XD0A 3GLEA 2Y7QB 4IOIB 4MSWA 1MWOA 3BPOC 3DSNA 1UA6H 1V7ML 1E2ZA 1YECH 2R7EA 4EEEA 4PJIA 2HFTA 4PIRF 4X7SH 5E9DA 2DDQH 3MRBA 4WZ9A 5AW1B 4DESA 1NPJA 5M95B 1A6ZB 3LPPA 4M5YL 4OVUA 2CDEA 2DD8L 1P7HL 1G9NH 1ETB1 4H13C 1PX3A 3FAXA 3IETB 3RTQD 3U1SH 4XMLL 3TONA 1VFAB 4JZOB 1MWAB 3B43A 3L5HA 3N9GH 4UUJA 5JDJA 3MFFA 3SDXE 1VLXA 1HKFA 3NIFF 2Y1YA 3D3VE 3G08B 5HJ3B 1WZ1L 3F01A 5D5MB 3K2IA 4MCYA 5IMMA 1H8LA 2WZPD 3BRFA 4MDJA 1KENH 3F00A 5E4OA 4MAUL 4YPJA 2V6HA 3MMEA 4LLVB 1JGLL 3MLRL 3RKDD 4N9OB 3TV8A 3E6HA 4JFOB 3ATFA 1JMXA 1XL4A 2D7NA 4HJIA 5FO7B 3CFBA 4EUPA 2XIIA 5IB2B 3UBGA 2J56A 2Y6SC 2D7PA 3MU3A 4X8JA 4UB0L 4M56A 1EEYB 5I1DA 1SF5A 3ZZQA 2Y1VA 3V6ZA 5D6DC 1QBMH 2VRKA 1J0KA 4PS8A 4WWID 1JXGA 1ZANL 4YSQA 4RVBA 4Y5XC 1N6VA 2PWGA 4K94L 5LBVA 5MENE 5AZUA 3B1TA 4OBSA 3NVQA 3NSFA 1FGVH 2BOBB 1VGEL 5CAYB 3X13B 4ZFGL 2MHAA 4S0HA 4IOSA 4NM4H 1DUYB 3VFOA 2EH8L 2WXPA 3W0WA 3PL6B 1ZHNB 2NZ9D 3QDAA 4OLXH 5IHZB 3VFSA 4HUWA 4BK5C 4ZZKA 3D18B 1PNDA 5DK2A 4KK9D 5G55A 1QLEH 4RESB 5F9OL 1CTNA 2Z7YA 3D2TA 3MNWB 4BXSV 1JI1A 4HCIA 3TVMA 3ALPA 2NY3D 3ZHFA 1A4BA 4XR8C 1MCFA 4HK0B 5LXGH 3NIGB 3T77A 3LH9A 2C1OA 5GRYA 1IBGL 5A2FA 2WVTA 5JA8B 4ONOA 2W80C 4R3SB 2J8UF 4KHTH 1WFJA 3VXOA 4KRPC 3BH4A 1DBAL 1TFHA 2WZ5A 2NY6D 4MJ2A 5JOFB 4WKZA 2CBPA 4P9ML 1I1AA 2LAGB 2Y24A 3GXTA 3N5AA 1R19A 3CVIH 4OV6F 1Q72H 3AG4B 4JLRA 3SPGA 1B6UA 1HXMB 3PV6A 4QT5B 2LLNA 4OCYL 4PGBB 4QHUA 2EIBA 5EUOF 3N85H 3NACL 2QJDA 2ZSWA 2Q6WA 4CSTA 5DHVH 5D4IA 4ZNEE 4K2UL 3DXAD 3LHPL 5DEJA 2A9MH 1BD2B 4ELMA 3EBAA 4GBXB 1PZ5A 4ZUSB 5IK3A 4KITB 4LDEB 5D1QC 2YXMA 3MLPA 3OMIB 5E8OB 2R56L 4KH9A 1MCCA 1FVDB 4XVTH 1FV1B 2FWOB 3LKQB 3WNOA 5JXAL 1FL5B 1SXCA 1SJEB 3MRRA 1WC7A 2EIDA 2F7RA 5DQJA 1B0RB 3U36B 2ZWSA 1RFDH 2CR3A 4GRLD 4A67A 2ZX6A 4QTIH 1E6JH 3HZVA 3SJVB 3FFOA 4CGUB 3G9VA 1HQRB 4JFYB 3L3HB 1UYWH 1A47A 2E8ZA 2YD3A 3AG1B 1DJIA 1CBVH 4XC1L 2FT6A 5IMLB 5DF0A 3L2NA 3I75B 4QXUL 4XH2B 4HWBL 3BO8B 3RVUC 1E2VA 1R6VA 4YH6A 2Q8BH 4PJ7F 3KYMB 2NY4B 5DZAA 3S36X 4H26B 2EIZB 2V5RA 2XTJD 1KEMH 5I5IA 1TJHH 3L9RA 3NEOA 1DJSA 5I6KA 5IHUH 3DIFB 3VI3E 1JF1A 1REIA 4GAJH 5T1MB 1DZBA 3KVPA 4EQ3A 2F1EA 4W4OC 4PY8J 1QUNA 4GXUM 3ZE1B 1U9KA 5HDOA 3SO5A 5I5MA 2WVSA 3KBEA 3KYNB 4FNPA 4DAGL 2CBQA 3WNJA 4EZLA 2AQ2A 4RZCB 2YJLA 3VCLB 5I6LA 5HYJB 2FYVA 5KWYC 1IC7H 4UMSA 3FQRA 4QO1A 2OYPA 1L7TH 3VXRE 2FJHB 4OZGB 1A6UH 3FMGH 4JGJA 4JFUA 2R4RH 4M5ZL 1Z9PA 1JXFA 2FX7L 5SX4H 3T0DA 4TUOB 4PGJA 3HG1E 4HKXA 4LCWA 3V0JA 1P4IH 1O7DE 2UUDK 1QBAA 3TZVD 1TSHA 1N19A 1T6BX 1QQDA 1JHLH 4GBXC 3IBEA 4TVPE 5B4MC 3PCYA 4EDWL 4ZPVA 4D0CA 3ZDXE 4ZFOL 5KEZA 1GKEA 2AEOA 2E7LA 1IZJA 4JN2A 1B4JH 1PY4A 4RGNE 1USZA 3NBNA 1J7VR 1FYTE 4Z3JA 4AG4H 1MHCA 1T1ZB 5FM8A 1ADQA 4KO7A 2DZEA 2CGRL 1QG3A 1UUNA 1J1XL 1G7PA 3K71A 1NSNH 1EJOH 5EZOH 3M1CA 3K6OA 1X9LA 4HFUH 5L7XH 1SN2A 5A2AA 4Z9KB 2IH1B 3RX7A 4DERA 2JJUA 4F3FA 3FOMB 4JB9H 4BE5A 2JTDA 1EEZA 1R3JA 3QORB 2FB4L 3U1QA 2BP5M 3FT3B 3ZYIA 1B4TA 1HS6A 2BNUA 1NC2B 2A9DA 2AERT 2OFQA 4IEFA 4D8PB 4B53A 4Q14A 4ZMWA 6PAZA 4PJEB 1G1OA 1YEGH 5K33A 3RUGF 3DKHA 1HQ4B 3SPIA 4U6HA 1Z1WA 3C5ZB 1PJ9A 4X99B 4YSCA 4GNKB 2JKSA 2EEBA 3VRJB 2N56A 2XG5B 4LSVL 3O4OB 2CO6A 3TFBA 1FBIL 4KXCA 3H3BC 4ODTH 2UY6A 2W07A 4ZODA 4IYKA 4L2YA 4F7MA 5IJVA 4OZHA 2WBJA 4UZGA 5ADOH 2FX9H 1R47A 1ONQA 3Q5OA 4B9FA 5H94B 5A40E 1CLZH 1UUSA 3EFFB 4LL4A 1K4DA 4YFDB 2NTFA 4IRZL 1JNJA 1MZYA 1WFMA 2FYYB 1SMOA 1CU4L 1A9EA 1KNOA 5E94A 5C0FB 4XP1H 2B2XL 2BP8B 1AGBA 2WLMA 2VITA 2I07B 2OMVA 4HC1L 1NLBH 1O75A 1WBZB 2HG0A 4K3DL 2EO7A 4JM4H 2XA8L 2KZBA 5GXBB 5IM7B 3LS5H 4ZMPA 4KRLB 3CH8A 4NO2B 5EOCH 1PG7H 1SMDA 3OM3B 2P8LA 3ZTCC 2EUVA 2H0FA 5E95B 4LIQH 4OIIL 1TKWB 3MXWH 2Q2EB 1K3IA 5CBAA 3C87A 3MNMA 1GYWA 1RUML 5IEHB 5JO5B 5GGQL 3ZYOA 5EIVA 2IG2L 3DJTA 4UILL 4ZYKB 5FX3A 4NP4H 2I24N 2LLLA 3MV8D 4XODA 4ZS6D 1G9MC 3WELA 1RPKA 2G2PA 5T3ZD 