1A7BA

Engineering a misfolded form of cd2
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
93
structure length
93
Chain Sequence
TVWGALGHGINLNIPNFQMTDDIDEVRWERGSTLVAEFKRKPFLKSGAFEILANGDLKIKNLTRDDSGTYNVTVYSTNGTRILDKALDLRILE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD2
publication title Engineering an intertwined form of CD2 for stability and assembly.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Domain swapping
total genus 7
structure length 93
sequence length 93
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1998-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a7bA00
1MRDH 4IS6B 3FQRA 2V2WA 3CMOL 1UKSA 5KTEH 1D7FA 3EO9H 4MHHI 4PLOB 1GHFH 2CR6A 2N1KA 4NQSA 4HBCH 3ZTNL 3RNKA 4NSKA 3MRMA 1GGTA 5MEND 2W38A 1JK8B 2FJGA 2B0SH 1MUJB 1TQCB 2PCPB 1M7DA 3PGFH 1CVSC 1VSCA 4YEFA 3O9WA 4X5WA 5EOTA 3C2AL 4X6DA 3RBGA 3RZCB 3VXME 3FQNA 3KPTA 2W65B 2V5RA 1F5WA 2YBRB 4I2XE 5DT1H 4HIIA 4UT6H 5D2NB 4DGVH 5IMMB 1NGPH 2SEBB 1RIVL 2XQBH 4LHQB 3DRQA 3DYMA 4DFHA 1R3IL 3RKDC 2DL9A 2E6PA 5KS9B 1CGXA 4NP4H 5FGBA 2VLKA 2XPGB 3ULUL 5GSRA 4QRTA 3T4AA 4XGZA 2YPKB 2Q7YB 2JJTC 1BIHA 2W07A 1A3LL 1AGFB 2XFXB 4LSQH 1W8OA 3QRGH 4LASH 4UNUA 3FO9B 3RX5A 3MMEA 1MAJA 4FFVD 4GRLB 4P59L 4YR6B 5E00A 4KK8C 4NQCE 3TVMA 2Q8AH 1M6OB 3BKML 1T04A 2R0KL 3FMGL 1NBYA 1FZMA 5ESQB 2M2DA 3IDYC 1JCKA 4YNYA 4PJEB 3S3SA 4NZJA 4GXUN 1GC1L 4Y88A 1TQBC 3SKNA 3GB7A 4N5EC 4HJ0C 3K0WA 4KMTH 3N1PC 1KJ3L 1DVFB 4EN3D 4MXVF 5IBLD 2VL5A 3WN5C 5FUCC 5AG8A 4P48A 3SE9H 4NWTH 1FH5L 1MCRA 2NQCA 1BAFL 5FGRA 1ZS8B 2OP4H 4RAVB 4RWYH 3MTRA 4YHZH 1JZ3A 1KIQA 1LO2H 4U2ZA 1NGWA 3LQAC 1N5YL 1YEHL 1PD6A 4HXAL 1QO3A 5BQ7A 2CKNA 1IT9H 1X5KA 1RZ7L 2ICES 1JE6A 2P5EB 4N0UA 3WNNA 3D2UD 4PRBA 5C71A 3QXDA 4P2CG 4J4PD 1ZT7B 2CJUL 3GHEL 3OKEA 3TCLA 4GG6E 1PG7W 5HTSA 5T1MA 4JFQA 3UJJL 1BFVH 2R8SL 4HIHA 4J3OC 3DSNA 1XZ0A 1SBBA 4NHCL 4M7ZC 4UIMA 4XAKD 3CX5K 2E9IA 3GI9L 1IAKB 4JFPB 1T21B 4RMUA 3TNNB 3TIDB 2ZSVB 3GIZL 2AJ3B 2JB5H 1HOCA 3FN9A 4ZOCA 5INDB 3RDTC 1KT2B 3VFSB 4NQDA 4OGAC 1JWSB 1EIBA 4H5SB 3UYPA 2GSGA 1BD2E 4PJ7A 3MRPB 5J6GB 4IHOB 4LCCC 3F58H 1DE4B 2IQ9L 3DTXB 5LAXB 2V2TB 4U1KB 2W60B 3DV6A 1A02N 5K9OA 4G5ZH 3MOAL 2R2BA 4Y4KD 4KHXL 5TE7H 3QDMA 2RIKA 1YPZE 2IFFH 4ZUUB 1MSPA 2Z31A 4WEBL 2HLFD 3IAGC 3CFJB 3VMPA 4I8DA 1IQDB 1SVZA 4PJ9B 3F7VA 5EPMB 1F8TH 3KLAA 3S4SB 2FWOB 3V6ZA 1FFNB 2UUDH 2KBGA 5FYJH 2XN9B 4NUGH 4PJIA 4DOHB 5ILTH 4HUWA 4HUVB 1FIGH 3V5KB 4WCYL 4ZS6C 3U79A 2K7QA 1CDUA 1N5AB 5BRZA 3VFMB 3FB6A 3OKYA 5JXAH 4UOW0 1NCCL 4WEMB 1QNZH 4MLIA 3NPSC 3H7BB 2IJ0C 3QUXB 5GIRB 2PYFB 4NKMA 2NY1C 5FOBB 4Z7WA 3ARGA 3AB0C 1EH9A 1I7UA 1CLYH 4NNYA 3N0PB 1HXMA 2ZUWA 3NIFF 2EDXA 4LLMB 3V4VL 2E6JA 5B4MC 4P23D 4G8GE 1F3DH 5IK3B 4S10A 5GGSY 2QQNH 3QEQA 5I2IA 4P46A 4R4ND 3AAZB 3FB7B 5DSCB 5C0AA 5IT2H 1C12A 1GXEA 4PR5B 2AGJL 5FM5M 4M8QB 4JM2C 2BSTB 3LQZB 1YYLL 4RFOL 5JIPA 3HS0B 4NO2B 4PD4J 3LHPH 4Q2ZA 1I85C 5IFHH 1BZ9B 3BWUC 3I6KA 2XZAL 4RFEA 3ZMRA 1H8OA 3ZDXF 1X7QB 3ARDC 1NCUA 4IDLA 5T3XD 1CFBA 3MRLB 4WFFD 2IMMA 1XGQA 2VXSH 2YWZA 4XVSH 1Z5LB 3WS6C 3WIIH 5I18L 4OZHF 1JHKL 1MFAH 2XWJA 2CR3A 4MDJA 4HK0B 4WUKL 1G9EA 4AY0A 5ACZB 5HYJD 5EC2A 4KZEL 3CCHA 5DRZB 1E4XI 4WO4D 2R4RL 3BP5B 4JHWH 4GXVL 4AJ0A 3VRLF 5FKPA 2GAZA 1P4BH 5DMIH 1R3HA 3MBXH 3MR9B 1AP2B 4MB3A 4JZJA 3LRSB 2CRIA 1WBZB 2ZUQB 1J8HA 4B50A 1CT8B 5DVMA 2VDLL 3GBLA 5KW9H 3BP7A 2NMSA 2NW2B 4IIQB 4PRPE 1EO7A 5I75C 4MXQC 2JJSA 1AY1L 1E4JA 4HH8A 3MV9B 1M7XA 3U36B 1CS6A 4ZAKB 2CK0H 3WIFB 1BFTA 1DR9A 3GJFA 3MA7A 7FABH 4AT6B 3MXWH 2VH5H 1FZKA 1B0GB 3QG7L 1BVKA 3MLYL 3NACH 1BPVA 4R96B 3I6LD 4JZNA 4M1GH 2HP4A 3OR6B 3VFTB 4HAGA 5J8OA 2R4SH 4NKIL 2ICWJ 3EDEA 3QDJD 4OZHB 4PJXB 3GO1H 4KKCC 2WBJD 4NDMB 2BC4B 2XNAA 3OGOE 1FZOA 1OTUC 4XXCA 4OCXL 3HAEH 3BGMB 1KXTB 3ZE0F 1TTFA 1WGOA 4ZXBD 1N7MH 4MDIA 4XBEL 3BQUB 5KZCD 3C5SB 2HRLA 4R2GC 1M71B 1FC1A 2HJKB 3O3DA 3N50A 4LKXB 5C07E 4L8DA 4Y5YC 4JFDE 4OLWL 4PJFA 4LKCA 2E9BA 1H3TA 3VW3H 3FFCE 4UAOB 4GBXB 3D87B 5C7XL 2IH1A 3KAAA 1CD8A 3TO4C 4CBPA 5IKCB 3DX7A 4FNLL 2A9NL 5C9JA 4UILH 3TPKA 1IGJB 3ARWA 1FJ1B 4AM0A 3H3PH 3K1DA 5D6DA 5J7CC 4G9FE 2NLJB 3KPOA 5J12C 3LV3B 4FMKA 4PIRF 4H25A 4KRPD 5KSAC 4Y1AD 3HE7D 1I8KB 1NMBL 3HI5L 3RWGB 1NANI 5E4EC 2HJLB 1KC5H 1RZIA 2AABL 3GNML 4LF3A 4FFWD 5IW3A 3ZSTA 4HH9B 3HR5A 3UO1H 5JW5B 2DN7A 4OCRL 5KVEL 4FTVE 1HK6A 3QIWC 1FL5A 1L7TL 4LAQL 4R3SA 3G5VB 1JTTA 3GZKA 3BISA 2DM7A 5EN2B 3U2SA 5C0RL 4IRJD 3MJ7A 3KPNA 5D71H 5GXBB 2VLJB 3IFPA 1V8HA 2HMID 1NBVH 1ADQH 4NFBA 3KPRB 1H0DB 3SDXA 1SYSB 1U3HA 3TN0B 1A9EA 5D2LE 3GDBA 5DEGB 4UT7H 4MSWA 6FABH 2R1XA 5EZIH 3RWEB 1FSKB 1L4IA 2QHLA 4WI2A 1G7LB 1XF5A 3GSOA 2F5BL 5DDHB 5AD0A 4FZEL 3SCMD 3LN4A 3ULVE 2VZOA 5C92A 2CXGA 5GGRY 4YZFF 3D18B 5C09D 5D1ZA 2APBA 2VLMD 3MV8B 4HV8B 1VACA 3FO0L 2J88L 4N8VB 3WDJA 4BZ2H 4BH8A 2ZZUT 4NZRH 1C5DB 3TV3L 5DQDL 3OR7A 1A7BA 1OCWL 2W0KA 2L4OA 1ACYL 4KJQC 1OQOA 2R0LL 2BHZA 4R7NB 4Z7QF 3CDFA 5FM8A 1HDMA 3ZT5A 1QVOB 2AJYL 4N0CD 3IKCA 4L4TB 4MAYD 5F7EH 4ZTOL 4H8WH 2D31B 2EYSB 1P1ZA 4X98B 3BUYB 1D9KC 2PXYC 1ND0B 4XP9L 4XXDB 1MEXL 