2GBUA

C6a/c111a/c57a/c146a apo cuzn superoxide dismutase
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
153
structure length
153
Chain Sequence
ATKAVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGATSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHAIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLAAGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Cu-Zn]
publication title The Coupling between Disulphide Status, Metallation and Dimer Interface Strength in Cu/Zn Superoxide Dismutase
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 153
sequence length 153
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2006-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2gbuA00
1HL4A 4FF9A 2Z7ZA 2VR8A 2WZ6A 3KM1A 3HFFA 2WKOF 1P1VA 1E9OA 2E47A 3GQFA 1CB4A 1FUNA 1DO5A 1YAIA 1UXMA 5KBKA 4BCYA 4U4IA 2AF2A 4L05A 1E9QB 1TO5A 4A7SA 1YSOA 4A7UA 5KBLA 1RK7A 1B4LA 2AQRA 4OJAA 3KH4A 2GBTA 3H2QA 2ZKWA 2VR6A 2Z7WA 2WYZA 2WWNA 4A7VA 3GZQA 2GBUA 3L9EA 1IBHA 4A7TA 1XTMA 1BZOA 2Z7UA 4MCMA 1SXSA 3GTTA 2AEOA 1SOSA 4N3TA 3HW7A 1L3NA 3KBFA 1MFMA 4MCNA 3PU7A 2NNXA 4B3EA 2AQTA 1PZSA 2Z7YA 1N19A 1AZVA 1OAJA 2SODB 1E9QA 3LTVA 1SXNA 2APSA 1EQWA 2WZ5A 3GZOA 1OALA 4N3UA 2AQPA 1SPDA 3ECVA 4BCZA 1TO4A 3GZPA 3ECUA 1S4IA 2R27A 3F7KA 3KH3A 1XSOA 1SRDA 3SODB 1SDYA 1Z9PA 2WWOA 1OZTG 2VR7A 1SXAA 1KMGA 2C9VA 3RE0A 3T5WA 2LU5A 1HL5A 2AQNA 1E9PB 1B4TA 1OZUA 2AQSA 2ZKYA 3MKGA 3KM2A 1XTLA 2GBVA 2E46A 3QQDB 1BA9A 2V0AA 3CQPA 1PTZA 2C9SA 1EJ8A 2WYTA 3F7LA 1DSWA 2C9UA 2XJLA 3L9YA 3ECWA 1JK9B 5KBMA 1N18A 2JLPA 5CU9A 1QUPA 1YAZA 2Q2LA 1SXBA 1E9OB 3H2PA 4A7QA 1UXLA 1IBDA 3HOGA 2JCWA 4OH2A 2AQQA 1IBBA 1ESOA 1F1AA 1OEZW 2ZKXA 1SDAB 3K91A 1COBA 1F1GA 1SXCA 1Q0EA 1SXZA 1JCVA 1E9PA 3MNDA 1IBFA 3CE1A 3KBEA 4BD4A 4A7GA 3CQQA 2K4WA 1PU0A 3QQDA 1CBJA 2XJKA 1U3NA 1F18A 2ZOWA 3S0PA 2WZ0A 4A7GF 3GTVA 1JK9A 1Z9NA 1F1DA 2WKOA 1IB5A
chains in the Genus database with same CATH superfamily
2VLRD 5I1IH 2FLRT 4QXGH 1LDPL 3EHBB 5HVFB 3JYBA 1FZKA 3MJ9A 3D39B 4Y4FB 1ZLVH 3GQFA 1LEIB 3VWKA 1TLKA 2AV7A 2Z8WC 2VSMB 4GY4A 5E8NB 1RK7A 5HHPA 3O4LE 3H9SB 4HS6B 5CLWA 1ZT7A 4DW2L 1O9ZA 1I4FA 3QEHB 2OJZL 2XWTA 4WLCA 3TT3L 1FWXA 2DIAA 5CSZA 1FHGA 3PNWB 2VXQL 4GKSB 2WWNA 4DKTA 1WBZB 1TF4A 4W9CC 3AROA 1WGOA 2N4IA 2Q7YA 2XVGA 2NUPA 1JF6A 1E3XA 3QUMH 4WHCA 1A3RH 5IB5A 1T20A 1U0QA 1ZT1A 4X5XA 4AH2B 3MLPA 5IMKA 1RZGA 3MLVL 3HZMB 4GSXA 3N91A 1QNZL 3QUYC 3VFRA 1HXKA 1BEYL 1I7TA 3KLAB 5D1XA 4GO8A 1JGDA 5DK2A 3SSGA 5BXFA 3CFIC 4HH8A 3DWTA 3AS3A 1CI5A 2NX5E 3BSZL 2EICA 4DJMA 1RHHA 4HAFA 3QNFA 3RU8H 1B0GA 4OF5A 4X7CC 3UO1L 3SPGA 3CSGA 4AEHL 2PXYD 3UJJL 2X2JA 4ONGL 4J8RA 2WQVA 2LV4A 5I15L 3LS4H 5H2BA 1HZHL 1XT5A 3OHXB 4UIMB 1OQOA 3DIFB 4M48L 3BVUA 3D4GA 2YGNA 2NXYC 3VX1A 1W0VA 2X4QB 1G7IA 4L8CA 1PFCA 1VCAA 4N9GB 3IVKB 1KB5B 1SYVA 3IMSA 3R06A 4N0RA 1I8IA 2O6CA 3KJ6L 4KWUA 4Q52A 5ISZB 1H3UA 5I73B 4Y2DA 3C5ZA 1MPAL 2QGEA 3GSRA 1J0IA 5GGVH 5DJCB 2BSRA 5I8CA 2DWYA 4N0YH 1EEYB 1Q90A 4MQ7B 2V8LA 4FMKA 4HUKB 3KYMB 5INDB 5AB0A 1PZBA 4RGNC 4Z7VE 4ONFH 1PX4A 2Z6FA 4AGPA 1NMBL 1AKJD 1BJMA 2YBRB 1R5VA 2YGVA 4K8RL 4K5MA 3PXJA 4NM8L 5JXAH 1GOFA 4U6VH 4HJ0C 3D51A 2DTMH 3VI4E 3CLFL 4K94L 3OGCA 4HJIA 5HYSG 1Z32X 1ZE3C 1MJUL 4QCIA 4TSAL 2XNAA 1MNNA 4HEPA 3UC0H 4MAYB 2MMXA 3QQDA 5FHAL 1FQ9C 2EXSA 1NCCH 4QNPF 3CLWA 3OJDA 5DURB 4WI8A 3VM5A 1TJIL 3MPCA 1KLFB 3IS0X 1QPPA 1PZ5A 3QDGB 4Y4HA 5IGXH 5F3HA 2SEBB 2Q76B 4W9FC 1P1VA 3VFWA 3C09C 1IUZA 1H6EA 1TDQA 4QT5B 2YD3A 5KBKA 4AGLA 3GS4A 3PE9A 4PD4K 2EDXA 4XXDB 3X13A 4OZHB 1HE7A 5E6ID 5KBLA 3BH9B 3L6FA 1RIVL 1RK0A 1B2YA 2L7EA 3FN0L 4PG9A 4TVPH 3I9AA 5E08H 1NCNA 4H8HA 5CFHA 3AWEA 1PZDA 1P1ZA 1QI4A 4WWOA 3W37A 3WKYA 2QADB 3EH5B 5DVNA 3QARA 3R8BB 3ISYA 2VDNH 2KH2B 3RVWD 1A6TB 2EUZA 3MLTA 1NUDA 3TT1L 3UABA 4LSVH 4GRLD 1RUQL 4A66A 3UTQB 4QMEA 2GW5A 2JXMB 3N1FC 4B9YA 2E6PA 2X4RA 3DUHA 3MNMA 4JKNA 5TGBA 2HTLC 4OCSL 3QI9B 3CG8A 5B4MD 5EIIB 3IU4H 2YRLA 1O5DT 4MA7L 1OGAE 3RVTD 2GJ6B 4E41B 1MIEH 4JFZL 1AIFB 3M1BA 4JFXA 2NUTA 1MFBH 3OV6A 4PTTB 5IJVB 3DV4B 1C12A 1FSKC 3BPCA 3F6JA 3RURA 3SPVA 3PP4H 3T0EB 1SXAA 1JF5A 1SJHB 1WFOA 1DSYA 4AWJC 1E8YA 2VAAA 4UQ2B 1I1AC 1D5IL 2XZZA 3QR2A 1AHWA 5DVLA 2EDQA 1AGDA 1CVRA 2EVIA 1DEEA 5KBPA 3MGTA 1FC2D 4GBXA 5DA4A 5EOCJ 1WH0A 1A22B 5CXPA 3KXFE 1XSIA 4IBQA 4L8BA 2JSFA 4G80A 2IDUA 4IMKC 4Y5VA 3LDBB 3S98A 3UYRH 4XTRC 3WIIL 1B6UA 5HYSA 2COQA 3TVMB 3LPPA 3HNSH 5EULV 4FJYA 1UXSB 2JV6A 1HOCB 2AVFA 3RWIB 2CK0H 1AZCA 3NYKA 5CJQL 5C08E 3KBEA 1JPTH 1XF1A 3HAEH 4W93A 1KOAA 1D9KB 2QPUA 2XQBH 1S8DB 5L0QB 2QJDA 5GJSH 1NCUA 3CD4A 4EZJA 1RUPL 3BAYA 2WNWA 2ZWLT 1F4YL 2RACA 3B2VH 3KW7A 3II1A 1HXYA 2LLGA 4KXZI 4M7ZB 5IJKC 2VM4A 2LAAA 1Q0YL 3MRRA 3DPDA 1K72A 3TEWA 4O4YH 4Y1AA 4L8SB 5A1AA 3BP4A 1RL1A 3DDGA 4X6CA 4ENEC 2HVKA 5ABDE 4NP4L 3LEXA 2WXKA 4J3OF 5CJOL 1UWXK 4NS0A 4CILA 2HJFB 1KCUH 1KJMA 4XPTH 1XR8B 3M6DA 1NCDL 4YMPA 3V0AC 5F96L 2DS4A 3WMQA 3RZCD 1JNHA 4QRFA 1HE8A 4OLWL 3IKCB 4ISVB 1MW1A 3F58L 3MV7A 3HHMA 4OAWA 7TAAA 3HC4H 1OK8A 4UOW1 1BFSA 2QQKH 4P4RB 2CRYA 2L7JA 5AKVA 3H3PH 4XB7A 