4LL4A

The structure of the trx and txnip complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
292
structure length
277
Chain Sequence
IKSFEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGSQQCKQTSEYLRYEDTLLLEDQPTGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGCVDYWVKAFLDRPSQPTQETKKNFEVDLMAPVSAKKEKKVSSMFIPDGRVSVSARIDRKGFCEGDEISIHADFENTSSRIVVPKAAIVARHTYLANGQTKVLTQKLSSVRGNHIISGTCASWRGKSLRVQKIRNILRVEYSLLIYVSVPGSKKVILDLPLVIGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin-interacting protein
publication title The structural basis for the negative regulation of thioredoxin by thioredoxin-interacting protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antitumor protein/protein binding
total genus 48
structure length 277
sequence length 292
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00339 Arrestin_N Arrestin (or S-antigen), N-terminal domain
A PF02752 Arrestin_C Arrestin (or S-antigen), C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.640 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ll4A01
2.60.40.640 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ll4A02
1ZSHA 5F0LB 2WTRA 2R51A 4JQIA 4LL1A 1G4MA 1SUJA 4GEJA 4GFXA 5F0PB 3GC3A 3LHAA 5F0JB 3UGUA 3LH9A 2FAUA 4P2AA 1JSYA 3LH8A 2WTRB 3GD1C 4J2QA 4GEIA 4R7XA 1G4RA 1AYRA 3P2DA 5F0MB 4ZRGA 1CF1A 3UGXA 4LL4A 4R7VA
chains in the Genus database with same CATH superfamily
1ZSHA 3KCPB 3HN5A 3OWEA 5IVXE 3MXVH 3GXTA 1GZHA 2QSCH 2F18A 1F56A 2CM6A 3EBGA 1V3JA 2VT0A 1EXUA 4ODBD 1EJOH 1WZ1L 3C8KA 1TFHA 2Z7ZA 3GSQB 3IMSA 3CMGA 2HH0H 3DV4A 4S1DD 1F3DH 3HS0C 5DJ2A 2BZCA 1RZJC 1TSHA 4KKAC 2XFXB 4YGVA 2QVTA 3T3PE 1U8CB 2ZOUA 4CVXA 1PY9A 4P2RD 4RESB 3IFNL 4YXLH 3DI2B 3VXRB 1OTUC 4PFEA 5JQHC 1I7ZB 2MSPA 3BJ91 3X17A 4ZFOB 4I2XB 2ESVD 5HP5A 2ROYA 1M7IB 4HWBL 1L4IA 1KXHA 1DCLA 4AH2A 1L6XA 4PJEF 5DRNA 3NIGE 4ALAL 3QIUC 2OMTB 5IQ7H 5BV7B 3BHBA 1Q90A 2VR4A 4XXWA 5ISZB 3IJYA 1CICA 3E2HC 1FL6B 4J28A 5D1ZC 3Q6FA 3MRBB 3L54A 3FO0H 2XQYK 1B0RB 2GIMA 4IU3A 3QE5A 4MXWH 4ZMYA 4H13C 4I3SL 5B4MC 2FX8L 1HCVA 2FNBA 1L7IL 4XVJL 3OVUB 4OTXL 3J7HA 3OSVA 4PJFA 4QRRE 4AEIL 4RGOH 4QRUB 5EOQH 4WRLA 2WCGA 4DEUA 1BVNP 2R69H 4YQXH 3KPLB 4PJHF 1DJIA 1E8ZA 2BVUA 2JKLA 3MC0A 5HD8C 3DVNB 4FQPA 1LP9E 2DM3A 4OD3H 1PLAA 4IKJA 5EF1A 3ETTA 3RZCA 4GW1A 4MA3B 1YEIH 4KWUA 2AC0A 3ARGD 4UT9L 2EO9A 2CDGA 3E8VA 4Z3FA 5KN5B 1VFAA 5A2KH 4PJDA 4N5UA 2VDLL 4BK4A 1X5FA 4FQ1L 2NZ9C 4OB5L 4U05A 4AIZA 3BRFA 1SQ2N 4NENA 4L9LC 3ZKMC 4GSQA 4YH6A 4Y5XC 4FMVA 1FIGL 2DBJA 1YEFH 2VC2B 1TR7A 3PP4L 5C0RH 1JFQL 5KYYB 2BX5A 2KI6A 4HUXA 3QNZA 1CFSB 3H42H 3UG4A 3IETA 2VW6A 3HBGA 1QO3A 4GP4B 1HWWA 3BXNB 1CFTB 3X3GH 2CDFA 2D3LA 4GW4B 1B0GB 1I7UB 3FU7B 3V4VL 3QG6A 2V9UA 2X4SB 1D6EA 4XRCB 2DD8L 2RHEA 4OZHF 1OB0A 1RQ5A 2NXZB 3QRGH 5DJZB 3WFDL 4AYFB 1YPZF 3TONA 5AB1A 2GJJA 1KYAA 3IJSB 1B4TA 4GRWB 2XUWA 2Q6WB 5F8RC 4EUPH 3WI9A 4PY7B 5DD6B 4WFEE 5CZVL 2AGJH 4JBSA 2FJGB 2G9KA 2VLRA 4IYKA 4LBAA 5I1JH 1E4HA 1D5MB 2C3XA 4GO9A 1XCQA 3MLUH 2FK9A 5EU4A 5I8KL 4QTIH 5AD0A 3K71A 2WW8A 2YD6A 4WEMB 4WHTA 3UYOD 1G87A 5L8KB 3KL0A 1AZUA 3OLIA 1XGTA 4JFYA 4ZTEA 3V52L 1Y0LA 4NM4H 4FQQB 5BJTA 5LG6A 1E4WH 4A6YB 3OWRA 1RV6X 1GYUA 3EGXA 3DHUA 2CO3A 1U95A 4W9KC 4AENB 1XCXA 5HPMB 5KBDA 1P5UC 4JQIH 1BQSA 4M7JL 1J87A 5ABDE 3FB5A 2WUCL 3HNTH 1ZOXA 3IPBA 4PJ8A 4APXA 3IDGB 4HUCA 4YC2B 1OD9A 4DKEH 5F9OL 1NOLA 1JNNH 1EHAA 5SX4I 2PCFB 5CSZA 1NCBL 4FKHA 2K1MA 5T1LB 2YD9A 3UC0H 2OZNA 4MD0B 2WLIB 2XWJB 4XTRC 2WXLA 4NQCA 4F15C 4HS8H 4HUWB 1DSFL 3PWLA 1N5AB 5J6HA 1NAMA 5EOTA 3I9GL 1T5XA 2X89A 2Y23A 4JFHD 3ZUCA 2OMYA 3HMXH 2E7LA 3MGOB 4TUUA 4ONHB 4N2AA 4K55A 4R5XA 5JPNA 1ITCA 3T8VA 1FCGA 3MPCA 2FO4B 4JFFD 5C9JB 1NPNA 1C5CL 4UQBA 1F90H 4NB7A 4Q0XH 5C09A 2JQAA 2WMPA 5D4IA 1WGVA 1KZQA 1ND0A 3JTTB 2WGXA 4OIIH 3BAJA 5IB1A 1RK0B 1XTLA 2FJFB 3O2VL 5I1AB 2CO6A 2CJUH 4P2RE 3K46A 4YHKH 3RWGB 2C3VA 5IV2B 4Z76A 5INCA 4GG6E 3HN3A 2YPVA 1WBXA 2Q8AH 2HUEA 3DROA 2ESVE 4NNPL 5BVPH 3BAIA 1PJWA 3AAZA 3GXPA 1OOWA 5AOKA 5C92A 3MRCA 4P2OD 3ZKSD 1HH9A 4WEUD 3W9DB 3KPSA 5CJXC 4X6EA 3CLFH 1FBIL 4FXTA 2H32H 5D4QA 3GXDA 3RWCB 2CIIB 2W59A 3RILA 2ZE0A 5T33L 4HX1A 4G9DB 3GM8A 3ML9A 4U1MA 3EJZC 1IGMH 2I5YH 5GGVH 3E7JA 5FKAA 5HHPB 2ZJSH 3UTTA 4OCWH 3N44B 1KPUB 4UT7H 4M3HA 5INDA 3UZEA 3GBNH 3QZLA 1LXMA 1S9XA 2F8VA 1C12A 2CRIA 2TRYA 4HDIB 4LEXH 2ROXA 4K3EH 3KWVA 5CEZL 3N42B 2A4EA 2XZAL 1D2PA 3S9DB 4J1UB 2BWDA 1AJ7L 3HMWL 3UO1H 3BUIA 2EZ0D 1YN7B 3SODB 3QC5X 4HIJB 3UPRB 3SKOB 3JBG7 4J8RA 1D5IH 1UD5A 4EN2A 4YHPB 4WK4B 4KMTH 1TNNA 4NQSA 3EADA 1QKZL 3IU4L 1KB5L 1ACYH 4HGWB 3WE6B 3GXNA 4AVIA 5IEKB 2B2XH 2DWSA 2WUBL 1RULH 4KK6C 4Y1SA 1TJHH 3MFFA 1X5MA 5C0IB 3H9SB 3T0WA 3QQ9C 4EF3A 3CG8A 2BSRA 1JZHA 2Y06H 4FZEH 4LARL 4Q2ZA 5JHDA 3QORD 1SN0A 4KDWA 5L0QC 2R2CA 4HKZA 1P53A 1HCYA 2X9WA 3BYTA 2ODHA 4Q9BA 5FDYA 5IGXH 3BWAA 3REVA 4QGTA 1ZEAH 2BNUB 3EYFB 3NJGA 1HC1A 3ZMNA 1U58B 4IBSA 1SUHA 2YXVA 4KXZH 4Y9FA 2O5NA 4EI0A 2HT4C 4RZCB 4S0SD 1KIQB 1JIBA 5JIHA 4DVBB 3OBAA 1L9TA 1DSYA 3QR1A 2HFEB 4P4KC 4YDVB 2IQ9H 1DVTA 3CPUA 2P7TA 4LLVA 2ADJB 4QHNB 5EA0H 2LAAA 1J9CT 4HFUL 1J9RA 3ILPB 