4LL4A

The structure of the trx and txnip complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
292
structure length
277
Chain Sequence
IKSFEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGSQQCKQTSEYLRYEDTLLLEDQPTGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGCVDYWVKAFLDRPSQPTQETKKNFEVDLMAPVSAKKEKKVSSMFIPDGRVSVSARIDRKGFCEGDEISIHADFENTSSRIVVPKAAIVARHTYLANGQTKVLTQKLSSVRGNHIISGTCASWRGKSLRVQKIRNILRVEYSLLIYVSVPGSKKVILDLPLVIGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antitumor protein/protein binding
molecule keywords Thioredoxin-interacting protein
publication title The structural basis for the negative regulation of thioredoxin by thioredoxin-interacting protein
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 277
sequence length 292
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00339 Arrestin_N Arrestin (or S-antigen), N-terminal domain
A PF02752 Arrestin_C Arrestin (or S-antigen), C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.640 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ll4A01
2.60.40.640 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ll4A02
2FAUA 4LL1A 4R7XA 1SUJA 4GEIA 1AYRA 4GEJA 4ZRGA 3UGXA 1G4MA 4LL4A 3LH8A 3LHAA 4JQIA 1JSYA 3LH9A 2R51A 4J2QA 5F0LB 2WTRA 5F0MB 1ZSHA 4P2AA 3UGUA 5F0JB 4R7VA 1CF1A 3P2DA 4GFXA 2WTRB 5F0PB 3GD1C 1G4RA 3GC3A
chains in the Genus database with same CATH superfamily
5L2JB 1KCSH 3V4UL 1YNTA 2Z4QA 5ITBL 2CBOA 2QGCA 4NN5C 3KPSE 4XHQA 4CJ1A 4FNLL 4RRPM 3HG1E 3OWRA 5ICUA 4XH2B 1YEHH 4X8GA 1T0NB 3TEUA 3MRMA 4IHBA 3WXVH 1YJDC 5FYKH 5AZ2L 5KW9H 1WG3A 3EJPA 3FUFA 3JSSA 4TQHA 4CAGA 1JWUA 2DBJA 4IK6A 2ADIA 5GS0D 1HT6A 1T66D 3ESNA 5CM1A 3A4EA 3ETSA 3STZA 3TU6A 4JFOB 2FT8A 3DWTA 1PQZA 3T0ED 4UI2A 3TTYA 3CK0H 4QTFA 1BLIA 4GT0A 2NY2C 4HGKC 3CQFA 5FW6A 1ZGLB 1AANA 1FE8L 2R0ZL 2J6EL 2NSXA 3WNLA 3UYOD 1WFNA 3R1GH 2XN9E 5MERA 3IJ7A 2OL3L 1QSFA 3UEQA 5INCA 4OM0L 5KYYB 1OTSD 2AV1A 3AG2B 3QG6A 3AB0C 3K6FA 5HVFB 3RWCB 3DTDA 1JGUH 5ISZD 1OVZA 1A1MB 5HHNA 3LQAC 2G2RB 3SDCC 4JQXA 1PZAA 4FFYL 3MV9D 4R0LC 1G5GA 1TVDA 2W1NA 2W91A 2ZCKL 5DZJA 4G42B 2ZX7A 3GXPA 3EOAA 1ZHBA 1W0WB 4M6AA 1NUGA 2VR3A 1IKFH 1N0LB 2NY3C 3TNNA 4QLRA 3VGAC 3CVCA 3FH5A 4AOFA 1WT5A 4P5TC 1YPZA 4KUCF 4ODTL 3LRHA 1W6WA 4AQOA 2QPUA 3U1QA 3ZTJH 1AO7E 5DVLA 1E5BA 3FUJA 1BGXL 1SHWA 1ONQB 4MRBA 4AYEC 4Z7QB 5AL0A 1EUUA 5DRWA 1XH2A 5E00A 1XIWC 3V0DA 4OGXL 4BSJA 1CBVH 4MD0A 2KL6A 4EPSA 4FLRA 1LVEA 1E8XA 1P5UC 3Q5OA 3AITA 1D5ZA 1MCFA 3BLPX 2BIQA 2WXOA 3MJ9H 2VDKL 4I2XA 4KXCA 5GGSA 4FZ8H 4MHHG 4AQ1A 5JIDA 2WIMA 3GDCA 4JK0D 3UBXA 3C6LA 3EO0A 1CFQB 1NCOA 4YGAB 1BEXA 3F83A 3OXSA 3ZRSA 2XVKA 4L8DB 5B3NA 2VLKB 3AADB 3S8WA 3PWNB 3GHEH 1JGVH 4KMTL 5IM7B 3H9SD 3RFZA 1ZVSB 3FSOA 4JRXB 3O9WB 2FEEL 4ZPTA 1OAYL 5L2KE 2H3KA 4ES8A 5IROC 2OMTA 1BVLA 3C5ZB 3BZFA 4IJ3C 4J3BA 4XCNB 3ZE1F 1DBAH 4DGIL 3OLDA 4AM0B 1SN2A 3GZQA 4CKVX 4YXHH 1IC5H 1ILUA 3T77B 5JW4N 1SJXA 3P9MA 3KBHE 3UZVB 3OGCA 3T1WA 3V5DB 1U8KA 5IMOB 4P5SA 1P9MC 4GUOA 5I73B 4ODSH 1GZQB 3L1FA 5F0JB 5BXFA 4PI2A 5DUJA 5MENE 2A9NH 1QABA 1MCBA 2MPAH 3DX0A 1GW0A 3DVFA 1AZRA 3ARDB 4F3FA 2BSED 3PAYA 2OYKA 4UUJA 1J9SA 3RX9A 4PJXA 3ARSA 1THAA 3IJSA 4F92B 4HSQA 4UMSA 5ACZA 2DB8A 4AQEB 1NGPL 3IDNB 2ZTBA 1A6WL 2R69L 2C9AA 2Y1ZA 3EFDL 4EIUA 2AXWA 4NQDB 4EN2A 7FABH 2J1XA 1MJUL 4I0PA 4AW7A 4FFVC 4P2OB 1I8LA 4L1TA 1EVTC 3EFOA 5A7EA 5BO0D 1WA1X 5CP3H 1NH6A 4U6TA 4FHBD 3HN5A 2B0SH 2CKBL 3RIKA 2AXJA 2CRMA 2ZAGA 3BP5A 1BFOB 4YNYB 1I3RA 1O5PA 3L9EA 2WLIB 4PS4L 3BGMA 3BDYH 3H2WA 4ODUA 2DMCA 3VQ2C 4EDWL 5IF0B 4NN7B 2F54E 1F3RB 2C8NA 5T5FA 4WKZB 2WNWA 4MA7L 2R2EA 1A6PA 5EO9A 2F7IA 4K7PY 2NY0C 3MOAL 4ZTPL 5GGUB 3ZJAA 4O58H 4DP5X 4LEOA 4GW1B 4S1DD 3W81A 3BUIA 4F1SA 5TH2B 1MFAH 2O30A 3HC3H 1AHWA 5HYJA 4ANXA 1H8SA 5IFAH 2XRAL 1HCVA 2ROXA 2J8OA 1A7QH 3U48A 3MRHB 4MA3A 4ZG1A 2Z35B 4DKAA 2W65B 3MA9H 4LCYA 1YMME 4J4PC 1CLOH 3LEXB 3O0LA 5E9DB 1QBML 2A99A 4NWTL 4D9RD 2YKLL 2WSPA 4HETA 4JY4A 4YL4A 2GTZA 2GJZB 1I8IB 4G6ML 1O9VA 4Q58C 4PRHD 4MDJA 4GXUN 2UY6B 1OSZA 2B4CC 3NEEA 2NMSA 3T8XB 5D7JB 5AWNH 1OGAA 2GT9B 4N2OA 2IH9A 2L7JA 3UBGA 3KNBB 1X5LA 3GLAA 2AITA 2AQ2A 3MRNA 4Y5XC 4ZD3L 3S3SA 2WWMC 4X7SL 3ERXA 4CNIB 4GG6A 2OXHA 2WLKA 1PYWA 5ICXB 1SXAA 4JS7A 1USQA 3ARRA 5T1KB 4A6YH 5IJKC 2P5EB 4NRZB 3FC8A 2PPAA 1BXUA 3WIHA 4DFIA 1XV8A 5EO1B 3UJJH 3ZQ9A 4FQXA 5ENWB 3LZQA 3Q0HA 1B0IA 4FP8L 5AW3B 3FQTB 3HCVA 3M1CA 4IIQA 2AC0A 2XA3A 2DQMA 4K7PH 3QRBA 3KPRB 1BM7A 5GSVB 3TN0D 1AGFB 2X4NA 4HUXA 4XOCA 1LQSR 4GW4B 5F9JA 5EIIG 3ARED 4D9QD 3WTYA 3BCDA 1U8LA 1X5ZA 4AV5A 1ID5I 3O4LB 5TE7H 4J1UA 2I27N 1E4KA 4M7ZC 5DUMH 4MA1C 4QHKI 2GJ6A 2FO4B 3TH2T 3ZMRA 1OT2A 5F7FA 4PH8A 2ZONA 5KYWA 5F7DB 1AGCA 4J3UA 3P11L 3D69A 3GZKA 1Z9SA 4ZO9A 5D70H 1HINH 3KGRA 2K6ZA 4ONGH 4WU5B 2JKRM 3KYKL 3W57A 3WMQA 3OR7A 1E6JL 4G3YL 5FXCH 3QIBB 5DHDA 4PHZA 2FIKB 2BCKA 1KCBA 1PX3A 3UTQB 3BSGA 3DVNA 1XDTT 1TSHA 2XZAH 1PG7X 2ZD0A 3QWRA 3BMVA 3HA0A 4ZO7A 5IJDC 2EEBA 4DP2X 4PLKD 4NSKA 1IM9D 5IW1A 2BY3A 4XWGH 1SFHA 4KO5A 1MFUA 3P4LA 2Z92A 3QIWC 1I1FA 4ODBD 3W0WB 4EI5A 3MLYL 2O4EA 3H9HB 1KULA 3I50L 1CYXA 2Z7YA 3LPGA 