1MG2C

Mutation of alpha phe55 of methylamine dehydrogenase alters the reorganization energy and electronic coupling for its electron transfer reaction with amicyanin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Methylamine dehydrogenase, heavy chain
publication title MUTATION OF AlPHA PHE55 OF METHYLAMINE DEHYDROGENASE ALTERS THE REORGANIZATION ENERGY AND ELECTRONIC COUPLING FOR ITS ELECTRON TRANSFER REACTION WITH AMICYANIN
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 25
structure length 105
sequence length 105
chains with identical sequence G, K, O
ec nomenclature
pdb deposition date 2002-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1mg2C00
1MZZA 2FT7A 3QJRB 2BHFA 4A2HA 2TSAA 1WS8A 4N4YB 1ZPUA 3T6XA 4WTQA 2TSBA 1B3IA 5F7BA 2YXVA 5AFAA 3IEAA 2DWTA 3OQRA 4YSTA 2OJ1A 4KNUA 1DYZA 1PNDA 3CVCA 4YSUA 1WAEA 1A3ZA 1XB8A 1AG6A 2HXAA 2XVBA 2YAQA 3DKHA 4HZ1A 2J56A 1WA0X 2I85A 2VSMB 1JZIA 5B7MA 3EF4A 4HHWA 3OMAB 2MTAA 3WNIA 4KOCA 4YVNA 2J57A 1IC0A 3PLYA 5AZUA 1OF0A 2PPFA 4E9QA 1XB3A 2FQGA 1NIFA 3X1NA 1AG0A 3QJQB 2IWEA 2W8CA 2IH8A 2QDVA 2UXVA 2PPCA 1JZHA 1MG3C 1N70A 4L0PB 3PAUA 1SDDB 4BDVB 1NWOA 3ABLB 3AG3B 4CSPA 3BVDB 2FQFA 1OV8A 3WKQA 3CVBA 1URIA 3ERXA 1T5KA 2FT8A 3WNJA 4QKTA 2J5WA 1L9RA 5A7EA 3NJLA 4GP5B 1E67A 3T9WA 6PCYA 1L9QA 3AG4B 3UAAA 3KW7A 3FPXA 4E9SA 1GS6X 1KBWA 2UXGA 2VW4A 1SFDA 3ZIYA 1AZNA 3NJHA 2WO2B 1GS7A 1JXGA 1ET5A 1PAZA 2IAAC 1N68A 3ABGA 1J9QA 2DV6A 1L9TA 1GSKA 1IBYA 1ZV2A 4DP1X 2GIMA 1BXUA 1MG2C 3EH5B 3EH4B 1JZGA 5I6NA 4A67A 3T71A 1V54B 2GC7C 1J9RA 4RH4A 4WKXA 3SQRA 1BAWA 4FA7B 1W8EA 5ANHA 1AS6A 4KNTA 4MFHA 5D4IA 3ASOB 5B1JA 4E9WA 3NJMA 1SDDA 2RACA 4F2FA 1ASPA 1SF5A 1BEXA 3H56A 5TK4A 4E9VA 2ZWNA 4DP7X 1QNIA 1ZIBA 1BXVA 1KBVA 2GC4C 3T6VA 3UGEA 2EIKB 2AFNA 1TKWA 3V9CA 4DP2X 2QT6A 2UX7A 3DTUB 1JVLA 2GB2A 4DP0X 6PAZA 1R1CA 2OV0A 2UXTA 4KO6A 1ASQA 5D4HA 4DP4X 1ZIAA 5B3SB 1OE3A 2HZHA 2GI0A 2PP8A 1OCCB 2JFCA 5I6KA 3DIVA 3UAEA 4BXVA 1NWPA 3X1EA 1SF3A 2XV2A 2DYSB 3PAVA 3WIAA 3EH3B 1NIAA 4G7RB 4G71B 4YSSA 5B7EA 1J9TA 3FQ1A 4G7SB 2BP8B 4DPCX 1CYWA 3PPSA 5TK2A 5B1BB 3NJFA 2DYRB 1GS8A 3RYMA 3ABMB 3ZX1A 4YSEA 4NAJA 1ETJA 2N0MA 2JXMA 4GXFA 2GHZA 3NP3A 1PMYA 3PXLA 3ZBMA 3UABA 4AKPA 5I28A 3NSFA 1J5CA 4HIPA 2BP0B 1RKRA 1F56A 1CC3A 1RCYA 4A66A 1WS7A 1E65A 2EILB 2XWZA 2AZUA 3FYEB 7PAZA 1FA4A 1AIZA 2XXFA 3BQVA 2PPAA 1L9SA 3OD3A 1HAUA 4GY4A 2J55A 1AAJA 3QJTB 4M3HA 4UANA 4E9RA 3MBWB 1PZAA 3IE9A 4BWUA 2XLLA 4YSAA 5FC9A 2HLEB 3WI9A 1A4CA 2IDFA 4NERA 1ID2A 2YAPA 2XV0A 2BP8A 4GP4B 1GR7A 3FSWA 3U25A 4AX3A 3AY2A 2PPDA 3FT0A 1M9WA 1ILUA 4YSCA 1AANA 3OMIB 1JZFA 3JTBA 2WO3B 2AVFA 2VSKB 2X88A 2Q5BA 1OOWA 3CDZB 1GW0A 3V9EA 3EHBB 2BP0A 3QQXA 5I5JA 4ENZA 4YSRA 4KO7A 3AW5A 2P80A 1PZBA 1PNCA 2QDWA 3GYRA 1PCSA 5PAZA 3TBCA 1L9OA 1PLBA 4DP5X 7PCYA 2QPEB 3FS9A 1IBZA 2FWLB 2IDSA 3NJIA 2I7OA 2EIJB 4ZK8A 2XYBA 2A3TA 4P5SA 3G5WA 2FJSA 1TEGA 4A2FA 1KV7A 1NPJA 4DP9X 3GDCA 2HRHA 1AOZA 2BWIA 2R7EB 3L45A 1NIDA 3ABKB 5I5IA 1FFTB 2WSDA 2EINB 3HEIB 2FNWA 3NP4A 3FSVA 5I5MA 1ADWA 2DWSA 1NIBA 1I53A 3UACA 1BQRA 2VM3A 1TU2A 5E9NA 3SBRA 3D12B 3PCYA 2ZXWB 1ZDQA 3S3CB 5B1KA 1ET7A 3CDZA 3N55A 2AZAA 5PCYA 4X4KA 1PF3A 2DY2A 3T6ZA 3S3DB 2E86A 3NT0A 5B7FA 3QJUB 1PLAA 1OCRB 4KOBA 5F7AA 1OE2A 2IDUA 2Y1AA 4BWWA 3S8FB 3IBOA 1JZJA 2ZONA 1NIEA 1FWXA 3FQ2A 1A8ZA 4W9ZA 4P5RA 5I26A 4GYBA 2H47C 2AANA 2YAHA 1L9PA 4KNSA 2FQDA 3FPYA 3QJSB 1V55B 2H5UA 4AKOA 1X9UA 4DP8X 2FTAA 1AQ8A 2PP7A 1XB6A 3FU7B 2B08A 3S8GB 1OE1A 3N2JA 2R7EA 4QLWA 3S3BB 3JT2A 2NRDA 2XV3A 3ASNB 5I6OA 1SHWA 1AZCA 2BZCA 2IWKA 5D4JA 4NB7A 2BW4A 2PCFA 2FQEA 3NSDA 2CBPA 1W6LA 2PPEA 2GSMB 4DP6X 3FU8A 4A68A 2Y69B 1MDAA 1BQKA 3NJJA 4YL4A 3QJVB 3HB3B 3TA4D 2UX6A 1XMEB 4BXSV 5I6MA 2UXFA 1ASOA 3CVDA 2YAEA 1PY0A 2HX8A 2IWFA 3PAZA 3H4HA 1VLXA 1GYCA 2XX0A 1AACA 1OCZB 1AZRA 3OMNB 1CYXA 1BQ5A 2EIMB 1BXAA 2YXWA 2XX1A 3X2QB 1GY2A 1SHXA 4HCGA 5I6PA 2CCWA 1GY1A 4HCIA 2OCCB 3AG1B 3C75A 5IY5B 1JXFA 1V10A 2VMJA 1IKOP 2XUWA 5B1JC 1JZEA 4JHUA 1AZUA 1KCWA 3IN0A 5AKRA 1KYAA 4G72B 4DPAX 2YQBA 1BYPA 3CZUB 1NTDA 4G70B 1A65A 1SJMA 1J9SA 1NICA 3TBBA 4AI7A 3ZDWA 4JHVA 3CG8A 4JKNA 2QPDB 3FU7A 3NYKA 3TASA 1J5DA 2VW6A 1IUZA 4F2EA 1NPNA 1RZPA 2CJ3A 3FSZA 2H3XC 4HAKA 4A2EA 2BWDA 3AZUA 4YSDA 5LDUA 4A2GA 1RZQA 2GBAA 4FAAB 2YAMA 1JVOA 4A2DA 2IH9A 3AG2B 4EF3A 4TXVB 2MRYA 1CURA 2IDQA 4YSPA 1KDIA 4N8UA 2HX9A 4HALA 1EHKB 1QHQA 2FT6A 1ZDSA 2VM4A 1AZBA 1AR1B 3QPKA 2XU9A 1OCOB 1JERA 3KW8A 4YSQA 1HAWA 2ZOOA 4F7KA 4AZUA 3NSYA 1PLCA 2JKWA 2YAFA 2PCYA 