1MG2C

Mutation of alpha phe55 of methylamine dehydrogenase alters the reorganization energy and electronic coupling for its electron transfer reaction with amicyanin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title MUTATION OF AlPHA PHE55 OF METHYLAMINE DEHYDROGENASE ALTERS THE REORGANIZATION ENERGY AND ELECTRONIC COUPLING FOR ITS ELECTRON TRANSFER REACTION WITH AMICYANIN
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase
molecule keywords Methylamine dehydrogenase, heavy chain
total genus 25
structure length 105
sequence length 105
chains with identical sequence G, K, O
ec nomenclature
pdb deposition date 2002-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1mg2C00
2I85A 4DPCX 3OM3B 3NSCA 1WAEA 2Q5BA 3V9EA 2PPFA 4P5SA 3FU7A 1ID2A 3IN0A 1AAJA 3FSAA 4G7SB 2DY2A 2VSKB 2WO3B 3WNJA 2UXGA 1X9UA 1XB8A 1ASOA 1W8EA 1KGYE 1N68A 5F7AA 2Q9OA 5A7EA 1AG6A 1JVLA 2CAKA 3UABA 1VLXA 2CBPA 3IE9A 3NSDA 4YSRA 2VM3A 2A3TA 2BZCA 1BAWA 2XU9A 2YAOA 3WIAA 2XV0A 4NB7A 1ASPA 3ZDWA 4BK5C 1URIA 4Q8BA 1ASQA 2IWFA 2B3IA 3QJVB 3ABGA 3S3DB 5I5IA 3TA4D 2TSBA 2IWKA 4DP2X 9PCYA 2CJ3A 2QPEB 3H56A 3PAZA 1CYXA 3WG7B 4EF3A 2ZONA 2XV2A 2Y1AA 4YSAA 1GS8A 1V10A 3X1FA 3FU9A 2YARA 2FJSA 1JZIA 1SDDA 4E9XA 1I53A 4M3HA 2VM4A 1ADWA 4TXVB 1JZHA 2JKWA 2PPDA 1J9TA 4PAZA 1R1CA 5B1AB 4GP4B 1L9TA 5PCYA 1OE3A 2AZAA 3GDCA 1A3ZA 1X9RA 2OV0A 3FPXA 1FFTB 1JVOA 3FU7B 1JERA 1WS7A 1AIZA 2IAAC 4E9YA 4HIPA 4KNTA 3ABKB 4KOCA 1A65A 2R7EA 4KNUA 3X1NA 1MZYA 2PLTA 3SBQA 1ZDQA 5AFAA 3SBRA 4HHGA 2J5WA 1AS6A 1NPJA 2MRYA 3OD3A 5I6PA 1SFDA 3UAEA 2GC4C 1CYWA 1WA2X 3GYRA 5B1JC 3T6WA 4A2HA 1FWXA 1GS6X 2DYSB 2OCCB 1PNCA 3CVBA 3FQ2A 3S8FB 5I26A 3S8GB 4UF7C 3QQXA 5B7EA 3WI9A 3FT0A 1E67A 4QLWA 2HZHA 1MG2C 3AG2B 4DP6X 1OCRB 2CCWA 2HXAA 1SF5A 4YSQA 4F7KA 2BO0A 2EIMB 1JOIA 2DYRB 4G71B 4GP5B 5B3SB 2MTAA 4F2FA 1M9WA 4G72B 4A2DA 3JT2A 1E65A 5I5MA 2GB2A 4KO9A 1AS8A 1NDTA 2YAHA 1AZCA 3V9CA 4HAKA 3BQVA 2YAFA 3PAUA 2QPDB 3TASA 3ASOB 4GY4A 2PPCA 1ETJA 3QPKA 3NSYA 4A2GA 4JHVA 3N55A 1NPNA 2IDFA 3X2QB 5I6NA 4DP0X 4E9RA 4GXFA 3FSWA 2GIMA 2VW7A 3MX0B 2IDQA 4A2EA 2GBAA 1PMYA 3AZUA 1SF3A 3ABLB 2IH9A 2GSMB 3DTUB 1NIAA 2QDWA 3NYKA 5LDUA 1PZBA 1NWOA 3NJKA 1OE2A 3BVDB 4NERA 3EH3B 2FT6A 4JKNA 5D4IA 2WSDA 1UATA 1ET5A 1BQ5A 3ASNB 1BEXA 4A68A 4DP1X 3PLYA 1ET8A 6PCYA 4X4KA 2PCYA 3C75A 2AFNA 3JTBA 5B7FA 1NTDA 4HCGA 1V54B 2CALA 3X1BA 5I28A 1GS7A 1XMEB 3H4HA 2FWLB 1MG3C 3NJLA 2BP0A 4NAJA 1QHQA 2XXGA 4HZ1A 1RZPA 2BP8A 3ZIYA 1BXAA 4JHUA 3QJQB 2H3XC 2PP8A 1M57B 4N4YB 4BWWA 3KW7A 1OCOB 3G5WA 1AZRA 4P5RA 2FQGA 1AG0A 3FQ1A 3FSVA 2EILB 3SBPA 2XYBA 2OJ1A 2EINB 2HRHA 1NICA 4AI7A 4HCFA 5TK2A 3PCYA 1J9QA 2JFCA 3TBCA 1M56B 3GXUB 1AOZA 1EZLA 1AR1B 3HEIB 2YXWA 3DIVA 4BXSV 2BHFA 1TU2A 4HALA 3IN2A 1PLAA 3NJJA 2TSAA 3QJSB 4AKPA 3L45A 5I6LA 1IBZA 1HFUA 4BWTA 1HAWA 3FSZA 5D4JA 1BYPA 1BQKA 2YAPA 3UAAA 1A4CA 4YSSA 2HLEB 4A67A 1OOWA 4KOBA 1WS8A 3QJRB 2P80A 1SFHA 3ZBMA 5IY5B 2H5UA 1DZ0A 3FU8A 3PAVA 1IKOP 1V55B 1QLEB 3WKPA 4HHWA 1ZDSA 4QKTA 5AZUA 4BDVB 1IUZA 4E9WA 2EIKB 1L9OA 2AZUA 1XB6A 2BWDA 2UXVA 1PAZA 5E9NA 4A66A 4FAAB 1KDIA 1PCSA 3NJFA 5I6KA 1SDDB 1JXDA 2VW6A 3CDZA 1OE1A 4E9SA 4YSEA 3FYEB 1RKRA 3WKQA 2I7SA 2VW4A 4HCIA 1J9RA 4DP4X 4E9QA 1KCBA 3OMNB 1CURA 4DP9X 1PLCA 1OV8A 1TEFA 1GSKA 2X87A 1KV7A 2I7OA 5PAZA 2UXTA 1E5YA 1AS7A 4KO6A 2R7EB 2FT7A 2HX8A 2BP0B 1IC0A 5F7BA 1F56A 2H47C 2DWTA 1JXGA 1NIFA 3HB3B 3S3BB 4PCYA 4G7RB 2FTAA 1TEGA 2PCFA 5B1KA 2PP9A 2FT8A 2FQFA 4KO7A 4WKXA 5EHFA 1NWPA 2B08A 1SJMA 3CDZB 1ZIBA 1HAUA 1NZRA 1IBYA 3ABMB 3EF4A 1BQRA 3U25A 4DPBX 2P80D 4GYBA 2IDTA 2PPEA 3OMAB 4AZUA 4YVNA 3PPSA 3T6ZA 4F2EA 1L9PA 3FQYA 1MDAA 2GI0A 1OCCB 1CUOA 5FC9A 3IBOA 1GY2A 2IWEA 4CSZA 2VSMB 4BDVA 2HX9A 1J9SA 4K9JA 1YLBB 2IDUA 2UX6A 3X1GA 1KBVA 2WO2B 1JZGA 2LLNA 1NIDA 3WNIA 8PAZA 2BZ7A 4DPAX 1L9QA 1TKWA 3NJHA 3NJGA 2YAEA 2UXFA 3S3CB 4DP7X 5I6OA 5ANHA 3T71A 3AG1B 2CUAA 3QJUB 5B7MA 3ERXA 4M4RB 3UADA 1GY1A 3AW5A 3OQRA 2JXMA 3TBBA 5B1BB 3CVCA 4N8UA 4YSUA 3UGEA 1ILSA 2ZWNA 1ET7A 1ILUA 1WA1X 1E5ZA 2YQBA 4KO5A 2Y69B 3NJNA 1JZFA 2XV3A 4YVUA 1T5KA 1JXFA 1BXUA 2VMJA 3NSFA 5B1JA 1AACA 3AG4B 3EHBB 2J56A 2AANA 4ZK8A 3T6VA 1RCYA 2PPAA 1AQ8A 2XXFA 1GYCA 1NINA 3NT0A 3RYMA 1KBWA 4BXVA 3TU6A 1ZV2A 2QDVA 3ZX1A 4DP5X 1SHWA 2XX1A 2XX0A 7PCYA 2BP8B 3UACA 2DWSA 4G70B 1OCZB 3FYIB 1AZUA 3EH4B 1CC3A 3FS9A 3NJIA 2FQEA 2YXVA 1AZNA 2DV6A 3QJTB 1SHXA 1BXVA 4YSPA 2XLLA 3NJMA 4BWUA 1XB3A 1AZBA 4A2FA 3N2JA 3D12B 1PF3A 3OMIB 3T6XA 2XWZA 1J5DA 4FA7B 2GHZA 1ZPUA 1FA4A 4W1TA 1ZIAA 1B3IA 1N70A 2BW4A 3SQRA 2HRGA 4AX3A 4YSOA 2X88A 2FQDA 3CG8A 2XVBA 2N0MA 3NP3A 1WA0X 1PZAA 2ZXWB 1PNDA 1PY0A 1DYZA 3MBWB 4Q89A 5AKRA 1NIBA 4RH4A 2UX7A 2FNWA 2ZOOA 2IH8A 1BYOA 1GW0A 3CVDA 7PAZA 1MZZA 4WTQA 2RACA 4AKQA 4CSPA 2NRDA 3IEAA 1A4AA 1KDJA 1RZQA 1EHKB 5I6MA 1W6LA 2YAQA 3CZUB 4KNSA 4E9VA 2GC7C 4AKOA 4YL4A 5I5JA 2YAMA 1L9SA 3AG3B 3H4FA 1L9RA 1SNRA 3FPYA 4G7QB 1AANA 4YSCA 1KCWA 1A4BA 3DKHA 2HX7A 4ENZA 1PZCA 1KYAA 2EIJB 2W88A 1GR7A 1A8ZA 3KW8A 3PXLA 5TK4A 4E9TA 1QNIA 4DP8X 2BW5A 3T9WA 2QT6A 2AVFA 6PAZA 2E86A 1NIEA 4YSDA 4UANA 4GP8B 4MFHA 4UAHA 2PP7A 4W9ZA 2IDSA 5D4HA 1JZJA 1OF0A 1JZEA 2J55A 2XUWA 3EH5B 3X1EA 3AY2A 1J5CA 1W6WA 3NP4A 2J57A 2BWIA 4L0PB 1E30A 2VN3A 4YSTA 1PLBA 2W8CA