4RCAA 4WVRA 4OCYH 1U58B 1FAIH 4FN0A 4E41E 1X6LA 1SJEB 1MI5D 2GUOB 4ZFFA 2FR4B 4NZTL 5H94B 5T3ZH 1G7JA 4KK5C 2DQCL 4LLWA 1VFBA 4LIQE 1F3JA 4RQQB 4ENED 4NQVA 4OGYH 4X83A 4ZFOB 2FHCA 4LMQE 2DICA 3U1SH 1OAXH 3GSUA 4QHMB 4NO5A 1FNAA 4Z7NF 1FNSL 5C0EA 4XP6L 3F7YB 1EHAA 4G6MH 4BELD 4GMSL 1F6FB 5HDBE 5JW4Q 3L3HA 5LKNA 4U1GB 5F9JB 4WTWA 1OGAE 3UZVB 3MLZH 1DL7L 1H15A 5L8KB 4WHDA 3VWJC 1G9NL 1XH3A 3L3DB 5D1XC 3T0AA 3STZA 4NOBA 5EWIL 2R2EB 3K74B 2QADC 3HE6D 3T2NH 1QSEB 4GKSB 3L5WA 2JJWA 1KPRB 4NQEE 1UXSA 4JDTL 1YC7A 1W72H 2MCPL 2P24B 4K7PH 2CK2A 4LHUA 4PJDA 1A4KA 1KEGL 4PJGA 4OFDA 4D0BB 3PGDA 3S36H 1LMKA 1EVUA 3EDKA 4YIQA 2Y07L 1BVZA 5LQBH 1J0IA 1J87A 1PVHA 3EO0A 4OIIH 4ALAL 1QPPA 1W0WA 2ZP0T 1RUQH 4JFZL 3M17B 1URLA 4OZIB 3WIHH 4DZ8A 1Q9OB 4HXBH 3FO2B 3VXRB 3C6LB 5I6XC 4KI5E 4RSVA 3SN6N 4EBQL 4U4BA 4N1HB 1E4WH 1QD0A 4M7JL 2CDEB 4RGMC 2DLEA 4XNXH 3EIFA 1GGCL 5I9QB 2XWBB 1FYTE 1FE8H 5IMOA 2X42A 3TO2B 3X3GH 5FYKL 4FA8A 2A74B 1WWAX 2PR4L 1ETZA 4UTBL 3QULA 5D5MA 3PWVB 1KELL 1XGYL 3ARBA 3BPNC 4L4VD 4MA8H 2HT4C 4ZFOL 3KDMA 5SX4I 4XCEB 4WHYH 3VFGL 4FP8H 2B5IB 4NC1C 5DD1L 4FABL 4YBLC 3C60B 1EXUB 4D9QE 5F6HJ 1WEJH 3MRCA 3U82B 5F44A 4MD4B 1NGYB 1KJMA 1QRKA 3ESUF 3PF2A 1MHPH 4UOW1 4KPHL 2Q86B 2DF3A 3LKSA 1HH9B 1CDYA 5IVNA 3RTQA 5A2LH 2G60L 1F4WL 2MQ0A 2COQA 4QRRB 1T66D 2Z35B 4NT6B 4MB5A 4EI5A 2FGZA 3QI9C 4TVPH 5BMFH 3V4UL 4HWEH 2HFGL 1HSAA 2ESVB 5DR5H 2Y5TB 4L5FL 2EIBA 3RUGF 5C0NC 1RZJH 3JVGC 4JPIA 5FYJD 4PY7A 3CVIH 4TYUA 4IRJA 1H5BC 4XVUD 5IJKC 1VHPA 2DQDL 3P77B 4PUBH 3TBVB 3PP3H 1FVDA 4TSAH 4JM4L 2VQTA 1XMWA 2JB6A 4L29A 3UYRH 5HGAB 3KNBB 3QEUB 4A6YA 3GK8L 3MRHA 2Z8RA 3SQOL 4G7VL 4F7TA 5A3IC 2GK2A 5T5NG 1Y6MR 1AR1D 4Y5XC 5IQ9B 3CH8A 2AJZA 5C09A 1ROWA 2R9HC 5J4MA 1DQJA 5TE6H 2DQHL 3SDDB 1ZGLM 1NKRA 2IPUK 2NNAA 2WANA 4BA8A 1U3ZA 2DIJA 4MGXA 2LU3A 3ILPB 1D6EB 2VZTA 5DUMH 5HVHB 5C1MB 3UPRA 4N1CA 4LCWD 4PRIB 2XKSA 3WLBA 2QSTA 4WWKA 5JLZB 2P46B 3SDCD 2EO9A 4CVZB 4NZDA 2A6JB 5F7DB 1GZPA 4BYHA 4PREB 3IGAA 4UUJB 2XICA 5DZLA 5AZ2L 5CGYC 5GRJH 1EEUA 1EHXA 4XX1G 1KN2H 1YQ2A 1CTNA 3MRIA 5C0GB 3EO1A 3FL7A 3O0RL 3QUYB 4HPYL 4FQCH 4FQJH 1IGFL 5IW6A 2ARJA 2AEPL 3Q48A 1LNUB 4LHUG 5TDOB 1JF5A 1ZXQA 3ARED 3H0TA 2D0FA 2R0ZH 2HT2D 3I84A 3LKOA 4U1NB 1M4KA 4JRYE 2R29H 3UTPE 1N6VA 2OSLB 3DO3A 4PRNB 3VD5A 4IRZL 3GRWL 4F80A 1J1XL 1S5HA 4M5ZH 4HF5H 4YC2C 3IXTA 5ID1A 4X7TA 2D4FA 2P44B 5E70A 5D93C 1D5BA 4XVJL 2BMKA 3G6DH 1MJUH 3ZDZF 4Z0BL 3P0VH 5EU4A 2VZUA 2DDQH 1TJIH 4J3TA 3T3PE 5D7JB 4NN5C 1U8LA 1QBAA 3RVXC 3GGWB 4WI6A 3JTSA 3HE6A 4R0LA 5FUCE 2V7HA 5HSFA 5E5UB 1E27B 4IOFD 1LQSR 2EDWA 5IJVA 1BLNA 4EOWH 3O8XB 3GSQB 3CFBB 4G6JH 4P4KC 5JA8B 1R3LA 5DJ2A 3OL2A 4QRPE 4OCSH 4JGJA 1U8JB 3LKPA 1IC7H 2QTEA 2GTZA 1M05A 2H32B 3SKUD 4OUUB 5IB1B 4ONGH 5IBTH 2X4SA 2Z92B 4XC1L 4QLRA 4JLRB 1BP3B 4RGOL 2ZSWB 1OSPL 5B38A 3S3JA 3QHFL 1MJ7H 5EZJA 3TFKC 5I1CH 5EBGA 3DI3B 4XCCH 4POZC 5DRWB 3UTTA 4K3HA 5DC4B 5JNYA 5IHBA 4HCRH 1JZ6A 1WT5C 2XIDA 2DWEA 2H1PL 3WKNA 4JQVC 5HHOB 1T5XB 5C0IB 5C0CA 5CLTA 2BOBB 3MBEA 3OAYK 1A6AA 1NC4A 1GOFA 1V7ML 3U0PB 5EO1A 3QJFA 1OVZA 5E99L 5E9DE 4LFHG 3U46A 3C6SB 3FQWA 2X7LB 1E28B 5SWZA 4QOKE 4I0PB 5IEKA 2ZWLT 4RMRA 3EFFB 2UZIH 3E8UL 2WWMC 3T65A 1LE5A 5E8PB 2P8PA 2BVYA 4K23H 1D5MB 4ZSOB 5I15H 3WL9A 1AO7D 3OZ9H 2EXYC 3L3OB 4GRWH 1P7KB 4JFEE 4LDOB 5DRXA 3BZEB 3TJHD 3FONA 1F58L 3D0VA 5EFIB 3I85A 1WAAA 4L1DA 4F9PC 2C7UA 2FX9L 3MREA 3KWWA 4EI6B 2X2YA 3DO7A 4KROC 4LCYB 1HHGA 1JV5A 5CD3B 4P57A 4MD5A 3OQ3B 2EXWC 1R0AH 4ODHH 1JYNA 5C08D 5TPWH 4F2MA 1FL3B 3QCUL 4Z0XB 3QEGL 2HTLC 2G9HB 4KJYA 4AL8L 3HZVB 3WNPA 3BZFB 4LLQB 2FJHA 4YDJA 1P9MA 3S35X 3ARFD 1T4KA 4E5XB 4P2OD 2J5LB 5HXMA 3RL2A 2YD6A 2KZWA 4Z6AT 1BGXL 4CVXB 4HKXB 2Z8WC 4PTUB 1RFDH 3LN5B 1C7SA 3NIGF 3PHOB 1S9VA 1C5BL 3DV4A 1QSFB 1OTTD 1ZT1B 5K9KB 1TVHA 4OIBA 1T03L 4LAJH 4DW2H 1NGXA 4I48A 4O4YH 2HVJA 3SJVB 1VPOH 1OTSD 2W9EH 5E5MB 4X6DF 3S37H 1OWRM 5FO9A 1AJ7L 3QJHB 3ZKXC 4BSWA 1KCKA 5DFVC 1C7TA 2BNQD 5FDYA 4K71C 2DBLH 3KLDA 4HFUL 3PWPE 5CILH 3SDCA 1NEUA 1U36A 1TENA 1HHHB 5F7LB 2ZCHL 1Z6JT 3FJTA 1QFWI 3FT4B 2MHAA 2IGFL 4M62H 4M03A 5SWSD 3RPIA 1INQA 3QQ3A 2YD9A 4XC3L 3FQRB 2V2WB 4OD2A 5M94B 1U8PB 5D1QD 2G2RA 3UYOD 5EBLA 1RZKL 2EZ0C 4NQSB 2MPAL 4W6YB 3T0EA 1OAKH 1NCDL 1GGIH 2F19H 3FT2B 3RNKB 4NSKB 5A43C 3O3AB 5J1TC 3O6FD 2IBZY 3A67H 3VXOA 2FJGB 2X9XA 3OWEA 1YZZA 4L8SB 1M7DB 2EICA 3O9WB 1EEYA 1AHWC 4HUNB 1XAUA 2PTTA 3BPCA 3Q1SH 3QUZC 5D7IE 1KN4H 3FQNB 4XWGL 3H9SD 5B38G 1BOGA 4HIIB 5F6IC 2XKUA 4PJAE 2P5WE 4MJIE 4XVTL 5ADPH 1FGNL 5CEZL 2VC2L 4YHYC 1NUNB 3WFBL 2NR6D 2VLKB 2I5YH 5E7BA 5GJSH 2E7CA 4TPRL 4M48L 1QR1A 3OB8A 5GSRB 3T4AB 4HKZA 4XGZB 3T2OA 2X6MA 4MS8C 3Q3GA 5ISZD 2R1YB 4DN3H 1B2WH 3MMEB 4K8RH 3HAEA 5E00B 3JV0A 3TVMB 2NTFA 5BO1L 1FPTL 4FFYL 4MNGE 1T04B 2JTDA 5F89A 5CUSL 1NBYB 1QRND 1FZMB 2D2OA 4XP4H 1GH7A 4G8FA 2H41A 4YNYB 3QEHA 4BZ1H 3GSNH 1TQCC 2VL4A 2DQGL 4HS8L 3SKNB 3GB7B 3V0WH 2FEEI 5D70H 5LWYH 1OWWA 2Y06L 2VL5B 4G80A 4X7DC 5ERWA 1TDQA 4S1DC 3RZCC 3IVKA 3RA7H 4CN6A 3NCYS 3G08A 3B9KA 4LPXA 1F90L 1KIQB 1P7QD 1NGWB 1X5HA 1LK3L 2EDTA 