3UADA 1UATA 1KDJA 4YSOA 3NSCA 1E5YA 3X1FA 1DZ0A 1A4BA 2X87A 2P80D 2BO0A 1A4AA 9PCYA 2HX7A 4CSZA 4KO9A 4GP8B 4AKQA 4E9YA 1JOIA 1EZLA 4Q89A 3H4FA 5B1AB 1SNRA 1NINA 3FQYA 4BWTA 2W88A 1PZCA 3GXUB 3NJKA 1X9RA 1HFUA 2CALA 3WG7B 3FYIB 1ET8A 1KGYE 1SFHA 2PLTA 2BZ7A 2VN3A 3FSAA 4BDVA 3FU9A 2Q9OA 2CUAA 4DPBX 8PAZA 2XXGA 4E9TA 3SBPA 4YVUA 1JXDA 4W1TA 3IN2A 2BW5A 1QLEB 4PCYA 4KO5A 1MZYA 2VW7A 1TEFA 2IDTA 4K9JA 3NJGA 2I7SA 3WKPA 4UAHA 1W6WA 4M4RB 1ILSA 3X1GA 4G7QB 4HCFA 3TU6A 2B3IA 2CAKA 4E9XA 1AS7A 1M56B 3SBQA 3X1BA 4Q8BA 2LLNA 3T6WA 4PAZA 4BK5C 1CUOA 2HRGA 2YARA 1M57B 5EHFA 4HHGA 3NJNA 5I6LA 1WA2X 4UF7C 1WA1X 1BYOA 1NZRA 1NDTA 2YAOA 1KCBA 1E5ZA 2PP9A 1AS8A 1YLBB 3OM3B 1E30A 3MX0B
chains in the Genus database with same CATH superfamily
3D2UA 3EJSA 2R1WB 1YHPA 2NUTB 3MYJA 3QNZB 3L1FA 4W9FC 2EIEA 2IANA 2E6JA 3D05A 3MOAL 3EZ8A 2X70B 4QXWA 3LMJL 5DO2D 1UOKA 3VH8G 1HZKA 2YFOA 4KNUA 4YIQA 2ERJC 3DHPA 4O51A 4RIRB 5KYNA 4MJHA 2PW1B 4DQOL 3K72A 3QCUL 4GQQA 5DZLA 4EUPG 3T65B 4B9YA 5FW7A 1FH2A 5E94A 1Z9NA 2FEDD 4JBSA 3ZE1E 4A7VA 4L4VB 4M1DL 4A7QA 4JM2B 1VFOA 3BEVB 4JCMA 4KTDH 1JN6B 1I7ZB 2MKLC 4GRWF 4KOCA 2BX5A 4Y19B 5AZUA 1F45A 3QZMA 2X4OA 4KKNA 2ZXBA 4QYOB 4YZFE 2DICA 1QI4A 4PUBL 2IH8A 2VTFA 3DJRA 3E6HB 3MRQA 4OSUL 1CI5A 4A7SA 4Y4KC 3NG5A 4TMPA 5FCUH 1DQLL 1SDDB 1YRKA 1XIWA 4TLSA 3AG3B 3K2MC 1RHHA 4JO3L 4QHPA 4MCZB 5IUSA 3ILEA 4N2GA 2P7TB 4GAGH 5KUMA 3T2QA 4AK2A 5KVGH 3EYUL 5IHBA 1VGEH 1IBBA 4PJBF 2ZCHL 3FT2B 1PZUB 1L9RA 1G6RH 2XQBL 3IXAB 1NPUA 1S2EA 4CKVX 1G5AA 4ALAH 2M83A 1CL7H 1K3IA 1KACB 4Y4HD 1TJGL 2MCMA 1N5AA 5CO1A 3S7GA 1T7VA 4TULL 5EU6B 1IC4H 4PGJA 3VD0A 2UXGA 1AYRA 4DGVL 5GRWA 4DK6A 4TQHA 2XYCA 5IHLB 3EJJX 3KBFA 5A43C 5D1ZA 3GTNA 3FT3A 2DIJA 4B9CA 3VFUA 3VFSA 1A9BA 2Y36H 1D5XA 3AVEA 3NH7L 4EXPX 3UTPE 1LO5B 2AJ3B 1IV8A 2P4AB 2GIMA 3SDDB 2HJKB 3SYOA 4WO0A 1JZGA 4L4TA 5I6NA 5CXPA 4A67A 1VSCA 3O8XC 4ONHB 4PV8A 2WIIB 3O2VH 3T1FA 2Y1ZA 4IS6A 3BZ4A 2AXFB 2GABA 5ICZA 1DHKA 4J4PD 4MA1C 1EA9C 2HVJA 4K8RL 3CDFA 3HN5A 4ONGL 4P2QE 5DJ8B 5B8CA 1P69B 4Y16B 1UD4A 1Z2KA 4HCRL 5GS0H 3UTPD 4PCTA 4E9VA 2ZWNA 4F33A 1MQKH 4ZBJA 4XNXH 4DO6A 2EXTA 1HHIA 1TNMA 2GTQA 3FQUB 4YR6A 4RAVB 5IFAL 1J5OL 4I77H 3QNYA 1CLOH 1T22A 1ANUA 2JB5L 2ZOUA 5J06A 4PQXA 4FQCH 5D4HA 5EWIH 5CIPA 1NCWH 2ROXA 4P2QD 2C3XA 4UIKH 5JIPA 2VN6A 5F7NC 3DX7B 2J3SA 1NCJA 1JWUB 5CZRA 4DAGL 5FWQA 1H3WM 3GSXB 3QXUA 3PRZA 4XO4A 4FYTA 3KH4A 4G71B 4ZZFA 3MNWA 2W9DH 5C86A 2EVHA 4LCUB 3DX9B 3QQ3A 5IM7B 3HFMH 3NJFA 1H3PL 4QLRA 1GJUA 2WWKO 4NO5B 2LLGA 1PY4A 3ZX1A 3GRWL 4J3SA 3O3EB 1NGQL 2VQ1A 3HC2A 1A6UH 4NENB 1OAKH 4UV4L 5DJ0A 3TYFB 3DMMC 2FECL 1SJVA 4NNPH 3R4DA 4I18B 4CN6A 4ZZKA 3VWJB 3B2PA 4I8DA 4EUPA 4RWYH 3EJPA 5EBLA 3U30B 5E5MB 3RFZC 1JXJA 2G2NA 4YDNA 2DQDH 1KEGH 1F0LA 1F56A 4K8RD 1F1DA 1FLTX 2BS9A 1RCYA 3WHXB 4NAQA 1WS7A 1H3GA 1MW1A 2G4EA 3WJLC 1PYWA 2VLKE 3TN0D 3BSZH 2PN5A 1PBYA 1YEEH 4LASL 4U0QB 3MRRB 5C8JB 3TBVA 1OSPL 3IGLA 2X5PA 4FCAA 5GGTH 1FL6A 1QLRA 1U8HB 1SLVA 3L3IA 2CO7A 3GNMH 3QUMH 3B5GA 1PZAA 4JG1H 1QSFB 2AK1L 3MUJA 1AMYA 4MMYA 5J13B 3U0PA 3LSOA 3II2A 3G04B 5E0QA 4Y2DA 2VLKD 1JNNL 3WI9A 1NFDA 4K7FA 5E7BA 2LFEA 3D0AA 5JXAL 2Z7YA 1ID2A 2ZP8A 3RUGA 1ACXA 5HD8D 1INDH 2WBJD 1GR7A 2YD9A 1ZTMA 4PHXA 4PJ7B 1YUHB 2PPDA 3D4ZA 3FT0A 3ZTNL 1A25A 3ZDYF 2R69A 1TPXC 1G7QA 4LRIA 4MD4B 5I1AA 1WO2A 4QY8B 3H9HA 1KTKE 4X6EA 1S3KH 5E6IA 1PD0A 1SPDA 1TQUA 2XFXB 1IJNA 4LEOB 3GINA 3TIDA 4BZ1L 4Y5VC 4U6VL 3ARFB 1NSNH 1TZAA 4UUJA 1EGJA 4HUNB 5TDNB 3RVWC 4F27A 3EOBB 5HYJA 2E4TA 4XVJL 4S1QH 1OTSD 1RU9H 2VRQA 2VISA 2V5RA 2D7TH 2QSCL 1DUYB 4WW2A 3BGAA 4OFKA 4FRWA 1A22B 2R0KH 5G4MA 4HIIB 4K8RC 3RVXD 2PXYC 2GFBA 3MSPA 1UH3A 2B15A 3ULUE 3NIDE 3SPJA 1Z9MA 3M1BA 4IQHA 1GRWA 2IDSA 3ASWA 2FX7H 3ZYZA 3IU4L 1CVRA 4P5SA 1W72A 4OIAA 5LG1A 4DERA 5A2IH 5EOCJ 5BZDB 5JOFA 4XNUH 2BWIA 3VFVA 2ZWYA 4G80A 3WGVB 3C60B 2VLRE 3WCYA 3ZZQA 5G5DB 5J6GB 1NFIB 1FP5A 4JO2L 2WP3O 4LCIH 4HWBA 2WQRA 1A47A 3N1GC 4OFQA 3ULUD 3FTWA 5GGUB 2LU4A 1QMUA 1KGIA 2WUBH 4R4BA 3OWEA 1NIBA 1FQ9C 4MKTA 1BD2B 3UCRA 5D7JD 2O6DA 3HUJE 3MRHB 4YN3A 1MN4A 3RAJH 4JFDB 4PJCF 3HC4H 3QEGH 2EDFA 4TNEA 2WBJC 1GMEA 1ET7A 3FRPB 4PJDA 3NGBC 4X4KA 4MBRA 1GHFH 4ORZC 2F53B 3KLAB 4L05A 3ARGA 3NIGF 2DDQH 3Q8AA 4NBZB 3O6FB 4PGDB 3AM8C 5HHQB 3EOYG 4HU2A 1GPOH 1RIUH 4OKVA 4J3TA 4Z3FA 2NXZD 5T5FL 2MEJB 4HKZB 3DA0A 1C8QA 4JRXA 1KIRB 1T2QH 1K8DA 3ARED 4KXDA 1PGRB 2C26A 3I3DA 3AADB 2ZPKH 4XX5A 3WL9B 4G7YL 3ZRCC 5IB5A 2XIDA 2YKLL 5JW3H 1IGJB 4GRLD 3NABH 4CC0A 2BSBA 3G6AB 5D7EA 4DK5A 