2GBUA

C6a/c111a/c57a/c146a apo cuzn superoxide dismutase
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
153
structure length
153
Chain Sequence
b'ATKAVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGATSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHAIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLAAGVIGIAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title The Coupling between Disulphide Status, Metallation and Dimer Interface Strength in Cu/Zn Superoxide Dismutase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 32
structure length 153
sequence length 153
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2006-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2gbuA00
3CE1A 1SXAA 1TO5A 1N18A 1COBA 1IB5A 2VR6A 2AQRA 2WYTA 3F7KA 2AQQA 2GBVA 3KH4A 3KM2A 1BZOA 1OEZW 2K4WA 4BD4A 4A7UA 2C9UA 3MNDA 2XJKA 2AQSA 1Z9PA 1CB4A 1XTLA 2WYZA 3HFFA 1F1AA 2SODB 1YAZA 1IBDA 1Z9NA 1MFMA 2Z7YA 2E47A 3S0PA 4B3EA 1DSWA 1OZTG 3RE0A 3H2QA 3K91A 4N3TA 1JK9A 2APSA 1U3NA 2R27A 4A7GF 4L05A 4OJAA 2AQNA 2C9SA 2C9VA 2ZKYA 3ECVA 1OZUA 3ECWA 2ZKXA 2ZOWA 3H2PA 1SOSA 2NNXA 2AQTA 1SDAB 1EJ8A 1SDYA 1YAIA 3PU7A 1B4LA 3KBFA 4MCNA 1UXMA 2GBUA 3F7LA 2VR8A 1XTMA 3HOGA 2WWNA 1HL4A 1PU0A 3KH3A 1IBHA 1Q0EA 4FF9A 2JLPA 4A7GA 4A7VA 2Z7WA 3GZPA 3GTVA 1DO5A 1E9OA 2AQPA 1SXBA 1PZSA 2XJLA 2Q2LA 1XSOA 1L3NA 1UXLA 2LU5A 3GZQA 1AZVA 4BCZA 1PTZA 4A7QA 5CU9A 1F18A 2E46A 1E9OB 1P1VA 3MKGA 1F1DA 5KBMA 1B4TA 1E9QA 1F1GA 2V0AA 3SODB 1JK9B 1HL5A 1S4IA 1EQWA 1CBJA 1SXSA 1KMGA 4A7TA 1YSOA 3GTTA 3L9EA 3CQPA 3ECUA 1E9QB 1SXNA 2GBTA 3CQQA 4MCMA 1FUNA 5KBLA 2VR7A 3T5WA 1RK7A 2AF2A 1E9PA 1IBBA 1N19A 1ESOA 2AEOA 4OH2A 1OALA 2ZKWA 2WWOA 2JCWA 1OAJA 3QQDA 2WKOA 1E9PB 1IBFA 1SXZA 1TO4A 5KBKA 1BA9A 1SXCA 3GQFA 1JCVA 2Z7ZA 4BCYA 2WZ5A 4A7SA 3GZOA 2WZ0A 1SPDA 1SRDA 2WKOF 2WZ6A 3L9YA 3QQDB 2Z7UA 3KBEA 4U4IA 3LTVA 3KM1A 4N3UA 1QUPA 3HW7A
chains in the Genus database with same CATH superfamily
4FLHA 1FRGL 2X2UA 4U0RB 2AQRA 1T6VN 5IJDC 3R1GL 2VDQH 3VVWA 1RJZB 2DQUL 3NIDB 4WFFD 1OTSC 3VWJD 4UT7L 2C9RA 3FU7B 4FFWC 2AQSA 4B9JA 5AAWA 2GK0B 1HH6B 1A1MA 1H9DA 1LEGB 2VLMD 1CUOA 1XGQA 4BFIA 4YHIA 3ZGHA 2FYYA 2BMKB 3OV6A 1GVIA 3DMMA 3CFJB 4FRWA 4UTAL 4AQEA 4Z0XB 3U4EB 2CUAA 1WCBB 1BVKB 2P24A 4GO8A 2F8XC 3V8OA 2C9QA 1TFPA 3S96B 3DSFL 5GS1C 2SEBA 1ZIAA 3VXRE 3SOBH 1EZVY 3ARGD 3TN0A 4WQOA 4GSDH 2E27L 4JKPH 3VFVA 4LNVA 4BFNA 5CEZE 4YXLH 4DP9X 1I9IL 1CDYA 1JG9A 2FHFA 4P23B 5FM8A 3GMPB 1PKOA 3F12B 2IGFH 3HS0C 2F74B 3N50A 1EX0A 1QKZL 3TH4T 4QHMB 2EYSA 4F7EA 1FFOA 4EOWL 3L3KA 2BFVL 3HPJB 1QFWL 1GGBH 3DX3A 1XD1A 1I75A 3KBPA 5B38G 2J88H 5DD6A 1CICB 4OJCA 2NQCA 2IG2L 3SE4A 3LS5L 5K5YA 4K7PX 1ZDSA 3V0EA 4IIQA 5C97A 2IH3A 3OHXB 1NCNA 1WQVT 5I8EA 1F0LA 3FU9A 4FCAA 2UZXB 4NP4H 2YPLB 4BUGA 5I6NA 1IM9D 1GGCH 1KDJA 3VI4F 4ZXBC 1UB6A 2EXYC 3RIAK 4JFWA 2L3BA 3U2IA 4X6EB 1YCSA 3P4NA 3B1TA 1G1CA 2PYFB 3L7FB 5BZXA 5T1KD 3EUDA 5GXBB 3H9SE 1MDAA 4YLCA 2QPFA 3IPBA 1D6EA 1HCZA 1EJFA 3RLSA 3CMOL 2A73B 2UXGA 1NINA 4GW4A 3L17A 2Y1ZA 4L3EA 3ZKMC 2ZYIA 1AQ8A 3NBNA 3DA0A 5EC2B 2XWRA 1KGYE 2YKLL 3FTVA 4JVPA 3WFBH 4WY7L 4K94L 4A2EA 3GHBH 3IETA 5SWZE 3KLAA 1NAKH 1NGPL 3EKCA 3MV8A 5I5JA 3EJPA 2A9DA 3OKDA 3IK2A 4XVTH 5DRWA 2CRMA 4J3UA 3ZKQD 1XMEB 1AI1H 2YMTA 3Q1SH 4GOSA 3TJEL 3C2AH 3T4AC 3WEOA 3ETBF 3HI1A 4ZFGH 3VD9A 2G9HB 1Q1JL 5ESAA 3V4LA 5JIKA 5JHMA 3WUZA 2DTSA 3MXVL 1IJNA 3KLQA 3HG5A 1DL7H 1FFNA 4YPJA 4I9XA 1ADWA 4P57B 5J7CC 3BZFA 2Z7YA 4X99B 5DWUL 5CLWA 5BZDB 3IEAA 5ID1B 4D9LL 1D7BA 1OOWA 2FJHA 5INDB 1M7DB 1AFVH 2WO4A 2DQTH 4N85A 5LCVA 1YAIA 5L9DL 1W72A 2O30A 3QFDA 3EOBB 5K69A 3G6JB 3D25A 2CBOA 2E6PA 2FUTA 1WWWX 3NZSA 3KWVA 1E50A 1PZ2A 3Q9PA 1M7IB 1UD8A 2VZ3A 3CH1A 3FSZA 3O9WC 4A7GA 1TJHH 3BP7A 2KDGA 3IU3B 3S2CA 4NKIH 1UWXK 1QUNB 4JX0A 4XPAL 3MLPA 3QUGA 5IVZA 3OZKA 2JLLA 4LVHB 3EBGA 5I18L 3BFQG 4OLUL 4CGUB 2ZF8A 4KZCA 1RHFA 3O3AB 4GUPB 5HYJB 4JFXB 1BVZA 3ZQ9A 5PCYA 4RNRA 4TNWK 4XVOA 1JVKA 4PWHA 3S6CA 1UOKA 5HDBE 2PXYA 2WVUA 1X5YA 1DZ0A 3NIFB 4IBLT 3EH3B 4OCLC 2OSYA 4WO4C 4YPGB 4ZRGA 1N5YL 1TYEB 3QR2A 4PP2B 4ONOA 4WNQB 1T0NB 3ZHFA 4IM8A 4JPIB 3ZT7A 3VD2A 1BYNA 4WK4B 2G9KA 1ZE3H 3O3EA 3TVMD 1AGDA 4JO3H 4W6XB 4G71B 3BESR 1OT4A 4X80H 2V9TA 1IAIL 2J21A 4YC2C 1H8LA 4TF4A 4OZHB 5FO9A 3VFUB 2WTRB 2XI9A 1DZBA 2YOAA 3GB7B 2BC4A 4OZFH 5I75B 2DMKA 1IKFL 2Y36L 2KQNA 4DW2L 1KSRA 2JE8A 2HZHA 2TSAA 5I17A 2J4WH 3ATAA 2OW6A 1XH2A 1BQHG 2W38A 4LVOC 1FBIL 4HKBB 3WEMA 4XMKL 2P9RA 4GAYB 2XV3A 3PGDA 5JQHC 4ZPVB 3JT2A 3QEQB 3QEGH 1NCCH 4L5FE 4O2FB 3FCSB 4U33A 1HXMB 2I32A 5DDHA 4JFHD 2DJ4A 2F5BL 3BEVA 1V5JA 3H9HA 4IS6A 2BNRE 5D1XB 5DHVB 2AXJA 3D0LA 4EDWL 4X98B 4IKKA 3HS0A 4HA1A 5GQBA 3B2DC 2GC4C 2XWJB 5CSZA 4Q9QH 3PGFL 4FQ2L 4IW4C 5AOIA 4BINA 3KW7A 1NC4B 3RP1A 3N91A 4WUUD 2WVSA 3MRCA 2NXZC 9CGTA 1IBDA 2RFXA 3HMWL 5EZOH 2EE2A 3F7YB 3C5ZA 5HI5C 3EYSH 1OZTG 3NJLA 3OVUB 4I77L 3QSKB 4LCCA 5INCB 1E0OB 3MCG1 3HG1D 2F54B 4P2CG 2AQNA 2XG4A 4P4KC 2IV8A 4ALAH 2XKNA 1KPUB 3EGSA 3NABH 1JPFA 3V5HB 4JFEE 1J5OL 5IHLB 3NN8B 2QFPA 2E5EA 1A2YB 1UD4A 2IMMA 1X5JA 3BN3B 