2GBUA

C6a/c111a/c57a/c146a apo cuzn superoxide dismutase
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
153
structure length
153
Chain Sequence
ATKAVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGATSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHAIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLAAGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Coupling between Disulphide Status, Metallation and Dimer Interface Strength in Cu/Zn Superoxide Dismutase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Cu-Zn]
total genus 32
structure length 153
sequence length 153
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2006-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2gbuA00
1BZOA 3GZPA 4BCYA 1OALA 2AEOA 2WWOA 1DSWA 1L3NA 3GQFA 1RK7A 3ECWA 5CU9A 2WZ5A 2C9UA 4B3EA 2LU5A 1IBDA 3QQDB 1F1DA 1OZTG 1UXMA 3KH3A 4A7GA 1OZUA 3PU7A 2Z7ZA 4N3UA 2AF2A 2Q2LA 3F7LA 2WZ6A 1FUNA 3L9EA 1B4TA 4FF9A 1SOSA 1E9PB 1SDAB 1F18A 1F1GA 1KMGA 1SXZA 3F7KA 1SRDA 3LTVA 1EJ8A 1IBFA 1U3NA 2WKOF 2AQTA 5KBMA 2C9SA 4N3TA 1SXSA 2XJKA 4A7UA 4L05A 1COBA 2APSA 3HW7A 1SXCA 2XJLA 2AQNA 3MKGA 1YSOA 1PU0A 4U4IA 1HL5A 3CQQA 3GZQA 4OH2A 2GBTA 1N18A 2VR8A 3HFFA 2JCWA 1SXNA 2VR6A 3H2QA 3HOGA 1EQWA 1P1VA 4A7GF 3QQDA 2GBVA 1SDYA 2AQPA 1SXBA 2AQQA 1OAJA 1BA9A 1XTLA 1OEZW 2E47A 1PTZA 1N19A 1YAZA 2ZKWA 1SPDA 4BD4A 2ZKYA 1QUPA 3H2PA 4A7SA 4MCNA 3KH4A 1Z9PA 1AZVA 2GBUA 1HL4A 2K4WA 2ZOWA 5KBKA 2WYTA 2E46A 4MCMA 1E9OB 2SODB 2V0AA 1TO5A 3GZOA 1CB4A 4A7QA 3GTVA 1F1AA 2NNXA 2WWNA 1E9PA 1Q0EA 2ZKXA 3KM2A 2R27A 2Z7WA 1XTMA 4A7TA 1IBHA 1XSOA 2WZ0A 3MNDA 3CE1A 2JLPA 2Z7YA 1DO5A 1JK9B 4A7VA 1ESOA 2C9VA 1E9QB 3L9YA 1UXLA 4OJAA 1B4LA 3T5WA 1CBJA 1IB5A 1JCVA 1Z9NA 2AQSA 3KBEA 3RE0A 4BCZA 3KM1A 2WKOA 3ECUA 2Z7UA 1E9OA 2VR7A 3ECVA 3GTTA 3SODB 5KBLA 1JK9A 3K91A 2WYZA 1TO4A 1PZSA 1SXAA 1YAIA 3CQPA 1MFMA 1E9QA 3S0PA 1IBBA 2AQRA 3KBFA 1S4IA
chains in the Genus database with same CATH superfamily
5IJVB 3NEOA 4ISVB 5LAXA 5EO0A 5CU9A 3WO3B 3SKOB 1HI6A 1I7TB 5I0WA 2E0PA 4A7GA 1OZUA 5G4NA 5HXMA 2D2CC 3G5VB 4G6FD 5G5DA 2V9UA 1XF3B 3OKYA 1FPTH 5K9OB 1N6QL 3GI8L 3P73A 5CKGA 5I23A 3NAAL 1RK0B 4D0BB 5D1ZB 1C5CH 3HZVA 4NFCA 5ID0A 3ECBB 3QUXC 4ZTEA 5G55A 1PNCA 1CXFA 2OQJB 1BD2B 3FPYA 4Y9EA 2W07B 4JHAL 1LK3L 4D9QD 3RUGF 5CNHA 1FFNB 4Y5VA 1FVCA 4OFIA 2DWDB 2JIXB 3UBHA 3T1WA 1A4CA 1W15A 2DBJA 3DXAE 2QZQA 4JDZB 5GS1B 2WTPA 1IFHH 5LBSL 5L2KE 3VXTA 4RVBA 2WVVA 3B37A 2DJ4A 3DBSA 1XF4A 4PJ7B 4WDIA 5SV4A 4D7BA 4JFDB 1I1AC 3CFUA 4XN7A 5ABDE 4GP8B 2VRAA 2YRLA 3OKMA 3PPEA 3QUXD 5JW5A 3OZ9L 4OQTL 1OL0A 1I3RA 3SQOH 1DJZA 1JZGA 2R29A 4WW1A 5FUZL 1B6DA 3ULVC 4UOW1 2ZOUA 3I9GL 4G6KL 4L4TB 2BNRB 4MQXD 3WIIH 4HWUA 2FZ3A 3E8UL 4FQXD 1YYCA 4YSPA 3U2SB 3QDJA 1MEXH 2QPDB 2R69L 4LIQE 4WGKA 4WWKC 4Q9QH 3P40A 5ANMB 4O58L 4JG1L 4CMHC 1ZSHA 3V6OC 5C70A 1FV1B 4DP6X 3RZCA 3ARRA 5HDRA 3QG7L 4OUUB 3GTVA 2ADFL 1MCHA 5D7KE 4HPOL 1QBBA 4JFPA 3HS8A 2DWYA 2GCYB 1W0VB 1XTMA 1ZE3H 4KJYB 2NNCA 3I6GB 3RI5F 5JORA 4GRWH 4PRHB 4Q8BA 1NC4B 4ZMXA 1UB5A 3FCTB 3RKDD 3QFJA 1CMOA 1HAWA 4LXFA 5I1IL 1E6JL 1GVIA 1GYCA 2DJUA 2WANA 5JPNC 2OMZA 4U1HA 3FBKA 1CTNA 5DGRA 3V2AR 1RI8A 3EKCA 3ULUC 2JNZA 3L3DB 1W8OA 2JI2A 2XY2A 1AIZA 1BQLH 1GGIH 4I77H 2N0KA 5C0GB 3WUWG 4IRSA 4JFHD 2K45A 3PWJA 5FB8A 3KBFA 2EH7L 3PXJA 3QDGD 2FQFA 3BUTA 4FJYA 4W70A 5I0ZA 1L7IL 1FO0A 2AJUH 5FOBA 4EN3B 2CHZA 3FQNA 4PY7B 5BOJA 2DF3A 1HH6A 2UZXA 4JFHE 1T5XA 2H6UA 3BDYL 3EOAA 5DJZA 1INDH 4X4XA 2GQHA 4PG2C 3DGCR 3NIDB 4GMTL 5E4IA 1I1CA 5D7EA 1KPVB 2CJ3A 4N20A 4PRIB 1JZ4A 1JBJA 1JTTA 5D7JA 4P57A 4XPGL 1TVBA 3NSDA 4XE5B 1YEFH 5I0VA 1D6VL 1CLYH 5FF6A 2UVFA 1NPUA 4JVWA 1Z66A 2B15A 1QLRB 1YEKH 3VXRD 5TDOA 4TUUA 4OZHB 5B3JE 4N85A 4ZYKA 4KI5D 3NJNA 5L4IA 4FCAA 3QS3A 4N1EA 3QUYB 3GI8H 5E6IB 4AEFA 4YZFE 1WA2X 4XI5C 3T2NH 4X80H 4NT6B 4FFWC 4P23A 4FXLA 3IDIB 5DD0H 5FYJU 1KBWA 1DFBL 1EQWA 3HNTL 1PYWB 3A4FA 1JGLL 4ZW3A 1FRGL 4F3FB 3MBED 1ETA1 1NUGA 1CD0A 3T08A 3ESUF 3Q0HA 3QFJE 3TPKA 1VF5C 4TVPD 3BN9D 4FEMA 5HYIA 1CIUA 3CUPA 1HINL 2NY0D 5GRJH 1DEDA 4RGNE 3U79A 2IBGA 4HS6B 2K9UA 1BREA 3C08L 4HUNB 4MGXA 4R7DB 5DJYA 1E28B 3EOBB 4OF7A 4HIHA 1HEJC 5BCAA 1AANA 3LRHA 5JHDB 2OS7A 4DK3A 3KPNB 3IJ9A 2XQ0A 4QTIH 3S34H 4X0KB 1H0DA 5HJ3B 2IAMA 3ZN6A 4GQQA 1KYFA 3IXAB 5FUOL 4A37A 4OKVB 3NABL 3WNKA 2QTEA 2LV4A 1AO7A 3LN5A 1KJ2H 4J3XA 4K9EH 5JXAH 3W5MA 1DLFL 2Y6TE 4DKAA 3AVEA 2W65B 1YEHH 4PGDB 2XQBL 3DUSB 4U3XA 4BH8A 3F3HA 1ADQH 2BP8B 1NGPL 1ODUA 5ISZE 2CBTA 2VZVA 2CNZA 1NEPA 5MEOB 4D7PA 5LBGA 3CFKA 5I1EL 1EIBA 1UXSA 3AREC 1SF3A 3MV8A 2JJUA 4H8WH 3LKSB 5DD5H 5H37A 3TIDB 1I82A 4IK6A 2H3XC 1Y6MR 1YUHB 3DJTA 3GSVA 1B0RA 1I1YA 1NCAH 2UXVA 2Y2WA 1LO0H 1BGXH 2WZ5A 3EYVA 3PV6B 1IBDA 1I8KB 5EEVA 4MAYC 5DF0A 4JY4A 3RTQA 5JXAL 4R4BA 4AEIH 4CSTA 1RZJC 2EYRB 3V0VA 2LR4A 2VWEE 3JV6A 4U7SA 4FNPA 5SX4I 3SCMD 1MAKA 3RGVA 3WENA 2NDFA 2NNFA 2LAAA 4KZDL 1TVDA 4WGWB 3G9AB 2SEBA 2Z1PA 3BWZA 2V9TA 3BSGA 3D4CA 1RZIA 5HGDB 2XCMC 5GRJL 1NFIA 2E27H 4GAYA 4PUBL 4EI5D 1V3LA 4OD3L 2Y6SD 3ZTNH 4DW2H 4KI1A 2ADFH 3LXUX 4DO4A 4HUWB 4KAQH 4WI7A 