5J89A 2O61B 2B8OT 5FYKU 5HGDB 4AIEA 2R9HC 3KCPB 5LNDA 2JVUA 3GMPB 4HSAC 3VXUB 1MW0A 1VCBC 2JKLA 3BXNB 4U3CA 3I9GH 2BOBB 1FVDA 5IFJB 5CU5A 1QI5A 1QRNE 3MOBL 3R0MA 4FX5A 1KJVA 2PO6A 4LXFA 4E42B 4H0LC 2CBPA 5KN5B 4PMFA 1MCRA 3INUL 2EYTA 3ZYJA 4LPXA 3BP7B 5EOQH 1JF6A 4PJBE 4W4OC 1G6RA 1KCKA 3WSQH 1SJXA 3C6LB 3GJEA 2APXA 5HPOA 2ATAA 5IG7B 3H9SA 5AOZA 4B5EA 3DYMA 5IESL 2IG2H 3L1EA 5F9OL 4XAKD 2A4ZA 5L2KA 3QQ4B 4KKRA 4MJID 3CFTA 1QRND 3F83A 1OCZB 4HUWA 3VXPA 4PS8A 1CS6A 4N87A 15C8H 2JKSA 1GY2A 2G5RA 3WY2A 4OZ4B 3KE0A 1O6SB 3GIZH 3VWKC 4P46B 4ANKA 3C75A 3GC3A 2CKBL 2Z8VC 1JZ8A 2Z92B 1KIUB 1R3HB 4JJ5A 3BPCB 2ZZUT 1NEUA 3M8OH 4R6UA 3U83A 3NK3A 3UTTB 2BY2A 3OPZH 1Q90A 2P3YA 5I1LA 3CDGA 3OSKA 3L4YA 1SJMA 3G5ZB 3S88H 5D71L 5F0JB 3FTGA 1JPSL 3PDGA 1LJMA 1UZGA 4LOVA 1OW0C 4NKMB 4H0HB 5ADPL 3N41B 3UTZB 1UXSB 3OXSA 4KV5F 3M46A 2UWEF 4K9EH 4K0OA 3CZNA 2BWDA 5BVPH 3SPIA 2NXYC 3HMWL 3Q5TA 3L9EA 1XVSA 2BY1A 3MR9B 1A6PA 1CURA 4M7LH 1A2YB 2HAZA 3V5DA 4ZPVB 3FOMA 3D48R 3ES6B 1TJHL 3FO0H 1G9ML 2AJXH 3RPIA 5ABDE 2XU9A 4F9LC 3IJSA 3DJ9A 2YEQA 1FNGA 4HLZH 3VD5A 4HBCH 3WLWC 3MRJA 1XBDA 4EAEA 4YXHH 2P45B 3QRBA 4H1LB 5IREA 3NZHH 3BLKA 3MKGA 2Z7WA 2KDGA 5K9OA 3V5HA 1EAOA 4ZT1A 3LXAA 4Y2OB 3B7YA 1U4EA 3TZVD 3JWNH 4DZBB 2ZXAA 2BY0A 4ZSOA 4LSUL 2CCVA 4TTDC 1NOAA 3G5YB 3K6OA 1KY7A 4V1DA 3ROLB 4BWTA 4J3UA 1HFUA 3PF2A 3H42H 4GH7B 2BZ7A 1QO3B 3UGXA 3K6DA 5EZJA 3QJFB 2XZQL 2Y7NA 3R7QA 3KJ6L 2XXGA 1LO4L 3CBKB 4X6CF 2R2BA 2XWEA 1BWWA 3LIUA 3F12B 3UAJC 3WIFA 3OAZH 4Z5RA 1U36A 5ITBH 1MZYA 2X3AA 3A4EA 2IDTA 4QXUL 2F19H 3HI1B 2RIKA 4ZAKA 4ZYKA 2Z35B 2W80C 2UZPA 3D25A 3UO1H 3GGWB 3QIBD 3IFOB 1P7HL 5C9KA 5CEZL 5IVZB 4QDGA 2J1KA 1X7TA 5JQ6H 4KRLB 2QVIA 1BBJB 3V2AR 3DHMA 4AVJA 1AP2B 2XBZA 1HI6B 3ATBA 1KXQE 1HXYA 1M1SA 2I5YL 5E8PB 3ZL2A 1RP9A 2FK9A 2MCPH 1WA1X 1BWMA 4YWGL 4PJXF 1KCBA 4QTIH 4HLEA 3U7WL 1KTCA 1MLBA 1XGTB 4HIEA 2AK4A 3KVQA 4YHIA 3TT3L 2V2WB 2QR0B 4A2HA 2EIZA 2BHFA 2V5SA 4IOIA 4RMQA 3WJMB 3WMSA 3ZDYE 4N4YB 5BV7B 1TYEB 4AE0A 1OANA 4NJ9L 2P5EE 1IC7L 2P5WB 2J72A 2UY6B 1DBJL 1KZYA 2H1PH 4JRWA 3UZEA 4DUVA 5CEZE 1PNDA 4AQOA 2H0EA 1MJJA 3BVXA 4KY1L 4JE0A 3DHJA 1URZA 4MDIB 5D7IF 4L3CB 4R4ND 3OXRB 4HHWA 3WMPA 4D94A 1EPFA 2X89D 3GSOA 4U0RB 2P5ED 1QG3A 3SD2A 4JN1H 4XODA 2WHVA 1OF0A 2PPFA 4OF6A 4PVLA 4Z7UA 5I2IA 4EZMA 3QO1A 1HSBA 2K6WA 3TV3H 3QFJA 2ZT9C 1K72A 3OX8A 5HSFA 3ULVH 3G5XB 4A6YA 1RVFL 4AYSA 4JFZH 5ABZA 4JZNB 4PREA 5F9DC 3SDAB 4YLCA 1KIPA 3MUGB 1CF8L 3FOLA 2EH7L 3MBXH 1OSEA 4X83A 4EIZC 5E9DD 4D0DA 3ERXA 5E6YA 5E1GA 2K45A 3IDYC 5GRJL 3ZT7A 3LPPA 1I7UB 3S4SB 1YNTA 2P8LA 3GMQB 4E41B 3MGAA 4NT6A 4PJCE 5D2NB 4N2CA 4ZMLA 5ANME 5F1NA 4LKCA 4N2IA 3VYOA 4X4YA 1DSFH 1SFDA 3ZIYA 4RGNB 2CUMA 4Q9CA 2NY2D 3NIGE 4HUUB 2EYRA 3NCCB 1ET5A 1F58L 1F3DH 1UB6A 3C5JA 1EHLH 2EDWA 1TITA 3RWIA 3EYSL 4ABUA 1D5IL 1UGKA 1U3JA 1EMTH 1UM6L 5ENWB 1RUKL 2DAVA 2DM7A 4XNMB 2AJSL 3EH4B 4R2GC 1CTMA 2JXMB 2O6PA 2CG9X 2VNCA 1J9RA 4KAQH 5DURB 4FA7B 1UB5B 4HDIB 4KNTA 1F6LL 4KQ4H 4MQTB 3QUXB 2WY3B 3MROB 1VFAA 5BO1H 4MNQD 4O51B 3II1A 3IDNB 5FV1L 3S37X 2YWYA 3UZVA 3DWTA 5DHYA 1HEZA 4UI2A 4UIMB 2EDHA 3U2IA 3K1DA 4XP9L 1SQ2N 5J11C 5E94B 4MHHI 1ZGLB 2F15A 1S7UA 3BP6A 3CSYB 3WY4A 4FQQA 3BAIA 4BCZA 3HE6B 4BGLA 5CZKA 1KJ3H 2K7QA 4YX2H 4ZW7A 4HH9A 1R24A 3UAEA 4NDMA 5GRVK 6FABH 2P26A 4H2AA 4O5LH 5DZAA 4L0ZA 5FS5A 1QTPA 3FRUB 4GXUM 2V9RA 1DANT 3TGXA 5I76A 2G5UA 4KDVA 3CMOL 1CYWA 5SWZB 1L6PA 3CVIH 3QHFH 4N0UA 4FZ8H 3DLQR 1XIWC 1DQVA 3GLDA 1ZA3B 2FH8A 4X8GA 5GJTL 3ROOB 4NZUL 3OKDA 5DUML 2IFFH 3VM7A 3N44F 3L7EA 4XH2B 5FO2A 5L7XH 1D5MB 3H9YA 4KRPC 3VGHA 3L4XA 2QZ5A 1A8JH 4KZCA 5EEWA 1DJGA 1IU1A 1WWBX 4XOBA 4KV5E 1T0NB 2UWEE 3RVTD 4FG0A 1YEIH 3LB6D 1RZKC 3RILA 3DRQA 4GSDH 1D5XB 1PDKA 4GXVL 1Q94A 1TSRA 2TAAA 1ESOA 1E27A 3SQOH 4UANA 5D1ZC 4D0CA 4UYQA 2AVGA 3BPNC 2XA8L 2IJ0C 3L81A 1P1ZA 1GGCL 2ATKA 2XDHA 1A0QL 5LVEA 5EEVA 2OCFD 2XLLA 4LK4A 5JA9A 4FFZH 2XWRA 1XFPA 1ROWA 2ZX8A 2BNRB 5F7KC 3GM8A 1EGJL 1KT2B 4LP4A 5F9WC 5J7CC 4L29A 2OXGB 3OKMB 1GGUA 1D9KD 2L7UA 4F33B 2KMWA 2K3HA 1UJTA 1OY3B 3TCXA 1CE6A 3H9ZA 3QNYB 4FNTA 3UL4A 1J0YA 2A9NL 5B8CC 5IMKB 3LNEA 3BAKA 1DBAH 3TCLB 1X5JA 1OARL 1TETL 4RESB 5GISH 5D7LE 1FYHB 2ZTBA 1I1AA 1JWMA 4AG4H 5IIEB 1W72L 4WWNA 5C6TL 4ENZA 5ISZB 2H2SC 3P9LA 1IGFH 1MELA 3EJTA 2NX5E 4P2OD 1YEHL 4CNIB 2ZICA 3A5VA 4X6CE 4Y2NA 1KGJA 4ZMTA 3MV9E 4IW4C 3GI8H 1JPGA 1BGXL 1DEDA 1X5LA 3FS9A 2WXJA 3B1TA 4G9DA 5I1DA 5D7LD 3LB6C 2LW3A 2AQPA 5E0FA 1ETZA 1MFDL 3QARA 1I31A 3F65A 4HXAH 1E4XH 5FO7A 5IROD 4PJAF 1FFPB 