1MG2C

Mutation of alpha phe55 of methylamine dehydrogenase alters the reorganization energy and electronic coupling for its electron transfer reaction with amicyanin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
105
structure length
105
Chain Sequence
b'DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine dehydrogenase, heavy chain
publication title MUTATION OF AlPHA PHE55 OF METHYLAMINE DEHYDROGENASE ALTERS THE REORGANIZATION ENERGY AND ELECTRONIC COUPLING FOR ITS ELECTRON TRANSFER REACTION WITH AMICYANIN
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase
total genus 25
structure length 105
sequence length 105
chains with identical sequence G, K, O
ec nomenclature
pdb deposition date 2002-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1mg2C00
1BXVA 3V9CA 3ABLB 2VSMB 1JXDA 1NINA 3WKPA 4BXSV 3IE9A 5LDUA 3AG2B 1N68A 1V55B 4DP1X 1J5DA 1ET5A 2FQEA 3SBPA 5D4IA 1BQKA 1KCBA 2QPDB 1J9RA 4TXVB 2HLEB 2GBAA 3RYMA 2H5UA 1WS8A 2YAHA 3T6WA 2ZONA 2OV0A 1VLXA 1OE2A 2VMJA 2ZXWB 5F7BA 3X1BA 4YSCA 4HALA 2OJ1A 1PZCA 1V10A 4Q89A 2IDUA 2BO0A 2FQFA 3QJRB 4G71B 3S3BB 2PLTA 1HFUA 2H3XC 2XLLA 3NSFA 2DWTA 4G72B 1AG0A 1GY1A 1JVLA 3ASOB 3CDZA 3NSYA 2XV3A 1EZLA 1URIA 5F7AA 1RZQA 5B7FA 1W6LA 3EF4A 1NWPA 1A4BA 4A2EA 4DP0X 2PP9A 4BDVA 1TEGA 3FPXA 4DP5X 2UX7A 2OCCB 2FT6A 1OE3A 5TK2A 1JZHA 1KBWA 2IDQA 3G5WA 4JHVA 3NJJA 1PMYA 2EIKB 3IBOA 2XXFA 2J56A 4F2EA 2DV6A 3GDCA 3NSDA 3EH5B 3NJNA 2HZHA 2XU9A 4AI7A 2EINB 2JXMA 2J5WA 3TU6A 1NPNA 1NDTA 3TASA 3CVBA 1GS7A 3H4HA 4BXVA 2QT6A 2ZOOA 2IH8A 2AZAA 3GXUB 3FYIB 1E65A 3NP3A 1W8EA 3FU8A 9PCYA 4DP4X 3NJFA 5I6LA 2YXWA 1IUZA 2IDSA 1L9PA 2CAKA 1ET8A 3FQ2A 4AKOA 3FYEB 5IY5B 1BYOA 1I53A 2FJSA 4NERA 4M3HA 1QHQA 3C75A 5ANHA 1AIZA 2VM3A 1JVOA 1MG2C 2WSDA 3FU7B 1DZ0A 5B1BB 1X9RA 4E9RA 1CURA 1NICA 3ZBMA 3UADA 1ZDQA 3PPSA 4UAHA 2J57A 2PPEA 1GY2A 3UAEA 4AKPA 3UAAA 4W9ZA 1E67A 1AZRA 2IWEA 4AZUA 4F2FA 1JOIA 1FFTB 1ADWA 4P5RA 2BP8A 2ZWNA 3JT2A 3N55A 3T6XA 2R7EA 1JZGA 1KCWA 1PY0A 1L9QA 3OD3A 3QJVB 1AOZA 3NJKA 3NYKA 1FWXA 5D4HA 4GP5B 4HIPA 1NZRA 1A8ZA 3WIAA 2YAMA 4L0PB 3KW7A 2P80A 1NIFA 1M57B 3H4FA 1NTDA 2CCWA 3X1EA 3FSVA 3WG7B 2QPEB 3ABGA 4K9JA 1MZYA 1BXUA 4MFHA 2XXGA 4YVUA 1OV8A 5I5MA 1W6WA 2B3IA 2BZCA 3S3CB 4G70B 1N70A 3SBRA 1WA0X 1HAUA 3AW5A 1NIAA 3EHBB 1KGYE 2BWIA 3OMIB 3FSAA 4HHGA 1NWOA 5TK4A 3HB3B 1NIBA 4A67A 1OE1A 2I7OA 3WNIA 3DTUB 3X1GA 4KO9A 3S8GB 8PAZA 5D4JA 3AG1B 1SFHA 3X1FA 3ZIYA 3D12B 5B3SB 1IBYA 2PCFA 4WTQA 2EILB 1GYCA 1PNCA 2BP0B 4DP6X 4YSDA 5B1JA 3NJHA 1KDJA 1M9WA 5B1JC 3PLYA 1GS6X 2E86A 4E9VA 1GSKA 4N4YB 4YL4A 1NPJA 1BQRA 2GC7C 2IH9A 3NP4A 1TEFA 2BWDA 3MBWB 3S8FB 4KOBA 3BVDB 2Y69B 4BDVB 3N2JA 1MDAA 4AX3A 1PLCA 1E30A 3IEAA 3U25A 1AZNA 3AG3B 3ZDWA 1A4AA 2HRGA 3AG4B 1GW0A 2QDVA 2FQDA 5AKRA 4YSEA 1SF5A 2UXGA 4JKNA 4BWWA 2X88A 3CZUB 3EH3B 2AFNA 4YSSA 3IN0A 5E9NA 3NJLA 1FA4A 3OMAB 5I26A 1AZCA 1KYAA 1V54B 4PCYA 1L9SA 4YVNA 4EF3A 5I5IA 2YAOA 4UANA 4A2FA 1WS7A 2BW5A 4N8UA 1PZBA 3FS9A 2IDFA 1OF0A 2VN3A 1OCZB 1ZV2A 3CVDA 4DPCX 1ZPUA 4WKXA 4FAAB 4UF7C 2QDWA 5B1KA 3FU9A 5B7MA 1T5KA 1J9TA 2PPAA 1RZPA 1JXGA 1GS8A 4PAZA 2H47C 1JZFA 3BQVA 3TA4D 1GR7A 2YAQA 1SDDA 3QQXA 4YSAA 4GY4A 1WA1X 4NAJA 2UXVA 2I7SA 4HCIA 3UACA 6PCYA 4YSTA 1L9OA 2BP8B 3L45A 2PCYA 1OCRB 1XB3A 2FNWA 2GI0A 2GHZA 3NJMA 5I6PA 2FT7A 2Y1AA 3FT0A 4X4KA 2I85A 1XB8A 1PLAA 1ZDSA 4GXFA 1ILUA 2YQBA 3ABKB 1AG6A 4CSPA 3QJTB 3JTBA 4BWUA 2GC4C 1SNRA 1SHXA 1J9QA 2MTAA 2BW4A 1IKOP 1ILSA 5FC9A 1CC3A 4DP2X 3UGEA 4NB7A 2VW6A 4JHUA 4E9QA 2TSBA 1BXAA 4DPBX 3PXLA 1AQ8A 1CUOA 2HRHA 4E9SA 1B3IA 4KNTA 5I6NA 4ZK8A 2TSAA 3ABMB 1ZIBA 2EIJB 5AZUA 2CBPA 2CUAA 4YSPA 4DPAX 1HAWA 4GP4B 2WO3B 2CJ3A 3CVCA 1QNIA 1OCOB 2YAFA 5I5JA 4QLWA 2Q9OA 1ASPA 4DP8X 5EHFA 1AAJA 7PCYA 3X1NA 5I6KA 1OCCB 4KNUA 2CALA 3AZUA 1JXFA 3X2QB 5PAZA 2BZ7A 4GYBA 2VW4A 3ZX1A 7PAZA 1SFDA 4ENZA 2VW7A 3DIVA 2XX1A 1ASQA 3PCYA 1KBVA 3EH4B 4P5SA 2X87A 3CDZB 1DYZA 1PCSA 1AACA 4KO6A 3FQ1A 2IAAC 4A68A 3DKHA 5I28A 3PAUA 2DWSA 1JZJA 2P80D 2NRDA 2WO2B 1TU2A 1L9RA 1YLBB 3KW8A 5A7EA 3QPKA 1PNDA 4A2GA 3T71A 4DP9X 2VM4A 1SF3A 3SBQA 1E5ZA 2XV0A 3WNJA 1PF3A 4E9YA 1X9UA 5I6OA 4A66A 2BP0A 1RCYA 2IWKA 1A65A 4HAKA 2JFCA 1BAWA 1QLEB 5AFAA 1PAZA 1M56B 2UXTA 1J5CA 6PAZA 2YAPA 3TBBA 1MG3C 2AZUA 4M4RB 1ETJA 2XV2A 1J9SA 2IDTA 2B08A 2YARA 1OOWA 1E5YA 3OQRA 5B7EA 4RH4A 3NSCA 4E9TA 3ERXA 3NT0A 1ID2A 3QJSB 3V9EA 1AS6A 2AVFA 4A2HA 3T6ZA 2GIMA 3WI9A 1WAEA 2GB2A 1AS7A 2XWZA 2FQGA 2JKWA 3IN2A 2AANA 4YSUA 4BK5C 1NIDA 2J55A 4BWTA 4HHWA 2PPDA 1SDDB 3H56A 1EHKB 3NJIA 5B1AB 1KV7A 1SJMA 1L9TA 2PPFA 2LLNA 2A3TA 2FTAA 2DY2A 2W88A 4HCFA 1ASOA 2FT8A 4FA7B 1JZEA 1XB6A 4G7RB 2HX9A 2XYBA 3NJGA 1PLBA 1F56A 4GP8B 3T6VA 3MX0B 2R7EB 2PP7A 1AR1B 3QJQB 1A3ZA 2BHFA 3FSWA 1IC0A 4QKTA 1AANA 2XX0A 3PAVA 4KOCA 3QJUB 1JERA 2W8CA 4G7QB 1MZZA 4W1TA 1A4CA 1JZIA 3AY2A 3GYRA 1PZAA 1TKWA 2XVBA 1BEXA 1CYWA 4DP7X 4F7KA 2UXFA 1RKRA 3FU7A 3S3DB 2N0MA 3UABA 4YSRA 1ZIAA 3PAZA 2Q5BA 3FQYA 3FSZA 1BYPA 2MRYA 3OM3B 2EIMB 2DYSB 2RACA 3TBCA 2GSMB 4G7SB 4E9XA 1KDIA 3ASNB 1CYXA 1NIEA 3WKQA 1XMEB 4HZ1A 4AKQA 2FWLB 2HX7A 1IBZA 4YSOA 2DYRB 1AZBA 2IWFA 4YSQA 5I6MA 2XUWA 3SQRA 1SHWA 2PP8A 1AZUA 3HEIB 1AS8A 5PCYA 4CSZA 2UX6A 3T9WA 3CG8A 4HCGA 3OMNB 4A2DA 1WA2X 4KO5A 2PPCA 2YXVA 4KNSA 4E9WA 1R1CA 1BQ5A 2HX8A 2HXAA 2VSKB 1ET7A 4Q8BA 2YAEA 4KO7A 1UATA 3FPYA