2DLEA 4E5XA 2BIOA 5JXEC 3ZE0E 5CO1A 1VGKB 4I18B 2NY2D 3V5DA 1F45A 2VXVH 2J88L 3SDDA 1N59B 3Q06A 1YEJH 4NI3A 4G11A 4XX5A 1I3VA 1R6VA 2BNRD 1ID2A 2H2PC 3RTQB 1BVLB 4K94H 4PJIE 2V17L 4M6OL 1I7ZA 3KPOA 1DDTA 4G7QB 3LIUA 3K2UH 1Q72L 1BQLL 2A74C 3BD4A 3RWIA 5T1LD 3SGJC 4A2MA 5BO0D 4N6QA 4ZUVB 3DHJA 2V33A 2I24N 2YQBA 1R34A 4JE4B 2VMEA 1UASA 4KMQA 3BAIA 1I9RL 3Q8CA 4WCYL 3AXLA 3AG2B 2NQCA 1JFQH 4KO7A 5AAWC 3AWFA 3VX0A 1KC5H 3AGVA 1G7JB 2BSED 5CJQL 1OGTA 2VDPL 1ORQA 2VDKL 5T5NF 1U8MA 1FL6B 1WCQA 3CFTA 5D1ZD 1HHGA 2WO4A 2XZQL 1JVLA 3MYJB 3CVHB 3KPSE 1FN4B 3IMRA 5D5ME 4I0PD 3FUFA 4DP9X 3ARED 1NCTA 1JXDA 3SD2A 3M1BB 1D2OA 2PWHA 4IBZA 1MIEH 1P6WA 3FQYA 3U4AA 2YUVA 4OF0A 3RILA 1WWBX 3OL2A 3IJ8A 3D0LB 3GXDA 3Q5OA 5JIHA 3ZBMA 4EDWH 5C8JA 3L1OH 4B3VA 2KZBA 3KHOA 3N55A 4U3HA 4ZTPH 3SGEH 4QHPA 3B2UD 2BRRH 2CCVA 2JJVA 2P49B 3ZDYE 3NJMA 2CPUA 3OKDA 1S7WB 4F7CB 3RKPA 1KLFA 3FTGB 5AVVB 4P99A 5DD5L 1UXMA 1I8UA 5IREA 2IFFH 3K6SB 5JA9A 2D9QB 4FQXB 4UBDD 1QTSA 4OCYL 4YWGL 5SWSE 1ZRUA 1INEL 5DHYB 3ARQA 4FZ8L 4J6RL 2Y23A 2ZPKH 2OJZH 5F6IC 4KJWC 4ANXA 4G9FA 1QSFB 3BN9C 5GRWA 1W8NA 3QG7H 1B2WH 5E56A 3RP1A 1NTDA 5I74B 6FABL 2IBZX 1CVSC 1MCQA 4C4KO 1T66D 2NZ9D 2QHLA 4XZUB 5FM5M 5GGTA 3QJOA 4PVBA 5DZAA 1BWMA 1VPOL 1VZIA 1LO2L 2FEEL 1XZ0A 4LSUH 4L48A 4NZRL 1CXKA 1QI4A 3WJJA 2WXMA 3DIDA 3QISA 3FN3A 1BG1A 2CJUL 1OSYA 1EHNA 2KMWA 2WSKA 2DQIH 3V4PB 3FUIA 5ESAB 2JKWA 3L48A 3LHPL 3IVKB 2X70A 2IWGA 4QRSA 1EVUA 5D96B 5FOBB 5D70H 1IAIH 2NT0A 3SGDI 3EGDB 1GC1L 1AHWC 1AY1L 3CPLB 1ZJAA 1EXHA 1UZ6F 3WY4A 1MFNA 4QHNA 2HT4C 4MD5A 1XGTB 3NJLA 2VDMB 2WO3B 1DVFD 2EEDA 4LCCB 3TBTB 1C5CL 1D9KC 1AD0A 1PEZA 3CZNA 4M61B 2ZSWB 5EU4A 1BW8A 1NM4A 1KEMH 2AK4B 4PJFF 5FM8A 1M3JA 4AV0A 3BJLA 1HZLA 4QF1B 4Y2LA 2Q1EA 1XD0A 3QFJB 1IFRA 3KW7A 5ALBH 3Q9QA 3RPBA 4H25B 1UD6A 2YXWA 5BQDA 1XGPA 3BAWA 4WI0A 3UXFA 2VL5B 2EEBA 5IEKA 3DX6A 1DJHA 3RG1C 3GSNH 3MCKA 2BMKA 2QTVA 4HH9A 4YGVB 1UD5A 3HEIB 5CN3A 4OUUA 5C0JB 1JVKA 5M94B 1S5HA 2HT2D 3DMMA 4N0RA 1OAYL 4IRSD 1BYPA 1T5KA 2BW5A 3QCTL 4PJ9D 3RKDC 3T2NL 3QULB 1IJNA 3PDGA 1K3IA 3BP7B 2JJTC 5AD0B 1ED3B 1H8OA 3GK8L 5DJ0A 3QQDB 4XCFH 5E99H 4K9EC 1R17A 4OGZA 3OGOE 4CN6A 4NZJA 4L4TA 3PWVA 4BKSC 3M1BA 1A1NA 1KB3A 1SN5A 5DYOB 4ADGA 3HRZC 5CZRA 3QIWB 1FYTE 4OAWA 2UZYB 5D5MA 5AW4B 3MYJA 4L18A 4WF7A 1UM6L 3VXRA 1KJ3L 3V0WH 1U8MB 2MQ3A 1AGFA 2CJSA 3BUBA 3BX7C 3S88H 2CDGA 3B2UC 3P2BA 3QNYB 1QI5A 4YSAA 2P48B 1BBDL 4OUOA 3MRMA 2R56L 2UY7B 5FYKE 5I8EA 2VABB 5ECGA 2Q86B 1F2XK 1DUYA 1F3DH 2YD8A 1RIVL 43CAB 2XZAL 3CFQA 3KLHD 5GGVY 4FL4B 1QFPA 3LVEA 2DLFL 1FVCB 4MJHA 4HS8L 1JYVA 2QT6A 4KROC 3X12B 4LBAA 4DPRA 3P4NA 3L5WA 3MRBB 5LAPA 1ZHBB 2P44B 2FX7L 3FTYA 3KPRE 4NHUB 3QAZC 1LO2H 2BOBB 3CGTA 5D1ZC 5B3NA 3BPLC 5HYEA 4H0IA 3PHSA 4GS7C 4Y4HD 1EO8H 3FCSB 1ZLSH 3HB3C 3WTSA 3QDJE 4FI8A 2OYKA 4BWUA 1BOGB 4H44C 3VGHA 3ABZA 4V11A 5GSVA 1NANH 4KMTH 5JYMA 4UTBH 2L0DA 3TTYA 3FFCD 3SKOA 3HI6H 4XVTL 3MRFA 1I3GH 2LLNA 3L1OL 2IDUA 4JGMA 1QG3A 2HRGA 3RPIB 1ZGLM 1IE4A 2ZOWA 1IGJB 2XOTA 3MRHA 1X5IA 2YO3A 2RCSH 4JFFA 5E9DB 4YK4B 2X0WA 4Q4IA 5F7NC 2UXTA 3MBEC 3NZ8B 3V6FA 2J43A 2LFEA 2X88A 5I15H 2Y1YA 5IQ9A 2AEIT 4WU7A 1HNYA 4HUXB 4N2EA 1P4LB 1SFDA 3IETA 4Z3HA 4M5SA 3TP4A 5IFJB 5BUPA 1AIFA 4U1NB 2D03H 3RVWC 1PMYA 1AXTL 1TQBC 2G5RA 3KXFD 4KH2A 1SGKA 4E5XG 4WZ9A 4U6YA 3Q3GA 2Z7YA 4KKBD 1MN4A 1TQVA 2V5YA 3L95B 1KXVC 1W72B 2D3JA 5I1GL 2EUWA 2EYRA 3JWNE 4OM0H 2GT9B 2XBDA 4HT1H 4JKWA 2CHDA 1QKZH 1OCRB 4OD2A 2I85A 3SOBL 4D9RE 5IVNA 2VXUL 3TU6A 5K5YA 3UGXA 1KYAA 4MA7H 3EYVB 3MRDB 4JRWA 3TT3L 2J6EH 1GRWA 2P28B 3MRFB 4WUUB 4MNHB 2BFVH 2VERA 5DJDB 4YX2H 2E7LA 4O5LH 2AJSH 3ULUE 3DURB 1NCDL 2XG5B 3B6SA 4FTVB 1RK7A 3TASA 4LFHG 3MRKA 2BP8A 5KYWA 4PI0A 3MLTB 1YEGL 2MFNA 5I1GH 5EF2A 3QXTA 1CTMA 2IQ9L 3LQZB 4YVUA 4ACPA 4JY6A 3ZKSD 3SOBH 3H8NA 1WICA 3FN9A 5MEPA 3PP4H 1SNRA 1FUNA 2HMID 1TKWB 1RIHL 2NXYD 3KW8A 3G6JF 2XETA 4YNYA 5EUKB 3N41B 4AM0Q 1FNSL 2Q86A 2VABA 4N22A 4ZXBB 3PHAA 4HJUA 2AAVA 2CO7A 2CDGB 3ARBC 5DJYB 4PGCA 1KTJA 3EGXA 2XTJB 3KS0J 5JTWA 4JDTL 3APCA 4HS6A 4I89A 4LKCB 3G6AB 5EIIG 4OAWB 3DO7A 2F8IA 5GRUH 3L3OA 1OGPA 3MAWA 2HLAB 5C86A 2X9XA 4HGKC 4WSGA 4WNQA 4ZW5A 3L3GA 4IOIB 3ROLA 2CK0H 4JS7A 3CFEB 3C9NA 3D2TA 3LCYA 2NUTB 3QGVA 4ZQKB 5DRXB 3SYCA 5B3JF 4YC2C 1SDYA 3M1CA 5T5FL 3QWRA 3T6QC 4EZJA 5CCKL 5I1LA 1FBIL 2NY4D 4LKXB 1FNFA 3JWOL 2A6JB 4Y9GA 2ATAA 3QEQE 5T3XH 4G8GE 1RHHB 2QR0B 3LKQA 1QPKA 1TZGL 1T0MA 2P9RA 2NX5E 1JOIA 2WJ7A 4AV4A 3QO1B 4ZYKB 2UXGA 4P5TB 2WYTA 3KWUA 1TIUA 4X9YA 1G7MA 1IGCL 2ICEA 1SUJA 2WBWB 2CRYA 3M8OL 1LEIB 1GZHA 2EIZB 3LNGA 4EIZC 4XOEA 1BBDH 4X4ME 5D7JB 3ARUA 1R5WA 5E8OB 2W0LA 3GLZA 3MHZA 3NSJA 3OX8B 1T03L 1HHHA 3GT6A 2F53E 4X4ZA 3UAJC 5GZOD 2GPZA 1KELL 2IBBA 5E8EB 5BV7H 4FHKA 1TZGH 3BAXA 4FULA 5F9JB 5FDWB 1R3LA 4KUZH 1G4RA 4GG6B 3GDBA 2UZXB 3ECUA 3UYRH 1A6VH 1NAML 1UCBL 5EF0A 2YA1A 3IKCA 3T0EE 3TVMB 1D5XA 3U1PA 1FO0B 2HRPL 1RD6A 3VA6A 3AS2A 1GKEA 3GMQA 4B41A 1ZE3C 4JN1L 1F4YL 4MMXC 4N2LA 2GJRA 3H53A 2PP7A 3IVKA 3DV4B 4YSQA 4UT6H 1R19A 3L3DA 4Y16C 5E8EA 1S8DB 3P4OB 4WW2B 3WXVH 2B1AH 1O6VA 4FQIL 4M7KH 