5HGHA 4HT1H 3UJTL 2DQCL 2FE0A 3APDA 3P40A 3TZVD 2FL5A 3IMRA 5EIIB 3VWKD 3IKKA 1RHHB 4WEBL 1CFBA 3FRPG 5AKRA 3U4KA 5D2LF 4JGUA 4NNXA 4UDTA 1RPUA 2CPCA 3RWGB 4E0RB 3SDCD 2HT4C 1ULVA 5EOTB 3B37A 3IGAB 4PJXA 3H3KA 1XB3A 1WF5A 1AXIB 1EXUA 1NGQL 1RJLA 4ZTOL 3PF2A 1GL4B 1LE9B 3EF7A 5D1ZD 4A39A 1U4EA 3GDBA 4KMLB 3BP4B 4X7EC 4H44C 3PY9A 3KLHC 1M2VA 1HL5A 1QLRB 1EQWA 3RUGE 3H56A 2E9WA 4Y9FA 4BFGA 3WXVL 3QXAA 1FLTX 1ZSDA 2AI0H 2R0LL 3D3VE 3DX9A 4ZFOB 5A2BA 4NQDE 4MCYB 4AENA 1JVOA 4K5NA 3QA3A 5EIVA 1G9NC 3ZL1A 4FCHA 1AC0A 2ZZUT 3EBIA 1OAYH 4HS3B 2NUTA 5E4OA 4PV8B 2WWKO 3CU7A 1G9MC 2BS71 3A4DA 4NZDA 3ZL4H 3ZO9A 4FQXC 5GRVK 4F7MA 1KYOK 2CDFA 4O4YL 4TSAL 5DS8A 5A6MA 1MHHB 5JPMA 3U4BH 4E9TA 3O4LD 1QSEE 1VA9A 4JG9A 1NGYB 1I4FA 5KZCB 1YY8A 1Z2KA 1N6QL 4J3OD 4YHZH 1JZHA 3GLZA 5CEYA 2XXFA 3V7AE 1F56A 1IGTB 2VR4A 2G2PA 4GB9A 4U6HB 1ORSB 2CKBB 3L2MA 2VQ1B 3W2DH 1VGKB 3MAWA 5IM7B 1NMAH 2XG5A 5FDWB 1KB5B 1L0XA 2K78A 3QRLA 4M8VA 4OU3A 5B1JC 1I85C 1MOEA 2PR4H 3K6SB 5CGTA 1B9KA 3VVVA 1RUKL 3FKUS 1PZ5B 2ZUXA 1MFUA 4N0UB 4Y16C 4EVNA 4B95C 3QIWD 2FYVA 1XF4A 3T0XA 1TQBC 2WHVA 1F45A 4AV0A 3COOA 1EHLH 4Z6AT 1INDH 1MI5A 1TTRA 3C6LA 3WCYA 4NRYA 3GNMH 3O6KL 3OKLA 4M43H 3JWNC 4G8AC 2J25A 4Q97A 4G6FB 2HWZH 3OQRA 3O41A 1A1MB 1WBZB 3VGFA 4N8UA 4XBEH 5DVMA 3C5SA 2YGQA 4KKQA 4Q4IA 3W9DA 3ULUD 4JGJA 1K5WA 2XVLA 1U4FA 4YHIB 2Z6FA 2FYYB 4MZRA 4PB0H 4AM0B 4AVHA 4WW2F 1M56B 3DMMB 3NGBC 4KOBA 4PUBH 3U6RA 1CTOA 3SE9H 3CJJA 5AW9B 3T6ZA 1RU9H 3HBZA 3F7LA 4AQEB 2J8UF 2HH0L 5CD3A 2P24B 4F7KA 1Y07A 4MA7L 3KPNB 4OJDH 1AR1B 2ZUQB 4KXAA 2Z7WA 2B16A 2FT6A 4XCCH 4PJ5D 2SEBB 5D6CA 4Z18A 1B2WL 4M7ZC 5I15H 1EJOH 3TN0B 2AZAA 4KKLD 4NT6A 1XGYH 3VFVB 4NP9A 2ZP9A 3GKWH 3IAQA 2EEBA 4ZUTB 4HQQL 5FR3A 1HHKA 4WI6A 1JGVL 3MLRH 2Q5BA 4U3XA 1CFSA 4ZMAT 3OXRA 5FHBH 4F7EB 5JR1L 5AFAA 1FFOB 4ODUA 2LHAA 1OSPH 2OMTA 1A3LH 3L3KB 5MEPA 2VMEA 4XXWA 5GGVY 3U83A 3WJJC 5JIQA 4YH6A 4AXWA 4OI8A 2QV4A 3CQPA 3K2UH 5DD6B 2VUYA 2J2ZA 2PR9A 5F1IA 2Y0SA 4HVBA 2IH3B 4NQCD 5I8EB 3LIZA 1XWVA 1AO7A 1CLOH 1ZHLA 3T3ME 1Q9KA 2P5ED 5D1QD 1AXTL 1OALA 15C8H 1FLRH 3EHBD 3NG5A 4R2GB 5ALBL 5FOBA 4M1DH 4NZJA 1UB6B 5AOJA 1NH6A 2X4TA 2OR7A 3MCYA 1BA9A 4CMHC 2MMXA 4HOXA 2GHZA 2ZF9A 3P4NB 4KAQL 4AQOA 3KD4A 2CLZA 4UOW0 4HDIA 3TT3H 3DETD 5I1JH 1QNZH 1UCBH 1OOAA 2CDGA 2NTSP 1D6EB 2FX8H 2JCCF 1RK1A 3ZE2E 2R69H 2KL6A 1FH5L 4GQ9L 4GW4B 4L3EB 3IFOA 1ZVNA 3JWOC 3B5TA 1E8YA 3GXFA 2KZ1B 3F7RA 4PS7A 1UCTA 3GT6A 2GFBA 1HH9B 4JQVC 3MV8B 3IDIA 2FDBP 3F7VA 5EBWA 4NRXA 3OKDB 5DRWB 1AE6H 3WS3A 3RGBA 3D09A 1QACA 3Q5TA 4HEPG 4P9HL 4EBQH 2RB8A 1B90A 4YWGH 3HI1B 5FUZH 3LD8C 5ESAB 3KLDA 4YBLC 2IAMC 3MV01 3VFRA 4UZSA 5LN8A 3KG5A 5FV1L 1TPXC 2VXVH 1N26A 5T3XH 5MEQA 3O2VL 1F3DH 1FFNB 3LS4H 1AZZC 3NFNA 4BK5A 2OMBA 3BZFB 4LOVA 3RAJH 1I3RA 3RX9A 5ISZD 5FEBA 1WIUA 3NCJL 2DEXX 4DPRA 3UP1A 4YHYB 4G5ZL 4WSGA 2KZKA 1GKEA 5DZLA 5KYYA 2FJHB 2ZX5A 4I5BA 1V54B 2Q87A 4D7BA 1J9SA 5CZVH 1JWMA 1TSRA 3GZPA 1U21A 1W72B 3QFDB 4YSAA 3D25B 5GS0D 5C0FA 1LO2H 2Y23A 4DPAX 2UWEE 2VAAA 3IPEA 1GW6A 3HNTH 1UB5A 3CH1B 1T0PB 2V5SA 1DBKH 3X1BA 1KN2L 4X7SL 5AKTA 3V4VA 1EFXD 1IBGH 1YUKB 5ESQA 1JDDA 1F1DA 3GJFH 5EU6E 3L7EB 3S35X 1LDPL 2F53A 2E4TA 2YIHA 1SN0A 4X7CC 5F7UA 4HLZH 1IE4A 4LEOA 3UROR 5F89A 2BWIA 2WVTA 4QMEA 4XP4H 3ABLB 1B4RA 1E5UI 4QHUA 4RNRB 2X4QB 2NYYD 1YYLH 2M2DA 4NN6B 4G8IB 4NC2B 3PQYA 2DBJA 4PYGA 2PXYB 4MSWA 2Q76B 1S9VA 2RCSL 5EORL 2AXHA 4OBSA 2VIRA 4M6AA 5AOKA 4GBXD 4XWOC 3OL2A 3LN9A 2G5UA 4JRFA 4MX7A 1AZRA 1SOQA 3AG2B 3UEQA 1MCQA 3BKCH 4XX5A 5JPNC 4LESA 1JI1A 1QLEB 2KLTA 3O3EB 1AGDB 4JCWA 4Y5XA 3ARDC 4F5CA 2H1LM 5IVNA 4PTUA 1HHHA 5E99H 5G4NA 3O2DH 1FNSL 1OCWH 2TRYA 4FFZA 1ZLVH 3Q2NA 1MIEH 1KYDA 2DLIA 2GI0A 3FT9A 4WJ5A 5K1VA 2CKNA 5FO9B 1HZLA 3ZE1B 5JZ7D 1WPCA 3OB0K 4LE8A 1JVLA 1NMBH 2OCFD 4U1HA 2XU9A 1JGDA 1W80A 2O1AA 3ZDZB 2CE6A 3O6FC 5AW6B 4F9LC 3F7KA 5DTFA 1DQKA 5CFHA 5E4EC 3MLVL 3NDYE 2H1PL 3D85D 2EDBA 3QJUB 5DDHB 1DVYA 5SWSB 1VFOA 4QRSA 4NZUL 1GS7A 3H9HB 4IS6B 4B6ZA 3CPUA 2V2TA 2YMXH 2C3WA 2VDOB 2XZAL 3QI9C 3D0LB 4L4VD 4PTTA 2D7PA 1MREL 2WXMA 3B7SA 3HS0B 4K2UH 5CSZB 2F7QA 2DPKA 1MFDH 5DEFA 4A66A 4P2OD 1NJ9B 1MCLA 1VEMA 3MRCB 4K5MA 2RFXB 3WJJA 3C5ZB 1KB9K 1NBZA 4BJLA 2H45A 3PL6C 5I6OA 4LCCB 1A0QH 4DN3H 1TEFA 1TJXA 1XBDA 1Z5HA 2YAHA 3APFA 3ZDYB 3WNLA 4XX1G 3D39D 3EGSB 4ELDA 8PAZA 1JPFB 1IIIA 1NUDA 5GGRY 3AT8A 2Z64C 4OKVA 5LDSA 3UAJA 3F83A 3UZQA 4M62H 3ZZLA 5HGHB 1MCCA 5CJBA 4XBMA 3VXTA 4H1LA 2FL5B 4K71B 4BZ1A 2XN9D 5GHWH 5HHMB 2HAZA 4LEBA 5HSFA 4LCWE 4ETYA 3F64A 3L48A 3VXRA 4UDTB 4YFDB 4OD1L 1L9MA 43CAA 3Q6GH 1JK9B 3JV0A 4I3SH 4FL4B 4PJXB 1VRSA 1XGUA 4A2FA 3AVEA 1EXUB 3KYOA 2WLKA 2VW6A 3T0EC 1Z9LA 3V0VA 1O5DT 4RX4A 2EDXA 3N40P 4Z7QE 5C0RL 3O81A 3RIAF 5ETUB 3IDJB 4F57L 1M2VB 3O4OC 3MLUH 4K23H 1RIVL 1CR9L 1AAJA 3QXAB 4N8VA 1ZSDB 4TNFA 4CW1A 4ZMWA 3DX9B 1G43A 2NCMA 1MN4A 2P8MB 2HYMA 4IJ3C 5ADPH 5I8CA 2BSSA 4JO5A 4AENB 3AREA 2XKSA 4JFYA 4MJIE 5JQ6L 5KVFH 1FZMA 1GR7A 3IMSA 5GPRA 3DO3A 3QA3B 1S5IL 3LB6C 2NUTB 5CGMA 4DKAA 1NQBA 4O2EA 5J8OA 3L5HA 4YVNA 2R56H 3ASOB 4F7MB 2CDFB 3TU6A 5DS8B 4GRMA 1IGIH 