5GGRB 1YDPB 4LLUA 3QORC 5E51A 3SB3A 1EHAA 3P11H 5CJQH 5I26A 1W0YT 1LK2B 5EC2A 2O6EA 1OOWA 4FERA 1O0VA 2HWZL 3NN8A 2HJLA 4HAGA 2VR5A 2JIXA 5TGBB 5F9JB 4KJQC 1SYSA 3S37X 2B59B 3MUHL 4AEEA 1BQ5A 1FZJB 3DVGA 4ETYA 3C5ZC 4GJTB 3DOSA 4NM8L 4UNIA 3O9WB 4WENB 3DX4A 4JFWA 1AR1B 3MUZ1 2P9RA 1NMBH 3FB8B 2GTZA 3O4OC 4TF4A 5LBSA 1J86A 3HBQA 3OJMB 5D7IB 5ISZA 2WBWB 4Q8BA 1IGFH 3MRIB 2WXFA 1RHFA 4JHWH 4YGVB 2V17H 3US0A 1C5BH 1Q9KB 5JIMA 5C3LD 1JI2A 4JQXA 1NBCA 3FONA 1EFXD 1JHTB 1UOWA 1I7TA 3A47A 4QHNB 2COVD 1TCRA 1CFNB 4XN4A 4XAWH 4MMZB 1LE9B 3TF7C 3LSOA 1KBGH 1ZMYA 4L37A 5IMKA 5CSGA 3EJPA 2X9WA 3UG5A 3ZKND 2KZWA 1BBDH 3PY9A 4U1LA 4PV8B 1XSIA 2ADGB 2F8IA 4BZYA 4UTBL 3QO1B 1V3KA 3NJFA 1FVEA 1YYML 4KVNL 3AG2B 3UTSD 1XXDC 3LV3A 4Z5RB 1BQHB 1OIOA 3N40P 3OAWA 4OV5A 4BYHA 2QADB 3TNNB 1KLGB 2ENJA 4G5AA 3IJSA 5ALCL 4MQ7B 3QI9D 5EDSA 3VFUA 4ZMNA 4ZAKA 5I9QB 2C9VA 5FA3A 4LRIC 3BLPX 1AIFB 1YEHL 2DQDL 4I1RA 2R29A 3WLWD 3V7AG 4ODHL 2FX8L 3CH1B 1MXDA 2CALA 3L6FA 4O02L 3DOHA 3GRWA 4LHUD 4B9KC 4P5MA 3RY6C 2W38A 5B38G 1WAAE 1D5RA 1EH9A 2W91A 1OGAD 4W9LC 4WNSA 1ITCA 4AZ8A 2VB5A 3OWEA 4HFWA 5J11B 1L7IL 2Z7UA 4FFZA 1CGSL 3DECA 3EO9H 1MCWW 4U1IA 3KLHD 3DX6A 2GT9A 4IRJB 1RL1A 1BEYL 1D5ZA 4XBGB 2KERA 1G9MH 4S1RL 2X89A 5AB0A 1SQ2N 4L9LA 1G5GA 1Y18B 2GSMB 3BEWA 3O9WC 1GY2A 5CXPA 4DTGH 4LVNC 1I7RB 4LVHB 4JQVA 4LDLB 2DQFA 2EDDA 4KI5E 2VDPL 3B6SB 3T2QA 2J55A 1HWWA 3CSYB 4QRPB 3ROOA 3QQ4A 3US1A 1H3GA 1JVOA 1T0NA 2ATPB 4DOHB 5CN3A 2BIMA 3H54A 1UT2A 2IXQB 1T5XB 3H42H 3PG2A 4O51B 4DGIH 3MV7B 3QJHA 4J3VA 3H7LA 3E80A 1NCUA 2GJ6D 1GMEA 2NX5E 1HSBB 4YN3A 2ADJB 4PJ5B 3A4FA 2HMIC 4AQ8A 5AOLA 4LT7A 5DHYB 2IDFA 5D4QA 3EO0B 2VQTA 1KTDA 1JPFB 2GVYA 4XNQB 5ALBH 2FRGP 3WO4B 4NFCA 5EU5A 4EXKA 4JVPA 1ZWIB 3C08H 3AW5A 5C0CB 1GRWA 4LU5L 3SDCD 1EEQA 3KBFA 3U4AA 1P4BH 4K4KA 3EKCA 2QADC 1MFVA 2ERJB 4FJ6A 5FYKH 5B1KA 4HT1L 2X4NB 3RWCA 2XWTA 5D93B 4ELKA 3CSGA 1YC8A 1NM4A 3MRPB 1F6AA 3I6KB 3G5ZA 1G94A 35C8L 1ZSDB 2CMRL 3N6YA 4LEBA 3TNMA 2WKOA 2YO3A 3PWJA 4J7RA 3G6JB 4G1MA 1VCAA 2X2JA 4G42A 4L05A 3QUYD 4XXWC 3WO3B 5DLMH 4LHJB 2PCYA 2WNXA 4Y4KD 3UZEA 2VR6A 5ACZB 1ZIAA 4QTHA 3G5XA 5BMFL 1B2WH 4IW4C 4IRJC 2PWHA 2WAHA 3BEVB 2CG9X 1OAQH 3MOBL 3Q06A 4JRXD 5I1JL 2GEEA 4PHZA 1L0YA 5LAPA 2V2WA 1OB1B 4CNIA 2XWXA 2SEBA 1S8DB 2HLFD 3PHOA 3LB6C 1CPUA 1M7DA 4UIKL 3RGBA 5FYJU 4L23A 4EVNB 1OEZW 2HRGA 3BD4A 4FZEL 4NRXB 1LO4H 5AKSA 4TLSA 3CHQA 3KLAB 1S7SA 2ZUQB 5EBLA 5J6HA 3HNTH 2BSED 1H6TA 3KPPB 5L8JB 2ZONA 2NXZD 1ZSHA 3U7AA 3MRJB 3JZYA 2Y5EA 4XNZB 2JKLA 2WWNA 1VPOH 4I3RH 2YBRA 3P3YA 3TIEA 1E5UI 2J5WA 3BH9A 4K7FB 3WO4C 1M7IA 3N0AA 4JFHE 4OLUL 2XQBH 1KCWA 2XNAB 2N7BA 4OLVL 3RI5F 2X4TA 2FEJA 3S5LG 2GIYA 3IFPA 4OF3A 4AE1A 3FO9B 2J88L 1SFHA 1WPCA 2XA3A 2ERJC 3F84A 1UXSA 1QTPA 3V55A 3VFNB 2ITDA 4N0YH 4NRZA 2H45A 3VXUB 4Y19D 1CIUA 2C7FA 3TS8A 1NPNA 3NP4A 3DJ9A 4XCEA 1AQDB 1AE6L 2PO6B 4YQXL 4Z77A 1J1OH 4JE4B 1XGQA 4NDMB 4X6CE 1MHEA 4FTVA 1WHPA 1HHKB 4P5KB 3IDYB 4UAOB 1QSFB 2V7HA 2L0DA 2W1NA 2YHGA 3OKNB 2G60L 4CDHA 5LJYH 4BZ2H 3BVNB 4HXBL 4ZRGA 5JQ6L 2BRRH 4L5FH 4P4KD 2VDKH 5C0BE 5DEFA 4R96B 1A7QL 3ZDYF 3KPRE 3RTQC 4HUVB 4LK4A 4HJTA 4YR6B 5C0AB 4G2AA 2DQTH 5KVDL 1FDLL 4DP2X 1MNUL 5K9OB 2HH0L 5IT2H 4WU7B 1NGYA 2XKNB 4H25B 4HGWA 4PMFA 4APQA 3L08A 5IW1A 3B9AA 3L2MA 1I8IB 4N0FB 2FH8A 2I26N 1F11A 3GI8L 3QEGH 4H2AA 3EGXA 3NCBB 5E6ID 1AD0A 3VWJA 5LGHH 1MVFA 2QVIA 3D85A 4HDIB 3RKDC 2ZUQC 1WAPA 5DUBA 2AGJH 1TZGH 2A0LD 2QMKA 4O58H 5DWPA 3VQLA 4OGAD 1EK3A 1P53A 2X6AA 3MJ6A 4IKKA 4XNZC 4LSQH 2JQAA 5B8CA 5HI5D 2YMTA 3ARBA 5GS1A 5EUKA 5A16A 4J2XA 3IDMB 4OZIE 5CCJA 3TO4D 4NUJA 3QBTB 4AJYV 4HPOH 1DVZA 4PP2B 4ZUTA 2MWCA 3R4RA 5KZCD 2NSXA 3DRTA 1IIIA 3QUZD 4QMEA 4AQ1B 3NRPA 4Y9EA 2D7TL 2MCG1 3QDMA 3RGVB 4WEEA 3VFWA 1DE4A 2O61B 3GXMA 1ODAA 4WUKH 5T5NF 1B3IA 4UAHA 4MJ6A 2HLAA 5AUMA 1ADWA 1T03H 4L4TE 1J8RA 