4PG9A 1E6OH 1JNLL 2XKNB 4TOYL 3AQXA 1H8OA 3MMEB 4HJSA 2UVFA 5C0DB 3ZKXB 4L5FH 1HKFA 2MQ0A 1HNGA 1SF5A 4KRMB 3ZL4H 4JR9H 1T7ZA 4BKLB 4J3VA 5GISL 4JM4L 2ZAIA 3CZUB 3T4AC 4B9PA 1ZT4B 1WO2A 1KBGL 3AWEA 3MUUA 4PS7A 3HMWL 3QXUA 3KBEA 1GZHC 4PJ8D 4ZXBD 3SQRA 5I9QC 1NCAL 2CRYA 3U4EA 2R29L 4WGVB 5FLUA 4AEHL 1TVBB 1YEDA 4BSVA 3MODH 4N2BA 3U0WH 1YN7A 2BRQA 2EC9T 3X3FL 1SDAB 4ZSOE 2GJ6E 1T0MB 1H5BB 3MRQA 3CVBA 4Z3TA 1HFUA 5AYUH 4YSSA 2JE8A 1DYZA 1ZJAA 3NTCH 3W38A 4P46A 2IANE 3NRQA 2ZWZA 4XNBA 1A1OB 4RGNE 5KBNC 1CTNA 3TNMA 1G6RB 2VDLB 1U2HA 5IW6B 3KXFD 4K5PA 5EU3A 3II3A 4XNMA 4M8UA 4HKXA 5J1AA 3U9WA 5EOCJ 5DJ8B 3SY0A 5C0BA 3RNKA 1K5WA 1HHHA 1OP3K 5AAMC 1BG9A 4ZNCD 4LKXB 4NUGL 2E9JA 1SDDB 5IZ7A 2GQHA 3CV5A 2HVJB 1K8IA 2J5LB 1CICD 2R1XB 3TZVD 1RZQA 4HISA 3GJFA 2YZ1A 1Q94A 4WJ5B 5DURD 4W9IC 4HXAH 3E7JA 3RWJB 3L3OA 4ZFFA 3JV4A 3ARUA 4KDTA 1S7RB 4H1LA 2G4GA 3O45B 4MMYB 3IDIB 1MFDL 3L3GB 4KKQA 3V6OC 5JZ7C 1AP2A 1FNFA 5K9QI 1NC4A 4AIOA 1EJFA 3S5LB 3DECA 4WI0A 3OHMB 4D0BA 1YEEL 4ATTA 1Z3RA 4R4FL 4Q6IC 3QAZB 4G8AC 1CT8A 3ESVF 3JTBA 3TBWA 5IQLA 1UQSB 1OT4A 5KYUA 3LY6A 4M1CD 4S1SH 5AOJA 1UXMA 2V3FA 2V9UA 3HUJE 4YHKL 1YNTB 1H3PH 1ZWIA 2VDRH 2KLSA 1N4XL 2Z4QB 4OLYH 4UTBL 1H15A 2RBLA 4HPOH 4KY1H 1KJVB 5E6YA 1HYSC 2YSSA 1MNUH 3LEYL 5ANHA 1XMEB 4N8CH 3TFKD 1MRCH 3MRMB 3IS0X 1U58A 3VFUA 5I6OA 1JWUB 2G4EA 2CR6A 3MJWA 2DQHL 4A7QA 2ADIB 4TSCH 3WY2A 5MEOA 1XD1A 5KBDA 3JWNG 3STZB 3MYZA 1PQZB 1VFOA 1ZV2A 1IGTB 1WK0A 5F71A 5GS1C 3U30B 5MP6H 5J12B 4UAOC 4Q4EA 3TM6A 3FDWA 3H2PA 3S8FB 1FF5A 1M6OA 1DSWA 1O9ZA 4YSDA 2NQDA 5MERB 1KCSL 5D1XE 2MHAA 4PGZA 1QSFB 3OZ9L 4UB0H 5INCB 5DVOA 2OYPA 1JHTA 5SWSA 1ETZA 2AV1B 3QG6B 1YEHL 4ADIA 1BF5A 2BNQD 5L2KB 1IZKA 4UM9B 1IGCH 3WXVL 1G1OA 4TNVF 1W80A 1FGNL 1JTOA 2IBBA 5FYKL 5KW9L 1FVEA 2W5PA 5HHNB 1W8NA 5A2KH 1WZ1H 1A4BA 2VDOB 2AV7A 3GMPA 5PCYA 3GM8A 2X3BA 4LVHB 4M56A 2ZWKA 3EOAB 5TE6H 2VE6A 2HJKA 5D9SA 4PJFE 3QUYA 1AQMA 5HHXH 5KVMC 3CK0L 1CO1A 2ZE0A 3D07A 2DEYX 3TNNB 3T08A 5MENB 3C6SA 3RL2A 1UKSA 1YPZB 1JUFA 1G6VK 4RNRA 3MCLH 4W70A 1H3UA 4NQCE 2F5AH 1D9KA 4K5OA 1IVTA 3BMWA 3IMSA 1CGYA 2A74A 2KZWA 3IN0A 4PPTA 5E00B 1F41A 3WFHA 1Y18A 3DGDA 5GXBB 5I0WA 1JGUL 4YE4H 4MD0B 1HTYA 5DWUL 3NCJH 3B3IB 1A3ZA 2VERA 1R3KB 4CU8A 1F1DA 5GGSB 4XAKE 3LN5A 2Q7AA 3FF8A 1KTJA 1OAZH 1XEUA 4AQ1B 3AWGA 3DDGA 4WWKA 1PGRB 5ANMA 3UBXB 2SODB 3C6LB 3EO0B 5HGDB 3C8HA 2FEDC 3L54A 5EC2A 4F8PA 3OXSB 3RPBA 1OL0A 3FF7A 5J6SA 3LIZH 1ZXQA 3EJYD 4CDHA 3RFZB 1AOHA 3PCYA 3QBTB 1I7ZA 4ZPTB 1XBDA 2EDHA 2MKLC 3WYRA 3BRFA 4WW2F 2KLTA 3BZFB 3QW9A 2V5SA 2XA8H 4OLUL 4WI9A 3SJVD 3NZHL 2R39A 2WXMA 4GRWH 4JO5A 5EBWA 3P9MB 3TF7C 4QRQB 5HVWA 4U1HB 3IDUA 3ZSTA 4ONFH 1U8KB 1UWYA 2Z7ZA 4R8WH 5CR1A 5FWQA 2BSCA 4FZ8L 4FQJH 3EO1B 4L1SA 3VXUE 5FHBL 5E2WL 5BXFB 3IGLA 1YMMB 1NPNA 2DYPA 3S4SB 1X5HA 4JFDD 4AVJA 5F9WB 4GG8A 2Z65C 5IT2H 4D0DA 1Y07A 1PY4A 1B0WA 2IPUG 4UUJB 3MOBH 1N12A 1SQ2N 3FT2A 4IU2B 4PJXB 3B5HA 1GSKA 3B9DA 1JGVL 3IJSB 1A4KA 5FDWA 1WUZA 4EKXA 5ACZB 4XPGL 3MRRB 3ZT7A 5DT1L 2JWYA 1XT5A 1DBAL 2EABA 4XP9H 5DO8A 1JPTH 4YXHL 4E9XA 1IC5L 5IJBC 2ERJC 3EFOB 4DNLA 2AJVH 1ZSDA 1N64H 2P47B 2QTEA 4W81A 5JR1L 3BP5B 5ETUB 4ODSL 2QQNH 1I3RB 5F7HA 2F8XC 1Y1DA 3BGMB 3EIFA 4ODUB 3WIHH 4Z18A 5ESAA 5IV2B 4HJEA 1BMZA 3SBWC 3T0WA 2R2EB 3U7WH 1SN0A 3WTXA 5INDB 4M8QA 1TEFA 1WAAE 2DM7A 2NY1D 4YSOA 5EO9B 5ITFA 1JXFA 1NAMH 3RL1A 3ZZLA 4LEOB 1SY6H 3IFOA 2LE9A 3QQ4A 5D7KD 4Q9RH 7FABL 1AHWB 5HYJB 4N2NA 4LPYA 2PXYD 4RFEB 2K6WA 2QHRH 5EU5A 3U7YH 4AUJA 4ZAKC 4DK3A 3Q8BA 4K4KA 2B0SL 4D3CH 1E4XL 4LCYB 4JFUA 1I82A 3MN8A 5DTFB 4UOW0 2GEQA 1F3DJ 4K8RD 4PGDA 1Q1PA 3S97C 1MY7A 3BDYL 4L3EE 1IGIH 4W9EC 4DK6A 5A2FA 1MCSA 2DDQH 3DOSA 2NNXA 4JY4B 2ZP0T 2OW6A 4MDJB 1DVUA 1Z66A 4G82A 5FLVA 1IAII 1X5JA 1OSZB 5HHQA 2E3VA 1UCBH 3C08H 3NJIA 1MZZA 4N0YL 2CA4A 2KUTA 1OGAB 1R5WA 1XAKA 3MOQA 4R90L 3ULVD 3L45A 1T83C 3GXMA 5HI5D 3MRNB 5A2CA 1MFAL 4GG6B 3HC3L 5FWRA 5AVXB 2VB5A 5JW5B 2GY5A 1EGJA 2GIYA 4MDRA 5IFAL 3CMOH 4TQPA 5F3HA 3WIIL 3DTUB 3O41A 1OM3H 4GY4A 1Q9KA 5I15L 3HFMH 5DLLA 4KJQD 2B9AA 4D8PA 4CGUB 3D2TA 2ZYIA 1CLOL 2BRRH 4NZUH 3HCVB 4MJ2A 5FYJL 2OULB 3JT0A 3KAAA 3NVQA 3K2IA 4DZ8A 2DJSA 2X4NB 4HUXB 1NEPA 5C0CE 4Z3HA 3HI1A 2CHDA 5F9JB 1SVBA 3RIAF 1KGUA 1NCWH 3CFMA 3DGGA 3BJLA 2BOLA 4JG9A 5AWNL 4J1UB 4DSYA 3ZE1E 4EAEA 4HAFA 3ILQD 2GJ6B 4URTB 4JJOA 3P4MA 2N7BA 1GAFL 4KJWD 4LSRH 5DXWA 5F6IC 1AGCB 1MFBH 4L0PB 3QO0A 2EC8A 3M7OA 3WFBH 3TWCH 4J39A 3D69B 1V7MH 4A6YL 1GCFA 4KV5F 4HGWA 2WN2A 5JPNA 3OR7B 2O6EA 4U1MA 5G2NA 2KPWA 2BCKB 2YLKA 3T8VA 3QDJE 2YEZB 2HLFD 5FV2A 1KLFA 1L6XA 3DVNB 1VZIA 1DSYA 4K7PL 4AK1A 1T0OA 3MLZH 4NQEA 2MRYA 3BE1L 1KYUA 4NSKB 3BSHA 3VU1A 2EDFA 1DQQA 1RCYA 2R59A 2XIIA 4UIKH 5IW1B 5GZND 3C60D 2N4IA 2Z92B 4ZFQA 5TE7L 4EI5B 1OV8A 4LCWA 2YUVA 2ZOWA 5EOQH 2WNGA 4KNTA 3TEXA 5ABDE 3GJFH 1Z9NA 3MHZA 2BJML 1RI8A 2XJKA 1D5RA 3MNWA 4PG9B 3V4VA 5JHMA 4LXFA 4OJYA 4RAUA 1WFIA 1HINL 5D70L 3WS3A 3ULUH 4H1LH 4MSWA 4UNIA 4XZ4A 4YHYC 1TYRA 3UP1A 4WTQA 4IKLA 4DP7X 3HN8A 3Q2LA 1IRAY 1XR9A 2CA3A 3OJ2C 4OLVH 4LAQH 1J0ZA 2JF1A 4PVLA 3T2QA 2RHEA 1J8SA 1UZGA 1RMFH 3P30H 4U4BA 3L5HA 4MB4A 3U4EB 4XZUA 1RAMA 