3SQRA 3L16A 4EDWL 4Z7NF 4YHYC 1OCWH 5JQ6H 1UFGA 3RRQA 4YXKH 1RZJL 2EE2A 6PAZA 1E8XA 4N1CA 3S4SB 5JPMA 1K5WA 4MD4B 1I7RA 4LHUG 4PHXA 3K5SA 4YDIH 3I6GA 1Y6NR 4JRYB 5B38A 3WKNA 1BZ9A 1BVZA 2H47C 3P30H 2X53A 1HDMB 3PJNA 3N04A 3HKFA 5DC9B 1T0NA 4L8BB 2QFRA 3QUML 4O00A 4BWTA 4BYHA 1TTRA 1T0OA 2NY6B 4AL8H 2JB5L 5TK2A 4E36A 4ZFOA 1PD0A 5JNYA 3QK0A 2H3NA 1IX2A 4ANUA 5C1MB 2FZ3B 1E8YA 5BVPL 4OSUL 3F65A 1NCDH 4U1IA 4YSUA 1VEMA 3GKWH 4N2NA 1YEDB 3PHQB 3HG2A 3HUJA 4N28A 5HYJE 3MLVL 4OFVA 5TF1H 3G6AA 4PJ5B 4OLVH 4GG6E 4KRLB 3TEUA 2L4OA 2A9NL 2AXFA 3ZTJG 3BD5A 1JF1B 3K2KA 2AABL 5ERWA 4KBPA 3UROR 4OZGE 4PJDF 3NA4A 3QZBA 1MI5B 3ZHNA 4F7EB 3CZJA 3PGFH 5EBLB 1NCCL 2I9LB 5FGBC 4D9LL 1RERA 2VZ3A 4RNRB 4JKMA 4XN4A 4OZHE 1F1AA 3TC9A 1YUKB 1IILE 2Z7WA 3NSFA 4OLWH 3D2UB 4LSVH 3JWNC 2GK0A 5JHDE 4YSEA 1A4KB 3TV3H 4BFEA 4FJ6A 1QWNA 3MOBL 4LSSL 2FH8A 5DZOA 5AVWB 2F1BA 4A38A 1D7BA 3FOLB 3QRFM 3ABMB 2EE6A 2J73A 3QA3B 5D72L 5FM5O 4OJAA 2VH5H 3IDXH 1NH6A 1MHPL 1MY5A 4JL1A 2HRLA 4F7MA 2P5WE 3EDFA 3Q5TA 2CHWA 1UD3A 2K1MA 2W0KA 5D2LF 3FN0L 3E2HC 1FYTD 1X3DA 5DZPA 3RNKB 4HIXL 4K07A 5IMKA 3SIKA 2CKNA 3MXWL 1G7HA 1FORL 1MHCB 4NQED 1ZY9A 1ZIBA 2CR0A 4FQHB 4G80A 2A7BA 3FFCE 4PLOB 1LWJA 3PNWA 1ETJA 1KLGA 2BDNH 1QSEE 2VH5L 3ESPA 3CHXA 3OSKA 2C9XA 4N0UA 3REWB 1BQUA 4H5SB 4HCRH 3F58H 2DQHL 2CR3A 4U49A 3SBWA 3IETB 2LVEA 3VFWA 2QPUA 4E9QA 4Q6IA 4HWNA 4LQFL 3NCFB 1KMGA 3O4LE 5IUCA 1JZIA 1BZ8A 4UTCA 1A66A 1NFIB 4M8RA 4X5LA 2C9SA 2B5IC 4HIPA 5ID1B 4C59B 4PRHE 3I6LD 4BK8A 1MIMH 5FPIA 2DJMA 3PF2A 4OGXL 2VO8A 2ZX6A 3BE1L 3RJOA 1PW3A 3REWA 1EGJL 1BQRA 2WXJA 5C09B 1ZTXH 3MA9L 4I2XE 4JFQA 3SJVA 4OZFG 1ASQA 1MRCH 3AQXA 3KXFB 4F5CE 3PNWB 1NC4D 5I5RA 2O4EA 2GBTA 3MRCB 4NHUA 3LEXB 2JKTM 3BP5B 2PCFB 1ZHBA 2NLJB 4XBEH 2FX8H 1WZ1L 1LWHA 2WQSA 3QCTH 1KCVL 1UG9A 2J71A 1V8HA 4UNTA 1PZDA 1U4EA 3VRIB 2NR6C 4M00A 5HI3D 1LDSA 2F5AL 2AV7B 1CG9A 3LQMA 2D7OA 4Y4FD 2Y1VA 4XXWA 4G9DA 2C5DC 3ZHDA 5BQ7A 3CXHJ 4EUPG 5EO9A 2BJML 5J12B 3WKML 3GBNL 9CGTA 3OPZL 5LNEA 3VFTB 1AGFB 1K3ZA 4HP5A 2XFXB 3SY0B 3VI4A 2DQFA 3NQKA 3FUEA 4AQAB 1MCNA 1LM8V 5D5MB 2P8LB 5FHBH 4ZAKA 5D8JL 4DP8X 4GG8B 5IMOB 3B8SA 3PL6D 4JQIL 4LLYB 3DXAB 3FT3B 3PWVB 3V95A 3WS6A 1NJ9A 4L5FH 1P7KB 3PWPA 4QLWA 3IXAA 1TJIL 5ACLA 1OCWL 4ZNEA 5IFHL 5JLZB 2BNQA 2E7MA 3KPNA 4WEUD 2F5AH 4GXUM 1E8ZA 4N8CL 4ALAC 4NYLA 1DYZA 2AQSA 1MF2H 5DMGC 1CFQB 1QUNB 4ODHL 5FGCE 5C08A 1NGYB 4FNSA 4AYGA 2HJLB 4NWUL 2WYZA 2DY2A 5DK2A 2LW3A 3U4EB 3QNZB 2WLLA 2XPGB 2VMCA 1CFNB 5ABAA 3U25A 2P47B 5M95B 2W0PA 3S9DB 1P84J 4DGIL 1XGPB 5T1DH 3EYSH 4DKFH 2DLGA 4P2AA 5FO9B 4L3EB 2DMBA 1OP9A 5BPPA 2X0UA 5GQBA 1EK3A 3EFOA 2HAZA 2APBA 2VC2B 1K4CB 1RJZA 3F7YB 3IK2A 2WP3O 4ELMB 4K0OA 4NM4H 4R5TA 4NQXA 2JFCA 1KDJA 2ADYA 1MJUH 5I1KH 1Z32X 1PKQE 4P3DB 1UH4A 5DWUH 3KL5A 3T8MA 4QXUL 5DMIL 3H9YA 4G6ML 3M46A 1YNLH 5IROD 3CZKA 1QYGH 2EP6A 2ZCHH 4H88L 4BSWA 3BT0A 1MREL 1QNZH 2AGJH 3T4AC 3TXAA 3FO0L 5EU7E 5D1QD 1EO5A 4PRIA 1Q94B 4BQ6A 2IGLA 4DNLA 5CINL 1N7ML 1FFPB 2IF7A 3GHEH 3KPRA 3VI4E 3ZRFC 1B9ZA 2DQ6A 2ADIA 4HIIA 3TEXA 3TF7C 1AAJA 1HH6B 1MW2A 2YHGA 3LIZL 4DEWA 4E2OA 1Z9MA 3PGCB 1XX9C 4JPVL 4EI5C 3GF8A 2FSDA 4KH9A 4HKBA 4BSWB 4A1RA 1FNLA 2A3TA 4FA6A 3BH4A 4O5LL 5HYSB 2XN9A 1SBSH 5GHWH 2WZAA 5KVDE 1HCVA 2H32A 3H2PA 4QPEA 5TK4A 1XB6A 3KJ4C 2W60A 3MGTA 4YDVA 1EPFA 1KT2A 2UYLA 1RJLA 4GMSL 1E9OB 5I9QC 4HCFA 2Q76A 1RXLA 1DBJH 2WNWA 3DUHA 2Z31A 4YHPB 4GIOA 3S5LB 3SY6A 2GKIA 3MZGB 3GFUA 4NIKB 3K4ZA 3PL6A 2QMKA 1PZ2A 2J1KA 5K39A 1OTUC 4HKXB 3K6SA 1IM9A 1QHOA 1UURA 2ZJSL 4CKQA 1JPGB 3GRWH 4YEFA 4PRHA 3SBQA 3B1TA 4CGTA 3APNA 4P5MB 1TU2B 2CU9A 2ZUVA 5D7SH 4ZX5A 4W4OA 2J5WA 3KYOB 1UD2A 3MLWL 3TCLB 1U6AL 4OF5A 3U30C 2XPGA 5JHAA 5F7LB 5FA4A 4OZ4A 4Z7WE 2AZUA 4HIEA 3MRLA 2VRKA 4NKQB 5JZ7D 5HSFA 3LKNB 2H6PA 3TN0B 4HJ1A 2YD4A 4HHAB 5H2BB 4LKXA 4YX2L 4ELDA 5BS0B 1N64H 2NYYD 3EYFB 3QPKA 4E9TA 3BWUC 3D0LA 1ZWIA 3FMGL 4TLKA 5DO2D 5DJCA 3MXWH 4MA1C 4WENB 2GJ6A 5IV2B 3CFEA 4Y89A 1IEAA 2CGYA 3TZVD 1AYOA 3VDAA 4AYBA 5HHMB 3L4WA 3U2JA 3W38A 1XHHA 3EO0B 5E6YA 4W6WB 5KN5A 3EXLA 3P9LA 1RUPH 3O3AA 4LKCA 1EV2E 1A3RH 4PB0L 1TNMA 3SE9L 1WG3A 4OT1L 4UINL 2E7LC 4DUVA 3L9BA 3LKPA 1NCBL 1ZV5A 3NDZE 4PRDB 4FLOA 1S7SB 2EDBA 2XUWA 3N9GL 4NOBA 3RTQD 4EPSA 1CG9B 4JO1L 3ULUF 1IC5L 1THCA 2HYMA 3ATDA 3B9KB 5DTFA 2DTML 1T0PB 3CAFA 1AGEB 3C5SB 2V9QA 1JNNH 3VFVB 4TQEL 2A9BA 1BXVA 4I3SH 2AI0L 5DMIH 3C5XA 4ZZKA 3WIHH 1Z7JA 1LYQA 2EEFA 4FQQB 3UTQB 5JMRA 3V4UL 1CXLA 4YHNA 4DH2A 3B2XA 3QUZD 3UADA 5AW0B 3UTOA 5F6HI 4I48B 4ZMNA 4UNUA 1KB9K 4I18C 4KK5C 3ARPA 2V2WB 3DURA 3F6IA 4JFQB 3SJVB 1JPFA 2WGNB 3BUQA 5DJDA 4KJQC 3WDIA 2HRPH 4WUUA 3O3EA 5DRWB 3MUZ1 4P59H 5EO0B 1AC0A 4ZODA 2WCGA 4MHHI 1YY9C 2P45B 2Q8BH 4GH7B 1E90A 4GT7A 4OQ1A 5F9OL 3FO0H 1H3GA 1WA1X 4MZ2A 4JFUA 5F88B 4NQCE 1GTNA 5IZ7A 4DO6A 4KV5F 3T9WA 2X2UA 2H41A 3WUZA 4RGOH 1CLOL 5HHNB 2XI9A 3O3DA 4QRAA 4B53A 4EJ1C 1EHLH 2JCCE 5HI4C 2BSBA 2QVTA 4F8PA 3DOSB 3S37L 5T5NG 5AVSB 4DTGH 3NK3A 5DVNA 4ONGL 4NNYB 1OSPL 4M1CC 2WQWA 4A7VA 2GSGB 3TX4A 5JIQA 2C7UB 12E8H 2E74C 1ONQB 3LH8A 3JVFC 3ZKXC 1XR8B 2Z7UA 3FRPG 4AVKA 5GSVB 