3F04A 3V2AR 2PO6C 4GPVA 5H37G 2ZUYA 1IGML 3HG5A 2ATKB 5DJXB 3T3PE 1JZJA 4QTFA 2OSLB 1HNGA 2QFRA 3JV5A 2JQMA 1J0JA 1KCLA 3IDYC 4UAOC 3RDTB 1IAMA 3CHXA 2OTPA 4JGMA 2BHFA 3ZKXB 2E6QA 4OGYL 1BMWA 5CCKL 1K5NB 1OM3L 2LAAA 2H2SD 2E9GA 5D71L 5H4YA 1V7NH 4HV8A 4LEOB 4X4ME 1LWRA 1E5CA 1MCDA 1AP2A 1RIUL 4K7PY 3Q8EA 4UQEA 4Z76A 3ZT7A 2AMUA 3D87B 1G4RA 1OE3A 2C4FT 2YEVB 3S36H 5I28A 4NO3A 2UZIL 4GW5B 4KQ4H 2V7NA 5CIPA 1MW2A 4YZFF 4LSUH 1EEUA 4DP6X 1KN4L 4OD2B 1NLDH 2ZKXA 2P5EA 4A66A 1D5XB 1Z3RA 3HKFA 1NL0L 4I3SL 3GLDA 3EYOA 1IEBA 3QHFH 1ZV5A 1CICB 2Q2LA 1AH1A 3VE0A 1SOXA 1JHKL 1LEKA 4YE0A 2D4FA 2CXGA 5ESQA 3VXMD 5INCB 4GLRH 2VDNL 3PABB 4XNXH 1TTCA 2EO1A 1QWHA 2O26U 3N1QC 4ES8A 5J7CC 3QA3A 1YSOA 3F64A 4PJ9B 5I5JA 1UJ3B 3CVHA 3WJJC 4GSUA 5FM5O 5DRWA 2YPVH 3AXIA 4Z8FL 2XFGB 4AQ1C 1KLFB 5D6CA 4M7LT 2IDQA 3RGVC 1NCCL 2BIOA 1Q0YL 2CBOA 3IT8D 4JPIB 3U83A 1TNMA 1KGJA 4N2GA 4NPJA 3FHAA 3W9EA 2WANA 3C60C 5ID0B 2IOIA 2DIBA 1OZTG 2O6DA 3CCHB 4I0CC 5TH2B 1KB5B 2EIJB 1GGIL 3LRKA 3U4EA 4PW4A 5G4MA 5E4AA 1R5WA 4G8EB 5J8OA 4CN4A 2P42B 2OL3L 2C1PA 3RJDA 3QAQA 3RDTC 4DSYA 3H3PH 4GQQA 5L6YH 1YNKH 1UACH 4BWUA 2H47C 3BD3A 4XVUC 2GUOB 3ZKXC 2B0SH 1OP5K 4A68A 1JV2B 3QDJB 3Q2LA 3QDGD 3Q8BA 4R7XA 2OP4H 4JRLA 1HDMB 4ESKA 2P5WD 1MIML 2QQQA 1HIMH 1RK0A 3H9SE 4X83A 3HS0A 4NN7C 4N6RA 4J6IA 2UWEF 4Z7UE 4YDIL 1XX9C 4G9FA 3GEFA 5C97A 1VB9A 3SDAA 4JE0A 2CKBH 5D1ZA 5D55A 4UT9L 4O5LL 3C2SA 2ZXCA 2C3VB 4UBDD 3RWEA 2ZCHH 4C4KO 1UWEL 2BWQA 2XG4B 3CAFA 2X4SA 4WF7A 3TZVC 4BSVB 2H6PB 4AK2A 4YSOA 3UTTA 1CDHA 1FO0B 4KZEL 2I5YL 1HX0A 2X4QB 4CDGC 2EEAA 2E59A 2JB6B 3O3BB 2G0KA 4JG1L 4NC0B 5HI4D 5GGVH 3DPBB 2DLTA 2K6YA 2MCPL 2MEJB 4NZUH 5E5LA 3ZLQC 1INEH 4LXFA 1RHHB 4PJ9C 4NQCE 5D7HA 1E4KC 3KLKA 2F68X 4LKXA 3FPYA 1N7ML 3ESVF 3TBWB 2J6EL 3BT2L 5IWLC 1INDL 1BJMA 3S88H 3M1BB 2FSEA 3R0NA 4OKVA 3PGCA 5IUSA 3IXAA 2VZOA 3H1ZA 1NBYB 5G4NA 2CLZA 4PGEB 1RK1A 4CRPA 5DZOA 3A5VA 1F4WH 5FM5M 4NQDA 3JV6A 4UQIM 4W9GC 4S1QL 4QRUA 3VXSA 4KPHL 5C09D 5CGYD 1T4WA 3L4XA 5HJDA 1A9BA 4ZOCA 2G2RA 3UERA 4Z7WA 2P80A 4KUZL 3CHSA 3QRBA 4MD0A 4AYMC 3OX8A 2NSMA 3TA3B 2ZT9C 2KC0A 4Y5VA 3SDXB 5TQ2L 3SYCA 4JFDD 2ZOLB 3BAEL 5F97E 3D3VB 3NSJA 5JHLH 4MXVF 1BYOA 4FQQA 5C08D 3UADA 4WFFE 1MJUH 2BW4A 1RURL 2P52A 4IGBD 2NYZA 2OAAA 1AZUA 4OLZH 3HE7D 2IBZY 4PD4J 3VO0A 3JWNH 4UNTA 4PB9L 2H1XA 3GKWH 4M7KH 4C57C 2AV1B 2DMGA 2EDYA 1FC1A 2BNQD 4MJIA 4QRSA 1UWYA 3ASNB 3ATDA 1ZGLB 4LSSH 4FQLH 3VGEA 5IVXA 4JKWA 3QIBD 3ZO9A 5EF2A 1A25A 3OKOA 2C9XA 2Z65C 3S37H 3PGFH 4E41A 3WNMA 2FQFA 4DGYH 1VKXB 2H1PH 3PP4L 4RX4D 4YC2B 3SOBL 5MENB 4YBLB 4YX2L 4QOKA 3D7PA 1EHNA 3ESUF 5GZND 3QXAA 4U6XA 2MIZA 4NENB 3T6ZA 3JQOB 3QFJA 5FHAH 5EA0L 1YA5A 2OMUB 4F7PA 5IQ9A 3QWNA 2X1QA 5F93C 4Q9RL 1T89C 3HI1A 4BFBD 2J7LA 1I1FB 5AOIA 1ETZB 5IW3A 2NYYD 3GMLB 2VLKD 4HIHA 1A6WH 1J87A 1I82A 1UZGA 2DQIL 3FU0A 4QEGA 3L1EA 5LAXB 3HAEA 4H0IA 5FDWB 3L3GB 1WH0A 4FMVA 4F9LC 5C6PB 3CJJA 4LLYB 4MVBD 1RAMA 1KCKA 2NZ1A 2ICWB 2VXQH 3BSZL 5L2KD 1G6RB 1LQBC 3TA4D 1EAQA 3VM7A 5TQ0H 2EDEA 1DJXA 3KL5A 3TA3C 3UDWA 3QO0B 1NANH 2R2HB 3TTSA 3CE1A 3OAYK 3IVKB 4OVVA 3TBTA 3BP7B 1NDGB 1N3NA 3ECQA 3I3DA 5JYMA 3V52H 4AEIH 3VGBA 2UYLB 4Y4FA 1CF8H 2FO4A 2WUBL 3AY2A 5I1GL 5GRZA 3D2UB 3NMEA 1NIBA 1C5DA 1M56B 2HKHL 1IBHA 2BSRB 2YARA 1OW0A 3F12B 1MFEH 3H9YA 4GRMB 4PJXE 4U1JB 1N9PA 4KK5C 4HPHA 1DN0A 5KTEL 1S9KC 5CEZD 1CE6A 5DUMH 3OV6A 3LN5A 5KYXA 1E5YA 4I4WB 5I8CB 4Q9QH 3SQBB 3V9EA 1XR8A 3OJDB 1UB6B 1PTZA 4JFTA 1JNLL 4UV4H 1S7VB 4CC0A 2Y36L 1M05B 1JGUH 4XOEA 1BSIA 1ES0B 4RSVA 2WCPA 3HCVA 1FO0H 2AMGA 2OBGA 4HMEA 5B39B 1QLFB 4G7YH 1J9CT 2ZKHL 1BM3H 4JPWL 1BFVH 2ZG2A 4M6MH 5TE7H 3TYGL 1S7WA 2GB2A 1AGCA 2BO0A 2EINB 3QUML 3L45A 1KXQA 5D2NA 4S2SA 1HESA 5IJDC 1NA8A 3BUYB 3O6ML 3IFOB 1JXJA 1OQOA 2NNRA 1TETL 3MJ7B 1KTLA 1AD9B 4L8SA 5E03A 2OR9H 5KVDE 2NW3A 1LO0H 5AFAA 3VU1A 