1YN7B 4KZDH 5AB1A 4DQOH 2G0LA 5KVEH 3WKYA 4W6WB 3QUKA 3EDEA 3MRQB 2CR0A 3IJ9A 3TC9A 2WO3B 3FQWA 5MHSE 4U1SB 5F1SA 2OLDA 1RJZA 5JXED 3LZPA 1TJXA 3D9AH 3HAEB 4PJAF 3TNMB 1H6FA 3ETTA 3LH9A 4L5FL 5EU3B 4XNMB 3MFFA 4MKTA 3ZE2B 3MLRH 5J1AB 3SY0B 4JR9L 1GJWA 2JJTA 5C0BB 3NFNA 4X6DE 1HHHB 3RNKB 9PCYA 4GSDH 4A2DA 1X7SA 1A7OL 2Z8SA 3QEQD 2R0WH 3NAAH 4K2UH 1P7HL 3BVWA 1J5DA 1K8IB 1U0QA 4IBQA 1C7TA 3D0AA 5J3HC 3U0WL 2N56A 4V1DD 5I1CH 3BLKA 3GJFB 5SWZD 1NMBH 1Q94B 3ASWA 1UT1A 4PY7A 4OD3H 3L3OB 1DUZA 1KTRL 4ZFFB 2DH2A 2ZKXA 3JV4B 4PJ9B 5AYUL 4CVWA 4NQSA 1NFIA 1UG9A 2GFBA 1LMKA 4I0CC 1J5IA 1AP2B 3ECWA 4I3SH 1NC4B 1V3LA 1U8CA 2ADYA 2VXSH 2IXQA 4WI0B 4D0BB 1NIFA 4V33A 2VZTA 5IFJA 1KMGA 1LWRA 1RUAH 1LDSA 3KVPA 2UZIH 1F13A 5GHWH 1CT8B 3KM2A 2OXGA 3VFTA 5KAQG 4I1PA 3TBWB 4W9KC 3WNKA 5KYUB 3AT8A 3HI6H 2Y1VA 4FF9A 5D4QA 5I71C 4Z76A 1IM3B 3QUXC 4AM0Q 4F9PC 3HZVA 1ZWIB 2VYRE 4ECNA 4LP4A 1K72A 2LU4A 3UO1H 4NQCB 1H15B 4N9OB 1OANA 3STBA 2FJGA 2VAAB 1K6QL 2YSSB 5IFHH 4GJTB 4LOVA 4IRZL 3BUYA 4N0FA 1CGSH 3OMNB 1U58B 4L3FA 5IQ9A 5CFHA 3KZ8A 5DEZA 3P9LB 3WNNA 1UOLA 4FQLH 2ICEB 2K78A 3NCXA 2AEQL 3PJLA 5MEOB 4LLWB 4N2DA 2EYRA 4XX5A 1QSEE 2NR6C 2JQZA 3QPXL 1LD9A 1FLRH 4AG4H 5K5YA 2QTVA 3SKMA 1MCDA 2QBWA 3BVXA 3G6DH 4OFYD 2XACC 1M6OB 2G2NA 2PR4L 4OKVA 5BUGA 3BISA 3VD3A 2VDRL 1H3PL 1I9IH 4OLYL 1WVZA 1QQDB 4Z7UF 5D2NE 1JHTB 3KYAA 3ARFC 4OGQC 5SWSB 1ETZB 2DLFL 4KY1L 4L05A 5D4JA 1TZHA 3HJEA 2OL3B 4G6KL 4UOQA 4HS8L 1EFXD 1XB6A 1FVEB 5JHAA 3QNXA 3UTTD 4FG2A 2AV7B 3T0EA 3GMPB 4YBHA 1JN6A 4TSCL 3ZE0E 5JQIB 3WLWD 2X1XR 3HPLB 2J21A 2HJKB 2VE6B 3FSAA 3NCMA 3QUYB 4XNQA 5D9SB 4HZ1A 1C8QA 4PYHA 1WCQA 5GZOD 5MP6L 4GYBA 3C6SB 2DQDL 5DJXA 4PJGF 3VWKD 1Q72L 2X4PA 1JUFB 3JZ7A 3O3DB 3KLKA 4RNRB 3LNFA 3T09A 3DX2A 4ZDHA 4DN4H 1SFDA 3SGJA 2YPVH 1D9KB 1X7TA 2VMJA 4UB0L 3NBNA 2JKNA 1KUMA 5F7YC 4OZGA 1AD0A 5ISZA 2A74B 4WI2A 1PF3A 3J07A 4R2GD 3WFHB 4JQIH 1Y18B 4M00A 4AX3A 3MV9A 4J3OH 3BKCH 3JWNH 3KH4A 4G8IA 4M1DH 4BA0A 2VCOA 4JANA 2C9PA 1NDMA 1WZ1L 2Y36H 4AVHA 2H1PH 3DVGB 4QRPD 1IL1B 5C07D 5D72H 5TE6L 3D50A 5HHXL 1VIWA 4WWKB 4NUMA 5ANMB 4YFEA 2OM5A 5FCUL 3A23A 3CQPA 4C56E 2GBVA 2O93L 3BGAA 3N50A 2BX5A 3MCLL 4Y19E 3UTSB 4HAGA 4WNJA 5DLMH 3DURA 2XY1A 4FNRA 5DJ6A 3D4GA 5A2BA 1G7HA 1G9MC 1DFBH 3GIVA 4ZYKA 3SE6A 2WXFA 3QI9D 3NN8A 4LVNC 3O9WC 3QG7H 1PKOA 5DD6A 2QV2A 3DOIA 3CSGA 4B9FA 4F58H 4TNFA 4L4TD 1UH2A 4UILL 4EMZA 5KTEH 4YE4L 2Q8BH 4XX1G 2EE0A 4JPWH 3FULA 4QI3A 4HUUA 5EBWB 2DLHA 3DO3A 1NSNH 3B9KD 3HLAB 3HS0A 5FYKE 1OWWA 3OPUA 4FQCL 4F80A 1OAZL 1FC2D 2HLAA 3SDAD 4KXAA 2DYPB 1EXGA 4ZI8A 1E65A 1B4JL 2A77H 4GG8B 4D0DB 1KIQA 3H9SA 3ARDC 1BAFL 4IYKA 1Y6NR 3EJUA 3FT2B 3NJKA 3LIZL 1A25A 1A4KB 3MGTB 5FDWB 3CBKB 5EB9A 3KBPA 4KVNH 5HHMD 4DVBA 1N26A 3D08A 3AM8A 2XA8L 4OW6A 2J8HA 5EV7A 4IKIA 4TLUA 3D30A 3O0RL 1MHEA 2R0KH 2ATKA 3EHBD 2WQUA 2CWRA 3ESPA 3OXRA 1ZSDB 3DJTA 1VACA 4LPCA 5DUBA 1HL5A 3ARYA 3A22A 3D4ZA 4NC2B 1EGJH 4FQJL 4H8WC 2V3DA 5DC2A 4AV0A 1KGIA 2BSEA 4W1TA 2CKBB 3LSOA 2HZHA 4HG4K 1EHKB 1F97A 5ESAB 3CX5K 2A6KA 5IT2L 2FGZA 3JZYA 4NN7C 1IT9H 3E3QC 3F2LA 4W93A 2YAFA 3NIFF 4FCAA 5C08E 4P4KD 1U3YA 4M8QB 4EE2A 3IBEA 5FV1L 4KRPB 5ITFB 2WLLA 3RL1B 1MWAA 3IFOB 4EKJA 4YDZA 2MCMA 3TASA 5B3JF 2WB1A 4XP9L 1C8PA 1A8ZA 4WNSA 3WE6A 5EU5B 4C57C 1X7QA 1UXSB 1Z5YD 2ZYHA 1THCA 3QHTC 1DN2A 2AJVL 2N01B 4DP9X 1QBLH 1N64L 1ZTXE 5KYXB 4FULA 4OTXL 3QDGD 1EAJA 1B0RA 2QQNL 1PEZA 4PP2A 1E40A 5I1GH 4PGDB 4GLRH 4GO9A 4YXKL 3V7AE 1RURH 4M6ML 1NZRA 3QDJB 1TTCA 4KX7A 4AKQA 5IHZA 3DOSB 3KDPB 4P2QD 2VOTA 4TQIA 4TNWK 3CN1A 2QMJA 4G9FE 2WK2A 5HHQB 1XGRA 3WD5H 1CD9B 4J3XA 1NAML 2OTPA 2ZJSL 1R5WB 5D7JC 3I74A 5FYLD 1WFJA 4KHTL 2VDMH 1SY6L 2VRAA 5HHVH 4BFIA 3EYUH 5LG1A 3NGBB 5CGYC 4DFHA 5KBMA 5TDNA 2Q8AL 3C6EA 1Q9KB 4D3CL 2C9SA 3TTSA 1F2XK 4D8PB 4R96A 5CD3A 1HK6A 3VFVA 1CYGA 3AMKA 4QNPF 1DLFL 4PW9A 2HH0H 3QJFA 3F5WA 3H85A 4X8JA 3U46A 4PRHA 1OB1A 2CDEA 3Q7JA 4LGSB 2DDQL 4IU3A 4N5EC 5K9OA 1EH9A 1I8UA 3WE1A 1BAGA 3HI1B 5I1IH 3DGGB 5DC4B 3N85H 1UCBL 4H7VA 3K4ZA 4UTAH 2A1WH 3GJFK 4MAZA 4N2GA 3ZK0A 3EYFA 2GK2A 2YAQA 5SX4H 3UYPA 4JG0H 4KXZH 3P2BA 2EKJA 3P3SA 3P4MB 3S0PA 3OJVC 3CSPA 3Q48A 3QO0B 5L4JA 3CMOL 3L3IA 5KVFH 1OM3L 1ACZA 4HGWB 3MLVL 3WBDA 1K4CA 4M7JH 3HFML 5JPNB 1PNCA 1G7QA 4U33A 2PPCA 3UBHA 4ETQB 3DX8A 4ZUVA 1YYLL 3THMH 5H2BB 5TF1L 3AQZA 2BRRL 3GGWA 3QIBC 5HJDA 3TN0A 1KLFB 1L7IH 3DIFA 3KL0A 4OCWL 3NFSH 4F2MA 3AREA 4NQEB 3REWA 2YEQA 2NTFA 2X28A 2XCMC 2EYTA 1O9WA 1KCUH 4EJ1C 3GTTA 1OW0A 5JW4M 1DQQB 5LQBH 1NCWL 5CUSH 5AVYB 4M1GH 2CM6A 1NWOA 2F5BH 3KPQA 3MUZ1 2UUDH 4GW5A 4XBPA 1MFBL 4PJIA 3MNWB 5GGTL 3V4VB 3WFBL 3TWCL 3WNOA 1V7ML 2OMBA 4RAUB 3WS3B 3TPKA 1GJUA 3DHJA 5JHLA 4MSWB 4EI6A 1VEOA 3ZKXC 5CZXC 2DJ4A 5D7IF 1XR9B 5DQJA 4AZ8A 1JZ8A 1VGKA 1IM9A 2PMZA 4N68A 2V3EA 3MLZL 2XQYA 3WJLA 3H42H 1A4JA 4N1HB 3P40A 5FYJE 3LD8B 4N8VA 1ZVYA 4UIKL 4A2FA 4JQVC 4ZUWA 4AJWA 3ZXAC 5CAYB 5J6GA 2TAAA 3QUKB 2BM3A 1H5BC 3IS1X 5EOQL 1U92A 3FQWB 4ABUA 1KIPA 4LPWA 1RJZB 3WIAA 4A7TA 5I16A 4QRRE 3RWHA 2ZUXA 3DYMA 4S2SB 2C1OA 5FKAA 2YQ3A 4PJDF 4F8NA 3FTUA 3MFFB 2AAVA 4L0YA 4KOCA 3KLHC 2Q20A 3CLEH 4DP8X 2Y5TA 2CGYA 4OLVL 1L3WA 