chains in the Genus database with same CATH superfamily
2G5BB 3ABLB 4H1LB 1II4E 2B1OA 3IMSA 4LAQL 1DBML 5CEZL 3FQNA 3FUFA 3QB7C 4JQIA 5JHDA 5HHNA 1IGMH 1UHVA 5SWQA 4AYGA 2H1XA 1GHFL 2JK5B 3VD9A 4UT6L 2NX5D 5AVYB 2H26B 4P23A 2MWCA 1A9VA 5IESL 2H5UA 1WS8A 2CBOA 2DYPA 4HA1A 4PJCB 5AYQA 3B56A 4F7EB 2BINA 1OE2A 2QADC 2VMJA 2HWZL 4RRPA 3T6QC 2YEQA 1QTSA 4ZFOB 1IBBA 2BVQB 1INEL 2AC0A 3ZT7A 1CXIA 4J3VA 4AITA 1G6RA 4XC1H 4ZQTA 5BRQA 2B9BA 2MNJB 5AAWC 2B1AH 3QUYA 5E5RB 4U1NB 3V0GA 5KW9L 5IHUL 2DWTA 1RFDH 2DQCH 2P4AB 3QQDB 1C5DA 5C7XH 4N8VG 4WRLA 3FO1B 3DC0A 3IMUA 1PZ5B 2YMXH 3L6FA 3HAEH 4A6YH 3K7UA 3ZL4H 1UXSB 2X53A 3VG9B 3ATEA 2XCMC 2BVTA 1OE3A 2WB7A 3FMGL 2OTWB 4NEHB 4NP4L 1EJ8A 3G5WA 1RP8A 1UXWB 5JXEC 1P7BA 1I7UA 2O5ZH 5E99L 4XNYL 2J56A 5ILTL 3K81A 5IHZA 5AB9A 1KG0B 3NAAH 3RRQA 3LEYH 3PV6B 3AROA 5EN2A 1BZ9A 1AD0B 3UG5A 2J1XA 2VH5H 4XN8A 5AW7B 1JMXA 1OZTG 4PRDB 3O3DB 3N0AA 2BP3A 5KSBA 1DEEB 3EHBD 4MXWL 1J8KA 4ZUVA 4GRLC 5ESQA 1FFOB 3VXRB 1IGFL 2X4UB 4UM8B 4Y5YA 3H54A 1EFXA 2N59A 3P0YL 2GK0A 4PRPB 2XQYK 3FU8A 2VXQL 1PL3A 4KJPD 2CU9A 5GHWL 1U8LA 2SODB 3HS0B 2V2TB 4GSRA 4XH2A 3RJDA 5F0LB 2E46A 3UAJD 2R4RH 5H37H 3GSNH 1RIUH 4Y4FA 4Y19E 3ISYA 4ZPTA 3PHOA 4XBGB 4NERA 4JK0D 1NUFA 4O4YL 1G7MA 4FQQB 3DVGA 2Y07L 4P3CL 4RFEA 1I3UA 3MROB 1B9ZA 4IOSD 4KAQL 2EE0A 1X5ZA 4KRNA 4YDZA 5LCVL 1FHGA 4HWBL 4X5WB 3RVXD 1P4IL 3GXPA 3SE9H 3EGDB 2VQ1B 3TEXA 3ZTJG 4DKFL 1O9ZA 5EZPA 4U05A 3WJJC 3GSWA 4KDWA 2F53D 2XKNB 2NY3C 3VXSB 5FYLE 1N4XH 1J11A 3KH3A 3TJHC 4ZMNA 3GJFB 4JFOA 3MUUA 4K7PH 3CN0A 5C8JB 1M3IA 2Z31A 3GWJA 4U1KB 5EWIL 1AOZA 4MJIE 4DZ8A 2CHZA 3VU1A 5JIMA 2ZX9A 3PFUA 4TSBH 1DP0A 1WJ3A 3IJ7A 4PRHE 3U9UA 1XF2A 4L8CB 2DQIH 4TVPD 1N59B 4ALAL 5DQDH 3GTVA 2BVUA 4LLUA 1YQVH 1FN4A 4YR6A 4UT9H 3UDWA 5KANG 3S37H 3EFFB 1C16A 5E8PA 2DLFL 4JANB 1FH5L 3SGDI 2AK4B 2FLRT 3O8XD 4UYQA 5KVGE 1A0QH 1OGAB 2FEDC 3A67L 4P5TA 5CBEA 3FQWA 2B16A 3WMPA 1UGNA 2X42A 3KPQB 4KTEH 3QQNA 4X4ME 1KTJA 4LSSL 4G1EA 2JJSC 4PJXA 5IEHB 2C7FA 2VZOA 1KBPA 2R69L 2AJYH 5SWSD 3IKCB 1CDYA 1A3RL 3VI4A 1N3NB 4LVNC 1KPRB 1NMAL 3RY6A 4AVKA 1CZ8H 3U7WH 2QSQA 1KDJA 1WT5A 2JKJA 1O7DE 4KVNH 3D18B 1UOKA 4F8QA 3PF2A 3APMA 4U7MA 3ETTA 1AMXA 3IDGA 1VZHA 4NC1E 1F6FB 5JXAH 3Q13A 2MHAB 3KLAA 4RAVB 4JFVA 5ALCL 3BQUD 5E9DA 1DHKA 3DSFL 2JH2A 3BLKA 4U3XA 4HU2A 3BGAA 1WGVA 4BDVB 1P1ZA 3VCLB 1D5RA 2W9EH 4X6CB 3VB8A 1KEGL 3RWHA 5D7LB 2FYYB 1OTTD 3EYQD 3BKML 4BSVA 5DFVD 4Y4KB 1UYWL 1ZV5A 4UDTA 1GW0A 2QDVA 4X7DC 3MJ9H 4MX7B 1CLZH 4GS7B 4XVOA 3VFRA 4Z7VA 3I85A 2WTPA 1KIQB 1A02N 3OHXC 4JFTA 4QRFA 5MP6L 4FE9A 3C6LC 1MIEL 4PR5B 5DI8A 4MMXC 3FAWA 4P2QE 4PJBF 3VMNA 2BY3A 4K3JL 4BJLA 2QGDA 5E8NA 2P47B 1E4WH 1PAMA 2IMMA 3EFDL 1MEXH 3CC1A 4K23H 1ZJBA 1NL0H 2RIKA 4ZUTB 2XZCH 4R7VA 5TE6H 4W9FC 5DDHB 2I27N 3JUYA 3KBHE 4ZO7A 4P3WA 3TNMB 2H47C 1XF4A 3U46A 3DROA 2WP3T 3VX0A 2OMZA 3RIAF 3JTSB 3KBFA 2Q10A 5GXBB 5HYEA 5T3ZE 4IBUA 2P5PA 5MI0B 3D0LB 4FQ2L 3OSKA 5IMLB 3O45A 3BEWA 3L3JA 5IG7B 2HJLA 3DX3A 3Q48A 4M1CC 4EBQL 5KYWA 5T3XE 4EUPG 1YY8A 2Z0UA 2E3VA 5TDPA 3WN6A 4JHAL 1T22A 3PWPD 3PHSA 4KQ0A 4Z7QF 2ZYHA 2GQHA 2ZT9C 3CLEL 4JZJA 5D71L 3US9A 2Y23A 3JWOC 3JTBA 3UYPA 4F57L 5I30L 2VC2L 1EDQA 5ETUA 1K4CA 4JZNA 4P06A 4AYFA 2OTPA 4YGVA 3C8KB 5DJ0B 3UO1H 4TSCL 2HJKB 2I26N 3UX9B 4I18B 4ODHL 1Q1JH 1NEZG 4W68A 5JO5A 1B3IA 4KNTA 4OD3L 2VDML 4N68A 1MNUL 1W8OA 3BOVA 4NO3A 1U8OB 1EJOH 3LEVH 2QHLA 4PJ7E 4X6FB 3ZTDC 3KLHD 3LKOB 4PCTA 4WWPA 4JJOA 1FC2D 3I3BA 4AW4A 5FKPB 3VSUA 4MNQA 3RVWC 1OEZW 2CJ3A 3CVCA 3PWVB 4UTBL 1MCOH 2YSSA 3WUWB 3X17A 2WLYA 3WIHH 1OCOB 2G2NA 1NC4A 4RMSA 4AZ8A 4U1IA 2XFXA 1QWHA 2CUIA 1P4LB 1Q9WB 5CN1A 4F7TB 2C3VB 1ZTXE 3TYGH 4X9GA 3MGAA 1QVOA 5FM5O 1B4JH 3PWNA 4H7VA 2P24A 1E6JH 3FBQA 1F86A 4ZQKB 5BOZG 4H0GA 3AADB 2PETA 1QNZL 2VTFA 3H3KA 3FCBA 1ZLUH 5CD5D 1OT2A 3IMBA 1YPZF 3IETB 3ZXAC 2NY0B 5KVFL 5CILH 4UINL 3KXFB 4L4VB 4JFFB 4AM0B 4K7PX 1EO8H 1KPVB 4HKJB 2H8PB 1PLGH 4J3UA 5DFTA 2R8SH 2AI0L 5IFJA 4XWGL 1T21B 3QK0A 5HHQB 4YUEL 5I19H 4P5KB 2C1OB 3ZTJH 4LLYB 1JZJA 4PJHF 5GRUH 3QXVA 4ISVB 2NDFA 5CEXA 5GZOA 3SE8L 1HXMB 5IB3A 2YGNA 3ILEA 3BAIA 4ODWB 5E4EC 2MCPH 2ZUXA 4MA8L 3BP5A 4FYQA 1JVKA 4HS6A 4OAWA 5BS0E 3SPIA 4PRBA 1KGWA 3P4OB 4GUPA 2WK2A 4O5LL 4WHYG 4KUZH 4ABWA 3Q7JA 1EMTL 5FO8B 1Q38A 4I4WA 3S37X 1RAMA 1PPIA 2Z8RA 2AITA 2YAPA 5D5ME 3AS1A 4NFCA 4EN3C 4O2EB 3ABZA 3MBEB 3MUJA 2OQJA 1A1NB 3MBWA 1EIBA 1OARL 3U9WA 1BF8A 1SMDA 2DLIA 3GNMH 5LXVA 1AD9B 1LEGB 2J25A 5DF0A 4PJIA 2AVFA 4L4TB 5A2CA 5JHLL 4LVOB 3QG7L 4AUUA 3MNMA 3D39A 4N1HB 2XWZA 2ZE0A 3BUPA 2X2JA 1AIFA 2WANA 4G8FA 4CAGA 2ESVA 1OTUD 3ECBA 4OQTA 4O9HH 1NH6A 4JJHA 4XNXH 5AZ2L 4AOFA 1SJMA 3KVPA 4IIQB 4NX0A 5C92A 1QBAA 1EEZA 3V5DA 4LOUC 1UB5A 4ELMA 4U1LB 1NFDE 4HEME 3X3GL 2VDKB 1B0IA 2D03L 2KLSA 2EEXA 5CEZE 5EO9B 2CM6A 2BCKA 3EYUL 1IC0A 3PL6C 3ZR5A 2YMTA 4EIZC 3MRRA 5T1LA 4IBLT 3SDCA 