chains in the Genus database with same CATH superfamily
2F08A 2F58H 1X5LA 1M4KA 2X05A 5C97A 5I66B 3GSNL 5C0BE 3CHRA 2A6KB 3SPHA 2I5YL 3U7YH 1I7UA 1ID2A 3EUDA 5FGBA 5HDWA 1QR1B 4NN7B 4UIKL 4EUPG 4JHZA 1JF1B 5J3HD 1DUZA 1FBIH 1RZ8A 1XHHA 1YEDA 2VL5A 1UXSB 2JI2A 2VSKB 3KDMB 1E2WA 3QDJE 3S97C 1A25A 3LV3B 4X5WA 2WM0A 4MSWA 5AW5B 5IVXF 5I30H 4G6FD 3VYOA 4PRIB 2AEPL 4GQRA 4PVNA 4DN3L 3IDNB 3NIDB 4LRIA 4IRJD 1Z32X 3OXSA 4U1JA 3I9GH 1AVAA 2WBXA 4JZNA 3UAJD 3ZUCA 1K8DA 4HPYL 1V7NH 3ROOB 2YFOA 3P3YA 5LN4A 3UBXB 2XU9A 5GGRA 4PW3A 3P9LA 4WSJA 4MZRA 1C08B 3GUTB 4MBRA 3WL9A 4C58B 5IEKB 3WMPA 3I2CH 3CN3A 4FTVD 4YHKL 2D0HA 3ZL2A 3LEXB 2P48B 5F0MB 1D5BA 1KGXA 1SJEB 3QW9A 1G5GA 4NPYB 4TVSa 5F7NC 2CRMA 1BW8A 4LCUA 3WS3B 5I0WA 4L05A 1BFOA 3PAZA 4O4YL 3QUMA 1CYXA 2XIBA 4IU2B 2HKFH 5JXEA 3GJFH 3JTSB 4QGTA 3F3HA 1UUNA 5F1KC 3V52H 3O45B 4IGBD 2QKIA 5G4NA 4QHMB 2CR0A 5IBLC 3W39B 4EXPX 3VB8A 1IGCL 1Q4NX 4KKBC 2JKWA 3QEHA 4NN7C 2PO6A 3SODB 1L5GA 3GZOA 2E56A 4GQQA 2ICEA 1N59A 4TVPE 2CGZA 3DI2B 1UKQA 1NFIB 3BZ4B 4XN1A 1DLHB 1JGUH 1ZSHA 4I77L 1NLBH 3AT8A 4JO1H 2WVSA 3C2AL 4UINH 4MXQC 2W38A 4BZ2A 2APFA 1DEDA 2CUMA 4G8IB 4CADA 4FLHA 4HHGA 3NFSL 5D1ZD 5MHSD 4PGCA 4L4VE 1SHSA 3QDME 1OTTD 4PREB 4TSBH 3CVBA 4AGMA 2CGYA 3TH4T 5AAWC 1ED3B 4LSRL 4P3DA 1IM3A 4U3CA 1I9JL 3KGSA 2X1QA 1E67A 4QLWA 1TQWA 1QI3A 2ALAA 1DHKA 3EYVB 4N2GA 1SMDA 3G5ZB 2DM3A 3GSWA 1QPKA 3LQMA 2Y6TE 4GP5B 1P9MC 4XBPB 1M9WA 1T22B 4MNHA 4FCAA 3VRJA 2EDYA 3QIBC 3QZOA 3U36B 2WQWA 1UEMA 1XR9B 3QS2A 4B9PA 4WZ9A 2NY7H 1T0NB 3NIFB 2X6UA 5EO0A 1CVSC 3TASA 3TBVB 4PY8J 1HL8A 3KMDA 5AL8A 4A2GA 4EDWL 1P4LB 4OTXL 2C3WA 3GPEA 4E9RA 1P4UA 1G6RL 2DMHA 4TTGA 2VW7A 3RWGA 3H7BA 3Q8AA 4P8QA 1LEKA 3SKNA 5F7EL 3B2DC 1IM3B 2BERA 4TSAL 3GSQB 4D0CB 2DMKA 3DTUB 4WK4B 1JDCA 4N8CL 1N6VA 5DVMA 3V5KA 4FZEL 1JWMB 3AB0B 4KV5F 1O7DC 1I9EA 3NJKA 5DMKA 2PYFA 1LNUB 4PJ8D 3NFPA 5D4IA 5ENWA 4IKLA 4PRBB 5C0CB 2BIMA 3ZHLA 4U6YB 4UYQA 1OKEA 2EVJA 4KROB 3STLA 4ZT1A 1KB5B 2X70B 1S9XB 3TA3C 2X4UA 2F9BT 4LDEB 4QT5A 1DFXA 3RX7A 4NQCD 4DUWA 4UOQA 4WGWB 3G04A 4XOEA 2ZSVB 5HYSB 4KY1L 4W9EC 3BDYL 4HZ1A 2XG4A 4IRJB 1MFAH 3DGDA 4TUJA 4TVPD 2D7TL 3ZIYA 1LEKB 5AYQA 4UT9H 4XZUB 2VDMB 1RZJL 2NUTB 4GW1B 3II2A 2O6DA 4FNUA 1ZSDB 4JFFA 3ZYJA 4UBDC 5ESVA 1EJFA 3C87A 1ZEAH 5IB4A 4Z8FL 4HIJA 1BYNA 3SB3A 5ALCL 1AG0A 1CG9B 4JFZL 1TTFA 1H5BB 4D9LL 3BW9B 3SBPA 2DQHH 4HGKC 4MMZB 5D55A 3ZRFC 2B9BA 4RIRA 5FDYA 1CFSB 4XPBL 4Z3HA 2IOMA 3D50A 4X9GA 3FTYA 3RVXD 1JF1A 4L3EE 2WBKA 5CGBA 3DX9A 2Y7LA 3UG4A 3RU8L 3WV0A 1CLVA 4YHOH 3PJNA 5CWSB 2F7RA 3G04B 3V0DA 3MRLA 5D1ZI 1EDHA 1FPTH 3AMLA 5B22A 4A39A 4PGDB 4H88H 1A14L 1WUNT 4ZD3H 4JHAL 1R3LB 2PCFB 1RURH 2P5WD 2AQ2A 5F1IB 4YQXL 1C16B 2YK1L 2D4FA 5ADPH 2FLRT 3QORC 4RAUA 1HNGA 4N8VA 2G5UA 4IOIB 2ICWI 3QJRB 4FQ2L 4PRPA 1NSNL 4YHYB 3E1F1 4KXZH 2K70A 2PF6A 1X7TA 1AZZC 3IMUA 1YPZF 4HCRH 4JFOB 2Y3AA 4X4XA 5DI8B 1CGVA 4HHWA 1ZDSA 2MHAA 4WTWA 5K39B 2V7HA 4BCZA 5IMLA 1RY7B 1MI5A 4OKVA 2AITA 2GITA 3NIDE 3WBDA 3MA9H 1OSZA 3H55A 4K7PX 4A66A 1KDIA 1OPGH 5E99L 1TOXA 1SDDB 2JELH 4GEIA 5C9KA 1PZUB 2DBJA 3LHPH 1LLAA 3FH5A 3FYEB 2VB5A 1N0LB 5G5DA 1A6WH 1HQRB 3AACA 4NC0B 4HJUA 1J9RA 5C07A 4E9QA 1MEXH 3AT0A 3IRZA 4JKPH 7FABL 4JFEE 1C16A 3GHEH 2LABA 1KJVB 4JFDB 1LK3L 2YFNA 3O2WH 4F15C 2YKLH 1FHNA 4WTZG 2AXHA 1XVSA 2DRUA 1NGWA 3QWOB 5FYJH 1FAIH 4N9GA 1G7HB 2OW7A 3CDFA 4S1SH 1QYGH 3BIAX 1N2RB 2XHNA 4OD3H 8CGTA 2F53B 5CEYB 1DQJB 5FDWA 1JZ2A 2C9PA 1FO0H 1WTLA 3OHXA 4K7PL 2B1AL 2QSCL 1SJMA 1HAUA 1CGUA 4HGWA 4JJ5B 3ZKMD 2J1YA 3F7LA 2MEJB 1N8ZA 4U1NA 2QADC 3FO2A 1NBYA 4AQ8A 5DU7A 2Y5EA 3PJLA 1SN5A 3ET9F 3PWUA 4FHKA 4GI8A 1FFOA 3GBNH 3MBEA 4P9HC 4UZGA 2OZ4A 2A83B 1NCJA 1MFNA 2XG5A 1T1YA 2OI9C 3LD8C 2I9TA 2KT6A 1O6TA 4PUBH 5T3XE 3Q01A 4KKAD 3TN0C 1OTSD 3NJHA 5JDSA 1HX0A 2XZCL 5A16A 1X9LA 3CK0H 3U30C 5B7MA 4R90L 4ONFH 1KWGA 1ZLDA 1SN0A 1IGYB 3DROB 1P5VB 4JHWL 2GAZB 1LGVA 1S7UB 3ESPA 4PG9B 1FH2A 3Q8BA 4OLXL 3UTSB 4G80A 4NQSA 3QUKB 4TV3A 3WFDL 4KRNA 5B8CC 1KY7A 3PNRB 4Z95H 3I84A 4HZAA 3RWIA 2X41A 2PW1A 4CADB 1E4XI 3DXAD 4PU2A 3KLQA 1BF5A 1U58A 5E0QA 1ZHNB 4PTTA 4ALAL 1JMXA 1V7ML 4JFEA 3TBSB 4BSWA 5FXCH 3B2MA 5GZOA 3DRTB 5DMGC 5I17B 3O6MH 4G42B 1E2ZA 3N0AA 4A6YL 4GG6F 4KPHL 1NINA 5F89A 1J1PH 3NA9H 1UT1A 3ZX1A 4ZMOA 2WZPA 2OI9B 4NUMA 4RETB 5ABDE 1KCVL 5J12B 1KCSL 4H13C 2AK1H 1EBPA 2VXSL 3CQFA 5KVEH 2A6JA 1VADA 2B3RA 2ZNWA 3BPOB 4QHPA 3TTYA 3T0AA 1NCCL 4LLVA 4WY7L 4CKQA 1SHXA 3O8XC 4FA8A 4JY5H 4HPHA 1CL7I 2PW1B 3MA7A 4A2FA 3NEOA 4U1HA 1VHPA 2JKSA 3FTSA 3QEGH 4XBEH 3F65A 1FUNA 1MJUL 2HRPL 2JK5A 1IC4L 3L3HB 4MA3B 1J1OH 3AABA 3ECWA 4FABH 1U9KA 4W9GC 1W8NA 4MA7H 2EKJA 1O9WA 1AXSA 1HCVA 4G82A 4G59C 3O11B 2HLFD 1YNKL 2ZP8A 4QOKD 2XVBA 4Z7OB 4HD5A 6CGTA 2Z9TA 2K9UA 2P8MB 3O2VH 2FJGB 5KVFL 1ES0B 3O4LE 2F19L 2QSQA 3M45A 4Q89A 2C9VA 4JCLA 4OBRA 1LO4L 4LCCC 5L88L 3SYOA 2IH8A 1BFVH 1L7TL 1W72A 4TRPL 4N8VB 4D3CL 5ICZB 1YMMD 2VLRA 5IOPA 