1PTZA 1N59A 2FHCA 1N3NA 1HXMB 4LAQL 4PJ8A 3OV6A 1HAWA 4PRPE 4ZXBA 1NPUA 3MUY1 1QSEB 4UM8A 1J0HA 4XBEL 3LDBB 4G11A 1RMFL 3P30L 4HJJH 2J5LC 2BWQA 2WOBA 1Z5HA 4XOEA 5KEZA 4KZDL 5BZZA 4DQOL 2Z0UA 1C08B 4ZODA 5KVEL 2YGPA 1RZ8A 1KJ2A 2DOCA 3NSXA 1MCLA 1DUZB 5HDOA 3CNKA 1DFXA 5L4MA 1MUJA 3CN4A 2GIMA 4NQSB 3ZTEA 2GFBB 5D1QC 1A21A 3KXFA 4FQPA 4ENEC 1AQ8A 2HYMA 3KPOA 3LS4L 2BP0A 4M7LT 2WSDA 1U8CB 4OCRH 4CW1A 1NGWB 3T1FA 2IXQB 3S9DB 4N0UE 5D71H 5E9NA 1R47A 2JKLA 3JWDH 4XPFL 5IFJB 4ISVB 2ENYA 4DN3H 1MCOH 4X9HA 3VFPA 3QJTB 3ECUA 4Z3GA 1F11A 3TZVA 1CICA 1KN2H 2OXGB 3VFTB 5F2FA 2R0WL 3NAAL 4K2UL 3GBMH 3F7RA 4LO9A 1OZUA 3GF8A 5AAWC 3TV8A 5I1CL 1AE6H 1NMBL 2IWEA 3HZVB 2Z93A 4HT1H 4OD3L 3GJEA 2WKGA 1BVNT 2BVOA 3H54A 1R46A 5E08H 2FJGB 4AY0A 2I32A 2J12B 2P24B 2J8UE 2Y23A 4FTVD 1TZGH 2PCPB 4KV5E 5T1MB 1X9LA 2WWKT 1H8LA 3CDGA 4N0FB 4OJDH 4I3SL 1EK3A 1NUFA 5IQ9B 2VXSL 3GKZA 1WIPA 3VH8G 4JFYA 5DZOA 3QUZD 3EYVA 2PTVA 1DQKA 1JPGA 1RUAL 1JPST 4L5FE 5CIPA 2UZIL 2ZX6A 3E8UH 1D7DA 1LD9B 3IGUA 3SKMB 3U30C 1OHQA 2PN5A 2XICA 3A67H 2YAEA 3MV8D 1OALA 3HI6L 5H37G 1F00I 4OKVB 5EUKB 3RVUD 1TOXA 4MXWH 3RAJH 5BRZD 4Y5YA 5T3ZH 2YRBA 1L4IA 1DBBH 4BA8A 4P3CH 1HHIA 4N8UA 1EO8H 1TZHB 4UT6A 5IFHL 5FOJA 1S4IA 2NCEA 4HEME 2HT3D 1KZQA 4JQXC 5I1JH 4FQLL 1JN6B 2YMXH 1WV7T 4LVHC 4OIBA 3FCBA 2QVFB 3I9PA 4PD4K 4XNQB 2NTSP 4ZS7H 1FLRL 4AG4L 3TONA 2VMFA 4HALA 1UOVA 3G6DL 4FZEL 4F57H 5DJXB 2X4PB 3ET9F 1K8DA 1WT5C 1CK0H 2WVTA 4ZDHB 3BZ5A 2PYEE 3IK2A 2KKQA 3P0YL 2BNQA 2CBPA 1NCCL 3HNTH 4OZGB 3LQMA 1AD0B 2YAPA 1QD0A 4XTRD 5ISZB 1S7UA 1NICA 3ULSA 3ZHLA 3BJ91 3MCG1 4F5CA 2DLTA 3RY6A 4PJAE 3MV9B 1CLVA 4G8IB 1INDL 4JANB 4EUPH 2V7HA 1NDMB 1ET7A 3U4KA 5JOEA 3E9UA 1OHZA 4E5XA 2ZYSA 5KANG 3KPMA 2EDLA 5F96H 3SQBB 3VD4A 1FFRA 4AQ1C 3IDYB 3FCSA 5LXGH 5HVGB 4HCGA 3C6LC 2JKTM 2JKJA 1YN6B 5FUCE 4PJCF 4J23A 1EO7A 4G59C 3QORD 1YEGH 1ZVHA 2H3NB 1U3JA 4FFWC 1QACA 3DURB 3N44F 1NANH 4AKOA 4DN4L 1EFQA 2YPVL 4QYOA 5DJ6B 1G7HB 3GIVB 4ZYKB 4JM0A 3RFZC 3NN8B 2FJUB 1ED3B 4C4KO 1XF2B 5DD6B 4LARL 1HEHC 4JQIL 3VYPA 4BZ1A 1X4YA 4PM1A 1MWAH 4M1DL 3REVA 1OTUD 4HUUB 1UASA 2OP4H 2Y36L 3VXMD 3HS0B 4WFGE 3DETC 1H0DA 2CR3A 4LGRB 1CB4A 1T1WA 2NNAA 4KZCA 5FGCE 5L8KB 2HLAB 1JHLL 4YC2C 2XYCA 1IFGA 5DS8A 4BFJA 5MEQA 3OB0H 1HH6A 4CVZB 1WC7A 5F9WC 1LO2H 1KIQB 3H9SB 3TA3D 3Q1SH 1AR1C 1BPLB 4YH6A 1MVYA 3O3UN 1X6LA 2NY4D 1Z0NA 4HULB 1DFBL 3SJVA 2XDHA 1QPPA 3BIKA 5CEXA 4DVBB 1W72H 1UADC 1KTCA 5KTEL 4CN6A 4PGEA 4KZEH 2Q8BL 4AE0A 3FFOA 4I0PC 3AG4B 1RJLA 1I8LC 1MHEB 2ATKB 5SWQA 3OXRB 1NSNL 3CLWA 1GYUA 4G70B 1AZNA 3UZQA 1DANT 3FSWA 4JFDA 4ONOA 3EFFB 4N1EA 3SDXF 3H9ZA 3Q6GH 3LSOB 1MJ8L 3QA3A 3BVVA 3UAJD 4IM8A 1BDYA 2A6KB 4L8BB 4YHLH 3ZKNC 1J9TA 4Z7UE 2NW2A 5AALA 2WLLB 2O6CA 4G6FD 4FE9A 2VZOA 2NXZD 2V8LA 5EBMA 4HG4J 1UUSA 1M71A 5T1JA 3CX5J 4WW2B 4QOKE 3EDKA 1YZZA 4L29A 3BKYH 3WE6B 1AHWC 1GXEA 3FNKA 2FBRA 2W92A 4HBCH 3K6IA 3R8BB 3WNJA 2P8PA 2NY5C 3EAKA 2QADC 7CGTA 1E90A 2J43A 4P23D 4PP2B 5FHAH 4NUJA 4I3RH 4ZX5A 1HL8A 1YEIL 2NX5D 3L4XA 4PJGE 2B1AH 1VADA 3WFCH 2EDXA 4YZWA 3RY4A 3S88H 4JO2H 1IT9L 5IQMA 1GGBH 4B6ZA 2O72A 2A83A 3EO9H 2OSYA 1SOQA 1XGRB 1CBJA 4R5TA 5E23A 3VRJA 2DAVA 2ICES 5EU7E 4MJID 3B2PA 2PXYA 4W9FC 1WE5A 3MLSH 5DVKA 3B5TA 5EH1A 1RHHA 1V3KA 4Y4FD 2FWSA 3TBTA 1J05A 4PW3A 1QBLL 4JFDE 1KDJA 3G5XA 2UY7A 4GRWE 4R96B 3MRDA 2BIPA 5CD3B 3VFVB 4FQXC 1J9CT 1HWHB 3F5WB 1RURL 4X8JB 4PRHB 4WEBH 2CDEB 3U46B 4IIQC 1Z9LA 2JJWA 4PV9A 2YA0A 4NRXA 3CVHA 1MFEL 3BLBA 4IU3B 4NCDA 2RALA 3CD4A 1OD7A 2PO6D 2ESVE 4BWUA 3WJMA 2O1AA 3ETBF 4OF0A 3WD5L 2H6OA 2UUDK 1JWSA 1JTPA 3EYFB 1E4KC 2VDML 3TV3H 3RB5A 3UYPB 5HHVL 1KBKA 4GAYA 5F7WC 1L0YA 4OVUA 3MV7D 4X4XA 1N0XH 3MBXH 3VCLA 3L3IB 2ZOKA 5DS1A 3IRZA 4LP5A 4LZKA 2CPUA 2H9GA 2Z8WC 3DX8B 4ZUVB 5F6HJ 1Z0MA 4LU5H 3GGWB 2YD6A 4LLUA 1UT9A 2X88A 4NO5A 4P9HH 2HH0L 1WTLA 2D31A 3IXAA 3DIFB 1EHAA 2AQPA 4P48A 3TN0B 4F2MB 5EF2A 5BZWB 2G75A 3AREB 2BINA 5FUOH 2DQUH 5C0IA 2NTFB 2XUWA 1KY7A 2EYTB 4Q9QH 3CU7A 5B21A 2V9QA 1E5UI 5F0LB 2K9FB 5JOFA 2JKIS 5CILH 4EI0A 3GYRA 4UTAL 1MZYA 1SF3A 3AS1A 1X4ZA 2Z91A 1JS4A 5CCHE 5DD0H 4EI5C 2YGOA 1P53A 3PPEA 4IBZA 2R83A 2MEJB 1NBCA 3L8QA 3F01A 5DSCA 2XTJC 3OPZH 5I30H 4GW5B 4XBPB 4QHPA 2ENSA 2K6YA 4MXQD 1AS7A 1KJ2H 3NJLA 3L08A 5LCVA 2V17H 2V37A 5KVFL 3CC5A 5IB5A 3AS0A 4M7JL 4EI6B 2Z31D 4NNXA 1HQRA 4WZ9A 1XGQA 5DQJB 4AZ8B 5J57B 5JXAH 3NFSL 4X7EC 1IM9B 1OE3A 5LBGA 3C87A 3D33A 1XF5A 3NIFE 5GZNA 3C60A 5TD4A 3BD3A 1A4JB 1KCUL 2VXQA 4K3JH 3W5MA 2C4XA 2F8OA 3F7KA 5F21B 5LQBL 3SE3A 5J6GB 1HJBC 5CUSL 4ZUWB 4M1GL 4F7EA 4PLJC 1XTLA 5IBTH 5B3JE 2VN7A 4ZOEA 2Y6SC 2F5BL 3N91A 1BLNB 3IMTA 4BWWA 3EBIA 3H8NA 4F7TA 1N6UA 1U92B 1KIPB 2C9RA 4W6YB 1KCLA 2VABB 3BX7C 5E99H 5I16B 1PVHA 4P46C 1PCXA 3M17A 1OCCB 3RWHB 5HD8C 4TTGA 2C1OB 3MJGX 1J8KA 5FKAB 1JAEA 1CPUA 3B37A 5EWIH 3D25A 2IPKA 4ICWA 3S2CA 4U1KA 1MLCA 3UG4A 3VSQA 1N59B 1N3NB 4PJ8B 4ZXBB 2Y7LA 4NQVB 1TQBB 3VTMA 2XX1A 4UM8B 4DO6A 2DZEA 1JZ7A 1ODUA 2EE6A 1JYVA 2DEXX 2F19L 1QRNE 4KROD 1H3TA 4WUKH 3I6GA 4O02L 4JJ5A 1NL0L 2AABH 2AF2A 5JXEA 4XNZB 5GGQH 3S37H 1MG3C 2HT2C 4M5TA 5EF3A 3L3OC 3ULUC 3B6SA 1MUJB 5T3XL 4AW4A 4KDTC 3MNZA 1CXKA 