2W0FA 3UERA 2X12A 4TULH 5C0CE 4JN1L 2A6DA 3KPTA 3MJ7B 4WI5A 2O6EA 4UTAL 2FBRA 3VWJB 3BXNA 3FF8A 3QI9B 4W1TA 4PJFE 4YN3A 3QRGH 5FYKU 3UYOD 4ATWA 3D30A 3HE7B 2JLLA 1CYWA 3FU7A 4NZRH 1FZKA 1RVFH 4WI4A 3FH5A 4OM1L 3JV6B 3PWJB 4PRNB 3HA0A 3S5LA 2ISDA 2HN7B 3JV4B 2HJFB 1C5BL 4B95C 2WUCL 3EBIA 1AQDB 1FV1A 4U6YA 4LGSB 1JZ7A 4HFUH 4XNBA 4Z0BL 5BQ7A 2F7OA 2FR4A 3S96A 5IFHL 1H15A 3MRKB 5CM1A 4WKZA 3FUJA 1RUQL 2ZIDA 2H3NA 3WY4A 3EO0B 4ZUSB 1IGYB 1WA2X 1WG3A 3IBEA 3WFEH 2FECI 1KLGB 5AUMB 4PMEA 1OPGL 2FJUB 3VXRD 3F6LA 1IKFL 3DXAA 4NLHA 4PJ6A 3V10A 4LSRH 1LEIB 2YC1A 2A4EA 3LPGA 3WD5H 3TWYA 4JPWH 3FFCB 4N2AA 3MC0A 1K85A 4M6OL 2OSXA 5ACZA 1YEDA 1TTRA 2GTZA 3BP6A 2CLZA 4ZMAT 4K5NA 4Z7NB 1A64A 3OKMA 5HY9B 3TVMD 1QRKA 5GJTL 4FXGB 2AJUL 1OAQL 2EEBA 4OJFH 3NK4A 2RFXA 4GBXB 1JGEA 4WHCA 4WV1B 5DZLA 1F42A 4YHZH 4AMKH 2Z0BA 4LPXA 4X0NA 1V8HA 2ZWLT 2IALA 3CLFH 4K9EL 1I1YA 3MNWB 4TSAL 4X98A 4OT1H 2FHCA 3QIWC 1YEIH 1EEUA 3CHSA 3LOWA 1ZLDA 2XBDA 4ZUWA 1KGCD 2JIXA 4HIHA 4WNSA 4K8RH 3VXSD 1EK3A 1WO2A 5DVPA 2HG5B 4OUOA 3VD5A 2XSKA 3FH8A 2C3XA 2QPFA 2BIPA 4LP5A 4OTXH 5T5NF 4G72B 1RZKL 1ZT7B 4FJ6A 3QAQA 1CFBA 1UJ3C 4G6FD 2NW3B 1FGNL 2NW2B 1ZK9A 4ZAKA 5F7LB 3IDYC 4NYLB 3PXHA 3DO7B 3QHZH 4EI5B 2PP9A 3P2TA 2W5PA 3MAWA 3S36L 1ES0B 1S9XB 3NZHL 4RGNE 4H0LC 4HIXL 4Z3EA 1KXQE 2AQ1A 2BFVH 3BKCH 1S7VA 2J6EL 2B5IC 4HIIB 1EJ6A 1QRNB 5AOIA 5GGTH 3QDJA 4EMZA 3VGHA 2HZHA 1E7UA 2EINB 1UEYA 2AJXH 4GW4B 3RTQC 1TZAA 4RX4A 2IANB 2NY5H 4R7XA 1F8TL 4M4RA 2ZUWA 3BZ5A 5IROD 1MCCA 1UM4L 4HOMA 4N2MA 2QKIB 2NLJA 4ONFL 5DT1H 4KKAC 1E65A 4PSRA 4Y19B 1OK8A 4YK4C 4AL8C 1SBSL 4N8CH 5IR1A 1AGBA 4E41A 5LN8A 2LU5A 4NUGL 5T5FH 2YN3A 4JPVL 4JO3L 4CUCA 2C26A 3N91A 4NO0B 2L8AA 3VXTB 3ULVD 1JDAA 4FQCH 4MQTB 1AR2A 1JAEA 1AHWB 1GZQB 4IQHA 1OP3H 4M3HA 5GIRB 1DN2A 5HGHA 2WSDA 1YQ2A 2VLKE 4ZS7L 4LVEA 3DMMA 2AJZA 2F8VA 3DV6A 4TL5A 4OGAC 5LGHH 5I24A 4QMEA 4XWOC 4XOAA 3UADA 2ZXDA 3UAEA 5DO2C 2J57A 1YSOA 3WMSA 4ZW3A 2CUMA 4PS7A 3C60A 3MKGA 4EE2A 5DJDA 4M93C 4ORZC 1N64L 3QPXL 5E5MA 5EU5B 1G1CA 1T7VA 3SOBH 2R0WH 1E6OL 1JWSA 4MS8C 3X11A 4PS4L 5CWSB 4TRPL 1D5ZB 3NCFB 2KL6A 2F74A 1KXVA 1WAAA 1HI6A 5J7CC 2GUOA 2AJVH 4W70A 3RGHA 1F3DH 3GGWA 1AXTH 4HZLB 4Y4KD 1FVDA 2CKNA 4HDIA 3C2AH 4R26L 1HHHB 25C8L 3RU8L 1JI1A 3FTXA 1F1GA 3U6XS 2EC8A 4BIKA 5AB2A 1TXKA 3HZKA 4XVUD 1IO4C 4ELDA 4K94H 5BZDB 1UM6L 5JHDB 1EJFA 5DRXA 5HHNB 1TFHA 2BZCA 2P8LA 5SWQB 4LHUA 4RVBA 3T77A 4CC4C 1BJ1J 5FGRA 2HSIA 3B7SA 5C08B 1T0MA 1U3JA 4HJGB 3REWA 1SJXA 4HFWA 3FQ4A 4RFOL 3QHFH 2GT9A 3K6IA 4WU5B 2D3NA 1IGML 3W0WD 5FHAL 5EPMA 1SM3L 5D2LB 4QRUB 1X3DA 5IREA 3HMWL 3D0VA 3MNVA 3FTYA 3JVGC 3O4OC 4V11A 3TOPA 3K8MA 2WV3A 4LB8A 4BE6A 1UM5H 5AZEH 2UZYB 3APNA 5J56B 2AQ3A 4PU2A 1G6RB 4GEJA 4OKDA 3TL5A 4O02L 2ZYRA 4LCWA 1JGLL 1T7WA 4ONHA 1Z9LA 3L7EB 3IFPB 5F7FA 1RIVH 1NAKL 2ZNXA 1QFWH 4XC1L 1NGPL 1FO0H 2IH3B 4NZDA 3LQAC 4M5YH 2E9IA 2DW5A 1TCMA 1OM3H 1RFDL 2PO6B 3UC0H 2CR3A 1HINH 4ETQB 3BSGA 4AX3A 1PLCA 4QRRA 4BFRA 4PMFA 1OGTA 2HKFL 1DBBL 5TDOA 5IHZB 5CD3A 2BRRH 3GB7B 1KCRH 2YMXL 3PDOB 4Y2DB 2Y5QA 1BZ9B 4C56D 1RUPH 4DVRH 3QHTC 4OJAA 3HBZA 4XVTH 3D8MA 4LAJH 2G2RB 4UBDC 4HMEA 4F2ME 3BW9A 1PZ2A 4HCRA 5I1GL 1KTDB 5ESQB 2FJFB 3OMAB 4BFIB 1T83A 3RWFA 5DJ6B 3VFGL 2K9UA 3QEQD 1N10A 4FERA 2GK0B 1QEXA 2VH5L 3L17A 1W72A 3QS3A 4M8QA 4ODSH 3K72A 2NYKA 1C1EL 1BFSA 4YXLH 1BVNP 4FQJL 4XB7A 3RZCB 3GLDA 5ANME 4KGJA 4H8WC 4ZPTB 2XKSA 3PHOB 1T5KA 3O9WC 1J5OL 4CVUA 1WITA 2G9KA 1G7MB 3CBKB 4XC3L 4RFEB 1M2VA 4I0PC 2A9DA 5F7WC 2NY0D 5AOLA 4AEIL 3BT2H 1RIUL 2VN5A 3KXFD 4M5SA 1R47A 1T7ZA 4L4VD 2DLHA 4P49A 4JFFD 4NQSA 5EUKA 3QZMA 3ULUD 3NSJA 4ZI8A 1HSBA 3LNDA 2Z92A 1T20B 2GI0A 2RGSA 3NJMA 4JFOB 3CPUA 4RGMC 1HVXA 4A7TA 3U4BH 3QWOB 4LLMB 3BN9C 1T1WA 3FT0A 3QH3A 4HBCL 5HJ3A 4D9QE 3EFOA 5GZNA 1RUKL 2DIBA 4PIRF 4RAHA 5GS1C 2RQEA 2EUVA 4KK6D 3CXHJ 3U9UB 4LEXL 3ECVA 4YH6A 1L7TL 3DOHA 2BW4A 2P9RA 3QNYB 2HPTA 3U4AA 3UZEA 3LNHA 2FATH 3QDAA 1DQDH 4TUKH 5E4AA 2X3AA 2VZ1A 4O58H 5F7NC 5EMYA 4DPBX 1AYRA 3K4AA 5E8PB 4U1JB 5AYUL 1S5IH 1O7SA 1RQ5A 3TYFA 4PP1C 4JKPL 4P5TB 5DQDL 4N9GB 5GRJH 5CBEB 3FQWB 4UB0L 4L4TD 2D2CC 1AXIB 4U3CA 2A1WH 3CSGA 3WLBA 4L8DA 3E80A 2JB5L 1L0YA 3BQUC 4G1EB 1MIML 4JG0L 1PD1A 3HKFA 5DD3H 3UEZA 4HK0A 4GQ9H 2E7LA 2BNRA 1KPUB 4TQIA 2J8OA 1GZHA 3ZRCC 3B2VL 4JO2H 4WFFD 4AC4A 1A7NL 4KTEL 2L4OA 1HE7A 1MI5A 5D4QA 3QISA 5JIDA 4CU6A 3B2MA 1KN4H 1ZWIA 2ZTBA 3BPLC 5PAZA 4GYBA 4J4PA 4JHWH 3VQ1C 3UZQA 1EA9C 4MBOA 1XCTA 5T5NG 1BZEA 3IDGB 3S3SA 3DVIA 4ANKA 4YAQA 3SGJA 5BV7B 2BSRA 1CZ8L 3APFA 4G9FA 2ICWA 3AS3A 2X1QA 5GS2D 2OR7A 4XMPH 3RIFK 3S3PA 5IW6B 1BBDH 1IC7H 5CGTA 4R4FL 2IAAC 3NTCH 5HI5D 3RWHB 3WFBL 5ITBL 4FLSA 1SN5A 4BSVB 4PSPA 3PG2A 1KJVA 3T71A 3FCSA 4UDTB 1DJHA 2VXSH 2MQGA 2F54E 5L4IA 2XZAL 4GI6A 4UQIM 2R83A 1WEJH 4A66A 1JZ5A 2EYSB 4NRZA 4AGOA 3VFRB 3MXVL 4QXUL 1TPXB 5SWZE 5DVMA 1PZUB 2P1YA 3IDMA 1P0SE 1A8JH 2GTWA 3SSGA 3NESA 2VXVL 2NR6D 2AZUA 1LE9A 4QJ4B 4YFDB 4PHZA 3TH2T 1CLZL 1MFCH 4Y9CA 1OOWA 1CDIA 2KZ1B 4L1TA 3EYVB 1JF1A 2HT4D 5C0GA 4L23A 3MLUH 5CJOL 5E8NB 4Q56A 3EH1A 3U1SL 1JCKA 2NZIA 5EZIH 1WAEA 3A47A 1UH3A 5E9AA 