5JPMB 3SDDD 1F41A 4DUWA 1BJ1J 4APXA 2H32H 2YBGA 1C08A 1I4FB 1QRNE 3GRBA 5HI4D 1K72A 1YY8B 5EH1A 1QUPA 5GRYA 2EDDA 3Q6FA 4JFDE 1OWRM 1PZ3A 2VDNB 6PCYA 3T65A 1JCKA 3H9SA 4JDTH 5FS5A 2WBKA 4PVMA 3RJQB 3ZDZF 4GT0A 4YDIH 5HHXH 3AQZA 1HYSD 4OCYH 1FZJA 2UZIH 4KQ3L 2DJSA 4MAYD 4NM8L 5I1IH 3ARFA 5AOZA 1NPUA 2MCG1 3CFKA 3UIYA 4Z7NB 4OJEH 2XG5B 2WLLA 2AGJH 3ZTDC 3PV6A 4WTXA 4HOWA 4OLWL 1YMMD 2WTPA 4WI7A 3CFBA 2F7PA 3UBXA 4AYGA 1WIPA 1GHFH 4AMKH 2I5YH 4Z7UF 2X3AA 5SWZA 1T0OA 1MH5A 4EVNB 5LBGA 4A2DA 1KELH 1XF4B 3IBOA 2OJEA 4EXKA 2I24N 1MI5B 1Z5LA 2DI9A 3C6LB 4R7DA 4NRYB 2FX9H 3D9AL 3HCVA 3OKLB 3FO0H 3ARWA 4XN2A 5DJ2A 4O9HL 3WTWA 4BYHA 2NY1B 5K1JA 1TJIH 2DLFL 2QGBA 1XBRA 5ALCH 3O41B 5CR8A 2UY6A 3U7WL 4J6RL 1JD9A 2FJUB 5LCVL 1MCPL 3DX0A 4NO3A 3W9DB 1T1WA 3LZFH 1V3JA 5KOVC 3CNKA 4KI5E 1MLBA 1CF8L 4AEEA 4TSCL 2DM3A 3TA4D 1AHWA 1OM3H 5IY5B 3U6RB 4KWUA 1JJUA 2NPLX 5CD3B 3EO1A 5JPNA 5JW5B 4R7LA 4TNWF 4YBHA 2V7NB 5GS2D 4XP6L 5D6CB 1L7IH 1FP5A 1U8LA 1NANH 3OAUH 4V1DE 4JVUA 5FYLE 3RY5A 4DVRL 4NT6B 4E9QA 1P7QA 1R3KB 4LASL 4WGKA 5E2WL 1P84K 3TJPA 1T03H 1V27A 2B1HH 1EH9A 1EXHA 3G5XA 4AUYA 1CFSB 3TBYA 4F9LA 5CJOL 2CALA 4EZMA 3OXRB 4ZO9A 4X6DF 5GS3A 4X6CE 4ODUB 2OMTB 1FNEB 4BFJA 2HTLD 1JYWA 3HC2A 4WKZB 4AXWB 2BLFA 4WUKL 4O5LH 4JPVH 2AVFA 4TSBL 2YEVB 4YSPA 2IAAC 3VXMD 3ZE0E 2J2ZB 5F1IB 2R1WA 1AC6A 4BGLA 1XH0A 1H6EA 2KDYA 4DN4L 1M1SA 3L4VA 3DO4A 5E6YA 1ZHLB 1IARB 1Q9KB 3QIBA 4XCFH 5D7IB 3QFJD 4L9LA 1JNHA 5IT2L 3RFRA 4AGQA 3STLB 3HRPA 4GIOA 4X5QA 5FGBA 4C55A 3VXUD 1BZ8A 3C60D 4UQ3B 4FNPA 4OIIL 4YDVA 2NQDA 4ABUA 2I85A 5T1LD 2X4TB 5AVYB 2AQ1A 3MRRA 2XCMC 4Y9BA 2E6QA 4ICWA 5EEZA 4JM0A 1J8KA 3RKDC 2CLZB 4HDIB 1YECL 3AMLA 1JYVA 3TPUA 5HDQL 3LEYL 4X7DC 5JO5A 1RK1B 5TE6L 2VL5A 1MCBA 5AW7B 1J8SA 1A1OA 2X12A 4WI0B 2VOTA 2HVKB 1T80A 2I9TA 1R47A 2HLFC 2X42A 4UIKL 3BIAX 5ITFA 5IB4A 2IFFH 4IK6A 4WSKA 3KPMB 2GFBB 1MCDA 2BERA 5CO1A 1H3PH 3IDIB 3LH9A 1IKNC 5EBWB 4NRXB 5MI0C 3TTYA 3PAZA 2WXJA 1E3FA 2X70A 2BNRA 3BZ4A 4KTDL 1F02I 4G11A 1MCFA 3VRIA 4U6VH 5KN5A 4MA1C 3VFRB 2VDPL 5DK3A 3Q8EA 2GIYA 1FVCA 1MZYA 3NSFA 3QZWA 4TQEH 2PWGA 2B1OA 1QTSA 5MEQB 2QTEA 2VR8A 3NFNB 4JY5H 1VFMA 1CDBA 1CE1H 2WWNA 4QRFA 1X5KA 3DJ9A 2MPVA 3NT0A 3JWNG 4WV1C 3ELQA 4LAQH 3RVTD 3SHSA 2YRLA 1ZVHA 4OLXL 4L8BA 4A04A 4XMPL 1M6OA 3AACA 3BSHA 3OKYA 4FNRA 4GAGH 3PLYA 5KYYB 2UX7A 5CCGE 2XFGB 1KXVC 4I5BB 2A6JA 2X89D 2VZUA 3W9EA 1MF2L 4JFEA 1SQ2N 5GGTH 4FMVA 1JWMB 3CTTA 2DWDA 4WWKC 1GPOH 4Z3GA 3INUL 4OGZA 5EU7C 4NFCA 4TNGA 5C0FB 1PZBA 3N6YA 2XETA 2VAAB 1CFQA 2VRAA 4J3XA 3GHPA 5M94B 1PX3A 1A1NA 4KKPA 1UB5B 5EO1A 2ESVD 5K59F 2ORBL 1J9RA 4M5TA 1YN7A 3V4VB 1ETZA 5EEWA 1TCMA 2F7RA 4ALAC 3IMVA 3NFPA 2C8NA 2R8SH 4C4UA 3H42L 2F53B 2BDNL 5TQ0H 4LEOB 2QFRA 4QXGH 5BCAA 3MA9L 4Q9CA 1EVUA 4HPOH 4EIBA 4QHUB 3VSQA 2YEQA 1BJMA 5L6YL 2R4SH 3PQYB 1A3RH 5EFIB 3RUGA 4ANWA 1XCXA 4AGNA 2WBJD 4YSOA 3OKKA 1ZV9A 2DLHA 2Z1KA 4MSWB 3D3VA 4W9GC 3QXDB 1S9VB 1WV7T 4XPHH 2BNQE 4NQDA 2I60L 2VIRB 3H53A 4Y5VA 2ICWA 4P3CL 4W9LC 2Y2YA 3ALWA 4YAQA 2VDNL 1QFUL 4KK6C 4JFSA 4Y5XB 2EDMA 1AQDA 1ED3A 3C87A 4NHUA 1R0AH 4PTUB 1NUGA 1D9KA 1HHHB 5AZEL 5A2LH 4ANUA 1WZKA 1QSEA 1U33A 2BNUA 2E7HA 4WJ5B 3HG2A 3OJ2C 4FYRA 2H4EA 3IJHA 1FFPB 1YEDA 2O5ZL 2R0WL 5F9JA 3NGBB 1S7WA 1N59A 4U1HB 5LGHH 1U41A 4KMTL 4LPWA 1PL3A 2FZ3A 4ERSL 5D72H 5DTFB 2J12B 4H88H 4ZFFA 1V7NL 3Q01A 3NUKA 4YDJA 3UPCA 1Q9WA 3LKSA 3P3YA 3T0VA 3WIIH 3VTAA 3CZUB 1Z7JA 3U36A 4HIXH 4G8EA 4OJAA 5CEXB 2V2TB 4TULL 4U2ZA 4PTTB 1P7HL 1QI4A 3TT1L 1PIFA 2V33A 4HWNA 2D31A 4RGMC 2DY2A 1BAFL 2NY4B 5DEFB 3PXLA 1PG7L 1WO2A 3MREA 1UXMA 4BZ2H 4JFPB 1W91A 1E5CA 3M1OA 4AE0A 2KMWA 1FQ9C 4RWHA 3ZZ1A 1HIML 1NBZB 1Q0YL 1QEWA 4IRJD 3B8SA 2YQBA 3VFGL 3NZHL 5E2UL 2LU3A 2NSMA 1AJ7L 3UTTE 1JAEA 3QORD 3QISA 4N5ED 4RMQA 5C0CE 2D7TL 1AQHA 5T1JA 2XXGA 2CA3A 4U3HA 2CIKA 2YXMA 2GCYB 2CHZA 4HIJA 2CO6A 2A83A 4AV5A 1HDMA 4AYDC 2NX5E 2AJYL 3VXTB 4H1LB 1U8NA 3Q44A 1KEML 2EIBA 2GUOA 3W0WA 4A7TA 3GPEA 3IDUA 3VXRB 2VUOA 4HW6A 4N2HA 1UQSA 3NIGE 1PD6A 5I1GL 1XZWA 5D9SB 3UYPA 4HHWA 43CAB 1UJTA 3P30L 3DKHA 4QTIH 3I9AA 2HMIC 1WYJA 4FXGC 2DYSB 4KFZC 3CGTA 4DQOL 4ZI8A 3KYOB 3HS9A 3LIZL 3V0VB 2VM4A 4LEXH 4MS6A 4CL7A 3JVFC 1HZHH 3LEXB 3R0NA 4N8VB 2VDLH 5I74B 5I8CB 4HGMA 2A1WH 5IB1A 2BSSB 3WD5L 3NQIA 3IMWA 5C07D 3AREB 4JFYB 4Y2LA 5C86A 1FZMB 1EHXA 4DF9A 4OLYL 4UI2A 2A9NH 2G3XA 4R96B 1IGCL 1KLFA 3BEWA 1DDTA 4LRNL 3CVCA 3ENEA 1TLKA 2W07A 3VYNA 3F58H 3ARUA 4NX0A 4GRMB 4WDIA 4Z7WF 4KI1A 1UZ6E 1CLCA 4GP5B 1JOIA 4APXB 1NEPA 1C08B 4IBVA 1WFMA 4MRBA 1WRFA 3Q6FB 1CS6A 4KQ4L 2VERA 3RGHA 4WU5B 2GIXA 3CC5A 2OCCB 3L5IA 3T65B 3H9SB 4XN5A 3T0WA 2VWEE 4X5WA 1OANA 1AGFA 2B77A 2E7BA 2Z34A 1IMHC 3ARFB 1N3NB 4RISH 5AAPA 4XPBH 2X3BA 3CFKB 2X6AA 4WSJA 1UT9A 1NEZA 4E2OA 4N2MA 3CXDL 3WEAA 2WLLB 3LEVH 2E9JA 2P8PB 1MRFL 3PV6B 3K91A 4W1TA 1DLHA 4PG2A 3MJWA 3DVGA 3UBXB 4AYID 3BH4A 3RWHA 1A14H 3MRIA 3SQOH 1G6VK 5SWZB 3VXSD 1MH5B 2C1PA 4ODHL 5C7XH 3HLAB 2CGZA 4NC1E 4L3CA 5F88A 2OJEB 2NUPB 1DVUA 1GZQA 3PU7A 2AK4A 1Z5LB 1EGJH 4WGVB 5CLTA 3MOAH 5KSAC 3HCVB 1I53A 1IC7L 2ERJC 3QEUA 3RDTD 4KITB 5DJ2B 1G9NL 