4LSSL 3AU1A 2NX5D 2WXFA 5LBSA 5IW6B 2NT0A 5IQNA 3NCBB 3MO1B 3ABKB 1TLKA 3DOSA 4FLHA 4GG8B 2Q76A 1TFHA 3RJDA 3US0A 4FNRA 5C0BB 1IVTA 2WNGA 3FHQA 4N2LA 1VPOH 1X9LA 2VRAA 3E6FA 1WVZA 3MV9D 4FHJA 4NBXB 3MFFB 5KANI 2BZDA 2I24N 4NRXA 4I3RH 2I9TB 2IXQB 4Z0XA 4B95C 4PJXE 4PS3A 4UDTB 2ZUUA 1OCWH 1TF4A 4RX4D 3LEXA 3PGCB 5DD1H 5DI8B 5TPWH 3CLEH 3T4AB 3UROR 4BSVA 1D9KC 3L3IB 5DMIL 3VXQA 1JTOA 2GW5A 5JHDA 1A1NB 1NEZB 2A77L 3EGXB 3OKNA 8CGTA 4HWZB 4LCVA 4MB5A 4IGBD 2NNRA 5F96H 3EGSA 5KSAA 2NSMA 3LSOB 4N2BA 3UTSE 4IBLT 2GQHA 5FOBB 3NA9H 1M71B 4KITB 4P5TA 3MREA 1P53A 5CUSL 5J3HC 2QSTA 3QZPA 4HX1B 1GMIA 1O5DT 3BW9A 4M43L 5B38A 4IRSD 1V05A 5D7IE 5IMMA 3ZE0E 4LSPL 4Y2DC 3FC8A 3WGUB 3TBTB 1MEXL 5KJ7E 3GZOA 1JGLH 1G7QB 2AMGA 3UTSD 2B1OA 1N8ZA 4NSKA 1PD6A 4MCYA 4C59B 1RZIA 4PY7A 1K4CB 1MI5D 2XNAA 3L3GA 3S96B 1WFNA 5I0XA 1IC5L 3EHBD 4WNSA 3C5SA 2Q3XA 4YGAB 4XGZA 2JI3A 4LRIC 1U30A 2VISB 1QEWA 1CDHA 2J8HA 1J86A 4H5SB 5IROC 5E6IC 2BW4A 4OD3H 3MJ9A 1BZ8A 1UXWA 4U6TA 1NGZA 2O5ZL 1W6LA 3IU3A 2NDFA 4PRAA 3PWNA 3RIFF 3MUZ1 3GSQB 2CSPA 1W8NA 3MDJA 3QJVB 4FLRA 2Z64C 1UYWH 2DD8L 5E8EB 5IF0A 3CFEB 4WW2C 2ZD0A 2Y5QA 4JDEA 3EG9A 1WDAA 1P4UA 2NY3B 3RWCB 4AGMA 4ZMZA 4ZMWA 5JOFB 3HW7A 5AQ0A 2FJHA 3MRKB 2X40A 4F8QA 5LXGH 5A40E 2OTWB 3H9SE 4O2CB 4OI9A 5D55A 1DBKH 5I6PA 3ZGIA 1GGIH 4U05A 5I19H 1D5ZA 2VC2L 3VSQA 4XCYB 1MCPH 3LV3A 2H9GB 4X7TA 5AKTA 1TXKA 1HH9B 1QR4A 4PIBA 4X5RA 3AB0C 4N68A 4GUCA 2OM5A 3MLYH 4R7NA 2HWZH 3L3DB 4TSBL 4OV5A 3QR2A 5D5MB 3ARGB 5TE4L 4UOQA 5HVGB 4QXGH 3FUFA 3R19A 4PLKD 5JOEA 3ZTJH 3BMWA 1CFNB 5FHAH 1H3XA 1MNUH 5E23A 3G7TA 4LB8A 4MJJA 4KMQA 1C08B 4JRXB 2GBAA 3EHBC 4FAAB 5T3XL 1OP4A 1RL1A 5JA8B 5I75C 5GPRA 1NC4B 3LQMA 2WXQA 1E43A 1KXTA 2M1KA 1A6AA 1AI1H 1ZDSA 1QP1A 2CH8A 4GUPB 1TQCC 2YEZB 5FKPA 3CXFA 3QPKA 4H20H 1K8IA 2H2PC 2BOCB 1KPVA 1A6TA 5FECA 2FNBA 1UASA 4Y4FA 3UXFA 1PEZA 1YY8B 5B3JE 3MPCA 3WTXA 1UATA 5K9JH 4YSOA 3NSJA 2WUCH 3EH1A 1IGIH 1MCJA 2EVGA 4TOYH 1KJVB 2PO6B 4PP2B 2O72A 4R0LA 5D7KD 3G6JB 1DZBA 3GSNA 2EQDA 2EUWA 3MLUH 3IWUA 4Q9BA 4YPJA 4CSZA 5IFHL 4AKQA 3QAQA 1OGTB 3WEXA 1KMGA 4DF9A 1G6RB 4YDJA 5AL8A 4Z3HA 1NINA 5BZXA 3M86A 2VDNL 3GO1H 1T20A 3GXUB 3NJKA 3U0WH 1QFHA 1L7IL 5EEZA 5HPMB 5L2KB 1GCYA 3FCUB 3IGUA 2FB4L 4G2AA 1Q9WB 3ILQD 4JE4B 4KUCF 4HJJL 5IGXL 4V1DE 5DRNA 1RI8A 3M1OA 5F8QC 5I8OH 3T8XB 3VXNB 3TWYA 2JQMA 3VSVA 1AD0A 4HFUH 2VW7A 4HHAA 1L7TL 3WY3A 2OL3H 5C7XL 5EORL 5C0CA 3KYMA 4OCXL 3IS0X 4XXWA 3F3HA 6CGTA 2ZCLH 5DZNA 2C3WA 2ZXEB 4X9GA 4LPUA 3DXAA 2F68X 2O6FA 3UFIA 4JM2F 3UERA 5IZ7A 2PWHA 2PNDA 4WHTA 3AT8A 3QQDA 3T04D 3TPUA 1GIGL 1CUOA 5AOIA 1TENA 4GBXA 3OXSB 2OMVA 1F8TL 4GS7B 4FQIH 4WZ9A 1B4RA 1ZT4B 5HHXH 3DO7A 3NCXA 3TBWA 3UIYA 3QUZD 4ELMA 3ZHKA 4NOBA 2YAOA 2P47B 5AZEH 3CZFA 4XN8A 1DJZA 5ES4B 4CSTA 4URKA 9CGTA 4M29A 4KKZA 4P48A 3RWEA 3QDAA 2WNKA 2TSAA 5HYQA 4PW4A 1FG9C 3SBWA 3PP3K 4NN5C 1QSEE 1DEEA 4OJFH 2XFGB 4EJ1C 5FXCH 2BH0A 3LHPL 2VXVL 1EEYA 1FVEA 2MHAB 3OKKA 4N8VB 4X8XA 2YUWA 4F37K 4ZFFA 2EACA 2BSRB 4LPCA 5D72H 1FNSH 4L5FH 4TQEL 3HHSA 4UQIM 4F80A 4A6YL 3OF6D 1UA6H 4NGHL 3MRJB 3DKHA 4M4PA 2J56A 1FE8H 5ALCL 3TO2B 1S9WA 2WLJA 5T1MB 1PKQA 1AQKH 4F3FB 5C0IB 1QLFA 2EKSA 3ZT5A 5DVNA 4XPTL 4M4RA 1HILA 4O02H 1IE5A 4PTUA 5GGQL 3OBAA 4Z0BL 2HT3C 2WN2A 5B22A 2BSCA 3NCJL 5GS2D 1R3JA 4APQB 4HZLA 4PG9B 2C3HA 4HGWB 4PVNA 4CVUA 1NLBH 1KUMA 5B39B 4JMXA 1TCRA 4KRNA 2W0FA 3BVDB 4LLVB 2FRGP 4GKZB 3NEXA 5LB1A 4B7IA 1OAQL 5BJTA 4FLQA 5K9KB 3IETA 4N90D 2X4NA 3K8LA 1TIUA 4OGZA 2CR3A 1JWSB 2JTDA 2Y5EA 5F6HJ 3QC6X 3AG4B 5GGSY 3RU8L 1EEUA 3HS8A 2P8MB 3QUMB 4BFGA 4KZEH 1KBWA 4CILA 3MV8A 2XACC 3PGDA 4N1CA 3PHSA 1CGUA 1ML0A 1YSOA 1KLGB 2NY1D 1BOGA 3O2DH 4NO3B 1FFQA 3MRIB 3X3FL 1CLYL 3IAPA 2BERA 4HUXA 3I02B 4ZAKC 3WUWB 5DSCA 3HZKB 3OKLA 4ISVB 5F71A 3FMGL 1BXUA 2IPUG 2NY6B 4UTAH 4M5YH 4UM9A 2OMYB 4J6RH 2YOCA 5LGYA 4LLDA 3ATDA 4FTVD 4KROB 4DFIA 5FB8B 3U1PA 1A9EB 2C9XA 2D3LA 3LH2L 4LLQA 3I6KA 3SY0A 1I9IH 4BIKA 5DQDH 3H6AA 4G1MA 1J8HB 3OV6A 1AY1H 5JDSA 4BFJA 43CAB 2QHRH 3QORB 4XCCL 3UJJL 2F0CA 2FBOJ 4H8WH 1IM9A 1NMCB 5BZWA 1MJJB 3T6VA 5HBBA 4UOW1 5CF3A 1YMMB 1R34A 2IOMA 3IMVA 4XNQB 5CD5D 1C7TA 2ICWB 4U6HA 3HLAA 2QJDA 3UZEC 4JPIA 5T3ZE 1MCCA 1IGCH 5IP4A 1JRHI 3F58L 3FH7A 4UAOC 5ERWB 4MB4A 1OWRM 4NPKA 3QO1B 4G1EA 1IT9H 5HVFB 3FFCA 4B9JA 1UHVA 4ZW6A 3MKKA 5EG6C 1HYSC 3CVHA 3S4SG 3OX8B 3QUKA 4I1PA 3U7YH 1L9MA 3GMMB 3H7BA 3OLIA 2O6CA 5I74B 3QI9D 1OEZW 2GAZA 1IM3A 3HRPA 3FQ1A 4N85A 5GSRA 3WS3A 4EZLA 2UV3A 3LD8B 3EO9L 4NZTL 3FOLB 3BPOC 3MBEA 3MLWL 2H0JA 5T3ZD 