3QXTA 1A1OB 1G7MA 4GKOA 2YXMA 4X7EC 5GGVH 4PJ7F 2CUIA 5MERB 4MJ5A 1QO3B 5BQ7B 5MEPA 4N0UB 3T77A 3ZKSD 1D5IH 5E2WL 3JWDH 3VA6A 5JORB 4PRBB 4Y19D 4I5BB 2BOCA 3HPLA 3QXDB 1U8IA 2JCCB 2R39A 2VDOL 3BX7C 1NBQA 5IHUL 2X10A 5E8OA 3TCLB 3E2HB 1AGEB 5T1MB 4JFQB 1V7NH 3TWCH 3V0VB 4HIHB 1XZ0B 2A1WL 1BF2A 4YX2H 1ADQA 1YY8A 4UIMB 3EDJA 5E1AB 2N56A 3UJTL 3I50H 2V7NA 3MX0A 4HK3N 4LEOA 3RNQA 1Q8MA 3MV7D 2ORBL 3MACH 4PJIF 5HY9A 4U6TA 3O4LE 4K3JL 1S7XA 5TFSL 2JJUA 3NBNA 4JFFE 4JN1L 1HOCB 1DVFC 1FNEA 4TSCH 2DQUL 1MCOH 5B3JF 3T1WA 4NQDB 5I8OH 3DGCR 4Z7WF 4OLVL 5CINL 1YEFL 4KDWA 1LO4H 4YFLF 2GSGB 3ARFA 1WZ1H 2CXKA 4FQ1L 3V5DA 4PJ7B 2VR9A 4P2OA 2BVPA 3SKJH 3JWNC 3S37X 1LO0H 3RWCA 4J8RA 2NXZC 3BMVA 2BXYA 4JKPH 1QUNA 1UWEH 3IXAA 2O26U 4TSBH 3L5XH 2GJZA 2BSSA 3RIAK 1A7NH 3VXMD 1VCAA 3BN9D 3QDMB 2Z31B 3KR3L 3MRBA 4RZCA 2DQFA 3KPSA 4FFVC 2MFNA 2VLRA 3F7VB 4P0DA 3CC5A 3QIUB 4DGIH 3CXDH 3IDXL 5C0BE 4F15B 5CJ5A 4BQ9A 1RPQA 2YZ8A 5KVDL 2ED7A 3MZTA 4C56B 2BX5A 5J9PA 5T5FL 4PJIB 4Y4FA 4HUWB 2IBGA 1ZLSL 5GZOD 5BRZB 2NY7L 3FB6B 4YXLL 2V5TA 4NGHL 4G6FD 3C2AH 3FFDA 5EIVA 1WZKA 5DJXA 4NKMB 4EN3C 4Z7WB 2MCG1 4U1IB 4NNYB 4NQCD 1HXMB 2DQJH 1GSMA 4APQC 3MPCA 5SWSA 1BZQK 3LEVH 3LPFA 1YNLH 4C58B 3BH9A 3QEQB 1LP9A 5I2IB 4P46B 1R3IH 2K9UA 1MQKH 1HKLH 1WBYA 4WFHE 5C0AB 1JN6A 1C12B 3G6JA 4JDVA 5EA0H 2DIAA 3LS4L 3ZT7A 3EYVA 4TVSa 4GW1B 5MENB 2EC8A 4Y16D 1A3LH 4GQPH 1X4XA 3BKJH 2XACC 4Q2ZB 2E7LA 3MGTA 5EU5A 4P59H 4XBGA 3HAEG 4LVNB 3BKMH 1KPUA 3E3QC 4H26A 1GPOL 4RFEB 1W72A 3WDIA 3FMGH 1B4JH 1ZEAL 2Z93A 1NGQL 2R0WH 1XGQB 4S0TD 2LU7A 1NCBL 4LSVL 4AEHH 3RVTD 3BH8A 3QFDA 2XWJB 3VXNB 3Q5OA 4MDJB 5JR1L 1KJ3H 5AZEL 3JBG7 5EC2B 3WIHA 3CCHB 4O2CA 4U3HA 3TA3D 1WF5A 1WWWX 4MVBD 1QLEL 1DZBA 5FKPB 2GAZB 2QSVA 1KTLA 2VQUA 1R3HB 4OLEA 1J0YA 5DVNA 4JZJB 3NA9L 1A3RL 2AJUL 3F12B 1J8HB 3LS5H 5FF6A 1UB6A 3GHBL 3AMLA 4PJFF 1HHJB 4LNRA 1TLKA 4DN4L 3NCBB 3KXFA 5DD6B 1B0RA 3C5ZC 4RRPA 1PW3A 1U93A 4FQQA 4N8PA 2D9CA 2CJUH 3K1KC 4RMQA 3OBAA 3GJFB 2PYEE 1NDGB 3MA7B 4M1CD 4NC1E 3U30C 2R8SH 4V1DA 1MRCL 1BVKB 3OGCA 4NHCH 4DKFH 1FFOA 4JZNB 3WYRA 3HC0A 5FA4A 1NH6A 3P3YA 5E1HB 1A9BA 4JQIL 2H45A 2CKBB 1UWGH 3FN3A 1P7QA 2XNAB 2IQAA 1CZ8L 1BZ7A 4N0FA 2WAHA 5EORL 3UROR 4L3AA 5KAQG 5TQ2L 1MFNA 2OI9B 3NVQA 4G42B 3WFDH 1ZOXA 4MDIB 3DSFH 1WCBB 4AH2A 1CXFA 3O3DB 3MNVA 4PV8A 3V6FA 5C86A 1I9EA 5K59F 3CK0L 4L8DB 2DJ4A 4PJFB 2J7LA 3SDXF 4LKCB 3RX7A 2IQ9H 4KKAD 3MC0A 3IJSA 2IH1B 3DX7B 4ZTPL 3RGHA 5HPMA 3TZVD 5CHNA 2E5EA 3WJJC 4WEBH 4AM0B 1JBJA 3ORJA 4Z7UA 5JHDA 3SGEI 4IRSD 4G8GD 4NYLA 5C2BL 3IFNL 4H25B 2I25N 4HIJA 1S5IH 4JFYA 4QXTB 3BRDA 1OL0A 1RZIB 4LF3B 3BP6A 4P9HC 1CLCA 3QAZC 3HR5B 2C3HA 2FHBA 2EDQA 4D9LH 1L0QA 4JJ5A 4FRWA 4UT9L 5DMKA 4Y4HC 4NKQB 1PYWB 1FL5B 4X4YA 4R3SB 5KVGL 1NSNH 2HFEA 4D3CH 1A6VL 1ZLUK 2A0LD 3U2SB 1X4ZA 3MJ7B 2F54E 3V4VH 5MEQA 4JY4A 2FGWL 5T5NF 1MIEH 2A38A 3X3FL 1U3HB 2JIXD 1A9EB 4I2XA 1Q72L 2CKBL 4MSWB 3KS0H 1AR2A 5FHBH 1MNUL 3EYQD 1XF5B 3GSOB 2Z0BA 2Q7NA 1NCWL 4W81A 5EOCH 4U6HA 2PUQT 3BT2L 2ZG2A 4I18B 4M5YH 5JDJA 2XZAH 5D1ZB 1IILE 1CICD 1QBML 5TGBA 1VACB 3HNSL 4J6RL 5D7SH 5FB8A 4Y2DA 4KUZH 4NQCA 3C08L 5FYLE 1ZHBA 1YEDA 3OR7B 2A6IB 5CP3H 3BGFC 4PRPD 3DETD 4DUWA 1HCVA 2CRZA 1T0NA 1TETH 4P2RE 2DKUA 1CDJA 1HDMB 5CSZB 3S34H 1DTUA 5F71A 2DOCA 1RJZA 1NAKH 2R4RH 3B2UC 3IKCB 3MOQA 4ZXBC 1MOEA 4V2CB 2VYRE 2NY0D 1VFUA 3TEUA 4PJDF 1H3WM 2LE9A 4PJGF 1OAQH 4ZFFB 5BZWA 5I66B 2AXJA 4RMWA 3LQAH 2VDLH 4U0RB 4ZD3L 4ONHA 5JOFA 3RGVD 5F7WC 4OI8A 1G7JB 2VO5A 1VFBB 1FAKT 1AY1H 1VA9A 1F3JB 1G9NC 4X6CA 3HZKA 2O61A 4NQVB 1U95B 5JOPE 4RRPG 3VMOA 5I1GL 4PD4K 4NM8L 4NRZB 3GSUB 4Y5VC 3TYFA 4NO5B 3B9VA 1J5OL 4WHYG 1OM3H 3VXUE 3O3UN 3IU3B 5C07D 4JFDD 2A6KB 3KLHC 4H88L 2A77H 3L3HB 1BWWA 1JGDA 4NKIH 3MJ6A 3TIEA 5HGGS 3FFCD 4FFWC 1H15B 1YEKH 1N6UA 3DROA 3BW9A 3STZB 5D5MF 4HCRA 4QXGL 5GS0D 3H9HA 4XH2A 5F7NC 3MV01 3OB0K 4OLYH 4P5KA 1HQRA 1MFCL 2Z8SA 3OKDB 3EFDL 4WUUD 4XBEH 4G9FD 2HMIC 4LHUB 4PJDB 1NMAH 2FB4L 4PJGB 3PGDB 4P5MA 4TUJA 1NL0H 1S78D 2XTLA 4YIQB 3WO4C 1KSRA 1EO8H 5C9KA 2Z8VC 3EO0B 1FL6A 5F70A 3MROA 4FTVD 1FCGA 1W0WB 1BD2A 1I3RB 3UC0L 1Z9MA 1FLRL 1I9RL 4FNLH 4AENA 4DZ8B 3HI1A 1U42A 1IC5L 3PL6D 3QDJB 1QR4A 3GBMH 3SCMC 2GCYA 5IVXE 3T8XA 2GT9B 4QYOA 2WBJB 1AXTH 2ZCKH 5F7UA 5GZNC 2G75A 1NMBH 4HQQH 1XGUA 2NX5E 5IMOB 3V4PH 2AABH 3EDDA 2AJXL 4OD3L 1FRGL 4OCRH 1ETZB 5D5MB 3QULB 5T3XL 2ZG3A 5FCUL 2AXGB 3ZE2F 4P5TC 4YE4L 5IB2B 4XB8A 3KDMB 3ULVD 5C6TL 5ITBH 4N0CC 4KDVA 4MAYC 3LH2H 3CH1A 2W9LA 1YEGH 3A6CL 3MRCB 2VXUH 3SOBL 3RY6A 1KJMB 1IGCL 5ITFA 3BKYH 4IRSA 1XGTB 2VXTL 2X1PA 3N1GC 4JPKH 3KYAA 4FZEH 5CEYA 4EI5B 3OKNA 3U9UA 4YO0A 4YWGH 3KYOA 2Y7QA 1HSAB 2X70B 5HHXL 4PLNC 3V52H 3CJJA 2J88H 3LPGA 3FAXA 4E41D 4PGJA 2PO6A 4JPIB 4PY7B 4IRJB 1VFAA 5DQDH 1Z9OA 2AS5M 5DI8A 1GRWA 4QNPE 5BVJA 3MZGB 3K3QA 1EDQA 3V6OA 2WK2A 2RGSA 5D9SB 1XIWA 1FVDB 4H20H 4L29B 4PJ8D 2Y6SC 4MJ6A 3VXQA 5L7XL 2R15A 3DMMA 2AJYH 1AD0B 1WFOA 5DVLA 5IB4B 2APVA 4F7TB 3KYMA 4X5XA 2EO1A 4KAQL 5SX5H 4GS7C 3SE8H 1IGTA 1MEXH 1GGUA 3SHSA 4JO2L 4EXKA 2AJZB 2UY6A 4B0MM 5JMRA 4DCQA 5C09B 