2DWXA 4HV8A 1QLFA 3QUXD 2V3DA 2YD5A 1NGXA 1UJ3C 3DJRA 3L4ZA 3TNNA 5DVLA 2VXQA 2VMFA 4XPGH 2H9GA 3AU1B 4LGSB 5ETUA 5I82A 2VAAB 1FNSL 5JW5A 3RY4A 1V27A 4HQQH 4LHUB 2ICWJ 2I24N 5F6IB 2BNRB 5AW3B 2NUTA 1M1XA 5I2IB 5TE7H 2O5YH 3VM7A 1JPTH 5MI0B 1A8ZA 2YQGA 3U7WH 2VE6A 2OPCA 1IC1A 2ESVA 4ZMLA 1NEPA 1DN2A 4PJ8A 4PV9B 3E9UA 3GC3A 4QXGL 3BLBA 2JCCE 4MMZA 1JV2B 5DJYB 3W5NA 1G6RA 1C5BL 1OF0A 1KJVA 3MRFB 3R8QA 3LKNB 5F3HB 1BCIA 1JWMA 1U8CB 4NQED 4YSTA 3D25B 4XN9A 4U4BA 4HKZA 2E76C 3R19A 4UAOC 4BUQA 4QHKJ 1SYSB 4UUJA 1A1OB 3QWRA 1JZ3A 4Z7OE 2HRLA 1G7IA 2JB6A 3R06A 3TIDA 2APBA 2PO6C 3HFFA 3RIAK 4ORGA 2KBGA 1OSPH 3MLTA 3IKCB 3B9KC 4BSJA 4TULH 2X2UA 3MV9A 3SDXF 4XVUC 5JR1H 2IXQA 5EU4A 3BH4A 4HUXA 3CSBA 4XE5B 4HGWB 3OKDA 3R7RA 1HEZB 1OWRM 1ZLVK 5B3JE 4MD5A 1OAYH 3QIWA 4IJ3B 2Y7OA 2CAKA 3MRJA 3O9WA 3P9MA 5F9JA 1Y07A 4DUXA 1GKEA 3BP7B 4JLRB 2V5SA 1QRNA 2F7QA 4N87A 3RIFK 2FEJA 5DK2A 4OH2A 3L48A 4PRHB 5T5NG 4Z7UF 2PR4L 3MCYA 4NQDD 2C34A 4PB0L 5DHEA 3Q3GA 1HWHB 1K2DB 2ESVE 2R2EB 1P4IH 3H0TB 3W9DA 3E6HB 2K3TA 3HI1B 2AEQL 1U30A 2W0FA 3FULA 3ZR5A 4M6AA 3F05A 4FOMA 1ASQA 3IF1B 4YGVB 5EDSA 1PYWB 4JKKA 4R2GD 4Y5YB 3LRGA 2GJJA 1BAFL 4NEHB 4ODBD 1MLBA 1AGFA 2CKNA 5TTRA 3WG7B 3SDCD 4HGMA 4GXUM 2YMOA 1DQTA 2QTEA 4AIZB 2FECL 1N6QL 4K8RD 4FMKA 3L1OH 1EEZB 2H0JA 3LQAC 1LO3L 3C8HA 5CIPB 2H0FA 2AJZB 4HEME 4YOKA 2PWEA 3MCLL 1SOXA 3KHQA 4G5ZH 3WHE1 4WDIA 4HWEL 4ZRGA 1R1CA 4X5LA 3FRUA 5GRVK 2M2DA 4JO4H 5CN3A 3QYMA 1A3ZA 1BVNP 1L0XA 2K45A 5FYJD 1AGCA 4ANKA 1FFTB 5AD0A 4O2EA 3S96B 3GK8H 1XGYH 3MI6A 5LAXA 4KZ0A 1L3NA 1VB9A 3ECBB 3OHXB 5BMFH 4O9HH 3L5XH 4PVBA 1IAOA 5JHDE 4XNYH 1PYWA 2A77L 4ZFFB 1YYML 5J9PB 3VX0A 4HOZA 3D39E 3T6WA 3QRBA 4MZ2A 3L1FA 4R7LA 3NRQA 1VFBB 2RA1A 5D7LB 4DGIH 3RWHB 1ANUA 4RFEA 2DQGH 2WLHA 1NBVL 3RX9A 3ZK0A 4WI9A 2DM2A 3K6FA 4YH6A 1JZDC 2FBJH 3AG2B 2YPLE 1TZGL 2EDDA 2R69L 1BMGA 5EOQH 4HP5A 3ZDXB 3CZJA 1G1OA 3F04A 4ZUSB 4F91B 1X5KA 3WS3A 3FF7A 3AM8A 3OSVA 3MRMA 2EIEA 2WZ5A 4G8EB 3VMOA 3J7HA 2A74B 3QJHA 2CK0H 4LRNL 4YXLL 3Q8CA 3ME0A 3B1UA 5LAXB 1HHIA 2IBGA 3UBFA 2PW2B 3WY3A 3O3EB 2VDLL 3FUJA 5E6IB 4QRRE 4U3SB 2XDHA 1L9MA 1QW8A 4HC1A 5IQ9A 3D3VE 3HUJB 3VG0H 2NW3A 2J6WA 1T66C 5F6HJ 1MELA 2UZXA 2ZJSH 2JIXD 4A2EA 3GSOA 1CF1A 2V2XB 1VZHA 3OZLA 5TFSL 3ECQA 1SF3A 5ADOH 2NUPA 5FO9B 1LDPL 3OJDA 4KBPA 5I1HH 3KCWA 2X9ZA 4PJAE 1Q9LB 1U42A 2GIXA 4NERA 1XIWA 3F7VA 4J28A 1USQA 5F93C 4EUPA 3HHMA 3BGAA 4A63A 5DJCB 3D9AL 5EORL 4P5MB 4MNGE 1WFJA 3K8LA 3DV6B 2X9YA 5E08H 2PWDA 3QFJA 2ZOKB 3D05A 1CU4H 2XN9E 1HTYA 1JNJA 3RVTD 3QZLA 5C09E 3V7AE 4ZNEE 1A9BB 1XSKA 4ZFOB 4MWFA 2XXGA 3HOGA 4EN3C 4PJFF 5CUSH 2ODIA 4DEWA 1WYJA 1YCSA 5FF6B 3HNVL 3QDJB 2JKLA 3CVHL 4QRTA 3K2UL 4NP4H 5IMMB 2WSKA 1OCOB 2X9WA 1XR9A 5C6TH 1F4YL 3OKMB 3BFQG 2AQQA 2ZXCA 3MRRA 5CIPH 3CFNA 3O0LA 2JCCF 4WO0A 3MUZ1 4X8GA 2X4SB 3GMNA 2G75A 4WJG3 3VI3A 4AG4H 4ERSH 1GGYA 5IV2B 2EILB 5J1TC 1CBVL 2XYBA 4IS6A 2Y7NA 4LSDA 4O51B 3SY0A 4HG4J 1GOGA 3WIFB 3ARBD 5FYLE 4PLNC 1VAHA 3ESUF 1DQDL 3P9WB 3GMOA 5BO1L 4Z7NE 2V8MA 4XNMB 5IM7B 3VFTB 2CBOA 2VDRL 4XP4H 5GS0C 5T3ZL 5CKAA 4AH2B 2ZOKA 1CLYH 1SOQA 2BSRB 1FGVL 1E5UI 4FP8H 4FXGB 1AR1B 3QISA 4JN2A 3VXRE 2F7IA 3CLFH 4J1UB 1HNYA 5E1AA 5EEZA 2BNQA 3MJ7B 1TJIH 2F2HA 3EJYC 1SQ2N 4PRBA 5HPOA 4LPTA 4KMLB 3GBEA 1Z2KA 3WS6A 1XD1A 3CFCH 5BS0D 2JVUA 3VFMA 2HVKB 3SOTA 1BDYA 4WU7B 2F8IA 3F01A 4LLVB 4BFFA 4S1RH 5IK3B 3LN4B 4R6UA 4E5XG 2WXJA 3VCLA 3IF1A 2FLMA 4K3DH 4IBUA 2DJUA 3JWNC 3SGDI 4LLUB 3FU8A 3PAVA 1IKOP 2FCBA 5GGTH 3TV3H 4KUZL 1CGWA 4PBWD 5AZEL 3WIHH 1IT9H 2VXTL 5F3FA 1GGTA 3ATBA 4QHUA 3BKYL 1KTJA 2EABA 1T1ZB 3VXMB 2RGSA 4PH8A 5F9OL 4ZOEA 5HDRA 1YMMA 2OXHB 2DI8A 5D2LF 3BYTA 3MBEC 4LVEA 2DLEA 2LVEA 4M8RA 3EHBD 3QNZA 3NRFA 4GBXA 3O9WD 2GEQA 1PG7W 1Q1PA 2E4FA 2XKNA 4OCRH 5I8CB 1IO4C 2CD0A 4ODTH 4WU7A 1DVQA 4O2FB 4ABWA 1CFTB 5SWZE 1UD4A 5I0ZA 3ZE2B 4YIQA 4B53A 2WIMA 1HL4A 1MHPH 5DC9B 3ML9A 2NY1B 2AK4A 2R15A 2EZ0C 3OPZH 4KK9C 5B1CA 2ZPKL 3HN3A 3TJPA 1QACA 3N1MC 5AW6B 3QSKB 1A21A 3EYUH 1UVQB 1TEGA 3V95A 3FN9A 3RFZC 4EZLA 3JTTB 5K9KA 3KJ6L 1OPOA 4UOW0 1G1KA 3IJ8A 1XH0A 2PTUA 3QNXA 3GRWH 4G6JL 4BSVA 2WVVA 5F96H 3VFUB 4WUUA 5JIDA 5D1XE 5K9JH 3T6ZA 4FQXB 3J27A 1OGSA 4QTHB 1IQWL 3K6SA 1OCCB 3CMGA 5I71B 4YE4H 4OKVB 4Z5RB 1J9SA 1M2VA 5EFIB 1RSFA 2FK9A 4FQPA 2LLNA 1MW2A 4HKZB 3PUUA 5FKPB 1U4FA 3SDDD 2YQ2A 4HS3B 2VABA 1ZHBB 1HZHL 5ESQB 4OIAA 4BKLA 2B9AA 1QEWB 5KJ7E 4Z7QB 1QMUA 3CJJA 5E8NB 4HSAC 2MCAA 2J88H 2VQ4A 2P8PB 2AMUA 3G08A 4FJ6A 3BOVA 3QA3A 3PDOA 2Q8AL 3SPCA 1PLGH 1TJGL 1FFPB 3H9HA 1O6SA 3ATDA 4WW2C 3OKYA 3IDGB 1ILUA 2VR5A 4QY8B 3O6FA 1CFQA 3FZUD 2LVCA 3L3OA 4M6MH 3UBXG 3F7QA 3NJNA 3GJFA 5DT1L 5I24A 2DL9A 3QCTL 4IIQC 2E7LC 2F7OA 2VDQB 3U4AA 1IIKA 5A2CA 5B38B 1TLKA 3DVNB 1J88A 2K8QA 2XFGB 2AXWA 3OHMB 1LO5A 1FL5B 2DL2A 5IWLA 1RCYA 2CUIA 2A7BA 4N0UB 3ARYA 3MBED 4BFGA 1WCQA 4ZFOA 5HGHB 3QXAA 1T0PB 1NEZA 2BP5M 1BM3L 5KSBE 2W80C 3FYIB 4POZD 1SPDA 4S2SA 1EQWA 3IM1A 4OFKA 4YHNA 1E4WL 1A66A 3L3GB 2CGRH 4QTIH 9CGTA 1G1CA 3S35H 1D3CA 5TDOA 4AK1A 2YPKB 2J8HA 1AZBA 1WFTA 2W59A 3V4VA 2QQLH 4FJYA 1PFCA 1DJYA 2WLNA 3VI3E 