5CZXD 5HYQA 2J55A 1J1OH 5SV3A 1OHQA 2W9DH 2FEDC 3LKNB 4MQXC 2JTDA 1R75A 1YMHA 3ZT6A 4L3CA 4G42A 5IROD 4M7LH 1XXFC 1ZE3H 1E5BA 2L7UA 2YS4A 1IFHH 1D9KA 3O8XC 4JO3H 3Q13A 2ED6A 3G08B 2DQDH 3BAEL 3LZNA 2D73A 3GHPA 2H41A 4BINA 2YUXA 2FYYB 3L16A 3KPOA 3QIUA 2NR6D 4FKEA 4P3DB 2VDPL 1RFDH 3S36X 1TZHA 2Z1KA 3GWJA 2BNQB 3H4HA 4GSXA 3DO4A 2BHUA 4AGOA 2EC9U 1QSVA 4CSPA 5T5FH 5EIIA 4IGBB 2O1AA 1E8WA 1IFRA 4BIKA 2CAKA 4X9FA 1Q94A 2YUZA 3WIFA 3X11A 4JFHE 4AW7A 3G6JB 1DZ0A 2RH0A 4PB9H 4M1CC 4O51A 2XTJB 5AFAA 1PL3A 1JWMA 5HDWA 1PYWB 3QFGA 1HYSD 4JFFE 3NSFA 5GSRA 3VAEA 4XNUH 3HBPA 2CJSA 4LP8A 1E7VA 4S2SB 1UA7A 4FFZH 3SKMB 1B88A 5CZRA 2FAUA 4FNPA 2HX9A 3D18B 3DJZA 2IFFH 5E94B 1RPKA 3TBWB 4OGAD 1A7RH 2EDOA 3I2CH 1QFHA 1BBDH 3EFDL 1HQ4B 2AV1A 4JAMB 2B16A 4NBXB 3WSQL 4GG8A 4R8WL 1TTUA 2Y7NA 1MPAL 3QQDA 1IC4H 4H8HA 1DQLL 5KYWA 2EDDA 3VI3A 2Q10A 4XC1L 1SVBA 3DOIA 1KTRL 3JVFC 2LT9A 1SUJA 1F3RB 4GOSA 4H8WC 5C6WH 4JVUA 1A7NL 2PYFA 2XDHA 4FRWA 4ELKB 1U8NA 5IF0B 2WQSA 5C08D 2EE0A 5IW3A 1XBRA 1PZBA 8FABA 1BX2A 3D12B 3LKOB 1CUOA 3A3YB 1AG6A 1RZ8A 2WN3A 4U1SB 2ZXEB 2AMUA 4WU5A 1J1XL 4B53A 1QA9B 4PY8I 5GS0D 2EAEA 3VRLF 3DRQB 3C6SA 3PWVB 1OCWH 3QHTC 4E5XA 3LZQA 4N2OA 3ZK0A 2BWIA 2WQAA 2N0KA 1O6SB 2ICWB 2Y7LA 1RH8A 2YOCA 2K8QA 4DP6X 1KTDA 3G9VA 5AYUH 3QRBA 2OX5A 5KYUA 3BGFC 4W6XB 3MTXA 1FZKB 3VGAB 1NDTA 3F7PC 4WEBL 5I17A 5JW5A 2OZ4A 1OLZA 4AQ1B 3REWA 3HE7B 2CHXA 4OM0L 2R1WB 3TA3B 5IJDC 3CX5J 4D9LL 2EKSA 4N86A 3MUGB 4TMPA 5EZOL 1A1MB 5F96L 3IWUA 35C8L 2HJKA 3L3JA 4UB0H 2XWBB 2VMJA 2XRAL 4NFCA 2J1YA 1CPUA 3HG1D 4YSEA 1A7PL 2Z31B 4N0UA 5E5MB 3GKWL 3K6OA 3GSVB 4F91B 1BVKB 4KKLD 1U8IA 3VTMA 4X4ZA 1RLWA 4E5XG 1I9EA 5CJOL 1ECYA 3AU1B 4UQ3A 5DJXB 3EJJX 3R4RA 3FQ1A 4UTAL 4H20L 4FI6A 4ABUA 3JQOB 1CD0A 5J3HD 2APSA 2IAMC 4MTMA 1TO5A 4PRPB 3L4TA 5GGQH 5J12B 4AM0Q 1OQXA 4KQ3H 2OJEB 5A7EA 4AWJC 1JMZA 3QUZA 5EWIL 5EG6C 4XB8A 2P24B 4PJXE 1MREL 3ZGIA 3WAJA 2F8OA 3RAJL 5KVFH 1HI6B 5FA3A 1S9WA 3GBMH 5MEOB 4PHZA 1YPZE 1R4XA 3MRKA 2V5TA 5A2LH 5CCGE 3ZDYB 5LB1A 1IVLA 2WB1A 3SGDI 2NCMA 5ESVA 4IJ3C 4OBSA 2R23A 5SWQA 1NCUA 5AL0A 1QFWM 4BDVB 3N44F 4O5LL 2Z4TA 1S8DB 2VWEE 3MXVL 4NO5A 1EAQA 3IYLW 3BQUD 4P46A 4PGBB 5E56A 2QSCL 4ZSOA 2OMWB 5HHMB 3CBRA 1HHIB 3VRIA 4CGUB 1Q8MA 2TAAA 4X5WB 1EJOL 1NGQH 2HH0L 5CJXA 4W6YB 3LQAH 2Z35A 2R56H 3BWZA 1WS7A 1IBYA 3SPVA 1NIFA 2YD3A 3OPZH 3WY3A 1OP4A 5DHMC 3U2SB 3P2DA 4WSJA 1BZ9A 1SMAA 5CLTA 2EUVA 1WITA 2ODIA 1M4KA 4YXLL 4WJG3 4NC1C 5J6SA 1I3UA 4KX7A 2B8OT 2QR0B 1RP9A 4RMUA 4TNWK 2F54A 3O6KH 1RZGA 5I6XB 4OJDH 3P73B 1UURA 2VZOA 1SLUA 4YSPA 4TQEH 3LZOA 5GZOC 4EO5A 5IQ7L 3S37X 1I7TA 2FWLB 4HETA 1ZHKB 2RACA 3N40P 5AVYB 4OZIB 2J2ZB 3TN0D 1NL0H 1KIUB 1OHZA 3NMEA 4N1HB 4FG6C 1CFQB 3FO0L 3RY6A 3UIZA 4MXWL 5E6ID 3S48A 2A6DB 2J5WA 5HY9B 1R5IB 3IU3B 1NIAA 4UM8B 4OFDA 4QRPA 5JUEH 5C8JB 1Q9KA 4ZAKA 4RGOL 2WLNA 5EOQL 1CIDA 1RMFH 4QGYA 5DJYA 4K73A 2R69L 1ZVHA 2BMKB 2ZUWA 4YQXL 4YPGB 4OZGB 4CVZA 4NFBA 3F7VB 5GRZA 5DVLA 4PPTA 1U4FA 2VDOH 2XOTA 3LDBB 4KJQD 4OAWA 5C08E 3C5JB 3RHWK 2IXQB 4OD3L 3RQ3A 1E8YA 4PBDA 1PIFA 2GG1A 4PRAB 4RGNB 1YEIL 1A4AA 2FH8A 3BVWA 3MROA 2CLZA 4LQ1A 1TSRA 3MRGA 3CHPA 4N3TA 3D05A 3BZEB 1N7MH 3JUZA 1BMZA 3CVHA 1KYFA 1EBAA 4MLIA 5DQ9B 2FL5A 5BOPA 5FKPA 1Z9SB 1ZLVH 5I0VA 5KANG 3S96A 2W60B 3B2MA 3ZZQA 1YEFL 2C9PA 2DOCA 4DO4A 5C0RL 5DWPA 1CXLA 3FT0A 1YY8A 3DA0A 5IVOA 4LIQH 1E7UA 4P4KA 5EEXA 3MR9B 1CE6A 2BRRH 3X3GL 1FP5A 3SDAC 4L1SA 1HSBA 2EIZA 5LGKA 4X80H 5B38A 2CLRB 2YEZB 4EBQH 3OJVC 2OTWA 2X44D 1A6VH 3DUUA 3MLRH 3O6FC 4JNXA 5ESQB 1UWYA 5IREA 4HPYH 3OXSA 4PP1D 3G6JF 2VYRE 1SOXA 3VRJA 1JF1A 4FQHB 2WPGA 4I87A 3O8XA 3QH3A 4DP1X 3HG1E 4M93C 2FWUA 3GTNA 2XWXA 3A4FA 5LGJA 2ARWA 5I1JL 3NTCH 3T0EC 4DP4X 5I30H 2O6PA 1XBDA 3VX0A 2ICWJ 2ZUUA 3BO8A 3MLUL 2QQQA 2B1HH 4PWFA 4YVNA 4XPBH 1YYCA 3LZLA 4QTIL 2C1OA 2AQ3A 5T1LD 4B9YA 5FOBB 3MBEB 4NQVA 2NSXA 3L4YA 5CCHE 3LX9A 5IW6B 1SN5A 4NM4L 2A4ZA 2BS71 4X8CA 3TZVC 4YDLB 1AOZA 1E4WL 4RMTA 1QEWB 4Y4FC 1J11A 5J11B 4HGKC 5E8NB 3PFQA 1R5VB 5BS0D 5DEGA 3ZHDA 2ZZUT 5JMOC 2BC4A 2CBPA 4JRXA 4MA1B 5TDOA 3ABLB 3MRDB 4JQIL 4NQDA 1D7DA 1DBAH 3GS0A 3KLAA 2ZNXA 5DLMH 4WDIA 3HNTL 2HX8A 4DKEL 4X9GA 1OGAB 5A3IC 3M8OH 1JNNL 3CFNA 4X50A 3FU0A 4EN3C 4L37B 1T1XB 2HFFA 1HX0A 2XWRA 5E51A 1TTFA 5FFOA 3DYOA 4NWUH 4LVOC 3L4VA 3UC0L 1G9HA 2PPAA 2JJTC 4KO9A 2NYZA 3VCLB 3QAQA 4UOW1 4HS8L 1GJIA 3K2KA 3MLWH 5E8EA 4I2XE 4ABVA 2DICA 1N0XH 4OCXH 5IIEA 1CT8B 3HMXL 2PN5A 1IBDA 4OZ4B 1MFNA 4N1CA 4HF5L 3P40A 2PWEA 4NXSA 4ELMA 1NEZB 1F90L 4Q0XL 3QIWB 3BZDA 3KPMA 3PL6C 4JRWA 4WV1A 4A2HA 2N7BA 4ZFGH 5GGTH 3BN9C 5C71A 3WKNA 4CSSA 5DRWA 1AMXA 1WAEA 2ZXWB 1A9EB 4YHKL 1JCVA 4H40A 1HCFX 2A74B 4MB5A 2V37A 3L1EA 2AAVA 4JGUA 1FNAA 3E1F1 3NFPB 3DECA 4L8DB 5E9DA 1GGCH 3BIKB 5KSBE 4OR1A 3IXAB 4N8VA 5CHNB 2H7WA 3QT2A 2Q87A 3E6HB 4FG0A 5BVPL 4IMLA 4V2CB 1L9QA 2ZKMX 1TO4A 3HUJE 1Z9PA 2OYKA 4XN1A 2YFNA 5DMKA 5DFTA 4ZQKB 4HU2A 2HCZX 3ARFC 1UWXH 3FU3A 3MXWH 2G3NA 5C0JB 1MELA 5TPWH 43CAA 1VACA 1OAQH 2C34A 1EEUA 3ARBD 1AIFA 3PNRB 5IHLB 1IGML 2I5YL 5GGVL 3LNIA 2OMXA 1JF6A 2ZJSL 4PP2B 3HCVB 3FAWA 3E1ZA 1EERB 2YFOA 4OCWL 4Z7OE 4UT7L 1OCZB 2I7OA 3SDYH 