5FYLL 4BFBD 5DFTA 3QYMA 5HHME 1I1YA 5CSZA 5DHDA 3U9UB 3WENA 2ZF9A 2DLTA 4NAJA 1YNTB 3DO4A 2O5YL 5DCCA 1OGAA 4HIHB 2H3NA 4PTTB 4PJ7F 3NSFA 5IB2A 1ECZA 4OGAC 1YEJL 4PWJA 1CBVL 3RX7A 2MJWA 2ED6A 3FU0A 1OAZH 1XF4A 1T04B 4BUQA 3B6SA 2R1YB 1YEFH 5FV2A 5IMKA 5HHMD 2AZUA 2G9KA 2ITCA 4DGIL 2FUTA 4G8GB 5IW1B 3PPEA 3RWGA 4WUKH 1A1MB 3IFPB 2MCG1 5KZCD 1ACYL 2A6JB 2X0UA 1DL7H 3QG7L 4GY4A 3CZSA 4AOFA 4PGCA 3PUCA 1MW2A 3CFNA 3D06A 2HJLB 4G6KL 3RIKA 2R56L 3MRBA 3JYCA 3VTTA 2IAMA 1QTSA 2X6VA 5FYLE 1NCAH 3MV7A 3SKUD 4YSAA 5F44A 4HUMB 4KTGA 3ARPA 3HG2A 1AHKA 4L3AA 4YUEL 4EI5B 2RGSA 4LLUA 4ZUSB 2F54B 3FQWA 3GT6A 4MMXA 2WANA 5LGHL 1M4KA 3GKZA 1AQHA 3UZVB 4FI6A 1KGXA 3OAWA 1HEZB 5FYKL 1F2XK 1WFUA 3CMGA 4K7PY 5DMGD 1MCLA 3R1GH 1AANA 3QI9C 3P4OA 1G9HA 4QWWC 5EBMB 3PJSB 4LKXB 2MQCA 1DN0A 4A55A 4R4FH 1RK1B 1UACL 4JM4L 4GI9A 2Y6SD 3PXJA 4R5VA 5KYWA 3H3KA 5JXED 2Y22A 5T1KD 1R24B 4PJIB 2AEOA 4U1SA 4F24A 2E6PA 3LOWA 3F84A 5LBSL 3OC8A 1S78C 3SE4C 4Z7WA 4M9PA 1X7QA 3STZA 1N5YL 5FA3A 4AYEC 2DWEB 4EBQH 1JNHB 1CICB 4MA7L 2ORBH 2RJMA 3P9MA 4PP1C 2J4WL 4PI2A 2EEXA 3CUPB 3MRDA 1P7KB 5BVJB 2ZF8A 5F1OB 1MH5B 3X3GH 1KB3A 5IR1A 4DN4L 3FFOA 1LD9B 3QJHA 1MRCH 2N1TE 5C3TA 4L4VE 4UBDC 2NTSP 4ANVA 2YC1B 4KUCD 3IKCA 4M8UA 4XNDA 1I9JL 5J1SC 4HPYL 4Y19E 3JSSA 2FEEI 2ADJA 3HG1B 4PJ5A 2BSED 1A7NH 1MHHA 1QSZA 1XCTA 3BOVA 2EDQA 3RURA 2AI0H 1RMFL 4Q0XL 5FM8A 3LN4A 4H8PA 3L1GA 4DGYL 1F4XL 4M1CC 3SBRA 4EVNB 4CSSA 4L4VD 5IBUB 1G6VK 5J0BA 4JM2D 4D0CB 2AXGB 1PF3A 2DY2A 2ZKHL 1SUJA 1CWVA 1CG9A 1P1ZB 2Z4TA 3GEWB 4X9HA 4XB8A 1I9RL 4KOBA 3TL5A 3BKYL 1M7IA 2VXQH 2EXYC 1VZGA 2X1OA 3QDJA 4OCWH 4M6OL 4ORGB 1S9KC 3N0AA 5CR8A 2J20A 4OAWB 2Y6SC 3L9YA 2G30A 5AVYB 5JHDE 5EU6E 3AS2A 3CSPA 4W9ZA 1A8ZA 5K1NA 5EDSA 2A6DB 4JKWA 1OIOA 4F1SA 4N2NA 4NUGH 5F7DB 3WDHA 5C07A 5AOJA 2BIIA 1FSKC 2J12B 1HINH 4KPHH 3MJ9L 5F21B 1MFMA 4UQ2A 3QJSB 4NAMA 1JZ5A 2H5UA 2Z0UA 2OMXB 3VXSA 4AZ8B 4DW2L 1QEXA 4W9GC 3FU7B 1FDLH 1GGBH 3CSFA 4N8CL 4XNYH 3AXHA 3L48A 4RBPK 5EU6D 3UG3A 4MA3A 3MRGA 2CPUA 2VDPL 3P9LB 4YMPA 3LRHA 2AXHA 4ZD3H 3CQPA 1CD1A 2PCFA 3N41F 3CFJB 4ACPA 3RL1B 4FXGA 3C08L 3RKDC 1MQ8A 4LRNH 3CH8A 3INOA 1I1AC 3Q6FB 4IBUA 2OYMA 2QLVB 2P48B 2BDNL 2WZPD 1LVEA 4U1GB 3SQBB 1KXHA 1JZ2A 4G9DB 3PWUA 5I1DB 1CD9B 1XMEB 2WQVA 3SDDD 4QMEA 1IAOA 3ZYIA 2YAEA 3CFCH 5I71C 3DDGA 4R26H 2VSCA 5DMKA 5MI0B 1ZGLP 4FD0A 2AHIA 2P5PA 2K7PA 2BSSB 1S7RA 3U4EA 3E6FB 4JFEE 2FR4A 4Y16D 1F00I 5I8CA 1JDAA 1KC5L 2H6OA 4HCIA 1RZ8A 4JAMB 4YDIL 4AQAA 2K4WA 4K3DH 1JGDA 2PUQT 1UJ3A 1NGPH 1ODAA 5DUBB 1KYAA 1OGSA 1EDYA 3LEXB 3NESA 3HAEA 4LESA 3BE1L 3UPRA 1FZOA 4AIXA 1WFTA 5E00A 3BQUB 2VDRH 5FK9B 1ZEAH 4JFED 3APNA 2C3VB 4N26A 5JMOC 2WXNA 3D18A 1A5FH 3FTVA 1ZE3H 2Q6WA 1M6OB 5KVEH 4U1IA 4NUJB 1CR9H 4NZRL 3BW9B 4A2DA 5KSAC 3AG2B 5C3LD 4JY6B 4QUOA 3GSNL 3OVUB 4H0IA 3BC9A 4LF3B 4X98B 4LL1A 1CO1A 4P5TC 3F64A 1AZBA 1A7QL 4PY7B 2DQIH 1ZANH 2XNAB 4LLWA 4NKQB 4R3SA 4CW1B 5AD0B 3H2WA 4PRNB 3VWJD 1OPOA 3RX9A 1MIEL 4ODUB 5DF0A 2ZUQB 5E24E 1BA9A 1INQB 3C5SB 4CKQA 4KXZI 4XGZB 1QSFE 3T2LA 3FBQA 3NSCA 2ED8A 2Y1VA 2CK0H 4J8RB 4L8SA 4UQ3A 2OXHA 3EAKA 1R5IA 2X87A 2X6AA 5JPMB 1MCWW 1ZVYA 4ZW3A 2J6EA 3OHMB 5DC0A 1WISA 2DW5A 3WFEH 1MW3A 1UWEH 2KERA 4HK0B 4XHJC 5DC2A 1BIHA 1UM5H 1XGPB 4L3EA 4YBLB 1PZCA 2XTJB 2DQGH 4MDRA 3FDWA 3AC0A 1E6OH 4PJ7E 2J5LC 4HOXA 1QSFD 3EOAB 4OD2A 1ED3A 3P4MA 3HHMA 1MVUB 5EO9B 2F7PA 2A74B 2ZCZA 1H3TA 2WC7A 2B20A 2YPLA 4LCYB 3FU6A 3VAEA 4DKTA 1RZ7L 1PQZB 3WLBB 1E3FA 4KO5A 2RFXA 1TEFA 1LO2L 3CX5J 2QPSA 3RWFA 4ABWA 1LMIA 1KLFA 4LHUG 1HE8A 1NGXA 3UZQA 1G5GA 5TD4A 3LJ3A 1DQJB 2CAKA 5DUPH 1YAIA 1MWAA 4E9XA 2HYMA 4YXKH 2FEJA 4PGZA 3SGJA 3NBNA 2LLNA 3ZW3A 4BGDA 4I3SL 4CVZA 3DX8A 1ZCRA 4B9FA 4HFWB 4YHKH 3ARFD 3VRJA 4PVMA 3D30A 4IRJA 5KYYB 4ZNCD 5BW7A 2V2XB 1ZXQA 1EAPA 2C7UA 1DE4A 3DJZA 4WU5A 4QCIA 1E3XA 1VEMA 4DO5A 5A6LA 2IPKA 1AS8A 5BPPA 1IBGL 5DRWA 5HI4C 3SDCA 5F7LB 2AJVH 1MZZA 1Y6KR 5KVDE 2UY7A 3EZJB 1A6ZA 3EOTH 3TA3B 2CK2A 2EC9T 3BDYH 1A6AB 5JPNB 3BKCH 3OZKA 5DJYA 2YXVA 3LKOB 5AFAA 1LO3L 2WINB 5F1SA 1PSKL 4XP5L 4EKJA 3DV6A 3QAZB 1AD9A 1C5CL 2X4QA 3V4VH 1A6TB 4ODXA 1BIIB 2XBDA 3ZN6A 2JCCF 3WD5L 1S5IH 1BOYA 3QIWA 4HJ0D 1FV1A 3C60D 3HG5A 1N18A 1T1ZA 3OMAB 3WNIA 1UT1A 4N6RB 3PHQB 4R0LB 4XVSH 5E5RB 1M9SA 4YVNA 2E7HA 2FATH 4Y4FC 1NMBL 3ZXAC 2FQGA 3B9KB 1BD2D 3WIIL 4I0KA 2CLZA 2W8CA 4JFDD 4N2OA 2DMKA 1NBCA 1RLBA 1HT6A 3QZWB 5DTFA 4NQEB 4OLZH 1DVXA 3MRPA 4EZJA 2OI9B 4N22A 2F53D 1ZT1B 4QOKA 2QVMA 4GW5A 1EJOH 2CO6A 3E0GA 3LPFA 3O6FD 3UBXA 4NKIL 3Q2WA 2CIIB 