4NZTH 4WEUD 4ZUTA 3AU1A 1CICA 1DQJB 4NNXB 4KV5F 5MI0B 3GIVA 2NNAB 4JO3L 4O02H 2XTJB 3R1GH 2OMNA 4NQED 5J56B 2VDNL 1YY9D 3IDGA 3TT1L 4PRPA 4GW5A 3UPRB 4NC2B 3WLBB 1I7RA 3I02B 4WWKB 2IAMD 3FKUS 1RIHL 4XP6H 5DGQA 3NFNA 3W0WD 3HR6A 4GMSH 5DEFA 2F58L 1GZPB 1YUHA 4TN9A 1MCEA 1ZK9A 4LGRB 3VFWA 4GSDL 4DTGH 4LSTH 3NAAL 5L2KA 3VI3F 4TNWF 3J7HA 3G04A 3MRIB 4IMLA 4WI5A 5L88H 1MI5B 4KI5D 1S9WA 2R69L 2Y36H 3EO1B 2B1AH 3F65A 4QXWA 4ZOEA 4YDLB 5JTWA 5IW6B 2ARJB 2B2XL 1FNLA 4UV4L 2GJ6A 4OZ4A 2FEEL 3QXVA 5C0FA 2F74A 4KKLC 1OHQA 5C6PB 2C1PA 2Y07H 3JV4A 3ZHKA 3OKKA 3WNOA 2YSSA 2NY6D 5F9OH 1ZANL 4JFZH 4GAJL 4X6FA 4D9RD 5I1HL 1S5HB 3IXTB 5CBAA 1T66C 5ID1B 4X7TB 3TNMB 1D5BB 4PV9A 3SKOA 2BMKB 3GSNA 3OKMA 3VGBA 3PJSA 3TF7C 1UZ8A 5EU4B 4D9QD 3OSKA 4M7JH 1U8LB 3CVHH 1N8ZA 35C8H 3JTSB 3HE6B 1S7WA 2DJSA 4R0LB 2GW5A 1RZFH 1TZHA 3EO9L 1FNFA 1GHFL 3QO1B 5GS2D 5JQ6H 5AWNH 2AK4A 4HBCL 5IJVB 1BLNB 4L3EE 5IROC 2F53E 3D3VA 1MELA 5IMKA 5DJ2B 1B88A 2IMNA 1NLDL 2B0SL 3PGFL 3LKPB 3IJYA 2GTZB 3BPLC 2KKQA 4YBQD 3UTQB 5TJWK 2YC1A 4O5LH 2X4SB 3TBSA 1WAAF 1DN2A 1D5ZA 1A2YB 1AR1C 5B38B 5CWSA 3HCVA 4TNWK 5DT1L 4UT6L 2YPLD 3MGOA 5EZJB 1NGPL 3EHBC 5DQJB 5FO8A 3UTTB 5ADOH 3SDAA 5JNYB 5ANMB 2XQBL 1XF4A 2XV6B 4NP4L 2CGRH 2E8ZA 5C0CB 3ISWA 1FVEA 4LGPB 2AV7A 3MBEB 1JZ8A 2VDKH 2OYPA 1EJOH 4L5FH 4IBLT 5EO1B 4OAWB 3QJFB 4LASL 4E42A 3P30H 3U46B 4L4VB 1MWAB 4LLVA 1QQDB 2Q8AL 3MXVL 5SWZB 5IEKB 1L7IH 4FS0A 3BPOB 1HQ4A 3CX5J 1KG0B 1C08A 3T65B 1LE5B 2OJZH 2P8PB 4JM4H 1HILA 5E6ID 1MHEA 3WL9B 1KB5B 2ARWA 3N1MC 5DRXB 3FONB 3D0VB 5LJYH 1I8LC 2Z91B 4KMTL 3SQOH 2C7UB 4G7VH 3MREB 3KWWB 1ZMYA 3TPUA 1T1WA 1L6ZA 3DO7B 3VJ6A 3AREC 1HHGB 3CFDA 4P57B 4MD5B 4WI7A 4NHUA 2HT2C 1FQ9C 1TVBA 2DMCA 4RWYL 4YHZL 1LO2L 2IANA 4F2MB 2JJVA 5DVKA 1RVFH 3SBWC 1MAKA 3BZ4A 1WC7A 2KL6A 1EERB 4LLAA 5J13C 4KJYB 1IT9L 1F2XK 2FJHB 5DJ0B 4YDJB 5GS3A 1IAMA 3BI9X 1T4KB 4MXVE 4YHLH 4DJMA 3RL2B 3SEPA 4KK8D 4M9PA 3EYSL 4L9DA 1WIOA 4RAUB 1RY7B 4JPWH 1WK0A 3VRJA 3UTPD 2YD1A 1CD9B 1SM3H 2OXHA 2UUDK 2HWZH 3QBTB 4JAMA 2EDKA 3DV4B 4QCIA 2NY5C 1TVHB 2WW8A 1OGAA 5AAWA 4Z9KB 4N5ED 3P9MA 1NGXB 4I48B 1A14L 2HVJB 1MWAL 5DS8A 5EU3A 1CGWA 3AVEA 3MJ8A 4NQEA 3IDMA 4AEEA 2YHGA 3E3QE 2ADGA 2BRRL 5D6CA 1KB5L 5DHYA 3QQ9C 4PJBA 3SDCB 3ZYIA 1TZGH 5B8CB 1U2CA 2XN9E 3F58L 2EDHA 4XVJH 2MHAB 5IWLC 4WRLA 1RK1A 1O5DT 3RPIB 1INQB 4G5ZL 4RIRB 3QQ3B 1Z0MA 4RISH 4Q58C 4IS6A 2IFFL 4OD2B 3PWUA 3T3ME 3BKCH 2G2RB 3P73A 5FV2A 4QT5B 2OR9H 4X6BB 3ARRA 1F8TL 1P4LA 1PSKH 4OF5A 5IBUG 3WJLA 4HPOH 2ICCA 1FYTA 5FYJL 1U0QA 4FQLL 1P4IL 4NUGL 5E94A 1G7HA 5ILTL 1ZAGA 1FIGL 4OF0A 1E4KA 5DGRA 1EEYB 5I1DA 1S9XA 3U9PH 5JXAL 4XC1H 1HZHL 2PTTB 1UVQA 3VXPA 3BPCB 2OK0L 4FMFA 1B0WA 1MCWM 4RGOH 2H3NA 1HINH 1CLYL 2W65A 2IC2A 1BOGB 1CLOH 2O5XH 4QOKD 5D2NA 4U1MA 1S7UA 2D0GA 2MQCA 1G7PA 3O11A 2FLRT 4ZO8A 1RHFA 4UNVA 2H1PH 3VG0L 4FQXC 1S7RA 1HHKA 5IT2L 4JVPA 4F8QA 3CSPA 2IPTL 4HKZB 3QXAA 4XPHH 1INEL 2FECI 3HRZA 3Q3GB 4P2QD 4LSUH 2XA8H 4M6ML 3LHPL 5I73C 1EBAA 3HAEB 4GRLA 1QOKA 3LEYH 1F4YL 2DI7A 5IFHL 2NTFB 3NIFE 5F89B 3DX8B 4ESKA 3B43A 3E8UH 4G8FB 3C5JA 4PJEA 2R2CA 2VXSL 3QEHB 3DECA 3UZEA 3AROA 4PS4H 3VGFA 4ZS6D 4XVSL 4PYHA 3O9WC 5I76A 4CJ0A 4C57C 3VA2C 2EYRA 2NY1D 3I75A 5ERWB 1OTSC 5BV7C 3IVKB 5KAQF 5F3BA 5E2UH 5CKGA 5F97E 1P4BL 5DMIL 2V9TA 3RAJH 1ZA6A 3MBXL 1BJ1H 2F5AL 3VE0A 1G7MB 3SO5A 3QEGH 4WFFE 4MJ5B 1BFOA 4AEIH 3ARVA 4OJFH 5KW9L 3T77B 2P5EA 2OX5A 4UNTA 4HMDA 4QTHA 2FHFA 3RVWC 4L9LB 3HPLB 1YJDC 1U8IB 2C4FU 2FX7H 5HYJE 1RIUH 3NZ8A 5E8OB 4HKBA 1ZT7A 5D1QC 5TF0A 2BY2A 1SEBA 5ETUB 1BGXH 2FEDD 7FABL 4OLUH 3MXWL 2VH5L 4GFTB 1Y6NR 3ARDD 3PWPD 4ETYA 3O6FC 1OGTA 1YY8B 3NACL 1X5JA 4KQ4H 5J3HD 3FHQA 3PHSA 1C5BH 3IS0X 4LEOB 1FNGA 1T1YB 1UH4A 3RNQB 3GO1L 1U8MA 5HY9B 5C08B 1CGSH 4JHBA 2AJ3A 1CGVA 5BOPA 5HBBA 3OKLA 4C4KO 2HTKD 1FNEB 2RB8A 3VFSA 2PKDA 3CX2A 3UCRA 4MX7A 1N7ML 4Y8DC 1E4XH 1I3VA 2C26A 3P11H 2JJTA 1CDCA 4YFDB 1AC6A 2BZDA 3ARFB 3V5DB 4P2OB 4BK5A 3MRPA 1LP9F 2D9QB 3CFEA 4IHOA 2ERJB 1DE4A 2BERA 1JGLH 4J8RB 3RWCB 3DTXA 4JRYA 3ABZA 3IXAB 4X4ZA 3G6JF 3V6BR 1M1SA 2GJZB 2E8YA 5CP3A 1JGVH 1E0OB 1CL7I 4PB0H 5ABDE 4ZUUA 3H9YA 4UILL 3K8LA 3MRBB 4RZCB 2Y4SA 2DQFB 3ZE0E 3GKZA 3KPSB 5J11B 1A6WH 5MEOA 2VLRB 2VKXA 3H3PL 3CC5B 5EPMA 2P5WD 4MJID 3QIBC 1U8NB 3RWHA 1F2QA 2X4TA 4I1NB 3WN5A 1MPAH 3CFKA 2H8PA 3ZKMC 5J9PB 1KC5L 2BSRA 3B5HA 4Y4FB 5HHQA 4GAYA 4HUVA 1FO0H 4KKCD 4PRHD 5DK2A 1UCTA 2DLGA 5IEHA 4QRPA 2GTWA 3ZE1F 1MCLA 1OTUD 3FFDB 1DJSA 5DJXB 3QUXA 5D71L 2X89A 4LLMA 1NBVL 4R2GD 2PN5A 1ADQL 4XVTH 5SWSB 4JHAH 2J2ZA 1DLHA 3BH9B 1FZJA 1LP9B 3BOVA 4Y1AE 1WBYB 3NZHL 1IEHA 1JN6B 4LQFH 4UT7L 3G6JB 4JDVB 6FABL 4QHUA 5DD0H 3EYVB 5GGSA 5EZIL 1UYWH 3WSQH 3TO4D 2EDNA 3JV6B 1MH5A 2BK8A 4CADA 4DEPC 1YNKH 3MGTB 5EU5B 4OZGB 2Z31C 2VJXA 1KPUB 2HH0L 4H26B 1WLHA 3TLRA 3FT3A 4L4TE 5IHZA 5CUSH 5KSAD 4XAWH 5E9DA 2Z93B 1S8DA 3ECBA 3RDTA 4NZRL 3VWKD 2AAVA 1OT2A 1FP5A 5EU6D 1Q9LA 3QFDB 5DZNA 1TNNA 5C8JA 1J11A 3QIWD 5FYKE 5T1LD 4JKLA 5ICYA 1A6UH 4LCCA 3SO3B 4JFEA 4O2CB 5DHVH 4F7PA 5IW1A 3ARGC 4H8WL 4YZFE 3SQBA 1KTLB 4U1HA 3S7GA 4GQ9H 2ITCA 