1I8LA 4Y4FA 3D39A 5DMKB 1A6WL 5IQMA 5JPNB 1LEIA 3CDCA 3TN0B 4WI0B 1IKFH 4K07A 2ID5A 4KY1L 5D7IF 3HE6A 5E8NA 1HWGB 5LGHH 4Z7WB 3H9SA 4HS6A 4HCIA 3QEHA 2F58L 1YYMH 4DKEL 1KDJA 4Y19D 4KDTC 1XB8A 3PNWA 2HAZA 1NFIB 4GKSA 4ERSH 1WBZA 4LU5L 1ICTA 2F8XC 4CVXB 3BMVA 1NCWH 4U1HB 1GW6A 2OI9C 5E6YA 4AH2A 4MZ3A 2XSKA 5DMIH 3HZMA 2MRYA 2FBRA 3KYNB 5CJXA 3BEVB 2X1QA 1KIUB 3KLAA 2QL1A 3EYVB 3TEUA 3US9A 3HNVL 1AS6A 4WK2B 1RJZB 5I71B 4KUZL 5I1EL 2GC4C 4P99A 3UDWA 4LASH 3BAEL 3MBWB 2YIHA 5DQDL 3ZDYB 1O75A 4A7QA 1GGCH 3OHXA 2OL3L 4UIMA 4BFFA 2FSDA 1PD0A 3DIFA 5DHYB 4CN1A 3CK0H 2J2ZB 2QKIB 4NC0B 5J13C 2IWFA 5EIIG 2X4QA 4N9GA 2KLRA 3MR9B 3IVKA 1KB5A 3NCJH 3PS6A 4ACPA 4Q74A 2R56L 2TSBA 3WXWH 1NIAA 4FP8L 2Q8BL 5ISZA 3PFUA 4JRYD 4XCFH 1A7PL 4TLTA 5AALA 1AS8A 5DJCA 2UZXB 2R39A 3L4UA 4R6UA 1E0OB 2C1OB 1EEYA 4MQ7A 3CZGA 4XVSL 3BUQA 4TM9A 1ONQB 2UV3A 3KYMA 5DK3A 2CCVA 2PLTA 5INDA 2A9MH 3BWUF 1JDCA 1HHIB 1BSIA 1YMHB 4N87A 3UO1H 4URKA 3VSVA 1HIML 2BH0A 3AG2B 3W1ZA 4FQ2H 2YBRA 5IHZA 5I2IB 4OLYH 4FFVD 3U4BH 1A4AA 1X4YA 1NC2B 4U1LB 2J8UF 4FZ8H 1BP3B 5F1SA 4Q0XH 5F9WB 2ERJB 3FB6B 5ICUA 5JIIA 3BESR 1PX3A 2ADGB 2BSEA 4MAYA 1JSYA 1QP1A 2DQCL 4FXTA 2AANA 4Z7NF 4BQ6A 1CLCA 5IW6B 1JZHA 4N2AA 5SWZE 5PCYA 4U1IB 1KLFA 3QDGA 5FFLA 4NUPA 4ETYA 2SEBA 2Q76A 2VDMH 4G8AC 5C1MB 2VZSA 4QT5A 3NPSB 1D5ZB 1OAZL 3PF2A 4GRMB 5IVOA 1UC6A 2EEDA 3VXSE 3OMIB 2A38A 4XXDA 4OZHA 5AD0B 1HJBC 1KGUA 3TXAA 3BH9A 2IAAC 5JXED 2BNRE 4Z18A 3ZL4H 1FVCB 4P5SA 4XX1G 1WBXB 3HI6L 5HHOE 1DANU 3U2IA 2J1XA 4HG4J 3FT9A 4IOSD 4EDWL 4YDJB 1OAKH 3V9EA 4AJWA 4KTYA 1V27A 2H1PH 2YLKA 4ZFFB 4CMHC 1X5AA 4KKCC 4FA8A 2O5ZL 1XHHA 1A6TA 1X5JA 5I23A 1M7UA 3S97C 4JFED 1SY6L 1QFOA 4RFEB 4PJGB 4N1CA 4XVOA 4B3VA 3Q0HA 3B5HA 3UTQA 1NPNA 1M6UA 3O2VH 2JXMA 3FQ1A 5D1QE 1MJ8L 4N0CD 4LT7A 2VC2H 3D52A 1C5CH 4NJ9L 4ZS6D 3DLQR 5CN1A 1M2OA 3QI9A 3MOBL 4CKQA 3ABZA 4HUWB 5EIIA 1NCJA 3MGAA 2NY3C 2XV6B 4E41A 2BVUA 2GJ6A 3PLYA 2A77H 2A6KB 3L1OL 1AIFA 4KMTH 5CD5D 2DQUH 4QEGA 3D1MC 4PTTA 1IEAB 4RISH 3V0FA 5IJVA 3DV4A 4WEMB 2BIPA 4HK0B 1RZQA 3O0RL 4XHJC 1M57B 4ESKA 4JHWL 3WJLA 4JFSA 4X80L 3T0EA 1JD9A 3VE0B 1G7JB 4JO3H 1SJHA 4XVUC 3GMQB 2HX9A 3NMEA 1KACB 4UQ2A 2LLNA 5CP3H 4QGYA 3WYRA 5EUOB 2ZUYA 4O5LL 1F6FB 2YPVH 3O2DA 3ZTJG 1RV6X 1G6RL 4JO4L 3DI3B 1INQB 2VR9A 2I5YL 4MA3B 2Y6SD 3B9VA 4XNXH 2YQ2A 4J2XA 2ITDB 4QPEA 1T7ZA 4LIQE 2F6AA 4WEBH 1CB4A 2BZCA 1AY1L 5J6SA 3OZ9L 4IJ3C 5SX4I 4H4NA 2BSTB 1IGIL 1BG9A 5E6RB 3HG0A 3TVMA 4YHIB 1MQKH 2R0LL 2UVEA 3H2QA 2HKFL 5E9DE 1UXSA 5F3FA 1HOCA 1OANA 3RWIA 4MYWB 1I8MB 5DJXB 1GIGH 4IBYA 1XF5B 4Q56A 1MJ7L 1D9KA 1ZTMA 2B08A 2BHZA 1S8DA 4FXGB 4W81A 4N4YB 2X0UA 5AAMA 1U3ZA 4XXWA 4Z7VB 3IJHB 1FL5B 4I0KA 3HCVB 3RL2B 1X5ZA 4NT6B 2YFOA 3L5XH 3TO2B 3KBFA 3M7FB 4ODWB 1ULVA 4G6JL 4OLUL 5I1KL 35C8H 4IRSD 3QW9A 2UUDK 4L8SA 3UTPD 1UM6H 3U48A 1A6UH 1GGTA 12E8H 5SWSE 5K9QI 4YHML 3BOVA 3LQAC 1NGQL 2HJFA 3WEXB 1XR8A 1AGBB 4TXVB 1HKLH 3IKCA 4ISVA 4EJ1C 3BAWA 3BUPA 3T5WA 4Q9CA 4MAZA 1KJ3H 1L3WA 3MXVL 4JDTL 2DOCA 3ROOB 5MEPB 4P4RA 2N7AA 3W38A 2C3WA 5DMKA 1QR1A 1BGXL 1INDL 3V4PL 2UXVA 3L9YA 5JPNA 3GS7A 4HWBH 4OKDA 4X7EC 4IDJH 4KHXL 3TN0A 4WI0A 1QFHA 4UOZA 5KSVB 3GRWH 4G7YH 4D7BA 1Q38A 2PWDA 1NPUA 5DFVC 4Z7WA 1WJ3A 1IT9H 5GQBA 4HD5A 4ZW7A 2OMTB 3UBHA 2Y4SA 3OKLB 4GP4B 3DETD 1D7BA 3T3MB 3VXRD 3UAJA 5CEZD 1NFIA 2CLZB 5AW5B 3V2AR 1CBVL 5FHBH 2WTOA 3QXAB 4E9RA 1AJ7L 4IIQC 5J5EA 1KBWA 1PL3A 4CVXA 2WXJA 3MX0B 1Q0XH 4U1HA 1I1CA 4NGHL 3VFVB 5DF0A 2YAEA 1SXCA 3FQYA 3K80A 1WTGT 3KYNA 5GIRB 3BEVA 3CFKB 3RVXD 1KIUA 3VTMA 5TPWL 3EYVA 1TZOA 2Q10A 3OAZH 1RJZA 5LBGA 2JIXD 1MRDH 1OGAB 1CLZH 1G5AA 4PG2A 4Q2ZA 3QHFH 3ULAB 3MBWA 1CF1A 3EGSB 2IALB 2YAOA 3MMEB 5DGRA 3TONA 3UZVB 2H2SC 5DHYA 3BP6B 2BCKB 4KY1H 2J2ZA 2QKIA 3V52L 4A7SA 2YSSB 4UT9H 3IE4A 3K6IA 3TV8A 4Z77B 3MR9A 3NG5A 4XPAL 2BP3A 4OZGB 4EUPB 4FCHA 2QHRH 3MCYA 2AK4D 2XTLA 4LPYA 1MCJA 4QF1B 4MJ4A 3KPMB 2ZXEB 1EUUA 3PG2A 4TULH 1BM3L 3UCRA 3ZDXE 4CGTA 5BS0D 2UZXA 3GDBA 2C1OA 5ALCL 2CJ3A 1YNLL 1QZNA 4Z7OE 4OI9A 2ED7A 5C9KA 1FORL 1ONQA 2BO0A 1P5VB 5EH1A 3QUZB 3B83A 3FUDA 2KLTA 3HEIB 2HLEB 2APXA 1HHIA 4AYGA 4UV4H 1IGFH 1YMHA 5DD5L 3CU1A 4G8GD 3D09A 3VM7A 1DVUA 4Z8FL 2DYRB 3E1ZA 1IFHL 3GJFH 2CBOA 3ZX1A 3D0AA 1QASA 5I2IA 1MHHB 3GO1H 5C08B 4MVBD 3OLGA 2K9FB 1NC2A 1FL3B 2X9WA 4U1LA 1YEEH 2PYEB 4OLVL 4GPVA 4RESB 4XXCC 3SODB 4ZODA 3FB6A 4FNLH 4PVNA 4O02L 1VHPA 2ADGA 3TPUB 1A5FH 2R56H 3EBAA 2GEEA 4YC2C 1MREL 3OAUH 1A3QA 2Q3ZA 1QWUA 5IW6A 4FC3E 2DM7A 2MQGA 4U1IA 3RUGF 4G8FB 3L5HA 3SPCA 4BQ9A 1HH9B 3S34L 4PJHE 3V0VB 1D5ZA 3WFCH 3LX9A 4FFTA 4GRMA 4RGNE 1ZTXL 5EZOH 5AD0A 3LZRA 3G6DL 1QSED 3GLEA 4ZOCA 5LNEA 1FVCA 5TQ2L 1WBXA 1UWGL 2A0LD 2APWA 5TF1L 2GHWB 3CFCH 3ILQC 4YDJA 2NSQA 5JA8B 2J6EA 2R7EB 5A2JH 4Y16C 4PLNC 4ZFFA 1H6TA 2NPLX 3SDYH 4FQCH 4A68A 2FO1A 3PWJB 5GGQH 4W9JC 5GRUL 2Y7QB 1CXEA 1MLCB 1KBBA 4BD4A 4EI5C 1DBKH 1AC0A 1BXXA 3MYZA 1NM9A 4RFEA 3FMGH 4PJGA 2ZF9A 3QDMD 1ADQA 3FFOA 4JRXE 3EDDA 4AQEB 4WWKD 4LHUD 1HSBB 4PJCE 3QWNA 4P59L 3GZKA 3BX7C 2Z31C 4B60A 4HUWA 1BBJB 3DXAD 2FNBA 2ZF8A 3CZKA 2A6KA 3C60C 4L5FL 1KXQE 2PTTB 3PGFH 