2J5LC 1G9ML 2QPDB 1N0XL 1BYOA 2UY6B 2IALB 3LKPA 2WQRA 4JRYE 5TK2A 4E9RA 4AYSA 4KDTA 1S9WA 4NO3B 3UO1L 1SLWA 1T1WB 3SKJL 3OMAB 3OG6B 3VGDA 2ITDA 1Z32X 1MLBB 4JQIA 2R9HD 3LVEA 2Z9TA 1RVFL 3CHQA 3Q8AA 5DMIH 1CMOA 4JHAH 1HESA 1T7YA 1AHWB 1GYUA 3OZ9H 4FQIH 1DCEA 1IC0A 2DEYX 3VA2C 3EO1B 5FV2A 1RPKA 1CFTA 2ZJSL 1BBDH 5FW7A 4H40A 2RAMA 5E8NA 2GIMA 4WWPA 4ZTEA 3P11L 2UWEA 4IGBC 1IC5H 1U8LB 4ZT1A 3WS6C 1NIEA 2H2SC 1P7QB 3VACA 4MB3A 5FK9A 4MNQE 3FN0L 3KZ8A 4R8WH 1OD9A 3TBYB 1NCWL 4KMQA 1L9RA 3MLZH 4ZUVA 2WWOA 3G5VA 5E4EB 1O9VA 5ANHA 4FADA 4XTRC 4Y19E 4C56E 4R84A 1JPTH 1OGSA 4PRAA 1Z9SA 2QVKA 1MJ7H 1GOGA 3QG7L 1II4E 5D7SL 3ARZA 3T71A 4V2CB 3EYFA 5JW3H 4XPGL 5HDBB 3WY2A 1MCEA 3P2TA 5BMFH 2YXFA 1GZPA 2IC2A 2B0SL 1HKLH 4FFZL 5GSVA 3QIBB 1NFIA 5LUMA 1EAPA 4L9LB 1JNHB 5T3ZE 1DBAL 3H0TA 1R34A 3HE7A 4M93C 3MTRA 1VCBC 5JIDA 4YDVB 4XXCC 1D6VL 1WTGT 4ILDA 3MRRB 2W95A 2YA0A 4UINL 3JZYA 2VLRD 4PMFA 3OLDA 1B6UA 4JN1L 4OJFH 3SE3C 3JV5A 4M5YH 5KVDH 2OZ4H 4NJ9H 3TPUB 5BVJA 2O6CA 3AY2A 2JF1A 5F2FA 1MWAB 4WFFE 2J6EL 3MLXH 4XN8A 1MRCH 5JO5B 4WNSA 5DZAA 4A6YA 2VL5B 5C08D 3P3TA 1PSKL 4HJ0C 1H8NA 2P26A 1DSWA 1A1OB 1E40A 2YAQA 2I9TB 4BUQA 2NXYB 2VLME 3WTUA 1ZXKA 4MHHG 3RVVD 5IB4B 1CGXA 3ECVA 4ONHA 4HPYL 1A4KA 4NN7C 4UILH 4WENB 5B7EA 4ZS7L 5C70A 4KPHL 2X70B 2BNRB 1IVTA 3BZ4B 4YHML 1BFVH 1H6TA 5CSGA 4KTYA 3VRIB 4DGVL 1CGWA 4FQJL 5I82A 3TA3B 1GGTA 2DQHH 3BAEL 1FVCB 3QZWB 4Z7OE 2GC7C 2VLJD 4M61A 4X8CA 5J0BA 5JMOC 2F6AA 5EOCL 3ILQD 2WPGA 5TJWK 3ARQA 5T8IA 1C7TA 3M8OL 4U3CA 4L8BB 2PO6D 4K15A 2D9CA 1DEEB 1A7OL 1UM5H 4MMZB 3VAEA 2EVGA 1M6OB 2B2XH 1IJ9A 1IVLA 5J12C 3MZTA 3RFZC 1T04B 3IFNL 3W9EB 2BSTA 4JFEB 1JWSA 2XWTA 5KVEH 1LXMA 2DWDB 3D12B 3ZK0A 4DIXA 1CG9A 2VH5H 2ZAHA 2VZSA 3H8NA 1BG9A 1EDHA 2QR0B 5CZXD 1CFQB 3Q9QA 4X8JA 1CDCA 2P49B 1SY6A 2X4SB 3BZ5A 4KUCF 4PJ8B 3JWOL 1A1NB 3MJ6A 4NWTL 4LCWA 3GJFK 4OT1H 5EO1B 3IU4H 3QDJD 5D96C 4UOQA 3OMNB 3NFPB 1JV2A 4OH2A 1XEUA 2DWXA 4FE9A 2D03H 2P8LB 4GUQA 2OL3L 2R0ZL 5KYUA 3R8BB 1UGKA 1UA7A 1UXWA 3IDXL 2Z3FA 5I8KH 1AOZA 5I0ZA 2J1WA 2AEWA 3HUJE 1T7VA 2CO1A 1XSKA 3RUGB 1NANI 1WZAA 1ZJBA 3B3BA 5F9OL 5ABDE 2AJVH 5T5FH 4EUPA 2XVKA 3D3VB 3S5LA 4ONFL 1ZLSH 1BXVA 1INEH 3CBJB 3L3OA 4NQDB 4PJAF 3TWCL 5IF0A 4Y5VB 4S1QH 2NR6C 2ICWB 4MJIA 1BJ1H 3RGVD 3RWIA 3IGKA 2VR6A 4UQ2A 1RUML 5DD5L 1Q1PA 4TXVB 4MJ4A 2YD8A 1ZLVK 3TCTA 3U2SA 4MLSA 1DQLL 2VXTL 4ZMYA 1AQDB 1ED3B 4NHUB 1D9KB 3GXDA 1JZDC 4DJMA 2E7MA 3A22A 1QSEB 2EDYA 2BNUB 4HXBH 1QRNA 2ZG3A 3DBXA 4GI9A 3IJHB 4JFDA 1YEDB 2YQ3A 4JJOA 5F9JB 1E4KA 2X87A 4W4NA 1S7WB 1N59B 4PIRF 4XNXL 4CC1A 4JHWH 4GKSA 2FZ3B 2AS5M 2ZXWB 4XXDA 4CNIA 3QQ3A 4ZFFB 4F8OA 4YDJB 3P02A 3WNKA 2V3EA 1HCYA 1SEQL 1Q9WB 4U3SA 3A67H 3WS6A 1JPSH 1PLBA 3JTTA 3DHUA 5IFHL 1JFQL 3U36B 3ZDXF 2WIIA 2XN2A 4G8EB 4QKXB 4ZOCA 4H2AA 1W0VA 2D31B 2A99A 4Y4HC 5I0DA 1RMFL 2DV6A 4G7VH 3IXAA 2HRLA 4PLJC 4PVNA 3QHFH 3MREB 1XR9A 4OZFG 4HV8A 2E3VA 3QZOA 4KROD 5GGUA 1KG0A 1QEWB 5CP7A 2C3VA 3GS7A 3MACL 1F18A 4B5EA 4QXVA 5TPWL 4QNPE 4YSSA 1CU4H 1NC2A 4LSSH 3HMXA 3B9KC 4W9IC 1DBJL 2H6OA 3WTVA 3GSQB 4WRLA 4PU2A 4HU2A 4PJEE 2YD9A 1LVEA 2I9LA 3VU2A 2CIKB 4IMLA 4HIJB 4X7TA 4PJBA 1MELA 3TBVA 4YHLL 2CO6B 2A83B 3US1A 1HDMB 4XXCA 2Z0UA 1U8NB 2ZUSA 1A6WL 2BVYA 4ZTPL 2GUOB 4GNKB 2H41A 4R97C 2CSPA 2VRKA 4LARL 5MERB 4BUHA 2BVOA 3SE3A 2ZXAA 1NEZG 2ZTBA 1FCGA 5DFWH 4V1DA 2VC2L 4UT6H 2CGRH 2J44A 5E4IA 4FQPA 5BO1L 1PW3A 2D0GA 3CN4A 3WNMA 3PIQA 2K8QA 2GY7B 3LVTA 2FIKA 4ZOBA 5C0ND 5F7LB 4Q0XH 4M6OH 3IPFA 4PQXA 4YE4L 4NPJA 4Y1SA 5CINL 4AIZA 4PJ6A 1ZIBA 4B50A 4FERA 2A9ML 3LY6A 1CL7L 3P0YL 3P3SA 3MYZA 1S9YA 1QWNA 5AVQB 3EJZC 5IB1B 5DZNA 5BZZA 1HNYA 4FI8A 1QLFA 1YEFH 4N2KA 3DJZA 1OLZA 4JNXA 5LVEA 3APCA 5AYUL 4GRLD 1VFBA 4MA1B 3T3MB 4ADIA 3BEWB 1KLFB 3D07A 4OF3A 1HNGA 5DGRA 2W07B 4AY0A 4JFHE 2BOBA 2X2JA 1EMTH 6TAAA 1F90H 2GEQA 3AXIA 3BT0A 4FKEA 3QEHB 5E23A 3FHEA 5IB3A 2XRAL 3TONA 2ZIDA 3VM7A 4D8OA 1H5BA 1CYXA 4U1NA 2V7HA 1QZNA 2BSRA 3CC5B 4PCKA 4AIEA 4X0KA 1UKSA 1IAMA 9PCYA 3RFZA 4WUUE 5IESH 4BHUI 1O6SA 2IDCA 2F5AH 3STBA 2E0PA 3ZE2B 1QR1A 4P5TC 3SO3B 4BSJA 1NAMA 1GMEA 4WF7A 2EDHA 3FO9B 4HIHA 3RI5K 3QIUC 3HG1E 4HGKC 5E8EA 1DLHB 1DVXA 3RVWD 1OXYA 2EYRA 3DVGB 2NY6D 5E6RB 1W8OA 4FC3E 3DIFB 4F93B 1DJWA 4CBPA 3MRIB 3SYOA 2CUIA 2WY3B 4OZGE 4EIZC 3NEOA 1J88A 4L3CB 5F88B 3MLYH 3SOBL 1S46A 1GZQB 1MEXH 4GSDL 4TLUA 4WTZG 4YXLL 3QEUB 5DJYA 4NQTA 3S34H 3L4CA 2ZWLT 4M9OA 4XNYL 3LKPB 4LHUA 4Q56A 3DTXA 2QSQA 1TTUA 2P7TA 3GIZH 1S9WB 3DTUB 3EFDH 4FULA 4I48A 3AITA 2ITDB 3QNFA 2AJXL 2GAZA 2H7WA 2J88L 2QELA 1LGVA 25C8H 4GIPD 4FNLH 3UTZB 1RZFL 2Q6WA 5DLLA 2D8KA 4GW1A 3ZUCA 3M86A 5CN3A 4HXAH 2YQ2A 4G6KH 2IFGA 2G3NA 4AITA 2GABA 4Y5YC 4L9DA 1CFTB 5I9QC 2EE3A 2E9BA 2ITFA 1DJIA 5CCKH 1A6VL 5I2IA 1MIMH 5E8NB 2UWEB 2X6MA 3HKFA 1TO4A 5FK9B 4BBWA 3GXNA 3KJ6H 5EU6B 3RZWA 4NI3A 3BQUA 1EHAA 1P6WA 1KCSH 4K3JH 1SRDA 4ZUVB 4L8CA 3O4LE 3G5VB 1FO0H 1KN4L 4RGNC 1BAGA 3BVNA 3NFSH 4Y4FD 2JJTC 5GZOA 3ARBC 4PRAB 2VL4A 1Z9SB 4MD4A 1G1YA 4AYFA 3BT2H 2R29L 3K5RA 4HFUH 3VFOA 1DJXA 1MVYA 5L2JB 4ZMPA 1BQHB 2ARWA 4X9GA 5DHXB 3WFBL 1LLAA 1GZPB 5F9WB 