3GBDA 3ZQXA 3FL7A 5GGQH 1BOGA 1ZA6B 2ZQKA 2XTLA 5CJ8A 1S78D 1L9SA 4D0DB 5CAYB 1IBBA 2ZOOA 2YD1A 2PYEE 1OKEA 4AEEA 2B7DT 3QG6A 1JGLH 1A4KA 4AX3A 3P0YL 4DN4H 3ECWA 1AS6A 1NBVH 2FVNA 4TM9A 3MFFA 1OSPH 1QW9A 1QLFB 4XP1L 43CAA 4AKPA 4V1DB 1BF2A 2E7DA 4JAMA 2IAMB 3C6LB 5I8CB 5ALCH 1OP3K 4L23A 4NO5A 3QNYA 5TJWK 3K2IA 1WYJA 3D4GA 4JO5A 5DUJA 1ZDQA 2NNAA 3H42L 2YAFA 2WM0A 1D6VH 1DBAL 5IROA 2Q10A 3OR7A 1JRHI 1JS4A 3UZEC 1DL7L 2EDXA 4ODXA 4ZS6C 1KCBA 4N3TA 1T1XB 1ZVYA 4KXCA 3MRNB 3IJSA 3C5ZB 5TGBA 2E9IA 1CLOH 2L8AA 5L4JA 3MV7A 3UIYA 4BZ1H 1RUML 2AMGA 1XAUA 1YMME 1UJ3C 1QTYT 4F3FA 1OAZH 2DICA 2YGPA 5CILL 5AD0A 1G6RH 3CX2A 1T3FB 4NBYB 2BS9A 2VR8A 1PVHA 1JFHA 2L7QA 1BAWA 1ADQL 3MJGX 4XHJC 5EU3A 3S35X 2PPAA 5KJRL 1DQLH 3RVVC 4L0YA 3GSQB 5GISH 4UQ9A 1BM3H 2HWZL 3I6LE 3LSOA 1QKZL 2IXQB 3BP4B 4HFWB 5FM4A 3SYAA 3BJ91 4AYMC 5KSAC 4MMYA 1O9VA 4OBRA 1SUHA 2EZ0D 2EE0A 4ANKA 1I7RB 4H25A 3DETC 2D73A 3GMMA 3U4BL 3TO2A 3WUWA 2J20A 3I2CL 3A67H 2SODB 3ARTA 3ARFD 3D0AA 1MY7A 2D2OA 4GB9A 2DTMH 4U1MB 3MREA 4B97A 2NNXA 2QHRH 3EO9L 3HE7D 2D4FA 1O75A 2DS4A 1AD0B 1J7VR 4I9WE 2M83A 4QT5A 3F7VA 4AJVA 1GYVA 2RACA 1T5XB 4PB0H 3BUDA 3VQ1C 3E1F1 1BFSA 2ZJSH 3O6KL 2Y2TA 4DJMA 5EIQA 5JOPD 4MD0A 3COOA 3VACA 1DBML 3GMQB 3MRQB 3CPLA 3RUGB 1ETZA 1OGAD 3RWEB 1HZHL 3RWJA 1D5XB 3RUGA 3UAJA 3VSVA 2VR7A 4Z3IA 1GGBH 5I8OH 4ZMZA 4EBQL 2AQ2A 4GG6A 1OOWA 3GUTA 4U6XB 1XXDC 4JFSA 1C08B 3CHSA 3ZTDC 4NQCD 3MGOB 1YNKL 4P48A 2L7EA 5LG6A 4MKMA 4JFXA 4EUPH 4S1SH 2OMZB 4U1HB 1CGVA 3B83A 1HHHB 3VFNA 4BCYA 3MA7A 5DUBB 1YEJL 4PCTA 3ULUH 5AW2B 3UBXB 1KJMB 2OTUA 4MQTB 3AMKA 2IPTL 2QZ5A 5CILH 2NXZD 4JRFA 1DQDH 1DVSA 4MJIE 4FCHA 3KPPB 3DOIA 4X7CC 1IGFL 4GNKB 4IRZH 2F54D 4X6FB 5E2WL 5BXFA 1XL6A 1OT4A 3LMJH 1IFHL 1YY8A 4N8CH 5LBSH 2A77H 3UP1A 1JRHH 3NJVA 4G9FB 4WCYH 3TL5A 1IC1A 4PJDA 5C0AA 1RKRA 2ENQA 3RZCB 4IKJA 4C55A 3GIZL 4XE0A 4EZMA 3O2DL 4X7DC 4U0RC 1OQXA 5D7HA 3CX5K 4M5YH 2X4QA 2WBXA 2PPFA 1EHLL 3C5ZA 5MP6H 1VCAA 2QV4A 2XQYG 4XVSH 3CBKB 1S7WA 4LSRH 2ZCLL 5BZZA 4M6NH 2O1AA 5HGHB 1NCIA 2D3NA 3D30A 3EGXB 3P0YH 5CKAA 4B9YA 3ISRA 1DJIA 4DGUA 5C08D 5CFHA 3IF1A 3X2QB 2CO7B 4ZUSA 2XIDA 1JPEA 4JPWL 1JNHA 1HZHH 4D8PB 2GIYA 4MA3A 4DGIH 4C47A 1E6OL 5EC1A 3WI9A 4QAMB 4U1LA 4V1DA 3N44F 2NYZA 4WUUD 1OM3L 2BOLA 5H37G 2K4WA 3RY6A 4ZFFA 2DWDA 1F11B 2JIXA 2YPLE 4LLWA 3UCRA 4O02L 1S9XB 4YXHL 3RX9A 5GZNA 5C71A 5MEPB 2VDRL 5H94A 3BT2L 1FG9C 5GS0C 1ZVSA 4Z7VA 3TA3B 1RCYA 4WNSA 4JG9A 4NCC2 4M7ZC 3EGSA 5A6IA 4XAKD 4R9HA 1G7JA 3UTZA 4M93B 3IFNH 4JHWH 4KRPB 4PD4K 3U82B 5HHOA 2P7TB 4FQIH 4FNTA 2XPZA 3KYKH 4YZFF 3SDCC 3ULSB 1YECL 2G5UA 2R69H 2PWFA 1Q1JH 2C9VA 5CD5D 5IVOA 5AWNH 1WH0A 3QFDA 1EX0A 4OV5A 5DJ2A 5AYQA 4MJ4A 4NENB 3S96A 2LGNA 4ZSOB 2LT9A 1W6WA 4XNZB 2LU7A 4RGMB 5LGJA 4L5FE 3BKMH 3GHPA 4A04A 1DJYA 4Z77A 2H7WA 1NINA 3TT1L 5L0QB 1E9QA 1NCWL 4Z3TA 1ZK9A 2HUEA 3FQRB 4HC1H 2RGSA 5DHVB 1B90A 5EBWB 5B1JC 3B7TA 4UMSA 5HDOA 1CTOA 1RUAH 1RUKL 4KZ0A 2EVGA 1XEDA 2GC7C 5D2NC 5GRUL 1K6QL 4XB3A 3GBMH 3BVNA 2C9UA 3GGWA 3NT0A 3ZMNA 5I5MA 1F86A 1IC4L 1X7QB 2IANB 3B34A 3QI9B 2R56H 4GFTB 5IKCA 1QO3A 2Z7ZA 3NZ8A 4K7FA 3TFBA 1UWEH 5IFHH 3MU3A 3QZLA 3C6LD 4FKKA 1F18A 2WLHA 2Z4TA 3ROOB 2GG1A 2XTJC 3GB7A 3KDMA 5IR1B 1T7VA 3BFOA 1ML0A 4CNIB 1XGRA 5C2UB 3DGDA 3GMNA 2WNKA 4DN3H 2VISA 1OM3H 3VNZA 3GJEB 3QHFH 4JPQA 2VDKH 1OK0A 2PTUA 3MUGA 4UT6L 3MLUH 4YHNB 3L1GA 3C5ZD 2F8VA 1FSKB 1DVXA 4FDWA 3W0WD 4LOVA 3DARA 3P9WB 1X44A 1SN0A 4OGYL 4MDJA 4FYQA 3ARGA 4R5VA 4RMWA 3RVTD 4QNPF 2ZCKL 4M9PA 2DIEA 5ILTH 2ZAHA 1HXYA 4ZD3L 4CADA 1JV2A 2JK5A 3QUYC 4GINA 3B9KA 5DTFB 1SHWA 3B5GA 4GBXC 1E3ZA 3MRMB 2JKNA 3POHA 4GRMB 4XCEB 3TO4C 5C3IA 1UVQA 1E3XA 5DJ8A 4U33A 3IS1X 1CQKA 1MRFL 4HEMA 2MCG1 5F7DA 4EKXA 3GWJA 3H9SA 1U0QA 5E1HB 3A21A 2B0SL 3WE6A 4TNWF 4YHZH 3UBGA 2EDEA 1KPUA 3TBSA 1ULVA 1ILSA 4HT1L 4DOHB 1HL8A 4ZUTB 3WFCL 1F6AA 1D5BA 3DRQA 3FQTA 4OKVA 3CVDA 2UWEF 3G6DL 4ETYA 2VLRE 3AROA 25C8L 5HJ3A 2ZUUA 5EOCL 3LZNA 1INEH 5DMKA 2QSVA 3S6CA 5IF0A 1MHEB 3QULA 1TQBB 1E28A 3KL0A 4HHAA 5H2BA 1WC7A 2CO2A 3GSXA 3E38A 3CSGA 2NY0B 4N8VB 1DJWA 2BINA 2OBGA 5I15L 3LKOB 2OXGA 1DSFL 3PAUA 1G84A 5I6OA 4HSCX 1F58H 4P5RA 1EUUA 3WKQA 3PWPE 5FYJE 5CEYB 3LEYH 4TVPH 3HCVB 2H9GA 3L5HA 2P80A 3OWEA 4OZFH 5E2VH 1JGEB 4Z7NB 1HOCA 1URZA 5GS0D 2OL3A 2XKNA 5E9AA 3QIBD 3A6BH 3BVVA 2V7HB 1GIGL 2P8PA 3C60A 3FSVA 1M05B 3ZQ9A 2Q76B 4AGPA 5GGSB 4LO9A 2EIDA 5GGRA 3WFDH 3KLLA 4DPBX 2W60B 1CFMA 1YPZF 4WIQA 5J7CC 2HFGL 5J11C 2AF2A 2XVBA 1X7SA 4QHNB 4FI6A 3VX1A 1J1OL 2BSCA 2RFXA 2FIKA 5CLWA 3DVFA 1KJ3H 2XA3A 4H8VA 3V0WL 4OFYD 1HNGA 4Q4EA 1FGNL 3QUHA 4TUJA 4XP4H 3LN4B 5SX5K 4OCMC 2KI6A 5DZ9A 2ATKB 5A16B 2IADB 4DGVL 2FNBA 4XCCL 3VSTA 5LG1A 2IDSA 2CLRB 3NN8B 5D93C 5ALCL 3WFCH 4AVIA 2ZXGA 3HR6A 3GS0A 4M62H 3ZKQD 3D2UD 3QO0A 2B2XH 2RAMA 3BCDA 3MKGA 3KYNA 2LOEA 2VITB 2BK8A 3MBXH 5B7EA 1TITA 3I6KB 4QCIB 4X6EB 2PKDA 2X89D 5GJSH 1T2XA 3UJIH 4YBLB 4RBPH 4BZ2H 3W1ZA 3ZX1A 5FYJD 3O8XB 3IMVA 1BV8A 4J27A 4H20H 2HMIC 2XTSA 4IGBA 1INQB 2ZCKH 2X9WA 4L0ZA 4LCUB 2GJJA 4PI2A 1OAUL 2GEQA 1GZPB 1Z5HA 3HPJA 1C12A 4H1LH 5LKNA 4X6DA 4XPHH 2G2PA 