2KT6A 3NDZE 1OV8A 1A7RH 4XVOA 4XMZA 4GKLA 3VXUE 2PWGA 4YC2B 5D1XE 4A39A 4D9QE 1VGKA 3GLAA 1IGYB 2RH0A 1RZFL 5LAXA 4NRYB 4YOKA 5C0CB 1AKJB 2B2XL 3KYMB 4X6FA 5DR5H 3BGFC 4FQ2L 3BWUF 3BPLB 3GS0A 5DD3L 4WUUA 1KULA 5C0DA 1SGKA 4I89A 2R4SH 2VZTA 3P30H 2WZAA 3B2UD 4LCCA 5L88H 5BQ7B 5LUMA 1YYMH 4GRMA 3VXUD 4GBXB 4G9FA 4UINH 3UYPB 2OMVB 5E99H 4XXWC 5D1XD 1KOAA 1YEGH 2NLJA 2HLAB 1OP9A 4XBGA 4E0RB 4NIKB 1MUJB 5C0FB 4FGMA 5J56B 3TYGH 4X7SL 4KKPA 4N8VG 4WRLA 2QKIB 2XG4B 1I8MB 4HS3A 2DYPA 4HJ0C 1BAWA 2BIHA 1EDQA 5ANHA 5HYQB 2FECI 4TQ8A 3C6LD 1KYFA 2YSSB 1BMZA 5KSVA 3T0EA 4Y9BA 1V8HA 5DJ2A 2NTFB 5HJDA 3REWB 5FFLA 3C5ZA 2LHAA 3KPMA 4GG6A 2B16A 2EDLA 3OKKB 1IKFH 1FORH 1XGYL 2Y0SA 3BIKA 3CVHL 3PV6B 4LHUA 4MMZB 4A38A 4B50A 1OB1A 2BVUA 1OHQA 1ACCA 3SBWC 2WOYA 4MA8L 3REVB 3LKSA 5B39G 4L2LA 2NYYD 3AABA 3C8DA 4DP0X 2F9BT 1Z7JA 3PWJB 4P46D 2UXTA 1X5AA 4OIBA 1HILB 1R0AL 4QGYA 5J1AA 1D7BA 3EO1A 2UVEA 3UTTD 3QA3B 1DUZB 1PCXA 4DGUA 1NWPA 3MHZA 3U2JA 3OR7B 1GSMA 3CN1A 3PAVA 1TCRB 3EH3B 3CLWA 3OZLA 4JS7A 2XWJB 2I07B 4NFDA 3IJ8A 1D7FA 1G84A 2BP8B 4DPCX 5BMFL 2DH3A 4K94L 3BWZA 4X6BA 1JV5B 3EBGA 1GS8A 5SWSB 2NCMA 3EJZD 2CA4A 1RXLA 1G1YA 4GXFA 5D1XC 5H37A 3U1SL 1OTUC 3PXLA 1SEBB 1T0MB 4XT1C 4L1DA 3ZBMA 1EXUA 2XTLA 3KG5A 3JXAA 4FE9A 4M3KB 5DYOB 3BFWA 4ZS6C 3FCTA 2BP0B 3N40P 2VIRA 3MV8B 3PGDB 3ABZA 4BBWA 1A6VH 3HC3H 3IF1B 4TRPL 1JK9A 4OZGA 5I66B 4GKNA 4LT7A 4Y7MA 4JHAH 5GRUL 3IMSA 5DSCB 2MH4A 4OT1H 3TC9A 1TCMA 1WCBA 1OP3H 3KPOA 2ENJA 5CZVH 1MNNA 3WMQA 2YGOA 3NPSC 2J55A 2VSDA 4M61A 4B9IA 2DMHA 3GF8A 4F15B 2X2UA 2DWXA 1SLXA 3MBWB 4UM9B 3FTYA 3UJTH 3CIQA 4LLDB 2PR4L 4BWUA 2FO4B 1T7ZA 6TAAA 1KTDB 2AEWA 1X5IA 5EOTB 4N5EC 5D7SH 3I6KB 3NIFE 1U41A 12E8H 1XH1A 2AV1A 3B3BA 4BRVA 4ESKA 2IDFA 1J8KA 2OMTA 4G1MB 2EP6A 4K23H 3N9GH 3ZGHA 3RIAK 2DLFH 1AGFB 1ZV5A 2EIBA 2K8QA 2XV0A 3U25A 1GYUA 1TT6A 4P05A 5IB4A 3BAXA 4K3JH 1LDPL 3P3TA 5IKCA 3KPSB 1HHGA 5BRQA 1BZDA 4FNLH 1M42A 2AVFA 4JFOB 1QBLH 3D33A 1L6XA 4JPIB 1KELH 3V9EA 3BISA 1NCBL 4HC1A 5E1QA 1CIUA 3HG0A 4G3YH 2FZ3A 3S34L 2JJTA 1X5GA 1ZVHA 2B1HH 3LKQA 5I5JA 2LAGB 1JDCA 2YD8A 4JO1H 2XICA 2YO3A 3WS3B 5KBDA 2Z8WC 2CHNA 2FHBA 3M45A 1FBIH 3SJVA 1CQKA 2GUYA 2P5WE 4BE6A 4D9RE 3W11C 3GK8L 1QZNA 3MOQA 2LLLA 1V3JA 3APFA 4OJDH 2IADA 1DBBH 1KJMB 1L0PA 2WM0A 2Y24A 5JORA 1MCBA 4UOJA 4A2FA 1H9DA 3MBEC 3ISWA 4PJFB 3BGMB 2C1PB 5JO5A 1XF4B 3VFRA 2H3KA 4WJ5B 4ZUUB 2P5WD 3B6SB 5DGQA 4CVWA 4ZFOA 3CQQA 2DKSA 3Q13A 2FNWA 4N2FA 1ZLUH 2ITCB 4HF5H 1P5VB 1RJZA 5I5MA 4U3SA 5FW8A 3RTQB 1HXMA 4BZYA 1M05B 1NBYA 3NEEA 3PWLA 3RP1A 2HFFB 4MRBA 3TJEH 1U8NB 1ZDQA 4MD0B 4YNYA 1Q72H 1SOKA 1WZMA 2MNUA 4HVBA 3MA9H 4A04A 4K94C 2D0FA 3O3BB 3HRZB 2O26U 3L1OH 1CLVA 2UZXA 5B7FA 2HLFD 1UZ8B 4ZOAA 2CJUH 1TTCA 2HKAA 3VI4A 1RPUA 3QUYD 3LN5B 4HT1L 3L5XH 4E41E 5F7EH 4WIQA 3BAEH 1IAIL 4XTRC 2F5AL 4FZEL 2IAMC 1NCDL 2JCCE 4TM9A 3SDAD 4GYBA 5I30L 2YHGA 4JL1A 4RGNE 1UWGH 4QO1B 1USQA 2AXJA 4PW3A 5TE6H 3I6LE 2H32A 3NZ8B 4MMXC 4AEHH 4AKOA 4IBWA 1NCCH 4ZXBB 4MNHA 4E41D 4P2CG 5I23A 1TZGH 5T1LB 5IQ9A 3TVMA 3GMNA 5ITFA 4JREC 4S1SL 4KUZL 4JY4A 2PW2A 2R7EA 4NN7B 1I7RA 4OLYL 3BSGA 4N2MA 3CLFH 2Q20A 2XV3A 1GVIA 2VO5A 3ELAT 2WZ6A 3LIZH 2PCXA 4RGND 1D6EA 2ZSVA 4M5ZH 2AGJH 2IWKA 4PS4L 4M8QA 5D5MF 4KMTL 4Z7WB 1YYLH 1BEYL 3I6LD 4D2NA 1S7XA 2B77A 3STZB 2WCGA 3BKJL 3V0VA 5JOPE 1CE1H 2VLJA 3S9DB 3FH8A 3D85D 5F3HA 2EXWD 3FO1A 1MDAA 3M88A 1XZ0A 3GS4A 1QR1B 2EADA 2OL3B 4FQLH 4ZQTA 1F4HA 3AT9A 3HPLB 4WFFE 2XWXA 1GXEA 4LOFA 5I73C 2B39A 5DURD 5BS0E 3NTCH 5C08B 3H4HA 3L3KB 5MHSE 1WBZB 1HKFA 1P84J 3IKCB 3K80A 1LDSA 3QUXD 5JOPD 5IBUG 5I0ZA 2YGNA 1GYWA 4W9KC 2WQAA 4PJ5B 2OK0H 2ZSWA 1MJ8L 1SM3H 1YN6B 4OLVL 4Z1PA 4HJGB 5I16A 4BK5A 3QUYC 5KEZA 3ZMNA 5KJRL 2HA1A 4WFFD 3WNOA 2W60A 2OULB 4KK9C 5CMAB 1KCWA 1BPVA 4XBPB 3BUBA 4H44C 5D2LA 2WW8A 2YD1A 4DPAX 4KWUA 3C8KB 5DD6A 1DJSA 5MHSD 3ECWA 1ORQB 5KYUA 3UIZA 3N40F 2E9JA 3TBBA 4CRPA 4HLZG 2NUPA 3DHUA 3G6JF 3HE6D 3K2UL 1UCTA 2VO8A 4LEBA 3A23A 4O2EB 4M7ZC 1BZEA 1JE6A 2GSGA 1RZPA 3PYCA 4JZJB 3JWNG 1AFVL 5JYMA 1ZA6A 4BJLA 4F7MB 1IRAY 3NCEB 5FF6A 4X4ZA 1IEAB 2YAMA 4MXVF 2Z8SA 5C92A 5C07B 5SWZD 2NR6A 5KVFL 4WK0B 3WHE0 3QPXL 2J6EL 4MCNA 1FIGH 4O02B 4G43B 3ECVA 4QF1B 3VXSB 2ZE0A 1A3RL 3QSKB 5F7MC 4YSQA 3T2PA 3JWOH 1CT8A 3RB7A 1QA9A 2WLZA 1PLCA 4XI5C 3QEUB 3KPQA 1IQWL 1KDJA 1SJHB 1X44A 3KXFA 4JRYB 5EIIB 4GMSL 1D5BB 4WNQA 3RY5A 4C8XA 3THML 3GJFH 1FNFA 3BCFA 2DQHL 2NY0C 5ILTL 2K6ZA 2WLLB 3DK0A 5DK0B 1G7IA 3PABA 3QZLA 2BNRE 3WELA 1RZJL 1EX0A 2FSEA 2GSIA 5C0EB 5LJYH 3V4UH 2V2TB 