3U46B 4Z6AT 1XF4B 3DROB 2CGRL 2OMZB 4BK5C 5F88A 4GJTB 5IQLA 3FFCD 5KYXA 4XCNB 5B8CC 4L3EE 2XZCL 3W2DH 3O45B 4I1NB 2HJLB 3Q8EA 1MHEA 2LTQB 3FONA 5KYWB 3C5ZB 1C8PA 1EQWA 1DVFD 4HS3A 4JO1L 5DCCA 2LT9A 1YY8B 5C0CB 2W95A 3V0WL 2X0VA 3N85L 4ZSOE 2ZCKH 4CDHA 1P7HL 4GAJL 3OBAA 4PJFB 3CN1A 4LMQE 2XX0A 3WYRA 4FMKA 4YDMA 3TN0A 3KDPB 3SE3C 5HHXH 2OJZH 1DJYA 2W8CA 1K2DB 4Y9FA 4XMUA 5ETUB 2ARJA 3UTTA 1K4CB 1RJLA 3CVIH 4JZNB 5A3ID 5DLML 4AH2A 5F89A 4LLVB 3HI5H 4G1MA 4YGVB 3CVHB 3KPSB 3UABA 4MA3B 1INDH 4OFIA 3TGXA 1NCAH 1JHTA 3BP7A 5JO5B 4S1DD 2WP3O 2EIMB 4DGVH 5AW5B 3OKKA 3EDFA 1T4KA 4PYHA 1IMHC 1XGYH 4CKQA 4YHOL 1GGIL 1NANH 1PDKA 1E3XA 2GY7B 1VEPA 1UCBL 2EXYC 2DF3A 1NBYB 4DJMA 3WNKA 4TNWF 1UEMA 1FLRL 1WWBX 1YAZA 3HZ3A 3ZJAA 2IWFA 1OSPL 2YSSB 3LEVL 1NC4B 3OXSB 4AZ8B 3CC5A 4U1IB 4PJEF 4FKEA 3TZVC 4HULB 5DQ9A 3MLXH 5KEZA 2WBKA 2WMPB 3G6JF 5DC9B 1QRND 3LH2H 1HSAA 5B22A 2K4AA 1QVOB 3PWNB 4A2DA 4KO5A 3D07A 2P24B 5HD8C 4I1RA 1QUNB 4DK3A 4XPTH 1C5CH 4A6YA 2PCFB 3HAEA 2VMCA 4KK9D 4FGMA 2AMGA 2NY4D 5IVXF 3O6LL 3F5WA 3DSNA 5TE4L 1U58A 4PJDF 4TUUA 3KMDA 4IOFC 4WHTB 4Y19D 1A3QA 2K45A 3EOBA 5I16A 5KUMA 5J3HC 4NN6B 5IFJB 1BQKA 4WJ5A 4XMKH 1B0GA 2ZXEB 5K9JL 2HLEB 1JYWA 1JNNL 2FK9A 4L5FL 2DTMH 2VL5A 2J4WL 4QKXB 3UBXB 3OL2A 2JCCF 2OV0A 1DR9A 4IRZH 3TONA 2X6UA 1ZA6A 5FYLD 4U6VL 1D6VH 4GUPB 3OJ2C 5HDBE 1AGDA 4Z76A 3FFOA 3M45A 3X13B 1BGXH 4YZFF 1JGDA 3PNWB 4MJID 3SKJH 3NPSB 5H37A 2NY6D 4I4WB 3GSNA 1TJMA 1RLBA 3QWRD 4AC2A 4G71B 3GKZA 3EBHA 4PRHD 4EN2A 3BDYH 1HHJA 2HMIC 3FHAA 1QPKA 5IQMA 4G42A 4JQIL 1FFRA 3AS0A 4ABUA 2XYCA 3ASOB 3MI6A 4YLCA 4RGNB 4YFLI 4AE0A 3QYNA 3P9MA 1IAIH 4HSCX 5LXGL 3I74A 3T8MA 1A4BA 2ZUYA 2I9LB 4PJIB 4TYUA 4UM9A 3GMNA 3TO4C 4F37F 3H3PH 5IT2H 2IDQA 4QRTA 4G8FB 4QRPA 1WFJA 1Z5HA 2ESVB 3F62A 4DETA 4W4OC 1E8XA 2DV6A 1RU9L 4U1HA 5IZ7A 2WQAA 4UQ3A 1S7QB 2FYVA 1NGXA 3HFML 5EOCL 3ESUF 2J1ZA 5C08D 1R3IH 1PFOA 1EEZB 3D3VE 3V5DB 4L37B 4ELMB 1UB5B 1GS7A 1JYVA 1NGZA 5C86A 4O9HL 1WIPA 2R9HC 3NH7L 1E3FA 1KLFA 4YXHH 3FYIB 2BCKB 1W8EA 2NOYA 2XQ0A 3U0TA 1E27A 4HOXA 3MRRB 3RY5A 4UT9A 2W0FB 3P69A 3BUYB 3ECUA 1BCIA 1T2JA 4A7GF 3VO0A 4CGTA 2EDYA 3SDXA 3ZHDA 4URTB 2X1XR 3BAKA 2K6ZA 3R0NA 3FT2A 3J7HA 2WTRB 5E7FA 3FU7B 4YHIB 4GKSA 5FHBH 1DZ0A 1FZKB 4R0LC 4Z7OE 3MRNB 4TULL 1ANUA 3V6OC 4I88A 4E9RA 4CL7A 1IVTA 1LO5B 2OMBA 2AV7A 4JM4L 3EJYC 3S5LB 4MXQD 5EIIA 2OTUA 1G6VK 4I87A 4G7VH 4CN1A 3EJCA 4FCHA 3WLWC 3L3DA 4XP6H 3BVUA 3SPVB 3N55A 3H6JA 1KELH 2PO6D 1A7PL 4MDIA 3QXUA 2FR4B 3Q8FA 1IIIA 1YNLH 2DKSA 4CSSA 1H15B 3G7TA 4K07A 4Y7MA 3T08A 1GYVA 2QGBA 4FHKA 4PJAE 1WISA 4BSWA 4BYHA 1AQKH 1CBVH 3H55A 2H3NB 2X41A 3EF7A 5CFAA 5IB2A 2CO6A 1AGFB 4Y2DD 1G7QA 2FWUA 5CLZA 1EXUA 3RVUC 1ITBB 2EIEA 1LE5A 4BFGA 4N2DA 3G6AB 3VXMA 3E8VA 7TAAA 3DXAB 4K71C 5EV7A 3T0AA 4G6KH 3CHXA 3G5XB 3LIZL 3NMEA 3GD1C 5ACZB 4WW2C 1AJ7L 1YEDB 2GTZB 2XQBH 3BP6B 4R97C 2CLZB 1FYTA 2Z91A 2P49B 2DIAA 1FGVH 3AW5A 3MJ9A 4J39A 3JXAA 3RZCD 3OMIB 2CRYA 3KPOA 5D9SA 5BXFA 3VWKA 5T3ZD 1IEHA 4A67A 2AJ3A 4NN7C 4BD4A 3AMLA 2OR9H 2ORBH 2VGLM 5C9KA 2IALB 2WBJB 1NCWH 3VSTA 5GGVL 1CD9B 2WAHA 2KQMA 2G2PA 3CZNA 5T3XD 5E03A 3X1FA 1MWOA 1FNSL 5AKVA 3T2NL 1PG7H 4WTQA 4X6DE 4ZUWB 3IXAA 4M43L 2JIXB 1WIOA 3ASWA 1DE4A 4FQIL 1IEBB 3EADA 1UWGL 3ZQ9A 1RPQA 2QMKA 4GQQA 2CGYA 1FORH 1ZXKA 2Z1KA 4IBYA 4YE0A 1G0YR 4R7LA 4TF4A 4ZAKB 1JS4A 5F8QC 3BPNC 4DEPB 2J88L 1A6UH 1ACYH 2RHEA 2V8LA 2HTKC 3FO2B 1J8SA 2Y6TE 4PJCF 2X0UA 2JKTM 4DN3L 3U25A 3L3KA 4F1ZA 4F2MB 4OIAA 1CXLA 1RPUA 3EGSB 1Z0NA 3D85A 3FB5A 3QDJB 1N6VA 1GC1C 4ETYA 1MKFA 4XO4A 1ECYA 1MH5A 1XBRA 3V7AE 2WSKA 1NFIA 4ODXA 5F3HB 3KVQA 3KYOA 4IW4C 4KITB 1JDDA 2BFVL 1RJZB 5D70H 3SCMB 4H26A 4J5VA 1J5IA 3K1DA 4WEUD 3WTTA 5EEYA 1L9SA 4LRIA 1ETA1 1TTCA 4KKPA 4FP8L 4KPHL 4N8VA 1ZOXA 1DQIA 5JOFA 1U8QA 1ACCA 1Z3GL 2NY5L 2MCAA 2IDFA 2VDQH 2NSMA 3CLWA 2B1HH 3LVTA 3C2SA 4AQEB 2CHNA 4EXKA 5B7MA 1U8JB 3ZHNA 3HG1E 3ARBA 3HRZA 4N8CL 1XF5A 4GG6E 3DV6B 1F4YH 3EKCA 4HH9A 4J6RL 3MRGB 4IU3A 2D7TL 3QQXA 5FUZH 3UP1A 3WIHA 2W60A 3BFQG 3GHBH 2LFEA 3RPBA 4XAWL 1IGCH 4TNVF 3WXWL 5E5MB 3ZIMA 2PCPB 4GIPD 1A7RH 4PB9H 3ZDXB 5I17A 1W0WA 1WHOA 1WZMA 2PCYA 1JWSB 5D7EA 3X11B 1B2WL 4HLZG 1CR9H 5BS0D 3P02A 1RI8A 3BE1L 4N6RA 4F7PA 2YD1A 3QXWA 4AYSA 1LP9A 4JHZA 3SYPA 4U6XA 1WIUA 1RXLA 1ZCRA 1R34A 1E5UI 4PJGA 3LNEA 5H94A 3QRFM 3UGEA 4MBRA 2O26U 3MRDA 5D2NC 4ZFFA 3HZKB 3V5KB 3FXIC 1X9LA 1YYML 2B4CH 1LO4H 1QD0A 3WMQA 2EIZA 2NNRA 3MRJA 5DRXB 1D7DA 3C08L 4JN2B 4K3HA 4LHUB 5INCA 4PY8J 2LVCA 1J8HE 1L7IL 1ZVHA 2NXZB 2WAQA 5HDOA 2BJMH 4N0FA 4WI3A 5E8OA 4CKVX 1U3ZA 3QR2A 4OQ1A 3TBSA 4FXKA 3EYSL 2W07A 1ZY9A 5JYLA 4BFBD 3N1PC 1E9OA 3F83A 2V4LA 2CBPA 4NZJA 4MCYA 4B27A 1A47A 1OT4A 2MNUA 2DQGH 2J8UF 3FUIA 4LSPH 5DRNA 5EPMB 5L6YH 5B39G 5BJTA 1KOAA 3I3EA 3D0VB 2FEJA 1A7BA 1HCZA 1VFAA 3MHZA 4AJVA 1IT9L 1QFPA 2ZXCA 3GS7A 5CZKA 5EHFA 3MREB 3X1NA 2E4TA 2CALA 4R2GB 4ZTOL 1A6WH 1TETL 5FGBA 1UUSA 3C5ZD 2OMYA 4RESB 3EJRA 3WHE1 2I24N 2OFQA 4Y4HC 5I8KH 5C0CD 4HUXB 1UM5L 2A99A 2P8PA 1VF5C 3HC2A 3OKOA 4OGXH 3U6RA 3MLSH 2Y2WA 1GPOH 3K4DA 4Q6KA 1H8NA 1RZ8A 4YDNA 4Z95L 1CXHA 2XN2A 3KGTA 4L9LA 