1NDMA 2ED7A 3GBNL 3OJ2C 5D2NB 2YA0A 4FNRA 1P4BL 4JR9L 4LEXL 4G6FB 4BKLB 1FHNA 4L4VA 4OFYD 1KSRA 2BSTB 3TBTB 3VH8A 4TUJA 2I26N 3GS4A 3UO1L 4XXDA 2RD0A 4PCKA 3RDJA 2K9FB 3GI8L 3P3SA 4N8VG 3RVXC 5JYLA 1PFOA 3P9MB 1ZXQA 2XU9A 3FTWA 3NGBB 5DJAA 3DO7B 1D5IL 2NYYD 3ZDYF 1KXVC 4GRWE 5BRZE 1HXYA 2A7BA 3F7KA 4KMTL 4MXQD 4JEGB 2XT1B 3HC4L 2ATKB 5E8PB 1ACYL 5DTFB 3KYOA 4EEEA 2B2XL 3J2PA 1C8PA 4PVNA 5TF1H 1RULL 3CFKB 1TJHL 1KJ2H 2GT9B 4P0DA 3RWIA 3STZB 1BAFH 1KGIA 5JIDA 2OL3H 3GLAA 4IKNA 4OVVA 2Y06L 4FZEL 2ZXGA 4RAUA 1A5FL 3VRLE 1F6LL 4PWEA 1TVDA 2VITA 3Q8FA 1EEZB 5GJSH 4OGZA 5IT2H 3ES6A 5IGXL 2E8YA 5DMGC 1YYMH 1BVOA 1EAPB 3QARA 4PS4H 5IQOA 1ZEAL 4WO4B 1AG0A 3OF6D 3LQZA 3ZE0F 5I8CB 2FX7H 3VH8G 2JCCB 4U6VH 1I53A 3SN6N 1W2KT 4OD2A 3VWJD 5DSCB 2RB8A 3MRRA 5A2AA 2JCWA 3EOBA 4JB9H 2X4NA 3WEAA 1TEYA 1V55B 3KNBB 2K4WA 1F97A 3KWWB 4IKKA 4WW2A 3RDTA 4HXAH 4PJCB 1CD1B 2IQ9L 2V3FA 3LKQA 2WANA 3BSGA 5DQDH 4OZIF 5J1AA 5EA0L 4E42B 1HL5A 3D39B 1HHJB 1U3ZA 1U3JA 1ZTXE 1MDTA 1OLLA 3BI9X 1PNCA 4N0YL 1J1OL 3CSYA 1JNHA 2W9DL 5BS0E 2KT6A 3AG2B 4AV4A 2EDHA 5EU7C 1E43A 1GJWA 2AQTA 3M17A 2P5ED 4H1LB 4Y2NA 4CC4A 1IFHL 3U9PH 4JO3L 2DQDL 4QTFA 2AQRA 5I8EA 4OZGF 2F74B 3KXFB 1N64H 4LCCB 3WNPA 1WA2X 3PWNB 3FHAA 1AFVH 2P1YA 2UXGA 5T1KA 4ZX3A 1PD6A 2IV8A 4I85A 5IQ9A 4MB1A 4QAMB 4LKCB 4A7GF 4Z7UB 4JM2D 3QDGD 2MWCA 4PJ9A 5T5FL 2X2UA 3F12B 4JQVA 4LHQB 3FBQA 3IGKA 4ISVA 3T2NH 3K4DA 4MD5A 3ZTCC 3MV8B 1AKJB 2R2HA 2B5IC 4PB9L 3WUWB 2GCYB 5CD3B 2HKHH 2DJMA 5CN3A 1WBZB 1HH6A 4BZ1A 3MJ8B 1F6AA 1GZPB 4GW5B 1FSKC 1U8PB 4XNUL 3PU7A 1IGIH 4FABH 2OMZA 2JIXB 1FFQA 3KPTA 3FT4A 4FFZL 1B3IA 2YAQA 1F11B 4G43A 1BQLH 4KKCD 5PAZA 3D2UB 1BREA 5F1NB 5C0EA 4PI0A 2J6EA 1XMWA 2IFFL 4G80B 2ICEB 4MMYA 3LB6D 4N0FB 1A7RL 2DAVA 4U1GC 3I2CL 4PJGF 2PKDA 1BBDL 4CSZA 1P1ZA 3FKUS 3QS2A 4FEMA 4F92B 5AKRA 1IM3B 5DMJB 5CF3A 4X98A 4LCIH 3B5TA 5IK3B 1XF3B 1QR1A 1DO5A 3DX6B 3H55A 3CFBA 1QNIA 4PR5A 3I3DA 1NCNA 1M1XA 1ETZA 3HE7D 2PW1A 1JFHA 3JUYA 4Y1AA 3BKCL 5LBSA 4PV8B 3TA3D 4IOFC 4LIQE 4POZD 4J6RL 2XV3A 3F58L 4FQXB 4PCYA 2K3HA 2IOMA 4I18A 4OGXH 1KXTA 1I9JH 1MH5A 4UILH 5HHNA 1OCWL 3BP5A 1FJ1B 5IJVB 3HI1B 4A66A 5DDHB 2Z31D 3UYPB 2A83A 1HE7A 4RIRA 3NCBB 4EZJA 4KRNA 5AYUL 3SPHA 4GXVH 4R96B 5D6DA 4DGIH 4O2FB 5I1HH 3KBFA 4HUVA 5I0ZA 5DO8A 1F4YH 3OMAB 4XCFL 5EEWA 1ZGLA 1KY7A 2QPDB 4GP5B 4KOCA 2GEQA 3B9KD 1EXUB 2VM9A 3BPCA 3C8KB 1PZAA 3TO4C 4AIOA 5HSFA 2F5BH 4K4KA 4AYID 3K74B 2WBJA 4PRPD 1VJSA 1GVIA 4HMDA 4YO0B 5FCUH 3GMQB 4RWHA 3JV0A 4IHOB 4HA1A 4F58H 1WICA 2J3SA 4TV3A 5C0BA 2P45B 4PJAA 2E7MA 4AGPA 1AQKL 3BVNB 4DZ8B 1F2XK 1WJ3A 2H2PC 1UOWA 4GAFB 1WO2A 3CHOA 2HVJA 1BZQK 4AH2B 5T3XD 1HKFA 5DRNB 3ZE1B 4OF3A 5IFHH 1BF5A 1XFPA 3BHBB 1QSEA 4JY4A 2EIJB 2BIIA 2DQHH 4PGDA 3UERA 2YLHA 5HHMD 5F0LB 1IQWH 3Q6FB 1RZPA 2W0KA 5ALCH 5GGQL 3CBJB 2ZOWA 1DLFH 4KQ3L 3IJEB 2AXGB 4OD1H 1NBYA 3EDKA 4OLVH 2WZAA 5KBPA 2H3NB 1IM9D 5DC4B 4U6YB 4WKXA 3UPCA 2RFXA 4M56A 5KVFL 3F83A 3RGVD 1F1AA 1F86A 1G9NH 1CD8A 4Q9QL 3RVVD 4IRSD 5JXED 6TAAA 4UQEA 1T7YA 5C0NC 5F89B 5MEQA 1H5BB 2P5EE 4C83B 5HGGS 1UD6A 3C6LC 5J1SC 1L9NA 4JDEB 1U92B 1F8TH 5B8CB 2Q86B 2VO8A 4F7PB 3BFWA 3L45A 2ZT9C 4UBDC 2PXYB 3GYRA 4UDUA 2EVGA 2PP7A 4PU2A 1CR9H 1NGQL 3QUYB 1IC7H 1O5PA 1LNUB 2N1KA 2HG5A 3LQAL 1FL5A 2R56L 1EO7A 1OSPH 3FAXA 3G5XB 4Z0XB 3QDGE 5TD4A 1TZ8A 4RMVA 2PW2A 3ZW3A 4Y5VC 1Q0EA 5F7YC 2QDVA 1LVEA 4AIEA 1J0JA 2XIIA 4Y5YA 3QNZB 1J0HA 1AS8A 2CHWA 4H5SB 4CSTA 4MQTB 4B9FA 3KAAA 2OPCA 5CBAB 4CILA 3RA7H 1FVEB 5BO1L 1J5IA 4X7CC 4DT2A 4JPSA 3O6KL 3SZKC 3TH2T 5DFWH 4DP0X 5J5EA 3T8XA 3W3BA 1B90A 2IANB 4HK0B 4TQEL 1D6EB 5EO1B 4HZAA 5EOCH 1TEGA 3OTTA 4DKTA 4YLBA 3O6LH 4EXPX 2AXFA 3CXDH 4HV8A 1NL0L 3RL1B 5I1EH 2WP3O 2NZIA 2NMSA 3MJ7B 1E9QA 3US1A 4K7PY 1OP5K 3X14B 3B9EA 3EYVA 5DEFB 3MV9D 2WO4A 1NDGB 3KBEA 4DCQA 5AD0B 4L2YA 5GGUB 3K71B 5KVEE 2JCCF 4GMSH 2GC7C 1E6OH 4BHUA 2OP4H 3LAFA 2FJHA 3ZRSA 5MP6H 2D0HA 3AU0A 4KI5C 3EGSB 2A6IA 2VDOL 1NGZB 3TJEH 4OJAA 3ZO0A 4OJFH 3NCEB 4PJCF 4MA7H 1CU4H 1TMQA 3MUUA 2OJZH 2JE8A 1IGTB 2NY3C 2OCJA 3BJLA 1JPGA 5HDQH 2C4FU 1WAAA 4MS6A 4AXWB 2BWQA 1LO0H 2ZP9A 4XMUA 1N7ML 2G2RA 3QQNA 2O4EA 2QELA 4KKBC 1RCYA 4K5MA 3S3PA 4DKDC 1X9UA 1FVCA 1WCQA 4XNAA 4D0BA 4LAJH 2VXVH 3WY2A 4NKOA 2DQ6A 3AG1B 2X1OA 3QEQB 3V0IA 4XN9A 1JL8A 4LIQL 3TYGL 5EOTB 3MBED 4NC0B 1WVZA 2FO1A 2BRRL 1RUAH 3QEHA 4OW6A 2DKUA 3ILEA 1INQB 4RFNC 3V6ZA 2VKXA 4X80L 4LRNH 4QRTA 3EUUA 3UTOA 3NZSA 4CBPA 3MUY1 1SLVA 1O6VA 4EBQL 4HXBH 1T6VN 4PRPE 1A6VL 2AJZA 3MLRL 3B8YA 4HPYL 3CWGA 4PLKC 3EDFA 5B3JF 2Q3XA 1JBJA 4RSVA 4HEMA 4ALAC 2DLFH 2JQZA 2Z8WC 4KGLA 4JPIB 4LVHC 4YSDA 2PUQT 1ZLWK 1A3QA 4B96A 2JKJA 1OGAD 1FFPA 3NTCL 1T20B 4OKVA 4Z76B 2FCBA 5I30L 3O11B 1U8JA 4B7IA 3BUYB 2B1HL 2GFBA 4XPBL 4TNVF 1G7MB 2HT2D 3BEWB 3L9RA 5T3XE 5HJBA 3UZQA 5JPMC 3MRCB 1R34A 1XTMA 2H0JA 1DQQA 4N22A 2CSPA 3S35X 3M46A 1MJUH 2ZWKA 2G2PA 3FUDA 3PJLA 1JUFA 1UWFA 4OY9A 3ZIYA 1J8HA 4MSWA 1DBAL 2OSWA 3CDZA 5DLML 2V4LA 2XWEA 1UH2A 2BXZA 1BFOB 1NIDA 3SGEH 3NIFE 3M8OL 4TUOB 5HHOA 3GMRA 5INDB 2GIXA 2JMRA 4GFTB 2VDML 1Z5HA 4GRLB 1K6QH 3EUDA 4FKKA 4IBTA 4NWUL 1B4RA 2X9YA 3IAQA 4DZBB 2XVLA 3GMNB 3MLWL 3NCYS 