4IJ3C 4MD0A 3LSOA 2FYYA 1AP2A 2VLME 3RIFK 4QHLB 1YEIH 1BQSA 4OCYL 1DQTA 4U6YA 1WBZA 3SGJA 4RBPH 1UB6B 2VE6A 3O4OB 1CT8A 3O4LD 3WUWA 5DRNA 2OTWB 4IIQA 5E2WH 1FFPA 5T3ZL 2X4OB 1H3PH 1KV3A 3KXFB 4U1LB 1OP3H 1B0RB 3MV9A 3BN9C 4JGUA 1F97A 4FQQB 1U93B 4OGYL 5IHUH 1WWCA 1CIUA 1DP0A 1YN7A 2YRPA 1A7RL 4YPGA 3U1SL 1OAXL 4Z7UF 4V1DB 2A1WH 3OGCB 1FFOB 4G6ML 3HC0B 3VFTA 5FA4B 3N85H 1KF9B 4PJXA 1NLBH 3MLZL 1DEEA 1A9BB 4DVBA 3DPBA 4KJQD 8FABB 1P7QB 4K3JH 5GZOC 2IQAB 4LMQI 1K2DA 4Z7VE 1BZ7B 3T2NL 4YBHA 2DQUH 4JN2A 1LO3H 4JM2A 4K7PL 5C0BD 4KKNA 3BQUA 1F11B 4NWUH 2PXYD 5DFTA 4AH2B 4Y19B 4Z7NE 3MCG1 4FQ1H 3MNVB 4PV8B 3V6FB 3S36L 1I85A 2CLVA 4HUMB 5CGTA 1PDKA 3BHBB 5LQBL 1KLGA 3IJSB 3CLEL 4EIZC 4DQOH 1RUQL 4KK5D 3WIHL 3L3JA 5HPMB 4HXBL 3LKRA 2JJSC 2CD0A 1NGZA 1IGJA 3WS6A 1CU4H 4Z7UB 5JHDB 1GGYA 3NH7H 3UTSA 1E4WL 4NYLB 2UY7A 1AKJD 1K3ZA 2NLJA 5IVZA 4YDVA 5KVDH 3C8HA 1I8IB 4HIJB 3RWGA 2GIYA 3LDBB 3FB5B 1FE8L 4IM8A 4JFYB 5D96B 3X3GL 3D39E 5T5FH 3BP6B 2FZ3A 1RV6X 2VB5A 3VWJD 4JJ5B 5D1XD 1U8KA 2H2PD 1FDLL 4KHTH 2NY7H 3PP3K 2KZ1B 4NGHH 2H2SD 4W68A 3EOYG 4DK6A 1WFUA 2QADD 2HFEB 3THMH 4XXCC 4MA8L 1T6VN 3LRGA 3I3BA 1TPXC 3TA3C 4X7SL 1QFOA 3MLTA 2VLJA 4FP8L 2OI9C 1QSVA 3NGBC 4MVBC 4BFGA 5MEQB 2X40A 1J0KA 4JY4B 1WEJL 3VXMB 5BCAA 4QRUA 2EH7L 3TN0A 3DXAE 4I2XB 4M8VA 5DA0B 4PJAA 5D7LD 4NZUH 4MJIA 1JF1A 1KIUA 3VG9C 2Q6WA 5DUPL 4POYA 1R5WA 1T0MB 4ZDHA 3E6FA 4U6HB 4TVPL 5BMFL 2HYMA 4LQ1A 1T5WA 4X6CF 1AE6H 5JPNA 1SMAA 3P4OB 4AIOA 4M1CC 5DR5L 5FCSH 5D6DC 1ZEAH 5TGBB 1DQLH 3DYPA 4LSDA 4Y2DB 5E03A 1RZJL 4NQCB 3CVIL 4LK4A 1ZHBB 4HAFA 1JYXA 4MNGA 4XNQA 5GRWA 2GFBA 3QFJE 1MLCA 5F1IA 1T0NB 4R7NA 3LIZH 4Y5YA 2CDFA 2HT4D 3BSZH 3L3KB 4KWUA 3UYRL 1RJZB 4S1QL 3EBAA 1KYOK 2VZ3A 1QLEH 2EYSA 4GKZB 3MSPA 3HNTH 3RUGE 1U2HA 4XXDA 3CVHA 3NA9H 4M93B 2LQRA 2W9DL 1SJEA 1U3HC 5BZWB 4KJPC 4ONHB 3LN9A 5TE6L 3WUWG 2A2QT 5JA9A 4DN4H 2YXFA 4PFEA 3HZKB 1N64H 2O61B 1KIPA 2B4CC 4ZFOA 1UENA 5E8EA 1CVRA 3TYFB 4QHMA 4GRWF 4NUJB 5FGSA 5FFLA 4M00A 4NCC2 3GMLA 2ZG1A 1JGDB 3AMKA 3HN3A 3TIEB 4OQ1A 5JUEH 3B8SA 3L3DA 5GRJL 4M9OA 4OGZA 1BREA 1Q9WA 5I8KH 4JZOA 3H9HB 5EORH 1U6AH 4P5KB 2AXFB 2NCMA 3K4DA 4FQJL 4JFFA 1RJLA 2XZQL 2WWKO 5A3ID 2RJMA 4LCWE 4P5MB 4TUJB 3AS1A 3N1QC 1Z9SA 4OKVA 3CK0H 2R0ZL 5D8JH 1FL6B 2R9HD 1CXLA 5EBMA 2R29L 1BD2B 1IEAA 2WP3T 4OZIA 4PG2C 4AENB 4ZTPH 3HI6H 4M5ZL 2GSIA 3ZYJA 5HDQH 3VXRA 1QPXA 2F54D 1G9MC 2RCSH 2GCYB 3G6DL 1MJUL 1RK0A 4QYOB 3P0VL 1NBZA 2WWKT 12E8L 2DDQL 1TJIL 2YUWA 3S9DB 5C2BH 2G75B 3TH2T 3H42H 1YPZB 1XGUB 3BO8B 3VI4E 2EC9T 1Q38A 3NTCH 4WGWB 4EOWL 4U6VH 1D9KA 3WKMH 4G6JL 3NCJL 1ZVSA 4IMKC 2XY2A 5JMOC 5HVFB 3EW3B 2D7QA 4OCSL 4U3XA 1SEQH 1IC7L 3VFUA 1F45A 5I74C 1MCCA 2WINB 1EAPB 1CGTA 2HA1A 4XWOD 5HHOE 5IBTL 4PGEA 3CH1B 4KMQA 1EZVX 2FGWH 3TJEH 5KSBE 2DRUA 3CAFA 3HC3L 2DL2A 1SQ2N 1FV1A 4LVOC 5FYLD 3RVUD 2OLDA 4JFHE 3CXHJ 2Q86A 1CXIA 1MJ7L 5ITFB 2IG2L 2CKBH 5I1CL 2X9YA 4IRSB 4XCCL 4QKXB 4G8GB 4HCRL 3GFUA 1A21A 2VDPH 4HZLA 4P2RD 3SDYH 1IC1A 4QRRA 5CEYB 3OKNB 4X4XA 3TBYA 3U9UB 4YO0B 4XNUL 3WCYA 3BT2H 3KYOB 2LVCA 2Y7QB 4PGZA 3RX8A 3GMPB 4QWWD 1ZWIA 2ESVA 4YJZL 3O81A 1TXKA 4G9DA 1QBMH 3ZHDA 3RQ3A 2PO6B 2AKRB 3MCLH 1VFAB 1VDGA 5DI8B 1OD9A 2FJFA 1B4RA 2Q1EA 2A73A 3ZYOA 2UZIL 4WW1A 1KBGH 1XIWB 4X80H 4K23L 1I9JH 5I15L 2OL3A 3ARBC 3OZ9L 1R5VA 4MJ6B 3VXQB 5GS0C 2VQ1A 5JOPD 3QPQD 2YN3A 3ME0A 3EOTH 1EUTA 1JMXA 1RURL 2R1WB 4X5XB 3VXUD 1UZ6E 3T08A 1IGTB 3Q5TA 5BS0D 1S78C 1VERA 4DCQB 3TFKD 1IKNA 4MQ7A 4ZUTB 3AU1B 4ODHL 1CICB 1AXIB 5TPWL 2R23B 2CRMA 2DM4A 3RTQC 4LU5H 1IQWH 4OV5A 5ELIA 5CSGA 1OAUL 1AO7E 5CEZE 4RX4D 3PL6C 2E6QA 1N6QH 5F9WB 3RHWF 3IDGB 4PRPB 4GW5B 1J5OH 1I7RB 1ES0A 4M7LH 5FECA 5JLZA 3L3IB 1M7IA 3NFNB 5DEFB 4CVZA 1MY7A 5F7DA 5M7QA 2N4IA 1YUHB 2PW1A 1EEZA 2PYEA 3VFWB 5IB5B 4OF3A 5HGDB 5L2KB 2LVEA 3QDGE 4HKJA 1RFDL 4IMLB 2EXYD 2FLBT 4CW1A 1S9WB 1MFCH 5JXED 1VKXA 2AJVH 2E7MA 3RGVB 4O4YL 4KQ3H 4OZ4B 1DBJH 1LNUA 1VPOL 5C0FB 2W9EL 4P4RA 2NX5D 4KROD 5DD3L 1C5CL 1P2CA 3QI9A 2F74B 2C1PB 4G8IA 2BJMH 3JV4B 3OKKB 3RVVC 2YSSB 2GYSA 4NBZB 4WTXA 2DBLL 1J8KA 4PRNA 2W0FB 1JMZA 3NIGE 4X6FB 5C07B 3QA3B 2HTLD 5CBAB 5MI0C 3FOLB 1HIMH 1JIBA 1IC5H 3CUPA 4PV9B 3FFCB 3GMOB 3SKOB 3GSNB 1Z9LA 1QP1A 2NY2D 5JW4M 1UZ8B 4M62L 5I8EA 4XHQA 4KY1H 3FZUC 3OJVC 1N8ZB 4NO0D 1S7WB 3LKQA 4X6DE 3ZDYE 1TZHB 1NEZA 5IBUB 4F58H 3VFRA 3NCMA 2AJXH 3R4DA 1OAKL 1GGIL 3D3VB 3O8XA 2DB8A 2WIMA 5FCUH 2BNQE 4PJ5E 3A67L 4P9HH 4J3WA 8CGTA 2I9LA 4PJ8C 3IJYB 5F8QC 5GRYA 3C9NA 5IB1A 4MJ4A 1WIPA 4O9HL 2YC1B 3TBSB 4YDLC 1D5ZB 3MLPA 3CMGA 3SOBH 4BSVA 3R0NA 5CWSB 3HCVB 2PW2A 3MGOB 1QBLH 4ORGA 5DFVD 5DRWA 1YYMH 2JKXA 3SDAB 2NY4D 4Z77A 2XG4A 5ADPL 1XF4B 2VXTH 3LD8B 4QY8B 4JRXD 1DBKH 4CVWA 1W0YT 2I5YL 5GJSL 4MQSB 1CE6B 5C0IA 5DURB 2P7TB 5EUOE 2BOBA 2AV7B 2HN7A 2HRPH 3HPJA 1QFWH 5GS1C 2ENYA 5FM5O 1WTGT 3OJ2C 4E42B 2IAMC 1B2WL 4LLVB 4X9BA 4NJ9L 4U05A 4CVUA 2BVTA 2EZ0D 1CL7L 2X7LA 3H9SE 4U6XB 1HQ4B 4PG9A 1C08B 1JYWA 4PLKD 3EUUA 4XP4L 4KXZI 1HILB 5CZVL 1D5MA 1MHEB 5IQ7H 3HG1D 4BZ1L 3GSNL 3L3OA 1KPVA 1QYGH 3V0WL 3ZYZA 5D70L 3EJYC 4GAGH 3FCTA 5LWYL 