4KO6A 1RIVL 2ZKHH 2YN5A 2I07A 1WD8A 2P44B 3PAUA 5DMKA 2NCMA 1QFWL 5KSAC 1GTFA 5TDOB 4ZXBC 3RFRA 3KPSD 2UUDK 4KKLD 1XWVA 4LLDB 5C09A 3QZBA 3ZDYB 5C0RL 4X4XA 3P2DA 4M03A 3WEBA 2WQRA 2FWOB 3ULVF 1PY4A 1JIBA 2IDCA 5IOPB 3G5YB 5H4YA 2A5UA 1P1VA 3BZ4B 4TOYL 3LQZB 3RWFB 3RVVC 1OF2A 1OLZA 3VE0B 5T1KD 1B6UA 1ETZA 1RUPL 5C0BE 3T09A 4EEEA 5IW3A 2HFGH 3RNKA 2J12B 43CAA 1J87A 4M8QB 4XVTL 1I1AA 2VB5A 3K72B 4D3CH 4QXGL 1F4WH 4XNUL 2YPLA 4OJCA 4C83B 1CXKA 2H2SC 3WUZA 4MMZC 4RH4A 1AYOA 2DQUL 5EZLB 3V9EA 1PJWA 1F6AA 1QBLH 5D1XE 4BKLB 4LEOB 4X6CF 1TLKA 2GB2A 1GA2A 3BLBA 4KUCF 5IVOA 3BRDA 1HU8A 4KK6C 3UTSE 4PJ5E 3RA7H 1U95A 1PG7X 1PU0A 5JHBA 3EJUA 1BWWA 3LZFL 4A1RA 1Z9SB 1KNOA 1JNHA 1I8LC 4G6MH 4RMRA 1PIFA 5B1AB 3LQAH 5AG8A 1FIGL 5EUKB 1X5HA 5FUCC 1HSBB 5F9WC 2DY2A 3HOGA 2ZXBA 5D7IF 1G7JB 2V5TA 2Z92B 4BM7A 1GYAA 2VL4A 3VXUA 5F7EL 1CFSA 1T1WB 2ZUQC 3QH3B 5HJ3B 5KJ7E 5GZOD 1BF2A 2VDPB 2V9RA 1U93A 2V2WB 3I2CH 3DX6A 1ZHNA 4ZMVA 1BZ7B 2UYLB 3BCDA 3GRWA 1R19A 2NNFA 4HUWA 4CDGC 4OZFG 1MPAL 2I5YL 1NBQA 3LQMA 4L5FE 5ICZA 3QCUL 1BEXA 4TQEH 1S6NA 4FKKA 2AXGB 3RZWA 4YMPA 4HC1H 3FSZA 2GAZB 3I6KA 1QLEL 5MEQA 4ADGA 1XGUB 4FQHB 5DS1A 5C2UB 2FATL 5MENE 1HEZA 4RGND 4LE8A 3BVWA 2H41A 4G7SB 1CYXA 3WHE0 4EUPA 3NCWA 1K6QL 4ONGL 4W6WB 1YRKA 2UV3A 4HZ1A 4KRPC 3WLBB 4AKQA 4L8DB 1DVXA 4DWHA 3ZZSA 4PJ9A 1HOCB 3PHQB 1LM8V 5IJKA 2XNAB 3M86A 2AHIA 2BNRB 1S5IL 3RI5F 3NIDB 3T8XA 4ODTH 4NHCL 2CO4A 3BKJH 3TBTB 1WUNT 1M05A 1BDYA 4FADA 5TPWH 1QFOA 1MI5B 4P46C 5K5YA 2GPZA 4PLNC 5DD3L 4QWWD 2K7PA 1NCUA 1BXVA 2YRLA 4FI7A 1NEZA 3TV3L 3UTPD 1G7HB 4H1LG 4HMCA 2VSMB 1JXDA 1Q0YH 1XCTB 5AWNL 3VXQA 2HFFA 3WKPA 4JO2L 4YAQB 1H8SA 2BSRB 4LT7A 4L1SA 1EO5A 4G9FB 2ICWB 4NQVA 2VLKD 4JHWL 4HUUA 1GCFA 3HE6D 2FUTA 3OAWA 1NUNB 1L0QA 4M6NH 2XWJB 3WDHA 3TIEA 1ACXA 1QHPA 2QBWA 2GBTA 3CHPA 4C58B 1EXGA 3RVTC 1BBDL 4DT2A 5I71B 5IHWA 2I25N 4HSQA 1D9KB 4HLZH 1AI1H 3BPCB 4HALA 2DMKA 1JHLH 1PZCA 1V10A 3CCHA 2IDUA 2R0LH 3NDZE 1ZLWK 3D87B 1IKNC 3GZQA 1ADQH 2B2XH 4Z9KB 5HYJB 4Y5XB 2GTWB 5I1IH 2VXSL 1TNNA 3ARDC 4S0SD 1PSKL 5FO7A 5ACMA 3TT3H 2H3XC 3BO8A 3LS5L 4FKHA 4LDLB 4Y2OB 5F6IB 3IFLL 1G7LB 2JKIS 4S1SH 4GXUN 1EZLA 1RZFH 1JF1B 3WJMB 5C0GB 1QR1A 3ULUF 1QLFA 1BBJA 4H20L 4YPJA 4FZ8H 4OF3A 5IW1B 5KSBE 4JFQB 1TENA 4ZO8A 2W0KA 1RPKA 3EOYG 4J8RB 1YEEL 2XWBA 4ZMOA 1WFMA 4HF5L 2D7QA 1YN7B 2OZNA 5F88B 3IK2A 3RP1A 5A3IC 2N7AA 4KZDL 2E7BA 5SX5H 5LGJA 1MREL 3ESVF 3MU3A 1KB5H 5A1AA 2C9PA 1IC5L 1MHEB 3FONB 1QAWA 3HBGA 3LKQB 3MLYH 2QLVB 5FB8A 2C3GA 3MA9L 5AEAA 1KIUB 1GMIA 1BOYA 3MA7B 4ODUA 2W65A 1I9IL 4PI2A 3F84A 1OB1A 1RL1A 2GFBA 3KWWA 4MAUL 4AYID 5ITFA 4PGCA 1X5AA 3U82B 1N0XL 2WBJD 3TN0B 2X44D 4I48B 4F15B 3W5MA 1RZJC 3B8YA 5IVZB 3BCFA 1SDYA 3UTQA 4YHLH 2DWDA 5AYTA 2XN9E 3UTTB 1T1YA 3QXDA 4QEGA 2ZPKL 3D52A 3EDKA 2ZCKL 2X05A 2Y7MA 2FJSA 2XHNA 4AH2B 1EBPA 4Z3JA 5AKTA 5GQBA 4HISA 1X7TA 4NAMA 3LAFA 1I9RL 4OZIE 4V1DA 3JZYA 3RDTC 5ID0A 5KVEL 1JHTB 3BP7B 2GHWB 4NC2B 4AKPA 4YIQB 2OSLB 4NWTL 3C5JB 1BFOA 4N0CD 2J1KA 4DERA 3UYRH 2NY4C 1YUHB 4XN9A 1PDKB 3KS0J 5DJXA 1ADWA 2FHFA 2DI8A 4FHJA 4YQXH 5AVQB 3B9DA 3SPJA 3WN5A 3WNNA 1Z5LA 5HJGA 5E24E 3RFZB 4WGKA 1KCKA 3G08A 4LRNL 4WWKB 5DQ9B 5ICUA 2Q3ZA 4LCYA 2J5LC 4UV4H 1G5AA 1OKEA 3HI6H 4L0PB 1FO0A 15C8L 2LVEA 3MV9E 4LSQH 4RX4D 1H5BB 1UKSA 3HAEB 1CE6B 4G11A 2JTYA 3SCMD 4FG0A 4LASH 1U58B 2G60L 4AVIA 4X5RA 5F93C 2PYEA 4EAEA 1I85C 3S7GA 3GF8A 3OJDA 5ESVA 2YUWA 3S3CB 5L8KB 3QFJE 2ENQA 5DEGA 5I16B 1N70A 5B4MD 3T3PB 1J0ZA 1HAUA 4WJ5B 2BSTA 3D2UA 3OJMB 5B21A 3VI4E 1A1OB 1L0PA 5J12B 2NT1A 4I3SL 3CSYA 2NXYB 4DF9A 2EIDA 1FHNA 2VL5B 3SDDB 3JWOL 1NCCH 3QIUB 3VVVA 4QHMA 4PV1C 2V37A 1KGJA 3MV7A 5BCAA 1KN2H 3EO9H 1HQ4A 3OWRA 2Y7OA 1QPPA 5DVLA 4Z76B 1AGDB 2DTML 5E9DE 1ZSDA 1R5WA 1NSNL 2XWRA 4D9QD 4FQ1H 3SGKC 3BLPX 5FM8A 2VMFA 3GSNB 1HL5A 3PDGA 3ZZQA 4DW2L 4LNRA 4IGBC 3KJ6H 5IJVB 2C3HA 3GIZH 3QS2A 4QYOA 4RIRA 1BOGA 2Y06L 2OL3H 4G42B 1GSKA 3HLAB 1HXKA 4F8NA 1T0PB 1BGXL 3SKJL 3S98A 4DEUA 3P9MB 3RWCB 4BGLA 1EFQA 2MSPA 1F90H 1LVEA 2VDOL 3NGBC 5C0AA 4UM9B 4POZC 1X6LA 3AAZA 1Q90A 1M3JA 1LILA 2B14A 1UWFA 4ZW6A 5JXEA 1O7DC 4WEMB 2BOCB 3AG3B 3KGUA 4A7UA 5I0XA 3P4MA 4UQ3B 3M1BA 3VFTB 5DVOA 1NGXB 1CFQB 2NXZD 3H3PL 4OUUA 1Z9MA 3FUMA 2GYSA 1WZKA 2NTFA 4AQ8C 4Y1AE 1GKEA 1KLFB 2VLRE 4HWUA 4PJBA 5AKSA 1D5IL 4NNPH 5HYFA 4KKRA 4IRJC 4Z1PA 1E27B 1S7TB 1X5FA 5F8RC 4F93B 2ZKYA 3CFNA 3KPRE 4GG6B 3E9TA 4HJSA 4HJJH 4H1LH 2Y72A 4WKXA 1AKPA 3GUTB 3WFHB 4MQ7A 3SDXB 1OAUH 5G5DA 1UA7A 1EHXA 3TJEL 3FT2B 1VAHA 1RZPA 5EOCJ 3OAUL 4AQ1C 4BZ1A 4GKSB 2E6QA 1E0OB 1KFAH 4NNXB 4U7KA 1IFHL 1IEAA 5I1AB 4O00A 2AV7B 4GY4A 3FW6A 3T0EB 5EIIB 2OTUB 5GS0L 3UACA 2M1KA 3FU3A 1QO3A 3WJJA 6PCYA 4DOHE 3DTXA 4LL1A 5LKNA 3ETBJ 1OCRB 3RGVD 1XT5A 2XXCB 2V17H 3OAZK 4MDIB 4ZNEE 4PVMA 5CCHE 3U1PA 5IEKA 4NQCA 1JD9A 3ESPA 4BSWB 1W72L 1QSEA 5IB2B 2CO6B 2E75C 4LXFA 1AQMA 1G7QB 1JZ8A 3MLTA 2WTOA 1EXUB 1X44A 2XJKA 3B2XA 2VUYA 3ROLA 1WH0A 1J0JA 5TFSL 4RDQF 2QGCA 5BVJB 5E8DH 1VZGA 2CJSA 1HESA 4MNQE 1MFAL 3IE4A 4DNLA 3RWJA 3LXBA 1AQ8A 5FCUH 4X9IA 1LQBC 1JK9A 1FYHB 4X5XA 4N0RA 5IV2A 2YLHA 4H88L 2TSAA 3IU4H 5HI3C 