5IIEA 5T33L 1YEIH 2Y5QA 2R1YB 4H8WL 4AW7A 1XZWA 4F58H 4GW1A 3TFKC 1AFVH 5CZVL 4Y2OB 2GK0A 5D7LE 5FYJL 5KN5B 1A3LL 2AK4B 2EYTA 4XPBH 1PQZB 3SE3A 3VXRB 1ZHKA 1F3DH 4KNQA 1R3KB 2BVOB 1DL7L 4QHLA 3QUKA 4GO8A 1U42A 2JCCF 5IFJA 4JR9H 1PBYA 2CHWA 4FQXB 2RQ8A 5FWRA 2ORBH 1T0MB 4YNYA 5AAPA 5FF6A 1AXSA 1S7RA 4K3EH 4J3SA 5SWSD 1SQMA 4PGDB 1KPVA 4Z7NE 3T4AA 3D9AL 3FTVA 2WWMD 1QKZL 1T04B 3K91A 4RAUB 4RDQF 2HZHA 4BZ1L 3BFWA 4TSAL 4NJAL 3C5SA 3DO7A 4IU2A 5KSUA 3ZDXB 1FUNA 1NCBH 1S46A 3NA9H 1UCBL 2WYTA 3K46A 2ZUXA 4P3DA 4G6KL 4RGNB 2AS5M 1SY6H 5JOPD 1IGIL 1FYTB 3V0FA 1UEMA 2HFFA 1A3QA 2R27A 4UDTB 1CLOH 3E8UH 1A66A 3WDHA 3QJXA 4JPKH 1UVQB 1XIWB 5I8EA 1A3RL 1IM9B 3BVVA 2P3YA 4DZBB 4U1NA 2OULB 1YNTA 4JHZA 1RULL 4HCGA 5ETUB 3RX5A 4GIAA 5CILH 1BDYA 1HL8A 1XH0A 4AYEC 4ZXBA 1GZPA 5CP7A 1H3PH 3CFIC 1OALA 4NRYB 3UO1H 3OAYH 5DUPH 3WU1A 3V4VA 1OAJA 4J3TA 2BFVH 3FCTA 2UZPA 1NC4B 5AZEL 1OL0A 3FBKA 4ZDHB 5JW4R 1YNLL 3DXAE 4NIYE 5LHDA 3EXLA 4UQ2A 4HIXH 4M6OH 4IDLA 3GSQA 1XF3A 2VDLL 3KPSA 1DQLH 2WZAA 1F58H 5F7KC 3CSTA 1KV7A 2W0FA 3W2DH 3BKYH 4TTDC 1E6OH 3ZXAC 4ZS7H 3CQQA 1BEXA 4LMQE 1FL3B 5SWQA 5E8PB 4NWTH 4XMPL 2DWEB 5KSVA 2YUXA 1HSAB 4FJZA 5HPMA 3NFNB 4JCWA 3W39B 4BH7B 5BO1L 5GS2D 3R7QA 2X6MA 4LEXL 4ZFFA 1MRCL 5IV2B 1QFOA 1BWWA 1P6WA 1ASPA 1WZKA 1AGFA 4EJ1C 2HVKA 3QJRB 2F74A 3E0GA 4P0DA 4PJIF 2VISA 4OT1L 4XBPB 1KACB 5C0IB 2Y7MA 3U0TA 2C4XA 5A2CA 2WTRA 4LKCB 4RGNC 4MB5A 2BX5A 3MRLA 3ZE0F 1KEGL 3ESNA 2NT1A 4PRPD 2YMXL 3O11A 1JF5A 1MFMA 3ZL2A 5I0DA 1O7VA 3HPJA 5EU6D 1MFCH 3MACL 1TDQA 1DANT 3C6SA 3S5ZA 4NCC2 2ZJSL 5JLZA 3TCTA 4F7EB 3BIAX 1HEJC 1A1NB 1XL6A 3Q1SL 4XPTL 1KELL 4LCYA 4MXQD 4LLAA 4EMZA 2VC2H 4M6NH 4KHXH 3WTTA 3HN3A 2IMMA 3T0EC 5I1LA 2AW2A 3VA2C 4ZX3A 3CDZA 3IFNH 1U36A 2WXKA 3K2KA 3B7YA 5C0EA 2X4RB 4YVUA 3REVA 4N9GB 2XN9A 1Q0EA 4DKEH 1S7XB 4XWGH 2AFNA 4Z7IA 4QRTB 1DJYA 3VI3A 4FKKA 2DIJA 2OA9A 4P4KC 1MQKL 1NUDA 1Q94A 5GS0L 2PXYB 4P2RD 2I9LA 4JANA 4MNHA 1JFHA 4Q56A 3SDYL 2LVEA 2P26A 2Z35B 3N42F 3IAQA 3QIUB 4F8TA 4TQPA 3V0VA 4KGLA 4KROD 3SKNA 5KVFH 3GTTA 5LO7A 1O6TA 3EJZD 1LEGB 1NBQA 2CHZA 4HW6A 2BDNL 3KL3A 1UASA 4G5ZH 4EE2A 1A0QL 3W11D 5F89A 2GTWB 4X5LA 4YWGL 4KFZC 4IRSB 1JNNL 2FNBA 4JZNB 4ZZFA 3HB3D 2VUYA 2A0LC 2BZCA 4PRAB 2L7JA 3LKRB 2EXTA 2W9DL 3G5VB 4RRPM 3ARUA 4QF1A 5DD1L 4KX9A 3OTTA 3ARDA 3QYNA 2E7DA 3HMXL 3WE6B 3HG1A 1WLHA 3M7OA 5HI5C 5DJ2A 1GGBL 2VZUA 4NKOB 3V7AE 2A7BA 2K8MA 3NJXA 4X7TA 5L9DH 2E9WA 4KMQA 5F7DA 3O8XA 4OM0H 4NLAA 1JZ6A 1OGTB 2FEEI 3HPLB 4QY8B 3F5WB 5JHDE 5E8EB 2N7SA 4GAYB 3QUZC 1J1PH 3OAUH 4NQEB 3F7VA 1P5VB 1I3GH 4P46B 4U6VH 5CR8A 1QSEE 3WFCL 1VEOA 1CD1A 3GJFB 5HHOA 5HHMD 2WBXA 2GEQA 3FB6B 4FP8L 4HEPA 4J8RB 4GI8A 5FKAB 2EDTA 1BZ7B 5E6RB 5D1ZI 2DKMA 3AAZA 1VSCA 3MYJA 1R3IL 1KYUA 4AVHA 1A14L 2LFEA 3ZYZA 5E8NA 4WTQA 3VFGL 1OE2A 2H3XC 2DAVA 3QZWB 5HD8C 4PLJC 3SBWC 2VXSL 3JV0A 4X6BB 3ZIYA 4L3AA 1DFBH 4W6XB 4BQ9A 1BXUA 2W9EL 1GR7A 3GRGA 4GRWF 4UM9A 1RUQH 2NNAA 4FC3E 4LLMB 3UJJL 4YXKL 1U33A 1HHJB 3E1ZA 1ZT4B 4NPYB 4Y5YC 3QIUC 5KOVC 3SGJA 4GSRA 2Y69B 4C4UA 1J8HE 1KSRA 3UJIH 1RUAL 1RVFH 5F1IA 2R2CA 3VFTA 1L9OA 4IS6A 2HPTA 4WDIB 3DSFH 4PVNA 5DD0L 5AVZB 3C8KB 4K0OA 1E0OB 4AKPA 4YHLL 3VQ1C 5I17B 1U8KB 3ZGHA 3J8F7 4X8GA 3O6LH 3OR6B 2Z1KA 2VWEE 4IRSC 5CCHE 4A63A 1WA1X 2VAAB 3C2AH 2NX5B 2FUQA 3GBML 4NBXB 4XO3A 4TOYH 5T3XL 4ZJ9A 5EZPA 1OCZB 2VCOA 3MV8E 4IJTA 4MA3B 1QOKA 2UY7B 1TVBB 1OSPH 4HBQA 1UZ6E 5HJGA 1QYGH 4L4VE 4J3OD 3WTUA 2PTUA 3RIAF 4ZUVB 3T3ME 3KPMA 5D7SL 2ZKWA 2RBLA 3MJ9H 3AGWA 4XP4L 4QHMB 4U6YA 1FZOA 2ICEC 4EZJA 1J11A 5AWNL 1Y1DA 3FT2A 3BQUA 4JFED 4V1DE 2YBGA 4DKFH 3AQDA 3L3OA 5M94B 1BAGA 3I9IA 2Z8SA 5E2UH 5KBMA 5KYUA 5T1LD 2JK5B 4N6QA 4P46C 5L4JA 1MI5E 3SOTA 2IV9A 1RZFL 2EABA 3MUGA 4J39A 1J5HA 4AGLA 4KXZI 4BCZA 4QXWA 1FH5L 3FCGA 3ZZSA 4MXWH 1H6FA 3VAEA 4BDVB 4YXHH 3RBGA 1CDJA 4Y2NA 3UYOD 4X42A 3BLBA 