1W0YT 2CK0L 3TH2T 2GIMA 4XNXL 8FABA 3T3PE 2AEQH 3N1QC 4I85A 4O51A 2WYHA 5IJKC 1CYXA 4KDWA 1ZHKA 1AE6L 4L3EA 3P3UA 3S3BB 4HWEH 5KAQF 4M29A 1DBKL 2AXJA 3MUUA 3SCMA 2Y1AA 3NCEB 4JFOB 2VE6B 1W0VA 4ONGH 1D7CA 1U8PA 3ZRSA 4AQZA 2GITA 3ZTJH 1P4BH 3NDYE 3O9WB 4YHYB 1ZHNB 4JPIA 4Z18A 1T21A 1BDYA 1S7TB 4AGQA 4JO3H 3GRWA 1YHPA 2DTSA 1T7WA 2ZUSA 1DQQB 3O2DA 4F2EA 1UWEL 3HC2A 1PX4A 3EJPA 2KDYA 2EXWD 4IKNA 1IEBB 3MV01 1BIHA 1URLA 5C0EB 1UXWB 4P07A 4XVUD 2DQUH 2C4FT 5LB1A 3SODB 4P4KA 2BNQB 4PRBB 3H3KA 3HE7C 4OGQC 4FP8H 2DQTL 1KIPB 3LDBB 1KCSH 1OB0A 2GTWB 4LIQH 4KKCD 3C2AL 5A3ID 2NY1D 4YMPA 3CFJA 3CSYB 3KPQA 4GG8A 4LOUC 5F1OB 1BG9A 3LN9A 2GSMB 1A7OH 4W81A 2IH3A 2JJSC 1YN7B 3H9HA 5I6KA 3BHBB 2K70A 1QEXA 3VWKD 3DETD 2DQFB 2J5LC 2M26A 4PSPA 3VXUB 1IC0A 4ABWA 2V9RA 4P2RD 3VDBA 3VFTA 3O3BA 4Q6IC 4WW2F 2X2JA 3MBXL 3EYUH 2BHFA 2ZG2A 4YQXH 2VDKB 4L8DA 3RVVD 1GW6A 4G6MH 4UQIM 5DD6B 2ARWA 2VLLB 5CEXA 3LZRA 1BFOA 4PEEA 1IAOA 2PCPB 1MXDA 1O6SB 3S8FB 1E9PB 1W72H 5HYJA 3RA7L 4NUPA 3LZPA 2G2RB 5CIPH 5TQ0H 2AMUA 2B9AA 3G7TA 5A2IH 3BT2H 5ID0B 5I74C 3VH8B 4LRNL 1P2CA 1JHKH 1PG7H 4APQD 3BDYH 1N59A 3DUUA 4ERSL 1VB9A 4DGYL 2IPKA 2MPAH 3VJ6A 4MMZB 4RGND 2I7OA 2FBRA 2F6AA 2FHFA 5IVZA 2IGFH 4NSKA 3EOTL 5FYLL 4AV5A 2KZWA 1TMQA 4HUWA 2L04A 3SYPA 1XF2B 3ZQWA 3AGWA 1QNIA 3D12B 4FMVA 1BVKA 4OZIB 3KNBB 1UWYA 4XHQA 4KKAC 4F8LA 4WUUE 4NJAH 3RUGE 3KWTA 4GAYB 4K4KA 4LLVA 2BY3A 1R3IL 3AZUA 4CC4A 4ZMYA 3VXPB 2A9AA 4QRPA 4XVSL 5I2IB 1PZAA 1KNOA 3QI9C 3BUPA 4B9KC 4MCNA 3RHWK 4M7LL 4Y4KA 1C1EL 3WNMA 2PN5A 1CL7I 4FG4A 3RB5A 4UQCA 4Q6YA 1MFEH 2FJSA 3T3MB 4LK4A 5DVOA 2HT2C 5G4MA 5JW3L 1U8NA 1ROCA 1T1ZA 4TULH 4U6HA 5D7LE 3NYKA 1S7RA 3HJEA 4OGAD 4J3OC 2ZKXA 2VUYA 3THML 4JY4B 3U30B 1NUNB 2GK2A 3S5YA 4OIAA 4UF7C 4KRNA 3LMJL 3GJFH 1PX8A 3WTWA 1LILA 2Q8AH 2Y36L 5L8LB 1JRHL 5HD8C 4JR9H 3O2WL 2KT6A 3OKOB 5CS7A 1KPRB 1WBZB 1BPLB 1KLUA 4KI5E 4LOUD 3FF7A 1AOZA 1LEGA 1JMXA 4AZ8B 3V5KB 4OVVA 1OGAA 1Y18A 3W2DH 2PXYB 5DI8B 4CVUA 4LVOC 2WHVA 1T22B 4UQ3A 5JR1L 2X4OB 1E27A 1MFEL 4PGDA 2OLDA 4H20L 4X5RA 3V4LA 4GP4B 1MPAH 2A4ZA 2CWRA 2FNWA 3V4PH 3W9EA 3AG4B 4UOQA 5GJTH 2F53A 3LN5B 4M8QB 3P4MB 4JO8A 1R75A 4PJXA 2V2TB 1OTSC 1M2VB 2WTRB 1LE9B 1CLZL 2AK4D 5EN3A 1AZBA 4QHKI 1JVOA 1LLAA 4M93C 4PV1C 1J0JA 4XBPA 4C56D 1N70A 3KDPB 3BRDA 2JTYA 2J25A 4XC3L 2WXIA 3BQUB 4Y4KD 3DO4A 3EOBA 2EJ1A 1KXQA 2WMPA 4F2MB 3K7UA 4R7DA 3QCVL 4X50A 4W4NA 3CFBA 2N7SA 1M42A 1QR1B 3L9EA 4MTMA 3RDTC 3UTTE 5EZLA 1SJXA 4KTEL 2O6DA 4YHLL 4G7YH 5F9WB 3HUJB 1JMZA 1MDAA 5IGXH 1VESA 5A2FA 2WUCH 4XH2B 1IM3D 1FZJA 1EJFA 1J9TA 3VG9B 4E0RB 2EE3A 2R9HD 4Y5YC 4OLUH 2JV6A 1HWWA 3GJFB 4HSAC 3ILPB 2YPLB 1YN6B 1AFVL 1YNTF 5E5MB 1FNGA 3HMWL 4A6YH 4MA8H 4Z7UE 5MENE 2PYEB 4UV4L 3U0TA 1COBA 2VUKA 5C3TA 3RHWF 4L1SA 2VT0A 1EO8L 1ZLSL 3U1QA 1CXIA 4NQVA 1HDMA 3AB0C 4IDLA 5CF3A 2OCFD 3DMMD 3DYOA 4YIQB 3T0EB 3B4NA 4KPHH 1KYOK 4ODUA 3O8XD 5CCJA 2V37A 3I50L 2DLHA 3RY4A 1AKJB 1UWXK 2YKLL 3QQNA 4MNQA 3RFRA 4JG5A 3RZCC 4NO3A 2B77A 4UIKH 1NCAL 3P77B 5J57B 3MLZH 4KOCA 2JMRA 2R4RH 3NRFA 3R7QA 5KZCB 4TTDC 3FB7A 3D87B 3NFNB 4JJ5B 2GBUA 5IBTL 1WFNA 5I73B 3P3YA 5IWLA 3D7PA 2NR6D 5FECB 2EXYD 3QJFB 3RWCA 3GXMA 4KKAD 1MOEA 1AJ7H 1JWSA 3HRZB 3N43F 5H35A 3CH1B 4PM1A 3S98A 2EVJA 3RBSA 3F85A 3WHXB 3W11D 2GFBB 4I87A 3IKCB 3QZWG 3BAKA 3PWJB 1KGXA 1KIUA 3ZDYF 5FB8B 4PYGA 1XF5A 1YYML 1P5VA 4LHUA 4WSKA 4PJBE 4A66A 3WFZA 3I84A 1IC5H 2VQ4A 5IMLA 4HIQA 1D9KA 3ASOB 1QZ1A 1ECYA 3NCXA 4H26A 5B38G 1NCHA 4WI9A 3IEAA 3KG5A 4HJ0C 1T7ZA 4JPWH 5AB2A 1RH8A 2IH1B 2BNQD 1KXVA 1MELA 1TZOA 4HLZG 3KPLA 3WNPA 4G6FB 5BV7C 3W0WA 5HHME 1BIIB 2P46B 4ODVH 4P2YA 4EQ3A 2FJUB 3BIKA 5K9QI 1FNEB 2AJZB 2H3KA 3QUZB 3EOYG 4P9HL 1Q8MA 3HRZA 1DUZB 4L1TA 4NCC1 4W9FC 5E8DL 4LB8A 2HT3D 2C3WA 5CWSB 3QJFA 5CZVL 4JZJB 3MNWB 3BAJA 5DK0A 1MCWW 3BESR 1TG8A 3MJWA 4OCRL 2R83A 1FG2B 1M2OA 2UZPA 4N8UA 1TQSA 4CDGC 3T1FA 2YEZA 1T0MB 2D7MA 2JIXD 2P5WD 1FFRA 2Q20A 5JDSA 4LSPH 4JCMA 2EC9T 2RHEA 3F7LA 3OPUA 4GBXA 5J56B 3X1GA 1I8MA 2XWEA 4J3OG 43C9A 2C9PA 1S9WA 2H5UA 3ZDXF 1RZ8A 3OC8A 4G1MB 1DJXA 2ENPA 2X7LA 4NRYB 1F8TH 1WUZA 4KTEH 1T1WA 1UJ3B 1NQBA 2PWGA 3FO1B 4BK5C 4UM8A 4UTAA 5SWSB 4LGRB 3LX9A 5IOKA 3HBQA 3L3OB 4PBVC 1E2ZA 4BFFA 4OCRH 1FH5H 4DOHE 3HE6D 2E8YA 3AU1A 3IGAB 4RGNB 5KOVC 4D9RD 1G87A 2ERJC 2PR4L 3OKMB 3OKKA 5AQ0A 4H1LA 4PJXE 2DBLL 3WKPA 1SM3H 1SXCA 1USQA 3D52A 3N0PB 4KUCF 5DEFA 4UMGA 1JN6B 4JFDA 2HX7A 1VLXA 4PB9L 2XG4B 3DK0A 3DDFA 3QEHA 4XBEL 1WFIA 2YPLA 1NBZB 3G04B 1S3KL 3OMAB 4WGVB 5T3XL 5E00A 3DX2A 1QBLL 2JJWA 4AYFB 1LK2B 3RVUD 3DROB 2ALAA 5F7EL 1OGSA 4HFUL 1MHHA 4KGJA 4MA7L 4UM9B 3RY6C 4BRVA 1I9JH 2G0KA 1TZIA 1WS8A 3HN3A 3QXVA 1TKWA 3A0OA 2YC1B 5C0FA 4TLTA 4Y7MA 3SPJA 4FZEH 1EMTL 3WS3B 2VDRB 1KFAH 1ZT7A 1JTPA 2OQJA 4CN1A 4EMZA 4Z76B 2D7PA 4NRZA 2G4EA 3U1SL 4MA8L 3ZYJA 3SDDD 2WMPB 5DZVA 3VGAC 4F2MA 3EXJA 2X4TB 4IU2B 4GW4A 3MTXA 1PKQA 1VACB 3WTTA 3FUMA 2CMRH 3S7GA 2BNUB 4FMKA 2NCMA 4XBGB 5DSCB 3HVNA 1X5FA 2QGCA 2J55A 3BOVA 3WYRA 2UX7A 1AO7D 1E40A 4UOW0 1TZHA 1N2RA 5IMMB 3I3EA 2VLRA 4YWGH 2ZP8A 3ZKXB 4FG0A 2UY6B 4JNXA 3MUHL 4WKZA 5JIDA 1OARL 1UB6A 