4GRMA 3N6YA 5B1BB 4L8CA 3WLBA 3KXFB 4U3CA 4WTZA 3T2LA 3S5YA 3TJEL 2IG2H 3KPOB 2BP0B 5CN2A 4ZX4A 4CW1B 3T1FB 3DYOA 4UT6H 4QNPE 1UD3A 3X13A 1XGUA 3QEQA 3U25A 2VZUA 4HWEH 2VC2B 1FNGA 2DMGA 3VFPB 1PJ9A 1YC8A 5T5NG 1F11B 1QZNA 3WHE0 3TZVB 1CICB 2LU5A 4V1DA 5AW5B 2OJEA 4N24A 1UM5H 3ATDA 4NKQB 4KQ4H 5SWZA 1XSJA 2MQGA 3FO2A 4HJJL 3SKNA 1YY9D 2HX8A 2BW4A 2YXVA 2Y7NA 4TSAH 4G80A 3TT1H 1GGUA 1WWBX 2Z93B 2FX7H 4FC3E 1E3XA 1IAIM 4QGYA 4LSUL 2ZX5A 4A38A 2YD4A 3CDGB 1INQA 4N20A 4OCRL 4PJDA 3E8VA 4JFYB 4QR7A 4FEIA 4OJFL 5KVGH 3VM5A 1URZA 4L37A 1CLYL 3JWDL 4U6VL 1EQWA 3K4DA 1JPGB 4ZS6C 1MCOL 4DN3L 2VW7A 2NOYA 2EO9A 5CIPB 3KLAA 4NKOA 4F2FA 1KN2L 3BVNA 1NGZA 4PIBA 4ZW3A 4QXGH 5BRPA 5KAQF 2PYFA 4BEIA 3FUKA 4D7PA 4HF5H 4Z23A 1A4CA 3UGXA 1QLEH 4UMGA 4JFFE 5A2LH 1CIDA 4Y5YB 1M9SA 4Y9BA 1I3UA 1Z6JT 1HHIB 4ZW5A 5GRUH 3R06A 4KK5C 5E08L 1JSYA 4LIQH 5KVEE 3LZRA 3QFJE 3TP4A 1R75A 1AC6A 1TZGL 4LPXA 4U6YA 4PBWD 1OSEA 3NESA 2IDFA 4A2LA 4MNGE 2LW3A 5F72S 1L9NA 4OLXH 2J20A 5D7IE 2JH2A 3IMVA 2NZIA 1U8JA 1DJHA 3MLUH 2IOIA 5ADPH 1F3JA 2NXYB 2KI6A 4OFYA 3RYMA 3E8UL 3QUYC 5CP7A 1BQHA 3ILEA 2XG5A 4Y1AE 4YEFA 4MNQD 3A67L 4ABVA 5K39A 2XV2A 1K8DB 4XOAA 5C0GA 5TFSH 5IB1A 5GJSH 1SLXA 3MLWL 3RAJL 3J27A 4HJ0C 5T3ZL 4PD4J 2XWBA 2BNQB 1DBBL 1OGPA 1D9KC 1P7BA 3TJHD 2DV6A 3GS0A 4LDCA 4G7YH 1S7UB 3OLEA 1EFXA 1GMEA 3ULSB 4CKQA 2A74C 2VZSA 1BZDA 4B5EA 3PU7A 2FEEI 3UTTA 4XXCA 4AYSA 2BIOA 4JPVH 2FGWH 1UKQA 5LXVA 2V7HB 2H41A 2NT1A 4Q56A 5I1JL 5JNYA 1CF8H 4Q74A 5FCSH 3OB0K 4HKZA 4E5XB 4XC3H 4OZFA 1XCQA 3KPMB 5GZOA 3US0A 3VWKA 4HAKA 4NPKA 3CZSA 2HJFA 4ZS7L 5CCJA 4WWKC 1GRWA 3FCSB 1L0PA 2ICWI 2YKKA 3AXIA 3GMQA 3LRLA 4F57L 4PI0A 5KZCB 2XC8A 4UT9L 4PS3A 3WO3B 4QYOB 4DPCX 1ZLEA 5KG9B 4E41D 1WZKA 5KSAD 5K1JA 1D5BA 4NPJA 3SN6N 3TEYA 2P52A 3IU4L 5AW6B 4H4NA 1R9FA 1BBDH 4QRPA 5AVUB 3REVB 1JMXA 1PMYA 2RMNA 1NKGA 4JPSA 3O8XD 1X4XA 5C07A 4JFHD 4FAAB 3G7TA 1S3KH 2AQNA 4Q52A 4GUPA 1T1WB 2NNAB 5TF0A 5F96L 1EAPB 4P9MH 4LSPL 2VISA 5I24A 3GUTA 3O6MH 2K70A 5DS8B 2ARWA 2X41A 4FX5A 3D2UD 5EZIH 5MEQB 1HH6B 2DM2A 3ZMEA 2E5EA 3APCA 4Y8DC 4AJYV 5A2IH 4IBUA 5GPRA 4XVOA 1NCDH 3ARVA 1CD0A 1YEGL 2XWTA 3QI9A 4AE1A 3C2AL 3IXTB 4TL5A 3N43F 3SJVB 2WP3O 3BIKB 4JPIA 4KKLD 4L4TA 5DMKA 3T3MF 5CEXB 2HAZA 3MCYA 4O00A 3QQ9D 1Q0XH 3DRQA 4L23A 1HL9A 5EEVA 3BYYA 2R7EA 2R4RL 3B9KA 4PGEB 1DBJH 4GRLB 3QZPA 3FTSA 1A65A 1RJLB 5TK4A 2OP4L 4AQZA 3L5XL 5SWQB 2NNFA 4UQ3A 3ZTCC 1VKXA 3L2MA 3TJPA 1AZBA 2VL4A 3SDAA 1KEGH 3Q2CA 5IB4B 4JFDB 3BUDA 3N2JA 1ASQA 2EDDA 5HI3D 2EIEA 3PP3K 4LEBA 3MNVA 3QA3B 1NLBH 1KCKA 4K8RH 1A3RL 3BSZA 2QFRA 4LOUD 4NN6B 5EF1A 1JF5A 2IWKA 1LO2L 3ML8A 4UZUA 3V2AR 5KYNA 3Q1SL 5HXMA 2E75C 1AZZC 4CBZA 1FIGH 2NW2B 1NLDH 1SLVA 1MI5E 4V2CB 1FZJB 3DTXB 3MJ7A 1J8HE 3KVQA 3OG6B 3H7BA 4KRPC 1M71B 1U42A 4ZUTA 3Q2NA 5E6ZA 2K7PA 1W72L 1EXHA 3ULVH 3SOBH 1P0SE 5JHDE 4L29B 3UPCA 1MIEH 1T6WA 2Z9TA 4KZEL 3GS7A 5DVMA 5JA9A 1X5MA 4KKCD 2WWOA 4P49A 4F8QA 3VD1A 2P8PB 5IG7A 2QVMA 2VLMD 3JWNE 5I66A 3TBYA 4U31A 4PUBH 4H0GA 4F37K 3G5WA 2VGLM 3APDA 5FYJU 4OV6F 3TO2B 3Q6GL 2AJYH 3WMSA 4POZC 4JUSA 1VADB 4P4KA 1QFWH 2NY1B 3PPSA 5F44A 5ABZA 3BZEA 2BLFA 1GA2A 2A83B 3EGSA 4Q8BA 3VRJB 4GMTH 1S6NA 2PXYB 5CN3A 5BV7B 2FT7A 2E8ZA 1KTDA 3PY9A 1GC1H 4EQ2A 1E8YA 3V5HA 3BKYL 1RHHB 5DA4A 4TF4A 3NGBC 4X98A 1J05B 3QDGA 3ZRFC 4HBCL 3I75A 3Q44A 3V0VA 3H56A 3G5XB 2UY7B 1Z1WA 4M7LH 4XN1A 3ZHNA 3MRDB 2EKSA 1N6VA 4HJ1A 4I3RL 2YPKA 3PHAA 4X6CF 3DNKA 4P2QA 5EZOL 3VE0A 1NPJA 2B1AL 4HIHA 4P99A 4PJCE 1CDIA 2Y7QA 1FGVH 4PV9B 4M8VA 4NRXB 4PWEA 3CVHB 3WFCL 2I07A 2HKHH 3DYPA 1JGIA 4JO2L 1HC1A 1MH5A 3S88L 1GGBL 1D2OA 3H6JA 3P54A 3NIFB 2O5YH 3WJMB 3EO9L 3EJTA 4X9FA 4YHMH 4NQXA 1JWSB 1LE9B 3HG4A 2BVTA 4JO3H 3MLSL 1CFSA 4K5NA 1OAUH 4X4XB 4Y9EA 1C12B 4E2OA 3VCLB 4R4NC 1DBMH 2IOMA 3JTSA 4NRYA 4AV4A 4D2NA 5HP5A 2ZOKB 4ZUSB 4TL4A 4TTDC 1CZ8H 5B1CA 2PP8A 4WFHE 3LPWA 2E9WA 5JPNC 3HE6B 4D7BA 1TYEB 4LLUB 5DJZA 3LB6C 1LMIA 2D31B 1SXCA 4F7CA 1HSAA 4WEBL 4BZ2H 5JW3H 2G75B 1JPSH 1UOWA 5L4FA 2MIZA 1FNAA 1ZS8A 4XP1H 3AUWB 5F7NC 5JOFB 3QCVH 3I2CH 5LAXA 1CGUA 3QT2A 3C5ZD 2E7CA 4FQIH 3RKPA 2Z91B 2X2UA 3TV3L 1TETH 4AZUA 1OGTA 4PY8J 1VZGA 2WY3B 4YUEL 5DSCB 3NOIA 1YQVL 3CAFA 3L5IA 5E4EB 2EXYC 4OCXH 3MBXL 5FFLA 5C0JA 2EVIA 4JHVA 3CC5B 5IB5B 3RY5A 1J5HA 3LPFA 3SDXE 2RCSH 4NNXB 1HQRB 4DPAX 4N0CD 1EANA 3FU5A 4LU5L 1XGQB 3O3BA 3OMIB 4M29A 4FXLA 4P05A 3C9NA 3OJMB 5BJTB 2BVPA 4W9CC 2DQUL 5CWSA 4N2LA 1VSCA 1XF5B 5FUOL 3C60B 2WYTA 4TVPD 2IDSA 4OVVA 2ALAA 5CILL 4NX0A 3LD8C 3QNFA 4F7EB 2BP8A 4P2OD 3NA9H 3BH8A 5DD0L 3MA7A 4F7TB 3DXAD 4P0DA 3OPZL 5I30L 3KWVA 3P73A 1PSKL 3RWIA 3M17B 1FAKT 4WVRA 4WWOA 1XCTA 1HHGA 1XXFC 2OMYA 3D25B 2YBGA 2IPKB 4HK0A 2NW3A 2GSIA 4Z7WA 4U1KB 1MLCB 3AG3B 2ITFA 2JJTC 2XPGA 4Y4KB 1KCVH 3PWPD 1YUKB 1D3CA 1MHPH 1X5XA 2X4QA 4K3JL 3L9BA 3LDBC 4JO1L 3A6BH 2DPKA 3F7VA 4JVWA 3B43A 3ARBD 5CSBA 4JJ5B 3IM1A 4S1RH 2EIJB 3OAWA 5B4MD 2AXGA 4JFFB 1NFDE 1XXDC 4L9LA 5HGGS 3MNZB 3QNYB 3FFCD 2FNBA 1V10A 4R26H 4L8CB 3WLBB 2OR7A 5EOTA 1QFUL 3FB5A 4XNUH 4JZJA 4TUOA 1FL6A 2DW5A 2J7LA 3QC6X 1VLXA 1XGUB 4N9GA 5D7IB 2DBLH 1I9RH 1WA2X 4P5KA 1FNGB 1URIA 2XTSA 5KVFE 4QD2E 1NJ9A 