2A9NH 2Z91B 5A2KH 1HYSD 1MUJA 2IGLA 2Z35B 3MBXH 1XZWA 5C07A 5ISZE 2X70A 3FCGA 4HT1H 4NQUA 1YYLH 4Q58C 5GJSH 3SYCA 5AENA 5D9SB 3F85A 3KPOB 2WWMD 3NZ8A 1QQDB 3VWKB 1MQKH 4XMTA 4AG4L 1NCNA 3T2QA 3MLVL 1JJUA 3P11H 2W9DH 4L3ED 4GUCA 4NHUB 3T65B 1F3JB 3UJTH 3T2OA 2J44A 4AUYA 4W93A 5DC2A 3CFKB 3L2MA 2E7DA 1YPZA 2B77A 5DD1L 4G43A 5AAMA 5BMFL 2ORBL 5EZOH 1U3HC 5E8EA 4ZFZA 4TNFA 1DE4B 1NCWL 4W9CC 1M53A 2OXGA 1QLRA 1PG7L 5E1IA 2HRPL 1KBVA 4MNGE 2JKLA 3LMJL 3ALPA 4FL4C 4RZKA 1XSKA 4LIQL 1UURA 3QJXA 4HUMB 5G2NA 5C0DA 3FQ1A 1XH3A 1T1ZA 4MA1C 2JJWA 3F2LA 3B9KA 3MACH 5FX3A 1FORL 2BX5A 3QRLA 1U6AL 3VXOB 3L3KB 2QVTA 4HAFA 3AY4C 4M1GL 3GSOA 5D2LF 5FFOA 4HGMA 5E00A 1QBML 4DGWC 3D85B 1R5VA 1URZA 2K6YA 4E9YA 4LK4A 3WNPA 3GJFH 4G2AA 1MH5B 3KWUA 1H19A 4EIGB 4J3BA 1A65A 1T6WA 5HYIA 1M7DA 3L3IA 1OP5K 4H26B 5I9QC 1R3JB 1T80A 1ED3B 1GGYA 2D7MA 3L9RB 3ZKXB 5C2BL 1MG3C 2QVFB 3D39E 3SJVE 5LG6A 4N8VB 2IDTA 5D8JL 5JOFB 3I50L 3P73A 4JLRA 3ZK0A 5LHDA 3LB6D 3QUZC 5AVTB 1HE8A 2YA0A 3FCTA 4HD9A 4LCCC 1MFDH 4LDCA 1EO7A 3RWGB 5D1ZD 3TH4T 3ZO9A 1I9EA 2GIMA 1JK8B 3ARBB 4N2FA 5L88H 3Q2CA 1XF5B 4BUHA 4AEHH 5HVHB 3QDGA 1HDMB 2VDQL 2CDGA 3BZFB 1HIML 2PTTA 3CZFB 4IU3B 5IQ9A 4ERSL 4D94A 2MPAH 4OLXL 4XOCA 3GMQB 3NCMA 2EDNA 2MJWA 2LLNA 4FF9A 2W88A 1W0WB 2FT8A 1LWRA 2EYTB 5DK3A 1UT9A 3BAXA 3V6ZA 1F56A 5IQ7L 2AK1L 4N6RB 4F7PB 4YX2H 1G9ML 5JLZA 3ULVH 4YE4L 1GGBL 4MHHG 5F9OH 1GC1H 3HLKA 3VU2A 3KLQA 1D9KD 3LHPH 3ELQA 2C4FU 4YPGA 5F1OB 4J3OD 1BQLH 1FDLH 5H94B 1AP2A 4JREB 5HYJD 3L95A 5IQOA 3COOA 2NYYD 3MRDB 2VABA 1OWWA 3QBTB 4ZFFB 2X10A 1VIWA 3II3A 4Z78B 3LVEA 5JPMA 2EIZB 3MRJB 4IRZA 1INQA 1JTOA 4GUOA 4XRCB 5GISL 1OL0A 4EI0A 1VENA 4N0FB 5E8OB 1YEJL 2V2XB 4MB5A 1BVOA 1KDIA 2WLZA 3O6ML 1Y1UA 3TBSB 4HJTA 2W07B 1GW6A 4AL8L 2HX7A 1S78D 1IBZA 4WK2B 5CU5A 3DX7A 4YSOA 5C0NC 5DRNB 4WUUE 5KOMC 4RLDA 1E5BA 1MJUL 1UVQA 3L7FA 2DQHL 5BJTB 4DQOH 3D3VD 1DL7H 4L1HA 3NZSA 2IAMA 1J1PH 2OAAA 3TCTA 1VFAB 5EU7E 4B6ZA 1BA9A 4UZGA 4FLRA 1GIGL 1O6VA 2R0KH 4E9WA 4JRLA 3TS8A 5CBAB 2BOBA 1PX8A 3BC9A 3ML9A 2FB4L 3JVFC 1MRFH 4PJ7F 4JM2C 2IH1B 5E1AA 3U6RB 1F4XH 2Z34A 3OKOB 3W11D 1XR9A 2QTEA 3A24A 2AABL 4XNQB 3CFMA 4GW5A 1VPOL 3C9NA 1X5IA 4Q0XH 4X7TA 3EJZD 4HMDA 1KBGH 2QGEA 4TXVB 3CUPA 5DMKB 5J89A 5CZRA 4X2UA 1ZGLM 5FR3A 1RJYA 1GPOL 4PCKA 4ZOCA 4C47A 2GTQA 2ZKXA 3Q8CA 4QRBA 1L9NA 3AMKA 5C09B 4F7MB 2Q8AL 2GCYB 3VACA 4X4XB 1UADC 1A66A 2QQKH 4P2RA 4JL1A 1RZIB 2OXHB 1U8MA 4ATTA 2E5EA 2LLGA 4UT7H 1KYUA 3AREB 4KKQA 4RNRA 1OF2B 3PHAA 1MCBA 3FFDB 2MOGA 1FNHA 4OLZH 5KVEE 3RNKB 43CAB 3QQ9C 1I1AB 2Z93B 4EN3A 4WWKD 1AC6A 4LVHB 2CK0L 2YPLB 1PG7W 1QMUA 4W9HC 2YO3A 4IRSC 3RUGE 3US0A 1F6AB 4JY5L 2LQRA 4HKBB 1I3GL 2UX7A 5TGBA 4ACPA 3WIIH 4L2LA 4CJ1A 4MKMA 4KZ0A 1F4WL 1PMYA 2CKBH 2D4DA 2DMGA 4FFVC 1U95B 4CADA 4F7CB 5DUMH 4JO4H 1CQYA 1LQSR 2YEVB 1KNOB 5K1VA 1XIWA 1QBLL 1AFVH 4AI7A 1BYNA 3SDAC 4K7PY 5F44A 2DB8A 1I1RA 4HXAH 3EIFA 2BIQA 1A2YB 2ERJC 2G9HA 4NO2A 3DUSB 5JTWA 2JI3A 2EEAA 1XD1A 2QT6A 1UZGA 3SDDD 3VXUB 4U1GB 1MAML 1UZ8B 4M7JL 3ARQA 3QIUD 3NP3A 1YMMB 2OW7A 4TL4A 3UZVB 4FDWA 2WQWA 3HC3H 5JW5B 1ZHNB 5HHME 3KYNA 4OCWH 2P45B 2WOYA 3RAJL 4QIRA 3R4DA 3IGKA 1O7VA 2WZ0A 2EECA 4XE5B 4RDQG 5ICZB 1QHQA 2BSCA 5ANHA 1WQVT 3UPAA 3QUXC 2QZ5A 2AKRA 4M48H 1BPVA 1Z9NA 3ULUH 4NN5C 1AGEA 1DBAL 4NWUH 5GGQH 3SKUD 5EU6A 3N40F 4YDVA 2WQXA 1PKQA 2FLMA 2HVKA 3LKNA 3DJZA 4BH8A 2BM3A 3MZGB 5DMIL 4WW1A 1CLVA 1SXAA 4Z7WE 2QQLH 1N6QH 2XACC 3NFNB 4GNKB 3G5VA 1XCXA 4N22A 1I3RB 1E4KA 3ZKNC 4LSUH 4GKNB 3C5SB 3QNFA 4PJ9B 5E2TH 3O6FA 4KFZC 3BEVB 1DQQA 3NYKA 1FPTL 3T8XB 2A77H 4PJFF 4H8WL 2XN0A 1DN0A 3T4AA 4HPOL 3MRMB 2P5EB 4WSKA 1M05B 4JW3A 5F6HI 3UG3A 2CCWA 4PGBB 2JB6B 3MTXA 5F0JB 5LQBH 1NEZB 1SLVA 5EBWA 4PJ8C 4UOZA 1V7NH 1W6WA 2DM4A 3JUZA 5FA4A 1T89A 4OIIL 5LNGA 4H8HA 3FT3A 3DDFA 3MODH 1MCFA 1WA0X 4I77H 4F33A 4NQVB 4Z8FH 2AGJH 3P30H 4CGUB 2ATKA 4ZPVA 4DKEL 2NY1C 2FX8L 4HJ0D 4XB8A 2C9SA 3FSAA 3A3YB 3SKOA 3VRLE 3TIEB 4TMPA 4G8GA 3NEOA 4QOKE 1DFXA 3QORD 4LCWE 4MAYA 2XY2A 1SMAA 3MGTB 5I1CH 1MFUA 3L9YA 3L3OA 2Y7QA 5J11C 3TA3D 1WSST 2NCEA 3T0ED 3WFCL 3SGEI 3QIWA 1T7YA 1MFBH 3P3UA 1M71A 3BD4A 2BP0B 1HHGA 4PWKA 3WFDL 2ZCLL 1YDPB 2CMRH 4Q9RH 4PYGA 4NQEA 4WDIB 2OLDA 4QRRE 1A5FH 1TZOA 3BO8B 4OGYH 5GS2H 3PLYA 3C12A 4ZTPL 5DR5L 1ZGLA 3ECWA 4R5TA 3NFSH 4YWGL 2P52A 2R0LL 4NKIL 4N4YB 2X0WA 2FO1A 3K6OA 4PP2A 1FRGH 2B2XL 3GKWL 1NPJA 4H2AA 4TTDD 3O2WH 3Q3GA 5I1IL 1BEYL 1YEFH 3BVDB 1FL6A 2Y69B 3FUHA 2CO7A 2QHRH 2XWBB 3V4PL 3ZYIA 2Y1VA 1GAFH 2XA8L 5E08H 3BD5A 1ZA3A 4N6QA 1KACB 3U83A 4Y1AB 3UBGA 2Q6WB 5EC1A 4NM4H 3LZRA 2WVTA 2NY2B 4IBTA 5GGSB 4GMTH 4BWWA 3RTQA 2IQAB 4XODA 3IN0A 3L5XL 2E6JA 3ATDA 5FB8B 4PCYA 1H6UA 2Y5TA 3JT0A 4PGZA 5CJ8A 2V9UA 4JY4B 3LS4H 1OALA 2Y22A 2W65B 1LD9A 4ODUB 4QRAA 2GFBB 1KB5L 3KWWB 2O6PA 5HJDA 3MGOB 2BVOB 4XP4H 2P48B 1PZBA 3UTQB 1WWWX 4IMKA 4JFDA 4OGZA 4HVBA 2DWDB 1BXXA 3B8SA 2ALAA 1T1YB 3QXDB 5B1KA 3D9AL 3OB8A 1KCUH 1QX1A 4V1DB 1CICA 5TE7H 1CL7I 4DGIL 2GSIA 3BDBA 4M7LH 4APQB 4XP1H 1SJHA 3NCJL 3QIBA 5J13C 3EYOB 1NFKA 1BFOB 4PTTB 4NIKB 1HQRA 4LBAA 4MNHA 5DJXB 2VERA 3ARSA 3WN5B 3L5JA 