1X9QA 2BIPA 4ATTA 4OZGF 4V2CB 4G8FB 1CGYA 2Z8VC 3QDGB 1CK0L 3K1DA 4XZ4A 2QPEB 4NQSA 1M53A 2UUDK 1A3RL 3MUJA 5H37H 3C8DA 4N0CD 3L6FB 2X28A 1WBXA 2CLVB 4J3OH 5HHQB 4TLSA 1I1FB 1JWMA 1MNUH 3CQPA 4XMTA 1N3NA 2A73A 4AUUA 4P0DA 5KANI 5GIRB 3OZKA 3ZKMC 3X1FA 4Q0XH 4RBPK 5E5LA 4DUWA 1IFGA 3OAZK 2O5NA 5KS9F 4JLRA 4NKMB 1Q9KA 5EDXA 5H4ZA 1A21A 1AZZC 1T1ZB 4U6HB 3KVDD 3MRHB 4JFFB 5ICZA 4AVJA 5D2LE 4BSJA 3F6JA 1M56B 3QBTB 3GRBA 4PJ9A 2F7PA 3LV3B 3WLBB 2ARJA 3WFBH 2A9ML 2NX5D 4K8RD 3X3FL 1H8SA 3W56A 4DP4X 4CC1A 1PPIA 2CIKA 3PUCA 4JHZA 4NAMA 1Y1DA 2Q5BA 5A6MA 1V54B 3W9DB 4LLUA 4WWID 4BGLA 3CMOH 3HC3H 4DKEH 1OXYA 3EJZC 1IM3B 1R3JB 4NUGH 4YBHA 4DQAA 4U3SB 2IWFA 4LAQL 2UWEA 3VA2C 3ULUL 1THAA 3EADA 2RALA 1EAOA 4PJHB 2PYED 1VKXA 3HBZA 1T6WA 2P3YA 2E4FA 2W9LA 1LL1A 3HZKB 5I8EB 1OCCB 4LSPL 4WAFA 1JZEA 4R90L 2CLZA 2ZTBA 4GXVL 5IW6B 4X5XB 2O6CA 4L3FA 3R0MA 3C2AH 5DS8B 3SJVE 2DL9A 2L3BA 2WN3A 5D2LA 2AQQA 5I82A 2UZYA 3KCWA 5LO7A 5J9PB 4MJ2A 4M4RA 2IGFL 2BHZA 4WHCA 2ADJB 3ZL1A 4ZMWA 2PCPA 4JN1H 2P5ED 4PY8I 3KHQA 3OKLA 4N90D 5DD6A 1QAWA 1NLBH 2AXGB 1LDPH 4KVPA 3IJEB 3J2PA 3IDJA 5HGBB 3NIGE 4CC4C 2JB6B 3CSPA 1I85C 4R0LC 3GZOA 2A6DA 2MEJB 4GUPB 1DEEB 2VLMD 2IFGA 4HBQA 1EAPB 4BDVA 4GOSA 3ULUD 1YPZA 1A7PH 5JMOC 1A7NL 2H1PH 4M6MH 4EZLA 4TOYH 4M02A 3ISWA 1KZQA 4PJ5D 5I5IA 3SDAD 2GTWA 5E08L 2LU3A 3ZKMD 2FH6A 1IO4C 1GHFL 3N1MC 2WIIB 1IRAY 1R3IH 4NN5C 1FZOA 3A4DA 2E59A 3A6CL 3FAWA 3HLKA 3L7FB 1U8LA 3B1UA 4O02H 2AK4A 3QZNA 2VDLL 1M6UA 1P4IH 3QDJD 3WN5A 4NIYE 5F7FA 3WJLA 5I1AB 5KG9A 4J39A 3LVTA 3O9WA 5AVZB 3RPKA 3TBTA 4WJKB 3KMDA 3U36A 3L3KA 3RTLA 4QJ3B 2GAZB 2CKBH 2HXAA 4KPHL 1XGTA 1CFTA 3FQWB 3BEWA 4IIQB 5C0BA 1VFUA 3RWHB 2VDML 4WFHE 4Y4FA 4KHTL 1YQVH 2D7TH 3W0WE 2XQBH 1BQHB 1NGQH 3LNIA 2HUHA 1XCQB 3DSFL 3ISYA 1NOFA 4M7ZB 4MRCA 4X6DB 2V5RA 2NY7L 2HJFB 2QL1A 4CVZA 1P5UA 3WXWL 1ZGLP 5ESAA 1WFMA 4GW5A 5FHBL 4ZT1A 1TCRA 4D3CL 3P3SA 1H5BA 1V7NL 1L0XA 4R7XA 2XWRA 3B43A 4AYSA 3DNKA 4YAQA 2PLTA 1HHJB 3ZE2B 3CIQA 3VXNA 3Q1SH 5KYYA 4PJGF 2V5SA 2QFPA 3LRSB 4PW3A 3SYOA 3T4YB 2F5BH 2BSSA 2YAEA 5INCB 1J1XL 4XZUA 2F8OA 5IB5B 4Y9BA 3CZFB 4GKNA 3GXNA 3JVGA 3G6DH 4M1DL 1SVZA 1J48A 1N0LA 3QUGA 3QP3A 3IS0X 3IBEA 5CSGA 3HI5H 1N0XL 3VXMA 2J7LA 4XC3H 4XMLH 2X2IA 1Q72H 4F9LC 4CVZB 3FQUA 2B0SH 1ZVNA 1HSBB 2HTKD 4JE0A 4Q2ZA 3UZVB 5IHBA 3LN4A 1ANUA 4UZSA 4AKQA 3ARDD 2J8UB 5C0RH 4FNLL 1V10A 1ZIAA 4YHML 3K46A 2QQLL 1YG9A 3KLAB 2RFXB 2VN3A 2F54A 5A43C 4BD4A 1J5CA 1MFBH 4LAQH 4X8JB 2WW8A 3A47A 1V5JA 3KCPA 4NKDA 5E03A 4DAGL 1MNUL 3BVWA 3QDHA 3WD5H 2OTWB 4F80A 5SWZD 3TO4A 5BZDB 1USZA 2NR6A 2IIJA 3AREB 5E94B 4DKEL 4LVOB 4BFKA 4GEIA 3U7YL 2PF6A 4B6ZA 4P04A 1BF5A 4QHKJ 3H56A 3K8MA 5CD3A 4GP5B 1A6WH 1YC7A 3D9AH 2OL3B 2XKNB 4GQZA 4WI4A 3IRZA 1GA2A 4P4KC 1SLUA 4M3JA 1XT5A 1LMKA 2YD0A 2YBRB 1OPGH 4LEBA 4GQ9L 1BYOA 4HPOH 3LZLA 2IDFA 3UAJD 4ZX3A 3GEWB 3ZW3A 1MJ8H 1IE5A 3KVPA 3ZLQC 4N8VA 5GGUA 5KVDL 4U0QB 3BSZL 3DA0A 1FPTL 1YA5A 5C0DB 3GSXB 1IQWH 4I3RL 1B0GA 3OXSA 1HQRB 4ZS6D 2ZG1A 4R7NB 2N56A 1U2HA 5EBMB 4AIEA 5EEUA 3JQOB 1ROWA 1NCUA 1ZV2A 2R1XA 3LB6D 4U6TA 4WHYG 5DMKB 8PAZA 2FLBT 5A40E 3WNOA 3FBQA 1WZKA 2G3NA 1NFAA 3VUAA 1U93B 1DQLL 4ETQA 4M1DH 5FO7A 4HU2A 1WT5A 3MRPB 3CDZA 1MW0A 5KSUB 5DFVD 5L8KB 2FYVA 4JKLA 2Q8AL 2HG5A 5J13C 3PP3K 3MZTA 3JWOC 1QYGL 3V0JA 2X4RB 2CDEA 1ND0B 1QACA 3D0VA 1F4AA 2VKWA 3F7KA 4LVHB 1NUDA 1XH3B 3SDDB 3L5XL 4AGNA 5B1AB 4DUXA 4WJG3 5LNDA 4FHJA 2N3JA 1R3HB 3ZDWA 3HZKA 1G7QA 3ARSA 2KLTA 2DMGA 3BWAA 2DN7A 4JDVA 4Q9RL 5EOQH 4R3SB 4U31A 4ZUWB 2CALA 3O8XC 1QSFE 4MWFA 1DN0A 4F5CA 2J1ZA 1J8SA 1S9VA 2QQKH 1YVLA 3JXAA 5C9JB 2AKRB 2C3VA 3M1OA 3DVIA 4EIGB 2VZTA 3MUGB 3W9DA 1E4XI 2RMNA 3H9ZA 5T33L 2IDCA 1M1XB 1X5MA 1WCBA 5EHFA 2X09A 2A4EA 1DSFH 3MJ9A 4DESA 2MTAA 3FUJA 3LV3A 2J5LB 3FRPA 5HVHC 4P9HH 2DBLH 3FSZA 2KPWA 3QDGE 2IH8A 4IS6B 4G2AA 3GLEA 4JPSA 1DFBH 3HNTH 4RZKA 5TE4L 1UKSA 5KVGL 1A7BA 1G6RB 1Z9PA 3QWRD 3F2LA 1Q9KB 1KCSL 3UTSB 5DD1L 4LL9A 1CF8L 3IFOA 3AWEA 1VZGA 4Y4HC 1JWMB 3FXIC 3LS4H 3BIAX 1JI1A 1GMIA 2NX5B 1R3HA 4M6ML 3N06B 1PZCA 2GW5A 3QDMA 4R6UA 3HPLA 4N2OA 4QRRA 1G9EA 3DUSA 3BEVA 2X4RA 2OMWB 3FTUA 3STLA 2NY7H 1TTFA 3D69B 4KV5E 4JM2A 2UZIL 4MJID 2HVKB 1JNLH 5I0XA 4XNQB 2KKQA 3QUZC 5AUMB 3ILQC 4X2UA 5KVGE 2A6KB 1A4AA 2FO4A 4W4OC 1SY6A 2Y07L 3HAEB 1YNTA 4FLRA 1U2YA 1MCIA 5D7IE 4JEGB 1MFMA 4JRXA 2RJMA 1Q9OA 4J2XA 2HN7A 2EO7A 4AENA 3OAUH 3LYRA 2E7BA 1JSYA 3GHEL 3UTZB 1CDIA 5EBMA 3T6XA 4R90H 3EGSB 1FVEA 2OMTB 4P3CH 4FQCL 2CJUH 1E5UI 1PL3A 5DJ6B 3VB9A 5H94B 1XGUB 4L1DA 4LCIL 3TV8A 2X38A 2WZPA 1F11A 4AQEA 4LSDA 5AOKA 3SE3A 4HPHA 3QWOA 3HB3D 5TQ0L 2WWMD 2Z4QA 1TMCB 3NCWA 4OLYH 3TONA 3BRGC 5F1NA 4PJ9C 4YHIA 3QIUA 2FJGA 1NLDL 5B7MA 1OHQA 1R24A 4IMKC 4AM0A 3HUJE 4ADJA 5DO2C 3L5XH 1E5ZA 3F58L 5GPRA 2KHAA 3WFBL 3AREA 3S2CA 1KCRH 1L9MA 3IU3B 1BCIA 2WXPA 4D9QE 2WQVA 5F6IB 2KDGA 3EBIA 2APSA 5JZ7C 1S7UB 5L2KA 1C16A 3B7SA 4PLKC 1DP0A 4IGBC 3UZQB 4CU7A 4Y19D 3VU1A 5FCSH 1WGVA 3GZQA 3QRGL 4NQDA 3HLAA 1AGCB 3V52H 1WRFA 3QJHB 1G1YA 1NCNA 2BNRE 1SXNA 2F74A 3EZ8A 1TPXB 5CGTA 5E1AB 3B9KD 5HVFB 4XAKE 4ZUUA 3T6VA 4XCNA 4PWJA 