2A77H 1N0XL 4OCXL 4NRYA 4B9ZA 5FM5O 4U3SA 4TVUA 1RZFH 5C0AD 1M71B 1JPST 2NX5B 3L3IB 3VFGH 2VLJB 5C70A 5HHQA 1Z5LB 5DD5H 1QFWH 2X2YA 3MTRA 2EEFA 3RVTD 4NQSB 3QULB 4ZFGL 1U3HB 2ZXQA 5GGTL 2WCSA 4WKZB 4LVEA 3MFFB 3IDMB 2QV2A 3U2JA 4AUUA 3HE6A 3SHSA 2ATAA 4CN1A 1D5RA 3VM7A 5ACLA 3PAVA 4O00A 5AW8B 1SY6A 5JHDB 5KTEH 1SOKA 4RNRB 5A2FA 2DM4A 1C1EH 1LMKA 4G6FD 4YK4C 3KLDA 5AL8A 2CCLA 3UACA 3F6JA 3CXFA 1EANA 1YJDC 3SKNB 1UM5H 2WXGA 3E6FA 3GJFK 3BWAB 4NQUA 1BBJA 3R8BB 3TT3L 4HSCX 4I1RA 4W4NA 2RBLA 1DBJH 3ARVA 2R15A 3MXWL 4P4RB 5EF0A 5TPWL 5L9DH 1OAQL 5CLWA 4KK8C 3MV9E 3ZE1F 4Z7VB 1UGKA 3VWKD 2BOCB 3SDYL 1IO4C 3GRGA 2P7TB 3SDXA 5H94B 3K6NA 4B9GA 3Q2WA 2WNWA 1KF9B 3C9NB 3D50A 3FUHA 3E8UL 3J27A 5IY5B 3VQMA 5E6YA 4MJHA 4JKNA 3U0TB 2YQ2A 3UCQA 4HPHA 4R9HA 3HEIB 2EDWA 3HVNA 2R39A 5JW3H 3PHQB 4IKLA 1Q9OA 4WO4D 2MOGA 1DLHA 1X7QB 1TVBB 4UQ2A 3VYNA 2CNYA 4HUUB 1QTYT 2O6EA 3TEWA 1LK3L 3FRUB 4GKSA 2QZ5A 4XN2A 1UUSA 4LMQE 5EIIB 4LSTH 1B4JH 2I07A 43C9A 1BAFL 4NEHB 2YAPA 2OL3L 2ZUSA 4OCRL 3ZUNC 1MCLA 4KNUA 4J3OD 5EZJA 3Q9QA 2MCG1 1N5YL 4O02B 1JS4A 1JF5A 4CDHA 1JWMB 3WEBA 4AT6A 4OI8A 2DLTA 5GJSL 2BM3A 5GSRB 3Q01A 4CW1A 2KH2B 2KQNA 3ENEA 1YYML 2C3HA 3MLYH 4POYA 4KZEH 2FX9L 5AG8A 4PS4L 3EYUH 1ZA6A 4OLUH 1QW9A 1KJMB 4KQ0A 4FFWD 2K4AA 2FX7L 4PTTA 4U6VL 2DWEA 2D3NA 1ZT7A 1A6TB 1I8UA 1SOQA 2AVFA 4K9EC 1OWWA 5LN4A 3FZUD 3ZT7A 4CNIA 1UB5A 1OGAE 1VPOH 2WXKA 4JB9L 1DVFA 2WVVB 3AY2A 3QXWA 3N41B 4NRXA 4HXAL 5AVWB 5JIIA 1LM8V 3PAYA 2QT6A 2CUAA 2VJXA 4G8FB 4PRIA 5D7JA 4XMWA 2IGFH 3R06B 4TQIA 3C5ZD 2H0FA 2LHAA 3R1GH 2VQ1B 4FLOA 2GY5A 4Y5VA 3VI3B 1FI8C 1WG3A 3ULUF 2HTLD 2YEVB 3MV8D 4HPOH 1AKJD 1JGVH 4BQCA 5TDNB 2QQKH 3FULA 2PYFB 4L1DA 3MODH 3SDCC 3ULSA 1AO7B 1U8NB 3FQNA 1UTDA 2J43A 3OKDA 1KLFB 5FUZL 2YSSB 3U9PL 3U6XS 1RZIA 2JIXD 3NJXA 2K70A 2YHGA 3FL7A 2ITDA 5D8JL 1N64L 2Q76A 3MRHA 5BCAA 1L5GA 5EO9A 3C6SB 1AFVL 2JK5A 2DN7A 3QEUB 4UZGA 3LXBA 2Q7YA 2OMUA 2XA8H 4E9RA 1QSFA 3A4EA 5I26A 1NGWB 2W9LA 1KTDB 3T2NL 4UV7H 4UYPA 1YC8A 4XMPH 4D8PA 4LAQH 3CSFA 3QPQC 1K2DA 2HKHL 1OAZH 5FOJA 5GGRB 3QCVH 4B27A 5I17B 4CJ1A 2HVKB 5C0AE 3VFSB 3L3GA 4G8GB 4JX0A 1RP8A 3REWB 3KBHE 1EZLA 5AKSA 3T0AA 3ZE2B 4HFWA 1IGIL 4PYGA 4FABL 3C12A 3F00A 5FW8A 1KGJA 2JVUA 3DX8B 3TF7C 1WRFA 5DZJA 1HHHA 1BQLL 2HA1A 3Q8BA 1E9PB 3TYFA 4FQXD 3FN0H 1AI1H 4XB3A 1HINL 4GUCA 1OT1A 4L48A 4ERSL 3GMMB 4XNQA 3WTSA 4YHYB 5G4OA 3L3DB 1E67A 1H8NA 1JZ4A 2GEEA 1KB9K 1XD1A 4TF4A 4ACTA 3VI4B 3K1KC 3LKRA 5ITFB 4AYSA 3D08A 4LLMA 4UQ3B 1HDMA 2F7QA 1MXDA 2EIKB 2EILB 4EI5B 4LP4A 3UFIA 4D2NA 3FO9B 5DT1L 4BFIB 5IMMB 3KPQA 5K69A 3ULVH 1TYRA 5K39B 1AD9A 1D2OA 3DPDA 1YEJH 3VXUB 2X7LA 2X4PB 2EDEA 1G1KA 5D2LA 4XI5C 1JG9A 3IMBA 1IU1A 1HL4A 3RVWD 4OGXL 4UAOC 1I9JL 4QHMA 3F5WA 3SE9L 4WHDA 1KTKE 3C60B 2HSIA 2Z4QB 4UILL 3GSXB 3I6KB 2WVUA 1EUTA 1R3JB 3PJNA 4GUPA 4KHXH 1B0WA 2J4WH 3X1NA 1E4KA 1XR9A 2R23B 3NCYP 1ET5A 3D3VB 4GXVL 4KTEH 5I1HL 5JA9A 4H0LC 3HS8A 1BD2A 1F4YL 4XPAH 1XHHA 3O3BA 4JZJC 3WXWL 3BDYH 3M1CA 1JZDC 2P43B 4LDLB 4ZFZA 2APXA 4NN6B 3R7QA 3BZ5A 1FZMA 2F5BL 4LPCA 3MKGA 4D94A 3NK3A 3N1GC 4QMEA 4JZNA 3BVTA 3BPLC 4YSRA 3HI6L 1CXIA 4BK5C 4BCXA 5I0XA 1T89A 2BS8A 3OKKB 4KOBA 3BAKA 1ZV9A 4IOSA 3WL9A 4F58L 1P7HL 4XBPB 1ONQB 3TV3H 2VR5A 4AQAB 3BH4A 5I76B 4TSBH 3THMH 1ZLEA 3B9DA 5DD1H 3EDDA 4KH9A 2CALA 1RZGB 4AVHA 1I1FB 2PYEB 5F88B 5KSVA 4XX1E 1DE4A 5IFHL 3BRGC 3T0BA 3RZCD 2YPVH 4S1DC 1QG3A 2XXFA 3A5VA 3R0MA 2XZCH 2DQHL 3AM8C 1IQWL 5FYKH 1F18A 3D30A 3IAGC 4K94H 3L6FA 2YD4A 4F2EA 2BDNH 1AZVA 3D51A 1Z0MA 2AK1H 3CC5A 1DLFL 4B5EA 4OD1L 1ASPA 1HQRB 2PTTB 5HDBB 4QRPB 4OLVL 4Q58C 3QRLA 3ZHFA 2ZF9A 1NUGA 3GSUA 2NTSP 4ZAKB 4Z7UE 1PZUB 2CO1A 4O2CB 2HLEB 2IQAA 3S6CA 4W9DC 1FG2A 1G9NL 2X4OA 1YEDA 2K0RA 5D7HA 4CVZB 3QYNA 3MV8E 2UZYA 2AV7B 4Y4KA 3JTSB 1MFDH 2OXHA 1A7BA 3K0YA 2V7HA 4FNLH 4Z7VF 1HHKA 2UXVA 1BIHA 1UC6A 4O58H 1S7RA 2MTAA 5D7LB 5JXEC 1RUPH 2NT1A 4IMKA 2IAND 1F8TL 1ZGLM 3BX7C 3ATAA 3KVDD 2V0AA 3DRTA 2MKWA 3T6XA 4NKDB 2Q20A 1YMMA 1IC7L 2Y7OA 3CVHB 4P5TA 5D7IA 2Y6TE 3VYPA 2ENJA 3GMLA 4NYLA 4E9VA 3QO1A 1OSPL 5FKPB 3ULUD 1R3LA 3PXHA 5D5MF 3MA7B 4M7ZC 2VLRD 1AP2A 4MQ7B 2QADD 4U6XB 4X6FA 4WZ9A 2H6UA 4F80A 1H15A 3WDHA 1U9KA 4AKOA 2V9TA 1VGKB 1DQVA 4Z0BH 1DQJA 3MRIB 2ZUTA 2YKLL 3ULVD 2E7DA 4W93A 2BFVH 5CKGA 2YZ1A 4GT7A 2V2XB 3ARGC 1KCWA 3U0WH 1PX8A 2EIZB 5B38B 3RJOA 3G5WA 1DN0A 2EIDA 3IRPX 4A67A 2OTWB 4LESA 2JJVA 5EOCL 1ADQA 2F7OA 3O6LL 4KV5E 3CXDL 5I1EL 1JF1B 3VFTA 1HXMA 5T1MB 2FGWH 1KGUA 3H3PH 4PJ8D 3WFHA 4BV1A 1CXKA 1RERA 3APNA 4NZRL 1LDPL 4CMMA 1Y18A 5E5LA 1CK0H 2Q2EB 1A9BA 1DTUA 4YHMH 3A4DA 2DI7A 1YG9A 1KT2B 3FCSA 2W65A 4GQZA 4GMSL 4HJ1A 4NQCD 1E6OL 2YGNA 1A6AA 2OP4L 4F27A 2VDMB 4Z7QF 3KJ4B 5MP6L 2J88H 3HZYA 1JVKA 4Q6IC 2X89D 3TJEL 4ZUTB 3RFZA 4D9RD 3N41F 4OJFL 3VXPA 5A16A 3ZYJA 4HJGB 4DTGH 1RZJH 5I6OA 4HKXA 4G1MB 1CU4L 1X44A 3JWDC 4MA7L 2OJZL 5F9WC 5TDOB 5IOKA 1G7PA 2J6WA 2A9MH 2KS0A 3MKKA 1V7NH 5HDQL 1LO0L 3QFJA 4XWOD 1E90A 1EZVX 1AHWB 1CFMA 2B1OA 3NPZB 3I9IA 1MFBH 3LZFH 2NY0B 3BPNC 3CHXA 2YQBA 1CJYA 2ORBH 4L5FH 2VXVL 3OG4B 4X8GA 4XP1H 5DK0B 1HZKA 2NUTA 2QV4A 2IDQA 3EG9A 4Y9CA 1OF2B 4Z7WB 1A65A 3KGSA 1QLRB 2BVPA 3WU1A 