3I9PA 3T0XA 4R9HA 4L8SC 4PJ8C 1D7BA 2QGBA 2DQCL 2ZYIA 3OC5A 2D7PA 3UEZA 3V4PB 5J6GA 4EVNB 2VLKE 3S36X 2A9MH 3MNVB 3QR2A 3UTSE 4HJGB 4JRYB 4KRPC 3OJDB 4AT6B 2AW2A 2Y07H 5JW3L 3OAWA 4BQCA 4O02L 3DPBB 4Q0XH 4EOWL 5DEFB 4XB8A 3WHXA 2X6VA 3PE9A 1QW9A 2VQ1A 2EXWD 3E38A 5C0AE 3DRQB 4JL1A 2VR9A 5H4ZA 5G2NA 4RH4A 5FO7A 1E8WA 1QFWI 1U8HB 1ZJAA 3A22A 3FJTA 3QDMA 5FHAH 5KVEE 2Y7QB 2BRQA 3SDYH 3TBTA 1QNZL 4LLYA 2ERJB 2V17L 5AOMA 2HJLB 3ESOA 4CMHC 2VT0A 1PEWA 1EHLH 1JK8B 1ND0B 3FO1A 4KNSA 2YXMA 3X3FL 5I9QC 1HQ4A 3WIIL 3U7YL 1JNNH 2W92A 1BZ8A 1NCAH 5GS3A 4MB3A 4PCKA 3GXFA 1XSOA 2VL5B 1ZA3A 3F7PC 5JOPD 1CDYA 4HS8H 2B2XL 3MNVA 4YBQC 4DK5A 2AS5M 3FMGL 3RTQC 2ITCB 3LNFA 1SXCA 1X7SA 5HPMB 4K3GA 4AT6A 5EZIH 4M1DH 4AJYV 5DMKB 4IOFC 1SLWA 4JZNB 2VJ0A 3GMQB 3MLWL 3U1QA 2ZP9A 2D7NA 2EO9A 5CZVH 4GP8B 5FUZL 5IP4A 2DM7A 2F0CA 4KKQA 3UTTE 1PU0A 3LXAA 4WHYH 3VD4A 1S9XA 1CFTA 4KK5C 3BLKA 3BEVB 3HAEB 4MS8D 1IE5A 2ADFH 3BH9B 3QCVH 4BH8B 2WYZA 1A47A 2BCKB 1AO7A 4X98B 3WUZA 1NCDL 1HQ4B 4YDIH 5JHDA 1IM9D 1EGJH 4IK6A 3V6ZB 1VFAB 2OJZH 4AQ1B 2VN5A 1IAKB 3FAWA 2GK2A 4PJDA 3S7GA 3M17B 3HZVB 4FYRA 3U0WH 3DGGB 4X7CC 4P5SA 5KG9A 4JUSA 3UO1H 1FF5A 3EFDL 3FSAA 5L2KE 2VMCA 4JRXB 1OAXL 4BJLA 1E7VA 4J3WA 1Q72H 2V7NA 4JG0L 2E7CA 4U3HA 1RIUH 1OGAA 3VYNA 5IOPB 2CLZA 2H1LM 2XQYA 5CP3H 1COBA 4AY0A 1O5PA 1XTLA 2CBPA 1WLHA 3RGVC 1RK7A 5GRUH 4YSRA 3B2XA 2A3TA 4MVBD 2APXA 2GTQA 3K6OA 1J0ZA 2HSIA 4KTDH 1WIOA 4ZS6D 1DL7L 1ZE3H 1KELH 1LE5B 2P52A 4K15A 2YXFA 4Q8BA 1WZ1L 5C0ND 5CWSA 2F54D 2VE6B 2XT1B 4AL8H 5MHSE 3TA4D 2XQYG 4PGCB 1PY9A 1SVZA 4JFXB 1AHMA 2IWKA 1EPFA 1S9YA 5JW4N 3QULB 1DJHA 1KFAL 1MDTA 3S88H 4H0HB 2B5IC 4P3DB 1RMFL 5FUOH 4F57H 2ZONA 4AH2A 5IW6B 1HILB 2EDBA 4KJWD 4TUKH 1DSWA 3B7SA 3F6LA 3H6JA 1U95B 4JREC 2Z1PA 1NGZB 3RHWF 4P3CH 5F7MC 3WSQH 4OZIF 4WTXA 4X0NA 4F58H 3IETB 4JFHD 3VXUE 1GW6A 1BJ1J 4ZZFA 3L95A 1WJ3A 3WFHA 5F2FA 4Y0GA 1KXQA 2D03H 3ZE1F 3QNYB 2OSYA 2IAMC 1T1XA 1F6FB 3R06B 3TIDB 1T5XA 4AGOA 4A37A 3ILQD 5B39G 1OAJA 2IAAC 3W0WB 3B2VH 4PJEE 3CXHK 3SOBH 2J72A 3TZVD 3ULVH 2OK0L 2DJ4A 1X5YA 2ID5A 2XVGA 5AVXB 4BEIA 2F5BL 3ZE0B 5HGAA 2HLAA 3H85A 4PTUB 1XAUA 3N41F 4WU5B 2X4TA 4OBSA 3ML8A 2B15A 2A38A 3G5YA 3VXUA 5J6HB 1J0JA 1UA6H 2OCCB 2Y36L 3MCKB 1EXHA 4N2EA 1B2WL 3V5KB 2YPVL 3A6OA 4K3JH 4LLMB 3H0TA 5C7XH 1HS6A 4FLSA 5I76A 4F1SA 1X7QB 5DJXB 5MERB 2CCWA 3MKKA 2OMVB 4BUHA 3WTVA 3MC0A 3ARFA 4I18A 3SPIA 4IDJL 2YZ8A 3EW3B 3U4BL 5MI0C 4L1HA 4F8TA 3PFUA 1WGVA 1RZ7H 5C0AB 4NQCA 1QFOA 4F7EA 3QGVA 1YEHH 4XX1G 3DOSB 1AZCA 3ASWA 3LV3A 4NQVB 3HIZA 3SJVE 3TPUB 4KZEL 1IC7L 1FO0A 3QZWG 5C08A 3PHQA 4F8NA 2QPDB 3IDYB 4V1DA 2BS8A 2KQNA 5CJXC 4NNPH 4Z76B 1M6OA 2WXGA 3C60B 4UB0H 4OGYH 4WI3A 5AZ2H 5GRJL 3FSWA 1CDBA 1M71A 3BGMA 1K8IB 3IMRA 4XNQA 4HLJA 4V1DD 2H32A 2Y2TA 2VXQH 3FQRA 4WJ5B 3GMLA 2H1PL 4NFBA 5AW4B 4O2EB 4WHTB 1CXEA 1RZKL 1ZEAL 1TJMA 4ZQTA 3EOTL 4P2RE 4G6FB 3WNKA 3PWJA 2QDWA 3UP1A 3GSNA 2OMVA 1BQHA 1HHJA 1LO5B 3BZDA 3JYCA 3OZKA 4B9YA 5IB3A 4D8PA 2FO4B 1H19A 2BNRD 1E3ZA 1JF5A 1UATA 3I02B 3MTRA 4UTBL 1NDMA 3V0AC 1F11A 3MV11 5E8DL 4HOWA 4WHCA 3AY4C 1KJ3H 1XDTT 5IJKC 3RZWA 5DJZA 3ARDC 1ZV5A 3EUUA 1RZJC 4LU5L 3IGAA 3FN0H 4YNYB 3DHUA 3QIUB 4AXWB 1A6TA 4ODWB 3ZTNH 1N59B 4NAJA 1KXHA 1QO3B 4ETQB 1MCSA 3TPKA 4YQXH 4NQEB 4XP1L 4BELD 1BXAA 4WRLA 3STBA 1G7PB 3QJQB 5I1KH 1T7WA 3K81A 3DRTA 3KW7A 1E9OA 4HG4K 2F5AL 4OCNC 1AZRA 1S9VB 4F9PA 4A7GA 4DNLA 4U1MB 4KHTL 1KC5L 2C4XA 4QRFA 3HUJE 1FYHB 3MREA 4L1TA 3JWNH 2UVEA 3EJUA 3C5ZA 2H1XA 4IMLB 3WXVH 2FX9L 1INEH 1KLUA 3VXQA 1ED3A 3MA9L 3DUSA 1XO8A 1QD0A 3BPNB 3O6KH 5KSAC 2ZXQA 1CQYA 4C56E 3GHBL 3LIZH 5IEKA 4ZSOA 1R5WA 3CFKA 1P1ZA 4QT5B 2ITDB 3L08A 1ESOA 2NZ9D 4ZMAT 4R97C 3RPIB 4QIRA 1LK2B 3VSUA 1P7QA 3GEWB 4HUWA 2VOTA 1XIWB 4JKPL 4L3FA 5A43C 3Q6GH 5EU6D 5C3LD 5T33L 1AGBB 4H8WL 1QFUH 4NM8H 1E0OB 4ODVL 1IBZA 5KYXB 4AIEA 1MQKL 2DD8L 5D4JA 3S4SB 3CDGB 4EQ3A 1JGVL 2QHRL 4HFUH 4ZJ9A 3LAFA 4PHZA 5HDOA 4QRAA 4I0PA 3IDIB 4S1SL 1MCKA 2MNWA 1NLDH 2HTKC 3FU6A 3C5ZB 3KGTA 3GSXA 2W94A 2JE8A 1GZHC 2ZCZA 2JJUA 3ZXAC 1CE6B 4J3OH 1U58B 1EERB 4BK4A 4TOYL 1XB6A 2BWDA 2VC2L 3IDYC 4LVOB 4QRTB 3SE4A 1ZPLA 3U4KA 1OP3K 3CSPA 2C3HA 3J8F7 1J0KA 1XTMA 4YSEA 3GIZH 2AQNA 4O2CA 4F8PA 2BCKA 4FS0A 5KYWB 4L23A 2EUWA 1FI8C 1U8NB 5ITFB 3L4CA 4U1IA 2QL1A 3AQZA 2Z91A 3HHRB 1NGYB 1PLCA 4Z7WE 1JZ7A 3AWFA 4X80L 4TTDC 5KOMC 5I1AB 4LAQH 4XN2A 4PB9L 3EH2A 3F85A 2QQQA 4C56B 2ICES 3L4TA 4KMTL 3FXIC 1JFHA 4FQJL 3PABA 4ONGL 5F7BA 1TKWB 3HBGA 4PV9A 1LO0H 5I8OH 1BIIA 5IKCA 2ZF8A 4QRUB 1CF8L 2WBJB 4U1HB 3UC0H 5LN8A 3GSRA 3DTDA 1E9QB 1CO1A 3TNMA 2WLIB 4NO0D 4IDLA 4OR1A 2IPKB 3FO0H 3S8GB 1XFPA 2RB8A 4FNSA 1CE1H 2P80D 4WEBH 1SM3L 5CSZB 3MHZA 4I4WB 5AVRB 3BRDA 2BNQE 4LMQE 4PW4A 1QFWM 5DHYA 3J2PA 3QG6A 3QAQA 3CN0A 1YSOA 3BEVA 1XEUA 5D9SA 5IIEA 1U3JA 3VH8A 3VM5A 1M3IA 4J3XA 2ZIDA 5FW8A 3OR6A 3UYRL 1TKWA 3ZKMC 4K94C 3WNLA 4XP9L 1BWMA 3FSOA 5I6OA 2WZAA 2G0KA 4LQ1A 5FYJE 1I1FB 1LL1A 3ABZA 4M5ZH 3V7AG 5DUBA 1P4BL 4OZGA 2M8XA 4JPVH 3BAYA 4BZ2H 4AYFB 3VQMA 1KB5A 2ZAGA 1GOFA 2NR6A 2IG2H 3EOYG 3EZJB 3FTVA 3FCGA 1TEYA 4L8SA 1JWSA 2CLZB 3FTGB 