1IEAA 4FTVE 3U1PA 3WMPA 3WY3A 1FVDB 4HK0A 3WY1A 4APQB 4N5EC 4HQQH 1MW3A 3HI6H 2EC9T 2CGRH 3VE0A 2HB0A 3QS2A 1G7JA 1JE6A 1JHKL 3TZVD 3GMQA 1NKGA 3BDXA 3RWJB 5EUOA 4OGXL 2XKSA 5JQ6L 3DI2B 1INQA 3FYIB 3VRIB 3EADA 2I07B 4MA3A 4J6RL 2BW4A 4OI8A 3VI3B 4YHZL 3RTQC 3IMVA 4YXKL 4MAUL 2ITDA 2B4CL 5KSAB 4YSSA 5JW3L 4YHOL 1CXLA 3KPLB 2WZAA 1Z9OA 2KL6A 2N3JA 1RVFH 2BSTA 4FL4C 2HXAA 3VVVA 1RUAH 5EEVA 3AB0B 1QEXA 1ZVYA 2ICEC 2FSEB 3KPSD 3KWXA 4YHIA 4OM1L 2FBJL 4H20H 2KZWA 2ZUSA 4Y4KD 4CU8A 3GI9H 1TSHA 3ARBC 1S4IA 2GIYA 4LRNL 4YL9A 3MLWL 4YN3A 4CU6A 2QSCH 1I8MA 5DJXA 1YEIL 4MLIA 5E2UH 4EUPG 1XF5A 2DQEH 4FXGA 5CZKA 4ZMYA 2FR4B 3ZE1F 1UGKA 2AJYH 3P4NB 3PREA 4X5RA 5E4EC 3V55A 3ZYZA 3MLZL 3RE0A 1IEHA 2IWEA 2MKWA 3GBNL 1QBMH 3IJHA 4Z7VA 1KTLB 2J6WA 5KVFL 4OCWH 1FL5A 3RL2A 3HCVA 4ODVL 3ZYJA 2LU3A 1NAKH 2WV3A 3AG3B 4NT6A 3TO2A 3QRGH 4ODWA 2G3NA 1HL8A 3P30H 3P3UA 5DWPA 1CPUA 3LN9A 2I5YH 1K85A 3UERA 3FO0H 2Q9OA 4HC1H 3TF7C 4M3HA 3SBWA 3F65A 2X6AA 2QVMA 4MX7B 3WEXA 3NIGB 3COOA 3POHA 3U1SL 1KB9K 1UQSB 3QIWC 1AGBA 1SZNA 1MAKA 5SWZB 4HLZH 4FFWC 3SDDD 3ULVH 3FU0A 2HKFH 1FC1A 1QMUA 2N0MA 3BZ5A 5KW9L 1B0RB 4G6FB 1KULA 1FFQA 3ROOA 5MEPA 2BINA 5LXGH 5ECJE 1GTNA 3P11L 3DYPA 3OF6D 5DS8B 3X2QB 1D5BB 4X9BA 1MCHA 2NY6B 4ZNCD 3U0TB 4DGYH 2AEPL 5HHOB 1X5IA 2R1XB 2Y2TA 5KSVA 3BFOA 4KK6C 1CGSL 4GXUM 4WUUB 5T1KB 2OMTA 3V0HA 3OKLA 1U41A 3TM6A 3VNYA 1L7IH 2CLZA 2QSQA 4NM4H 1OPGL 3QXAA 3IRZA 4LSPH 5FYJE 4UILH 5IVXB 2J1YA 4H2AA 3MX0A 2D7PA 4HJJH 3VFVA 4FKHA 1KEGL 2A99A 4LCYB 1JMXA 1M1SA 4BFGA 4M6AA 4EZKA 3NIFE 3NPZB 5GIRA 4PS7A 3BGFB 3CFKA 1TMCB 4PI2A 3RX8A 4TNWF 4OM0H 4Z3GA 3T3PE 3UZQB 1VGKB 5F8QC 2LR4A 5FX3A 3HG1B 5DZJA 2N7BA 1RUKL 2EEBA 1AE6H 4UNUA 4TQIA 3LNFA 3EGSA 2VISB 4IK6A 2IALA 3MMEA 1GL4B 3N40P 4OBSA 3UZVA 2YD1A 3BP6A 2BCKA 3C6LC 1W8OA 4HHGA 2DQJL 4H8PA 2YSSA 5E6IC 4EPSA 4Z77A 4G71B 4CC4C 4JPQA 1EAOA 5F93C 4OZGA 1BYOA 4EUPA 3DO3A 5JMRA 3F7RA 4UYQA 2KS0A 2WLZA 4QF1A 4W4NA 1OTSC 4NRZB 3ABGA 5CUSH 2E74C 2QLVB 2VUKA 3KPMA 4RMUA 1J5OH 5EEUA 1BVZA 2Z34A 1EHXA 4K3DL 1QBLL 2E9BA 3H7BB 5I19L 3FTWA 1B4TA 4PRHB 4A2DA 3B7SA 4CMMB 2VLLB 4M7JL 1L9TA 3MXWH 1P5VA 1DQVA 3QUZA 4N2OA 5D1ZC 2XA3A 4XBEL 5CILH 3OBAA 5F6IC 2E0PA 2ZX7A 2HPOA 4QDGA 1KN4L 1N10A 1KJ2H 3VRJB 3SCMD 1ORSB 3B8SA 1KCSH 2CZNA 4PJBF 1MHHA 2YD0A 3DX1A 5C08A 3NACL 4L4TD 1OP4A 4PM1A 4X5LA 1FL3A 2DI9A 1A3LL 3QFJD 5F6HI 2PYEA 3JWNE 2QHLA 3JZ7A 1HHKB 3SGKA 3U7WL 3SKOB 4K15A 3TPUA 1A7OL 2G60L 2IFFH 4TTGA 3N40F 1J87A 2JELL 1VGEH 4G8FA 1HTYA 1U8QB 4U2ZA 3NZHL 1HH9A 5SWSB 5J9PB 1QSFE 1QHPA 1U30A 4L4JA 3GTVA 3K3QA 1A8ZA 3QUMB 5LCVH 5F0MB 3V0VA 4J3SA 4HPHA 4OLZH 3B7UX 1A6VL 5DRXB 1A65A 1H3XA 3RBGA 15C8H 1JDDA 3FDWA 1N3NB 3N43B 1DVZA 3K1KC 1ECYA 5EO0B 4JO8A 5GXBB 2IOMA 2ZUVA 2R0KL 3L8QA 5AVRB 2R7EA 4NO0B 4AOFA 3C5JB 3MC0A 1D2PA 2X2YA 1HWWA 4OGAD 3BKYH 2PWHA 2O5NA 2EYTB 3GM8A 3IDXH 2CGZA 3PWJA 1TITA 4RMVA 3U4AA 1BZQK 1NUGA 2Y7QA 1MLCA 4O02H 4U3CA 1HN1A 2X89D 4AENB 3K4AA 1N5YH 1OK0A 5JLZB 1BECA 4JFFE 3OR6B 5KSBE 4AQEA 4BZ1A 3QPKA 4BZ2H 5DZNA 1HSBA 2BHFA 4FNRA 5JOFB 5PAZA 5IIEB 4NKIH 1XGUB 3UJIL 3WNNA 3KL3A 5JHDE 3APCA 4V1DB 5MEQB 5M95B 1BBJA 4OZIB 2BRRH 3MLRH 3P9WB 4QRQB 5J12C 3QG7H 2PTTA 2NXZD 2X6BA 2BY0A 2WQ8A 1FVDA 1QA9B 3QWOB 4R26H 4APQA 4JL2A 1RIUL 4DGIH 4LCVA 2X53A 3ME0B 1O7VA 1CGTA 4O00A 1Z9SB 1MXGA 4QHPA 4UAOB 3EW3B 1MNUH 2BIIA 4U3XA 1XSOA 4DETA 1MRFH 3FQNB 3RWJA 2HUHA 1Z9PA 3I85A 4QTHB 1IGMH 4B50A 3VFTB 2ZXQA 5JW4N 2FO8A 1EGJH 3ESVF 5F0PB 3VRIA 4G43B 2I07A 3VI3A 3ZHLA 1WIPA 5KSAA 2XWXA 2A9DA 3GEWB 3OSVA 3KPLA 4WI7A 1W2KT 2C9UA 3BT2H 3FU7B 4ZTEA 4MNGE 4QRRE 2AXHA 1NICA 4XC3H 4JQXC 4P59H 4FLHA 1MIML 2FSEA 3QUYB 4KJYB 1CDIA 1GXEA 3C8KB 3HS0B 1MI5B 3BYTA 1NMAL 4LKXB 4ODUB 4L5FH 1TZGH 2XACC 1HCVA 5D93B 4TQEH 4F3FB 2V6HA 2ZOOA 2FR4A 2F1AA 3P4NA 5F7FA 1NFDE 3RDTB 4O58L 4B41A 1CLOH 1KTLA 2CHNA 1D7FA 1OAUH 4Q58C 4NZUL 4N2NA 2IGLA 3QCTH 4G42B 2VLMD 1ZK5A 4UAHA 1WFUA 1YRKA 1JG9A 4WI5A 1F45A 4YXKH 3MUZ1 3NZUA 4AQ1C 3CMOH 4MX7A 1IGTB 3FCTB 3RL1B 4JQIA 4LOUD 5EMYA 1NFKA 3NJGA 4X9GA 1E9QB 1UQSA 4N8VB 2AJXH 2F1EA 1QLFB 1NM4A 3EJTA 5SWZA 3ARFD 2Y24A 2KQNA 3QHZL 4K7PL 1B0RA 5DTFB 4RGNB 2A83B 2V4LA 1AVAA 5F89B 3VW3H 5DS8A 3GMPB 1D5BA 1I9RL 3QUXD 4GKNB 5B1JA 5TK4A 3WD5L 3Q2CA 3ZTNL 2ZQKA 3U0TA 4UDUB 2QFPA 3FO1B 2R1XA 4J3OC 1AS7A 3RY6C 2GAZB 4YHNB 4H8WL 1QHQA 4FKEA 1KELL 5FDWB 3SDAD 4WUUA 3V4VL 5T1KA 5FOBB 3WTXA 2J43A 4PS4L 3NTCL 4L3FA 2EINB 3AWGA 2J1KA 3RGHA 1FLRH 4AGQA 3ZW3A 1DJXA 1EBPA 3WJMB 5IVXA 2GTWB 3LIZA 2FATH 3AU0A 1L9NA 5DMJB 4UUJB 2DJ4A 2KZBA 4KHTH 2MFNA 4LCYA 2A9CA 5EV7A 3S37X 4JRXB 3TX4A 4DTGL 5CFAA 3C09B 4LXFA 5KVDL 3O2WL 1Z7JA 3ZRFC 2V9RA 2DQGH 1BDYA 4UINH 1A3ZA 1J8HD 4KI5F 1JVOA 2IAMD 3GTNA 3EJPA 1NGWB 3UZQA 1VGKA 2P9RA 3HG1A 4WZ9A 2R51A 2AHIA 5LBSA 2KZ1B 3RILA 1CFBA 2VISA 2XTSA 4JFVA 4R4BB 2D0GA 1UYWH 3ALXA 4H88L 3O3UN 1FGNL 3HAEB 2Y36L 4A2LA 5I5RA 2AEPH 1VCBC 4NQED 4XP5H 2RQ8A 2VAJA 2Z91B 2V7HB 3SGEI 1ZY9A 2AMUA 4YQXL 3TH3T 3BWZA 1JPSL 1E4KC 1KYOK 2YHGA 1S7WB 3KDPB 4J28A 1AQ8A 3ZKMD 4NRZA 3SPHA 5C71A 2YO3A 4JANB 4JVUA 2OCFD 3LPFA 3VRLF 2ZKXA 3IDMB 