1RUAL 3QI9A 4CJ0A 4M6AA 3KWUA 3UBXB 2AJUL 2EEXA 3KPSD 1NQBA 2H47C 3MRFA 3ECUA 3FSVA 6PCYA 3KJ6H 4RDBA 2LU3A 1JI1A 5H35B 1U21A 3AW5A 3RIKA 3ZKND 3SDCA 3KW8A 2EXSA 1KCVH 2UX7A 3L5JA 4JJ5A 5C86A 1XF5A 3N85H 3TEZA 5FF6B 4JANB 3DX9A 1EV2E 4FLRA 1ZAGA 2D31A 4PJFE 2DLFL 3KYKL 5DRWB 1UJ3C 1W80A 4PM1A 2QKIB 2G75A 3BEVB 2UYLB 2R27A 3UTSA 4MJ5A 1G4MA 2DQGH 1XEUA 4HISA 4LSVH 3ZE2F 1ZSDA 4OCLC 3V0HA 5E9DB 3DXAA 3OZ9H 3SY6A 4ONOA 4OI7A 4KX9A 5L4FA 2QHRH 3P9LB 4J27A 3QZWA 3LV3B 1W8NA 3OMIB 3X13B 5C07A 4DP5X 2BOLA 2F5AH 3ARRA 1GGBH 5DMKB 1LO4H 2X40A 3A47A 2DQTH 3HN8A 3TS8A 3KLQA 1MJUL 1SHMA 1Y7VA 2VTFA 4E0RB 5KSAB 3L81A 3QO0B 3UGEA 4LVNB 2WBWB 3IJHB 3VI4F 4NKMB 4YHZH 3V8CA 1BQHB 5BQ7B 3AGVA 1E3XA 1SJHA 3MLXH 2YUVA 4BSVB 4JQXC 2CZNA 3R19A 4LDOB 4UIKH 1TQBB 3CH8A 4YDJB 4M8UA 1WFNA 2NNAB 4L3FA 1ETB1 3AS2A 1K6QL 4XPGH 3RL2A 4P2OC 4W4OA 4C4BA 5FGBA 1WV7T 5JHDD 1KBGH 1MCIA 1SXZA 4TUJB 1PZ2A 1SYVB 5K9OB 4OUUB 2IANE 4LCUA 1BA9A 1S6NA 2D4DA 3PG2A 3DX7A 1XGQB 1N0LB 1KDJA 2GAZA 5IBUB 1FQ9C 1JXGA 1RZFL 2EDXA 3FFDB 3NQIA 4I5BB 3QZWG 4NJ9H 3LN5B 3VFGL 2BZDA 4K23H 5DD5L 3ULUE 1WD9A 2F53B 3BUPA 4R7DA 4XBGA 1KTCA 1W0WA 2AQSA 2FH6A 1ZK5A 2OZ4H 2VLRE 3CFDA 3HZKB 5F3HA 3HAEA 4BZ2L 5I1LA 5BW7C 3QUML 2A73A 1R5WB 2F2HA 3RWIB 4KK9C 4PGEB 5AAWC 4JHVA 3TNNB 4QJ4B 3ULVE 2ZWNA 3EO0B 2AP2A 4MWFA 5L2KB 4PLJD 4RAUB 5KTEL 2QDWA 2EDYA 2M2DA 3ZRCC 2EZ0C 1C1EL 3SCMB 1WT5A 2R7EB 1V3MA 2YIHA 3RTQB 1UM5L 1VSCA 4CADA 3GGWB 2CO7A 5J13C 1AHMA 2GHZA 4X99B 1DBJL 1U6AL 4ZOAA 2IPUG 3MRRB 3UTQB 4UI2A 3EH3B 1JDCA 4JKMA 5F7EL 2CR3A 3ARSA 3F7YA 4LSRH 1ADWA 3ZX1A 4F7CB 3RDTB 3FQWB 2HJFA 2X53A 4HWZB 4KROD 3QORC 1NKGA 3PHOA 1V7MH 5IHUH 1ZK9A 2OMNA 2DJUA 4B97A 4NQCE 1MNUH 2XVKA 1H3XA 1JYWA 3CFJA 4FCHA 4IOIB 1R17A 3HAEG 4NRZB 4WI0A 5IHZB 5HDBF 2DTSA 3FB6B 1R3HA 5F1IA 5C0FA 4D9RE 5KZCB 5EEUA 2WOBA 2NQCA 2Z8RA 2NQDA 3QG7H 4RX4A 3O9WA 1KTLA 2HN7A 3CCHA 3S7GA 5F3BB 3GBEA 3L5XH 3WO4C 4ZXBA 3A4AA 1WCBA 1MZYA 4BFJA 1I3VA 5AZEH 4JHBA 4JO4H 3WS6C 2EADA 2EO1A 3KWXA 4LRIA 1FNEA 1AZRA 3DX2A 1SVCP 1BVLA 4NAQA 3Q2NA 4NUJA 4BQ6A 3FUNA 4LSTL 1B4JL 4PD4J 5CZXC 2VSMB 3GQFA 2A9DA 4TLKA 5HDRA 4DH2A 5I66B 4QRBA 5FYKE 3JSSA 4RBPK 2OBGA 1B9KA 3O3AB 2BIQA 4IW4C 4JUSA 5IROC 2DM2A 4P9MH 3WN5B 3KPSE 4NOFA 2VLLB 5I1IH 5K59F 4NHUB 2WLLB 4KZEL 3DX0A 3K8KA 1GA2A 2NR6C 2A9BA 3CZJA 3ELAT 1A1OA 5DEJA 3Q5OA 1U8LA 2PPCA 1I8LA 4ZW7A 1GC1H 5D7SH 5CGTA 4ODXB 3FB7A 4MMYB 2OKMA 4FG2A 5L2JB 1KELH 1ZKAA 3GSNH 3ZTEA 4L8CA 2H45A 4EIZC 1P1ZB 2EECA 1DZBA 2BHFA 4W1TA 1M6OA 1O0VA 1VADA 2IGFL 2J21A 1CVSC 1A3LH 2XN0A 1JWUB 3K6DA 1M42A 3R1GL 4HLJA 1N10A 4XNYH 3WMPA 4N2BA 4JJOA 3ARDB 1JGVL 2QQKL 3MODL 1N9PA 5IEHB 1TYJA 2QKSA 1M1XB 4HS6A 4KUCF 4MDIA 5DJCA 1ETZB 1S3KH 3P77A 3MOQA 3OLDA 4XCNA 5IMKA 4L29A 1NA8A 3MNZA 2WIIB 2P47B 3S4SA 3DHMA 4ODSH 4OQTA 3TP4A 1H3WM 2FZ3A 2ZUYA 4XCCH 3TCLB 1MAJA 1X7TA 2XA8L 2MQCA 5JHDE 3GHEH 4RIRB 3SGEI 3BUBA 3WEXA 2E86A 3FFOA 4UV7L 4XMPL 2EDBA 4TNWF 4LAQL 2FWSA 1OAZL 3QCVL 4ATTA 4EI5D 2CM5A 2XXMB 4N9GA 1TQCB 4MZ3A 4LLUB 4Z7WF 1S5IH 3C09B 4WAFA 5GS2H 5EUKA 2QMJA 2C7FA 4BSJA 1AXSA 2OSLB 3ABMB 2WQRA 1AI1L 3FN0L 3QUZD 4YDMA 1YEKH 5EBMA 3S34H 5FK9B 1IAKA 1IAMA 1QAWA 3V0VA 1S9VB 3AREB 3V8OA 2I9TB 2NSQA 2ZWSA 4JJHA 3ZKQD 2J71A 3S4SG 1AGBB 3NZHH 3LY6A 4ZW5A 3N40F 4X9YA 3RHWF 3KPNA 4ZUUA 4A37A 3MNWB 4JY4B 4P5RA 2JJSC 3DGDA 4P46D 1ZIBA 2PTVA 3FPYA 4PGDB 1UB6A 5KAQF 3QYMA 1N8ZA 3ULVL 4L5FE 1MNNA 1TQTA 3ISRA 3ZTDC 1YEJL 1JV5B 2E7CA 3TBYA 1YDPA 1PKOA 3K6SA 1J8KA 1SPDA 3GTVA 1IE4A 1E65A 4R97C 2RFXB 1JRHH 3KPPB 2CBQA 4WK0B 3PWPA 4G8EB 4KHXL 4U1NB 4KKLC 3G6AB 4GAJH 2QSQA 5DYFA 4LSSL 1CMOA 1UJ3A 2J4WL 4FXKC 3SE4C 1G6RB 3FOLA 1G9EA 1EDYA 1EZUA 1J10A 4CMHB 4KTEL 1NTDA 2F54D 1UWGH 4R5VA 3I84A 4ZMLA 5J3HC 4JG5A 4XPAL 2H6OA 1ZLUH 2PYED 3AT0A 3DBXA 4KHTH 2XKNB 3BP4B 4KTYA 2EDFA 3BDYL 2UWEA 4UDUB 2NW3A 2J7LA 4HHAA 3O2WH 4ZUSA 4ZO9A 1ZHBB 4HIPA 1F4XH 4F7TB 1OARH 4TNFA 3P3UA 1OSEA 1AR1D 7PAZA 4WTWA 3VMPA 4QRPD 2H26A 4OV5A 4PN6A 4ZAKD 5J7CC 3TV3L 3U7AA 4ZMVA 4KRMB 4TSBL 3THML 3S36H 4M9PA 5DD1L 3VI3E 4BZYA 4YHIA 4HKBA 3VACA 3HPLB 3BQUC 5E08H 3WIHA 4GAGH 2QSVA 5J9PA 2VZ3A 3NJIA 2VZTA 4E9YA 2NCEA 4O2EA 1LK2A 2M8XA 3EOTH 5DZ9A 3QXDA 5BOJA 2YPVL 3H7BB 2XZCL 2MTPA 3Q3GB 2V8LA 3SGJC 5FYKL 4MGXA 3U36B 3S0PA 4K94L 3WJJC 1SDDA 2BDNL 3S98A 2AK1L 3GIZH 3T9WA 1A3ZA 3D33A 2CK2A 1P6WA 5AWNL 4L0PB 3Q2CA 3BH8B 4H8PA 2P8MA 4XCEB 5I9QB 5BZWA 3O2DA 4NUPA 4Y16C 1UFUA 3CFIC 1U42A 3TCXA 4PJ7F 4B0MB 1JWSB 5JDSB 2DQFB 2E27H 1GKEA 3D0LB 1I7RA 3W0WB 4JW3A 5KG9B 4FNLL 5GS1C 5F7AA 1R0AH 1IEBA 3FTXA 4O58L 2RR3A 3TN0C 1JDDA 3OHXC 1H0DA 4PUBH 5E6IC 1Z9OA 5K9QG 1NM9A 2AJVL 3MLSH 3CZFB 2QGEA 3T65A 2GHWB 2G2RB 1TKWA 4ZUWA 3RX5A 1TZIA 2OTUA 4RETB 2X3AA 3ZMEA 2CBMA 4PJHA 5EFIB 3IJ7A 3SE6A 1HNGA 1MJ8L 5DS8A 3EO1B 3GO1H 3D52A 4N0UE 4D0BB 2Z3FA 5IOPA 5IFJA 3VXOA 2APFA 5IKCA 1CO1A 3BWUF 5DCCA 1N2RB 4KJQC 4R7VA 4Z0BL 2CHNA 1KIRA 2YSTA 3VI4E 3I02A 4RAVB 1PKQB 2BFVL 1KCBA 5I19L 1U91A 1Q9WB 5CP3A 1C16A 3U0WL 5D7EA 1TOXA 5HGBB 3HA0A 3V6ZB 4EXKA 1MN4A 2D7PA 4M62H 4F9PC 3VXMB 4BUHA 4IEFA 5HGDA 4JRXD 2P8PA 5PCYA 1KULA 1PDKB 1IX2A 1OCCB 4N2HA 1BJ8A 2XV6B 4A2DA 