2BNQA 4RGMB 2OI9B 4Y4HA 5GSVB 1NFIB 1A9BA 1EAPB 3MBWA 4CSPA 4U1SA 4XMTA 3HE7B 4Q9RH 4PJIE 4OSUL 4EI5D 2RIKA 2IH8A 3SCMA 3VGAC 1U91A 4ZFGL 1CD1B 1VADA 3OJMB 3MV7D 4YFEA 3TF7C 1A66A 2BVPA 5EMYA 4OFQA 1FGNH 3N0AA 4PP1D 2AJZA 4LCUA 3S5ZA 5LGKA 1DL7L 2O5NA 1SJEA 4KRMB 5BVJB 4KTEH 3N04A 1EEQA 1ZLDA 5TDPB 3ZE2F 4BE5A 1OY3B 4W6YB 5J9PB 4A6YB 1QWHA 4Z77A 2ZOWA 1KENH 2J1ZA 1W15A 3MGTA 5GRJL 2HRGA 2XTJC 2YZ1A 3QZNA 1SVBA 3ULUE 1AFVL 2Y07H 1W0YT 1HL4A 3Q43A 4ONHB 2Y3AA 5AUMA 1A4KB 3IFPA 2A77H 4RRPA 5IEKA 1U2CA 1RZ7H 2QKIC 5BJTA 5EBGA 3L3JA 1GXEA 1W8NA 5DJXA 4JAMA 5FCUH 3KS0J 1D5ZA 4NKIL 3A6BL 4PJ5E 4OCWH 4YZFE 1DJZA 1ZWIA 4KFMA 4M61B 3GM0A 2X6CA 3L4WA 3KLSA 4I1PA 1GYVA 5FKPA 1QSFD 4AEIH 1FORH 1OAQH 3BUYA 3SYCA 5HYFA 1ILSA 3U25A 4U6XA 3W1ZA 4G1MA 2HFTA 3UTTA 4CUCA 1OE1A 2D7MA 4G8FA 4Y8AA 3CLEH 5GGQH 4WI5A 1F11A 5C0CA 4R0LA 2BSTB 3GS0A 4Z3FA 1JZ6A 2NY2C 1JWSB 2XWTB 4K9EH 5D93B 1XIWC 5IHHA 1GGYA 5A7BA 1NM4A 1CG9B 4N68A 2NX5A 4ZQKA 3CPLA 1J05A 5D7JD 2ZWKA 4X8JB 4NKMA 4NQCE 5DHYA 5C0AD 5ICXA 3VXPA 5I17B 5KSUB 3ZO0A 4HJGA 4LCWB 1UYWL 4JO3L 2P5EE 3HG0A 5D1QE 1DEDA 1NSNL 4ZAKC 4X80L 5AVWB 5CGYD 5TDOA 1JV2B 3VSTA 1OM9A 2A74C 2NY3C 2VJ8A 2WC7A 5AVXB 5IHZA 5KYUB 4N2NA 1VZHA 4P5TA 5DGQA 1UXWB 5IMLA 5L2KD 3HZ3A 3AAZA 4NKDA 1OSZA 2P46B 4Z7QB 3BH8A 2J4WL 4NQXB 4I2XE 3ARGC 2FATH 4IQHA 4XZUB 4I3RH 4EUPB 3S5LB 3QQ4A 3KEDA 5C0GA 3F7PC 4YSQA 3FOMB 1UXSA 1J87A 1NCCL 1UD2A 3QEGL 3UMNA 3L3OB 3ESVF 4MJIB 3C09B 4KJQD 5FWRA 4IOFC 3I9PA 3RWIB 4FZEL 4UQ2B 5C7ZA 2ERJB 2I26N 2FECI 3ZRFC 3U2SB 4JQXC 4Q9QL 4MVBD 1TVBB 4U05A 5CCJA 4FXTA 1P7KA 3WIHA 1QRNB 3DX4A 3DBXB 2JJSC 3MBED 2GG1A 4JFDB 3OD3A 4LKCA 1C1EH 2P45B 3FCBA 4UU9A 5KANI 5MHSD 2YGOA 5TQ2L 4GKSB 2MNJB 4N0RA 4GH7B 4NB7A 4ALAL 4XXDB 1Z3RA 4CNIB 4DNLA 4J2QA 1VKXA 3QQ3B 5FGCE 1HC1A 2Y7SA 3HOGA 4G70B 4GKLA 5ISZE 4M7KH 4CU8A 1NEUA 5C6TH 2BIIA 2R2BA 4U3SB 5LXGL 4HT1L 2CJSA 1AH1A 1DVFC 4H7VA 3JTTB 4OVUA 5ES4B 1ADQH 2LE9A 2WIIB 4KJWD 2Q2LA 2O4EA 2CUHA 4N87A 4W9HC 1W0VB 1EPFA 1RZGA 2XQBH 3IXAB 4UQIM 3S4SA 5I8OL 5B1KA 2DQJH 4OLVL 1GY1A 4JQIL 1XR9B 2YUZA 3NJGA 3QPQD 5HDLA 1NBVL 4HV8B 2JJTA 3SODB 2XTSA 3BPLC 4GSXA 5DURB 5GGUB 1KG0B 3EJSA 4JRYA 2C3VB 5CP7B 5HDWA 1KMGA 4WK0B 3H2WA 4P8QA 2WXHA 1NC2B 4OZIE 4JM2C 1OAUH 2I9LB 4XAKD 2MH4A 2DQUH 4IIZA 4RMWA 1ZGLM 4IMLB 3CWGA 5C3IA 4OLZH 4X7TB 5IJCC 1BV8A 2W65A 3TBVB 4QI3A 4UT7H 5F6HJ 4BE6A 5JIPA 1OAJA 5I1DA 2DQEL 3ZYZA 5KBKA 1WWBX 4N8CL 2BVOB 5HD8C 5EB9A 1KJ3H 4E9XA 4V1DB 3GZOA 2IWGA 5C0BD 1DVSA 3OKEA 2F19H 2ILLA 2EC8A 5JLZA 3MRKA 1XMWA 4WK2B 3IWUA 4MNQA 2HVJA 4YK4C 4LL9A 2FIKB 2EEXA 4Z7QF 5AB1A 1KXQE 4U4BA 1LO4L 1LD9B 3K0WA 5HVWA 2APXA 2VUKA 4X6CB 4AIZB 2C7FA 4Y19A 3BAXA 4C56A 3W2DL 2EVHA 5IQ7H 5JHLA 1HVXA 1NMAL 2XWCA 2E27H 4KNTA 1KIQA 1S9YB 4NN7B 3LXCA 4L8SB 2P28B 2QKIA 1QLFB 3ZE0B 1L6ZA 2PR4L 4LCYB 4Y89A 2DQDL 4NQED 4Z3EA 3NJJA 1NZRA 1QKZH 4D2NA 1VFBB 1T1ZA 4XHJC 1IEAA 4BFFA 4MXVE 3JT0A 4F24A 3S3PA 2BFVH 1XO8A 2V9RA 1INDL 1QFWH 3P73A 2BOBB 4RMVA 4A6YL 1TTCA 2WBWB 3NP3A 4M43L 1TVDA 4L4VE 5IB3B 1HHGA 4HIPA 2HWZL 4PJFE 1H5BB 4XCNA 1AMYA 5ACLA 4U1NB 2V7HB 1R75A 2BSRB 1DLFH 4X0KB 4LOFA 3RFZB 1HHIA 5IJVA 5J1AA 4UQBA 3N5AA 1E4HA 1O6SB 3VWJA 1RERA 2C4FT 1XIWA 5B39A 4XE5B 1QR1B 4UM9D 1WP6A 3U0TA 1NAMB 3FAWA 3VE0A 4BK8A 4PUBL 2O6DA 4X7FC 5E1AA 2FT8A 4KU1A 4XOBA 1VENA 5E8EB 5F1KC 2EYRB 1OT1A 4AW7A 3MRPA 2RMNA 3QULA 3D39E 5MEND 1GJWA 3KVQA 2H6UA 3ET9F 2FTAA 4XCCL 5HJDA 5T1MA 2HPOA 3SQRA 4DK5A 5I15L 4ELME 5KJ4A 2EIMB 1RZQA 1XGYL 1WEJL 2XN9E 3W39A 3RX7A 1DQQA 1P9MC 3FF8A 3QUXC 5DJYB 3Q2CA 2YKLH 2HN7A 1NCOA 4K94H 2WB7A 2ZKMX 3ARGA 4LHUB 4RGOL 5FHBL 5FOJA 2P7TB 3AG3B 3U48A 3ZLQC 1OSPL 4KI5F 1AG6A 4F37K 5CHNA 1AGBB 4HK0A 3TJEH 2BHFA 1CVSC 1IFHL 2GAZB 3NRPA 3K2UL 1YJDC 2XX0A 4NQQA 1RQ5A 4PJBF 3MRMA 2Q6WB 5DJDA 3ZDXB 4GW1B 2V2XA 5ANME 3ULSB 4J4PD 5CNHA 3ASWA 5KS9E 2F68X 4FJZA 4DERA 3GRWH 2CD0A 5DVPA 1NDGA 1NIFA 4KV5E 4F8NA 6CGTA 3RVUD 5I2IB 2XQYA 15C8L 1E28A 4M5ZL 3BN9C 4M1DL 1HWWA 4HOMA 1I8AA 3VXOA 1G7JA 4D9LH 3WMQA 4NLAA 2RTTA 1KNOA 1IM9A 3IAPA 1JZ7A 4CADA 2K7QA 4OCRL 3TT3L 1PYWA 3HZYB 4IEFA 5B7MA 3BQUB 2PP7A 1QNZL 1DUYA 1UCBL 4L8CB 5L9DH 3FZUD 3T0AA 1CFNA 3BVNB 2NNFA 1FYHB 2R69L 5T1KA 3ZYOA 4JFFA 4MD4B 1KOAA 4JFVA 4H0GA 3I9GH 3VFOB 1CXEA 2WZPD 1T20A 4XPAH 2B59A 2YXVA 3IJYA 1R5WA 3IRZA 5I18H 1S3KL 1IM3D 2BNQB 4Y4HB 1FYTD 4OLUH 4Z7VE 3N55A 1A9BB 2SODB 3MBWB 2DIEA 4U1SB 3PHSA 1YMME 2AITA 3DIVA 2HP4A 3QAQA 1QO3A 3SCMB 1IQWH 3QS2A 1CGYA 1U91B 2LR4A 5FUZL 2DZEA 4LMQI 1VADB 4ZZKA 3DROB 4KJPC 4R26L 5DSCA 1A8JH 2BVPB 3AADB 4BFBD 3EGDA 2CRIA 3VQLA 1F13A 4LCUB 2AP2A 4ODTL 1SM3L 3P2DA 4G3YH 3SDXE 3BUBA 1SJEB 4YBQD 4NQSA 4PW9A 2HB0A 3DOHA 4PWGA 4Z77B 1E67A 1IUZA 4JKWA 4L0PB 2N0KA 3MGTB 4EN3D 1FN4A 1RLWA 1PNCA 3K8MA 3T0BA 1J8HA 3GSRA 3K6OA 4HUMB 1PAMA 1IAIH 3B1UA 3UEZA 1FGVL 3VTMA 5CZVL 1L3NA 2WYHA 5AUMB 1PZAA 5BO0D 3GSNA 2WLZA 3BSZH 1JGUL 3FQXA 5IEKB 4IRSC 4LP5A 3QNZA 1IKFH 4L2LA 4CVUA 4RFNB 3L95A 1URLA 4ODSH 1CLZL 1Z9OA 3L3JB 3QRGH 2CQVA 1ZLUH 4DW2H 4URKA 5DJXB 4JAMB 5JDSB 1DBKL 5JXEC 2NNAA 2ZX6A 3DGGA 1I9RH 2WAQA 1D5ZB 1N64H 2J55A 