1XT5A 5A2CA 3ETSA 4YZWA 1PLGL 2CALA 1MWAL 5DD5L 5KVFE 5JIQA 2PLTA 4ZDHB 1DVYA 4FXGC 3H3PH 1KG0B 4HKJB 4UZUA 5TF1L 2CUAA 4I2XA 2WTRB 5D9SB 3RHWF 4MXQD 1CF1A 2BNRD 1X4XA 4L3EE 3V9FA 1A6WL 4PCYA 2FR4B 2XSKA 5EC1B 4OJEH 5AWNL 3VFWA 5I8CB 1MRDH 3HC0B 1RZ8B 4PRHA 5ISZE 4YHYC 3CFBA 3X1GA 5E2UH 3NVQA 1N3NA 1NAKH 4FQHB 1LEIA 5EEUA 5KG9A 5E2VL 1UVQB 1Y07A 3SOBH 4J8QA 2FD6L 4B9GA 4FFYH 2XJKA 5AW2B 3FO2A 2HUEA 4WEUD 1ITBB 3VA2C 3VG0H 1X5MA 1CCZA 1SVZA 1UJ3C 2DQFB 2Q86B 5DDHB 1MSPA 4J39A 5EC2B 1V3MA 3U6XA 3MLRL 2CXKA 2RQEA 5ISZD 2R29H 2Q6WB 5D1ZI 3TONA 1TYRA 1R3KA 5GZNA 1QLEL 3PY9A 2P52A 3U0TA 1NM9A 3MX0B 1NJ9B 4Q58C 5C0BE 5C97A 1UWYA 3GZPA 4RMSA 4M7JH 1C8PA 4AITA 5F97E 4Q2ZB 1JMXA 2D2OA 3GXFA 2WSKA 3D0VB 3ZKXC 4IBYA 5H94B 4AQ1C 2R2EA 4R90L 2QL1A 5D70H 4G6ML 3HG3A 4KK5D 1P4IH 1RULL 5JW5A 1DJHA 1EO8H 4F57L 1BQLH 4XO9A 2QQKH 4OR1A 4UQBA 1RUQH 5FHBL 5HYEA 1MFEL 4LL9A 3RGVB 4G83A 2E46A 1V7NH 5C0BD 4OZFA 4UB0L 3NCFB 3N43B 1F3JA 2OXHB 5HDBB 3CFIC 4CL7A 2J57A 1HZHH 3P4NB 4LVHB 4XPAL 2AJZB 2EDDA 3RX5A 3V6BR 1L6ZA 2IWEA 1NAMH 3KYKL 4D0BA 2APTA 1F6AA 3F00A 1CLZL 3T2NH 4CMHB 4L8SC 1QVOB 4TVPL 3A6BH 4LAQH 4NN6C 4IIQA 4I4WA 2JB6B 1ED3B 1RUAH 2Y7SA 3ABLB 2VDLH 2Z0BA 4PV1C 2CHDA 4WI5A 2AJYH 3NPZB 5FA4A 3BVNB 1SDAB 4IEFB 4IU2B 3CC5A 3O11B 3KPPA 1ZLUK 1ZVSA 4TNWK 1AGBA 1B0WA 5CJ5A 3IM1A 3KNBA 3T9WA 3VO0A 1DN2A 1T5XA 1KTLA 4E9SA 2KL6A 2Y7QB 1XXFC 3JWDL 1C5BL 5FLUA 1Y0LA 3S2CA 2J1XA 2CUIA 1TQVA 3L95B 2ITDA 4J23A 3MC0A 3F7LA 2WO2B 3DO3A 5CR1A 1JXGA 3UCQA 2P24B 3ABGA 4OJAA 4TVPE 5FR3A 4K71C 1A4JB 3HJ0A 5I1HL 1R5WA 5DWUL 1AR1C 1IB5A 3PXHA 3Q9QA 5IVXA 5F3BA 4S2SA 3N85L 4QCIB 3SGJC 3SDCB 1W16A 4L48A 3T71A 4FN0A 1V54B 5DLML 4QNPF 1GOFA 1T89A 3FFDA 4WKXA 2GK0B 4YHPB 2VAAB 1FFNA 3SYCA 3RI5F 1YN7B 2MPAH 3M07A 4IRJC 4PSPA 5HDQL 4WI8A 4LOUC 3C6SA 4TVPD 5BW7C 1MCSA 4F7PA 1W8OA 2X4RA 2CM6A 4XP6L 4F2FA 5E2TH 2NY3D 4EDWH 3LIZA 3HE7A 1I4FA 3OC5A 5FCUL 1W0VA 3BESR 1U3HB 3QZWG 3SKNA 4YPGA 4I5BA 1RLWA 3E1F1 5D5ME 1JVLA 4GG6E 4G42B 2WXHA 4UWQB 3ZE2B 3GRBA 1QI3A 4KKQA 4FYSA 4JFPA 1EIBA 1J12A 3Q1SH 1OGPA 2QSQA 4Y1AA 1PG7W 3ESNA 2PP8A 3H6JA 5FO9B 2OJEB 4R97C 1MCOH 2ED9A 4OLXH 3DUUB 3QIWC 3O4LA 1W91A 1LO0H 4GLRI 3DROA 1KNOB 3BUYB 2C1OB 2RMNA 1WEJH 1K9TA 4OCLC 3WIAA 2VUOA 4QOKB 3A6CH 5EU7E 5CP3A 3WFDH 1JPFA 1U9KA 2ARJA 2XPGA 3GXTA 2QPFA 3OQ3B 1DQIA 4PR5B 4ETQB 2VXUH 4RZCB 3STLB 1QD0A 4NEHB 5AOKA 1QBMH 4LIQL 5TGBA 2Y36L 5FDYA 4EN3A 1NCTA 1NC4D 3TJHD 4CC4A 1SXAA 3TXAA 3VFTA 2NNCA 2AXWA 4JFYB 5HHOA 4W68A 5CFAA 4BINA 1SYVA 1BVLA 3BRDA 1I9EA 4G9FB 2QQNH 4PJIF 3CCHB 1Z5YD 2VE6A 4GAYB 5D7HA 1P7QA 1NLDH 4XBGB 4I0PA 3R06A 5FW6A 2EZ0C 5JUEL 1WFOA 4LCCC 5CCKL 3AFLA 1MQKL 2FHFA 4E9RA 5DS2A 3KLHD 3HI5L 4U1LA 2EJ1A 1LYQA 4WI0A 1AH1A 5DJDB 2X28A 1JGVL 1II4E 3FTUA 4LIQE 2HLEB 5IQOA 3T0EB 1TO4A 1A4CA 4L8BB 3B7UX 3NUKA 3C5ZB 5TQ2H 4JCLA 4NERA 3BP4A 4OUOA 3BIKB 1S7TA 3BEWA 2CLRB 1KN2L 2QFPA 3LX9A 3O4OC 3JWDC 3WFBL 4AL8H 1M7DA 5T1DL 3UBHA 1XH0A 1X5YA 2N56A 4LGPB 1Q9LB 1TZIB 1T03H 1SYSA 2QV4A 4ZMXA 5D8JL 3VVVA 2Z31C 2G4GA 4PYHA 1XWVA 4Q56A 3TEUA 5J1AB 1IL1A 4LSRL 5DJAB 3T3MB 3U36A 1WZ1H 2Y1YA 1OL0A 3T77A 1PZDA 4BE5A 1OAKL 3OZ9H 4CU7A 3HPJA 5TFSL 4GAJL 3GHBH 4HAFA 1S8DA 5F3FA 1KCVH 2IOOA 4LPTA 3TJHC 2VXTL 5E08H 1C1EH 1MHEB 2GJZA 5EU7C 4DVBB 4ZFGH 4ZFOL 3TBCA 4PLNC 1JUFA 3SE9H 1I82A 3C2AL 2X3BA 2WKLA 4ZNEE 3EW3B 5TDPA 5GS0D 1MAML 1S9YA 3BSZL 3IVKB 2WLIB 4HPHA 2A83A 3KWWB 3JVGA 3PG2A 3GS7A 5GGTL 2A3TA 3CN4A 1KYOK 3D69A 1PZ3A 3G5WA 4B9ZA 1U8JA 3IDIB 2D3JA 5CCGE 5GGRA 3QUML 1E5BA 1R6VA 2VDRB 3LNDA 4HQQH 5CEYA 2I9LA 5I6XB 2A9MH 4CADB 5HXMA 3FQNB 1JRHH 3RVVD 1A3QA 5HYIA 3ZJAA 2DWSA 4XRCA 3AGWA 1HX0A 4PJEA 5DQ9B 4AUUA 3HG4A 3KPOB 4C56B 4MZRA 2DEYX 2K70A 4M61B 1OF2A 2E9WA 3BSHA 1S7VA 2ZXQA 1WBXB 2H8PA 3CDZA 2QGEA 2HMIC 5DFAA 3QDMA 4GI6A 3MLVH 2C9UA 4NXSA 3B9EA 2WKOA 2X4SB 5I17A 1GOHA 4APQD 4RNRB 3CWGA 3S8FB 4L8CA 2PABA 2YRLA 4S0HA 1NQBA 1UXLA 2B0SL 3TNMA 4PJ8B 2JKXA 2LVCA 1L4IA 3IJ9A 4I85A 3VJ6B 4ODHH 3BWAA 4JFVA 2ZJSL 1NBVH 1RU9L 4S1QL 4ZOCA 3IS1X 3VI4E 5IB4B 1HWGB 2D7TL 2CBQA 2YUXA 2VERN 4FFWD 4KXAA 4BZ2L 5A6IA 2C9PA 2Q3AA 1WTLA 5JZ7C 3MQIA 3VGDA 1AO7B 2DIAA 3M7OA 5HHNB 1OE1A 2PWFA 4GQRA 4K3HA 3N2JA 4QLWA 4K3EL 1DQDH 3Q2NA 3UC2A 2WVTA 2FX7L 4EO5A 1XH3B 3U6XS 1AZCA 1F4YH 1E8XA 5MP6L 4MVBC 4JEGB 2AMUA 4E5XB 2ITFA 2YS4A 3DV4A 3B8YA 2UUDH 4N5UA 1T1YA 1J8HE 2JJTC 2QADB 3POCA 3TH2T 1QFPA 2QTEA 3UYRH 2HCZX 2V6HA 3MMEA 1KJ2A 3L9RB 1G7LA 3EDJA 3IXTB 5CHNA 1DSWA 3KPRB 4BEIA 2NY6D 1I8IA 2GIXA 3ZPDA 4QRAA 1E2VA 