1BF8A 3C8HA 5GQBA 1UXMA 3H3PL 1DANU 3LNFA 4ODWA 2EC9T 2OI9C 3CK0H 4Z3HA 5FLUA 5LBVA 2NY0D 1CK0L 3MVSA 4JFEB 3QJVB 4YHML 1N59B 1NC4A 1T21B 1XH3A 3IPFA 1XT5A 1NC2B 4ECNA 2P9RA 4B7LA 4OZHA 1OW0A 2J88L 1YPZA 3JV5A 1L6ZA 1DQQB 4XXCC 1HJCA 2DQIH 5DQJB 5F7LB 5ID1A 3EOAB 4OF6A 1I9RH 2H1PH 3AB0C 3QNFA 3I6GB 1RJYA 3NCWA 4DTGL 1RZJL 1J8HB 4JVPA 2FE0A 2K7PA 2A9ML 4X0KB 1MWAB 1V7NL 2EKJA 4RLDA 2EYRA 1GYWA 2X2HA 4XAWH 3GBLA 1YEHH 3I74A 4FTVA 2O61A 1BPVA 1MFBL 3LZFL 4G7QB 1ZTMA 3ROOB 2ORBL 3DURA 3PABB 4XP1L 5E9DD 3QUMB 3MGAA 2Q2LA 5LAPA 1F45A 1QP1A 1UD4A 2F54E 1GSKA 1U36A 1E9OA 4NRYB 2R2BA 4BWTA 1F1DA 2ZCZA 12E8H 4JRYB 4OFVA 4LE8A 2YN3A 4H26A 3OR7B 1OCRB 3FTGA 5F6HI 4APQA 1EHKB 5DHYB 1IGYA 3UZVB 4AQZA 1KCVL 5DWUH 1FNSL 4QRPE 2DW5A 3N85L 4RMQA 1WC7A 4BZ1H 5ACZA 3EJSA 3H8NA 3LNEA 3MYJA 3ZT5A 2DQGL 4LSVL 3T4YB 3N1QC 1I3RA 3D48R 3AT9A 1ROCA 1XIWA 4QO1A 5AVRB 1T22B 4OLYH 3VXSB 3VNZA 1XH1A 1VEOA 2QHRL 1TIUA 2FIKB 3AACA 2IH1A 2J6EH 4L4VD 4XNMA 3WJLA 4UIMB 4G83A 3H6AA 1CTNA 3L7FB 1J12A 2DLEA 2F5AL 2WWMC 4JREB 1GGBL 3F6IA 2DQTL 4OF0A 3CFCH 3PGFH 2BIOA 2C9QA 1DO6A 4G3YH 5DS2A 4JDVA 2WWKT 4Q74A 4WTXA 1EVUA 3N1PC 4WWKA 5AVVB 2CLVB 4MKTA 3PJSB 3NZ8B 2AJSL 2O93L 2F53D 1DUZB 2HLAA 3LN9A 3MLXL 3RWDA 2YAOA 1MCFA 1DP0A 3DTUB 3S37H 2CKBB 2FB4H 3FMGH 3MA9H 4NNXA 4UIKL 1P84K 5CFAA 1FZOA 1NFIA 4YIQA 5LBSH 2B59A 4ODVH 4XPGL 1X5HA 4N8CH 3ZPDA 1UM4L 3W81A 1KBGL 4YBLC 3NJMA 1ACCA 3GHBL 3LRMA 4AEEA 3MNMA 3SCMD 4LLQB 3E0GA 3L9YA 3LS5H 2QSTA 5D70H 2BCMA 1YYLH 3ESPA 1MJ7H 1S7XA 3VFOA 1BEYH 3ARBC 3VGGA 4N6RA 2GUYA 5F21B 2IPKA 4NJ9L 2BINA 4OGQC 1IQDB 4K23L 4IHBA 3WGVB 4XVUD 2MCAA 2P5WB 4UQDA 1J18A 2OA9A 3HRZB 2OZ4L 5DK2A 3SY0A 4PVLA 3SJVA 2KLRA 43C9B 5L4JA 1LO5B 4FL4B 3DX1A 3RDTD 3ZN6A 3NQKA 4PJBB 4XZUA 3VTTA 3FQUB 2ADFH 3QQXA 1MHHA 5C0DB 3AWFA 4GI8A 1R3KA 4YL9A 5T1DH 5IQMA 4ZTOH 1SM3H 1CGTA 4MJIA 5J6GB 4BFKA 5I23A 5KZCD 3AQDA 1VCAA 4CW1B 3AUVA 5CINH 3MCYA 3SE4A 2NYYC 4JRXE 2J57A 3KCPA 4MXQC 4NQDE 2DRUA 4U0RB 4X8XA 2VR3A 4L4TB 4PTTB 5I28A 3IN2A 2V3DA 4N2GA 1I1AB 4CNIB 5D1XB 1RKRA 1UB5B 5GHWL 5LGYA 2DZEA 3GSQA 3CXHK 1UUNA 1QTSA 3A22A 4LSRL 5T1KD 3A0OA 3X12A 2R4SH 4N2FA 1YN6B 2XFXA 2G0KA 5FDWB 1RSFA 1MIMH 3AJ7A 1V7ML 4Z3JA 4PJ9D 5D7JB 4DPAX 1QNZH 1R24B 4GQRA 1U8CA 5F1SA 1MNUL 4AX3A 2J8UF 3CZSA 4Z7WE 2D03H 4O9HH 4P2CG 2BVYA 3D7PA 2JKNA 3JWOH 4HVBA 3VXRA 3L13A 1I7ZA 1P2CB 3DSFH 4XVSH 2HLFD 1K3ZA 2CNZA 4ZFOA 3ZDXB 1QOKA 3RNKB 4L2LA 1M7IA 3OKDB 5LKNA 3VWJC 4GXUM 5DURD 1QHPA 2TSAA 1QASA 1DVYA 2OMTA 2AXHA 4ORZC 4JO4L 2VW7A 2FO8A 5CWSB 5ISZA 2DI9A 1FL6A 3MRBA 5F7DB 1B0RA 2GSIB 2DDQH 3FT3B 4MS8C 3NABH 3GJFB 5E9DE 3CU7A 3WD5H 1HL9A 3VFWB 5DO2D 4YLCA 2JJWA 2IEPA 3VFVB 1WWWX 4AITA 4NIYE 4QRUA 4D8PB 4QRQB 2A38A 4OLZH 4P9ML 4XN4A 3ARDD 4J23A 3NEOA 5IHWA 4NKIH 2WZ0A 5C7XH 3DVNA 2QGBA 1RUMH 4P2YA 2AABH 4Q97A 1JHKH 4E36A 3DGGB 2HX7A 4Y1AD 4NHCL 5B3NA 2P8LA 1GC1L 5D7SL 4KKZA 4WI9A 1FE8H 4JM2C 1HEJC 5E7BA 3IN0A 1Q0YH 3GSNL 1R33A 4XNQB 3ROLB 2MEJB 3MLZH 5DI8B 2B9AA 2C9VA 4L4VE 4DP8X 2GK0B 1A3LL 1UFGA 3T77B 4XNYL 5DZAA 3VA2C 5JQ6H 1UACH 1PBYA 4JN2B 1BGXL 2ZX7A 1CFSA 3HR6A 3U9UB 1GOFA 3FYIB 1CFTA 2NY2B 3T1FA 4KKCC 4BA0A 4GW4A 3FQTB 1S3KL 1B0GA 1I85A 4JHAH 4BUQA 1I7UA 3FU7A 2X7LB 3DK2A 5DZOA 2X4SA 5DJZA 2AMGA 2F53E 4NS0A 2WBJD 4ZJ9A 4AYFA 3AQXA 3UDWA 4ODSL 4HALA 4TUKH 2KKQA 3D0VA 3FT2B 4J7RA 3BIAX 4XCCL 3WJMB 2Q6WA 2B7DT 1CS6A 2YA1A 3HKZA 3RURA 5CSGA 4PY7A 5DD6A 1FL3B 2FJGA 3EFOB 1KCSH 4HCGA 3RB5A 2XQBH 3E9TA 1D5MA 3GLDA 1JZ6A 5SX5K 1XR9B 1UYWH 3PDOB 2OAAA 4AK1A 1BD2B 3HE7C 4BJLA 4PIBA 4Y2OB 4G2AA 1XR8B 4FQQA 4OCYH 1AOHA 1QHOA 3TA3C 4POZC 3ISYA 3K80A 1KPRB 2FRGP 3V0JA 1IE5A 4MLSA 3D25B 4XXCA 5CJQH 2X12A 4AENA 1KTBA 5HPMA 1S5IL 2VR8A 4P99A 3GDCA 5I74C 1OO2A 3FPXA 4FULA 3VQLA 4CVWA 2Z31C 2R4RH 2A9AA 3WL9B 1JERA 4JZOB 4LLDB 2GTZB 3IDGA 1T7XA 4PB0H 1VA9A 4NOBA 4I89A 5FV1L 4QHPA 2PCFA 2WN2A 1QW8A 3KM1A 2C1PB 3QYCA 1II4E 2FUQA 3NZHL 4MQSB 3A6OA 5G4MA 4MD0A 2XWJA 1J0IA 3B9KC 3ZOAA 4LEOB 3S3BB 3HFFA 2JLLA 1PG7X 4HUWA 1PW3A 1U2HA 1N5AA 4ZODA 2JKRM 3N04A 5DHEA 3RUGB 2ZAGA 2R2EB 3MGOA 1UD2A 4ONHA 4GIAA 2ATPB 1AQDB 5GRVL 5CR8A 5I5IA 4M5ZL 5ICYA 1BMGA 2FO4A 2R9HD 5C9JA 5AZUA 3CQFA 3IDJB 3NJFA 4GKZB 3BDBA 3EH4B 2YAMA 3GSUB 3LPWA 5CSBA 1JRHL 2YWZA 3JTTA 4UNUA 3WELA 4BWUA 1AKPA 2IQAB 4YDNA 5CD5D 1RK0A 2FJFA 5D1QB 1J5DA 2X4OB 1O75A 1V10A 4GAJL 3RWGA 5IV2A 4LHJB 2OXHB 3HC3H 2UZXB 2UXTA 1WWCA 3KLLA 5IVNA 3EO9H 3NG5A 1YY9D 4MZ2A 2XG4B 3HZVA 2BIPA 2Z64C 1WF5A 3LXAA 1RVFL 3V9EA 2XBTA 5I2IB 1OGTB 1UKTA 3DRTB 4N8PA 2G60L 3W9DA 2EUZA 4MJ2A 3HNVH 5JOPD 1JPSH 1F4XL 3QO1B 1OARL 2WYIA 3RGVC 4TTDD 1GL4B 4G9DA 4R2GD 2NY5H 4KXDA 1ICTA 1SOSA 4IRSC 3RVVC 4OIFA 1BOGB 4J8QA 1RJZB 1YNKH 3HB3D 4KRPD 5H4YA 5I6PA 3IFPB 5HHPA 3FJTA 3M1BA 3MI6A 4XR8C 1KPUA 3S36L 4BE6A 4WGKA 2GQHA 1C9SA 1GRWA 4DFHA 3VVVA 4HDIA 5B22A 4PRBB 1NCTA 4GAGL 2IH3B 1GCYA 5IWLC 1NCHA 4PJBF 4E9SA 1SY6H 3QJZA 4Y1AE 3NJJA 4FXGC 5F7UA 2ZUQC 4G72B 2V7NA 1YN7A 4HIJA 5A40E 3HS0B 3VFTB 1RIHH 3Q2VA 3SKOA 1LWJA 1LLAA 2X4RB 3UPRA 1YEGH 3GIZL 3BVXA 3WFHB 1CI5A 3L2MA 1ZLSH 1P9MC 3ILDA 4K2UH 4PVMA 4YHPA 3T4AA 4QF1B 4H7VA 2DPKA 2EVFA 3WE6A 5IEKA 