3QBTB 3PWPD 4RDQG 1K85A 4X9FA 4DQAA 3WSQL 1ZWIB 4D9RD 3TEXA 3EJCA 4MCMA 1JRHL 2ADYA 4FLQA 4MNHA 4LXFA 4PJ7F 5FKPB 3QIWC 3LKOA 1KT2A 4FMKA 4LDCA 3BUYB 1YYLL 1N19A 1GYAA 1FSKB 2WQ8A 3SBWC 1O75A 4U6XB 4G1MB 2PCPA 3L9RA 4EDWH 4RMBA 3UTTB 2CJ3A 2CCVA 3MRNA 4G8FB 2DIBA 5C0JA 1L0PA 5C0CB 1F11B 2APFA 4PJEA 4R0LB 1SMOA 1NFKA 5FYLL 4PBXA 1F4AA 1AKPA 3DVNB 3QUZC 3VXME 5GGRA 2NX5B 4ZQKB 4P59H 5JNYA 4BRVA 4PW4A 3OPZL 4NKMB 5DHYB 4I77H 3VXPB 5EZIH 5ICXB 4JGNA 3CFUA 2MKWA 4HJGB 5DMGD 3QFJE 5E8DL 4U1GB 3NIGB 5E99L 5TDOB 3WN5C 3O2DL 4N24A 5E56A 3OLGA 3VXUE 1MIEL 2D4DA 3CXFA 5C92A 2LABA 5IHZB 3GLEA 4D9QD 3TVMA 1XXFC 5FA3A 5D5ME 3HB3D 5IMLB 2OX5B 1NMBL 3RZCC 3U9UA 5D2NC 3AAZB 4UOZA 4ZMNA 1JP5A 4M7LT 4NKDB 4WEBH 3BH8B 3OKOA 3BGFC 1VACA 4B9CA 3SPVA 3QQXA 1YVLA 2YGVA 1XTLA 5C0GB 1UXSB 5L88H 3CVBA 3EZ8A 5I1CL 2JWYA 3NPSB 3BPOB 2XIIA 2WUCH 4PJ9D 1NGQH 4ZTOH 3WLWD 5ILTL 2DYRB 2P43B 3MRGA 3CCHB 2YMXL 4NO5A 3FU6A 1MLCA 3WY3A 4QOKD 2A9CA 3RI5F 3WXVH 4TMPA 5DO2D 2R0LH 1DQMH 3FTGA 4HHAA 1HK6A 2Q86A 1P7KB 4PRHD 1NAML 1P4IH 1UUSA 3DVFA 1WAAF 4LLQA 1DR9A 4HYTB 4EMZA 4LKCB 2FBJL 1JL8A 5D6DC 1KFAL 4UU9B 4BGDA 4DEPC 4LOUD 4KKBD 4DN3L 3TM6A 5JIMA 3TBSA 1BF8A 1VKXB 1FHNA 4HP5A 5LKNA 3ZY7A 2Z93A 3HG1A 3KWUA 1T2XA 2OP4L 2F08A 5GHWL 1E2WA 4H8HA 4IBWA 4OZGA 3MJ9A 1OL0A 2FUQA 1RZGB 2WANA 4K5LA 3S4SB 3TZVA 4PIBA 5TDNA 3VWKA 4I3SL 4KKRA 1ZLWH 2F18A 3PPEA 1RK7A 2ESVE 4DZBA 4JRYB 1RUKH 1LEKA 1ZK5A 2IAND 3MLUL 5B21A 4K23L 5E5LA 2VDRB 4IYKA 1JZ8A 5HYIA 3BFWA 1HNFA 3MX0B 5D1ZA 4H8QA 3WKMH 3O6KH 4KGLA 2K9FB 2BFGA 1YZZA 4O51A 3UXFA 4ICXA 4B97A 2W65B 5E00A 1CC3A 2CZNA 4PRDA 3KJ4B 1P69B 3FYIB 4UMGA 5I1DB 4JCLA 2CJTA 4Z7IA 4AT6A 1U8KB 1IGIL 3ZYIA 1J0ZA 5BOPA 3UP6A 3OKEB 4KVPA 3VD0A 1MAKA 4G59C 2QPEB 3QPKA 5JLZB 2NTFA 3BKML 3D5OF 3MRKB 4FFYH 3WELA 2Q1EA 3H7LA 4MNQB 2HVJB 2OYKA 3EGXA 2HH0H 1E2ZA 4MA7H 4ZNCD 3QUYB 1E5YA 2DDQH 3WI9A 5IV2A 4K07A 3O4LA 1A21A 1I7RB 1XCWA 2UZIL 5I1IL 4L4JA 1S7SA 2A0LD 3PDGA 1IGML 4Y19B 1PGRB 4C56B 4P07A 1B2WH 1KB3A 2HKHH 3KGSA 2D9QB 4RDQF 4ZW5A 5C3LD 3DOSA 3UABA 1K2DA 3MYJA 4OQ1A 1CGUA 5H37A 4HQQH 2JMRA 1AQKL 1UHVA 2BCKB 5C0IB 3RY6A 1M3IA 4AMKL 1JGVH 1E4WL 3QJSB 4EF3A 1RH8A 4IBQA 3GDCA 3VI3E 4Y2DD 3ZSSA 3DXAD 1U58A 3T6XA 1KELL 2ARJA 3FQRB 4V2BA 2W8CA 5SWQA 1UZ6F 3LQZA 3P73B 2GKIA 1AHKA 3M6DA 4OF0A 3KBFA 2BVQA 3QIWA 1USZA 1HHGB 4XCNB 1XGTA 1TJIL 3IKCA 4GBXC 4FZ8L 5ALCL 4CC4C 4ZMLA 4UM8A 3KE0A 1X9LA 3JBG7 3HE6D 3V4PA 1HHIB 2EP6A 1XGPA 5IJVB 5J1AB 3QCTH 1AXTH 4QRPD 3VWJB 3RWJA 1NTDA 3GFUA 3FTXA 5B39B 3U0TB 3CX5K 3VE0B 1KTJA 2HJLA 4X6BB 1S7TA 1TETL 4KAQH 4KH9A 3KS0H 2VO5A 2OV0A 3MRPB 1S7UA 1H3XA 2BY0A 3QULB 4DK3A 5EEUA 4L8DB 5KEZA 1WISA 5T1MB 1L7IL 3TO4D 5JOFA 5I71C 4LBEA 4LLAA 2DWTA 4BWTA 1FH5H 4Y0GA 4GQ9H 4O02A 3PWJA 3S7GA 2ZNXA 2P1YA 3RZCA 5AL0A 5G2NA 2HN7B 5IB5A 3DURA 4PJ5A 2HKFL 2FT7A 3WLBA 4Z7OB 1OT2A 4IRZA 3LRGA 4TPRH 2UV3A 3WNJA 4YSTA 3ARGB 1TFHA 2AEOA 4H0IA 4MZ2A 5CHNB 1RIHH 3KYNA 3HAEA 4HK0B 1WGVA 1IBFA 4GUOA 4JPVL 2IH9A 1PEZA 3MRMB 3DIDA 5DJDB 3S3BB 4KRPC 1U8JB 2V2XB 3UBFA 3VMNA 4A7SA 4AQ1C 3QXVA 4HIQA 1JZEA 2F7IA 2RR3A 3O2VH 4XCFL 1NDGB 5K33A 3WL9A 3S3SA 5DRZA 2ZX8A 3DX8A 4YVUA 5C07E 1BHGA 5CJXC 4N25A 3HFMH 2DICA 1IKOP 3D8MA 3POCA 2Y5EA 3NCJH 5LQBH 2MJWA 2MEJB 3VXOB 2ODHA 1G7JB 2D7OA 3D48R 4G5ZH 1KACB 2P5EA 4NAQA 5D1QA 4G9FD 3K81A 4XO4A 1QP1A 5ERWB 1KNOB 1IM9B 4GKOA 4CADB 4LZKA 4APQD 1PYWB 1TJMA 4IEFB 3STZA 2C9UA 4JPQA 3II3A 2HT2C 2KUTA 1DUYB 2EZ0D 2J71A 4K9EC 3KGRA 4GG6E 1CFNB 4ENED 2M83A 1JDAA 4GMTH 1TZGH 5T1KB 3CVIL 1I1CA 3ARPA 2FH8A 2EXWD 2OXHA 4I2XA 4U1MA 2BZ7A 2E47A 3L81A 3J27A 3AU0A 3RIFK 1KN2H 2K4AA 3UL4A 5H35B 1T20B 2B59B 2IOOA 2NZ1A 2AMUA 3IJYB 5F7KC 1R5WB 2OSXA 4X4XA 4FXLA 1LDPH 4XR8C 2KPNA 3WIHL 3VQ2C 3PGCA 5DEJA 2DOCA 1JF1A 2DH2A 1QO3B 5TH2A 4MMXB 4UZUA 5JIHA 2CHWA 3VXSE 5DSCB 4OUOA 4HAGA 2Q3ZA 1U8IA 1OE2A 4PVLA 1U2YA 3EGDB 5EDSA 4TQEL 4RMSA 3I84A 4P3DA 1HT6A 2QDWA 1NWOA 4MB4A 3B4NA 4GFXA 4NQSB 4W81A 2AXFA 4HKXA 3LH8A 4WHCA 2ZT9C 5DO8A 4ZUUA 1Y1UA 3EXLA 5DZVA 2O93L 1QFWI 4GAGL 3E7JA 2IH1A 3NJFA 1FN4B 1F4HA 5LAPA 4Y88A 35C8L 5FUOH 1NOLA 1G4RA 1QZ1A 3GSRB 1FNSH 2EQDA 4GEJA 4GY4A 5GGTL 5H8DA 5ISZA 5KANG 4JRLA 5JHDA 4RAVB 1KB5H 3TOPA 3GSNB 3N42B 2JI1A 2WGXA 1K3ZA 3HRZC 3QNZB 4IJTA 3UACA 3L95B 3WO4C 2GBTA 1X6NA 2OR8A 4P06A 3QZPA 3IE9A 4BA0A 3QCVH 2NNAB 3DGGB 4IBYA 4Z7OF 5AVTB 3I9IA 5E6ID 4DCQB 3DGDA 3MRJA 4LPYA 4YDLC 1ZGLP 1H6FA 2H1PH 3B7RL 5GISH 5EHFA 2W0LA 4QXGL 2A6DA 4MNHB 1EFXA 3I3EA 4HPOL 4TM9A 1KT2B 3O8XC 4HIEA 5BW7C 1UEMA 5CBEA 3NCWA 2PCPB 4DT2A 1RKRA 1I1FA 3HVDA 3DUUA 5DVKA 3MRNB 4OZIA 2WZ0A 5C0JB 3UAAA 2BW5A 1KYFA 4PJEB 5E2VL 3ZQWA 1BD2D 4AEHH 4NGHH 4XWGL 3P3RA 1WITA 5GGRB 3NQKA 2HFGL 3NK4A 5JNYB 3BQVA 3EYQC 1RP9A 3FW6A 1MWOA 1N18A 1U3HD 3K6DA 2ZXGA 4GBXA 4CC4A 3UPAA 4Z95L 3L2LA 4LP4A 3BPCA 2ZCHH 3S3CB 4KKAC 5DLML 2PF6A 4L4TD 5DJ0A 1HWHB 2YFNA 4Z0BL 5GGVL 4YHNA 3TVMB 3B9EA 5FA3B 4W93A 3U9UB 2HT3C 5LGHL 5AD0A 5CGBA 5IQOA 1NMCC 2VLRE 4WFHD 1OF0A 2MPAL 4B9YA 3OKOB 2E76C 2YBRA 1VACB 2VTFA 1N7MH 3SPVB 3ROOB 4FA7B 5C08E 1CXHA 1UM4H 3Q06A 2QTVA 3WIIL 2LU4A 