3HMWH 3DX6A 5JIKA 3QUZD 4HGWB 4KAQH 3TPUB 1T1WB 4FZ8L 1WICA 4U0QB 3VJ6B 3UAJC 3RA7L 4AMKH 3CFDB 1IAIH 5EUKA 3A0OA 1TVBB 1J88A 2ADJA 5FK9A 4O51A 1PAMA 3BZ4B 1WC7B 4CKVX 3N1FC 5GGVL 1S7QB 1UJ3C 4PJBF 4JREB 4P4KA 1D5IL 1FO0A 3JWDL 4MS8D 2X1WL 1DFBL 4ODSL 1T1XA 1YEEH 3ZKQD 4RFNB 5MHSE 4LVHB 4HC1H 1FORH 3G5XA 4MA7H 1V7NL 4NQDE 1B90A 3TWCL 1Z3GH 4HKXA 3L5JA 2CIKA 4OD1L 4PTUA 5TQ0H 2IWGA 2VZSA 3IKKA 3PHOA 3I50L 1EFXD 2VR4A 4QCIB 3TYGH 1OGAB 2H9GA 3AXLA 4C59B 4BFIA 1HKFA 5E56A 3MACL 3M1BA 3O6LH 1WT5A 1X3DA 3G9AB 1IM9D 1RUMH 4PJHE 2OR8A 5DS8B 1OAYH 5LCVL 3ULVL 3S8WA 5EU3B 1UA6H 5E5MA 4S1DD 3RZCD 4NQEB 5I8OL 4RX4A 3IDMB 4KRNA 2AK1L 5F96H 4HFWA 4K9EC 1ZE3C 4Z7OF 2F53D 2ADGB 1LO4L 3QQNA 2PTVA 5D6CB 3AM8C 1WZ1L 3GKWH 3IF1A 3WNMA 4GAJH 1EVTC 5DHYB 4BQCA 1LO0L 1I1FA 5AEAA 1KTDA 3FT4A 1UWEL 2NPLX 4TSBL 2NW3B 3L5XL 1A7NL 3V7AE 2WUBH 1P9MC 3LY6A 3PWUB 3QH3A 1U8PA 5K93A 1MHCA 3BD3A 3P73B 1D6VH 5DHVA 1NEZG 4DGIL 3CXDL 1P4LB 2JE8A 3FT2A 1XF1A 4PP1C 3HNVH 4PBVC 4Q6YA 4WI3A 3O3AA 1N4XL 1FYTB 1S7VA 1F42A 4NOFA 4U33A 3RI5K 1NLDH 4L8SA 5E6IC 4PLJD 4ACPA 4JG1H 3NCEB 5E94B 1G7HB 4M61A 4PJEF 4I4WA 4CN1A 5C0AE 5I1DB 2NY6B 1S9XB 4LIQL 3RY5A 5I17A 1UVQB 3VXPB 1DVFD 5JZ7C 2H3NB 1MLBA 2BVEA 4OM0L 2DQJL 5BJTA 2YR3A 2Z4QA 2B7DT 4U1MB 1S7UB 2JF1A 1G7PB 3LEVL 3WDHA 1YNLL 3O11B 1MQKL 1HKLL 1F6AA 5A2IH 1S7RB 5JW4R 1HHKB 4R97B 2NXZD 2J8UA 1V3JA 5EA0L 3QXAB 3JSSA 1AXSA 4NBXB 3P4LA 3HRZB 2R1YA 4ZG1A 4W6WB 5CZKA 2XT1B 3IJHA 3BKJL 1OAZL 2V9QA 4ISVA 2EE6A 3MXVH 3HMXH 1T80A 2P49B 2EDJA 1B4JL 5FGCE 1J10A 4WIQA 3T0EC 3VDCA 3S5LB 5IFJA 1HWGB 1BBJA 3C5JB 5IFAL 2R0WL 4Z5RA 4ZFGH 2J4WH 1J8HE 4AEHL 3CDGA 1A7QH 1RQ5A 4W6XB 4OKDA 5I76B 3D69A 1L0YA 4MA1B 2EYRB 3I75B 4NM4H 4JEGB 1DQML 2GY7B 1V5JA 3RWDA 4EDXA 1ACZA 5F3BB 4APQD 2DBJA 1LDPH 4YHMH 1ZA6B 4YQXH 2VABA 2BCKA 3VE0B 5EBWA 1A1OA 1FNHA 1FYHB 3H6JA 4MNHA 2VSDA 3LS5L 5CJXA 5MERA 1O0VA 1BFOB 5HVGB 4EDWH 2P48B 2CLRA 3TGXA 3U83A 4QTHB 1GZQA 5JORA 2Y1VA 2C4XA 4I5BA 3BVNA 1GIGH 4UMGA 2JCCA 4CMHB 4R26L 4ZMAT 3NZ8B 4HKBB 4HJGA 5TE4L 1FN4A 1SEBB 1AGEA 3EYSH 2VZVA 4PJ9D 2K7PA 3V0VA 4XHJD 2LTQC 1PZ5B 4DKFL 3T3PF 5LVEA 1OGTB 4S2SA 3TC9A 4OIAA 2KQNA 4XNZC 2XN9D 5E1AA 4R9HA 2YUXA 4ODBD 5HYQB 1FNGB 4G8EA 1U8MB 3D6GA 3FTGA 1H9VA 1ZGLP 1UWGL 4UV7H 3OKLB 1A14H 2BVUA 3STBA 1MWAH 2FL5A 2AXHA 5IF0A 3MLSH 2LV4A 3WFDL 4MX7B 3DSFL 4GRMA 3EGSB 1EGJL 1BOYA 4QGYA 3B9KC 2AEQL 2BRRH 2C3XA 4MJ2A 2XKNB 3X14A 4FQIH 1KB5H 1MVUA 2XQYG 2GQHA 3CFEB 3S88H 3ZO0A 3QXWA 1B3JA 1CDBA 4JRYB 5FEBA 1X5GA 3HUJA 5B39A 3IDYB 1WQVT 1EHLH 1TQBB 3C5ZD 3UTOA 4QTIL 5MEOB 4NO3A 1SYVA 3QIUA 5FUOH 5JDSA 3RWHB 1T3FA 1IM9A 2X4TB 3CFCH 4C56A 4ZOAA 3WN5B 3CFKB 2H8PB 4FQLH 1S5IL 1KLUA 1P4IH 5E24E 1S7TA 4XZUB 2BSRB 1AFVH 1L6XA 5HHQB 3SDXE 4E0RA 4GAYB 4CU6A 4L3EA 5DK2B 1W0VA 4D9LL 5IEHB 3SY0A 5AG9A 3QCTL 4QRPB 2GTWB 2RR3A 1HZHH 5KVMC 1FC2D 5E8NA 3H3BC 2OK0H 1NSNL 4D3CL 3ZT6A 3ALXA 4XMPH 1PG7H 4U1IA 3DVNA 2VDQL 1A6TA 3VDAA 1P6FA 5LBSH 4JGMA 3L6FA 1KLFA 1QLRB 2K1MA 1DLHB 3UTZA 1FZJB 1MIEL 2HG5A 5KN5A 3VG0H 2Y23A 3BWAB 2YRLA 2V5MA 2QQKH 5IB3B 4QHUB 5FHBL 1T2QH 2IPTH 5GGSB 2ADIA 4GW1A 5MENA 4M7ZB 4OTXL 1I7TA 1INEH 1MH5B 4MQXC 4CADB 5EOCL 4M6MH 1AGDA 1ZLVK 5IM7A 4O00A 3OG4B 1F4YH 4M5YL 4XP5L 2I60H 5I1KH 4FQ2H 2FEDC 1CK0L 3FT3B 5IHZB 5E9DB 3FN0L 2A6DA 1S8DB 4LNVA 5D7SL 3SGEH 2X41A 4RWHA 3ECBB 5J3HC 4NCC1 3RDTB 4KUZL 3I3EA 4ODTH 4QOKB 4Y4FC 1Q9LB 1OARH 2LABA 1NJ9A 4PJXF 1SJHA 4Y4HD 5C8JB 3PP4H 3VXNA 1I1RA 3BZDA 1TETL 5ICYB 1AGCB 1AQDA 2HTKC 4LCCB 3S34L 4JFEB 4F7PB 1NAKL 1CF8H 1MFBL 5IW1B 4OLZH 1TJHL 1ZSDA 5JO5A 2RAMA 4U1HB 2ITCB 4MD0B 3LSOB 4JM2F 3PV7A 2FYYB 2F5AH 3DVGA 3ZSSA 1KCRL 4ONFL 1OAQL 3O2DL 3F12A 4DUXA 4U6YB 1J0HA 1K4DB 4F3FA 3X11B 1IKFH 2VE6B 1MY5A 5C70A 3LQAL 2KUTA 5E2VH 3WUWB 5DRNB 1HHJA 2F15A 1FFPB 4GBXD 3ELAT 3D48R 4PJCA 1C1EL 25C8L 2WMPA 5DD6A 3HZYA 4Y89A 1OW0A 3T0WA 2GHWB 1YN7B 4XBPA 3ILQC 2GKIA 4YPGB 1NDGA 3BAEH 2MKLC 4HIXL 3NPSB 3QWRD 1OM3L 4EIGB 4EN3A 2NY1B 1G0DA 4PJGE 3VXSE 3AB0B 2A77L 3F8UB 2FH8A 3GI8H 1ORSA 2PF6A 4NQXA 1DEEB 4DVBB 1YEKL 2CKBA 3UBXA 4XCYA 4M7LT 3T4YA 1VEPA 3HLAB 1ZVYA 2NY5H 1K2DB 2J8OA 3VFNB 4OLYL 4JN2B 3B2UD 4G42A 4JM2B 1WCBA 3P40A 4OFKA 4NFDA 5GGTH 1LEIA 2X4RA 1R5IA 3D2UA 1NMAL 3MLWL 2X9WA 4CAGA 1YNTA 2EIDA 2H6PA 5EULV 2CLVB 3KPRD 1NL0L 4J4PA 4K3DH 1EO8L 1KLGB 4RMSA 5BVPL 5I8CA 1MRFH 4PJAF 5GRZA 3ARDB 3UXFA 4E9LA 3L3JB 1K3IA 4YK4C 5B39G 3LKRB 4ZS7L 2NZ9C 1ZT4A 2APWA 1NGZB 3GBML 4IEFB 3OF6D 4WUUE 3QDAA 3BEWA 3UTSB 1AXTL 2GITA 2ZCKL 5K9QI 2YWYA 5IVZB 4YDVB 1DANT 2AEWA 1U8QA 3MV8D 4HQQL 1UM6H 3KLHD 4QXTA 4X99B 1RULH 3V4PL 2FZ3B 4TTGA 1VGKA 4GOSA 3VWKC 1AH1A 1CGUA 1U8KB 5FDWA 4EUPH 4FOMA 1U9KA 3AGVA 1PYWA 4U31A 3QHZL 3PQYE 1DANU 1WIUA 5ITBL 4OLXH 3MLTB 4L4TD 5DJ6A 3LH2L 1A8JH 3GBNH 5I75B 1YEGL 5SX5K 4Y4KA 2VXUL 3C5ZA 1T83A 2DKMA 4QRUB 4ODXA 3NZHH 4PJAB 4Z8FH 2OMBA 3BKYL 2P5WB 1HEZA 4MJIB 1JF1B 3MFFB 3PXJA 5FYKD 2Q6WB 3ARQA 3ES6A 4JPKL 1R5WB 4KU1A 4ZDHB 3E6FB 3MRFA 2VITB 4YWGL 1T5WB 4I18A 2AQ3A 5JPNB 2HH0H 5GZND 1CD1A 3V52L 3K8MA 1ZLWH 4WU7B 4KFZC 5GGRB 4MNGB 4XNQB 2A6IA 