1WCBA 3DOSA 1UOLA 1F0LA 2ZX6A 2EDDA 4KRMB 5EF3A 4P8QA 4XPAL 2IFGA 4AQAB 1BREA 2NX5A 3OZKA 4QHNB 4OCSH 4LCYB 4P4KB 5I5RA 5IVNA 4Q6IC 1JRHH 1U8NA 2A74C 2VIRB 4LIQE 1FO0B 2A6KA 4K5MA 5C0BD 3MN8A 3AUVA 2AEPH 2ZX7A 3UOAB 1E9QA 4RWHA 3QO0B 3TO2B 1FUNA 1G9NL 2XG4A 2YOAA 5EBMA 3VDCA 5A7BA 3BVNA 1JYXA 1D5BA 5F7DB 5BRZB 2O5XH 5D1XD 1RZJH 4LSQL 1PZSA 1LO0H 4J7RA 3D2UB 2JJTA 2HCZX 3MLWL 1RHHB 4MHHI 4WENB 1PKOA 3CSYB 1NCTA 4E5XB 1XGZA 2MKWA 4LF3A 1UWEL 3VRJA 5KBLA 5AZUA 4YSPA 4GP4B 4OVVA 4XXDA 3ZHKA 3MV7B 2M83A 1TQCC 2QADB 3GBNH 2YGQA 5C6TL 3AXLA 2Z65C 3X3FL 3D09A 2C4FT 3JVGA 2E7CA 4JQXA 2YK1H 5KS9E 2JV6A 4FNLH 1KENL 1R5WB 4UZUA 3MJ8B 4ADIA 3OF6D 3KHOA 4KNUA 3KBEA 2BIIA 2NY7H 2VZTA 5FXCH 1V3LA 4Z7IA 4P2OD 3VI3B 4RIRB 4QYOB 7PAZA 1NBZB 3Q2NA 4PRIE 5F9JA 2FECL 5FGCB 4P5SA 2VDNH 3T04D 3CDZB 1XXDC 1QSFE 2WLMA 4UNUA 1PYWB 5E2JA 1QKZH 3AAZB 1IGIL 5FYLH 1TJIL 4ZD3L 5J1AB 2IBBA 5DK2A 2NRDA 1NGYA 3TPUA 2CGZA 3DOIA 1BIHA 2COQA 1EAPA 3CPLA 4KROD 3UAJA 1SHSA 5AVRB 1SYSA 2IPUK 5I1EH 3M1BB 3Q5TA 4OUUB 2JMRA 3UXFA 4Y5VC 3WIFA 4UQ2A 1OD7A 2Y1ZA 4EOWH 5E2VH 2ADFH 4IOSA 3GEFA 1QLEB 2FX9L 1CCZA 2D3VA 3ZZLA 3OGCA 5JW3H 4EDWH 4Y9BA 4UOJA 3MR9A 3THML 5AW4B 1CG9A 2KDYA 4MJ6A 3E8UL 3P3RA 3N0PB 3V0VA 3GSXB 2F53A 4LCIH 5DYOA 3DLQR 2FNBA 1A6ZA 3RGVC 43C9B 3TH3T 1YAIA 4N2NA 2IADA 2BDNL 4MQ7B 3EJQA 1RV6X 1JPSL 4JMXA 5G5DB 3WBDA 5KVGH 1KEML 1V7ML 2I69A 4NNPL 1AXSB 2FSEA 1WBXA 2CRIA 1J1XH 2VQ4A 5EFIA 4F20A 5IKCA 1IEAB 3C6SB 2ROXA 4JRYB 4FZEH 4TVSa 1I8AA 3M17A 3VXNA 3MUHL 1J48A 4AEEA 1YEGH 1MSPA 2BSED 3B7RL 2FJGA 4K5OA 4ZOAA 1QO3B 1GVIA 2Y24A 3SBWA 3A6OA 4R90L 4FJYA 4GLRH 4W9EC 2NY3B 5FKAA 5FWRA 2QV4A 2ZOKA 2KPNA 4FYRA 1WE5A 3D4CA 5ABZA 1IX2A 4Z7QB 3ARPA 3BUDA 2VQUA 1TYJA 4OD2A 4DO6A 4NQCB 2XIIA 3ZHFA 1DDTA 3CZKA 4FQXD 2CM5A 3O8XA 1SY6H 2YD6A 3TX4A 4NKMA 5C09D 1GZPA 1OAKL 5GS1A 1NGQH 5CCGE 2GSGB 4GMSL 1QFHA 4B53A 2P7TB 3JWNC 3FCUB 3CX2A 3ARED 2D0GA 3MLZH 1LK3L 3APDA 32C2A 4MDJB 5SWSA 2OMTA 4OW6A 4YSRA 3V7MA 1JK9B 1J0YA 1I1AD 3BGMA 4IHOB 4WO4C 1CVSC 1YECH 3VSVA 1MUJB 1I4FA 3CSBA 3S0PA 2VE6B 3MV11 3MV8E 2CLRA 5FOJA 1DJXA 4HX1B 4Y9EA 3ZDXF 1U8CA 3CDGA 4HS8L 1D3CA 2E47A 1ADQA 4P3DB 4U6TA 4PJEA 1T2QL 2F5BL 2YKLH 3G6JA 3LH8A 3SQRA 3BQUA 4QLRA 3HW7A 1EBAA 3ESMA 2J73A 4K0OA 1ZANL 1R3HA 3IPEA 4K9EC 3ET9F 3T9WA 1NDGB 3L81A 5BPPA 4W9GC 4TPRL 3GRWL 5IVXA 2ZXAA 3VDBA 4Q8BA 1ORSA 2DPKA 4PJDA 3UJTL 3BYTA 3A4AA 2OJEA 2IOMA 4Y2NA 3QDME 4TLTA 1FZJB 3ZE1E 2OXGB 3N41B 2HKHH 2AQSA 1RK7A 4BXSV 3Q9QA 2PKDA 3GS0A 2XN9D 4NQDE 1N68A 4QT5B 3S5ZA 1YMMD 1RZKC 1ZEAH 4GKOA 3ZMEA 3D69A 5T3ZH 2DWXA 5EZOL 1ITCA 3CXDH 4HUCA 3Q05A 2ED9A 3FH7A 5D7JC 4QHPA 5C0DB 2GJ6E 2HT3D 1XH3B 2HT2C 5A2BA 2JCCA 4XZUA 1T1ZB 5B39A 3V9FA 2DBJA 4P5MB 5LBSH 5T3XH 1CK0L 3UBXG 2CBTA 4MRCA 5DURD 5HGDA 1QP1A 4GRMA 3QZWB 5GSRA 3N1MC 2BLFA 3KWTA 3S35H 2KI6A 3IMVA 5IGXL 3MACL 2P5WE 4L1BA 3JV5A 1H0DA 4J8QA 3OHXB 4YXKL 1GJIA 1HNFA 3PJSB 3WXVL 1NLBH 3HR6A 3GHPA 3HMXA 3C6LB 1E4XH 3CBRA 3PIQB 4LU5H 3POHA 4NFDA 1AG0A 2BERA 1R24B 2B3RA 2KUTA 3LPFA 3MV9D 4OZ4B 4JLRB 4MMXB 3REVB 3NSYA 2G5RA 3V4VH 2ZKMX 5CJQH 2P5ED 3SPGA 4P07A 4XXWC 3U30B 2X3CA 4UILL 2DQEL 3PWPA 3GMOA 1MELA 3QFJD 3VTMA 2EIKB 1UCTA 3E7JA 5IQ9B 2R15A 2WBWB 3CHQA 3DGCR 4JZOA 4X6BA 1JI2A 3NJNA 4XPBH 4ZX6A 2XU9A 2OMUB 1ZTXH 2TAAA 5EU3A 4LCUA 3TU6A 5B8CA 2HYMA 4XBMA 1JPGB 4DAGH 5LGKA 3CVBA 2A6IA 3H9ZA 2WLJA 5I15H 3TXAA 3V6ZB 1DQVA 2XRAH 5HHMB 4FN0A 1DUYA 4XCYB 2XTJB 1MCPH 2X1PA 3U6XA 3MZTA 5F9AC 1JTTA 4A7GA 1CGUA 2DL2A 3T2LA 5BRPA 1MN4A 5L9DH 2YXWA 3BZEA 3KCPB 4BUGA 4YPGB 1UD2A 5AOZA 3FYEB 3QEUB 5BO1H 5K9OA 2R56L 4G82A 1G0XA 4G6JH 4WSGA 4D0BA 2VABB 1OTSC 1F02I 2IWGA 1KTKE 2QJDA 2VM3A 4LLWA 5BV7H 3HZMA 1CFVH 1YC8A 5JPMB 5CCKH 2G4GA 1INQB 1KGIA 3CQQA 1ZDQA 5EA0L 5E1QA 1FDLL 5LAXB 5AW0B 2JF1A 3ARGC 4X8GA 1E8WA 3RILA 2DBLL 3GHEH 3W11C 4XVJH 3VXME 2DM7A 3FN9A 3DX7B 1COBA 2RAMA 2M2DA 1MF2H 1CE1H 3MDJA 1AO7E 4NJ9L 1K5NA 2QSCH 2VWEC 4HWEL 1XGTA 1JV5A 2IAMB 1G7IA 2OL3A 4U6HB 2Q8BH 3WTXA 2VISA 3DX9A 4Y1AD 5I82A 3MMEB 4OZFA 2WXJA 3BFOA 1FYTE 5BUPA 2VLRD 4Q2ZB 3X1EA 4WEBH 2UZXA 2NY2D 1G1OA 2QPEB 3BHBA 4GSUA 4P9ML 4ENEC 5IFAH 2BOBB 1BXUA 4KQ4L 3KPRD 1BJ1H 5GGRB 2AXWA 2EZ0C 2XG5B 4NPJA 2NNCA 5IBLD 2J20A 4NQXA 1XR9B 1MCSA 4R7DB 2R2CA 4JJ5A 4QOKB 1AGCA 4I18C 5JNYB 4GG8A 4X7TB 3NACH 2VUOA 2OR8A 4JFEE 1TZGH 3SY0A 4CBPA 1RJYB 3X1GA 2WZ5A 2HVJB 3KHQA 2UZPA 4LAQH 1DBMH 5CEZH 2VDLL 5E4EB 1AZZC 5FK9A 4I2XE 4APQD 5EEVA 3B9AA 4TKWA 1U8PA 1GHFH 2G30A 4H8PA 4UT6H 5J6SA 2EILB 3K6SB 1U8MB 4H1LA 2X2HA 4N87A 4KZEL 3HZVA 3ZR6A 2G3ZA 5B1JA 4RNRB 5IESH 3VTTA 1T6BX 1M9WA 1XTLA 5CJXA 5JW4M 2JK5A 2QQKL 3ZMNA 4EN3B 3DGGA 4HWZB 2N56A 2K8QA 3FSOA 1J05B 4P4KD 1RHFA 2X4NA 1INEH 3MNDA 5CAYB 1U2CA 2X3BA 4PJCA 2WKLA 5KWYC 3S8FB 1W16A 3ZTNL 2YXFA 3N2JA 5H2BB 5TGBB 3DETC 3TO4A 3S34L 5KW9H 5IHUH 5ISZD 2ZCZA 2O61B 4W4OA 2HRGA 2CHXA 1XIWB 3QFDA 4WU7A 3EJPA 5BRZD 5E6ZA 5I18L 3CZUB 3DA0A 1BG9A 3FU0A 3NJLA 2G9HB 4NO2B 5E9NA 3LYRA 3RLSA 2XWDA 3CHOA 4X4YB 3FMGH 3S3JA 4A2FA 3ZUCA 1N0LA 2H6PA 5E99H 4HYTB 3H2PA 3M88A 5ILTH 2QADD 1PZ5A 2PABA 5IWLA 4YEFA 4D8PB 3KYNB 3MBEC 