4P2QE 3WFBH 2WYHA 5AB9A 5DZLA 3D0LA 1WIOA 1HFUA 3H7BA 4PRHA 3IF1B 4CMMA 3EKCA 2VLLA 1G9MC 3L3KB 3VH8G 3PJLA 4P3CH 2FUTA 1F18A 3EXJA 2UZIL 3GI8L 2NW3B 5G55A 4UQAA 2IJ0C 1TTGA 5AW0B 3VRJA 1FSKB 4EKXA 1ORSA 3QCVH 4J3OH 4QXUL 4C56E 1JD7A 2WNKA 4D9RE 4YZFF 2A9AA 4YSAA 4K3EL 3EFDL 5I8KH 4TQPA 4CNIB 4A7UA 2BIQA 1G1OA 1LWRA 4Y88A 5IHBA 1UM4L 4CDHA 4OR1A 4FABL 1V05A 1BWMA 1HHKA 3SKOA 5EBGA 4QXVA 5T1LB 2GUYA 1MFUA 1XF3B 1QLRB 4NRYB 1F2QA 1OARH 5E1IA 4HFUH 4RGOH 3S4SB 1II4E 1TVHB 4G6KL 3TO4C 4FMVA 3AJ7A 1DJZA 1SM3L 1U8QA 2ADIB 1PLCA 5SWSA 5J9PA 1U3HC 4H1LH 5AYQA 4AL8L 3QUMA 4HIXL 3CX5K 5D4JA 4AZ8B 5DRXA 1ITCA 2Y1AA 3ZTEA 4NNYB 1GC1L 5AW8B 4D9QE 1N3NA 4N2FA 5EO0A 4XPFH 2W88A 1H9VA 2WQXA 1DBJH 1DBAH 3L95B 4NO0A 3C5JA 3I6LE 5SWQB 4N8VG 1MFCL 4OFPA 2EYTA 3W81A 5D2LE 4LCUB 4L48A 1QVOB 2UY6B 3U7WH 4AENA 3W0WD 4K2UH 5C2BL 5FC9A 3SZ6A 4DHLA 5JLZA 2E9GA 2XT1B 2AW2A 3OR6A 3F6IA 4HJTA 5FO2A 3MODH 4Z5RB 3PWUB 4K73A 5M7QA 5JOFA 3J07A 5IIEA 1XGUA 5HHMB 5MEQA 2YPKB 4OZIA 4V1DA 2OMBA 3JVGC 4M1DH 2G3ZA 4S0HA 4IMLB 2BDNH 3ZE2B 1O9WA 4QRQA 1ZHKB 1WD8A 2JLPA 3APMA 2ZIDA 5EUKB 1R6VA 2XVLA 1QA9A 2CSPA 3QWOA 3FUIA 4MMZC 4QYAA 3P3YA 3P9LB 1T7YA 2JH2A 4WFED 3ME0A 3FSOA 1Z9SA 1W16A 2AQQA 5HY9B 4I1RA 1IKNA 3MROB 1G84A 3FQNA 3FL7A 2AJUL 2G0LA 4FXLA 4XI5C 4KKZA 3EYFB 2X1XR 4QTHA 2MKLC 2EXWD 5GRYA 1UM5L 3VFTA 2FUQA 1JNLH 4DOHB 3QJRB 4F7CB 2CNZA 1ET7A 1A1NB 4G43A 4J3BA 3V7AG 2DMKA 3P40A 2OSXA 5HYQB 2NDGA 3SYCA 1CICD 1YC8A 5GS0C 4UOQA 1MG3C 4M7KL 1WZ1L 2EXYD 2OR8A 3FU7A 3DHMA 2B5IC 4MXQD 5ID0B 3UH8A 2EDRA 2QTEA 2LHAA 4I9WD 4F15C 4KJYA 3HAEG 2J3SA 2ZP9A 1AR1C 3GC3A 3BKCL 3C8KA 3IK2A 3LXAA 3CX2A 3HS0A 4KTEH 3ZHKA 1GTFA 1MI5A 4JJ5B 4LKXA 4ODUA 4NUJB 1GS7A 2VDMB 1CFSB 2BWQA 2WVVB 2VLKD 1ZOXA 2RGSA 5MERB 4F3FA 2LTQB 3AGWA 3H3BC 5DC9B 3RDTA 5KZCB 2VDPH 4RAUB 1BWWA 1FO0L 4KOCA 5FEBA 3MOAL 3WGVB 1WEJH 4F7TB 2OK0L 2K0RA 1J7VR 4G42A 3S37H 1R0AH 1X3DA 4N8PA 2FQFA 5GRXG 1N64L 2VMJA 2RMNA 4FQQB 1HINL 4KO6A 2W5PA 4RZCB 4P4KC 3VD0A 4CN6A 1IGTA 3FCTA 4HLJA 3RL1A 1TNNA 1QFUH 1DQMH 1XIWB 3WXVL 1E9QA 1P6AB 4N8VA 5DA0B 3TYGL 2H7WA 2LE9A 2BS8A 1EO8H 3JWDL 2E4FA 4C4UA 4WUKL 3HZYB 3Q13A 2EDOA 4BWTA 2VC2B 4U0RC 3WENA 1KYAA 1QSFB 1UT9A 3VFMB 5DTFA 4UTBL 4BWUA 2A83A 2PN5A 5F89A 2P5ED 1MZYA 1T5KA 2X4OB 2Z0BA 2K8MA 3GMPA 3KGTA 3T6QC 5KJ7E 2F54D 4GKNA 1N7ML 5HI5D 1KBGL 2HLFD 3ORJA 4UDUA 5KEZA 3FO1A 5GS1C 5LAXB 4J23A 1MWAL 2GAZA 4YHNA 5C3TA 4Q6YA 4F2MB 4PJ5B 5FDWA 5FOBA 4Y8AA 4MJ2A 3T1FB 3NEOA 5I6XC 5D6DA 1L6PA 3OR7B 5BOJA 1U8OB 1AO7E 2X0VA 1QRNB 4GAYB 3MACH 4HVBA 3WY4A 4BE6A 3WJMA 2GTWA 2W9EL 1G0XA 3RB7A 5EC1B 3U7AA 1UD2A 1DSFL 5CNHA 1QTYT 3AITA 5H94B 4L3ED 2H9GB 4UUJA 2OR7A 2KPNA 2J56A 5CEZH 4EXPX 1YECL 4JRXA 5DD0L 1EJ6A 1DDHB 1UT2A 4LLDB 4OCNC 3KEDA 1NGWA 1BVLB 2ZG1A 3H55A 1JVLA 4X5PA 4NKOB 1MHCB 5LKNA 1G7QB 2DM2A 3HMXL 1ROCA 3IJ8A 4HS8L 1X7TA 2ROXA 2WP3O 5G4MA 3GMMB 4R4BA 4YFEA 3M86A 3HAEA 1TETH 1WWAX 4Y4FD 5KS9E 3T4AC 1CYXA 2Z91A 1RJCA 2OMYB 4KO7A 4PJIE 2V7HA 1M1XB 1E6OH 2VH5H 3H4HA 4IHOB 4ALAC 1T3FB 4PW4A 4NWUL 3P77B 5I30H 1S7WA 1MFAL 5MEOB 4JANA 4UQBA 3KL5A 3IDMA 3TL5A 1F4AA 5IJDC 1AXTH 1VEOA 2EC8A 4UCFA 5DMGD 3MBEC 1J9CT 4DTGH 3IF1A 3L3KA 1U8HB 2NY3B 3ZY7A 3WN6A 4AIXA 5AYUH 1Z66A 5FWRA 2FH6A 2L8AA 3BISA 4IRZH 4JMXA 2NW3A 4WWKC 4Q4EA 1MCEA 3I2CL 1PX8A 3GXPA 4CDGC 2WZPA 2BFGA 1UCBL 3QISA 2B1OA 4OGYH 3T4YB 1WT5C 3CHOA 3O45B 2NQ3A 4P5RA 4TLUA 2F7IA 4H88H 3U30C 2ZUQC 1TTCA 1GAFL 4WU7B 1Z0NA 4CNIA 3QK0A 1AXIB 2ENPA 3ULUL 2IV8A 2P48B 1J86A 1BZEA 4PH8A 4HMEA 1NUNB 2XC8A 3UTSD 2AQPA 4PMFA 5T1LA 2D7TH 1XF3A 1QLRA 2XFGB 3O6LL 4NRYA 4LFHD 3TFBA 2LABA 3AY2A 3S4SA 1TVHA 2NDFA 3FHAA 4IJ3B 4NUGL 5LXVA 1O7DC 1N6QH 2ADIA 5KOVC 5J8OA 1EMTH 5FM4A 4AUYA 4TPRL 3GKWL 1A9BB 2D2CC 1IBGH 1A14L 2NNAB 5GSRB 4AZ8A 2ORBL 2VN4A 1SOQA 1V54B 2E6JA 3IBOA 4NNYA 2HH0H 3W56A 4PY8I 4NQXB 5L7XH 2IH9A 4QOKE 1I9IH 1V7NH 4FOMA 2XRAH 3L95A 4F92B 4BH8B 4TSCL 1Z3RA 1X5FA 5SWQA 3VMPA 3HOGA 5IJKA 2X40A 4LCUA 2PPCA 1C8PA 1ESOA 1QVOA 2UY6A 4LNRB 4RWYH 4YGAB 3AG1B 1A0QH 2DLEA 1Z3GL 3RTLA 3UBXB 4R2GD 4P46D 3PPEA 3TESA 3KBHE 2K3TA 1G43A 4GSUA 3B2MA 2OSLB 4I4WB 3ZRCC 2A5UA 1JZIA 2O6FA 3EJZC 4N2DA 4Z5RA 1YEHH 3PWUA 4PGEB 1B4RA 1PCXA 2YPKA 2CD0A 3WN5C 5JUEH 2QR0B 2X4SB 3ASWA 1H6FA 4IMLA 4LBAA 3QDGD 5JZ7C 1ZHKA 4KKBD 4DN3L 4FYQA 2D31B 4XP9H 5EUKA 3BVTA 4EVNB 3LCYA 1TTRA 4JQVC 1ZJBA 5D7KE 3HC0B 3P9LA 4WCYL 2B0SL 1I7UB 5EZJB 5J3HC 4QHKI 4M5YL 4QNPE 3ZDZF 1J05B 5HY9A 3D3VD 3GXFA 4TYUA 2NZ9C 3MROA 2WOBA 3EYFA 3WLWC 2WO3B 3KLHD 5ESAB 4EI6B 3QIUB 1S7XB 3GJFB 1LO4L 3HFMH 3HIZA 4POUB 4F7CA 3LZOA 3BLBA 3HPJB 3Q8CA 1A1NA 2BZDA 1X5KA 2OL3B 5HYQA 1UH3A 1F41A 4KDTA 1EJOL 3AFLA 3IKKA 3IGLA 2J1WA 2FQDA 4Y5XB 4AQZA 3EDJA 3CTTA 4HT1H 4NC2B 4N9OB 4RBPH 3RA7H 5ID0A 3ETBJ 2MHAB 5ESQA 4G1MB 1G7MB 3C8DA 1NCHA 3BQUD 1N8OE 3EH4B 4JJ5A 1G9NC 3X1FA 4F9PC 1AHKA 4NUJA 1UA6L 1CFSA 1BQRA 1Y6MR 2WVVA 2HT4C 4F8OA 4RGMB 5MERA 4MCYB 4N0UE 2DQMA 3HA0A 4WO0A 3U2SB 5IHWA 4RAUA 1WA0X 1AQMA 2NY7H 5JR1H 3AADB 3QQ9D 4C56B 4HGWB 5T3XL 4Q14A 4F7TA 1M6OB 3F85A 1IM3B 1SDDB 4JRFA 4ZW5A 5ICZB 1K6QH 4FQXB 2ZKYA 