4JY5L 5HI3D 4MCMA 4ONHA 3VSQA 3VFGL 1E5ZA 4KKRA 3BWUF 3HRZA 4KH9A 5D1XC 2JK5B 3OF6A 4EI6A 4GIOA 2HLAB 1RJZA 2XRAL 4PRPE 1S5IH 1WFOA 5IB1B 1BXUA 1J05A 2VMJA 4PJHA 4KVCL 4GW1A 4MLSA 5C3IA 2XSKA 2QZ5A 3VJ6B 3KNBA 4EZMA 4Y1AA 3ARUA 3WGUB 3MRQB 4BQ8A 4PLJD 1KBWA 2NQ3A 1AGDA 3FRUB 3QUXB 2XX0A 2OR7A 4FQXA 2R56L 3PP4H 3W57A 1U8JA 4OCMC 5LBVA 2AHIA 4UQIM 4P57B 3QDGD 4RMTA 1ULVA 5T1JA 2H7WA 1L7TH 1U95A 3N1PC 1V8HA 3NJIA 1PX8A 3CFJB 1OM9A 1EAOA 1YRKA 2DV6A 5BUPA 3FOMA 3QJTB 4UM9D 3MNZB 2FH8A 2VR3A 1T20A 2AXJA 1I1CA 4R3SA 3DTXB 1KCKA 3OKNA 2Y23A 4HX1A 4KI5E 4RWYH 3RWIB 3TWYA 5JLZB 3C6LD 4HXBL 2NPLX 5IB1A 2CO3A 3WDIA 1I3GH 2MCG1 1RPKA 1E5BA 3ZE0E 4G7VL 3RP1A 3P30H 4TPRH 4Y16C 2O5YL 1N70A 1P1ZB 4E36A 1VACA 3NIGB 2R9HD 1MPAL 5JPNC 2ZWZA 1E8YA 3KPPA 1L6XA 3SZ6A 4QXGH 3EGXA 4GRLD 4M61B 5DJ8A 3A5VA 2R23A 3SKMB 3HR5B 4UQCA 3FQTB 3C5SB 3MLVL 4YAQA 5DFTA 3HNTH 3NCFB 2I9TB 1FFNA 3JUZA 2WY3B 4LVHB 4M3JA 4E42A 3BVNA 3IAPA 5JPMB 4X5WB 4Y9GA 3VI4F 4WTQA 2X44D 3V6FA 4EI5D 1AJ7L 4NYLB 3CC5B 2NRDA 3OJMB 2HVJA 3RAJH 1SLVA 2R4RL 1NCWH 3I6LE 2ADIB 2WMPB 4WUUD 3V5HB 3RUGF 3LKQA 4XX1E 4AXWA 2G9HB 4DKTA 3HKFA 1AYOA 3AQDA 1DLFL 1UC6A 1IEBA 1VEPA 4XTRD 5T1MB 3WMSA 3L3HA 4JFDA 1XXFC 2IVFC 1TTBA 2GK0A 3ETSA 3BKJH 3DARA 2QVMA 4LIQH 1TYEB 3EJYD 3MFGB 1D5BB 1I1YB 4BYHA 1F2XK 4XPTL 4YZFF 5F0PB 5L6YH 2QT6A 3PWPA 4OM1L 2E86A 1W16A 3VDCA 4EUPB 1N2RA 4UT9A 2VUOA 4KJYB 3FQXA 3TO4A 4F8OA 1CTOA 4QWWC 4P5KB 4LOEA 2CO2A 2OTUB 3QFJE 1P4IL 2HKHL 3DBXA 4LPWA 5T3XD 4WFGD 4MLIA 3V0EA 4ZX3A 1MCEA 2VISB 3WHE0 3AWGA 2CIKB 4AV0A 2OQJA 3CZKA 3IGKA 4IBWA 2FJHB 3JSSA 1L5GB 4OZFB 2K6ZA 3BPCA 3D8MA 3U82B 3W1ZA 5KYUB 3DXAA 1I3VA 3VO0A 1WWWX 3KE0A 4KH2A 4APXA 3SE9H 4DO6A 2A6JB 4AM0Q 4B95C 4PJHF 3ROLB 4AUJA 1HSBB 4LL9A 2OSLA 1JN6A 4GI6A 4B7LA 5B3NA 3OB8A 5D7HA 3IAQA 3ZKXC 1HWWA 2JJTC 5HVHB 4XNZC 1JPST 2ENQA 2FO1A 1UYWH 3EJSA 3S5LB 3NCCB 3PFQA 3U2SA 1U6AL 3M07A 3MROB 4OUUB 4WWID 4DVRL 1Z6JT 1CL7H 3RVTC 2A74C 3O4OB 3CVHB 2MNJB 3C6EA 3CPUA 4PREA 2W9EH 1CT8A 1JHTB 4ZO7A 4OLUL 1IE4A 4PMEA 4L4JA 3RKDC 4G8FA 5FW7A 2MCPL 4LCCB 3P73A 3WNPA 4BHUA 4PN6A 4PG9A 5E95B 2R2BA 3V4PL 4Z7NB 3EJTA 2H32H 3TO4D 1LXMA 3N40F 4BFIB 1U8CA 2DB8A 1UCBL 4CBZA 2RD0A 4P2OB 3IJ7A 3MOAH 3MGOB 3T8XB 4CNIB 3QUMH 4POYA 3TYGL 4BKTC 1MY5A 4HPYH 4XN5A 1YECH 2EECA 4K8RH 1CXHA 4Y4KC 5DRWB 1INDH 3MBXH 2YPLD 2O72A 2OR9H 3D48R 3TT3L 4GKSA 4MMZC 3EJRA 3LB6D 1G7QB 3TBWA 1HYRC 2E5EA 3NCBB 2ENSA 1BG9A 2VN7A 3G5XB 4NNXA 4B3EA 2LU7A 3MRJB 3GXDA 3ZKXB 5I1GL 3LNIA 1FBIL 4EZKA 1H9DA 1IZKA 4XNAA 1Q9KA 3IDXL 1TVDA 3QZWA 2YUZA 3GPSA 3WXWL 3LVTA 4M7KH 3QXTA 3VYPA 1HXMB 1OHZA 3WJJC 3NOIA 5C0CA 4YBQD 5I6PA 1A6PA 2PCXA 1WA2X 2OMXB 1CB4A 4PJGB 5B1JC 2ZXDA 3QWNA 2DYSB 4WKZB 25C8H 4GRWB 1EK3A 3HW7A 5I26A 2QPFA 1WE5A 2O6CA 4XNMA 3VFTA 2BIPA 4MXWH 3TXAA 3DOHA 3QB7C 1NLBL 2BVPA 1LEGA 3DX8A 4DW2H 2JIXB 3CBKB 3IMTA 4L9LB 3FU3A 4X6CF 2NZ1A 3Q9PA 4N85A 4MRCA 4QHLB 1GAFH 2OAAA 3EYQC 4OZGB 3DUHA 1NL0L 4QEGA 1AQKH 3BQVA 3BH8B 2B1HH 5KBDA 5J5EA 3TEYA 4XPFH 3RWDB 4HIHA 3I74A 4LLQA 5EUOA 2WYTA 1K72A 1IGCH 4H7VA 5EOTA 2QV4A 1I8AA 1F4WL 1ETJA 1W8OA 4M9PA 4X8JB 3RILA 1OK0A 1NPNA 3N55A 5T5NF 43C9A 3QEUA 4M61A 1ZWIA 5D6DA 5FF6A 2GIMA 4XAWL 1B4RA 4QNPF 3FQTA 2AI0L 1LILA 3HNVH 1F86A 4RSVA 4YAQB 3V0WH 1IGJA 5IVXB 5CGYD 2K6YA 1KTDA 4DO4A 5JXED 3AB0C 3GD1C 5JORA 3KBHE 4APQA 1HH9B 1IBBA 1U8OA 1KYFA 3V6FB 2YWYA 2VZVA 1EO5A 3LNGA 5TQ0L 3A6BL 1YEFL 4AE1A 3KYAA 2X4OB 1KY6A 1OE2A 1SMOA 2OMWA 4J3BA 3KL5A 5I16B 2FT6A 3ETTA 3G5VB 3GBML 4JKNA 5CP3A 1C7TA 3UZEA 2WSDA 4Q9QH 5BV7B 3PHOA 1PVHA 1B88A 3FUEA 3UTQB 2VDNH 3LEVH 5J1SC 1VGEH 3EOAA 3NZUA 1T2JA 1WAAF 4RGND 1JNHB 4B9FA 3T0ED 4G1EB 1J8RA 1HXYB 2ADGB 5IBTH 1GS7A 2G30A 5DJXA 2CBTA 3BUYB 4P99A 3SDAC 3VXOB 1UTDA 1FDLL 2A9DA 1HT6A 1PQZB 4D2NA 3OXSB 3KVPA 3FUIA 1JI2A 1N8OE 3FCUB 3VXSE 4RZCB 1MCCA 1U8KA 3L9BA 4F7EB 4Z3GA 1ACYL 2NY3B 3IKCA 4ZQKB 2HFGH 3ZZQA 4NC2B 3ARBB 1AE6L 4P5RA 5E6ZA 4ZXBA 4N0FB 1VZIA 1NAML 2JLLA 4YXKL 2CHDA 2NUPB 5FHBH 4ZBJA 1W80A 4GH7B 3ILQC 5FO9A 4L2YA 5GJSL 3WFCH 4XWGL 5KYUA 5C0RH 1SJEA 2EINB 3EAKA 3EFOB 3EGXB 3T0DA 2XETA 3B6SA 1MCDA 3IFPA 4NO3A 1DE4B 5D5MF 1R3HB 1HSBA 1MF2L 3ARXA 2V2TA 5KJ4A 3RY5A 1UWEL 1AFVL 1RZJH 1EZLA 5D6CB 4P23B 4PLOB 5IB5A 4YGVA 3ZDZF 3RZCC 5I8CA 5CJQH 2WYHA 1FSKB 3L4XA 1QLEH 5I71C 3LKRA 5GS2D 3S5ZA 3CN4A 3FFOA 3I02A 4PJ5D 2JH2A 4MJJA 4LCVA 3WJLC 4GG8A 2OR8A 3FOMB 4DN4L 2FH6A 1XIWC 1CXIA 2YOAA 2EH8H 5IQ9B 3CMOL 3MV8A 5G4OA 1CDJA 1KIPA 1KOAA 1LEIB 2IPTL 1SY6L 2ZF9A 1N7ML 1I1YA 2UZXB 5F6IC 1I9RH 1IKNC 5DTFA 1UH2A 1A7OH 2YJQA 1KZQA 1PAMA 3FT2B 3OZ9L 4RMSA 5HJ3A 4Z6AT 2VDPH 2AZUA 1T1YB 2K1MA 3ZTDC 4YHIB 5LXGL 4N90E 1ZTXH 2YK1H 5E6ID 2P9RA 2IFFL 3HE6D 2KERA 4NT6A 4DETA 4JMNA 3GO1H 4NN5B 5F96L 3BCFA 1XGTA 1QHPA 4RDQG 3V4VH 1ECYA 3L9EA 3QE5A 4FQ2H 4WFED 4NN6C 5GSVA 1M7DA 5F8QC 1KCBA 1RJYB 4YEFA 2TRYA 3KH3A 4YE4L 4ZO9A 5HP5A 2O5XL 4E68A 4LSPL 2VITA 5EN2A 4C57C 4I1RA 3SQOL 2I9LA 3T4YB 2HVKA 3L2LA 4DAGL 4L1LA 2R7EB 1LEIA 1HDMA 1QEWA 4KQ4H 1S46A 1A1MB 3HS0A 4IIZA 1F45A 3GKWH 1OPGL 2ITDA 2ICEC 3VACA 3T3PE 1NDGB 4MMYB 4I7ZC 2HP4A 