1JCVA 4JFPA 5DGQA 5D5MF 5F8QC 1YUKB 4WUUE 3CMOH 1PKOA 3M45A 5EIIB 2CR6A 3IDIA 5KG9A 3S34L 3H9HB 1AZCA 3HC4L 1MVYA 4PCYA 1BBJB 1ZRUA 2ADFL 5CR1A 1U8MB 3A6BH 3QQ9D 5F3BA 1FCGA 1GH7A 3EYFA 3OQ3B 1LD9B 3ZL4L 3IJ7A 4JX0A 5HGAA 4O4YH 1IM3A 1HEZB 4E9QA 5I1KL 4KI5C 3NCWA 4CAGA 1S9WA 3BZFA 4ZOEA 5BRPA 2OMNA 4R97B 1CGTA 2AJXL 3BD5A 3DTXB 4LSPH 3T71A 3VWKD 4AT6B 4N3UA 3FRPA 3NH7L 3RE0A 3IDJB 3FQWB 3DI3B 4H1LA 5GRUH 4K94C 2XX1A 4QJ4B 2XTLA 4YHNB 3MNVA 4IIQA 3P54A 5MEOB 4QAMB 5FCUL 5HYFA 2K7QA 4FABH 4HMDA 5EEYA 5TDPB 1JWUB 1IO4C 4IHOB 5JHAA 1IJNA 1OGAE 3U9UA 2P5PA 4HS3A 2XVLA 4L1LA 5E9NA 5LCVH 5KSAA 4WSGA 7FABL 3TT1H 2AANA 3WIAA 1GL4B 3SKMB 3TVMD 4R7DA 4CSZA 5J57B 1BM7A 2R2BA 1EO7A 3LZQA 1N10A 1YN7A 5MEQB 3NIGF 4JFQB 4UU9A 5EZLB 2JB5L 2QDWA 3PHQA 4UDUB 4K55A 4QYAA 1S9YA 1V7MH 4OM1H 2ZWLT 4LPYA 1DUZB 2VDOL 2Q86A 3OF6D 4JG5A 4X6CB 1QWUA 3S3BB 2UXGA 1IKOP 1XV8A 5FYJE 4P04A 4FMKA 4CSSA 2QSTA 1G7LA 4ISVA 4XZUA 5F9DC 2GJ6E 5EOQH 2DD8H 1VHPA 1N0XL 4HXAH 5C0BB 1MY5A 2BSSA 3OR7A 3KPRB 3UXFA 5KBDA 2NTSP 3PQYD 5F1KC 3FSAA 4AWJC 5DS8B 2OMZB 4G7SB 3UBXA 1TOXA 3D0LB 1TTAA 4EPSA 1UQSB 2XXMB 5I30H 5E00A 5J9PB 5EMYA 2NYKA 3WXVH 4NSKB 1IARB 1XSKA 2DBLH 3BGAA 4FGMA 1NWPA 4NXKA 2ZP0T 4PP1D 3NCEB 3GBNL 3IKCA 3MGAA 5HDQL 5GZOC 3IAPA 3NZ8A 2TSAA 3MZGB 4Y5XA 1BZ9A 1FZMA 4J3OG 5JUEH 4KFMA 3DBXA 3GB7A 5K5YA 4FLOA 2WK2A 4JFSA 3TBVB 5AB2A 2QQNH 1TZAA 5D2LE 1E40A 2DF3A 3DJSA 3H3KA 3LEXB 4OTXH 4ZK8A 4A7QA 3WGUB 1CR9L 1TZHA 2XY2A 3NQKA 1YEFL 5IVZB 4LSTH 4LFHD 3QIBC 4OZIB 1JK9B 2XZZA 4LDCA 1NGZB 1RJYA 3TASA 1YLBB 4K94H 3EOAA 3RWDB 2J2ZA 3DHMA 1E5ZA 3PFQA 3J2PA 3D51A 1CC3A 3ZE1F 4YS4A 3C6LD 1LP9A 4NHCL 1P9MA 4X0KB 4DN3H 2EH8H 3IGAA 4MCZB 4U1MA 5ICYB 4FG4A 2FJUB 4RWYH 4B9JA 2F1AA 5KS9E 3HE6C 4L4TB 3ZRCC 2DTMH 2HJFA 3DTUB 1KLUB 3P4OA 3T3PB 2X4UB 1TQBC 3BCDA 1QLRB 3IU3A 4HKZB 2YD4A 2ID5A 3T04D 4OCXH 4OZGF 3UOAB 3UTQB 5EEVA 2E4FA 1IBGH 3L4UA 1ROWA 1BQLH 4LCWD 1JPSH 4FCAA 4R6UA 4WGKA 1MHPL 3MRMB 3ARGB 4X5RA 1IGCH 5I23A 3NTCL 2L7UA 1JMZA 2F58L 1DBAH 1ZDQA 5DMIL 3BT0A 5I76B 5D1QA 2HTLC 3CDGA 2C4FU 2Z92A 2DI7A 2YA0A 3MLXL 4XCFL 1L9MA 2FHCA 2Q76A 5K39A 2F19H 3L3IB 5KJRH 1FF5A 2WQRA 1QEWB 4QCIA 4NC2B 4GG8A 4KJYA 3ZJAA 4OCYH 2D3VA 1H3UA 3NACH 4NC1E 1ETJA 3M8OL 3MI6A 1U3HA 2R8SL 2RB8A 3LHPH 1AKJA 4JVWA 3MBWA 1IVTA 3MRQA 4B6ZA 2CK0L 4RGMB 3WMPA 4WI3A 3MV01 4FQIL 4JNXA 3JTTB 2YXWA 4QIRA 5JXAH 1DDHA 1JRHL 4N2CA 4NBZB 2WIIA 1IC4L 3LIZA 1HHGA 3NP3A 5HPOA 4PYGA 2OPCA 3GUTA 3DI2B 3FL7A 3D48R 4X6DE 4W4OA 4I87A 5JMRA 2R0WH 3FU6A 1BIIB 4QXUH 4YIQB 2AKRA 1JWSA 4D0DB 3LKNB 3HHRB 4NB7A 3DX1A 3L17A 3FS9A 4AVKA 1MJ7L 1KT2B 3A4AA 4YK4C 3Q8AA 5E5MA 1ND0B 1LO5B 1A6VL 2VQ4A 4AYID 1P7BA 1KJMB 1EV2E 1XF5B 2BIIA 5K59F 1MY7A 4PRIA 4DO4A 2H1LM 5JW4N 4JFXB 1ZPLA 4XE0A 1OANA 3X12B 1SHMA 4POZC 4HIEA 2XPGA 2NR6D 1PD1A 3HFMH 3PIQA 2H41A 1P1VA 4MMXB 4DAGH 3L1GA 1F42A 5DD6B 3D25A 2YJQA 5DJCB 5FS5A 4N2IA 3N3EA 1Q0XL 4KKCC 1V55B 1E50A 5GRJL 3ARGC 5C07D 4OZFH 1X4XA 2VLRA 3DUSB 3H9SB 1WIOA 4FXLA 3VH8B 3L4YA 4Z7UB 2BC4A 4BBWA 5DVLA 3HLAA 4Y16D 2VIRA 5E4EC 4M5ZH 4HOMA 1JXKA 3U4BL 3CFMA 3EZJB 1TO5A 5FB8B 3QDHA 2AXGA 4NWUH 5AD0B 1CG9A 4GY4A 2YWZA 3DHPA 1F45A 1LEIA 1MCPL 4Q52A 1QFUL 4P05A 2ESVB 5DFWH 4Z78A 4NI3A 3MCKB 4EDWH 3K6NA 3MOAL 3P2DA 4K3JH 1ZHBB 4N25A 2XCMC 2AC0A 1Y6NR 3CFTA 1CDIA 12E8L 4NQCB 4P5TC 1JYNA 1GGCH 1MPAL 4Y1AA 2VQ1B 2B1AL 3ARQA 3A67H 1IC5H 1QBLL 1U8LA 1ZDSA 4FFTA 4O02B 1TJXA 8FABB 2CGRH 4I0PD 4Y9FA 2A6DB 3B2XA 1PFCA 5KVGL 5EN2A 3VFPA 1NUFA 4CA4A 2F7OA 5FPIA 1SOKA 4FNSA 4GKOA 1QO3B 2QMJA 3RWGA 2VDML 3TCLA 3WAJA 2E3VA 2G3XA 1DR9A 1ZTXL 3O0LA 4PJBE 4ZQKA 1EJFA 1G0DA 2XKSA 1A1MA 1U93B 1Q9WA 3QJUB 3S2AA 4BGLA 3INUH 5ISZD 1A7PH 4S0TD 2X1OA 5D7IF 3UIZA 3CD4A 3MQIA 4JUSA 2VDPB 4MMXC 5GGUA 5AZ2H 5CMAA 5LQBL 1SEQL 5GGRY 3VXME 2J5LB 4LPCA 1WBYB 1NPUA 1TO4A 2WKGA 3NEXA 3OB0K 5EU3B 