5DXWA 4XO5A 2CIKB 2OTWA 4QGTA 5I1LB 5KVMC 4MXWH 5FYJL 4XPHL 1UOWA 2PPAA 3HC3L 1IGFH 3KGSA 4YDIL 2HFTA 2AKRB 3S35X 5IB4B 2HVBA 1AGEB 3FTWA 4R0LA 3IT8D 3PV6A 2OYMA 3UBFA 1AD0A 3P0YH 2VXQH 1PKQB 1LP9E 3LKNB 4HW6A 5GHWH 1DEEA 2FLBT 1UC6A 2JKRM 5DS8A 3VXRA 4D7BA 3LRMA 4PJGE 4QNPF 2X4UA 4UM8A 5CR1A 1BW8A 1A4KB 4PEEA 2CPCA 35C8L 2ZCHL 1N7ML 2BMKB 5FDYA 1DQQB 4WI6A 2I85A 5I74C 1HXYA 2Y07H 2EE2A 3K5SA 4N8PA 4P3CH 2VO8A 3HS0A 4KAQH 5B3JE 2PXYD 3FOMB 2YOCA 4UAOC 5LCVH 3TVMA 4HWBH 2BHZA 4KTYA 5I0VA 4DKFH 3C09B 4Z7OF 4XBGA 2X7LA 4M8UA 4KNQA 4FFWC 4PG2C 3N9GH 4UNTA 1FL3A 1G0DA 3MROA 3H7BB 4NB7A 2JE8A 5EU4A 2BPBA 4GRLD 5EBWB 2CJUL 1Q1PA 2MQ0A 1E42A 1TZ8A 3QI9C 3VWJC 4BZ1L 1WP6A 3E6HB 3HPJA 5L2KB 3OAYK 2HFEA 2VQ1A 3EGDA 3HE7C 5EWIH 3FT3B 3FNKA 3PQYB 4JB9L 3T8VA 3IVKA 3L1EA 4F33B 4MXVF 2XKNA 3VXSA 1TCRA 4KKBC 5D1QC 3BSZL 2ATKB 3GJFA 4ZPVB 3U2SB 5C8JA 3PUUA 4PJAF 2Q86A 2Z6FA 2J8UA 3LKPA 3SKOB 4M8RA 1S3KL 3TFKC 4G8GB 2CIIB 4MAYB 2X1WL 4WZ9A 4ALAH 1NM9A 4B7LA 3DO4A 5BOPA 3P30L 1QNIA 3AQYA 3L3OB 5E6IC 4L8CA 3RL1B 4JRYD 3GDBA 5DTFB 4J2QA 1OANA 4OLWL 2DLFH 2DM2A 4XB3A 2CZNA 3QIWB 1FH5H 4PB0L 2BS71 2VDQB 3AUWB 4H8UA 1NOAA 5FF6A 4Y1SA 4Y1TA 4NQEB 3AM8A 4PPTA 3TJHD 1MHCA 3EFFA 5HI4C 1UKQA 1SGKA 4LSSH 1JPTL 3QR1A 4M7KH 1ZGLB 2CDEA 4NQCD 5EEWA 1UJ3B 4PP2B 1DZBA 4JGMA 1LWHA 4QRSB 2CHDA 2R69H 2SEBB 3T3PF 4BFOA 5IROA 3WEAA 4XCCL 1DANU 3KPQA 4Q4EA 5CZVL 7FABL 1NMAH 3CJJA 3IDYB 2VMDA 1J86A 3PWLB 5C71A 2CO7B 3MPCA 5IEHA 5LJYH 4UDUB 1NAMH 2IXQA 4GBXC 1IM9B 3O2WL 4X6DF 4WWNA 1MHPL 5DMYA 1ZA3B 3IKCA 1N3NA 4JFPB 2R1WA 3VUAA 5J9PA 1KT2A 4F5CE 5EC1B 2EVGA 5ALCH 4HAKA 4WUUD 3RTQB 1XSIA 3D18A 3Q2VA 2FEDD 2UXTA 1KEGH 4TUOB 6PAZA 3CU1A 5M94B 2BIMA 3IRCA 2OYPA 4L48A 1LD9B 5D7SL 5J06A 4TS6A 4HJEA 3BKMH 2OKMA 2BY2A 3DI2B 2YARA 4RAVA 5K39A 4ZZFA 4YK4B 4Q4IA 5DJAA 3HIZA 4ZUUA 4Y7OC 3VCLA 4X6CA 4U2YA 3LS4L 2G0LA 4KBPA 5CUSL 4KX9A 4OGQC 4I3RL 5BUAA 1UQSA 5MP6H 1AS7A 4KH2A 4Y4KA 1YNKH 2UY7A 1CICB 4EI5C 5DZAA 2AANA 3M8OL 1HWGB 2GSIB 1MIEH 4LCVA 3QO1A 1SJHB 4MX7A 3PRZA 1EHKB 4O2CB 5D7IA 1KIQA 1IE4A 4ZMWA 4UOW0 4MNHB 4K3JH 2A3TA 4PWHA 3EFDH 3DOSB 5TE7L 1JMZA 3BISA 3KJ4B 4PR5A 4XP1L 3STZA 4KI1A 2R7EB 4DO5A 1U21A 3KLDA 3IFNL 4Y8AA 3WKYA 1PQZA 3VFSB 2K3TA 1URLA 2EC9U 3DNKA 4KXZH 4ZUTA 4GG6F 2A6KB 2ZG2A 4FQ2H 3W0WA 3EH2A 4IEFB 3MYJB 1JZIA 1MCIA 1MRDL 3DK2A 3VGEA 1RZ7H 1NCJA 1TKWA 4OCSL 4OI9A 3WV0A 5EBMB 2XG4B 3MV8B 4MVBC 5D2NA 4XX5A 2PW2A 5I8EA 4JHAH 3C6LD 5T1JA 1F58L 3FUEA 5IMLA 2E27H 4N2KA 3CLEH 5D71H 4F57H 5I30H 3DRTB 2IPKB 4IU2B 2VC2H 1MWAL 4LF3B 5E6RB 2R2EA 2P46B 4JRFA 2WZPD 3BMVA 3A22A 5HHVL 3EDJA 5D6DA 1RZJL 4PW3A 1HN1A 4TSCH 5IMOA 5JIIA 3F7QA 5JZ7C 5HPOA 4MCNA 1NBVL 4KXCA 1LDPL 1BD2E 5TDNB 3LZNA 4B9IA 4FCAA 4CSZA 4OD3H 2VDMH 3O4OB 1MNUH 5A43C 4WGWB 4ABQA 1QA9A 3CIQA 1WFTA 3IPBA 4N5UA 2PPCA 4PM1A 3C8KA 4YHYC 2HJKA 4KROC 4IJTA 4M1CD 1P5UA 1ZHLB 2AMUA 2EEFA 3N06B 4RWYH 3NJXA 4C56A 5HHMD 1KWKA 3K74B 4UTBH 2CKBA 1PD0A 2ZOWA 4WUKL 3WTWA 3DX0A 1FE8L 3VTAA 5KBKA 3VW3L 2Q0ZX 3QEQA 4LQ1A 2ODIA 3D06A 1I82A 4P23C 1ERNA 1QNZH 1CTNA 4L1DA 3GMMA 4AENB 3QR0A 1P4LA 1Q9WA 4DIXA 1EAPB 5CCJA 4PY7B 3TEWA 1X5KA 2QMJA 4UINH 4EZKA 1GOFA 3IGUA 5FFLA 1MLCB 2AI0H 4XWGH 3FO9B 4YUEH 4UMSA 5CF3A 3OGCB 1FVEB 3MR9B 3KXFA 1CG9B 2XZQL 1TVHB 4L4VA 4MJ6B 3QUYC 3RVWD 4JFFA 4AM0A 1K72A 3SE8H 2NTSP 1X5GA 3LNGA 3ZQXA 2F53B 2H8PA 5FECB 5BZWA 2GBVA 2HKAA 4YC2B 1A6ZB 1WTLA 4MKTA 2ADFL 4MA8H 1T21A 3TLRA 4PWJA 3UGXA 1M6OB 4NUPA 1S7SA 2C1OA 1M7IB 2IADB 5CMAA 4EDWL 4ZX3A 3MJGX 4PS3A 1T04A 4FQXC 1EMTH 1HXMA 3O9WB 2FSEB 4WFEE 1WBXB 2ICES 3DX8A 1I7ZA 4MB1A 5EFIB 5IKCB 1RSYA 4XMZA 3GDCA 4WY7L 2JKSA 2Z1PA 3PWUB 4LESA 1I8LA 2FJGB 5EIQA 4QOKD 2FL5B 1OARH 5FO8A 3DUUA 3LH9A 1NDTA 3TASA 3PGFL 3AU0A 1ODAA 1E8YA 5FKAB 1U2YA 2ZOKB 2FDBP 2O4EA 5JHLH 4RGMB 3QG7H 4O2EA 2H6OA 2CDFB 2FJHB 4UIMA 2WXIA 2M8XA 3MRPB 3QCTL 4OCRL 2WJ5A 4Y5YC 5IIEA 4FNPA 1GZPB 1P5VA 2KC0A 5GS1B 1AD9A 4B9ZA 1LEGA 3LKRA 4L4TA 5AZ2H 1CFTB 4BUQA 3A6CL 3QA3A 1BYOA 2AS5M 4AGPA 2APTA 2Y3NA 3CK0L 4XGZA 4Y4FC 3ZYZA 1HT6A 1IFGA 5TF1L 3M1OA 4LEBA 3X3GH 32C2B 5GS0D 1JP5A 2D03H 2Y7LA 4KVCH 3BYYA 1XX9C 4PLOB 3BWAA 3RB5A 4IIQA 2PPEA 1E9PA 3EYUH 3BGMB 3IDJB 4EN3D 1E67A 3WTYA 4JL2A 1I4FB 1Z7JA 4JN1H 3VFWA 3MLZL 1E50A 1FFTB 3E3QE 1U8CB 3CDGB 4UTAH 2WKOF 4EKJA 5EO9A 1KCVH 1AH1A 4PJEB 3KPMA 3OD3A 3G6JB 3BQUB 2PYEE 1PS3A 1WVZA 3FUKA 7CGTA 2CWRA 2QELA 2Z31C 1DLFL 3MJ7A 4OM1H 3V4PB 3B1UA 2ZX8A 3VFUA 1M57B 4Z3FA 2WUCH 1SOXA 4K9JA 1ORSB 2PMZA 5DRWA 5ID1B 4DZBB 3I02B 1EVTC 3PABA 5JHMA 4Z0BH 5I1JL 1D7FA 1KTLB 3H6AA 4PRNA 3X12B 5F3BB 5IFHH 3SD5A 2VT0A 1AQDA 3H9YA 3PL6D 3UDWC 1RUQH 1A6PA 4XOEA 1QI3A 4LEEA 2ED7A 1KB5B 2NR6A 2JCCB 4XZUB 1MW0A 5B39B 2OZ4L 1OCWL 4MQSB 1IGTA 1N19A 1OPGH 3MRKA 2F08A 2I7OA 4YDKL 4WFGE 4G3YL 3PE9A 3S8GB 3UC2A 2WXKA 4GRMB 3UEQA 5GGUA 1AOHA 5JR1L 1SFHA 4ZUSA 1IGYA 4M6OH 3AQZA 3QYCA 5AUMA 3UTZA 5LBGA 1E7VA 2QPUA 1PNCA 5C0AE 4X0KA 1H0DB 3FRUA 1J10A 2DLTA 1JGUL 5GJTH 5CU9A 5FYJE 2JELL 4F8PA 1GJUA 1OAQH 2AJUH 2VSDA 3RY6C 5IM7A 2C3WA 4X8CA 3FFCA 1FFNB 2Q87A 2OS7A 4HPYL 4EVNB 1WT5C 3NCBB 2E86A 2R2BA 1IV8A