3A6CH 1KCLA 1OTUD 3LOWA 3UZVA 2DQUL 5BZXA 3MBWB 1F3JA 2R29H 4XXWC 4YO0A 3JSSA 1CBVH 2OJEA 2E4TA 2WXKA 2WBJC 1KGYE 4PG9A 1E7VA 1KTDA 5DQDH 2ICCA 4I3RH 1FH2A 3FU3A 1CZ8H 1EFXA 3CBJB 1FNEA 2NUPA 1KJMA 2OTUB 3LRSA 3DYMA 4LDOB 7FABH 5FXCH 1E0OB 5DR5H 5DUBA 5C08E 3VG0H 1OARH 4R4NC 5C0GA 2B4CC 1MXGA 1DQJA 2NSMA 2X4NA 5E7FA 4H26B 3T2LA 2X4NB 1CURA 4W9IC 4XNDA 3V10A 4EI5A 2VSMB 1QRKA 1BMGA 2ED7A 4NPKA 4BRJA 4D9LH 2NZIA 3O6LL 4R7VA 2Y72A 4A2DA 3FUKA 5I28A 5J1AB 2O72A 2GJZA 1WQVT 3CSTA 2ZICA 4MD0B 4LBEB 1NC4A 1CFTB 3FQWA 3QXDB 5FUZH 2ESVA 5AALA 4HOXA 4PG9B 3G5XB 3MACL 3MX0A 4HD5A 2OXHA 3W3BA 4ZZFA 5ILTL 4IJ3C 3ZR6A 2ZYSA 2LQRA 2XQYA 3L7EB 4YO0B 1UOKA 3BZ5A 4Z7UF 4Z9KB 5IHUH 3SE4C 4LHJB 1UCTA 5LWYL 4LP8A 4WO4B 3P9MB 2FYYB 2EECA 3K74B 5E1AA 1YO4A 2WB7A 3EG9A 3FTVA 2CGZA 3EJJX 2NTSP 3QEQA 4PGBB 2CO6B 5DEJA 1W91A 4WJ5B 1AKJA 4N6RA 4HJEA 1JF6A 1BD2E 3MCG1 4JM4H 2WUBH 4G83A 3FB6A 1MW1A 1SOKA 1NFDB 3AS1A 3LS5L 4Y4FC 5CGYD 4YZWA 1IKNA 3ATFA 5GRVK 3VO0A 1AACA 4BQ8A 5CIPA 3RVXD 4DFHA 4OCSH 3FYIB 2ZKMX 4ENEC 1FF5A 3QCUL 3IDMA 2C1OB 3B7RL 1CZ8L 3II3A 3BVXA 2ZOKB 2WVVB 3IDJB 3UMNA 1AR1C 4YLQT 3AADB 2QKIB 4I0PC 2X42A 1ETB1 4V2BA 2VAAB 2AQNA 1LO3H 3CQQA 3QR2A 2ADJA 4I77L 4ZD3H 1T1XA 2VW7A 4HXAL 1AR1B 2JCWA 4OZGA 1GL4B 1BQ5A 5EC2B 5T3XD 4C83B 2VLKA 2JKSA 1ZEAL 3VD2A 1JAEA 3CN3A 4D0CB 3NTCL 5DJ6A 3ZE1F 3DV6A 4IOFD 2WZPD 4UBDC 1SXBA 1WZMA 2I69A 3SE6A 3SGJA 5IW6A 1N7MH 3K8KA 3ABGA 5TQ2L 3MRGB 3PXHA 3BKJL 4N9OB 4F8QA 5CBEB 4G6AC 4N8PA 2R39A 2Y7QB 4XMKH 2BIMA 2MCPH 1RLWA 3LH2L 1CT8B 1M2VA 5KS9A 4E9XA 3BW9A 2FO4B 1I53A 2JCCA 3AY4A 1X5HA 4G1EB 1YMMB 4LSTL 3W39B 3KS0H 3UTPD 4ZNEE 2UWEB 3V6OA 2EYSB 1VADB 4C56B 4Q52A 1YYMH 1YZZA 3CZGA 1W16A 1IM3A 4HF5L 4ORGB 4K5MA 1FJ1A 1IBHA 5J3HC 3L54A 4NM4L 2FAUA 3SE8L 3R8BB 4JG1H 4IJ3B 5J4MA 4XWOD 2CG9X 2CIKB 2DB8A 5GS0H 2W1NA 1SVCP 4FQJH 4AUYA 5D9SA 2FJHB 2VLJE 1AQHA 1G7LB 5GGTL 4HZAA 2YD7A 3LH2H 4F92B 4XGZA 5IQOA 4R97B 1G7IA 4H8QA 1K4DA 3KPRD 4JFZL 3X11A 4HBCH 5IROC 3WAJA 4CC0A 3OG4B 4ODWB 3EFDH 3HE7B 3LZFL 2C4XA 2R7EA 2ZUQC 3PIQB 1PG7X 3Q8EA 4MCMA 3D85A 1SMDA 3QUKA 4GRWB 4MX7B 4Y2OA 4CDHA 5I75C 2GYSA 3QJUB 4B3EA 4AOFA 4YLBA 2LU5A 5K1JA 3PP3H 2V7NB 2IH9A 3C2SA 4TOYL 1AKJD 3D85D 5HHXH 5D1QE 1U95B 1F4WH 2R4SH 2L7JA 3TH4T 1NBCA 2WZ6A 4ORGA 5D6CB 4QKTA 1WT5C 4DTGL 1D5MA 1ZSDB 1E4HA 2HFFA 3SKMB 4M5YL 1BWWA 1VADA 1U3YA 4P06A 1FE8L 2K8MA 3ZL4L 3DJRA 4ZUWA 3O3EB 5DRWA 5KYUB 1TZHB 2YK1L 5J12C 3APDA 1JZ5A 1HKLL 1P4BL 1QZNA 2XZZA 4PS4H 2I27N 2Z34A 1MJJA 3WXVL 5DS2A 4B0MB 3ZVVA 5C2BL 2NXZB 2DYRB 2BM3A 4IMLB 3ULVH 3DTXA 4OFKA 4HU8A 35C8H 4NHCH 2EDTA 3C8HA 2XJLA 2MQCA 1XH2A 3BSZA 2WPGA 2WYIA 5BRZA 4C56E 2VQTA 3FT4A 4HVBA 4PJ5E 3UEZA 2V5MA 3VFGL 5I30H 1O5DT 4OFDA 5HDBF 2WAQA 1BMZA 1DCEA 3W57A 3TEYA 2EABA 4DPAX 1HH9A 2NSQA 1NC2A 4KQ3L 4BA0A 3EJCA 1J88A 4L8DB 5D71H 3KBPA 1TEYA 2IWKA 3TGXA 5ADPH 3WY2A 3BD3A 2CA3A 2XG4A 4XX1G 4LSQH 1YNKH 3GMRA 3IDMB 4PJ6A 4UB0H 5F1KC 3V7AG 1HTYA 2XWCA 4A7SA 2JE8A 4K3EH 3OB0H 3AU1B 5IQMA 3VQLA 4LEOA 3FF8A 3KYMB 4APQA 3HN8A 3UPRA 1A5FL 5EZOL 3VXSA 1PY0A 1ZCRA 3FB6B 2GHZA 3MGAA 3NOIA 2XBTA 1AQKL 2NTFB 2IOOA 1AQMA 2X7LB 3L3JB 4PGBA 3O4LA 1QHQA 2DQDH 1Z9SB 3MNZB 1CC3A 4FG6C 1AS8A 3G5ZB 3MR9B 5AVQB 3DPBA 2NDGA 2AQ1A 3NFPB 4NQEB 3JT0A 4WFGD 1A6AA 3L08A 4YUEL 4X9IA 4GEJA 3M6DA 1XXFC 1ASPA 4AXWA 3LRMA 1EH9A 4L3CA 5FA4B 3KGRA 1X4XA 1RFDL 1WD9A 2ILLA 2QLVB 4RMUA 4FABH 1TF4A 1SHXA 3OQRA 3AMLA 3MNWA 4BINA 4KVCH 2F19H 2O61B 5CM1A 1BAFH 3RLSA 2HWZH 2R2BB 3IFPA 2R1YA 1A0QH 1IM9B 3HE6B 2XZCL 5EO1A 2X6MA 3EAKA 4B9GA 1C7TA 4IRJC 4KRPD 1BIIA 2ZAGA 4KTDL 4E42B 3KPLB 3SE3C 4JDEB 5CP7A 1DQML 2R0WH 3STBA 1M6OA 2MNUA 2YD9A 1U58A 3V0AC 2Z64C 5BZWB 3RGVC 1KB5B 3H6AA 5I30L 4XXDA 4M48L 1SEBA 3VXMB 5J6HA 5ABZA 4LARH 4JVUA 1HK6A 1AHWB 5CEZL 3ELQA 3UBXG 1HILB 4N2HA 1EANA 3I6KA 4NM8H 4TSAH 4HOMA 1RULH 2FWOA 3LD8B 3T4YA 2K3HA 32C2A 3OC5A 1MCDA 3L3OC 1U3NA 1PLCA 1L5GB 2EVHA 4IBVA 2BVOA 2NY4C 4L5FL 2DQGH 2FEJA 3CU1A 3RWCB 1WIOA 4CA4A 2JI3A 4MDIA 2ZOTA 2CLRA 5HI5D 3SO5A 4ACTA 1DCLA 4XXDB 5KVFL 1QW8A 2WV3A 3QXWA 1NBYA 2I25N 3FNKA 1U58B 2FIRT 3KJ6L 5HYQB 5AOMA 5HY9B 3OG6B 1M6OB 1SY6L 4WFEE 3AU0A 3VXME 3CH8A 2VTFA 1AR1D 2EXSA 2NW3A 1R5VA 4Y4FB 1F5WA 3O11A 5AZEH 1N6VA 3CX5J 3IFPB 5EO1B 2EQDA 4G59C 1YEWA 3VFGH 4QJ5B 4BWWA 4JUTA 4GSDH 5SWZA 2O6PA 3U36B 5DFVC 3ZGHA 4WV1B 1NMAL 2Y7MA 1F4XL 2MWCA 4ELMA 1AYRA 3DX9B 4R2GC 5GGRB 4G42B 3WN5B 5LQBL 1G0XA 1KIQA 2JQMA 3ZT5A 5IBUB 2QQQA 4WWKD 1WGOA 3EFOB 1KV3A 4FQXC 1QVOA 3MQIA 4PRPA 4X6BB 3NFSH 4J1UA 3NIFE 1FZOB 1FNGB 4JGUA 3O4LB 4A7QA 2A83B 2R69A 4HALA 4JZOA 2P5EA 3IFLL 4PUBH 5DWUL 5IEHB 4XMPH 2Z4QB 1JJUA 2YZ8A 4OJCA 1HCFX 1M7XA 4KKNA 3U4BH 2J1WA 3FFOA 3ZO0A 1YEEL 3BAEL 3U4EA 2YR3A 3AT0A 4YDJB 5TF0A 5CR1A 5C0CE 2HJLA 5CZVH 4H8WC 5JHBA 5EH1A 3QJQB 1QLEL 3GMRB 4DT2A 1PJ9A 3DDGA 3T77B 4K9JA 2AXGA 1PQZB 4XBPB 5JLZA 5IVXF 4JRXB 4WK2B 5HI5C 4JFFE 3TBWA 5J6GB 1VEOA 1HYSC 3OXRB 5ESVB 5EPMB 3JUZA 4AH2B 4KFZC 1MWAH 3EJTA 1QP1A 4UYQA 1P1ZB 3I50H 1G9HA 4CSPA 2JQAA 4AQAA 2EC8A 3VI4B 1A9VA 4BV1A 3VXSD 1FVDB 4Q9BA 3GXIA 3IN2A 1F97A 1HE8A 4KFMA 