3TZVB 2X89D 2WUCH 5EUOF 2XA8L 2QLVB 2ZXEB 4AVJA 2EUXA 4Q4EA 2J20A 2GK0B 1MEXL 3K5SA 3ZR6A 2AVGA 2OYPA 2X1OA 1ETZB 4H8QA 2HFEB 3KL0A 3R4RA 5FA4A 1BBDH 3LOWA 2NDFA 1U91B 3D0LB 4OLVH 3L6FB 2UWEB 1ZIBA 4Y9CA 3O2WL 1XGTB 4HCRL 1KXQE 3WS6C 1HK6A 2PETA 4M6ML 2K6WA 3QT2A 2BP3A 4Y1AE 1ECZA 4XBMA 1RP8A 2ICWB 2OM5A 4FULA 4QWWD 2ZXAA 3CU7A 2WKOF 4F92B 4H40A 3F5WB 4ZYKA 1SYVB 1YLBB 1KCUL 1ZLEA 4Y5YC 3CH1B 1A4KA 1WIPA 5EIQA 5GRZA 5DUPL 4L3EA 2P8LB 1JNLH 3U1SL 2EDTA 3EBIA 1CLZH 3N04A 8PAZA 5KYNA 5I8KL 4OM0H 5EU6B 1L9QA 3QUHA 1W0VB 4PR5A 5FWQA 2WXPA 1J1XL 3QEQB 3T71A 1XR8B 4NUPA 1B0IA 4Y2OB 3HZYA 1OGPA 2P3YA 4QO1A 3TA3B 2AK4B 1LK3H 4L29B 4IRJA 5I1LA 2CIIB 4JFFE 1A7BA 3RA7H 1LHZA 4N8UA 5I1AA 4ODHL 4RGNC 3VWKB 2FWOB 1KTCA 2PWFA 5BRQA 1TFPA 2DMGA 2BOCA 2C9UA 3BX7C 1FYTE 1CG9A 4N2AA 5E2WH 5C0DA 3ZHNA 3REWA 4GRMB 5EUKB 2ZG3A 4LOVA 3UTQA 3GLDA 1YQ2A 3HE7A 1NBCA 2OXGB 5F7YC 3TF4A 3NSFA 1RUPL 4G7YL 2B1AH 1AACA 2OXHA 3UTSD 4HWZA 4QRRB 3E3QE 3QS3A 1U8IA 1EBAA 3HG3A 4XPAL 2Y07L 5CFAA 3WHXB 5FM4A 2OKMA 4OLXH 4M7LL 4JQIA 4BXVA 4LQFH 2YN5A 1RZFH 2RCSH 2BP8B 3SJVD 3G6DL 2C7UA 1FG2A 4KJWC 2DWSA 1EUTA 1ETA1 2WAHA 3HC3L 2UY6A 5EH1A 2FZ3A 5I8EA 3L4VA 4PJ5B 4X9FA 1FC1A 1QNZH 4M4PA 5CD3B 1GGBL 2O93L 3L3KA 3T04D 2XZCH 3TURA 5M95B 4F5CA 5LXVA 4M7JH 4TKWA 1PF3A 1ZXQA 3ZKQD 5KTEL 4MD0A 4RSYA 5MP6L 4UM8A 3RVUD 4QXUL 3MCKA 4PY7A 2NY5H 4P2RD 2WHVA 3GJFB 4AC4A 4AENA 3GT6A 4ZFGL 3GMPA 3OAZH 1BA9A 5D6CA 1JWSB 4HPOH 1LYQA 4YDLC 4YSOA 3FF8A 3R8BB 4LHJB 5LCVL 1WWAX 4P59L 2C3VA 1NCCH 1WA0X 3ARRA 2ZXWB 4MQ7A 5C71A 2P5WE 3VX1A 5KAQF 2JTDA 1OHQA 2E75C 4I77H 3GGWA 1A7NL 2VL4A 2BFGA 4WW2A 1U3NA 2LAGB 3F7YB 2ZOOA 1UQSB 3KBFA 3S48A 1TG8A 2NX5A 2EJ1A 4PJEF 3PHQB 4HJIA 4BKLB 3KPQA 4A6YH 2VMEA 4M6NH 2YC1A 5HDBF 1WC7A 1KIRA 1U8MA 1J1PL 1VFAA 4MNGA 1U3HB 4Z7UE 4GFXA 2XJKA 1DBAH 5IMOA 1F00I 2GKIA 4LSQL 2N1KA 2XA3A 3V2AR 4AM0A 1G4RA 4BGLA 1CIUA 2AK1L 3AG3B 3N9GL 3MLYH 4KTGA 1Q0YL 1GPOH 3UDWA 4FCHA 4RAUB 1XD0A 3LMJL 3IPEA 5ILTL 3T0EA 2GIYA 4ZPTA 3JXAA 4D0DB 3KR3H 2AXFA 1DVXA 1MREL 3E8UL 4HS6A 1T20B 1BREA 3QHZL 1WSST 3QEGL 1YEKH 3WUWA 3WDHA 4N2DA 5EBLB 2AVFA 4E0RB 4Z7OF 4CN1A 4UAHA 4YJZL 1D5IH 2ENJA 5G4MA 1RSYA 3EFOA 5D4HA 4ACPA 1JZEA 3ETBF 1KPVA 1D6VL 1QTYT 3O2DH 4FNQA 1EGJA 2OW6A 5HDQL 1J8HB 4OTXH 4FQHA 4N1CA 5AKTA 5G5DB 3VGAB 4G3YL 5IVNA 4ENED 3QNXB 2FBRA 3RGHA 3S8WA 4Z3FA 5I23A 4A6YB 1AXTL 3NSCA 2GJ6D 4N0CD 1H8NA 5IHLB 3DIFA 3ULUC 4WTZA 1OGTB 4BM7A 4F7MB 4QRQA 2WO3B 2VZSA 1AKJD 4P2CG 4ZFZA 4E42B 5DXWA 4X6CB 1C5BH 1OAUH 5DVKA 1JGDB 1KTRL 1E6JL 4BRJA 3CQQA 5ABZA 2BDNH 1DJXA 3HVDA 1I1AD 3KPOA 1Z3RA 3VXRD 3MYZA 3IE9A 2F53A 5EA0H 5CEYA 4A04A 4IBSA 4DGYH 4PVLA 5AQ0A 3X14B 1QHOA 2LQRA 3SDAD 1U8QB 2Q8BL 3U4EA 4NX0A 4HJGA 3OGCA 5B8CB 3SOBL 4JJ5A 4BK5C 3ULVL 2OK0H 4K9EH 1MXGA 1TCRB 5DD3H 3L81A 1FFPA 2ADYA 1OL0A 3T2LA 3EYOB 2OL3B 5DYOB 4S0TD 1FZOA 1AGBA 1URZA 4HIXH 2CHNA 4U1GB 3QJFB 1I8IA 3MMEA 4D9QD 3LQZB 4NP9A 2CNYA 2XV2A 4M6OL 2CJUH 4NKQB 5EF3A 4KGJA 4Q56A 1YMHA 4JFZH 1A5FH 4OCXL 1E4XH 3I6GB 4JPKL 4PBXA 4ZOBA 1IV8A 1JZIA 1SDDA 2D73A 5BVJA 3T4YA 1JK8A 2AABL 3FO1B 5E4AA 1OF2A 4CBPA 5IFJB 2VDOB 4L4TB 1UH3A 4JFUA 3VAEA 4R7DB 5E8PA 3QXAB 4N5ED 1ZJBA 3OR7B 1TQUA 5I75C 2X09A 5ALBL 3THMH 4A1RA 3D2UB 2QKIC 3D5OF 4TULL 1JVOA 5A2IH 3IXAB 3VXPA 2CJTA 2EC9U 5C08B 4I3RL 4MX7A 4LAJH 1U8IB 1G7PA 3KLHD 5IFHL 2CHXA 3PGFL 1OAYL 5E9AA 3QYNA 1M3JA 4O58L 4X2UA 4ELMF 2BSED 3LKPB 5GHWH 2ZCKH 1NPJA 1SFDA 5ANMB 5EU6E 5LBSA 4FLOA 4MJ6A 4GRLC 1AYRA 5GZOC 2DZEA 2X4RB 3PGDA 1H0DA 5T1LD 1IFHH 2Y3NA 3L5IA 4NZJA 2GY7B 3EOTH 3VQ1C 5ECGA 4Z7WB 3FT0A 4OT1L 1VGKA 5GS0L 5AYUH 3FBQA 4YL9A 1T2XA 2AJ3B 3MV9E 4TUUA 2BO0A 3CFDA 3OAZK 2CLRA 3STZA 4ZFOL 5JZ7C 3U9UA 1ZT1A 3IXTB 3OR7A 1TU2B 1DVFC 3SDDC 3QEQA 1C12B 1FORH 3MUY1 5IVZA 3AQYA 1DDTA 2JTYA 4N5UA 3L3JA 4PS8A 4MX7B 1NDTA 2A9NH 3L1OL 4HIEB 5JHLL 4HAKA 3VMNA 2XG5B 3IRPX 1BEYL 4X99B 5LWYH 5HHNB 1PIFA 4OGAD 4G5ZL 1BQHG 1UURA 1SUHA 1BZ9B 2PUQT 4JFQA 3FT3A 1ZS8A 1YEWA 4MS8C 5T5FL 3GK8L 1H5BC 3N3EA 3C8DA 3CWGA 4KK5D 5E1IA 4E2OA 4KZDH 3BUQA 1VEOA 5HGBA 3AROA 1T0MA 4R5VA 2IH9A 1WEJL 1TMCB 5E5MA 4AGQA 1KC5H 3O8XD 2NY1C 5CU9A 4NXSA 4G6KH 3IWUA 1RI8A 2VDLH 4OFYD 3N42B 2R4SH 4AQAA 2GT9A 3H1ZA 4JO3L 1HILA 4OLYH 1TJHH 4ZSOB 4GW4A 2C3XA 4JFDD 4HCGA 1EHAA 1E90A 1FCGA 3H4HA 3P4NA 1BOGB 4PJIA 4PRHE 3P2BA 1FYTA 1A6UL 4JZJB 4Y2OA 1YAIA 3LRKA 4X7DC 5C0FB 2CRIA 5T33H 3BT2H 1QFUL 5FGCB 3BGFC 4YXLH 3EJQA 4KKCD 3WTYA 4JG1L 4NCC1 2AJUH 3NN8A 4GQZA 4UM9B 3C5JA 3O3BA 4XN8A 4PG2A 4JRXA 4XXWA 3D9AH 5EORH 2AQRA 3B5HA 2XXCB 2X0VA 4P4RA 2NY6B 1PZDA 5T1DH 1TVBB 4I2XE 4PMFA 4IRSB 5J11B 4YHPA 1E3XA 4R90H 3PQYA 5DI8A 1EFQA 1SGKA 1MJ7H 1I7UB 35C8L 1IFRA 5DZ9A 3CFIC 1WGOA 3N5AA 3EBGA 3U46A 2BNUB 4HU8A 4TQEH 1ZT4B 3TCXA 3GXUB 4I0CC 1AOZA 3OB0K 3BE1H 1BZ7A 4PS4H 1JZ4A 1MN4A 3LS4L 4NWTH 3UTOA 4ODUB 1Y1DA 5CIPA 4FA6A 3VU1A 1FVEB 4AMWA 1N0LA 1C5DB 4F7PA 1CBVH 4NQDE 3QULA 3AADB 4NZ8A 5HVHC 1YEEH 4XC1H 4BZ1A 5GRVL 4P06A 5E1GA 4DKEH 5FCUH 4LAQL 4ELME 1P6FA 4FQIL 2DQFB 1WISA 1EHXA 2QSTA 4ELKB 2Z8WC 4AITA 3UBHA 4L8BB 4B9KC 1Z9SA 3MRGB 4MCYB 1K8IA 4NUJB 1F18A 