2GFBB 4P23A 4R2GB 1MLCB 5B3NA 5I19H 5F1IB 2YOCA 4P5TD 4H20L 4PTTA 4Y5YB 1RJCA 2CDFB 3C8DA 5CSZA 4DKEL 1QSED 3H8NA 1T0PB 4GG8A 3KYKH 1KEMH 5BV7H 5HHNA 3SE8L 2B1HH 3CVHB 2Q87A 3V79C 4O2FA 1T89A 5I66A 1OSZA 3T2QA 4HT1H 5J12B 5KSAB 4F37F 2CH8A 5E4EB 1P69B 4ERSH 4O02L 2MSPA 3OTTA 3R1GL 3T0BA 4OZIF 4UZGA 1QA9A 1U95A 1KIPB 3C6LD 1DQDH 1A7RH 4NRZA 1SBSH 5E8EB 1YJDH 4Y4HA 5H37H 3QIWB 3MOBL 2WM0A 2I07A 5T1LB 1T7ZA 5TDPA 3IU3A 5HYJA 2CPCA 2XRAH 1WTLA 2A6KA 2YD2A 3GMLB 4QF1A 4WO4A 5B22A 2IEPA 4Y2DC 1CI5A 4MB4A 4DTGL 4LSTL 4Y8AA 2DQIH 2H2PC 4X9HA 1Q9WB 2H2SC 4JZOB 2Y6SD 2ZJSH 1RI8A 5L88L 3LKNA 1IGIH 1QEWA 4TRPL 2Y36L 1MREH 3OKDA 2B1AL 2R56L 4JB9L 4LRNL 2YD4A 4JFFB 1RJLB 4OF8A 3C60D 3VH8A 1CG9A 2D7TL 3V5HA 4RGNC 3R8QA 1GOGA 4HUUA 3D39D 4OKVB 3JZ7A 3MLUH 3W0WE 3W9EA 2KDGA 3KJ6H 1T22A 4F57H 1A1MB 3L1OH 5EBMB 2ZUTA 3CLEH 3VI3E 1IEAB 1PKQE 5F9OL 1I3RA 3IDNB 4U7MA 3W2DH 1SY6H 4XMLH 1EEQA 3IDUA 2GSIB 2WQRA 2YA0A 4J3VA 4N9OB 1F4XH 3QDJA 5DD5H 1RK0B 5AYUH 2GT9A 1NBZB 2WBJA 2C1OA 2OZ4H 3IS1X 3CVHL 35C8L 5HD8C 4N9GA 3DXAD 1RZFL 3PG2A 2E9WA 3ETBF 3PIQA 4F37K 5JQ6L 5AWNL 4HWZA 4ZXBA 3OXRA 3BDXA 1D9KB 2PXYB 5KANG 1FDLH 1ZVSB 2AXGA 1P5VA 1TFHA 3EJJX 4D9RE 5IB2A 3VFUB 3VFVA 4PGEB 4X7SH 4O5LL 2MNUA 2VISA 4I3RH 5C0CE 1V3MA 5LGJA 3MQIA 1YMHA 1X5XA 1FV1B 5E0QA 4KKLD 2EH7H 3U4EB 2Y9RT 3KLSA 4HC1A 2P8MA 4Y5VA 2EECA 1ZKAA 3QFJD 4B5EA 5ADOL 1XGTA 4XPAH 4HZLB 5DUPH 1CFQA 4X9IA 3MUJA 4Y1AA 3EKCA 3HE7A 3SDDD 4X4XB 2B20A 3TBYB 2CGRL 2ZPKH 2X70A 2V5YA 5D1XB 1ZWIB 4TTDC 2VDKL 4G9DB 1EJOL 2QADB 3P30L 4GW4A 1MIMH 1QFPA 4ODWA 4J12A 2O93L 1L7IL 2FJFB 2YPLE 4NJAH 2A73B 2WIIB 4WW1B 4FQHA 5D9SA 2OJZL 4B7IA 2OL3B 1R5VB 2VQ1B 4M1DH 1DSFH 4S1QH 4DK3A 1AD0A 2QQLL 5IB4A 1PQZA 3BE1H 3QUYD 2EE9A 3K2UL 4QHNA 3SCMA 5I6XB 2EDEA 1F3DJ 2W9DH 3ROOA 3EHBD 5ALCH 3MRKA 1ONQA 4MQ7B 1S3KH 4RGMB 4NNXA 2Q20A 1RVFL 3PDDA 1LHZA 5TDNA 4OV5B 1UXWA 2Y25A 3QISA 5DWUH 1YQVH 4PBXA 3U0TA 3HFMH 5TH2A 1FFQA 4P5TA 3I02A 3JWOC 1ES0B 3OMZA 4OGXH 3BPNB 5D7JD 4YHLL 5FECB 3WMSA 1M7IB 5ID0A 4QXUH 3IU4L 5FO7A 2PW1B 2PYEB 1EEZB 4NN6B 4LDLB 4MAYA 4JPWL 3VCLB 4YBLB 1ERNA 5BW7C 1T7WA 1SM3L 4HKJB 1EHNA 2KH2B 3BRFA 3V6OC 3WFZA 1XIWC 2HWZL 5CIPH 2VOTA 4CW1B 1MI5A 1VKXB 3DMMC 1UG9A 3QNXA 4XWOC 3I9GH 1JWUB 1S9KC 1U91A 1JP5A 2XZQH 4Z7VA 5DK0A 3VH8G 4P4RB 3UBXI 5T33L 1P2CB 3QI9B 1NFDE 4G8IB 4M4RA 1HXYB 1RZGA 3RVUC 2DIBA 4K7PX 3L9RA 3HMXA 3KG5A 4U7KA 3T0EE 2OL3L 4UU9B 4GH7B 2NY3C 1TZGL 4EQ2A 4Y0GA 3S36X 3TNMA 3CUPB 4JDZA 5HHOD 2FATH 5LGKA 5LXGL 3WFEH 5I8EB 4H0GA 12E8H 4QWWC 1W8NA 4RISL 1J1OL 3LKQB 3BKCL 4JFHD 1NEZB 3QO1A 3VFRB 2OR9L 1PSKL 4I0PD 5CD5C 3NCJH 4HPOL 2G5RA 2IPKA 4WV1C 4A2MA 5GQBA 2I9LB 1IZJA 4Q6IA 4JQXA 3C9NB 3QPQC 5HGBA 3UTQA 1JUFA 5JIHA 3U9PL 5KANI 2P43B 1A2YA 3V9FA 3HC3H 4BSVB 3RWFA 1HINL 1HYSD 4FG6D 1N0XH 1QLFA 1OP5K 2O5XL 1CLOL 2PW2B 2IG2H 4ORGB 5DQJA 4K8RC 4Z77B 5ANMA 4M3KB 5GGQL 3QQ9D 3CFIC 4ZUVA 1ZV5A 5FYJU 3G9VA 2DM2A 4XNUH 3E6HA 5K33A 5HJ3A 4QEGA 1UM4H 4N90E 4S1SH 4XPHL 2HN7B 4D94A 2PNDA 3HPJB 1KIRB 4JVUA 1YECH 4ZO9A 4OAWA 4LSUL 2XA8L 4L4VA 1MWAA 2VIRA 1QQDA 3LEYL 5IGXH 3GSRA 2JELL 5SV4A 4I3SH 4LBEA 3O41A 2DAVA 2P42B 4PG9B 1KG0A 2ATKB 4L8CB 1RAMA 3MLRH 3DUSA 1CN4A 1KB5A 5CEZD 1QSFD 3Q0HA 4PS4L 1KPVB 5JXEC 5L6YH 3UDWC 2Z91A 3D9AL 3FCTB 4AIXA 1RURH 3DX6B 1DDHB 4P2RB 2X4UA 4YC2B 1YC8A 3MODH 3JWDC 4P2QE 5D93B 1BEYL 3T09A 1IFHL 5SWQA 3CPLA 4KRMB 2D7OA 3MO1B 4NN7C 5E2UL 5EUKB 4EQ3A 4TQEL 5CSBA 3QDGD 2ADJB 5FK9B 3RAJL 3CXHK 4O51B 3GMQA 4FQXD 5C6WH 2IADA 1OAUH 5TF1H 4AEIL 4OJFL 3B9EA 5IROA 5EIIA 4P4KB 1FO0B 2CQVA 2NY2C 3BXNA 3LCYA 4JO4H 3VXTA 3FB8A 3WLWC 3HRPA 5DJ0A 1N3NA 4XPGH 4CUCA 4HJJL 3UZQA 1T1XB 2FX7L 3B2VH 1RIUL 1N59A 4WTZA 1DBBH 3EYFB 3UPCA 1YA5A 4RAUA 3G5XB 4W4OA 4OLUL 4JY6B 2CIKB 3VXUB 3WXVH 3OG6B 4KQ4L 1BQHA 2NXYB 5LGHH 4K94C 2H9GB 3AXLB 1OF2B 4BFIB 4EVNA 4HUXA 3O9WD 2DMBA 3M1BB 4LRIC 1I1CA 1CGSL 4OM1H 1IMHC 4R8WH 2ICEA 1MCWW 2C5DC 5E4IA 4A2LA 2MQ3A 5DD3H 1C5CH 2ATPB 1T2XA 2DTSA 1QZ1A 2FD6H 4HFWB 1EX0A 3GMNB 3KPSE 2VZ1A 1FGVH 1E4XL 1U3YA 2VLRE 3P11L 5HHPA 2NY4C 4LCWA 4PJ5D 5ACMA 3IF1B 5IOPA 1J86A 1C8PA 5L0QC 3RJQB 5B8CA 4JE4B 1I1FB 1JGLL 1KTDB 1LVEA 3GSWB 2VLKD 5DJZA 1I1AC 1G6VK 2J8UF 4I3GA 3SE3C 1JGVL 4WI9A 3RVWD 4RIRA 4Q74A 4PB0L 1G9MH 5C2UB 3QH3B 1EV2E 1G6RH 4HD9A 1MHCB 1LK2A 1JGUH 1A6WL 5F7YC 5JW3L 1I7ZA 5DHVB 1I8LA 4QT5A 4X6BA 4YLQT 3TVMD 3ARSA 3T0XA 4PB9H 4HUKB 1G0YR 3DI2B 1S7VB 4PLKC 1MPAL 4KROB 3JXAA 3AREA 1UWXK 4M61B 4I4WB 1FO0L 4O9HH 3G6JE 4QNPF 3MNWA 4F8TA 3AUVA 5I17B 4F33A 3GSVA 3ULUC 1LGVA 3SGKA 1IAII 1MLBB 1RU9H 3T0VA 5BJTB 2Z4QB 4RAHA 4JHAL 5KSBA 3F7PC 5GJTH 4NO0B 1PX4A 1F6AB 2QL1A 1A7OL 4X4ME 4LQFL 2J8UB 3VGAC 1VB9A 5DD0L 4CGTA 3IETA 3MJ9H 4PRHE 1GC1C 4ELKA 1UYWL 1AXSB 3WSQL 2UV3A 1I3GL 2I9TA 2M1KA 1CQYA 1YNKL 3IJHB 4NJ9H 3D85D 2JCCF 4ISVB 4ZNCD 1CL7H 3QIBD 1EPFA 2IPUG 3FHAA 1JWMA 3DX8A 3JUYA 4XAWL 5GGTA 2VAAA 4LCIH 3U6RA 5IFJB 3CLFL 3KGRA 1BBJB 1PBYA 1TCRA 3ZKMD 5CZVH 4MZ3A 1PKOA 2DQEH 4Z5RB 3ZKXB 2V6HA 4R7DA 3CDGB 3KPMA 4K71B 1KCVH 1JNHA 3D69B 1JNLL 5GS0H 1H3UA 1A6UL 4FZ8H 5MHSD 3T0DA 