4L29A 3MTRA 1T5WA 4X99A 5D7JC 5I66B 4S0SD 3VSUA 3VI3A 3QZOA 1C8PA 1BQKA 4F57H 5BMFL 4YDLC 1ES0A 2QDWA 5GS3A 1J8HD 1T04A 4WK4B 3ZE0F 4U3SA 4W9JC 4PWFA 2XX1A 4N1HB 5F7AA 2BP5M 1S7RB 1EEZA 3QFJD 1CGSH 3GXFA 5D6CA 3VSQA 1FFTB 2PWDA 2VOTA 4PU2A 1T7YA 2VMJA 3IU4L 3NFSL 2W81C 2PW1A 4IOSA 1KTBA 3T04D 1XSJA 3GMNB 5GZOC 4YFEA 2EDHA 3RQ3A 1M1XA 4PTTB 3DVNA 4AUJA 1QPXA 4MJ6B 1KCUH 4AQEB 4F33A 1PX3A 1X4ZA 1NCOA 4I8DA 4PJ9B 2XKSA 1CR9H 2EH8L 1GY1A 1A14H 2OMXA 4XVOA 4RMTA 1EEZB 3KNBA 4FKHA 3LEYL 5C9JA 4N2BA 2K3TA 3O45B 1KCWA 2G5BB 3ZPDA 3ATBA 1MJ8L 1VJSA 2IANA 3BKYH 3NUKA 4IDJH 3DBXA 1IC7H 4LNVA 5FO2A 4QR7A 5IG7B 1N3NB 2A73B 2YQGA 5IVZB 5TE6H 4HJSA 3VWKA 3QCUH 4KK9D 4FQLH 4XPTH 4DGWC 3JWDL 2ICWI 4TYUA 1CE6B 5T1MB 3ZZ1A 5D1XB 3PRZA 1EJOH 2CDEB 4X7EC 15C8L 1ZKAA 5AW5B 1IGFH 2G2RA 2EO9A 4N2AA 5DEZA 1FLTX 2EYSA 3TN0D 3PGFL 2WLNA 5BS0D 4GQRA 2M2DA 1OK8A 1EEYA 3L3IA 3EJSA 1O6SA 1GJWA 5FO7B 3ULSA 2ZUWA 1LP9B 4UT6A 3L2LA 3PQYA 4GMSH 4BUGA 2WXHA 1T2JA 4YLCA 1DBJL 4F7MB 2V8MA 1L6PA 3S37X 1UA6L 2R1XB 4ONHB 3STZA 3QA3A 5AZEL 1QFOA 3VXOB 4RRPG 5ETUB 1UKQA 3VXUA 4NRZB 4TSBH 4EIBA 1WSST 2YMXL 1A7QH 2GK0B 2ZKHH 1YN7A 3H9HB 3VM7A 2VLKB 1RV6X 3IDYC 3DX1A 2ZD0A 5C6TH 2VC2L 4L2LA 1OALA 5F8QC 4J7RA 2MOVA 3D07A 2YBRA 5EBLA 5IEHA 4JGJA 1DTUA 2QKIA 3ETTA 2Z35A 5KVMC 5HVHB 4ZUSB 3V8OA 5IQ7H 5T1LA 3BI9X 2PO6B 1M3IA 3N42B 4G8IA 4HHGA 3ZE2E 1M9SA 4PAZA 1UGNA 3PWLA 3IGAA 4F37F 4H2AA 2P26A 3MROA 4DEPC 2GEEA 2K6ZA 4MCZB 1T80A 1YEDA 1NSNL 4HCRL 4A39A 2H0PA 4UM8B 5TDNB 4AQ8A 4JFOA 4POZC 3MRIA 5I17B 2HKHH 4NRYA 4NP4L 3WO4C 4Y1SA 4FYTA 5IFAL 2NW3B 4ZFOB 4DP0X 5JNYB 2A9NH 4WI5A 2DIBA 4HUUA 3QAZB 5KUKA 4GW1B 4GIPD 4L8SC 5B39B 2OV0A 1NCWH 2CM5A 1CD1A 5E99L 4GRLA 3RB7A 1ZHLB 3GHBL 4PJIA 4P2OC 5CWSA 1JGIA 1VFBA 4FTVD 4PJ8A 3SDXE 5J13B 1JDDA 1DUZA 4MD4A 1RSFA 3ML8A 1MW3A 3ZMEA 1CI3M 3S5LG 1IAKA 1MFDH 5KYYB 5HHPB 3NESA 1FAIL 2R0KH 4L4TD 5F3BA 1XH1A 4PJXF 2FDBP 1KUMA 3SYQA 1LO5B 4PS8A 3ZDXE 2NXYB 3ERXA 2J8UF 1S8DA 1RURL 5AVYB 5FX3A 3DV4A 1SQMA 4JY5L 5IMLB 1SJEA 3B9DA 3FW6A 2VZOA 4PRIE 1WAAE 1P5VB 2R27A 5INDB 1OGAE 4XMUA 2ED9A 1TCMA 4QYAA 3FZUC 3U9UA 4IOFC 1PLBA 3B9VA 4UDUA 3TVMA 3E8VA 3G3LA 4BQ9A 3MRQA 1M57B 3BEWB 5C0BB 1NPJA 2ESVD 1QHPA 2VDRH 3F00A 2CM6A 4XCYB 2R23A 3KBEA 4QTFA 4YDKL 3SPGA 2FEDD 1R3LB 2VR5A 3F7VB 3K5RA 5L88H 2WXOA 2J88H 2XICA 3EO1A 3TZVA 2EH8H 1U8QB 4FXGB 3T6ZA 1JGDB 5JW4Q 3ASWA 1TTCA 3TF4A 2HTLC 1PS3A 3NFPA 4NQEA 2B4CH 3CTTA 1GOFA 3L7FA 4OGYH 1ZAGA 2B16A 1SFHA 3OJVC 5I6XC 3GMMB 1BZOA 3F8UB 4BK5A 4I1NB 2HKFH 2JKXA 2DYSB 4LMQI 3JTSA 12E8L 1G7MB 3BP4A 3RDTA 4HFWA 3Q1SL 4XN5A 5K1VA 3VXSB 5IOPB 4YBLC 2OSWA 4I7ZC 5T3ZL 4A2EA 2VR4A 4E9YA 1OF2A 3L1FA 5DUMH 1JZFA 3ZT6A 3PCYA 2X41A 2XA8H 1IGYB 1IUZA 1BEYL 2A6DB 3MLSH 3MSPA 3UC2A 1G9NL 3WLWD 5EEWA 5IF0B 4MRBA 4Y2DC 2H2PD 4NUGL 1BM7A 3PQYD 3POCA 4MB3A 5E1QA 3SD5A 3ILPA 4FFZH 1EXGA 3I02A 2X9YA 4ZQKA 2NUTA 3FULA 5C0CD 4S0HA 4X9HA 4CBPA 3DX0A 3L3GB 3HC4H 4IOIA 4PV9A 2PYFB 3US1A 3V8CA 3K71A 3FQXB 4YE4L 3HAEG 1JL8A 4ESKA 3VD9A 5D2LB 3KL3A 2CKBA 4QDGA 4AEHL 3CFBB 2CSPA 4M1GH 4QWWC 4QXTB 5FEBA 1VSCA 3H4FA 3DTXB 2YQ2A 3QJTB 3RI5K 3AAZA 2J1YA 1ZLVK 3QORB 3TYFB 5AZ2H 2HN7B 3MPCA 4JAMB 4Q9CA 3C60D 1XGYH 4NBXB 4YPGA 2VB5A 1HXYB 1NGWA 3D18A 5I0DA 5MHSE 3V6ZA 4S11A 4U1SA 1MQKH 3LKRA 3MFFB 3UX9B 5T1KA 4HK0A 3HR5A 4EXPX 4Q56A 1HL4A 3U48A 4IBSA 4CILA 1HFUA 3O6KH 2FLRT 3MLPA 1VENA 4P49A 1CCZA 2CRMA 1U95A 2VN6A 3FT2A 3HPLB 4QTHB 1YMHB 1TSRA 1NSNH 1W80A 1QWUA 5CJOL 1D6EA 5F3FA 4M7JL 1T4KB 2JQZA 1IARB 3FK3A 1KLUB 3NEEA 2Q3XA 4F1ZA 1XR8A 5HTSA 3KDMB 4EN2A 1WHOA 2ARJB 2QADC 5FYLD 4EDXB 4MMXB 1XSKA 2YSSB 3K72B 2W5PA 4WTZG 1KY6A 4PS7A 1RLBA 4QRUB 2PP9A 4JLRB 5TE7H 3X11B 1DZ0A 1QO3B 2XVGA 2YSTA 3IM1A 4S1QL 5KBLA 2XZCH 2WINB 3FU8A 2O5ZL 4N2IA 3H3PH 3V9CA 5MERA 2FGZA 5EZIL 3DHUA 1PAMA 4LSQL 5LWYH 1PAZA 8CGTA 3V0FA 1AOHA 5FC9A 4Q74A 4F7PA 1T4KA 1KG0A 4OZHF 5EBWA 4GRLD 1A3LH 2KZ1B 1G6RL 4H0GA 1U41A 4AVHA 1YMHA 4QTHA 3FZUD 2ZX9A 2A4CA 1AR2A 1N64L 1XGQB 4L1LA 5KEZA 5FO8B 4NQUA 3IXTB 2HA1A 1S9VB 3E0GA 4OJDH 4PJBB 3RBGA 4HK0B 4MVBC 2EYTB 3C6SA 3A24A 3WEXA 4BFGA 2E9WA 5IVXB 2PO6D 1NGWB 3DSNA 1TEFA 3PFUA 4AL8L 1I9RH 4NP9A 2BC4A 2QVFB 4BZ2L 1SRDA 3QORA 4FQLL 4XPTL 4NC2B 3NZSA 2Z0BA 1ASOA 1U8CA 4N0YH 5GGSY 1WE5A 2KPNA 5CLTA 1R9FA 2VXQH 3OGCB 1G9NH 2GSIB 2H26A 4P23C 4GRWE 3RYMA 1UWXH 2Y25A 3P4NB 4MS6A 1PDKB 2BHYA 3QHTC 5E8PA 1X9UA 1S7QB 3N43B 4OZGB 1E4JA 4JY5H 4C4BA 4UQDA 4UM9A 2FEDC 5D1ZI 2Z8SA 4F15B 4HLEA 1FQ9C 1ZLWK 4MZ3A 1JZ3A 5E00B 2ZWNA 5JIPA 3TIEB 1JNHB 3BCFA 3QEHB 4CSZA 5LVEA 5EFIA 4WEEA 4CN4A 3TEZA 4J3VA 4PG2A 4Y19A 3WFHB 1RUAL 1RUKH 1D3CA 5FDYA 4WY7H 1AVAA 5SWSD 1RK1A 3DRTB 5CIPB 1E5YA 3TA3D 1AZNA 2WXFA 5KN5B 2O5XL 2ZKYA 5E4AA 5ADOH 3TOPA 3CFJB 3CSYA 5ALBL 3MOBH 1NFDA 5K9QG 3Q6FB 2YD3A 4FNRA 4KJPD 4ZI8A 4O2CA 2V0AA 4WJ5A 1JD7A 5AW7B 3AM8C 1V3KA 2BP0A 5DFWH 3VVVA 5KVFH 1NGXB 2FYYA 4M8UA 2VN4A 5KBNC 2CDFB 4HIEB 1UOVA 4HX1B 2XYBA 1UM5H 1J05B 4RGOL 1T21B 4AC4A 5DD1H 4G7RB 4UUJA 1EMTH 3G5XA 3OMIB 4I3GA 2XWDA 2ESVB 1LO0L 4J3UA 1HEHC 3BIKB 3LXCA 5J1AA 3VRLE 2J4WL 4QMEA 4UINH 3S36X 5DRNB