2EC9T 2BVUA 1M7UA 4NO5B 1X5IA 1BREA 3GXPA 4F57H 1MLCB 4XNZC 3D85A 3G9AB 1RIVH 1IBHA 5AVSB 2F9BT 4D0CB 3O6LH 1TYJA 3FTGB 4HHAB 4JM2F 3MMEA 4BZ2L 2Q86B 1KTBA 3FQYA 1FA4A 4NM4L 1U36A 2OTUA 4LLQB 4PJFA 4BDVA 5JQ6H 2YSTA 4NEHB 3H7BA 5GJTL 3WYRA 4P2OA 3G6DL 3ZKXB 2YJQA 3RHWK 4AQ1A 4WUUB 2VLJE 5JYLA 2IWEA 3TBSB 3NSYA 1RUPL 3KWWB 3FB6A 2B5IC 3Q7JA 4RETB 4YDMA 5F93C 5DVLA 3EOYG 2WQUA 3AGVA 4OGXL 2IDTA 5CJXA 2ROYA 2B9BA 4KXCA 3FHQA 3HG1B 5A6IA 2KH2B 3D39A 1FUNA 1EEZA 2GJZA 2VDQB 4OZGB 4NM8H 2BRRH 1E9PA 1X5GA 4ELMA 4MA8H 3SY0A 3TZVB 2XN9A 3VWKB 3ASNB 1A3QA 3RWCA 4OLWH 4Q52A 4WLCA 1IAII 2EILB 3QDJE 2FAUA 4DZBB 1LEKB 2ALAA 5CMAA 3SDCB 3ZKND 3GIVA 2PP9A 5LAXA 5F70A 1X4ZA 3WN6A 3ULVC 1R3LA 3MA7A 2VDLL 5D1ZB 4MDIA 3D9AH 2A1WL 4DKTA 2EE0A 4O51B 1MAML 2YAMA 4FQCL 2V8MA 1RZPA 2N3JA 4KY1L 5ANMA 5E9DA 5JXAH 5KS9A 4QTFA 2MOGA 4O9HH 5E00B 3WHE0 3WIFA 5J89A 2DLFH 4PRDB 5D4HA 5FFOA 3TYFA 2FRGP 3U7WH 3US0A 5LCVH 1MCPH 2OQJA 1PDKA 4JG1L 2BP5M 1W72H 3F58L 4EQ2A 2J7LA 4DP6X 4TSCH 2LGNA 2VDMB 2XJKA 2NTFB 4RH4A 3SGJA 1CWVA 3FTZA 2WK2A 2HG0A 3EGXB 3TFBA 2DL9A 2FNBA 3HZMA 4LPUA 1NCTA 3EIFA 4MAUL 5DYOA 4R4NC 2X2IA 5L8JB 1BM7A 3SDDA 4CGTA 3O4LB 3NRFA 3SOTA 3D05A 5IV2B 2FSEA 4JMNA 4N5UA 1S7SB 4G7RB 1HILA 5HPMA 4RISL 1FL3A 1N4XL 1KBKA 3LRSA 3SE6A 3LRHA 4QHLA 4DVRH 2C9XA 2FQEA 3DOSB 2ZWSA 1K2DB 3EBAA 3I6LD 3MYJB 4LASH 4NQUA 5E2WH 1X4YA 3HZKA 4XVJL 2YWZA 4KKCD 4BFOA 4MAYA 4POZD 1PS3A 1YHPA 3VD4A 2YR3A 5AL8A 3JWDH 1A14L 4Z7VA 3GEFA 3BCDA 4BWUA 5AW5B 5C7XL 3FB8A 1THCA 1YMMA 4KK5C 4F2ME 3AY4A 5SWQB 3LQZB 5CZRA 3MOAL 2WBJC 4NO0D 5EZJA 2OYLA 4Z7AA 4WUKH 3R7QA 4PGDA 3QIWB 1QLEH 4QHPA 3IKCB 5HJGA 4JPWL 3CUPA 4DN4H 3SDAC 2JKXA 4UM8B 3SDXA 3NJNA 3V4PB 4YFLF 1XGPB 3MRBA 5JW4Q 1S7XB 4E9VA 2AXGA 3GSNL 1T21A 3RWJB 5CF3A 1A47A 4OIIH 5IKCB 4OFYD 5LB1A 1A4BA 5DJZA 2HJLB 4WI3A 1S7TB 3PCYA 3VH8G 4I87A 1I7UA 1KBWA 5KW9L 4OZGF 5ACMA 3H85A 2H9GB 2W80C 2WW8A 1QA9A 2P5WD 1W8EA 2AQ2A 4H20L 5JOFB 4LBEB 1BPVA 3CBRA 2BOCA 1E42A 1ZHBA 5AB2A 3VFNB 2X9YA 4O02B 3PWJB 2NY0C 2VDOH 3SPJA 3DLQR 3W37A 3L3HA 1FC2D 3BVTA 3ZIYA 5IB5B 2WXOA 1BZEA 1FH2A 1SHSA 2D3JA 3DURB 3NCBB 4HUCA 4LLVA 4PD4J 4PJ5B 4UIKH 3MUY1 4YO0A 3WLBB 3MI6A 1VIWA 3D4GA 3MLZL 3P3UA 1HN1A 3VYOA 4QYAA 1C8QA 1WIOA 3TGXA 3N1PC 1X7SA 5C0DB 3FN9A 2Z31C 3KYNB 3HAEB 4GKNA 4P4RB 4ZW7A 5J11C 3KBEA 3R0MA 1E3ZA 5AYUH 1YY9D 2EDTA 4XC1L 4KTDH 1TQCB 4LDOB 1O7VA 5LLIC 3VCLA 2IO5A 2E7LA 2EEAA 3D0VA 4U0RC 4JL2A 1HKLL 3CVHA 4N1CA 5ABZA 1PY0A 5CD5D 3WL9B 1JWUB 3VXMA 3PAYA 2H2PC 5DRZB 1NCIA 3DX8B 1LNUA 4NQCB 2KLSA 1EHKB 2YD2A 3TJHC 4Z5RA 4LSPL 3QFJA 2P5EB 5D1QB 1BLNA 4DO4A 5C1MB 1G6RA 4K3DL 4DEPB 1MF2H 3EHBB 1X5AA 4OJFL 3VXUA 3C60A 4TLTA 4M5YL 5C9JA 3D2UD 3STZB 2OZ4L 4NJ9L 3ESPA 4Y8DC 5T1LA 4IOIA 2GJPA 3INUH 3MLXL 4HUKB 3BAYA 4LRIC 4ZS6D 5D5MA 4V33A 4UYQA 2EYTA 4G7YH 2OXHB 4I2XB 4U1MB 1PJ9A 4BEIA 1SUJA 4BELD 1A02N 1L9OA 4LIQL 2H0JA 1ONQA 1T83A 1S8DA 1XAUA 4X4XB 2P52A 4HMCA 4AK2A 3CH8A 3FHAA 3Q3GA 4N28A 1FG2A 2BDNH 2MHAA 5IROD 2FNWA 2E8YA 3PGCB 2CAKA 4P23C 1QPPA 2XWEA 1YJDL 1JF1B 3D08A 4ODWA 5IBUG 1LMKA 4FYTA 3U1SH 2E7DA 4HX1A 3N44B 1YA5A 2W0FA 3MSPA 5ECGA 4FD0A 2VSMB 3RX5A 1U8IB 5KVDE 3HS8A 3S37X 4P3DB 1NGZA 3UOAB 2X41A 3D34A 2I60H 3JTBA 2ICWJ 2KS0A 5F8RC 4LSRH 2E46A 1HFUA 4JFOA 1CICC 2AXFB 4HKXB 4J3BA 3V6FA 4ZUUB 1BXAA 2VDNH 1QFUH 3OHXC 4NXSA 5ID0B 1L5GA 2GSMB 3ULUF 2IH1B 2V6HA 5FGCB 4WWID 1HQ4B 5AZEH 3US9A 3CQQA 5ISZB 1BFTA 3VX1A 2AC0A 2ATKB 3QHZL 3WXWH 1UKQA 1Q9OA 2O5ZH 1ZLUK 2R0WH 2JXMA 1R9FA 2X89A 4Y9EA 4P2RD 5BQDA 2ED7A 4OT1L 3V9CA 1FV1B 2J56A 2YK1H 5BS0D 1YYML 1V7NH 2V37A 1ERNA 2BY3A 2M8XA 1IAIM 1OF2A 4PGZA 2RQEA 4HJEA 2A6DB 5F0PB 1EFXB 4TVPL 1ZA3A 4HIEB 4C54A 3QR0A 4TULH 5CBEB 1E5AA 1U3JA 2DBLH 1I1FB 1GKOA 3DUUB 4OZIB 1BAFH 1LWJA 1U8QA 3OGOE 5T5FL 5MP6L 1Z5YD 4JY6B 4X5XA 1ZLSL 1PG7H 1JXGA 3S2AA 2DN7A 1UADC 5BRZA 4S1QL 2JH2A 3FQNA 2VDML 2CO7A 4PY8J 2GT9A 4P9MH 2WBJA 3E3QC 1QTYT 1HIMH 1Q0YH 3BE1L 4XVUD 5ENWA 1LP9E 2Q9OA 1Q0XH 5E2UH 1SHWA 4GBXB 1AJ7H 1TR7A 2R9HC 4N2IA 4Q6IC 2W60A 4I0PD 3BPCB 2EUVA 1KIRB 4OV5A 5DXWA 3O6ML 5DJ0B 4GLRH 3MV7E 4YHNB 1HE8A 4GW5B 1XT5A 2WCSA 2H0FA 2JQMA 4L05A 5AD0B 1A7NH 3QCUL 4FN0A 1KEMH 8FABA 4IBSA 2Y1AA 2YBRB 1PG7W 2UXVA 1IBYA 2DQ6A 2JI3A 5BVPL 2JIXA 1E4JA 5I1GH 4JJ5A 1LTXA 4HF5L 1QPXA 3P30H 3A67L 1JPSL 2X6VA 1B4JL 4AYBA 5AVVB 3FQ1A 3LIZH 3RX8A 3AMKA 3N44F 1E9OA 3MZGB 4LVHC 3PPSA 1U8PA 3D85B 4AZ8A 3M45A 1P5VB 3GUTA 3QHFL 2K0RA 2HFEA 3MMEB 3FCUB 3U6XA 4L4VB 2OTUB 5EG6C 4ISVA 4PJFB 5LN4A 4BDVB 1HTYA 3ULUL 4OLYH 4P2OB 3V5DA 5EA0H 4AQ1B 3D52A 4G8GD 1IGCH 1CU4L 1MZZA 1YUHA 4FJ6A 4LRNH 1DBBL 2IPUG 1JDCA 1HWGB 2GEEA 1RJCA 1ZD6A 1QSFE 1WFTA 2EE9A 3FB6B 3QUMA 4IRJA 2V5RA 1J1XL 4WKXA 3UIZA 3CXHK 3AABA 1MRDH 2W9EL 1UENA 4KQ4H 4FFWD 1ESOA 2HLAA 5F44A 3D39B 4IRZL 4G7SB 4UANA 2MCPL 5I0YA 1MHEA 4YNYB 2GSGA 1N6VA 1EEZB 2GJZB 2LAAA 3VG9B 4L18A 1E9PB 2DIJA 4ELMB 1WWCA 4QRQB 4UT6L 1ZLWK 3SY0B 2BMKA 5BMFL 4M1GL 1T7ZA 2XN9B 1SBBA 3P9LA 5C0AE 5I75C 4KVCL 1R46A 1MRFH 3RWCB 4WJKB 5FM4A 4YX2L 3NEEA 2E86A 1OPGL 3MNZA 2JJUA 3R4RA 5CMAB 3AGWA 5DWPA 3GIVB 3W38A 2X4RA 