1IGJB 2QMKA 4R7NB 3UMNA 5F3BB 5DJYB 4FQQA 3MV8D 5HVHC 4RZCA 1NWPA 2YD4A 4QY8B 3MKKA 4ETQB 5F6HJ 2IC2A 2IADB 1XIWA 2LVEA 2NY2D 1JFHA 4DH2A 3UG5A 3CN2A 3INUH 3MV9E 1EZLA 1G1CA 2QVKA 3D2UB 3BVWA 3HZYA 3MNZB 1B6DA 2WBXA 1KZQA 1QSFA 3VFMA 5ABZA 1RQ5A 1M05B 4NPKA 5IJCC 4RBPK 2VO5A 3T2NH 2X4OA 4S1SH 1B90A 2X4TB 2JCCF 4PRBB 1Y6NR 4LRIA 2Y72A 2WUCL 5LAXA 2W94A 4L1HA 1DTUA 1HYRC 3R0MA 4F2MA 3WIHL 2VR5A 1PU0A 1AGFB 4PJ5A 5E23A 5K59F 3U6XS 3QORB 2AMGA 2I9LB 2NY0B 1GA2A 3T1FA 3NJKA 4AUJA 1EHLL 1G7PB 3OR7A 5CP3A 1U8OA 1N12A 1PLBA 1F1DA 5F7EL 3DSNB 1FE8L 1QRNA 2AXJA 2YPVA 4FI7A 2NRDA 4GAYA 1K8DB 4JE4B 2PNDA 1RJLB 3BVNB 3DMMC 4PI0A 4YC2B 3MJ9L 1BZ8A 2CWRA 2WZ6A 1N59B 5EC1A 2AGJH 3GLZA 3EOTH 1UG9A 5DT1L 5H94A 3N85H 3EJYD 2H9GA 5C2UB 1I1YB 5D7LE 4BCYA 4XBMA 1MVYA 2K4AA 1JUFB 1KEMH 3H42H 1B4LA 3PHSA 4XMVA 3SDXE 3Q7JA 1LEKB 5BO0D 4P48A 1DDHA 1N0XL 1J88A 4LLDA 1OIOA 3O8XD 1BVLA 1UD8A 4U1NB 1HHJB 3QEQB 2P8PB 1S5IH 4EQ2A 3ASOB 4NKOA 1MHCA 1G7QA 3BPNB 2K7QA 3UBXG 1FAIH 3D4CA 2C3XA 4B9JA 5HDQL 1BQHB 3FUKA 1NCAH 2X41A 4HIEB 3SJVE 3GMMA 1DN0B 1N7MH 2VXSH 3D4ZA 5E24E 4MCMA 2FJFB 3UGEA 2VYRE 1YMME 1NANH 1JGLL 4FLOA 1MCOL 4RDQF 4UZSA 4LGSB 1GHFH 1MHPH 2OMYA 1QFWH 3CBRA 1XH3B 1M1XA 3RGBA 3TN0D 4IHOA 1T3FA 4M1GL 4ZXBD 4G6ML 4M6ML 3TEZA 3V0WL 3P77A 1TQBC 1EZSA 1F3DJ 1PKQE 3QT2A 1MW0A 3AMKA 4MZRA 4Z0BH 5MEOA 2RD0A 4OGAC 4G7SB 4X8CA 2Z31B 4YUEL 3D6GA 2X44D 1U8HA 5D7IE 3L16A 4FQLH 4U7MA 2QQLH 3MDJA 4GQZA 3WFEL 5L8LB 1RFDL 3GBMH 4KO9A 3HTLX 3QJTB 1LO3H 2O5YL 5GRJH 3L3IA 4I1NB 3RJDA 1AZNA 3WNKA 1YY8B 1L4IA 3T4YA 3O45A 5HP5A 1Z5YD 3WTWA 4FXKC 3VWJB 4KXAA 4WU7A 4KRPB 1NDTA 5EF3A 3DKHA 2JI2A 4PJEF 4HWBA 1TNMA 4XAKE 3TU6A 2OMWB 2VLRB 3GRWA 4HEMA 1B0WA 2XBDA 3RTQB 4F5CE 3GXNA 4YSQA 4WK0B 1I3UA 1L0XA 2QGDA 5C0AE 2WXGA 3BSGA 1PQZB 5JIDA 4MXWH 2ZPKH 1A9BA 1GOGA 1PBYA 1THCA 5GSRA 2NNAA 1KN2L 4KJQD 4IK7A 3CQQA 2A2QT 4S1QH 3ARBB 2VXVL 3LMJH 1ZHLB 5M94B 3TOPA 3JTSB 3ZR6A 4BZYA 4NQXA 4KNSA 5E4EB 3M1OA 3ZXAC 4BH8A 2R1WB 1O6VA 1S3RA 1M3IA 2KUTA 1LO2L 2P43B 2XN0A 3HC3L 3N1PC 3VFPB 4LNRA 2WNGA 2ZYRA 43CAB 2GK2A 4GT7A 4HPYH 3UBXA 5F44A 1Q1PA 2C9QA 1WICA 5KG9B 4UT9A 2PXYB 4Z23A 4I4WA 2OSLA 2OS7A 4FAAB 3FK3A 3HG2A 4Q9RL 1AO7B 3H9HB 4PGEA 3IDIB 3ARQA 2Q87A 4HOWA 4UMSA 1IBHA 3IPBA 2QR0A 2X4SA 3QIWB 2VXTL 2J8UE 1XGYH 1TG8A 2C3GA 4HG4K 1QYGL 5ID1B 5LN4A 4FRWA 3DGGB 2EXTA 2D31A 4EVNA 1MJJB 1R46A 3HC0A 1CD9B 1OLZA 4HDIB 1PZSA 1I7UA 1JRHI 3ILEA 4PYGA 5EZJA 5K9JL 4Z7NE 1J05A 1R3JB 1UB6B 3BZFB 4W6XB 3FT4B 2WXHA 4ZAKD 1TZIB 1UZ8B 1JPST 4GMTH 4YE4H 2VDRL 5C0CD 5KTEL 5ESAA 4EI6A 3RKDD 3QIUA 4PUBL 2YPLE 3GJFA 1QI5A 4L3AA 3QPXH 3HPJA 2BM3A 4B97A 2DEXX 4F24A 2OL3A 3IWUA 4GKOA 2RHEA 1H5BC 2NOYA 2JLLA 1AKJB 1I8AA 2Q7NA 2VR7A 2NY4C 4O2CB 1IZKA 2R69L 4JM4L 2ZKHH 4Y5XA 1CE1L 3JWOL 1BQHG 1GSKA 1Q9WB 4BRVA 1L7TL 3LB6C 5AVWB 5IROD 3O4LD 2MHAA 5DS2A 4FJZA 2BHUA 5TE6H 3T0VA 5IJBC 4G1MA 4WSKA 4W6YB 2YGQA 4TNWK 1G7MA 1DSWA 3OPZH 4Y9GA 3QYCA 4ZT1A 1NH6A 1S9VB 4AJVA 4YAQB 2BNQE 3KPOB 4M7LL 3BD5A 5F7KC 5K1JA 2ZP8A 4MCYA 4KJPC 3JUYA 4FNTA 4M02A 2YZ8A 1J5DA 4X8XA 3U2SA 4ZMXA 5EO1B 4H5SB 3BLPX 1D6VL 1P4BL 4R9HA 1NCTA 5FYLH 1J1XL 3LKOB 2P24B 3ES6B 4GI9A 3QEGL 2NX5D 4HGWA 3C6LB 4C56A 4HU8A 1M4KA 5JPMC 5E6IB 1WV7T 1M6OA 1MFEL 4IBLT 1IM3A 1SDDA 4MMXB 5ICZA 2YKLH 3EFFB 4TS6A 4FQXA 3ZIYA 2Z4TA 4YDKH 1IGJA 4R7NA 2NYYD 3X11B 5F3BA 3QC5X 1IFGA 4I85A 5DJYA 4JFUA 4NJAL 3SO3B 4X6FB 2Y5TB 4HLZG 3NFSH 4A2MA 2ZOWA 4O02B 4QY8A 2BMKA 4ETQA 4MNQE 1AD9B 2IADA 3Q43A 1IB5A 4HIPA 3DGDA 1BOYA 2CG9X 3DK2A 3EJJX 2R4SL 1O0VA 3D2UA 3KVDD 3MNZA 5I74B 1OW0A 4TKWA 1MCWW 4BKLB 3QDJE 4K3HA 5D4HA 1FVEB 4GRLB 2CM6A 3MJ8B 1WE5A 5EIVA 3EG9B 1M05A 3ZYIA 1ZSDB 3WJJC 5BO1H 1JI1A 4ES8A 1AH1A 2JKLA 2X4TA 3TC9A 4PRBA 3Q8EA 2OP4H 2BJML 1Y1DA 4DN4H 4QOKB 1AGFA 3L9EA 3QORA 2I9LA 5AW4B 4A7TA 3KW8A 1G7PA 4NBZB 3VQMA 5FB8B 3DSNA 3TFKD 1J8SA 1K8DA 1RJLA 3BVNA 3TA3D 2NZ1A 1N59A 4LSSH 4MGXA 1NL0L 4B3EA 1I1YA 5GISL 1ETA1 2BFVL 1VFBB 3WIFB 1PLAA 2GUOB 3U0WH 1JUFA 1V3LA 5C8JB 4CUCA 4F57L 1LEKA 5C0RL 3HG5A 3VGEA 2CMRH 1I8UA 3FZUD 5F7HA 4U1NA 1HHJA 3QEQA 2P8PA 3NIDF 4IKJA 2NTSP 4LEEA 2X87A 4WENB 5CCKH 1EAJA 4F27A 1BQHA 5TQ0L 3AGVA 5L88L 3ZHNA 2WKLA 5I8EB 4HIEA 3ARGD 5TK2A 3ELAT 3VQLA 4C57C 1DN0A 2CJUL 2FJFA 2WUCH 1PDKB 2OYLA 2WJ7A 1DO6A 3IAQA 1SUHA 4P23C 2X1OA 6PAZA 3WELA 1IIKA 1A9VA 2DDQL 1W9XA 1KIQB 1XH3A 5IM7B 4DEUA 2CR6A 4EN3C 3CH1B 3DX4A 5F7EH 5DQJB 3L3OC 3ZMRA 3ETBF 4GJTB 4OKVB 4Z95L 3PV6B 3TWYA 1L0PA 4KI5C 5AAWA 3D18B 2RTTA 4PJFB 4KK8D 2Q7AA 3HMWL 3N06B 4B9CA 1E5ZA 4HC1A 2R2CA 4DKFH 3LEVL 2Z31A 5F97E 3PWPE 2OXGB 4J7RA 3E9UA 1LMIA 1KB5L 2WC7A 3O81A 2O4EA 1M2VB 3R4DA 1DYZA 5J12B 5CEYB 1NUFA 4H25B 4JDZB 1Q0EA 3O6FC 2BX5A 3K2UL 2O93L 3S3PA 3CVIL 5DQ9B 2QEJA 1YY8A 3QIBD 5KN5B 2WO4A 3NVQA 3RZCB 1OGAD 2DI8A 4FG6D 3R8QA 5CSGA 3VWJA 3W5MA 2FECL 2FHBA 3L7FB 4CVWA 4X99B 3S3JA 2E75C 1BQLH 4LP5A 5GGSB 1JTTA 4N8CH 2OMWA 2VLRA 2R83A 2ZXWB 1YQVL 3OKKB 3SQOH 3K6SB 4I3SH 4L05A 5E8OB 3RTQA 5I1JH 4WNSA 1YEKL 4CSZA 3VDCA 1P69B 1PQZA 2XHNA 5D6CB 3ENEA 3W3BA 3FOLB 1DCLA 4PJDF 5G5DB 4KVCH 1FI8C 2W1NA 3A6CH 