5HYIA 1J8KA 2BNRA 5DJYB 3IMTA 4LSVH 1FBIH 1ANUA 4KBPA 4OAWB 1VFOA 1W80A 5HGDA 2A5UA 5DJDB 2W92A 2CPCA 3ULUL 4IJ3B 2YRPA 5GIRB 4AKOA 4PWHA 2WB7A 3Q43A 4KKLD 4ZTOL 4TQ8A 2X0UA 1JK8B 3SGEI 4DGVL 4QRRE 3CVCA 5I0VA 2QPEB 1S7QA 4IRZH 4I9WD 2ITCB 2QVFB 3QJTB 1CU4H 1MFBH 1S7TA 5BUAA 3FCSB 2B2XH 2APXA 2IADA 4BSJA 3CIQA 4HC1H 2CLRA 4PJ8B 4D0BB 2XJLA 4A7UA 2VKWA 2YQ3A 3ZO0A 1T21B 3E3QC 4PN6A 1JWMA 2WIMA 3SDDB 2Z31D 3ZPDA 3DV6A 4YUEL 2A6JB 3RJOA 4WY7L 3QDGE 2J71A 3U6XA 4OIIH 1L9TA 3BIKA 3UAEA 2N1KA 2P5WE 1PX4A 4JGUA 5ESVB 3VXTA 1RUMH 4X98B 5GGQH 1AO7E 1P2CB 1BF2A 2ZSVB 4UILH 2FBJL 4Z23A 3AVEA 2R0ZL 4DP5X 4L9DA 1O7SA 2OYLA 4HKBA 4LAJH 4DZ8A 5BXFB 3OQRA 4JQIL 2PR4L 1OAZL 4HAFA 4FQ2L 5IR1A 2VN5A 1R5IA 3FT0A 2ARJB 5INDA 1WV7T 4V11A 4X7CC 2IF7A 2HWZH 3PU7A 1K4CB 5B1CA 4HZLB 2BP0B 1I9JH 1VAHA 3GSWA 1H3VA 2ZYSA 4HJ0D 2R23B 3HG3A 2H0JA 1RKRA 2J5LC 3DX8B 3P4MA 5B7EA 3TO2A 5I2IA 2F9BT 2VLMD 4NM8H 4ANXA 2DWTA 4WJ5B 4HHWA 4AGMA 4DVBA 4R0LB 1CDGA 3BH8A 4KROC 2J20A 2YK1H 3FOLA 1GTFA 4M62L 3DGGB 4OJYA 3NOIA 2NUPB 2MKLC 4IJ3C 43C9B 4CUCA 4NCDA 1JZ2A 3W11C 4KXBA 4LP5A 4PJXB 1CFQA 3ZQXA 3R18A 5DI8B 3RZCB 1S78D 4CMHC 3S4SB 1ZEAL 4HUXB 3DYMA 5GS2H 2MPAL 1RUPL 4Z7VE 1BOGB 4A2EA 1WIPA 4UTBH 2A6IB 4IQHA 4F27A 2QLVB 3OG4B 1YYMH 1ZLSL 4WEUD 1CXHA 1MDAA 1DVSA 1ILSA 2GPZA 3G6JF 2CPUA 3JTSA 4HSQA 1S3RA 3BZ5A 1L0XA 15C8L 1ZA6A 3T2OA 4YDKH 4JFDE 5ALCH 4F9PA 3O4LD 3N06B 4LPXA 4LLWA 5C08E 2C3HA 4W68A 1YEHH 2YR3A 3OB0H 1ZPUA 2LQRA 4IBQA 2ZX9A 4MD4A 2FX8H 2LABA 4ODHH 4N5EC 4WHYG 1QRNA 5CNHA 4YHIA 1VDGA 1M71B 1HHIA 2NDGA 2GJZA 2NLJB 4P23B 2Y6TE 3KPNB 5J1AB 3MJ8B 4ZUUB 3LNGA 3RTLA 3BRGC 1CGSH 1D7BA 2P8PB 3GRBA 4M3KB 4Y0GA 2FJFB 2OK0H 1RZJL 4S1RH 5JW3L 1OM9A 4GUPB 2F53A 5D7LB 1O6VA 3WL9B 3GSOA 1YJDH 1G84A 1JDCA 1EXUA 3GMNA 3O0RL 1FNGA 4PD4K 1E8XA 3MKKA 3BGMA 4R0LC 4XT1C 3OKEB 4IU3B 3L5JA 3B8YA 1KPRB 4A2LA 3KXFD 1YAIA 2X05A 1DVUA 2F7QA 3KW8A 3S96A 1TZIA 2NMSA 3FTZA 3RZCC 2VLKE 1I8KB 1P1ZA 4YHML 4M8QA 1EO8L 5IF0A 3K6SB 3H7BB 4BJLA 1YPZE 3P77B 1LDSA 3RVXC 2QR0B 4NO0A 4B50A 2IFGA 3OKMB 3QEHA 3R06A 4J28A 5IEKA 4GXVH 4BZ2A 5JR1L 3NK4A 4GINA 5L2KE 3QCTL 3D39B 4LU5H 5IBUG 3FUIA 3WEXB 4X6EA 1NOAA 1KIPB 5HHPB 5JMOC 4RRPG 4FQCL 4FTVD 4RFOL 3VI4A 5KBNC 3DK0A 4HT1H 3EYVA 3ARYA 1S9XB 5TE4H 3V6OA 1L3NA 2VMDA 3UPAA 2AQSA 2VNCA 3CC5B 4KXAA 4WQOA 3UBXI 1FRGH 4PG2A 3VTMA 35C8H 1PKQE 2CMRH 4PRHD 1AG0A 4XXDB 3FFDA 4AITA 4C8XA 3KYOA 4MAYA 2AK1H 3TJEL 3KGSA 3I50L 1SLVA 2XIBA 3C8HA 5BQ7A 2JKXA 1JS4A 1GOHA 2LU4A 5EDXA 3SE9L 4APQD 1DLHA 3DXAB 4P23C 2UWEE 4PJHB 4XB7A 4OBRA 2VZ1A 3BZDA 5BMFH 1FNHA 5DDHA 2BVUA 4WI5A 3R4DA 3P4NA 2XWBB 2JJSC 3EYSH 4O00A 1AZRA 1HHHB 2Q20A 3F7YA 3L48A 5HDLA 4AIOA 4PB0H 2CE6A 3T09A 3EBHA 1UWXK 4G43B 3VSVA 2PMZA 3WMQA 3TBYA 4PJCB 3TEXA 1T66D 5JDSA 2TRHA 2VDNB 1MJ8H 4Q2ZA 1JVKA 2DQGL 2H4EA 2HT4C 3VWKC 4GG6A 2RAMA 4RCAA 1M2OA 1KOAA 5CEXA 5C9KA 3IJ8A 2ZWYA 2DLFL 1FZKB 3F58L 5CSZA 1WUZA 2LR4A 2WV3A 1QI4A 5SX4I 5D1XE 5F2FA 5GGVY 5ITFA 3G04B 4MWFA 1U8IB 4XE5B 3D6GA 4L3ED 3V4PA 2ZPKL 3N50A 1OGPA 2EXYC 1K85A 4PIBA 1W72B 4OLUH 5EO1A 3LRGA 2VR7A 3QYCA 3TEUA 5F9WB 2WN3A 2H8PB 4GS7C 1DANU 2Q3AA 4NNXB 4EI6A 4U1KB 1EXHA 4ETQB 3CFNA 4J3OH 2OL3B 3F05A 1WVZA 1KBKA 1RZIA 2CJUL 3RTQA 2VERA 2TAAA 1NDTA 2ZXEB 4YQXH 4FG2A 5IBTL 3GBEA 4I2XE 1OSZB 3QJFB 1OTSD 3HG4A 2JFCA 3MX0A 1XGUB 4LARL 4HPYH 4P2AA 3L5WB 3OKDA 1LDPL 1UM6L 5EOTB 1ED3B 3SE6A 3MLTA 2KPNA 2WZPA 4HXBH 5TPWL 5JQ6H 3LS4L 1Z5HA 1S5HA 1A7QH 4WFGE 1KIQA 2B7DT 2W0LA 2PWEA 3QIWD 3QCUH 1MHHB 1YMME 4GSDL 1N67A 1MNUH 1MIEL 2HH0H 2JV6A 1GJWA 4F93B 1YYLL 2J4WH 5T5FH 3U0WL 5HYSG 4EKXA 4WNQA 3MRGB 1IQWH 2YZ1A 3ASOB 5B3SB 3FO0L 4GIPD 4NQTA 1FG2B 4YO0A 3O3EA 1DDTA 1X5KA 2XNAA 4AZUA 1MH5B 5BS0D 2Y07L 4M1CC 4W1TA 3ATAA 4FG6C 4F91B 3CZKA 4M02A 4NQXA 3BHBA 4B9YA 3BZ4B 2LHAA 2XDHA 4OH2A 7PAZA 3S3DB 4AH2A 2BVQA 4NUMA 