2XVGA 3F8UB 3V5KA 4BSWB 1R3LB 3MA7B 1TEYA 5L2KE 4MDIB 3L5JA 4PS4H 5D1XC 4N20A 1IC7H 2EDQA 4JGMA 3EDFA 5ANMB 5KS9B 1TU2B 1DANU 3WIFB 1G9MH 2EO1A 4LHJB 4QHMA 3TYFB 4F8LA 4M8QB 1PDKB 2FWOA 2JKSA 2PO6C 3HPJA 5C07A 3UO1H 4K7PH 3RIFF 1S3RA 5F6HI 1ANUA 1C5DB 1DJYA 3WE6A 4KUZH 3AQDA 3BLPX 1H15A 1M53A 4XMLH 3V4VH 3HZMB 3X17A 5DYOB 1OZUA 2KI6A 1NM9A 3SDDB 3VW3L 1PD1A 2YPLA 2FSEB 2L4OA 4AMWA 4RAUA 1HILB 5HPMB 2ARJQ 3P11H 1FL3B 3LRSB 5I1EL 4N86A 4QHLB 4ZXBD 2F61A 2EXYD 2X1QA 5ITFB 43C9B 5MHSE 2VN6A 3HZKB 3GBNH 5G55A 3FN0H 2PYFA 4KH2A 3L1EA 3ARTA 4MAYB 2R2HB 4XCYB 5FM5O 5FYJD 1QBLL 3L1GA 4E5XG 4ODXA 2BVEA 1NCWH 1H8SA 2X4PB 4KHXH 4Z7VB 3EOAA 3PJNA 4MLIA 2Y7NA 3FB8B 1YMMB 3B5HA 1UOLA 2J3SA 1L9QA 1MEXL 4PFEA 5EZJB 1BEYH 1Y18A 3O2WL 4KY2A 4S1SL 5CU9A 3OMZA 5D7SH 5EC2A 1QFHA 3VXSA 3ZKMD 4PGDB 4XPGH 1Z3GL 1BEXA 2H47C 4OB5L 3CUPB 4AOFA 1ITCA 4MZIA 4FFZH 3SDXB 1W0WA 3E8UL 3CDZA 3RKPA 5AYQA 1DBAH 2MQCA 5F7BA 3RDTA 3WY1A 4UNVA 2AXGB 1JV5A 3FUIA 1PFOA 6PAZA 4HJIA 4AIOA 4UV7L 4PJHE 5DJZB 4YLBA 2GTQA 2XICA 2WWMC 4JN1H 2EUZA 4WTWA 1T89C 4ZFZA 2CA4A 4Q6IA 4XAKE 4M3KB 1QA9B 2WCGA 3UJIH 1OSEA 1JK8A 1MIML 4W4OC 4PRID 1V3KA 2BOCB 2NNCA 1ZHBB 2OM5A 3EYUL 1J0HA 5D70H 3L3HB 3KMDA 4LLVB 1ZT1A 1MFAL 4YO0B 1KCSL 4K3JL 5C0BE 2DB8A 3CHOA 4PLNC 3EOBA 4HPYH 3ATDA 4ZW6A 5KYNA 3G6JA 4RIRA 1XF5A 3OF6A 4GKNB 1LEIA 4YHMH 5EF0A 1M7IA 1LO0H 4YHOL 1YC8A 1AIZA 3O9WD 4LO9A 4DGVH 2HJKA 3DI2B 3VCLB 4A7UA 4FQJH 1BG1A 2NW2A 3BAEH 5FO2A 4I1RA 4HUWA 3OWRA 5TFSH 4LNRA 3Q8BA 3CVHB 2H3NA 3L45A 4KROC 2IOIA 3D0AA 3D69A 3O3AA 4HC1A 3VXMB 3VMPA 1SMDA 4P46D 5FIEA 3M8OH 2CBMA 3CVDA 4NQEE 1LNUB 5DMYA 1NFDF 4H1LH 4BZ1H 3CV5A 1CD9B 5F1OB 2Q8AH 5DD0L 3SBPA 3P0VL 4Z5RB 3LKQA 3QFJB 1BLNB 1EZLA 2R27A 1G6RB 4YE0A 1BQUA 3IFNH 4XB8A 4WO4D 3C60B 5L4IA 3GSXA 3VXUB 5CEZH 3I75A 4J12A 5T1LB 4IOIB 1AXSA 3DMMC 3MJ8A 4IMKA 5D5MB 4JPIA 1PD0A 4ECNA 3DRTA 4GRWE 2X28A 2VLRA 3VRLE 2EYTB 3FCTA 1AR1C 3JWOH 3BXNA 4NWTH 3UC2A 2BSDA 3VRJA 2NNRA 4PJCF 3FO1A 4N0YH 1U8CA 3RB7A 4ENZA 1SOXA 2YD1A 1YMHA 5C08A 3DO7A 5C9KA 1S8DB 3ZGIA 3SYAA 1JGIA 4Y4KD 1G94A 3Q3GB 3TN0C 4BHUA 1FG2B 2MHAB 2R0ZH 1WK0A 3SSGA 3GZQA 3U30C 1RZ7L 1O9WA 4N2OA 3IDXH 1FC1A 3ORJA 4UZGA 3TBBA 5MENE 1U9KA 4HX1B 4TL5A 2W0FB 4MAZA 5F9OH 4J2XA 4RZCA 4I1NB 4OCWL 4ONFH 1NGZB 5GIRA 3FCSA 3LZNA 2JKIS 5GSRA 3BI9X 5E1QA 1KFGA 1CJYA 4R5XA 5C8JA 4GRLC 1TZIA 4JFOB 1UD5A 3L8QA 5I19H 3V6FB 4M3JA 1RUMH 5DHVA 4POUB 2QMKA 4TUJA 3IN0A 3R18A 3FUDA 2VLJA 1L5GB 5LDUA 4X98A 3ISWA 3HEIB 1AO7D 4DGYH 5FYKD 3UBGA 1DQLH 2VXTH 3CLEL 4XNUH 2WXGA 1ZPLA 1BF2A 2PO6A 3D50A 1P7BA 2B7DT 2GVYA 4K9EL 3OC8A 4R2GC 1IQDB 3ZU8A 3QJRB 2NXZD 1WHPA 1Q9OB 4HUUA 3WTTA 5HI5D 2JXMB 2O5XH 4F92B 1T22A 4XNXH 4XZ4A 4BH7A 3AUVA 4TQIA 4NENA 3V6BR 5GZNC 4P4KD 5FKAB 2CBPA 1VZIA 5CU5A 1DHKA 4LPTA 1SEQH 2VISA 3NN8A 1B2YA 4K5PA 4MJ5B 5DS2A 5IBTL 3RVWC 4XE0A 1OF2B 3V6OC 1URIA 3R8QA 3P9MA 2ESVB 1PBYA 3TH2T 3QDJA 3ZHNA 4ZX4A 1J0JA 4Z3JA 5EIIA 1JFQH 3EF4A 2LAGB 1ZA3B 2XX1A 2HPTA 1QATA 4B7IA 3OWEA 1TNNA 3IT8D 3IJEA 2FATL 1RMFH 2FJSA 4I3RL 2YUWA 1UUNA 3LDBB 2G30A 3RWGA 5LG6A 4X5XB 1F6FB 2HT4D 1DP0A 3N2JA 5FB8A 2YD3A 2CO7B 3TLRA 2GT9B 4DPBX 1YAZA 2WBJB 5T1DL 5HHVL 3S36X 3BP4A 5ENWB 4HWBA 3HC0B 2XPGB 3MFGB 4AVJA 1YN6A 2GTWA 5TPWH 1FYTE 3SKOA 3KLHD 4JRXD 1F8TL 2W60B 3RGVA 2FCBA 3UO8B 4ZFOA 4OV5B 3VTTA 1KPVA 3EJRA 2CO2A 1J9QA 2JQZA 1EJ8A 4YHLH 4OTXL 2YUXA 3P4MA 2I7SA 2ICES 3WOVA 4NN5B 2HJFA 4ZTPH 3VGGA 1GS8A 4LARH 1GTFA 1I31A 3OLEA 4FQXD 4WVRA 5E8PA 4ELKB 4UBDC 2AQPA 4JJ5B 3FS9A 4WIQA 5C6TL 2R15A 2VMFA 1CGSH 2AZUA 5HYSB 1CXKA 2X3CA 4N0FA 8CGTA 4FG6C 4YQXH 1HJBC 5IFJA 4CSZA 3VI3B 1E9OB 3A47A 4Y4FC 5EPMA 1RZ8A 1ORSA 1W6LA 2CKBA 3FCGA 5CINH 1U8PB 4F2MA 1U0QA 4AZ8B 3PREA 3EJJX 2A9MH 2CH8A 2VQTA 1CL7H 2HFEB 3P0YH 3ULVF 2DQJL 3KGTA 4QXUL 1U3ZA 4NN6C 1IEHA 4ZUSA 2EVJA 4I89A 4ISVB 3T3PE 2CLRB 4HWZA 1WJ3A 3O3UN 3F04A 4QWWD 2PXYC 3V5DB 3JWDC 3PWPE 4Y16D 4Z3IA 4Z9KB 1D5RA 1YUHB 4D9RE 1KBBA 1OAUL 4KZ0A 4QRRD 3QUMB 4IRJB 1LWRA 1TLMA 2IGLA 4OLZL 2XRAH 1QYGL 4HKJA 1UZ8A 1PLGL 3QORB 2HLAB 2WCPA 2C5DC 5CUSH 1WBZA 5DHDA 5CM1A 1MHEB 5F7HA 2GSGB 4OAWA 4J39A 5BOJA 5B3NA 3VDBA 3CFQA 4DPCX 5IQNA 5F0JB 1KJ3L 2NRDA 4AM0A 3MUHL 1YDPB 2F19L 1GC1C 3P9LB 1G7QB 5KVMC 4FKKA 4GSRA 2CGYA 4PLKD 5H4YA 3KPNA 1K9TA 1SYVA 3MNZB 2DMBA 1KXHA 2YRBA 3MLWL 4BH8A 4NERA 2X4RB 3V5KB 3NCMA 4HWEL 5IQ7L 4D9QE 3TBTA 1IGYA 4AW4A 3ZBMA 2X4OB 2VN3A 4F8TA 4ZUTA 1EA9C 4LLDA 5IB2A 1WC7A 2DAVA 3ZZSA 3AT9A 2YLKA 3TEWA 4XNYH 2JELL 3CDFA 2DLEA 2F7OA 3S8WA 2VSDA 3VO0A 4ANXA 2F0CA 4MQTB 2GJ6D 2FWOB 3BLKA 4HZLA 5C07B 4UOW1 2HTKC 2AJXH 3NACL 3C5ZC 4HG4J 3WE6B 4GRLA 1RZFH 4PV9A 5IK3A 4AH2A 3UGEA 4LCCC 1UWEL 3MVSA 1H15B 4QOKE 5FLVA 1WFJA 1JZJA 4D94A 1DLFL 3B34A 5DVNA 4F2EA 2X1WL 1MCNA 5D7JC 1XGRA 4PRHE 2FEEI 4GG6B 1A6VH 2ZSVA 2XXCB 3G7TA 4OBRA 4RAUB 4K71C 3ZSTA 4NQVB 2WKLA 3EW3B 2R83A 4J3TA 4GLRI 4ODXB 2BSBA 1NBQA 1JXJA 5GZNA 4XO9A 4D8PB 3EOAB 1KN4H 2EH8H 3WKQA 3ULVL 2QQQA 4MMYA 2JK5A 2WIMA 4FL4C 4GUCA 3NJHA 4KRNA 1HSBA 1U8HA 2APTA 1WBYB 4HCGA 4PS8A 4GAAA 5AAMA 3V6OA 1I1AD 2OR9L 1Y18B 2R29H 1URZA 3VXSB 4B7LA 3PYCA