4Z6AT 4X6DF 3IJSB 4Y19B 3SGDI 1MEXL 2RJMA 3ARBA 3KXFD 2EXYC 1VAHA 3IRPX 4N2LA 5DD6B 1ZHLA 4N68A 4MS8D 3JTSA 4C83B 1VESA 4MHHI 2AJSH 1GPOL 2R1WA 3K8LA 1ZV5A 2A6DB 1T2QL 2ESVE 3UL4A 3VFPA 5C08D 3ZHFA 4TOYL 43CAA 1HILB 2CBTA 3OKYA 5FPIA 3SE9L 5KG9A 4KFMA 2PXYA 4JN1H 1VPOL 1O7DE 3Q6GL 4QAWA 4WEEA 1YLBB 2RA1A 4OB5L 2OW7A 4W9DC 3OJMB 1AO7A 1KCRL 2P5PA 3H9HA 4G5ZH 3IDIA 1JXDA 5MHSE 1JYNA 3KZ8A 2XWDA 3QIWA 1BAFL 3LHAA 1QKZL 4H40A 4P04A 4R7LA 3VGAC 5ID1A 1GYUA 3DGGA 1S7QB 3JV4B 1U8IB 1MJJA 3FB8B 5HYIA 2V3DA 2VSCA 1UZ6F 5LJYH 3IGAB 4JRYB 4HDIA 1JCKA 1KZYA 4ANWA 2CKNA 1R3JA 1UB6A 3LRMA 3BZFA 3FT4A 3RUGE 1TZIA 2H6UA 4NN5C 5EBWB 1UZ8A 2DYSB 3B4NA 2E86A 1HHHB 3KS0H 5C0IB 3T8VA 3ULUF 3ESMA 3OB0H 2ZCLH 3DARA 5IW1B 3N42B 1N70A 4JGMA 3NH7L 2YWZA 4PPTA 2NLJB 5MI0C 1YG9A 3O6MH 3RGVD 3MLXH 1AKJA 4J4PC 4O2CA 3OMZA 1TTFA 1KFAL 1JZGA 3BGAA 4WWNA 3WS6C 1Q9WA 5D1ZI 4A37A 1EAPB 3FPXA 3OLIA 2AXFB 3O2DL 4M3JA 1MRCH 4UM8B 2ZAGA 5HDBE 4HBCH 4S0TD 3ZZQA 2KERA 3SPIA 4I7ZC 4WV1C 3DSFH 5DU7A 1DVFC 2EZ0D 5I18L 1IGCL 4LSRL 1S9VA 2XN2A 3W57A 2JTDA 1IE4A 1B9ZA 4YAQA 2EIBA 3KPOA 4H1LB 1S9KC 4YX2L 3GXTA 5FCSH 5LCVA 1NBVL 2F0CA 1YAIA 1WCBB 3WO4C 5EO1A 4H5SA 1YNTF 1BFVH 4APQD 2QQNH 3LKOA 4XNYH 4BQCA 3QZWB 2P24A 4P5TC 3ES6A 1IFRA 3C6LA 4R97B 3ZT7A 3LZFL 4JG0L 1KC5L 1FDLL 4HK3N 5E6IA 4AYDC 2XYCA 4FFZH 4XRCB 3WFDL 4MMXA 3EFFA 2WXFA 3B37A 3GK8H 2BVYA 3X11A 1JOIA 4RSVA 4X6FA 2IANE 2Y5TA 4YBLB 5CZVH 1XTMA 1NDMB 4O02A 4LLAA 2NQCA 1AD9A 1B0IA 1SOXA 4MYPA 2ZUTA 1E4XH 3SGJC 1WC7B 3R4RA 4BZ2A 1KTCA 1TOXA 1ZLEA 2EVHA 2COVD 2ARJB 4BKLA 4JFEB 4AI7A 3O3BB 1DANT 3E7JA 3S3BB 3PV7A 1FVEA 4GRLA 4R8WH 2F8IA 3MJ8A 3TS8A 2HZHA 5TE4H 3HZVB 4M43H 3EG9A 3ZYOA 4HX1B 3AXLB 3N55A 1DP0A 1ZSDA 1NGPH 5I1GL 3ZLQC 4W9KC 1FHNA 5KOMC 5E5MB 1RMFH 4Z7UF 2JJSC 5DMGC 4YDZA 4TRPH 5EORH 1Z5HA 4HIJB 4QOKA 4OLXH 5F7AA 4PY8J 2LAGB 1WZLA 2HRPH 5J06A 3PDGA 1JVKA 3HRZB 1IAIL 5FB8A 4X7SL 1OZUA 2XQYK 5DXWA 1WFIA 5F9DC 4F58L 4M6OH 1OSPL 1EGJA 2Z65C 4PJ7B 3F7VB 3VDAA 1K2DB 1USZA 3U9WA 5A2BA 2F5BL 3ZE1E 4GOSA 2CK2A 5IOKA 3TJHD 1OCOB 1VFBA 3WIFA 3TO4B 2GUOA 5IVZB 2VWEC 5C8JA 1NTDA 1F4XL 3BN9D 4GMSL 3S35L 5LNGA 1X5YA 1XX9C 2ENQA 3F3HA 3CFTA 1NOLA 3ALWA 3R18A 1BVKB 3MRJB 5SWZD 5D7HA 1E6JH 5HI4D 4P8QA 3D34A 3QBTB 1RZFH 1CXHA 5T1MB 1KCKA 1KCBA 2B4CC 4G7QB 5I8EA 1OAXH 5EOQL 3IFLH 3MJWA 1PDKA 5AB1A 4ZMVA 4BKSC 3CSFA 4TVSa 3VXSD 3QPQC 2RQEA 3BAXA 3U6RB 1OVZA 3K72B 4FQJH 5HD8D 2BNRD 2VDPB 3WL9B 1KIQA 5IM7A 1T0NB 5I6MA 3CH1A 5HHOD 2DZEA 2KMWA 5DQJA 5DK0B 1ANUA 3ATAA 5E8DH 4OKVA 2P42B 5GRVL 3PV6A 4NIYE 5J1AB 3FUEA 3D18A 3QUHA 1U6AH 4PJFA 4ZO6A 1VFOA 4JPVL 2BFVH 1DUZB 4X4ME 4YVNA 5C3IA 4URTB 5E2TH 2OXGA 2HT2C 3UCQA 3GHBL 4LKCB 4IRSB 4KJWC 4B9PA 1M2VA 4XO8A 1KCVL 1M9SA 5CEYA 4H25A 1TQWA 4JDZA 4OLEA 5D1QD 3O41A 1LE9B 1FL6B 2DD8L 1XCWA 4K23H 1JN6B 3Q3GB 5DQ9A 5F0JB 5H37H 5CCHE 4BDVB 3I50H 5KN5A 3NCWA 2GPZA 5L88H 4JGNA 2F74B 3RZCA 3VXUE 4KZEL 2FJSA 4FLRA 4RVBA 4TVUA 5DLMH 3L7FA 4X99A 1WK0A 1JRHL 3EDFA 5B1AB 1WF5A 5GGSA 4M4PA 3A4FA 1E5YA 1RIHL 5I9QB 3K6SA 4UB0L 3OKKA 3NJNA 3VG0H 1I3RB 4ZTOL 4H1LG 3UEZA 4HOMA 1C16B 2K70A 3LTVA 3P3RA 4OZ4B 5E8OA 3J8F7 3UIZA 1U36A 1YEFL 1T1ZB 4JQXA 1SPDA 5D6CA 3VW3L 3BGMB 3AXIA 4H44C 3APNA 3LEVH 3TV3L 3FOLA 4L1LA 5IEKB 4NFCA 3BXNB 3QZWG 3LY6A 4F15B 5G5DA 5FR3A 2X4UB 3P3TA 1R34A 4Y19A 3IJSA 3NSCA 1U8PB 4OV5B 1KMGA 5K93A 3SN6N 5DD6A 1IC1A 2C9RA 1IVLA 4C83A 5CN3A 3QDJB 5IMLB 4WHTB 1KTJA 4G9DB 4WI3A 2JI3A 3S35X 1MKFA 4LSUL 5E9DD 2A6DA 3F62A 5ABAA 1NFAA 3DTDA 3GNML 1HILA 2JIXB 3X3GL 1XEDA 1VRSA 2XV2A 2A6JB 2EDYA 2W9LA 4JKKA 4LSTL 4KVNL 3PWNB 4PAZA 3HR6A 3GJEB 3S2AA 2J6EL 4JRWA 4PJBE 2RALA 3QQ9C 3N9GH 4XODA 2ENYA 3BZ4B 4S11A 5L2JB 1MH5B 1EV2E 3NDZE 4S1RL 4DQOH 1ZLUH 5KYUA 3O6KL 2DH2A 2O5XH 1XB6A 1DJSA 2OTUB 1CD1B 5SWSD 2IH1B 1S7QA 3JV4A 1U8IA 3FB8A 2AK4B 1UWEL 4I2XB 4KKLC 4YDLC 4ZI8A 2RB8A 5AZEL 3AXHA 3IGAA 4JRYA 4HWEL 1WYJA 4OD1L 4YBQD 2NY2C 1SOKA 5BS0B 1T2XA 4FF9A 1SMDA 5FYLE 2YD6A 5EBWA 1JJUA 2E47A 1HHHA 5C0IA 1FUNA 3OLEA 1Q72L 4RWHA 2YS4A 3A4DA 1E43A 1GJUA 2I24N 5IW1A 2LW3A 4NO0D 5I6XB 2TSAA 2WCPA 4D8PB 2KYIA 5HGBB 3LD8C 2NLJA 3MFGB 1RURL 2R0ZL 1DHKA 2D03L 4Z7QF 1VZHA 4OB5H 3BVXA 4MA1B 4PS8A 3ARTA 2C4FU 3LV3B 1EAPA 4G7VH 5DWUH 2AXFA 4UM8A 5HHNB 4GXUN 3TNNB 4JRLA 2IPUK 5ITFB 3BKML 3EF7A 1WG3A 5HI3D 4PJHF 2F18A 2X28A 4IOIB 1PZAA 1G6VK 3OZLA 3H9YA 4H1LA 4U2YA 4XGZB 4ZNEE 3T2PA 4MZ2A 3OWRA 6TAAA 1WCBA 2AABH 2IBGA 2WLKA 5DLLA 1ND0B 3P0VL 5HDOA 3WG7B 1IMHC 2APSA 4DCQB 4YEFA 3SE8L 3QZWA 2XVKA 1WISA 2RR3A 3QXDB 4Q6IC 4R7VA 5LB1A 3BKJH 4L0PB 4XRCA 1QSEB 1ZPLA 5JXEA 1OCWL 1PSKH 3PXHA 2ODIA 2X9ZA 5E8PB 3P2BA 1WQVT 2E9JA 1MW2A 4IOSA 1NDMA 5D8JL 2DQDL 2PPFA 1J8KA 2PP7A 1NINA 3R1GL 5LQBL 1I1FB 1V7ML 1YNKL 2FDBP 3SOBH 4KZDL 1WC7A 5HGGS 3A67L 2LFGA 2ARJA 1BEXA 5JTWA 4JFEA 2VDQL 3O3BA 1XMEB 3LPOA 3QDMB 5ENWB 1DJWA 3BMWA 3HZVA 3R7QA 4HX1A 1X5LA 3AXLA 4WWKB 1PJWA 4LHUB 1Q9KB 2IGFL 3MBXH 4OH2A 5E5MA 2XA8H 2N0KA 3ZKXB 4XMLL 5JHLH 2JB5H 5LWYL 4PGBB 1CR9H 4AIOA 3O0LA 3OZKA 4HIJA 2NY5L 4EMZA 5ALBH 1UJ3B 4O51B 4OCXL 1NBYB 2ADFH 3HRZA 1K9TA 5DJZB 4JFQB 