5A2BA 1F4AA 4WEUD 4L3CA 1SVBA 3QORA 2VXSH 4X5RA 2MCMA 3KYOB 2O6EA 4QXWA 4A7TA 5AZUA 4WWOA 2WXRA 4HKXB 1IUZA 5GRXG 4WY7H 1F4YH 4Q52A 1MHEB 5IHWA 2GFBA 4ATWA 5FKPA 4P2OC 2KPWA 4X6EA 1RERA 2WKOA 4Y5YA 3WMQA 5IFJA 3SGEH 1OB1B 4F2MB 2AV7B 3PWNB 3KWTA 1A4JB 4LDCA 3S34L 4DGVH 3LH9A 1NDMB 3PL6B 4NNYB 1PTZA 2YMXL 3DHPA 4F8QA 4EDWH 3UPRA 1FE8H 1CURA 4QHKI 3AXHA 5BO1H 1D5RA 3OGOE 3BD5A 4KUZH 2R8SL 3WN5B 5H35A 4DIXA 2I7OA 5EPMA 2AERT 4FG6D 4JDTL 2CDEA 2NY2C 1HI6A 2W0LA 5SX4I 2GCYB 1YNLL 3SPVB 3KWWB 2E4TA 4Z7IA 5HGDB 2VGLM 2ZX7A 3S3BB 1HH6A 3ATFA 3OKNB 3LKRB 1OZTG 4Z18A 4XMKH 1D6EB 2DN7A 2XWBB 1CE6A 2NOYA 3TX4A 1T1WA 4MB4A 1BHGA 4DPBX 4MNQA 3NJXA 3FHEA 4C83A 4AE0A 4X0KA 3I3EA 1SN2A 3T77B 2WQUA 3O2DA 3DA0A 1RHFA 2QVFB 3KPNB 5F71A 4BINA 3LPPA 5TQ2H 4WUKH 3MRHB 1IAMA 1EMTL 1NFDF 2VSMB 4S2SB 4BDVA 1J18A 3NIFF 3QCUL 4JFEB 1T0NA 1JZGA 3O6LL 4PWIA 4X99A 1UASA 1NC2A 4XVJH 4K5OA 5CZXC 3N43F 2HUHA 3BC9A 3I6GA 1O0VA 4N9GB 2IV8A 2DIBA 3IGFA 1KGCD 5FKAB 4F7TA 3NCYS 5DC2A 5DLMH 3GRWL 5H37G 2KPNA 1AGFB 3BAEH 2XWBA 3QIUC 4X5XB 5E2TL 4EVNA 1HEJC 3SJVB 3HFMH 4X42A 2D9QB 3V79C 2WQ8A 3RIKA 3AXLB 1CGTA 4ZO6A 3EOBB 5EMYA 3MJ8B 3UERA 1T5WA 2ZWNA 2CPUA 3D18A 3BVUA 2PXYA 1QSEA 4XC3L 3VUAA 4GIAA 2H4EA 1XIWD 1ACZA 4NDMA 4UV7H 4AVIA 2WTPA 1AQDA 1A14H 5DLLA 4ZD3L 3KAAA 1N19A 3QG6B 5FX3A 1QKZH 2DYPD 3KPLA 4X6FA 5AKSA 3C9NB 4FXKC 5I15L 2PPAA 2VISA 3HC0B 3RYMA 5DC4B 4ALAC 1W0WB 2XN2A 1DCLA 1CFVL 4WWKA 5GGUB 2JKRM 2ADJA 3KLAB 3U9PH 1CDHA 2NNAB 1VFMA 3INUH 3EO1A 1XF3A 3ISRA 4XCYB 1MOEA 1AR2A 2BCMA 4OF8A 1UZ8A 4YZFE 1ZY9A 3RGVA 1CC3A 3FS9A 1H6FA 2FQEA 1AJ7H 2G2RB 5DMGD 3NIGF 3FFCA 4IBZA 1VJSA 2YPVA 2PXYB 3U2JA 1ZHLA 2NMSA 1BIIB 2FEEL 2X10A 3QQDA 1MAMH 3D12B 1OW0C 1O6VA 4D9RD 4UZSA 4PTTB 1N6QH 2EDNA 4DZ8A 2WLKA 5KW9H 4M8QB 2CIIA 2C9SA 1BWWA 4RQQB 1A7PH 4Y4HC 4WI6A 5GQBA 3GMNB 3VGFA 1XL6A 1IZJA 3CG8A 4JX0A 5E5RB 1DCEA 3VWKA 5DD1L 3NP3A 4P2QE 3FTZA 1CGSH 4BQ9A 1PGRB 1QSED 2R0KH 3S35X 4B9GA 1HIMH 4HCRA 3MBWB 5AOKA 2XPGB 5AKRA 3ZQWA 3WELA 1I3RB 4BV1A 4OLWL 1ZS2A 4AQAB 1IAII 1OAQH 3TCLA 3B9KD 2NXYD 2OXGA 2G4EA 4O9HL 4N26A 2WC7A 2XYCA 5IVOA 2JKTM 2IAMA 1AQMA 4R0LC 3HE6A 1E8XA 1MCWM 3CFJA 4TLTA 1AIFB 2WN2A 4JGUA 1EZVX 1MCQA 5CMAA 2X28A 5E2VH 3DXAB 5KN5A 5MEOA 4HFWA 2BFVH 3HMXA 3TBWB 3RTQB 2YAMA 4POZC 4NNXB 3H4FA 2PTTA 1RULL 4GUCA 3LN4A 4FI8A 3NN8B 4XB3A 1PZCA 3DV6A 5EOQL 1Y7VA 2EYRB 4NGHL 4Y19A 5FHAL 3PXLA 1TZIB 1MUJB 4YHKH 1BFTA 2AQ1A 2I5YH 4BK5A 3ZSTA 3PXHA 1BVLB 3BLPX 4CN6A 4HKBB 4MS6A 2CK0L 4FD0A 1EHLL 3FU5A 3CU1A 2P5EA 4NWUH 3W3BA 3BT0A 3BIKB 1NCAL 4FNTA 4KXZI 2VDQL 5SWSA 2CDEB 4HUUB 4L0PB 4WNSA 5AENA 4Y19D 4HV8B 3I9GL 3QO1B 2L3BA 3KXFB 1WBZA 4RLDA 4EOWH 3EO0B 4IGBC 2XKNB 2I85A 4MVBC 4S1DD 4EMZA 3UPCA 2OTPA 1X3DA 1A0QL 4FFZL 3R0MA 2FAUA 3GSUA 4J8QA 3QUML 4XMZA 3V9EA 3ZRCC 4AVKA 2N7BA 4J12A 3MLWH 4R4FL 2OS7A 2B39A 2RMNA 2JWYA 1SBSH 5LHDA 2D8KA 1OLLA 1NGQL 5IFAL 1MJJB 4Z78B 1ZVSA 5L4IA 4KKLD 3LSOA 1KGYE 3OKLA 4PJCB 5KJRL 4EBQL 1N68A 4XB7A 1DSFH 5C6WH 3H8NA 3ZKND 4JM0A 5D1XD 1PG7X 1TQCB 3ULUL 5KSBB 2E6PA 4ODSL 2KHAA 2YIHA 3DX0A 5FLUA 3TTSA 2WNKA 3D06A 3NSDA 1NCDH 1B6DA 3HN5A 4XGZB 4L3CB 3UOAB 3V52L 4TQ8A 1UM6H 1UEYA 1YUHB 4HIQA 1Q9WB 4I2XB 3FMGH 3VH8G 5KAQG 4CDGC 1MCHA 4WFGE 5IQNA 3UO1L 4I87A 4P5KA 3ZDWA 4M1DL 2JXMB 4U33A 3BZEB 2ATPB 1TXKA 2BRRL 4M7KL 1WBZB 4QNPE 3HPJB 1KJ2H 1Q72L 5AG8A 2LU4A 4JG0H 3HAEH 1RIUL 2TSBA 3H54A 4DP2X 4F7TB 2OMWB 2X4OA 4P5TD 4MJID 5DS8A 1TZHB 2NSMA 4CU8A 3IJHA 3O3AB 5LJYH 2FRGP 4GG6A 5GRUL 4L8CB 1QFPA 2IXQB 5EU4B 3U7AA 1BZ7B 2WXIA 1PFOA 4MMXB 4RAVA 1HEZA 4ZNCD 1JYXA 3EADA 1KELL 2DOCA 2MQ0A 3TO4C 3AREB 1SZNA 1JZHA 1VA9A 1DQKA 4PAZA 4JM2C 1YNKH 3BGMB 4GP4B 1G9HA 5A6LA 1G0DA 3ZSSA 3FCBA 4M8VA 5DD6B 5KVFH 3NK3A 1I9JH 4R7VA 2CDFB 4AK2A 3U6RB 1K9TA 5FUOL 4F57L 5K1VA 2Q76A 2ZSWA 4KQ3L 1Z9SB 3SDCC 2BVEA 1PX4A 3QUYC 1S7SB 5SWSE 1UZ6E 2EIBA 5HI4C 1Z5YD 1RK0B 1UH4A 3G6JF 4N0FA 2GJ6B 1ZVNA 4UTCA 4MAYD 3MOBL 2BVOA 1VZGA 2EXWC 5GS0D 5I1EL 1KB3A 4P48A 5TJWK 3V0WL 2ZXBA 3NK4A 1P1VA 2NXYC 4OZGF 3FQ2A 5SWQB 2H6PB 4OZHA 4PJXE 4NO3B 5ICUA 3RURA 2COVD 1C08A 5TQ0H 3TV3L 1FNEB 5IB2A 1A3RL 2R27A 3G5VA 4R26L 2NTFB 5F7LB 1YYCA 3MRNB 5E00A 5C07E 4YSQA 3IAGC 1ORSA 3U7WL 2EIMB 3NRPA 1JOIA 5KZCB 4L5FH 3BKYH 5H94B 1OGAD 4RGNE 1MFAL 4N8CH 3U6RA 3H7LA 2XWCA 5H8DA 2YAHA 4GS7B 4WWNA 5SX5K 5A7BA 4M5YL 4YWGL 2HVBA 4M48H 3VWJA 3NSYA 4ZG1A 4ZAKA 4P4KC 1QFWH 1DVUA 2PO6B 3CZNA 5EEVA 1IM9A 3FRPA 4LVNB 3INOA 2WXFA 3GZQA 4BBWA 2GBAA 3QHTC 1RZ7L 1P7KB 1THCA 3T2PA 3FL7A 3MNDA 1NAMH 5LNDA 2WBWB 1K3ZA 3S36L 3IKKA 1FN4A 3VNZA 3KPLB 1DUYB 4HSQA 1I7TB 2VQ1B 3O6FB 1G7LA 3UG3A 3IDMB 3QIUD 2QJDA 3RWCB 4CN4A 4Z7UA 3DYOA 2H9GB 3AU1A 3ASNB 1TZOA 4DP1X 4L29A 5DS2A 5E7FA 2X4RA 3PGDB 3FK3A 1NMAH 3UEQA 3GMOB 1RURL 3ZZSA 3DYPA 2NX5E 4XH2B 3DBXB 2G3ZA 4IKNA 4G6JH 2O61A 4Y19B 1CZ8H 5CZXD 5I74C 5CJQL 5J0BA 4PJAF 3SDXA 4J5VA 5TE4H 1IEAA 1U93A 3MX0A 3Q06A 3D85A 1AMYA 4GAJL 4X5XA 1XF4B 2WANA 5HHMD 2WSPA 4NCDA 1Q9KB 5AEAA 4N4YB 1M57B 3B5TA 2EH8L 3ZYIA 1H3PL 3HG1B 1IAIL 2XQBH 1U21A 1HXMA 5F21B 3RI5F 3ECUA 4XMPL 3D4ZA 2BS71 4H88L 2H3NB 3MCLH 