2WNGA 3FCSB 2FNWA 5C0IA 5EHFA 3H9SA 2E27L 5FO9B 3DOSB 3WFZA 1NBZA 1RK7A 4UZUA 5BXFB 1F2QA 3MNVB 3DLQR 5IFAH 1R0AL 4NT6A 4LGPB 4G9FB 3U1SH 3UPAA 3E2HB 4HKJB 5AW6B 4R0LC 5D1ZB 3OZLA 2XZQH 2QGCA 1EO8L 3MLSL 3VXMD 3ZYZA 4C4KT 3FUJA 2WZPA 1O7DE 5EC1B 2BNUA 4PJDF 4NZUH 3EYFA 4J4PA 1U4EA 1U58A 2AEOA 4ETQB 1OL0A 1S7VA 3ZDXF 1XB3A 1MIEH 1MJJB 4RZCA 1W0YT 1KIQA 1H19A 3GO1L 5EBWA 5KBKA 4DVBA 4PJAE 1CG9B 1O7VA 5J1TC 4IS6B 5ABZA 5AQ0A 1CLOH 5BOZG 4JFED 3MZGB 4ZPTB 1PZCA 4YDVA 2ADJA 2ETWA 4R5TA 3QI9B 4JFSA 4JPWH 3ILPA 1ZVYA 4M62L 3MACL 4GS7B 2GI7A 1F3JB 1T66D 3OKMB 1J8HD 2ZYHA 4HLZG 3OR6B 1XF5B 4BUGA 1LE5B 3G08A 4CU6A 2HJLB 4L9LB 4X4XB 4X83A 1INEH 2QZQA 1JHLH 1PCSA 1MVYA 3U4AA 4AJ0A 2FYYA 3IFOB 4P3DA 1QYGH 5HHOD 3CK0L 4K8RH 2BNQA 5EZIL 3UEQA 3MBEC 2JNZA 3RWJB 4IGBA 2QPUA 4ZYKB 2CWRA 3ASWA 5C07B 4XT1C 5KVDL 3G6JA 4V33A 2DQIL 2LQRA 3OMZA 5FFGA 1QRKA 2H1PL 3BT2H 3BWSA 4ONFH 4JRYD 5E2JA 1PYWA 3BKJH 3U83A 1Z1WA 5GIRB 5KVGE 3OKOB 3P4MB 4HS3B 5AW1B 4ZMZA 4S2SA 4XAWL 3SKMA 2Y5QA 1BIIB 1YEHL 1DYZA 5JORB 2Y36H 2HT2C 3D09A 5E94A 3TBWA 3HE6D 4WNQB 3PPEA 2Z91B 3FRPB 1JRHI 4U2YA 4JAMA 4JCLA 2V17H 4PBVC 3FSAA 5D55A 4U1JA 5J56B 1M05B 3VXSD 2Z34A 4ODHH 3IE9A 4ZMNA 3QVAA 2ID5A 4BGDA 12E8L 1QLFB 5JOPE 4ELKA 5DHVB 4UUJB 5IF0A 3TEXA 4IBWA 1S4IA 3LKOA 1UZ6E 1ZXKA 5F3HB 3VFUB 1JYVA 4BZ1L 3V5KB 4XN5A 4U1SA 2ZCHH 1QFUH 3LRGA 1BAWA 3DJRA 5C2UB 3Q9PA 1ILUA 3DRQA 4GSRA 5GGVY 4B5ZA 3V5HB 3JZYA 3L3OA 3HC2A 4F15B 3PWVA 5T5NF 2Q0ZX 1A22B 4OLYL 1KENH 5I16B 1O6SA 2J6EL 5HI4D 1TTGA 3FQ4A 3RB7A 2H1XA 1IBZA 4JPQA 1K8DB 2AEQH 1AGFB 5DF0A 4EZLA 5JO5B 4XWGH 1FZKA 4K5LA 1MG3C 3RVTC 1SN2A 3TASA 3UMNA 3CFCL 3PGFL 2DKSA 1WAAE 4GAYB 4QHUB 2IWFA 4AQ1A 1FIEA 6FABH 3WXVH 4LEBA 1RZ7H 2E4FA 1KEGH 3MV11 4WQOA 2R1WA 3TA3A 3OQ3B 1QLEH 3HKFA 4X7FC 2FB4L 3MA9L 4YFLI 2L04A 1VDGA 1DFBH 3RUGF 4TSAL 1IEHA 1RURH 4ODUA 2XWBA 4IBVA 1EAOA 5LBSL 3GRWH 4AGQA 2AK4B 3CIAA 4ODVL 5DJ8B 2Z31A 3QJHA 5T3ZH 3QNYB 1R3HB 5EU6B 5E5MA 3V0WL 3NEXA 4XE0A 3QISA 3B7SA 1BVKA 3LS5L 3DSNB 1UXSA 5D70L 1YYLL 3OZKA 1MJ7L 3NGBC 4ZXBB 3S2CA 1BEYL 3VXME 3AU1A 5EORH 1CDCA 4HC1A 4K8RD 2L3BA 1N4XH 2KZ1B 4BRJA 5EZLA 4MYPA 3VWKC 4PREA 2Z8VC 4Z7NF 1I1AD 4PRPA 1FNHA 3QC6X 1FFTB 5D1XD 3RBSA 1KFAH 2I27N 2OJEA 4M5TA 2V5SA 4ZFFA 4LCWA 4JFEE 4OGYH 2H3XC 4FHBD 2PPEA 5D7JD 5T1DL 1HI6A 3EJPA 2KPWA 3JVGA 1I1CA 5MEOA 4P06A 4LPVA 4XBMA 3DIVA 5ANMB 4UDTA 4OCNC 3F7RA 5AVUB 3N91A 5CINL 4UU9B 4WO4C 2EDTA 4XN8A 1J8HE 4BDVA 1OPGH 1ZDSA 3N3EA 1S8DA 4PGBA 2OYLA 1IGJB 4MDRA 2GJ6B 2OMWA 2XSKA 4BWWA 1HHIA 4PCTA 4KI1A 4X5WA 5HHOE 5SWSB 3V4VA 1J9TA 3JT2A 3LD8C 2FGZA 2PNDA 3H2QA 3VD0A 4J3OC 2R4SL 3TV8A 2Y9RT 2NQ3A 1QSFD 5L0QB 1QNZL 3U2SA 2UVEA 1T0MA 4OV6F 4O9HL 2YAHA 3DSFL 3GXUB 4LNRB 2QR0A 4FFWC 4D7BA 3C5XA 5AW0B 3HIZA 3QUXC 4XPFH 2R59A 2J44A 1P6FA 3P73A 3FZUC 2CU9A 5IMKB 1XH0A 1F02I 4JY6B 4PVBA 2QVIA 2DLGA 3F85A 1ZHKA 4OZIA 5FAAA 5IB4A 2J2ZA 1KIUA 3GSOA 3S35H 3L1FA 5BQDA 2ZCKH 3NK4A 4AEHH 2DDQL 2A6DA 2EDRA 2O6FA 3NABL 2C9SA 3C5ZC 5HY9A 1R5IA 3MCLH 4UM8A 4NO0B 5I0DA 1QZNA 3FTZA 5L6YL 3WD5L 2HTLC 5C8JA 1DL7L 3VXSE 3PWUB 1JK8B 3CLEH 1EJ8A 3PIQB 4OBRA 3GXFA 4GY4A 4DSYA 2HFGH 2WQVA 2DF3A 2BMKA 3OPUA 4OLZL 3ZTNH 4OZGA 4FX5A 3F7VA 3RX7A 2O5ZH 3D85B 4NKIL 5LCVA 5C7XL 3W5MA 5CAYB 2Y24A 1H3PH 1OK0A 1RUML 4JGMA 2AABL 2IXQA 2JFCA 3BYYA 4JKLA 1S78D 3V7MA 4MAYA 2XV0A 4LPXA 4PRAA 2C4FT 3QJSB 5F7BA 4A7GA 3QJFB 4F7KA 4CAGA 3FC8A 2ICEC 4PJ6A 4JO1L 1AXSB 1FE8L 2VM3A 5T3ZD 2CO4A 3BZEA 2GJZB 1IAKB 1Q0YL 3C2SA 2X41A 1WFUA 3GC3A 2F08A 2VXQL 3SDXE 2VISB 1ADQH 1MCNA 3EBAA 1D5BB 3KL5A 3MLZL 5DQ9A 1DBMH 2XZZA 4R4ND 3SBPA 1NUFA 2W60A 3G7TA 4N2LA 1Q72H 3BW9B 1J0YA 2WYTA 3VO0A 4ZRGA 1T3FB 1T5WB 1UACL 3BFQG 4XVTH 5JQ6L 2FLBT 4JFWA 4IIQC 1JN6B 2IGLA 2QPSA 2OR9L 1CI3M 1BD2D 3MR9A 3WNMA 4LLAA 1VKXB 1NUDA 3ABGA 1XGUA 4JHAL 4AE0A 4PJGA 4W9GC 4FQXC 2CLRA 1E4JA 2DH2A 3BVDB 4KUZH 4IBUA 5FYJD 5CLXA 2MRYA 5ESQA 5CGMA 3X3FH 4TUKL 2K8MA 2XPZA 4FQHA 1UXWA 4IOSD 2X70B 3LEXB 2XQBL 3MQIA 4R3SB 1UYWL 3WBDA 5CS7A 1A6PA 5FOBA 1OQOA 1GZHC 3MBEA 1URZA 3PAUA 2X6AA 5IW6A 2GJRA 3L2NA 4K9EH 3HHSB 3U30C 3HPJB 4OCYL 4C56B 5MENB 3EYQD 1QEWA 2E0PA 2YGVA 1WTLA 4XH2B 3BP7B 3EH1A 5E8NA 5CJQL 2W38A 3RVWC 2YPKA 4NZDA 1GGYA 2VSDA 5D1XE 1S7TB 3IDUA 5HVGB 2NDGA 2DQMA 2H0EA 1L9OA 4OV5B 2R4RL 1TPXC 4BELD 5HYJB 1N6QH 5E7FA 4PB0L 1OGAA 3QP3A 3WTVA 3J8F7 3TJPA 4L37A 1T1XA 4YHIB 5FFLA 4YEFA 4YFEA 4F8NA 3OJMB 4QXGH 3VCLA 5AOJA 5FYKU 4XXWC 4F7EB 2A6JB 4AQEB 4KZDL 3WY4A 2C9XA 1AGDB 1CT8A 4AW4A 1FNGB 1EDHA 1TCRB 4OZ4A 1SDDB 3IAPA 4EKXA 1P4UA 2W81C 1H3VA 1YMMD 4P05A 4P5TD 5IMOA 1NEZA 1BJ1J 2X28A 3QIWA 2P8MB 5CXPA 1JZIA 4I77L 2VMFA 4MAUH 4K3HA 4F9LA 4ZW8A 4FGMA 1QSFE 5DJ0B 4FG4A 3G6DH 3RP1A 4U6TA 3CX2A 1W0VB 4PJEB 2CJ3A 1A9EA 2IADB 4E41B 2A74A 1MCHA 5MHSD 1XSJA 4FS0A 1BLIA 1XD0A 2BCKA 1ES0B 2JJUA 1I7RB 2MOVA 3E80A 3NDYE 3HC3L 3NFPA 3EZ8A 4K15A 4L8DA 4N2CA 3RZCC 3IXAA 3EO9L 2HKFH 2D2OA 2DY2A 2LABA 5CHNA 2UY6B 1KCUH 4DKAA 3E6HA 1TNMA 2ZD0A 3VGFA 4E9XA 2CXGA 1ZT1B 3FF8A 4F7MB 1FV1B 2LU7A 1BP3B 4Z78B 1IVTA 2IAMB 3RJDA 4ZPVB 3EBHA 3I50H 2QL1A 3ZBMA 5C6TH 1JPSL 1TKWB 4ZUWB 5EN2B 4ZQKA 4B3EA 3GZPA 4M8QB 3BKMH 4PJHB 