5LUMA 2NXYD 3SE4C 2GSGB 4GAFB 1SQ2N 1OWWA 3L5JA 4PJ7A 3SY0B 1C8QA 4BK4A 3F7VA 3TZVB 2PCFB 1K2DA 4HIIB 4AW7A 5T1JA 3BIAX 3TO4A 1T89A 5IVZA 2AEQL 1CGYA 1T1YB 4OCYH 1C5DB 3O11B 5AWNH 2H5UA 1H8NA 2VITB 3N3EA 3L81A 1G7HB 3WSQH 3E8UL 4EOWH 4PRIE 4IKNA 2FQGA 1BVKA 3MRJA 4Y89A 2IWKA 1ZAGA 5C70A 4JG1L 1AZZC 5T1MA 2ROYA 1JGEB 3FFDB 5HDLA 3WTVA 4RGND 1U8JB 2H47C 2DLGA 2WO2B 1KPVB 4Y4KB 3U6RA 3K72A 3EXLA 2R8SL 3UJTH 3WL9A 5E2VH 4PLKC 5INCB 1JMZA 1T0NA 4G7RB 4K9EL 1LMKA 4QHLB 4HJ0D 2A1WH 3O9WC 4WO4C 5DK0A 1PS3A 1TCRB 1SN0A 4NKQB 2GT9B 4LE8A 4JFPB 1YEGH 5J1AA 1OSPH 4AYMC 4CU7A 1SOSA 3FO2B 2CCWA 3HW7A 3LEYH 4BQ8A 1EFXD 1DUZA 2DBLL 5K1VA 1FRGH 3MA9H 4M7LT 5JOEA 3Q06A 1SXNA 4X6CF 1ZLWH 3V8CA 1EZUA 4Q9QL 2VRAA 4IRSA 4LKCA 4NQDE 3RFZB 3ZKQD 1FG2B 3WDIA 2Z8SA 2NY1C 1AHMA 4JRXD 4YHKH 5L4FA 1UD3A 3BPLB 3F7KA 3RWEB 2X6VA 4KRMB 3BUBA 1LE9A 1FL6A 4BDVA 1J9SA 1JN6A 3Q3GA 4NCC2 1R1CA 3ZUCA 1B88A 4BQBA 2F74A 4LCCB 3LKPB 5D5MB 2KT6A 2BPBA 4BXSV 2M8XA 5G4NA 3SDDB 4XMUA 5MP6H 5J6HB 1NDGB 4FTVD 1YDPB 1WD9A 3UYOD 3UTOA 1ACYL 3NJFA 3EIFA 1UATA 5DD1L 1WRFA 3KPTA 4HUCA 1AD0B 2B16A 2ZYHA 4K3JH 4KI5E 5BV7H 1I3RA 2E27H 4I3RH 4DPBX 1FZJB 1C16A 3ZZ1A 4OZ4A 4AYID 1GGIH 3QZMA 1ET5A 5HHVL 1XD0A 3AT8A 1T1ZA 1AFVL 2OJEB 4JPVH 4XMPL 3BGMA 5L4JA 2X9YA 4RZKA 2IMMA 4J3WA 3UP1A 5IEKA 3BXNA 2DV6A 2X4UA 3F04A 1CLVA 5FUOL 2PR4H 4J3VA 1U8PA 4XN8A 4OV5A 2XZQH 1NLDL 2HTLD 1J5IA 1QD0A 2JQMA 4OSUL 2PABA 3AQYA 4U1MB 5FGBA 3N5AA 5AVSB 4DVBB 2F5AL 3QDJA 5IMLA 1MSPA 4WHTA 4I18C 4P0DA 1FH5H 3A6BH 4G9DA 1HJCA 3ZT6A 4NZRL 3VRLE 3TH2T 4F8TA 4XAWH 2X1WL 3S88L 4DAGL 4YSPA 2WM0A 2JIXA 1I1AD 5D7JC 3RY4A 2V3FA 2WBKA 2R2EB 2A6JA 5GZNC 1OD7A 4MXVF 5CBAB 1N4XL 3PWNA 5HVHB 3GJEA 1U95B 1REIA 4LHUG 4XHQA 1J1PH 4PJ6A 3DYOA 2Y06H 3AT0A 4BBWA 2EH7L 3MO1B 3SKJH 1RK1B 4YZFE 3BZ4A 5L2JA 5KJRH 4AGOA 1MH5A 5C7ZA 2D7QA 2F61A 5E4IA 3UACA 4XZUB 3ZE1B 2C26A 2OTUA 1CD1A 5FA4B 2IH1A 3FSAA 4OT1H 4XTRD 2AK4A 4I2XA 1USQA 3RPKA 3KE0A 4BZ1L 4RFOL 4ZS7L 2ZJSH 4E5XG 1OHZA 3V7MA 2YAMA 5FCUL 5BS0A 4IRZA 3HPLB 2R29H 4F2FA 1MY5A 4LSUH 3JV6B 1KIRB 2VB5A 1S5HB 3CXDH 3JZYA 1GZHC 3PIQB 4D8PA 3CN1A 5HGBA 3PP3H 4QO1B 1Q1JH 4KUCF 4Q6KA 4LK4A 4P5KB 1JZDC 5D71H 4DZ8B 5A2IH 4W4OC 4M93B 2IPTL 5I0XA 1B4JL 2WANA 3LV3A 4XC1L 3QFJB 5HHNA 4ENED 3RHWK 3H54A 3FB5B 3TNNA 2N7SA 3FH7A 2FX7H 5ITFA 2XPZA 2NW2B 4DVRL 3K0WA 2WAHA 2YEZB 4GG6B 4AXWB 2ZX5A 4GS7C 5FYJD 4IOIA 1EHKB 3WEOA 3GHEH 1A47A 4FNPA 4XGZA 4O9HL 4AG4L 2JKWA 4HWEH 3Q5YA 1RUMH 2HSIA 2OTWB 1ND0A 2JJTA 3HBQA 4OCRH 5CU9A 4DCQA 4OZHF 1XCQB 3TURA 3QXDA 1XSJA 2DQTH 2WTPA 3B7TA 4AL8C 4LOVA 4NZTL 1QSEA 4N8UA 1TJHH 4XP6L 5C07E 3TBVB 3V5KB 4F7EB 4RA0C 5E8PA 3EOBB 5I75C 1TQBB 1G1YA 2VDKH 1GC1C 1MAMH 4QGTA 5KSBF 1BQSA 1LNUB 2WLYA 1E65A 1UD6A 3ZR5A 2WHVA 3H56A 1I1FA 2XWJB 3LRHA 4HPOL 5E70A 3L17A 4DP7X 3CZSA 3LH9A 4PP2B 4M6NH 4HUUB 2Q3AA 5TDPB 2DQIL 3SQRA 1NGYB 2E3VA 3TBCA 2XTJC 3R0NA 3QDMA 5ENWA 3CC5B 4E42B 5HJDA 4WWKA 1CF8H 4LHUA 1Q9KA 4JQIL 1YEJL 1FBIL 2GITB 5CSBA 1WT5A 2MNUA 2HJLB 2EECA 3SE8H 1NCBL 4PGBA 1RP8A 4ZZFA 3CGTA 4FZEL 5DVOA 4FXKB 5IBUB 1ZTXE 5KZCD 4FDWA 1W15A 3VYNA 2NXZB 4MCZB 1UJ3A 4O51A 1FNSL 1NBYA 1XB3A 4YDIH 5DJZA 4JFQA 5EA0H 2WWMC 2GSGA 1N6VA 4V11A 4XCCH 4Y2LA 5EHFA 2APTA 3EF4A 3IDYC 3SY0A 4LVOC 5I5JA 2PCFA 3TZVA 1XAKA 2CDFB 2EIMB 4HIIA 5F9OH 3RAJL 3TWCL 3NSFA 3KEHA 1DQIA 3GTTA 1U42A 3K5SA 2MPAH 1XWVA 2UX6A 3KWVA 2WQAA 4ZFGL 1T1YA 3EOYG 1C5DA 1GYWA 1L3NA 3O11A 4OF3A 5HPMB 1AMYA 4JR9L 4GIPD 2VITA 4ELDA 1G7HA 1AZVA 1OXYA 5E99L 3QZLA 2J4WH 1DFBH 3AM8A 4IGBC 4L0ZA 3KYOB 2F1BA 2HFGH 4BFBD 3LIZL 4MDJB 3AY4A 2A6IB 4MB3A 1IAIM 2DIBA 4LCIL 3I3DA 2DF3A 2WLHA 1QSFD 1AQHA 1JGEA 2D3JA 3FFDA 3KJ4C 1OPOA 5I0YA 4KPHH 1SRDA 3E6FB 5GGRB 1U8JA 3LHPH 1KPVA 4Y4KA 3IM1A 1MCSA 2B2XL 5BUPA 2PPDA 5INCA 2GEQA 4PRPE 1A25A 4QHLA 2VDOH 3QNXB 2J5WA 2XZAL 3MRFB 3PAUA 3Q1SL 5LBSL 1TCRA 3KM2A 2GT9A 1V3KA 1SQMA 4JFPA 3V4UH 3FO2A 2VWEE 2V0AA 3OXRB 4R0LB 3UZEA 2DWXA 1N0LB 3DX0A 1P4IH 3MAWA 4AT6B 4KAQL 4R96B 4EBQH 1CU4L 1WFNA 4ODSH 1URLA 1YUHB 1RZKC 3RFZA 4E9XA 3D7PA 1FG2A 3LPGA 5AOKA 4JFFD 3PJNA 2DY2A 3U9PH 4GUOA 2IWGA 3RWEA 1XGZA 4JQVA 3BSHA 4P2AA 3U83A 4HIQA 5JHDD 4HS3B 1ITBB 3CDGB 3LKPA 4LCCA 4QTIH 5D5MA 2VLJE 4RCAA 3ARFB 1BAGA 3SDDA 5J6HA 1NDGA 1YDPA 1RD6A 5ETUB 1N67A 1ZA6B 3JWDC 1QACA 4XN4A 4D0DB 3EO0B 1AD0A 2EKSB 2DQHL 4HGMA 2HCZX 2FT6A 4NZFA 4B7IA 2GTZB 1FZJA 1FNHA 3OF6A 4KKCD 5D7SL 5AVYB 3QUXB 5I1IL 5KVFE 2OJEA 4HOZA 4QXGL 5LDSA 1NZRA 4OF7A 1SJEB 4HLEA 4PSRA 2EDTA 1IO4C 1BD2E 2FD6H 3L54A 1E2ZA 1JDAA 5A2LH 1T1XB 1V3JA 1JPGB 3VG9C 1TXKA 4UV7H 4QRRD 1T7WA 2NY3D 4U1MA 4L8DB 5AL8A 2WKGA 4DVBA 3VTAA 1PY0A 3SPJA 2P80D 1U3JA 1TQSA 2IEPA 3QUML 4XHJD 1A3RL 1ZVHA 1J8HB 4XVUD 2IAMB 3PQYE 5BJTB 1OF0A 3GXIA 1WS7A 2WXMA 3NRPA 3T6WA 2OR9H 2R2EA 1CLYH 3F6LA 1Q9OB 4PCKA 3K2MC 5DUJA 4HF5H 3H7LA 5CBAA 4YLCA 5I1AB 1U95A 3OPUA 1EIBA 1RZKH 2ZAIA 3MO1A 4N2KA 4HHWA 1RK1A 5D9SB 4NQEB 4UT6H 9CGTA 4ZPTB 3W82A 2WXLA 2X38A 3LS4L 3S48A 4XZUA 5IBUG 3OG6B 3QB7C 5FA4A 4LAQH 4K5LA 4NWTH 3TIDB 2N1KA 4U49A 2YD7A 4JMNA 2A74C 2N01B 3B56A 1AIZA 3X3FL 4JHAH 1CJYA 5TE7H 2DQFB 