3Q13A 1TQBC 3IJSA 1IBGH 4P23D 3T3PB 3ZTNL 4AJ0A 5L2KD 1F42A 5L4MA 1JPSH 1GJUA 1MCBA 3GHEL 4NKOB 5DEGB 4JG5A 3QXVA 5LXGH 5C2UB 1QUNA 1HU8A 1PSKH 1M56B 2VXUH 3B7YA 2F1EA 2YKLL 3L4UA 3NSXA 1URLA 2EXSA 1L0PA 1KEML 4QYOB 2CWRA 2IBBA 1O75A 5HI5D 1RIVL 2OMYB 3VRIA 3PL6D 2GUYA 4CNIA 1HFUA 1YUHA 2VYRE 3V4LA 4AENB 2FX9H 2GTWB 4ISVA 4PRNA 4R96B 3RVXC 4B9ZA 2QV2A 3UZEC 4GW4B 4YSSA 4A67A 5FOJA 4KOBA 3JV4A 3MJ9A 1RJCA 4LU5H 3LKSA 4J2XA 2Q20A 1E2VA 2C7FA 2Y9RT 1D9KC 5AVWB 3SY0B 2WP3T 1QWNA 4Z3EA 7FABH 1VF5C 1CMOA 2GBUA 2OTWA 4YDNA 2WUCL 2XWDA 2FNBA 4JKMA 4IEFB 2E0PA 3E9TA 4M29A 4WU5A 1U91A 3D0LA 4KJQC 6FABH 3CZSA 4NM8L 3BIKA 2SEBB 2DD8H 3M1OA 1DVTA 4X4MA 3CX5K 5F7HA 3AREA 5D8JL 4EUPH 4PUBL 3WE6B 4JE4B 4WUUB 4K07A 3GB7B 3VG0L 2Q86B 1T6VN 4DP9X 4EI5B 4LHUG 3LIZL 2LOEA 3UL4A 4L8SB 4JB9L 1NGZA 1CLZL 2A1WL 2WJ5A 4IKKA 4JHWH 3RFRA 1W0VA 4PR5B 4XRCA 4HDIA 2VC2H 4F80A 2AXGA 4ZFFA 3WN5C 2RIKA 3WUWB 1MCIA 2H47C 4QRSB 2YBRA 4M4RA 4PSRA 1JRHI 1MQKH 4HC1H 1F97A 1FH5H 5B1KA 2W0KA 4N2HA 4XNXL 2Z7UA 2FQFA 5ISZD 2V5YA 3SPJA 3LZNA 1RUQH 3KNBB 5DD0L 1I3UA 2WQAA 3U25A 1KFGA 3QQ9C 5EOTB 3TEUA 3PGCA 3Q1SL 3O4LB 2V9TA 4YPGA 1XSIA 2X5PA 3IFNL 4AZUA 4J27A 4Y1TA 4D9QE 4H0LC 4Y7MA 1F58H 3FQYA 1TNNA 2GI0A 1YJDC 4FKEA 5ISZB 3MNMA 4XCCL 2EIDA 4HAGA 3VFRB 3IFOA 1Y6KR 2D7MA 4M5TA 1Z0MA 3CX2A 4X8XA 1QBMH 1T03L 1A7RL 4NM4L 1KBVA 2WO2B 4PJDF 4AYID 4KTYA 1F3JB 3KPTA 3WCYA 1NIDA 3R18A 4I18C 2NX5B 4F1ZA 1MVYA 2DLIA 4M56A 4BA0A 1Z9MA 3L1EA 5C0AA 1RZFL 1EFXD 1MVUB 2WXMA 4IJ3C 4EN3D 3IGAB 4Y88A 2C9QA 1S9WB 1SM3H 3ELQA 4AQEB 4EE2A 4XNUL 5IROA 1DBJH 4Q14A 1DJIA 4LPUA 5DGQA 2NY0D 3FTWA 1J1OL 4GT0A 3OQRA 3MV8B 1QLRA 4NAMA 2B14A 2YRBA 3IMWA 3KBPA 5IG7A 2DM4A 2EE3A 2JJWA 4G9FD 5F6HI 5JNYA 5SX4H 1F4XL 5ITBH 2RR3A 1CF8H 5K9QG 5DYOA 4HZLA 1IAIM 2E7DA 2OMTA 1JZFA 1JXKA 5I6XC 2BVQA 3GMLB 2VIRA 5LLIC 3NEEA 1N0XH 3DDFA 4U4IA 4HK0B 4XOBA 5EFIA 1PZ5A 2Q3ZA 1U36A 3FHQA 2BM3A 4MDJA 5DEJA 3EHBB 3GFUA 3MSPA 4ZQKA 5B39A 3NCEB 4FQ1L 2J56A 4HJSA 4MJ5B 1FNGA 4Y2DB 4X50A 4ZUVA 5LCVH 2BVYA 3TH2T 1QQDB 3M7OA 2QPUA 1GYCA 2EXYC 1UJTA 4L4TA 2EDXA 2HRPH 2CKBB 5DHVH 5DEFA 1SHWA 3CPLA 1XF4A 1DL7H 3CXDL 4XPGL 5K1JA 4QRPB 1FFOB 3MBEB 3WIHL 3VGAC 1KB9K 1MKFA 1O7VA 2CO7B 2WPGA 5EZLA 4IOSA 3DO7A 3CDGA 4UQEA 4AL8L 1WWBX 1DVZA 1QRKA 5F9OH 5DYFA 1E6OL 1DBAL 2F19H 2IOIA 3PWPD 3ZDZE 3S88L 4GEJA 1SUJA 5DUJA 1G7JA 1K6QL 4JPVL 4TLSA 5F97E 1GPOL 5KYYA 3WJMB 1BFVL 2B59A 3L17A 4J6RH 3DROA 3UBXA 3WSQL 1U8QA 5DQJB 5EBWB 3M6DA 4J3OF 4FXGA 5TF0A 4ZODA 2HRGA 4Z3TA 1E4KC 1TCMA 4OJYA 3H2WA 1Q9LA 5MEQB 3ZL1A 1U2YA 2QKSA 4HETA 1D5IL 5EC1A 2V8LA 1QRNE 3FOLA 3A0OA 2I25N 5J3HC 5HDQH 3K71B 4PIRF 4GSDH 5GS1C 1VFUA 2F5BH 5FW6A 1MZZA 2ARJB 4GXVH 5I1DA 4AKQA 2XN1A 1YZZA 4N0UE 1EHKB 4R7NB 3E6FA 4Y4FD 4QHMA 1T04A 3TO2A 2ZWYA 4OLEA 3FT3B 2BSCA 2F74B 4NRZB 3V6ZA 2Y36H 5E9DD 5HSFA 2GSIB 1HHIB 1L9RA 2O5ZL 3TEXA 1UWXK 1TYRA 3O3EA 5C7XL 4HUCA 3JV5A 1E4HA 1UJ3B 2BSTB 2YSSB 3CIAA 3CGTA 4QCIB 2BDNL 2H2PD 1U92A 1ZVHA 3U4BH 4E9TA 5BRZB 4HUMB 4KVNH 2VLJB 3H9SB 5HHOA 2WVTA 5EA0L 3GLZA 4DGYL 1OSPL 1HKFA 4UANA 5JXAH 2J5LB 1P7KA 4W9ZA 2IDSA 4O2FA 3EH5B 1L7IL 3R4DA 4OJFL 5ICXB 2VLMD 4JFYB 4XCFH 1ZRUA 4LHUD 4MJIA 3FCTB 1PLGL 1TJGH 3U0TB 5KYWA 3FB8A 1SXNA 3DUUA 1XBRA 1YDPA 2FJFA 1U3HA 1X5AA 4I3SL 1R24B 1TYJA 1Q94B 1NFDE 4CVUA 1F1AA 1WHOA 5DZNA 1HYSD 4XO4A 4XXDA 4DCQA 1ADQL 2A5UA 4X5QA 5GZND 1HWGB 3KPMA 3NCJL 2Q9OA 5DD5H 4NS0A 1NCWL 3JQOB 4YDJA 3VDBA 3QFDB 4HUVB 5DRZB 3GMMB 3WO4B 2OMUB 5BV7H 1BIHA 1FNLA 2PABA 5FFLA 1KJ3L 1S78C 1I31A 5F1NA 1HZLA 2PYED 5F1OB 4LCWA 2YBGA 1KV3A 3US1A 5FV1L 2DI7A 5K93A 1KGWA 1JS4A 4ABUA 3LPWA 3MUGB 3LY6A 4FG4A 4HS3A 4NPJA 5E5MB 3QJOA 4FQHB 3GXMA 4PV8B 1MCOH 4YK4B 5LQBL 4GQ9L 1M42A 1WT5A 3VW3H 1H0DB 3VVVA 2ENPA 5IUSA 2YEZB 1IFHL 2ZWLT 4EF3A 1JV2A 1RL1A 4RMQA 3LXCA 4KTEH 5HHPA 4KWUA 1K5NB 2W9EL 5FB8A 3BWSA 4OT1H 2R83A 3CVIH 4KFMA 1OGAB 3SO3C 4BGDA 4GUPA 1NM4A 4E9XA 1YJDL 3P4LA 1XXDC 4K71C 1KNOB 4Y4HB 4JRWA 2EKSA 4DN3H 1I7RB 2VJXA 3CSTA 3K0YA 3M86A 4LOUC 1FORL 5T1LB 4A7SA 2O4EA 3KPOB 1NCTA 4X7TA 5C0FA 1A1NB 1T66D 3MGTB 2WWKO 2ZQKA 1RXLA 3GHBH 4JN1L 1V7NL 1OK8A 3DX7A 4OJDH 3V7MA 5KSVA 5CR1A 1F8TH 3UX9B 4ZOCA 3T09A 1DP0A 5C7ZA 3EXLA 3DVNA 2O5NA 1KN2H 1SEQH 1ZSDA 1QWUA 1JE6A 3DSNB 4P2QD 4LASH 3SBQA 3SBRA 3M1CA 4ABQA 1WP6A 2CDGB 3OD3A 1KENH 5DHXB 1FVDB 1CYWA 1I8KA 2GJZA 4AQZA 5GIRB 3ULVF 3RZCA 3B7RL 4R8WL 4QYAA 1YEJH 2NTSP 2YWZA 4NOBA 1U8PB 4H1LB 2WKGA 5AVQB 1VFOA 5K33A 1IL1B 2CHZA 1IKFL 3PREA 4IKIA 4RMRA 4OGXL 3X12B 1HL5A 5L8LB 2IC2A 1NCHA 4AYSA 2VKXA 4WO4D 2XN9D 1ZE3C 1Z0NA 4L0ZA 2VDNB 1MW3A 3QORD 2J2ZB 1BD2A 4LF3A 1RQ5A 4QJ3B 2IQ9L 1ZHKB 5FUZH 5CJOH 4BH7A 1AS8A 4PJHE 4NN5C 5AOLA 5CBAA 3W37A 1R3KA 2YAFA 1DLHA 3MJ9L 4WO4B 1M53A 1A6AB 3AAZA 1VSCA 3HNSH 4P5TB 4WLCA 5K5YA 4WV1B 1NBYB 2GHWB 3X2QB 3QWRD 3IWVA 3A4FA 2OYKA 5C3TA 3O3BB 1EGJL 1YN6A 2IDQA 4Y16A 4CJ1A 5HYIA 1IMHC 1FCCA 3MV01 3EXJA 3WXWH 3TYFA 4KMTH 2FUQA 2ARJA 4Y19E 4OD2A 3QPQC 2XZQH 3B9KB 4H1LH 5DZVA 1OAXH 5DO2D 5JMRA 3JVFC 3JWNE 4YUEL 4XPFL 3ARFB 1T4WA 3L5HA 4UBDD 1NOAA 5BOJA 1GSMA 3U0PB 3CVHH 3FT4B 2JJSA