4R4FH 3RWDB 4EDXB 4NQDD 2EYTA 2CIIA 2DQTH 3ARZA 5D2NC 6CGTA 4GQ9L 1X5LA 2VABB 3OXSA 2BCKB 5EBWB 5IV2A 1YEIL 5FA3A 1CBVH 1XEDA 4MNHB 1GGBL 2B8OT 4CNIA 5EU6E 1JPTL 1OT1A 2CLRB 3UJIH 1GOHA 1GZQB 1K4CA 1DFBH 1H3PL 3HUJF 4EUPA 4L9LA 3FRPA 4ODSH 3BVNB 2VDML 4XCFH 1AO7A 2OTUB 2YUVA 2Z31D 4HJGB 1FN4B 4WTZG 4GRLC 5ETUA 1DUYA 4QHKI 2N7BA 2ARJQ 2W59A 4OD1H 5D72H 4S2SB 1K9TA 4YGVA 1BQHG 1JFQL 4PLJC 3N85L 5F6IB 1NLBL 1T1YA 3I2CH 4G8EB 3FTGB 3MNZA 5C08A 4YHYB 5HHME 4LPVA 3ULVH 5LCVH 1UCBH 2FL5B 5IF0B 5T1KD 3EOBA 1LO3L 3ARGD 2AK1H 3U7WH 4GRMB 2IH3B 4NWUL 1KENL 3QP3A 3X14B 1MVUB 4MCYA 3QEQD 4P46D 3QUKB 3DIFA 4GXUM 5C0AD 2X05A 4JG0H 5CEXA 3HUJB 4BJLA 4DQOL 5HI5C 5B39B 1MCFA 1JPST 1K5NA 4M6OL 1EFXB 4EEEA 4LSSL 2YA1A 4Q9QH 4CMHC 1YMME 4WJ5B 1CCZA 1CU4L 4XTRC 4NO3B 1SYVB 3NH7L 5C3LD 5JDSB 2D3VA 1U8NA 3VD7A 4Y2OA 1T3FB 1IM9B 4JKKA 2YMXL 3O45A 1IAOA 3AS2A 2J3SA 2BNRE 1N4XH 1LE9B 4H1LH 1I8MA 2QHRH 1KLUB 2J8HA 1KNOA 1S7TB 4E0RB 2O5YL 2HKFH 4L3EB 3DBXA 2F53B 1W0VB 3HC4H 4KHTL 3SY0B 1B6UA 2BNQA 4LIQH 4PJ5A 2ED8A 5I1IL 3HHRB 3EZJB 5E8NB 3THML 2WV3A 1KYOJ 1JF6A 4OM0H 4X8JA 3DVNB 1A6TB 1MCIA 4K3EH 3L6FB 1BF8A 2HLAA 4ZQKA 1TTUA 4LEXH 4ODUB 3E0GA 3UTZB 2HG5B 3L3GA 5KN5B 3KJ4B 1CDHA 4HIEA 4N8CL 5D1QA 2ZKHH 3PABA 1WJ3A 1J8HD 4NZUL 5KSUB 3NFPB 2VAJA 4WFEE 2ADIB 2Q8BL 4TULL 3LPWA 3O6FA 3U4BL 1I7TB 4KKBC 3JV6A 4NKOA 2BHUA 4PJCF 2VERN 3TH4T 1AGDB 3SKMA 1DBAH 5IM7B 1OAZH 4OZGA 3UMTA 1AE6L 1RUPL 5EUOA 4P99A 1OPGH 1Q1JH 4PJ9C 4B41A 5DO2D 1XGPA 4XHJC 1DQLL 2A6DB 1NPUA 2UWEA 4RGNE 2X44D 3DHJA 5IFAH 4XNYH 3H9SA 4PGCA 1FBIH 4S1RH 5D7LE 2Y72A 1NJ9B 1SJHB 3RP1A 4YXKH 1NAMH 1F02I 3LIZL 1AQDB 4KGJA 1R3JA 1SY6A 3BSZL 2NXZB 3BFOA 3QUXC 1DQMH 2Q3AA 4X6CE 3MJGX 5A16B 2VXQH 1IL1A 4F7MB 1ZSDB 4X5LA 2E3VA 5JO5B 4BK4A 4XPBH 4TOYH 1Q0XH 4OF6A 1OLLA 1F3RB 3HNTL 5ISZA 3DVGB 2OZ4A 1P7HL 4KMLB 4QHLA 1CD0A 3D85A 4F3FB 3QIBA 1A64A 2OTWA 2FO4A 1QRNA 2APTA 2WNGA 1XR8A 4LDEB 4PJCB 4NNPL 2X4OA 1TJGH 4LL9A 4U1LA 3HZYB 4EUPG 1L0XA 1HWHB 1N64L 3FRPG 3HZMA 4R26H 5BOZG 4LLYA 5DF0A 5TE4H 4XBPB 4EKXA 3LOWA 1F4HA 4UINH 4M6AA 1QG3A 1WBXA 1LEKA 5JPMA 4EN3B 4X9FA 5GS2H 5JOEA 3MLXH 3T3MF 2Q76A 1ORSB 3UPAA 4APQB 4NQXB 1J1PH 5JUEL 5DVOA 8FABA 3UBXB 4KZDH 1K6QL 4XCYB 1NC2D 3T4YB 1JZ7A 1TCMA 1E6OH 5I8KL 1U6AL 3GJFK 5ESVA 3FAWA 3K7UA 7CGTA 1LEIB 4JO1H 1EGJH 2X4RB 1F11A 1R5IB 3D2UB 4PJHA 2AEQH 4GRWE 1YNTB 4Y19A 1VGEH 2H6PB 1OB1A 5JIIA 4HWUA 1JHLH 3DARA 3MRGA 1MJ8H 4K9EH 1U3HD 5D8JL 3BHBA 5KSVA 1YN6A 3OPZH 4KJPD 2ZUQC 4LSRH 3SGJC 5I8CB 4KRLB 4ZPVA 2X5PA 3A6OA 1H8SA 2A9MH 4IIQC 3HI6L 5GGUA 1ZHNA 4QO1A 1ZT4B 4QTIH 5HDQL 2RCSL 4K07A 3MV7A 3CSYA 3BEWB 4ZAKC 4NPYA 2GITB 3K81A 5D1ZD 3ZTJH 3H42L 1Q0YL 1U8QB 4LLDB 4UQ2A 3TCXA 3QSKB 1I8IA 3O3EA 2CUMA 5T1KA 3FB5A 2N7AA 4M43H 2UZYB 3EDFA 1B6DA 1VGKB 1DBMH 3NTCL 1TNMA 3TT3H 4U6VL 3WKML 1UKQA 1RHHA 3G5ZA 5FDWB 3QCTH 2YKLH 3NIDF 2I26N 3W11C 1F4AA 2E27H 1SEQL 3LMJH 4JJHA 3QNZB 2FBOJ 2VDQH 3F7QA 4UI2A 4PY8I 5ICZA 5DJ6B 5GHWL 5INCA 5E6YA 3BQUC 3TJEL 4Y4KB 4EJ1C 3EYUH 3VXMA 3P0YH 2I27N 3C5ZB 3PWLA 4WFGE 1INDH 5H37G 1UQSA 5HDLA 4ODXB 3WEXA 3O6KH 4YH6A 4LLUB 3U30B 2AI0L 1HEZB 1ZGLB 3C8KA 1MAMH 2VDPL 3G5YA 5A1AA 3ES6B 3V8OA 4UAOC 4GBXC 4OTXH 3V6OE 3SDYL 4BSJA 1AC0A 1YDPB 1T0MA 5KJRH 5CIPA 3MRFB 3T2PA 4WI4A 4XP5H 3P4OA 5IG7A 5E6ZA 1CD1B 1CK0H 1S7SA 3REVB 3FN0H 2WUCL 5J1SC 3IYLW 2BY0A 3MCLL 4NRYA 1LO5B 2CLZA 3FOMA 2J6EH 3QO0A 4P23B 1KBGL 4X80L 4KK6C 1I4FA 1QFUH 1EFQA 5FUZH 4JFXA 4PTTB 1BQLH 1I9JL 5DFWH 3L3KA 2YEZB 3CD4A 4R6UA 1MFBH 4GG8B 1T20A 3EOTL 1A3QA 1TJHH 4Z95H 4GKZA 2EIZB 4LHUD 3U0WL 4Y16A 5HHNB 1J7VR 3Q2CA 3VXSD 1KCRH 4ONFH 3O2DH 4CJ1A 1UADC 4YHOH 4O2FB 3TN0C 2H26B 1CWVA 1OSZB 3R0MA 3W9DA 1FFRA 4F9LA 4NQTA 4LU5L 1IQWL 1FSKC 5L2KE 1C1EH 25C8H 4QRSA 3RJDA 2DS4A 1G7QA 1QA9B 3QAZB 5EU7C 4Q9RH 1N6QL 4Y4HB 4HIXH 4GO6B 1KJ2H 4HZAA 2I07B 4NUJA 4WDIB 2EKJA 4M7LL 5TDPB 5I1EH 5HYJB 2DI8A 2GJ6E 1NFKA 4GG6A 4QF1B 4WO4B 1H8NA 3TA3A 5BS0E 4HG4J 3ZL4H 5BXFA 5T1DL 5EO0A 2VN7A 1A4JA 3ARBD 3M45A 4XCNA 3OAZH 3WO3B 3LKNB 1QEWB 2AXFA 4HDIA 2AJVL 1R3KB 4J7RA 1L9MA 4WHCA 1HNGA 4KQ3L 4WU5A 3VH8B 1CG9B 1KB9J 3MLWH 4HWBA 4W70A 3V5HB 1DBJL 3L7FA 4HUUB 3W9EB 2BJML 2OTPA 1UACL 1T22B 5EIQA 5BVPH 3MRDA 1GAFL 1E6JH 2AK4E 5KG9B 1CFSA 3RTQD 3D3VE 1O7VA 4ZS7H 2VXVH 3PQYD 1HIML 2QKIA 4EI5D 2EE2A 4FFZH 1V3KA 2A83A 3BGFB 4KY1L 2C1OB 1NC2A 2UVFA 3F6LA 2C3VA 3B8YA 1DQQA 1YPZA 2X4QA 4LFHD 3V7AG 4N9GB 1ORQB 3PIQB 3BO8A 4J3UA 4HWZB 4F58L 4ZXBB 3OXRB 1IGMH 5KZCB 4U1GC 2BRQA 3IFLH 2WLZA 3RFZC 3MCKA 3NFSH 4CL7A 3M07A 4P9HL 4KDTA 1NQBA 5DHXB 3QHZH 4I77H 3VFVB 2WINA 5GSVA 1EAPA 4OT1H 2VISB 3M8OH 5DYOA 2EEAA 5LGJB 3CZFA 3TZVA 3AY4C 1NDMA 1YMHB 4ZYKA 2L7JA 4P3WA 5DJAA 1QBLL 3RVVD 2P8MB 3NCYP 4Y5VB 4JKMA 1YYML 4OV6F 4G8GA 1WV7T 4KRPB 5AAMA 4ELME 4XI5D 1CFQB 4Y1AB 3HE7B 4KTDL 1RZ8A 1DBKL 4LOUD 5FHAL 4OI7A 2XTJD 3NN8A 3LZFH 5CJQL 3KHQA 3QNYA 3C6LC 3GMPA 2HRPL 3FZUD 1QFWL 1W2KT 4GW4B 2OJEA 4WWKD 4W4NA 5I9QC 3IRZA 2AKRA 4ODWB 4GKNA 1Z2KA 4FQHB 2IANE 3B3IB 5IQ7L 2JIXA 3T1FA 3WO4B 2DWDB 3BP4A 4JRXE 1DLFH 1EO5A 2HFFA 4MNQE 4DKEH 1VFOA 1QYGL