1MJ7H 2D7PA 4KTEH 3S3JA 4JRYE 3QUMA 1NIAA 2V7NB 2BY2A 2VQUA 2OJEB 4U1GB 4V1DB 5SWZB 5E0FA 3T0VA 3FO2B 3SKNB 1TZ8A 3NEXA 1U36A 4WUKL 4IKJA 2QPSA 3KGSA 4HW6A 4N26A 1ZHLA 4G80B 5F7AA 3UADA 2QV4A 2PKDA 5HPMA 5GGQL 3WKNA 1H9VA 5T1KD 3WKPA 2ZIDA 3GI9L 4IOFD 2P5ED 4QKTA 2NZ1A 4HS6A 1BXXA 4GKNB 4AJVA 1SEQH 1INQB 5AD0A 2EDJA 5EDXA 2GITA 4PJDB 1A8JH 4JPKH 1L3NA 1HZKA 1PAZA 1DQTA 2TRHA 2G3ZA 5KOVC 3KPRD 4OQTH 4LL1A 2BSTA 5E03A 3IDJB 4Z77A 3KLAB 2WAQA 4NKOB 3GSRA 1NGZB 3JQOB 5DHEA 1UM5L 3O4LD 2K0RA 2JJUA 1UD6A 2PYFB 3LX9A 4FJYA 2TRYA 4KH9A 4KQ4L 4OZFH 4APXA 5EUOF 3GSNA 4KI5D 5J1SC 4M43L 3CMGA 1WZAA 3TT1L 4TSAL 1MCPH 3US9A 2FX7L 4FTVA 2O6DA 1NCUA 2H26A 2YMOA 1KV3A 2XWDA 1R3JB 4R3SA 3V55A 1GHFH 4Y16D 2FATH 3CWGA 2BWDA 3QUZA 5T3XE 5BO1L 2DMBA 2CIKA 5GS0C 1T66C 2WZ0A 4JFQA 4NNPL 4XVJH 1MFCH 3A6CL 2YN5A 2ROYA 5KVGL 4ZRGA 1U8JB 3T0EC 4WO0A 1MEXL 3E2HB 2F7QA 2YA2A 3GHBH 3HZKA 1F3JB 2FQGA 1CFTB 3B5GA 3MV8A 5D6DA 5DEJA 3WFDL 1EX0A 5AENA 3WHXB 5ILTH 5BRZA 3MKGA 4IIZA 5K39B 2XZZA 4HF5L 3PWUA 4KWUA 1PS3A 5IB1B 1M7DA 1EEYA 4K73A 4OLEA 1QLEL 3SPVA 5IMMA 1OTSC 2XWBB 3SGJC 4FG0A 1P4IH 2IALA 5AVQB 3PHOB 5GRUL 5H35A 3WDIA 4LIQL 1QMUA 1EFXB 2P45B 4D0CA 2TSAA 4X83A 1UWFA 2VQ4A 3UTTB 2IGFH 4I9XA 1SYVA 1J5OH 1GMIA 4WJG3 3RU8H 1EHXA 3IGFA 4OLXL 5JIIA 5JNYB 3NSFA 4BV1A 2OTWA 1PFOA 2WYZA 3MLUL 3P69A 1DR9A 2X40A 2XETA 4HKZB 1Q0EA 5ADPL 1XCQB 3ALPA 5I8CA 3J2PA 1LL1A 3NT0A 3E6HA 1WTGT 3VWKB 1Q90A 1UB5A 4EXPX 2HJFB 2VR9A 2CD0A 4HU2A 5GJTH 4UQBA 3TX4A 3CVIH 3GMQB 3IDYC 3O6FD 4BKTC 1QG3A 5LG6A 1XTMA 2X10A 3WEBA 5CCKH 3HB3D 3UAFA 5GJSL 3KPSD 2RD0A 1TO4A 3VGDA 2B16A 4JRLA 4K3HA 2H32A 3VFGH 1TQVA 1WYJA 1PY0A 2KQMA 2A5UA 3DHPA 2CGRH 3GMMA 3HG1D 2X2HA 4R2GB 5DFVD 4G7YL 1D5BB 1J8HB 3KYOB 1Z9OA 3FTYA 3IPEA 5JIQA 3HC4L 3NJGA 5IHBA 1NOFA 4QRPB 2FGWL 4LDOB 4RGOH 3CDZA 4PTUA 3E6FA 5C07B 3WXWH 3GBLA 3BQUD 3OQ3B 3OAYH 3HS0C 4YPGA 4XC3L 4ZMTA 1M05A 2VISB 1RZ7L 3LKQA 3TCLA 3QORA 4LEXH 2ZZUT 3N9GL 2XN9D 3S36H 3OKOA 3BP7B 2XWTB 3QI9B 4NGHH 3RI5K 2AZUA 1FA4A 4GBXD 5AZUA 1FC1A 1YJDH 3M88A 5T3ZE 1NKRA 3ZLQC 1UKTA 1ROCA 4M5YH 3DRQB 1HAUA 4FGMA 4NBXB 4P3DA 3L4YA 4NIYE 3AM8C 3VXMA 3B9KB 1BBDL 3C09B 4M9PA 3IE4A 2DJMA 4UQ3B 1JD7A 1VKXB 3SDAB 3MROA 2UZXA 1S3KL 4G83A 4MLSA 1MVFA 1OCRB 1DVQA 1E2WA 3BD4A 1E4XI 4P9ML 3VJ6A 1ZLDA 2VJ8A 5EZIL 3TA3A 3MNVB 4LL4A 4TLSA 3NSYA 2VQ1B 2ZOLA 2QPDB 1GGIH 3L7EA 1AO7D 2NRDA 2KDGA 5F1KC 3NSCA 2ZYRA 4DF9A 3MJ7B 1TNNA 3H7BB 4X6EA 3TBCA 1DN0A 2ITCA 3JV5A 2F0CA 5FYLH 3LQAH 1Q0XL 3EHBB 1VF5C 4WCYH 4JB9H 2UXGA 1YYMH 1DBJL 3RIFF 2KH2B 2XKSA 3WEXA 5IG7B 1U8QB 3BN9D 5I66B 2HKAA 3TBYB 3BP4A 2R2CA 2VXVH 3UAJA 1BVKA 1TKWA 1FPTH 1BJ1H 2FWOA 3TYFA 5B3SB 2ZKYA 3NIDB 1RK0B 4FXGA 1NLBL 1T5KA 2WLNA 3VVVA 3ARXA 4P4KB 5T33H 2WZPD 1QUPA 2IDTA 1JXGA 5FK9B 3PS6A 1IO4C 1AVAA 2Q7NA 2YQBA 3R8QA 3GNML 1SJMA 3VXPA 3EGSB 5C92A 1NLDL 4S1DC 1JZIA 4ZJ9A 5L2KD 1CDBA 4HUWA 4UM9D 1UA6H 3T4YA 2IBZX 1Q8MA 3KW7A 1E9OA 2NYYD 1KTDB 1GKOA 4UNUA 3V5HB 3SOBL 4H8UA 2AGJH 2MQ3A 1MIEL 4X50A 1IAKA 1OY3B 4X98B 5GGRY 3QDGB 2HP4A 4MJ6A 3N5AA 2K45A 3I75B 2D73A 4FRWA 4P23A 1VB9A 1KDIA 3V0VB 1AZUA 2NX5A 1UJ3A 4PUBL 4Q0XH 1LP9E 2GBAA 5MEND 2EKSB 4MJJA 2L7UA 1X5YA 3WN5A 3TCXA 3NK4A 2IGTA 1OARH 3BFWA 1LWHA 3HBQA 2RFXA 3I3BA 2HVKA 3BN3B 1MJJA 4FLSA 4P2QB 2DF3A 3VE0B 4HIHB 5A1AA 4KKPA 5L8LB 1RUQH 2Y7QB 5DHVA 1QFWL 4TM9A 2I07B 3ZDXF 2Y7MA 1MH5B 4U1NA 3AT0A 2FH8A 5IVXF 1ET5A 4MJIA 3NPSB 4PG2A 2FLMA 2XNAA 2AK4E 2ITDA 2WSKA 4EIZC 4NQXB 2I26N 4GMTL 4IRSD 1M56B 1A9EA 4JG1L 3EJSA 5L9DH 4DKTA 4Y4FA 4NPYA 1GC1L 1CFSB 2HTKD 2GTQA 5I17A 4Z1PA 3GTVA 4FFZA 4NRYB 3JTSB 3CXDL 3ARTA 3EYSH 2BHUA 4N25A 3UMNA 3WUZA 4LHUG 2VR6A 3LXUX 5IHLB 1F6LL 4B0MB 1GGCL 4H0IA 5JIHA 4C4UA 4X7DC 5DJZB 4BBWA 1N18A 5K59F 3L1OH 4F7CB 2F54D 1HSAB 3TN0C 2PO6A 1GOFA 1WWCA 2NDGA 1FGVL 3AREC 2GPZA 4CU7A 3PAVA 5CCGE 3BT2H 3EBHA 2O5YL 1OW0C 2AJXH 5LAXB 4YHML 3CFIC 2FLRT 1HQ4A 5I8KH 1T3FA 1AZCA 3MV7A 2WZ6A 3HI5H 4OH2A 4B53A 1OGTB 4NZRL 4JO3L 4PJ5E 4F9LA 2L7QA 5CJXA 4HWUA 1OAUL 4WO4D 4XX1E 4DPBX 3MAWA 4Y0GA 5AVSB 3LVEA 3VACA 2YLHA 3G5ZA 4UCFA 3X12A 3N1FC 1CZ8L 1YMMD 1IIKA 5E6RB 4POYA 4GKLA 4XCCL 1Z5LA 2CO4A 3O6KH 3KCPB 1E67A 3BD5A 3SKOA 5HBBA 4XMPL 3HBPA 3CIAA 3C9NB 4PLKC 4BZ2L 4TMPA 3CZLA 5JW3L 2BVPB 5CWSB 4OF7A 1I31A 4LQ1A 4XMWA 5ACLA 3WJLC 3B2XA 1T4WA 3R4RA 1A7RH 3QCVL 3I2CL 3SYQA 1M7XA 3QUMH 4JAMA 3U9PH 4FFTA 1M6UA 4LRNH 4FQIL 1ZK9A 3D0LB 2BP8B 3BH8B 5BS0E 1TETL 2E56A 1FN4A 3MA7B 4FQ2L 3P4OA 5IVZA 4NO3A 4NS0A 1RULH 2Z31A 3RWIB 1WCBA 3T0XA 1KJMA 1TFHA 2EJ1A 2X5PA 3QPQD 4P9HC 1XCTB 3B2UD 1HHGB 1PD6A 2OMYB 4CJ0A 4BUGA 4HK0B 3EDJA 2WTRA 1HCFX 3TYGL 2GSIB 3KR3H 3IETA 4Z7WB 5JUEH 2Y9RT 1OD9A 5E8DH 4PJ8C 4ZXBC 1IQDA 1KB5H 1TQBC 2OYMA 4WTWA 3LKOA 2X4QB 2APXA 3CFBA 3F7VB 4GXVH 5HYSG 2XV0A 4HCRH 4OZIE 3VW3H 3ZIYA 1RLBA 5AKRA 5K69A 1W9XA 3FUMA 3MO1A 2FX9H 5E1HB 1JWMA 2AXGB 3NA9L 2DM4A 2OAAA 4L9LB 3GSNH 4WI3A 4XNZC 1LE5A 1J0YA 5L6YH 5F1IA 3FB8A 3LZNA 1S78D 4X9IA 5EOTB 1FYTE 1S7SA 3G6JA 2JKXA 4L9DA 4JZJB 2OA9A 4TUOB 2E0PA 1FL6B 2W9DH 2V5MA 4X6CE 2UWEF 4N9GB 5D7SH 5C3IA 4P5KB 5ALBH 4YSTA 4FCHA 3LIUA 3HW7A 2N7AA 1MHCB 1NJ9B 3WMPA 1KCVL 1PG7H 