2X6VA 1KG0A 1T20A 2EH7L 2APVA 4KVCL 2VZSA 3TBSA 3VFRA 4M7LL 5KVGE 1NGWB 1LVEA 4KK6D 1I7ZB 1HI6A 2ZWZA 3MO1A 4WTWA 5CN2A 5JHDB 3DX9B 1H5BB 2NQ3A 2YPLD 5DQ9B 1OY3B 1ZTXE 2B4CL 2D7TH 2EXWD 1VADA 2Y7OA 3CLWA 3G6AB 1MSPA 3O45B 1SUHA 4H0HB 4ICWA 1QSEB 3LNDA 1OD9A 3WFBH 3IDGB 4HWZB 1SJHA 4G7QB 3HNVH 3FUHA 1MWAL 2CKBA 4L1TA 4PG9B 4P5SA 4YSDA 3NSCA 4UNUA 4QXTB 4N2HA 3ZHLA 5BJTB 5IQMA 1UWXH 1IGMH 4YSTA 32C2A 3CTTA 1LNUA 3ZRFC 2AXFA 4P2OC 1GZHC 4X7EC 3UYRH 1M1SA 2DEWX 4N85A 4Z3GA 3MV9D 1IVLA 3PWNA 4N2KA 4PJDE 5AVTB 2V2TB 4S1SL 5D1ZD 4P07A 4CVXB 1U8QA 2G3MA 4OGYH 5CCKH 1CD8A 5ES4B 3ULUE 5SV3A 3WN5A 2DQEL 3L81A 5AL0A 3WLBA 5D71H 1RUKL 3RAJH 1R46A 5I66A 1THAA 2EACA 1KPUA 3MBEB 4FLQA 4BK4A 3P2BA 1ADQL 1IBYA 3MLWH 4KMLB 1IKFL 3ESOA 1J8HB 4UTCA 3MCLL 2FECL 4A7GF 1UH3A 1AGEA 3GYRA 3VFMA 3GWJA 1DBJL 2UZIH 5DJAB 4GRLA 4J4PC 2CHXA 5HY9A 1BGXL 1IT9L 5GGSB 2VGLM 4WK0B 2DQUL 3OLDA 2P47B 2YLHA 1I1YA 4I3SH 3T8XA 5HHQA 2AJVL 5JW4Q 1XGYL 1JHKH 1LJMA 5DHDA 4LOEA 2K7PA 3GF8A 4JFFD 4F2EA 4A04A 1ACCA 1EMTL 5FV1L 4G9DA 4PWKA 1FP5A 4L4VB 4KQ0A 4PJ7B 4GO9A 1IU1A 1GSMA 3T3MB 3C60A 4CGTA 2WMPB 5BPPA 2B8OT 2OTWB 4ZBJA 2JF1A 1NKRA 2IH9A 1SM3H 1HAUA 1U8CB 2F54B 2I69A 2XXGA 3GGWA 5DEGB 4Z8FH 4V1DB 1JVLA 3QULB 4U3HA 4XWOC 1H3WM 1NGXB 4P2RE 5JHLA 1Q0YH 3LKOB 1MI5B 2JI1A 4A7TA 5L4FA 3NJMA 1MLCA 4U3XA 2ALWA 3Q6GH 4JO3H 2N0MA 1ROCA 1YEWA 5F1OB 5JXED 3SDXF 3HZYA 5A7BA 2BSTA 5FO9B 1T2XA 1DEEA 4NHUA 2H6OA 5CKAA 3CBRA 3PE9A 4PREA 1XF4B 4WUUB 2NR6C 3N1MC 3SY0B 1V3LA 5JNYB 4OF8A 1CDBA 4LOFA 1CXKA 2LW3A 2DV6A 3O2WL 3QGVA 4TUJA 2ZD0A 4MJ5B 5HVWA 1I9IL 2Y3AA 1M2VB 2VSDA 3TZVA 1A2YB 4YHOL 4HWEL 2JI2A 2A9AA 2Z93A 3MBEC 5PAZA 1P7QB 1KJ3L 3V0HA 3LX9A 1AGDA 1WFOA 4YDIH 2E9JA 4F1SA 4D2NA 4F57H 4O5LH 1LGVA 2QSCL 5AAMC 3RNKA 2HFEB 1VFBB 5IFHL 1E4KA 2HJKB 2VWEC 3QJVB 4Z0XA 3S5LB 1SOSA 3FN9A 5HHME 3D52A 5IWLA 2YC1B 4KZEH 4NEHB 4GW4A 5ANME 4I88A 4PJGE 1AHWB 1DQML 1E7VA 3O2VL 1OAUH 5GSRA 2CDGB 2QDVA 1UTDA 2CJTA 2MCPH 2VXQA 4PS7A 1KJ2A 2HYMA 3HZMB 4GSQA 4DPBX 3NCMA 1HXYA 3QUMB 3BQVA 3CMGA 4F80A 2Y5TA 2NQDA 4HBCH 3BT2H 3EDJA 1INDH 2AXWA 2WLKA 3D4ZA 4PVMA 5LBSL 4I0PC 1G1YA 3MA9H 2RGSA 3V6FA 4PSRA 2VMFA 5JZ7D 3IKKA 3X1GA 4LCVA 4RMQA 4WO4D 4U2YA 1QR1B 1S7UB 1HE8A 5DC4B 9PCYA 4PSPA 2OJEB 1ACYL 4ZMOA 3LZRA 4FQPA 5B38A 4CADB 4HVBA 1FFTB 3M17A 3MDJA 2AJZB 3OGOE 2GSIB 4KAQL 4KPHH 4LSRL 4JJ5A 4N0UE 5BRZD 2GJ6B 2V2XB 3B9KD 4ZMXA 1EJ6A 4XPHH 3F83A 4KUZH 1A7OL 4QWWD 2ZOKA 1JDDA 4PGCB 3LVTA 4F1ZA 1IFHH 3QUXB 4WI8A 4CMMA 3CHOA 1JNHA 2EKSA 4IOFC 3DC0A 4KY2A 3BSGA 5TQ2H 3ARFB 3BAEH 3FAWA 2E27L 3X3FH 4TSBL 4OQTL 3IN0A 4HUUA 4EZMA 1UGNA 1OAXL 2C9QA 1F2QA 4O2FB 2A83A 1O6SB 5E9DE 5DTFA 4U33A 4IBYA 2R29L 3ZQ9A 1XZ0A 5I18L 2JJTA 5HGHA 5AG9A 2IANA 2YA2A 2ZTBA 3WCYA 2PW2A 1MDTA 1A6PA 3GRWL 4MTMA 5D2LB 5B1BB 4RNRB 4Y4HD 5FGBA 4YL4A 1AHWC 3VUAA 2MNWA 2XSKA 2YAPA 4FFZL 4W9CC 3L3KA 1T89A 3RG1C 3TPUA 3VXNA 4U1HB 5EZJB 1KJVA 5D70H 2G0LA 2VOTA 3SOBH 2Z6FA 4U4BA 5I5RA 3MV8A 3VI3F 2Z31C 4CC4A 1TTBA 2ZNXA 3KCPA 4UQ3B 5DZNA 2BWDA 4F9LA 4DNLA 2KL6A 1BVLB 1P5UB 1V54B 3SEPA 2R1WA 5T1KD 5LG6A 5ECGA 1U8JA 4XZ4A 3RWFA 4PR5B 2ITFA 2KT6A 3O2DA 4Q9RH 5KS9B 5C70A 4G71B 1P6FA 4IM8A 1SEBA 4N0CC 1GAFH 3GIVA 2VDLB 1WA0X 2XN0A 4H8WC 5DK0A 4G8GD 1JERA 2DWYA 3GO1L 3MRDA 4L3CA 2WTPA 1EX0A 1NGPL 4FQHA 4IMKC 4DK3A 1XB6A 4E5XB 5EPMB 2FJGA 3EDFA 4PYHA 3V5HA 2ADIA 3BXNA 2Y06L 3ARRA 4CL7A 3VGAB 1CJYA 3DX0A 1C12A 4AEHH 1CE1H 1N64L 2VERN 3QR2A 3JSSA 3QUXC 3GMOA 1U91A 4G11A 4KUCF 1C1EL 3W0WE 1R5VA 2C9UA 3ECBA 4KY1H 3WHE0 3ARFC 5IHBA 1EFXA 4PJFE 5CWSA 1XVSA 4W9ZA 1JGEA 1FFNA 3GJEA 4JAMB 2JWYA 5D4JA 1KGIA 5I1HH 3BDYL 2ZNWA 3L2LA 3ZDXF 2CGYA 2R51A 3EHBB 4AL8L 1GYAA 3FQUA 5I1GH 5CU9A 4P2QA 3GHEL 3RU8L 2DYPB 2OW7A 3IFLL 1S4IA 5FK9A 3KJ6L 2HKHH 4X5XB 3UTSA 1VGKB 1NOLA 2ZWKA 2AJSH 2Q3XA 3QFGA 4XI5C 2QQKH 5KTEH 3CVDA 1YQVL 2GQHA 