2ZUVA 5C0JA 4KKAD 5EUOF 1ZRUA 5DS8B 4R84A 3P0VH 2GTWB 1OTSD 3SYOA 3IMUA 3CZEA 1YNKL 4PP2A 3HCVA 3B56A 4Y2DB 1NMAH 3U25A 1NEZG 2P4AB 1ZJAA 4IJ3B 2KMWA 3O4OB 3LRSA 2ERJC 3V0AC 5D2NA 3B3BA 4U3CA 5C0GB 3U0PB 4DEPC 4BKLA 2BVQB 3M7FB 3RLSA 5FX3A 4Q8BA 2BSTA 3L95B 3TBTA 1MOEA 2CD0A 1KEML 2HMID 4M29A 4G9FD 1BXXA 2COQA 4MZIA 1A6WH 4LHUB 3ULUC 5FO2A 1RU9H 2NY7L 1RIHL 5T3ZE 3BISA 1H3GA 1YEGL 2Z93B 1F58H 3P9MA 5ADPH 2QADC 4L8BB 3DO7A 2FLMA 1Q0XH 2APWA 1ZLSL 1NCAH 2DL9A 4K2UL 4ODWB 2GBUA 5CIPB 2WWNA 2Z7UA 2ATKA 3ULVC 1NSNH 4KZ0A 5AOZA 5E8PA 4KNTA 5AUMB 4UNVA 3CFKA 4JMNA 2OFQA 3UJTH 2GT9A 3AMLA 3STZA 2W94A 2G3ZA 3WFEH 4WUUB 1BD2E 4Y89A 3JWNE 1N3NB 5IFAL 3QI9D 2VDQL 2AQPA 3ESNA 3U1SL 1HCZA 1S5HB 1HFUA 5FYJE 5JOEA 4PJ8C 3FOMB 2ZICA 1EAPA 3APCA 1ZDQA 4NZUL 4FHJA 1JPEA 5GZNA 5I8CA 3RY4A 2JCCA 1B4LA 3UTSD 5DSCA 1MIEL 3AROA 2IDFA 3KNBA 4AM0B 3DXAD 3KWWA 1CLOL 2WV3A 1UZGA 2EVJA 4GUQA 3B5GA 3PYCA 4PJCA 4W9ZA 2E7LC 1CD1A 1XB6A 2R2BB 3KDPB 4LL9A 1JYNA 3LPPA 4E42A 4EDWH 3D39A 3K8LA 5C07D 1HHJA 4JPWL 1AZCA 1OAYH 1YC7A 3KMDA 3UAJA 4N24A 4FNSA 5CILH 1AH1A 4XHJD 3IKKA 4XWOC 3FTGB 4QYOB 2HP4A 2DIEA 5EV7A 1IGYB 5MEPB 4H1LA 2B39A 2W8CA 1XVSA 4AGMA 1TZOA 2FHBA 3Q06A 4NI6A 1VFBB 2F74A 2IMMA 1INEL 1IGCH 1JHLL 3KXFA 4LCCA 3PWNA 1QYGL 3ATBA 1I3RB 5BZXA 3WNIA 2NT0A 4LKCA 4F8PA 2NYKA 1QACA 2AJYL 4Y8AA 3EHBD 1HS6A 3PREA 2H2SD 4V2BA 2AW2A 2HPOA 3FTSA 4HIXH 3MX0B 4K9JA 4QUOA 3VVWA 1PZ5B 3ZKNC 4DQOH 4C4UA 2GCYA 4DVRH 5CD3A 3BT2L 4TPRH 5DGQA 4ONFL 1WBZA 3CHRA 5DUPH 2CBTA 5EU3B 3MJ8A 1QMUA 3O6FB 4GQPH 1GZPA 4J3OG 1YMME 3CUPB 4GW5A 5D7IE 2XWDA 4WWKB 1U8PA 1CWVA 5LQBH 2XWTB 1XSIA 1S7UB 4TSCH 3DVFA 2HLAB 4M93B 1F11A 2F61A 3RWDB 2AEIT 3UZEC 3D2UA 1NINA 3T0EB 1X4XA 5F1NA 4ES9A 2DMCA 2F8IA 2Y36L 1TTBA 4H1LG 4X6DF 2F1AA 2ICEA 5MHSE 4N0FA 2B59B 4QXUH 1D6VH 3EW3B 2IJ0C 4AGLA 5TE4H 2V17L 3SBWA 4ENED 3ZR6A 4ODHL 3TZVB 5EPMB 5E4EB 1IM3A 4XP9H 3CVDA 2KZBA 1HK6A 3HC0B 3QSKB 1MF2H 5IK3A 2NUPB 1XF3A 3B37A 4IBZA 5E2WH 4HWEH 2WO2B 1M6UA 32C2A 1I1RA 5IBTL 4BXSV 4HJSA 1WZAA 4ADIA 1T7ZA 3PUUA 3L3HB 3WUWG 3JZ7A 4Z7AA 4EN3B 2HVBA 1WBYB 4PV8A 4RWYH 4N8UA 1CFNB 1Y6NR 1KYOJ 3QIBB 5E1HB 1EXHA 4NWTH 4S10A 3OSKA 4LVOB 1R3KB 3T3ME 2HWZH 5IJVA 3HI1A 3HTLX 5EU5B 2FBJH 5DDHA 4F33B 4U1LB 2WZ5A 3CHQA 3ASOB 3JWDH 3NP3A 3FNKA 4H25B 3QNXB 2AEQL 4ZX4A 4NN7B 4RX4D 4R96A 4XMKH 3O9WD 4G9FE 4O2FA 4XWGL 1CE1H 5FGCE 1HILA 4JFQA 5AVXB 4ZXBD 5C3TA 5ALBH 1HYRC 3FUMA 1DJSA 3QFJE 2D7TH 6FABL 3CPLB 4FQJH 3WXVL 1RZ7L 3MFGB 1KEGL 4HZLB 3EJZD 3IMRA 4AC4A 4DESA 1QLEL 4XAKD 3X12B 3PFUA 4PLJC 5E0FA 4UV4H 5KUMA 4YO0A 3VFPA 1FAIH 1DFBL 3GMQA 4U7MA 1RURL 3H2WA 1Z7JA 3GRWL 4UZSA 2PR4H 2YMOA 3HR5B 4IHOA 4D0DB 4U0QB 3V4PB 5IG7B 1KBBA 5T3ZL 1HEHC 5CJ8A 4CVUA 1BWMA 3BVNA 2BXYA 4DZ8A 1D9KC 4IRJB 2QTVA 4KXAA 4Y1TA 5JNYB 1NMCB 2UV3A 4HJ0C 3ARFB 1I9IH 5EORL 1MRDL 3B2PA 3EJRA 1N4XL 4GFXA 5JHBA 4M43H 5F3FA 1KN2H 4N2IA 1MXGA 3UTSE 2BZ7A 4KROC 2JI1A 2P48B 2NW2B 1KFAL 1KIPA 4X0NA 3IJEA 3UAAA 2AXGA 2RA1A 4KK6D 3WCYA 3DXAE 2H3NA 4OGYL 5I73B 1ACXA 4U6YA 5DYOB 5LUMA 3UXFA 2AQ1A 2FEEL 2K6ZA 5JQIB 5C07E 1GOHA 5CEXB 4JLRB 2FATH 2P3YA 3KH3A 4UWQB 5F89A 2G4EA 2IV9A 3NACH 4OLXL 4NC2B 1USQA 5KS9B 5CMAB 1H5BA 2IBZX 3LIZL 1JXDA 4C83A 1OPGL 1XEDA 4FMKA 3NSYA 4JDEA 1U92A 2A0LD 2P8LB 5B8CA 4MCMA 3UYRH 2Q86A 4F7PA 3WIHH 2PXYA 1ZV2A 3QUYA 1T5KA 3U9WA 1LNUA 1Z3GH 3D2TA 4P3WA 4M03A 3WV0A 4Z0XA 1ILSA 3G5XA 3DJSA 4P57B 2X2IA 4F8OA 4C55A 3D87B 2CHDA 4AQ8A 3B1UA 5E6UB 1CIUA 4H5SA 1AVAA 3O2DH 5CBAA 4MNQB 3K6IA 1FVEA 2LVEA 3T1FB 1V3LA 4FQIH 1X5GA 4NO3B 2C3GA 4XPFL 2IANA 1IMHC 4HK0A 5IUCA 5KJRH 5EO1A 3BVVA 1UD8A 4BM7A 2IWGA 3UC2A 1MFMA 1B2WH 2E4TA 3D0VB 5LHDA 2VMDA 3P0GB 3RL1A 1FRGH 4JKWA 4RCAA 3S35L 4AEHL 2ZCKL 2ZXAA 5AOMA 1H8LA 3MOBH 2QBWA 3B1TA 3MJ7A 5F9DC 1VFOA 1S3RA 3X14A 3CNKA 2EP6A 1YJDL 1AD0B 5DEFA 4J2XA 4Y4HA 1NDGA 3ZXAC 4MMZB 4A7VA 2EIMB 4NO2A 5GGUA 2HFGL 4HGMA 1C5DB 5DC0A 3F62A 3ZTNL 1QR4A 7PCYA 1T0NA 1QQDA 4HK3N 3J07A 4CKVX 3EGSA 1NGZA 3MN8A 1H3PL 1Z3RA 3AC0A 4WTZA 3VX1A 3A24A 1R46A 5MERB 2MMXA 1IGTA 2VDKB 1A7QH 3IEAA 3PGCB 3HMXA 3W56A 5ADOH 4FXLA 1NOAA 3TFBA 2QPEB 4AXWA 3D6GA 3PXJA 1UZ8A 4G1EB 4KH2A 3QDJB 2HT3D 3PWPD 4TQPA 1DBML 1P7KB 4OJCA 3IB4A 2PPDA 1Q72L 2B5IB 2WBXA 1I8MB 4OKDA 4JRLA 4XVTL 3UBFA 3QEQA 2XQYA 3HJ0A 4RDQF 1FSKB 1J1PH 5E2TL 4DN4L 3ML8A 2FR4B 2J25A 4QOKB 1TMCB 1MKFA 2J20A 4X6CB 3C5SB 1PSKL 5MEND 1INQA 3EF7A 5ICYB 1P7QB 3QUZC 4KUZL 3FU9A 4XAKE 4JL1A 3VSQA 2MPAH 1UOLA 5E1IA 1HEZB 2E47A 3PF2A 4M5YL 4MXVF 2GABA 4JGNA 3X3FL 4U1GB 3MRNB 2ITCB 2EEDA 4WTZG 3BE1H 2E9IA 1A4KB 4FTDA 4JPIA 3RWHB 3P2TA 2HFTA 2R29A 3T6VA 1GZQB 1T20A 3O11A 5L8LB 2AQNA 3BRDA 3BUYA 5ANME 4WNJA 4P46C 1G7MA 2AI0H 2BVTA 3BEWA 3HZVB 2XV2A 1UM6L 4NBZB 4K9EL 2EDJA 3P3RA 2G9HB 1EWHA 2EH8L 4PIRF 5F0PB 4H4NA 2J8HA 3LNDA 4M1GH 2XQYG 2YA2A 1BVNT 2VLKB 4HOZA 1VHPA 4GMTL 3U1QA 4OFKA 3GUTB 5CP7B 3WMQA 3HOGA 4JFOB 1LEKA 3HHRB 1BFOA 3M1BB 1J05B 2OW7A 4TUOA 3ETSA 3VD2A 4AYGA 5ECGA 1GC1C 3B2VH 2NLJB 4F1ZA 3GZKA 4GRLA 5GGSY 1RZKH 1CGVA 1HT6A 1FG9C 4TVPD 4DZBA 4QXGL 3OD3A 4HOWA 3GMNA 5J57B 2FEEI 2BHZA 1EQWA 1A4CA 3RE0A 3TO4B 25C8H 2IOOA 3RY6C 2V7NB 3CDGB 4YR6A