2WXGA 2Y6TE 1CICC 3TZVC 3GS4A 1MHPL 3LNIA 3TEZA 2PP9A 3A6BL 2NY6D 4X0KA 1PX8A 1ZHLB 4DO4A 4UZGA 5HPMB 1J1OH 4Y89A 3V4PB 4QIRA 4JREB 3P4NA 1QI3A 2R1YA 3HKFA 1E4JA 3QQDA 3T04D 2NYZA 3PWJA 1EPFA 3NCBB 3H3PH 5AD0B 1QHQA 4POUB 2AVGA 4XNUL 1V5JA 2GITB 1LO0H 2F58H 1MIML 4YIQB 1WD8A 2OV0A 3S2AA 4OCNC 3UXFA 5IBLD 2MWCA 5AOZA 5KUKA 2CXKA 2DBLL 1I9RL 2E7BA 2B20A 4Z77B 1MJ7L 3LCYA 1NMAH 5T5NF 3WJJA 4M1CC 3OHXA 1XZWA 2XZQL 4TULH 2O5XL 4APXB 3GSNB 3B8SA 3OGOE 3UGUA 3WNIA 1EDQA 2EIDA 1JGDA 4XBGA 1NGYA 3VFOA 1DANU 1CQKA 4Y5YC 4FTVB 5IB2A 2H26B 5B38G 3LV3A 4R3SB 3TFKC 2IAND 4GMSL 2GI7A 1FO0A 4ONHB 3KW8A 4RGND 1QUNB 3WGUB 4OF8A 1SEQL 4WWPA 2DWDA 3QUZB 2COVD 4FHJA 2CIKB 2FR4A 4JFQB 4B95C 1S9XB 2H2SD 5C6TH 4AVIA 3U1SH 1LO3L 1D5MA 4X4ME 3HZKB 4OQTL 1MF2H 1ZLWH 4OUOA 4O2FA 3BW9A 3QRFM 3MV8B 3DC0A 3S37X 4RESB 5IEKA 3X1NA 4LF3A 1WA0X 3P77A 3PV6A 2OR9H 2Q2EB 5BRZB 5BVPH 3PWUB 1JDCA 1NWPA 3ARWA 1M7DB 1E5AA 1EEYB 4F33A 1CS6A 3SPVB 1UXWA 2VDNL 3PXHA 5IMMB 3AABA 4KFZC 3BRDA 1BQSA 5DFWH 5LNGA 5H35B 4EZKA 4M62H 2XVLA 5JQ6L 1GHFL 1XCWA 2F7OA 2JCCA 1QTSA 4LSTH 2VSDA 4M6OH 3CH1A 3MGAA 3UZEA 5MI0B 4DEWA 3P3RA 4JKPH 1KXVA 4FYQA 3RY6C 1E5CA 3A5VA 4XC1H 2R23A 2RGSA 4YR6A 1DJYA 4ALAC 2OTWB 5ES4B 1EZUA 2BXZA 5A2AA 4BQ9A 2WV3A 5I8CB 3E6HB 2Y2WA 4MNQA 3HHRB 5HI4D 1UB5B 3GRWH 2LR4A 3ZKSD 3QSKB 5FS5A 5ILTL 2A38A 2VWEE 3ATFA 3BP6A 1OLLA 3ULAB 5EUOA 2NDFA 3LEVH 2XBTA 2CRZA 3NP4A 4F8TA 2GTWA 4OKDA 2XWCA 4JN1L 2H32B 3B56A 3GMMB 2OSWA 5L0QB 1N5YH 1R34A 1P4IL 4QT5B 5DK2A 5DD5H 4XCFH 4ICXA 4J12A 2HXAA 2X4RA 4W68A 1JFHA 5D7LE 4YQXH 3UEZA 1KZYA 2IGFL 5I0ZA 1J5OL 5A7BA 4KUZH 1B3IA 3RU8L 4H8HA 3CDZB 3E6FB 3NYKA 4MD5A 2YIHA 5C9KA 4YPGB 2W0LA 1M05B 3B1TA 1JZ5A 5KVGE 2DKUA 4Z3FA 5GJTL 4QO1A 3TCLB 3QORB 3M45A 4AYBA 3CVIL 3RVVD 3NH7H 5D1XD 3BEWB 3OKOB 5CCKL 1JK8A 1UOKA 3QRLA 4E41A 3FSVA 2YQ2A 3EJYC 4PJ9D 5KSAA 3II2A 2YUZA 4RCAA 3VFGL 5IVNA 2CGRL 4HHGA 4CC1A 4GQPH 3EKCA 2IVFC 1C5CL 2N0MA 2XQBH 3OKDA 4PJHF 4P3DB 3O8XA 3VXMB 2G30A 4LIQE 1WHPA 3GSXA 1P1ZB 2KLRA 4RGOL 1T03H 4B9IA 1J9RA 1MCCA 3MROB 7TAAA 2UZXB 4MHHI 3D2UA 3JBG7 3S35X 2WINA 1FDLH 2CO1A 3V9CA 2IFGA 4R7DA 5I5JA 3PQYE 3VJ6B 3TA3B 1E30A 1L9SA 1SXBA 4IW4C 4LEXL 4YEEA 1IM3D 5LDUA 4R83A 3E9TA 2NY4B 2FJFA 2ZCLL 1YMHA 4NN6C 4NQCD 3L7EB 5E5LA 4HX1A 4NGHL 2V2WA 3HMXH 2YD0A 4X6EB 1DN0B 1MVUA 2QKIA 5AB9A 2ITCB 2YOAA 1YJDL 4N2FA 3R7QA 2NUTA 2YRZA 4ZS6D 3X1BA 4BGDA 2B15A 3QIUD 2BVUA 4HC1L 3KLDA 4XAKD 4F7MA 2VLRE 2ZXEB 3BP4B 4JY5H 1ADQA 4BKSC 4PJEF 4WIQA 1BVKB 1TKWB 2FWOB 1CFVH 3CDYA 4O4YH 3TYFB 1T5XA 4FXGB 1K85A 1SYSB 1KWKA 5LBSH 2B2XH 4BGLA 2B1OA 3K5RA 2BNRE 3VXNA 3ZTJG 2NY1C 4G6FB 4J2XA 2BC4A 2NXZB 2F74A 3VXPB 1NBVH 2A9MH 2SEBA 2BH0A 4YLCA 4HUWB 2P4AB 1G7MA 2XI9A 3SKUD 1OE2A 3T3MB 2C34A 4B7IA 3GXNA 3K8KA 3LQAL 1P7KA 2PXYC 3RHWF 3UC2A 5BV7C 5JMRA 4MBRA 4DOHB 4WCYL 1UD2A 4JB9L 4N5UA 2R27A 1IAKB 4UINH 2AHIA 4XPBH 5I5RA 4H26A 1BZ7A 1IIIA 4MJ6B 4P23B 2E76C 5DRNA 3VXUD 2NX5B 1UJ3B 1SJVA 4K8RC 2W59A 3WN5B 2VXVL 2X6AA 1IE4A 5GGVY 5E4AA 3DX9A 4FA7B 3EH1A 2RFXB 2HVKB 1MJJB 3UAEA 3QGVA 5DHVB 1B4LA 5T33L 1A6UL 3P1VA 5LJYH 2DQTH 4U1NB 1Q1JL 4MJIB 1REIA 4LHQB 3IWVA 2DWXA 2XNAB 2ITDB 2Z1KA 1GR7A 4NEHB 3ULVC 3K6SA 3SE9L 4YPJA 1UA6L 5HI5C 1A9EB 1ZJBA 2EADA 2L3BA 1G5AA 4Y4FB 4NPYB 2CG9X 2BZCA 2D8KA 4YBQD 5I17B 2AGJL 3L48A 1DTUA 3K72A 3R7RA 1GIGH 4KJQC 1UD5A 3CHSA 1RUKH 2AEPL 4G6AD 4MZ3A 3ABKB 1GW6A 1VFUA 4CADB 4Q6YA 1UA7A 4HLZH 4CN4A 3LQZA 1K5NA 1OARL 2F53E 2CJTA 5E8EA 2PO6B 4B3VA 1RUQL 1QVOA 2CO7A 4KO7A 4ZPVA 2YJLA 4I88A 1W15A 1ZHNB 4NQUA 2YXWA 4PEEA 2MMXA 4XNXH 1WIUA 4JVUA 2DYSB 3ILQC 1HQ4B 4Z7VA 1T3FB 1JNJA 3O2DL 3MV7B 4KJWC 1RZFL 1VFMA 5L9DL 1T2JA 2R9HD 1I3GH 1SRDA 2VLME 1IGFH 3GO1L 3QWQB 2CK0H 5LLIC 2FRGP 3G5ZB 3GSQA 5E4EC 3WS6A 1OCWH 3X12B 4QJ3B 4PCYA 1CURA 4QTIH 5GGVH 3EYSL 1FYTB 4S1QH 2X53A 4LMQE 4RISL 5KUMA 1SM3H 2HLFC 1Z5LB 1QEWA 2QSCH 1J0JA 1D6EA 2Q6WA 4L3ED 3UJIL 3SKOB 5IREA 4KUCD 2XG4B 5AQ0A 5L8JB 2P9RA 3L1OL 3HR6A 3WFEH 3RZCD 1HX0A 3M1OA 4K94C 2CO3A 3C5ZA 5C09D 4ATWA 4AENA 5IVXA 4AM0A 5GZNC 3C60C 4ZFOA 4LCUA 1NBZA 1IFHH 2AJXL 2XN1A 5AAPA 3HG5A 3SE3C 4JAMB 3T77A 4WAFA 3V79C 1WAEA 4GUQA 5I8KL 2E4TA 4JUTA 2FYYA 3SE8H 1G1CA 5KBPA 5GS3A 3NK3A 1FN4B 5EU6E 1UVQB 5IVZB 4NO3B 4DTGH 1MRDH 3UGEA 2Z31B 3CFCL 2Y3NA 1JYXA 5HDBB 2BHFA 1WCBB 1KJMB 2EIKB 3K3QA 2Z3FA 2AQSA 4LL9A 2WTRB 4EEEA 3IETB 1G4RA 2AJZA 4XT1C 3VMNA 1ZGLP 2FAUA 4EZMA 2N3JA 3TIEA 3N3EA 5C0CD 1IQDB 1D2PA 4MQTB 3VFRA 5JDSA 3CFBB 3GFUA 3ABLB 3ZTNH 1A7RL 4P2OA 5AYQA 5T1LB 2OMWA 2W88A 3U9PL 3G6AB 4LRNL 3DXAA 2OJ1A 1WPCA 3IAQA 3MO1B 1JWMB 4OU3A 3VI4E 1QRKA 2P46B 3D5OF 5JXEC 3MX0B 5F1IB 1NEZA 3FB8B 1RULL 3GLDA 2DIAA 5A3ID 4N6RA 3L9YA 2Y24A 3G6JB 4PHXA 1PX4A 1S7VA 3ZO9A 1N6QH 1G0YR 4HMDA 4RMWA 4P5MA 2EEDA 4WKXA 4WKZA 3QC5X 3SEPA 3GB7A 3QDJD 4JKNA 1RZKC 4PJ7E 3RDTB 3PWPA 1JGLH 1BHGA 4OIAA 3KR3L 4EOWH 1WBXB 5E8DL 3U79A 3ZDXE 2OTUB 4GW1A 1F4WH 1CDJA 1OAJA 2BOCB 2HKFL 2B4CL 1KB5L 2G9HB 2ZUWA 3ARBA 2FSEA 4U1GC 3L6FA 3OLGA 4XWOD 2AXHA 4ELMA 4HCRL 4X0KB 3VW3L 3D85D 5TQ0H 5B39A 3FFCA 1JZ6A 1NAKH 2Z35A 2ZWSA 5D5MA 5EZJA 3P4NB 1T7XA 2R1YB 4ORGA 4P2RD 4LFHG 3QQDB 5L6YL 3II1A 3PWJB 