4JUTA 3ZO0A 4PRIB 3HPLA 3DX6B 3FRUB 2C9XA 5DUPH 3V0GA 4Y0GA 5FUZH 4ZMLA 3JV6A 1LO5B 2EE0A 3EBGA 4JFOB 1KIRA 5GGVL 1S5HA 1WHPA 1CIUA 1J0YA 3W2DH 3PIQA 4S1DC 5CS7A 5JOPE 4N0YL 1E2WA 4QO1A 3V95A 1KGWA 1GVIA 4P5KA 4DZ8A 1KDIA 2ALAA 1L9RA 4ONFL 1J1OH 2CU9A 5IBLC 1P5UB 2J88H 1EBAA 3QFJA 1FCGA 3MCLH 3FB5A 4N90E 3L3GB 3L2NA 2CUMA 3VMNA 3UPAA 3NFPB 4U6VL 2NW2A 5EBMB 5JXAL 2YEZA 3GSVB 3BYYA 4GG6A 1G4MA 2DTML 4AXWA 4POYA 4JY5H 2K4WA 4DZBB 2VXUH 4M61B 1YC7A 3UC0L 5FWQA 2BXZA 1UH2A 2BVEA 1AP2B 3BIBX 5F2FA 2OTWA 1YPZF 3CN3A 1NCCL 1IAOB 2CCLA 3D9AH 4XB3A 1XCQA 4NN6C 5IGXL 4P23B 2OV0A 2X9XA 1CDJA 4YE0A 3RIAK 2NSXA 1BAWA 4ONHB 1GGUA 3TBVA 4U6HB 3V5KA 4M8QA 4EN3B 4F7EA 1Q4NX 3D06A 3EOBA 5DFVD 4X4YB 2HPTA 2ZWZA 4TVPL 4OFYD 1IVTA 1P4LB 3ZDZE 5E08L 1LNUA 2XY1A 4X42A 5FW7A 4F8QA 2XWJA 2KPWA 1VACB 3FT1A 4PB0H 4PJGF 3TLRA 1F90L 2BVPB 4PP2A 4HUUA 3Q05A 5TDPA 3HLKA 3VGDA 4NNXB 1INEH 3W0WB 1NGYA 2VDNL 4DNLA 3CC5A 4RA3A 2GI0A 2XYBA 4M1CD 1EJFA 4E42A 4HU2A 5F9JB 1CDHA 3BH8B 4P2QD 4LSVL 1LYQA 2EIDA 3WHE1 2GITA 4MMYB 1B2WH 1NC4B 1WZAA 2WIIB 2HJLA 3PAVA 3TTYA 3TEYA 3I9PA 3OD3A 4FXKA 3ZKNC 1EUTA 4IKKA 4MCZA 5E9NA 2ARWA 4WY7H 3IU4L 4NHCH 3U4EB 1MIEL 1DJGA 4C56D 5CWSB 4OFKA 4C4KT 3N0AA 4D9RD 4D9LH 1MFBL 5EUOF 1BZ9B 4I87A 2B1HL 4A04A 1FA4A 2XFXB 5EWIH 1BYNA 4WTZA 3PP4L 1HU8A 5E2JA 2BSBA 4TL4A 5BW7C 3VD9A 1DQDH 5HPMA 3CLEH 2Y2WA 1DJHA 1FN4B 2IDCA 1H8LA 5CGYC 1DBBH 3FOMB 1E40A 1N18A 1CICB 3GPEA 3KYOA 5LGYA 4DKDC 1A66A 4JS7A 1AQKH 4LEXH 4MDJA 2A6IA 3WKMH 1IC5H 3U36B 1WPCA 2YXMA 4I77H 5E0FA 3SDCC 3E6FA 5GGRA 4L2YA 4KROC 5ADOH 5DHEA 2W0FB 1ZXKA 3BIKB 3UYRL 1A7QH 1HAWA 5B8CC 4D9QD 3WAJA 2VLKB 3QNXA 3MRFA 3HNSL 2JB6B 1CDCA 2KKQA 4Q9BA 3F84A 3UG4A 4XPBH 5EN3A 4GIAA 1OM3H 2CR3A 4Z3EA 2CK0L 3EGDB 1YY9C 3I6LD 2WMPB 2ZCKH 4L4VE 3OXRA 3HZ3A 1JPTL 1U2YA 3PGDB 4R0LA 4AT6A 1N0LA 1S46A 4YLBA 1TEFA 1T83C 2JCCE 2XQBL 4HUVB 4PJ8C 4R96A 5GJSL 4QYOB 1YUHA 5IQ9B 3B2VL 2YAHA 5BCAA 4OUOA 1TO5A 3MA7B 5I6OA 5BRZE 4I8DA 4O4YL 1UACH 4PRNB 2JKXA 2IXQB 5IHLB 3ATDA 1KGXA 1AI1H 1JFQL 2BZ7A 2D73A 4HS3A 4R90H 3SYQA 1M42A 3CDGA 3BWSA 3OVUB 4UIKH 8CGTA 3K2KA 3ARFA 1KCUL 4XPTL 4G6AC 5D70H 5ICYB 5EIQA 3FUFA 1TEYA 1R5IB 2NT1A 5ETUA 1ZA6A 4QRBA 4D0DA 3EO0A 2EKSA 3GSQB 2DYPD 4GQPH 4GQRA 4Y16D 4MWFB 2GTZA 2P5EB 2C7UB 4WHYH 3WOVA 5J1SC 3HC4L 2F54B 2HFTA 3QUXA 4GXVH 2QQKL 3KR3H 4B9FA 4EI5D 4EZLA 3P0GB 3H3PL 4M9OA 4WGVB 1SJEA 3T3MF 3MLUH 3G6AB 3FONB 3MRIB 2FYYB 1T1XA 4WV1B 5DJ8B 1IKFL 1JV5B 3LVTA 4HETA 1JPGA 5LGHL 4HWNA 1I3GH 1RZPA 1YYML 2N59A 4L8DA 1W6LA 4P5MB 5DUBB 1S9WB 4DGVH 2ED9A 3C60D 4L3EB 4X2UA 3BRDA 3WFZA 5IW3A 4PD4J 4LIQH 3VWKC 4N5ED 1NCWL 4QXWA 1HH6B 4LARH 5EF0A 2NYZA 5DMIL 1J8HA 3LAFA 4OIBA 4PLJC 2IAMA 4X9HA 3X1BA 5DRZB 4LCWE 4PYHA 5BJTA 4PJIF 2DQHH 2XZCH 1FLTX 1Q9OA 2OTPA 5T33H 2K1MA 3I6GB 5I1AA 4HEPG 1TZAA 4BA0A 3V6ZB 5DHDA 2DL2A 4LASL 1TEGA 5D9SA 4NQEA 3RTQD 2VZVA 1Y07A 4OZGF 4ZPTA 3NAAH 5DZAA 1GGCL 1AOHA 3D30A 3W11C 5D1XC 1IQDB 1KENH 1NBCA 3CK0L 3FCSB 3S8WA 2X6CA 4PJEE 2FB4H 3TIDA 1HOEA 4ZFOB 4ZO8A 3WUZA 4OD3H 4XNBA 4IHBA 2JE8A 1ZPUA 3NCJL 4UQEA 3RJQB 3JVFC 2DQFA 3E8VA 2BCMA 3ARBD 3K46A 4W1TA 3SGEH 4PRIA 3WXWL 3DX6A 3FRUA 1L9MA 2XICA 4XCFL 1LO5A 4JFOA 2LU4A 4DP6X 1X6NA 2FGWH 3JYCA 2EILB 1NA8A 2WBJD 3S5ZA 5FYKH 3RYMA 3ZE0B 1A1OB 2VKWA 3FCBA 4P3DB 5GPRA 1IE5A 3FUJA 4GLRI 4XCEB 3B7YA 4ZSOE 4HKJB 2A9ML 3SHSA 1LQSR 1EH9A 1F4WH 3C5ZC 4YSTA 1KIPB 2JNZA 3AU1B 4E9SA 4FKKA 1P5UA 4ZUTB 5H35B 4A2HA 4FQ2L 4OIAA 5JQHC 3L3GA 1A7NH 3FTGB 3GMNB 1P7QD 3NFPA 1AO7D 4OLYL 5EBMA 3U4BL 3GSVA 5E2WL 5KWYC 4K7FB 3UTSB 4FZ8L 1PG7X 1CXKA 3SB3A 3QIWD 4Q0XL 4L1BA 4DZBA 4PBWD 4DEWA 4M61A 2YC1B 3WCYA 4FFWD 1T2JA 4MQSB 4NKMB 5CP7B 3X3FH 1BPVA 1E5AA 1PZ2A 1AP2A 1XQ4A 3ISRA 4B96A 4FE9A 4FFYH 5C09E 3CFBB 1IAOA 5T1DH 2Z4QB 4WGKA 4P23A 3P2DA 4ES9A 3WNJA 2VDML 3EUUA 1TJGH 4ONHA 3QYNA 4U6HA 2VABB 4EN3A 3GZOA 3K4DA 2HVJB 4KK6D 4X4YA 4P3WA 3ZL4L 3MRBB 1P4LA 4ODHH 4PRAB 4GH7B 1ZWIB 3B34A 4QRPE 4Y4HC 5FGCB 1VACA 3QUYA 1WFMA 4FNQA 1OAKL 2BVPA 4KXBA 1BCIA 1EK3A 1WFJA 1E9PB 2H1PL 4LPCA 4NNXA 3W0WA 4R2GB 5JNYB 3M8OH 4P46B 5IWLC 1TYRA 4PBDA 4ZDHB 5F9JA 2JI1A 4M8RA 3L1EA 3BH8A 1HXMB 2KBGA 4MMYA 1QEWB 2J12B 1NC4A 4GAJH 2WIIA 2I25N 3O2VL 4ZJ9A 5DEGB 1E9OB 2VC2L 4NPJA 1C5CL 1OCCB 2C3HA 2KI6A 3QRLA 5DDHB 4OJYA 3ZSTA 3H6JA 3U4EA 1FNEB 2W81C 2A77L 3C6LD 3OLDA 3QJZA 2VSKB 5CWSA 4KMTL 2DQUL 1BZ9A 4RISL 2YN3A 3D3VB 4GRWB 2OCCB 2XFXA 3NGBC 4L9LC 1I82A 4JO3L 1JZ7A 1KYUA 3VI3F 1SVZA 1OTSD 2XTJE 1F90H 2JJVA 5IFAH 1FN4A 4ZOBA 3UTTE 3F7PC 3FOMA 4NQTA 1TZ8A 2H3NB 1Q8MA 1WCQA 2YPVL 3CJJA 2OBGA 1CICA 4JKPH 4J3XA 5GGTH 4ANXA 3P69A 2HG5B 3U36A 2TAAA 4XNXL 2QTVA 4WDIB 5D1ZD 2P8LB 4QHMB 4DPCX 1DQLH 4WEBL 4N1EA 5B3SB 1CIDA 3BQUB 1AHWC 3H6AA 2Y07L 4MLSA 2W0FA 4AC4A 3BIKA 5I1LB 3GKZA 5FGSA 1NEZB 4WW2B 2VDLH 4FMFA 4HXBH 2VLKA 1WAPA 1MQKL 1Z9LA 2JB6A 4GBXC 4IBTA 4QOKD 1CFVH 1TSRA 5B22A 3AAZB 2B1HH 1JWMB 3EGDA 4FFZA 2WMPA 4YK4C 4UT7H 4Q97A 2B3IA 3PGDA 1GIGL 2MQ3A 3D69B 1CGWA 1UKSA 3QRBA 2YD9A 2Y1ZA 3CUPB 1F8TH 3L5WB 4Y5VC 4ZMWA 4HUVA 1XGRB 4K71B 4QYOA 1QTPA 4YSDA 2R69A 2DW5A 1UWXH 3ECQA