3KPOB 5IB5A 5DJ8A 3PRZA 3K3QA 2WSKA 3QI9A 3HAEG 4YDJA 2WXLA 2YGOA 5IMOA 4R2GB 3RBSA 3REWA 2OJ1A 3EFDL 1E4XL 4MNQD 3D0VA 2JNZA 5C7XL 1IKNA 1BECA 1H8OA 2MRYA 1PZSA 3UYPB 4BRJA 5CCGE 5MEPA 2Y36H 4X6DB 1C08A 1W0WB 1M1XA 4LHUA 1TZ8A 4R4NC 3CFDB 3WEAA 1MCSA 2CU9A 4N2MA 4JPWH 1DBBL 1OGAA 1P5UC 4WI7A 4ELME 3TYGH 2EC8A 4UYPA 1ACXA 1VZIA 3KPSD 3ULSA 5I16A 1B6DA 1AYOA 1A6AB 2G75B 2R0KL 5ICXA 4XCYA 4G3YL 1A4KB 5DT1L 1F02I 2FHFA 3LKSB 1SF3A 4L8BB 5AW2B 4X9BA 3SCMD 3O6MH 4QKTA 2K1MA 1TETH 1B0GA 4PRNB 4HCRH 1MRFL 2FD6L 5LGJA 2X2UA 3SKOA 3K0YA 4G6FD 1FLRL 1DJWA 3KS0H 4H8WH 2MPVA 3BOVA 2A6KA 5C0RL 7CGTA 1B0IA 3AQYA 4PTUB 1QVOA 1QTSA 3EH1A 3HJEA 4RLDA 1NFIB 2FT8A 3PXHA 1DL7H 3QQDB 3N1FC 4OCRL 1CXEA 2WO3B 3EADA 2FR4B 4E9RA 4ZNCD 5JOEA 5DHXB 1FH2A 3EHBC 2JELL 4YBQD 3HI6L 1TSRA 3KH3A 1CXLA 3HR5A 4JO4L 4UZSA 3FTWA 3AREB 4OLYH 3TN0B 3QH3A 1D5MA 1MREL 4JG0L 3D9AH 1QKZH 1V10A 3SDCA 3C9NA 3OXSA 3HKZA 3BC9A 3LEYL 5DCCA 4TSAH 4NJAH 3NZSA 5SWZD 3UZQA 5F7UA 4N8PA 3EXJA 2YPKB 3ZX1A 2PCFB 4BV1A 4N2LA 1LXMA 1UCBH 1L9NA 5BNXD 4R2GC 2VJ8A 1QX1A 1TYRA 4G6KH 4EI5B 5EOCJ 1FN4A 2QPDB 4LCWE 1A3RH 2C3XA 2CHDA 1C9SA 3KR3L 3QUYA 4H88L 3JV4A 4N2OA 4HAKA 4BM7A 1EFQA 1RULH 5I1AA 5I8OH 3QQ3A 4Y4KA 4AQEA 2HKFL 4NYLA 1QRKA 1D5BA 3RY5A 4MJHA 1HILA 4DUVA 1NKOA 1SBBA 3N91A 4JRXA 4HMCA 4R90L 4ZT1A 3QXDA 1K2DA 2OR8A 4PJBB 4NBYB 1AI1L 1ORQA 1Q9LB 3WI9A 4XN8A 4QAWA 5GS0C 2E5EA 3QB7C 4BRVA 2D9CA 4D9LH 2R9HD 3J07A 3VQ2C 4XP9L 5EC1A 5A3IC 3LH8A 1UENA 5LGKA 3F65A 1T83C 2Z3FA 1FFPB 4PTTB 3CSFA 3W56A 4XNUL 3GI9L 5A2JH 1U92B 2ROYA 4BQ8A 2VDLH 4G8FA 3OWRA 3QNZB 3VXMB 1DSWA 4ORGB 1PJWA 3L7EA 1OHZA 4K71B 3QJQB 2E9BA 4NZJA 1XCQB 3EJTA 2AJYL 3L7FB 3B3BA 3WDIA 1IZKA 2HUHA 4TULL 1J48A 5IJKA 3V4UL 5F70A 4NNPL 4DO6A 3RWHA 5C6TL 3DVFA 3AREC 2XN1A 4LEXH 4QRRB 1G43A 1JV5A 5IQNA 3EG9B 2Z0BA 1VFUA 3FZUD 4QGYA 5BUGA 1JFQL 1L0QA 8PAZA 3IJHB 4BFIB 3KEDA 1TF4A 1QATA 2WXMA 2BINA 1GC1L 1MJJB 3OGCB 4XMTA 1BOYA 4MB1A 4S11A 4Y2DB 4N28A 1M9WA 3CN2A 1U8PB 3BKCL 4G1EA 2YRBA 4K5LA 4Q89A 3KH4A 4DP9X 4N90D 4Y19A 1BVZA 3T0EA 3GMPB 2ISDA 3VXPA 1KMGA 4OZHE 1WD8A 5HVGB 4B5ZA 3T65A 1WAAF 5ESAA 5CHNA 5J12C 4EAEA 2P5WB 3VVVA 2V0AA 3N43B 3AU1B 2GHWB 1L0PA 4WW2A 1AO7B 1T1XA 2B1HL 4YDVB 3OKKB 1PDKA 5D8JL 2J1YA 4G7VH 4P4KA 2Y7SA 1NCHA 4AIZA 4RISL 3MRNA 3EDKA 1DVFC 3OZLA 1WICA 3CZNA 3RI5K 3HRZB 3LMJH 3FTGA 4V2BA 4BFEA 4BH8A 3RFZC 3F85A 3QZMA 4AC2A 5CD3B 4KI5F 4J1UB 3B4NA 4QLWA 2G3ZA 2KQNA 1YEDB 2OSWA 1IAOB 3Q6FA 1X5HA 2I32A 3LDBB 4UIMB 5E6IA 3PJNA 4ZW7A 4D9RE 2BZDA 4M93B 1MQKH 3LPWA 1DBML 3F2LA 4K71C 4NKIL 3CVHL 3FRUA 3G9AB 2WZ6A 3GMRB 3SYOA 3MJ9A 1XR9B 3N0PB 5FO8A 1HCVA 2ENPA 2P1YA 4WWKB 1U8NB 2CO4A 1AXTL 4J12A 4GMSL 3EFOA 4FYRA 1QSVA 3IPFA 4FG0A 4LL1A 5IROD 1MVUB 4Y88A 4YWGH 1N5YH 3TO4A 2X9ZA 1SJMA 2JKRM 4TSCL 1TUPA 4U3SA 4U49A 4MDIA 1G7IA 3QUZA 4LASL 3K72A 1U8HB 3LNHA 5KYWA 3HMXH 5D7JC 5EU4B 4Z7VB 2WXNA 3SPCA 4E42B 3FTYA 1TQUA 5ISZE 2CIKA 3EDEA 2Z7WA 3ILDA 3NJVA 3GSVA 3CFEB 1EGJH 1IILE 5HI3C 2VDOB 2GIXA 4HSAC 1YEKL 4AK1A 4YFEA 3GUFA 5C2BL 5DS1A 2EXWC 2G3NA 2EE0A 3T4YB 5TFSL 4PCTA 4Z95H 5C08B 3WFCH 1C7SA 4PRBB 1SHXA 4M43L 1FA4A 3I6GB 4ZD3L 2MTAA 1UM5H 4XPFL 2F61A 3H2QA 2WWKT 4NJ9L 3DWTA 4HH9B 4QXVA 3CSPA 1BMZA 3E38A 2F15A 3WTWA 1FFOB 3HRZC 4Y5YA 1EAPB 1JYWA 2A73A 3X17A 1H15A 5F7YC 1R3IH 1A14H 4I9WE 3L16A 3QR1A 2APSA 2ED8A 4ENZA 2LGNA 3C5JA 3LDBC 4JM0A 5F71A 4H7VA 4M93C 4N8VB 5AVSB 1X7TA 3X3GL 1XGRB 3MLZL 3S2CA 1VESA 4WNJA 5LCVA 3UJJH 4YXKH 3ECVA 4JL2A 4PLNC 4ODVL 3JYCA 1D6VL 3BMWA 3HHSB 4M61A 4WWKC 2AJUL 4APXB 2JKNA 4ABVA 1RUAH 1YY8B 2WZ0A 1D9KB 3FU9A 5CINL 4XXCC 2HG5B 4JRWA 5DD0H 2VDQL 3ES6B 1F3JB 4XRCB 4YHLH 1SUJA 3UABA 4N8CL 4TVSa 4XX1G 1U3ZA 2UZXB 2EDQA 1M3IA 2ICEA 4YVNA 3UCRA 3GBMH 2MCAA 2VXUL 2BIPA 3D4CA 4HEPG 2OSYA 4R8WL 2VLKB 5AALA 5T3XH 1MNNA 1UHVA 3NESA 4AUYA 4FI6A 2IGFL 3ME0B 1YPZB