5G4OA 2PCFA 4F24A 1ZLWK 4O51A 4B41A 4KVCH 4ZBJA 1VFBA 2W9DL 1DVSA 2MCPH 2B3RA 2F7PA 5K59E 2CZNA 2QZ5A 4ABWA 3I6LE 4WFFE 2E74C 4NUPA 3DSNA 4L0ZA 1PG7L 1WSST 2OZ4L 3OHXB 4OQ1A 5BVJA 3ALWA 4H2AA 5GRVK 2E6JA 4Z76B 2P49B 4HZLA 4O2CA 3QEGH 1JGDB 3BVDB 1NGYB 5T1KA 3VFOB 2P5EA 1J1OL 3AAZA 5MHSD 2ZUYA 5IB2B 1HXYB 4A04A 2YPLE 3LV3B 4U7MA 1OEZW 5GQBA 3DV4A 1ECZA 1FO0B 4JFVA 4X9BA 5C6PB 4WHDA 2DWDB 4RDQG 1SMOA 5HHOE 4X99A 2JQAA 2PCYA 5D7LB 3VGHA 3KPRA 5GSVA 2FR4B 3SB3A 1LO0L 1E9PA 3CZFA 3PWPE 2X4OA 3CIQA 1CDYA 1G0DA 3AROA 3WTWA 2C9VA 4M5ZH 2ZOOA 3E2HC 3O4LA 5JDJA 4O2FB 3CTTA 1NMAL 3BW9B 3HUJF 5TE4H 5IEKB 4WF7A 5DJDB 5CGTA 4LF3B 2KZKA 5JW4R 3TF4A 3TVMD 4R9HA 4I7ZC 3QARA 4F33B 1UXWB 1WS7A 5CXPA 4Y16A 4U6XA 2APBA 2WHVA 1MELA 5DWPA 4NKDA 2BNUA 1YUHA 1ZLSH 3VDAA 1EV2E 5HPOA 2YGVA 4M3JA 2JCCB 3UTQA 4I5BA 2X1OA 4JHAL 1F1AA 1KXQE 3CH1B 4NUQA 4XBMA 4E9SA 5IW6A 3GQFA 1U30A 1B3JA 3PP4H 4XXCC 1F4YH 4E9WA 5JOPD 2R23B 4YR6B 5C6TL 4RGMB 3U1SL 3WLWC 2EEAA 4ANVA 1DJIA 4PRIE 1FV1A 2OYLA 1UD8A 4PBVC 4MNQB 5GZOC 1T89A 2VO8A 3VWKC 2WBWB 5JMOC 1UTDA 3PQYB 2VR8A 1DSFL 3HRZA 3BP6B 5BVPL 2YD5A 3ISWA 5EUOB 2A7BA 3OAUH 2GUOA 4Q7DA 2WOYA 3MMEA 1OOAA 3WAKA 2DLEA 5CD5D 4R2GC 5D4HA 3PF2A 4M62L 1H3GA 4A7GF 1ZANH 1BWMA 1BYPA 2X4RB 4HD5A 4LSTL 4M6OL 4KTGA 1V7NH 1YC7A 1ERNA 4JKPL 5A40E 1KTBA 2GJRA 4DERA 1UUNA 4XC1L 2UWEE 4S0SD 3VB9A 2C5DC 2EUZA 1NA8A 1ILSA 1QSED 4MD5B 1A64A 4PP1D 3KJ6H 3MXVH 2VLRB 3O6FA 3QJVB 5HJGA 2X38A 2VDPH 2FL5A 1D7CA 4QYAA 2X2IA 3GRWL 4JFEE 5TQ2H 4QO1B 4KJPD 1B0GA 5C8JB 3KPSA 1BECA 4WHYH 4PRBA 1QBAA 3HG1A 3UO8B 1AG6A 3DROA 3LEVL 2PETA 3QDME 2YXFA 2F18A 2ZX9A 4E41B 3BH4A 1FQ9C 1L9QA 1OM9A 3WDJA 1UM6H 5KSAB 2B77A 5HGAA 3QI9C 5E70A 5IQ7H 1N5YL 3KLQA 1H3VA 2MNJB 3T3PB 4GS7B 1TJIL 4NC1C 5DD5L 1WGOA 3APMA 3AMLA 3OKDB 4XCFL 1VGEL 3T2OA 4B9ZA 1JZ3A 1CDUA 3APNA 3O8XB 4YQXL 1XH0A 3BQUA 3QO1A 5IIEA 2X6BA 2E59A 3B9KC 3L5WA 1SDDA 3C09C 4KUZL 1EXUA 1IGMH 2R1XA 2QEJA 5DUPH 4FI7A 1RXLA 3D2UB 3SDAC 2WINB 3S96A 3W11D 1T4KA 5DJ2B 3S5ZA 2XN9A 5ECGA 2LAAA 2GJPA 3N0PB 3K81A 3ZZ1A 1BJ1J 5TK2A 2FJFB 3NH7L 2IQ9L 1YMHB 4MMYA 1BF8A 4GBXA 5CF3A 4HX1B 4PTTA 1HCZA 3FU7A 2V2WB 4L48A 3PG2A 5AOIA 3S5LA 1ZEAH 2A3TA 1MVUB 2QKIB 4HHWA 6PAZA 3GK8H 5DC9B 2XQBL 2EDNA 4EVNA 2BDNL 2NUTB 1C7SA 2E7DA 3EHBC 4OI8A 5TPWH 4IOIA 1G43A 2YC1B 2QQKH 4F7MB 4HWNA 3LNGA 1FDLL 1JZHA 1T5XB 3RTQB 2CPCA 1RP9A 3GXDA 2AMUA 2ZWYA 4C56D 1AO7A 1FAIL 2F53B 1KJVA 4WK4B 1G9EA 4Y19D 3HHMA 4P4KC 3VXNB 2X0WA 2BC4B 4U2ZA 2F74B 3SZ6A 1HNFA 3JT2A 4GP5B 2VKWA 4PSRA 3ZT6A 2SEBB 3HMXL 1JV5A 5EOCL 2FD6L 1G7MB 1KEMH 4LCIH 4GSQA 2M2DA 4NENA 2ZQKA 4HEPA 5JW4Q 4Q4IA 3BWUF 1P7KB 1O5DT 1R0AH 1LO4H 1S9KC 1HSBA 2IEPA 1Z7JA 4YHZL 4YK4B 4KK6D 1HXKA 1IGTA 1T1ZA 1ZA3A 4H26B 1BZ7B 1FH2A 1JV2A 4LLMA 5FYKD 3S36X 1IJNA 3C5JA 1TLMA 4X5XA 5DRNB 3QCUH 3ZYIA 3DO7A 3DK0A 3AT9A 3CSBA 3ZDZF 3BRGC 3H1ZA 3MRGA 4PB9H 2WZPA 4K07A 1CFVL 4O4YL 4QHNA 3DX9B 1IARB 4N2AA 1WAAF 3AACA 5LBSL 4BJLA 5CEZL 5L2KA 3KPLA 1G9MH 1QX1A 2YS4A 4UM9A 1U4FA 3BIBX 1EHLH 4CRPA 2EVJA 3CXHK 3NPSC 2A9ML 3K6SB 4FMKA 3T0AA 5C0AE 4JZNA 4KAQH 3O2WH 4G6JH 5SX4I 3K72B 4UINL 5E6SB 1Y7VA 5MENA 3LAFA 3P3UA 1J8RA 3BAEH 3CPLA 5I5MA 3LQZB 3OC5A 1K5NB 1XSKA 3S98A 3VX1A 5E8EB 1C5DA 4WTXA 5E95B 5CJQH 1UENA 1F8TH 1QVOB 2CO7B 2H4EA 2PUQT 4WI5A 2DQTL 4ZPVB 5C08D 1E3FA 4HH8A 5EULV 2F61A 4IRSA 2RTTA 1I3VA 4Z7VB 4PJHE 3B3IA 4B50A 1R3KA 4GO6B 4G5AA 4BHUI 1QLFA 1ZT7A 2I5YL 1JF6A 1E2VA 1UA3A 4UBDD 2EIMB 1IC4H 2JQMA 1XD0A 3FCGA 2MSPA 3GSQB 2OCJA 1J11A 2RJMA 4CVXA 2UXTA 4H8WH 5HGDA 1RUKL 1KENH 1JNNH 2P5PA 5A43C 6FABL 4YDKH 1EMTH 5E51A 2F54A 2LFGA 1QEWB 1D6EB 1HZHH 2Q6WB 1L9PA 2A2QT 3PXJA 4G8GE 4M61A 3AY2A 1TR7A 5F7UA 3STLA 4DGYH 3D4CA 4DAGH 2QSTA 2Q3XA 3N40P 3RG1C 4G9FD 2VN6A 3ZDXB 4DK5A 4AENB 2WB7A 5IVXB 4ZFOB 4NZTH 4LCUB 2VJXA 1NBZB 4XNXL 5I0DA 5EEUA 1O7VA 2ED9A 3K2KA 4Q89A 3D3VA 4QRQA 3CN2A 3FJTA 2FYYB 3OKYA 3PXLA 4U1HA 4WO4A 4QKXB 3SCMD 1F42A 4RMTA 3EO1A 1IGFL 5HY9A 3FONA 1YMMA 1N8OE 1ZPLA 2CK0L 3S4SA 4WSGA 1OCWL 2J57A 1JJUA 4P07A 2EZ0D 5GGVL 3E0GA 4S1QL 4JFPA 3U4AA 4PJEE 5I18H 3HG0A 4IU2A 4GEIA 2BS9A 4IBVA 2AJZB 4XN7A 2W0KA 4WUUE 3SODB 1YG9A 3WFEL 4AIZA 4ZNEE 5I1EH 3IT8D 5EORH 3MRRA 1ZLVH 3MVSA 3TIEB 4KZ0A 3X1GA 3HBGA 3AU0A 5IY5B 3VFRB 5JDSB 4TS6A 4FYRA 1IFHL 1EVUA 1BZQK 2BMKA 2OMWB 3F6LA 4RMVA 5FM5M 3DXAB 3ENEA 4OLZH 3SE8L 4NZJA 1HHKA 1TJHH 2FO8A 2VLJE 2K3HA 5ETUA 1KYFA 1BZ8A 1ICTA 4L9LC 1TVHB 1S5IH 5DMIH 2YPLB 1NEZB 2JKSA 1MRDL 2LV4A 4DTGL 4Z7NF 3X3GH 1KB9K 4N6RB 4F20A 2FNWA 4NOBA 5B8CA 2VKXA 4KO6A 1S7VB 3FOLA 5IV2A 3HPJB 4P5MB 4QDGA 4MAYD 5D2LF 5LDSA 3EGDB 2WZAA 3GB7B 4JZJC 4NO2A 5INDA 3PWPB 4FNPA 1AI1H 3NDZE 4LASL 4U0RB 4UU9A 5DJYB 3ZIMA 3G3LA 3UIZA 4B5ZA 1RIVH 3PL6D 4QEGA 4TLTA 3S6CA 3ARBB 2ZPKL 2FSEB 3VXSE 4NP4H 5J7CC 3L6FB 3ZTNL 4APQD 4KKBD 4RFEA 4ELMB 3D3VE 4JGJA 1X5FA 3GPSA 3QFGA 4JVPA 1N67A 4M4RA 1UT2A 2ZX8A 3BWAA 2HJLB 3GKWH 5B39B 2FWLB 3FFCB 1TNMA 1QFOA 5D5MB 5EZJB 3KH3A 4JREC 4ORGB 1I7RB 2W9EL 3S34H 5DTFA 5HYQA 3BO8A 4QHKJ 2PCFB 3CLFH 4X6DF 4O51B 1N6QL 4M3KB 1VFBB 4TSBH 4PJBF 1HU8A 3SDYH 1EJOH 4EOWL 2CXGA 4NZDA 2AANA 3K0WA 4PRIB 3U4BH 5JPMA 2APSA 3V52H