1TZHA 2W9EH 4IHBA 4A2MA 4KROD 1VLXA 5EF0A 1NUFA 5EUOA 5ID0B 1MFBL 5F0LB 2EVJA 4WGVB 5M7QA 5L6YH 1SHXA 3KGRA 1J8HD 4ADIA 2PKDA 3DX6A 3QORD 3ULSA 5TJWK 2OCCB 4AV4A 5KW9L 2ZKWA 1AXSA 4U3SB 1V10A 4KVCH 5IQ7H 2XUWA 5CILH 2V17L 4QHUA 2BPBA 3CGTA 4AUJA 3ULVF 5KOVC 3D39A 1QFUH 3PWLB 5KUKA 4G72B 1YMMD 5E8NB 2BVPA 1ORSA 2EC9U 1NTDA 2BRRH 4YNYB 3V0WL 5J6HB 1QQDB 5LWYH 2CGRL 1USZA 4PJGA 5ESQA 4QNPE 1XF2A 1A7PL 4IM8A 4MAYB 3WN5A 4AEFA 4LCWB 3NYKA 5C0AA 4F2EA 4PB9H 3Q8EA 5D2LE 2WV3A 3A4AA 3V4VB 4P23A 3LZRA 4S1RH 1IEHA 4J27A 3B7TA 1QNZL 1G7JB 4DEPB 3IT8D 3K2IA 5IK3B 2NW2B 3ZY7A 2ZAHA 5EF2A 4R96B 3OKOB 4KKBD 4K15A 2RD0A 1PFCA 2BNQA 3SKMB 1ZV9A 2ENQA 4UDUB 1S6NA 2IDQA 1Z3RA 4PGBB 1JNJA 3R4RA 2VJXA 4QRRB 3P54A 4P4KB 2VDML 2G5BB 4UYPA 2Q8BH 2VR4A 4G8GE 4JUSA 4J3OH 5EOQL 2J2ZB 3MCLH 1G0XA 3JTSB 3WSQL 2YK1L 2Q7YB 1HAWA 4JY4B 5FYJH 4NIYE 4OY9A 3FT1A 1I7RB 1NKOA 4PW9A 5DT1H 1GTNA 3LHAA 3DGGB 4HJSA 1IQDB 3OAYH 2GK2A 1TLMA 4NYLB 3BX7C 1E3ZA 5C0RL 4M8QB 4EI0A 2HFEA 3DSFH 5GS1B 5HI5C 4P5MB 3TVMC 3F2LA 4IDJL 4AH2A 4U1NB 3IKKA 5E1HB 4G8GD 1A4AA 3GMOB 4N9GA 2F54E 2B1AL 1JOIA 4MASA 2CJTA 4BFIA 1MRFL 5E1AA 3RZCD 4AQZA 3SSGA 1NMCC 4U6XB 2H45A 1HQRB 2AQSA 2HN7A 2J8UA 1FYTA 1Z5LA 3E2HB 5JNYB 1ZAGA 3U46A 1OSZA 4EI5D 2PTVA 4EI6A 2F54D 4K7PX 4ZTPH 2BIOA 3CX2A 3UG4A 2VKWA 2WQWA 4K9EL 1Z9SA 2CLVA 4PJIE 4WFGE 2BHZA 3OL2A 1CD8A 2HVKB 3QDHA 1CZ8L 2W60B 2HFTA 4MJ5B 2FL5A 3DYPA 1AHWB 25C8H 3ZZ1A 2G0LA 2P8PB 4P3CH 4OQTA 1PU0A 5KYUB 1N0XH 1UADC 3QCTH 2EE3A 4QIRA 3BJLA 4KTEH 1TTRA 4BK5C 3LDBB 3POHA 1QPKA 1U8MA 2IQ9L 3QDGB 4FCHA 1I8AA 1WA2X 3QH3B 4WFGD 4EQ3A 1WWAX 4K07A 2JELL 5JW4N 3VD4A 5L0QB 3K5RA 4WV1A 1G0YR 2DQUL 4NO2A 4ONFL 5CINL 3FZUD 2HTLD 3HFFA 2D03L 4M48H 4R7DB 5CGYD 1SEQL 1CICD 4DZ8A 5EIIG 4L37A 3WXWL 1EERB 3W39B 1A7OL 1PG7L 1KB5L 4KXCA 5IT2L 3QWQB 4KKCD 5EO1A 2JTYA 3RZCC 1WAAA 1GH7A 1J05B 2CHXA 3B9VA 4FQ1L 4MWFA 4XCFH 3DETD 3SZKC 4QAMB 5D1QA 1DQMH 1WA0X 2I85A 2VKXA 3WKNA 4YHLL 4KK6C 2AV7A 3HG1D 5BRZA 1SBSH 3MXVH 2RCSH 2FX8L 3SGDI 3SOBL 2E56A 1WK0A 4P4RA 4X6DA 3GSUB 5CJQH 3PL6A 1CTOA 2VZVA 3D3VA 1C12A 1H0DA 2PPCA 1RJCA 2WBKA 3VI3F 2XN9B 4WGWB 4AGQA 2MOGA 1BPLB 1U8IB 3VQMA 4ZUWB 3BH8A 3U4AA 1L5GB 3JWNE 1XXDC 3PP4H 3KPLB 3DIFA 4M5TA 5E4EB 1IFHL 3HNTL 3BRGC 1AXTH 1H5BB 5KYXB 3KGTA 2VR5A 4NZ8A 3X11A 2EUXA 1E67A 5SX4I 3FBKA 3IGAA 3SGKA 1YMHB 1L9QA 2LU5A 4KXZH 5F1KC 1U8QA 1MFCH 4JO4L 3PQYA 2BVQA 1BLIA 4DIXA 2FYYA 3TBYB 1FNHA 1MIMH 4F7TA 1GL4B 4P9ML 2ZG1A 2WTPA 3N1QC 7FABH 1K6QL 2HFGH 4PRPA 4NQVA 4BHUA 1U8PB 3CK0H 4XXCA 4RISL 2A6KA 2N7SA 3VXME 5AVRB 5GIRB 2IALB 4FHBD 2G60L 3CFDB 3MOAH 2DJUA 3TBSB 3LMJH 1ZRUA 2LVEA 5MEQA 1FG2A 2OSXA 3BD4A 3BUIA 1GJWA 4WO4B 1AS6A 1DVSA 1T3FA 4DQOH 4AJVA 4AJWA 3ESPA 1WV7T 4S0TD 4PI0A 2R2EB 5GZNC 4Y5XA 2E47A 3BT2L 1DTUA 1OHZA 1CN4A 4M1DH 4NQDB 5HYSG 1MHCA 3CHSA 4QRPA 1MF2L 1ZLVH 2KC0A 4X99A 2LFGA 1R5VB 3CZGA 3ULVL 3EDKA 4O58L 2X7LB 2KZ1B 3UX9B 3QIUA 4JFQA 2HVBA 4PUBH 3N04A 2BK8A 4OSUH 3LQZB 1TZOA 1WQVT 4KO6A 4JGJA 5TH2A 3ECBB 3AS3A 1DQLH 5CP7A 4DEWA 4OLWL 2VL4A 1X6NA 3ZRSA 3I3BA 4YLBA 4Y5YB 4UT6A 4JO3H 3DIVA 1VACA 3DBXB 3IDMA 3V6ZA 5DU7A 3TPKA 1VJSA 2VLLB 4IIQB 5DEFA 3BQUD 5A16A 1TNNA 2H6PB 2ZCHH 1HKLL 3PWPE 1I75A 2XQBH 4GNKB 3E38A 1DSFL 1JCKA 1EO5A 3PU7A 5MENE 1TJGH 4PSRA 3WFHB 3BHBB 4TULH 4ZJ9A 3KPPB 4AIZA 3HBZA 4Y2LA 4DGVH 4RFNB 3JV4A 3ULVE 4NCDA 5BXFA 5H35A 2Z7UA 1WT5A 3EYQC 5JW4Q 1XH2A 3PWPD 4QRQA 5HDWA 1EQWA 4IHOB 4GIPD 2XV6B 4IMKA 1RJLB 5MEND 3LAFA 1JFQL 1WJ3A 4MDJA 1KSRA 4U1HB 1UA7A 5AG9A 2WXOA 1OB0A 5DRZA 2XTJE 3R18A 1W15A 2VITA 3ULVD 3T0XA 2ESVB 3NCMA 1K2DA 4S2SB 2VR8A 1D2OA 4XPBL 4D7BA 4K8RH 3QP3A 3VX1A 1J10A 1AGCA 3MRMB 4IOFD 5I18L 3LPOA 4HCRH 3GSVB 2VL5B 1R9FA 3WIHL 4PJHB 1S7SA 4OZIA 3KDMB 2X09A 3MRFB 1SDYA 1MDTA 3C6SB 1AIFB 3S48A 2XTJD 1NM4A 2XWBA 5IFAH 1J5OH 1FFOA 3OR6B 1JD9A 4U4BA 4KKAD 2JB5H 3JV6B 4HH8A 1T89C 6FABL 2ZUTA 4G8FA 4TKWA 5E6RB 4PJFF 4G59C 1GAFL 3OHXA 4NPYA 3G5VB 5I9QB 3UMNA 1GOGA 2J88H 2ATPB 2ZX9A 1SHMA 1P4LA 3IRZA 3MJ8A 3S8WA 4WAFA 1KY6A 4P2RA 2W0LA 3HVDA 5A3ID 1IC1A 2LT9A 2W07B 3HE7C 4FZ8L 1XGRA 4JG0L 3ARXA 1R17A 3QQXA 4RA3A 3VFOA 4L0YA 3E1ZA 3PJNA 4JFFA 2XCMC 3DROB 4KO7A 2HJFA 2DTSA 2GT9A 3U6RA 1JZDC 1A3LL 1PZBA 3GRWH 3RBGA 2XPGB 1NGQH 3ILPA 3I50H 4J1UB 5I1GL 3LCYA 2AEIT 2BNUA 4QHMA 1LQSR 2QPEB 2ICCA 2Q2EB 4OGQC 3CPLB 4D9LL 5HYSA 3QXAB 3NJIA 4X5PA 4EN3B 1CXEA 1TVBB 2QTVA 1HHJB 1GZPA 3TA3D 4PJ9A 1I8UA 2Z4QA 1RJYB 2GIYA 2IBZY 4LASH 4PBDA 3SQOL 5HHOB 3L2NA 4NBYB 2ADYA 2WSDA 4IRZA 2GTZB 4IOFC 3DVGB 1ZY9A 3ZU8A 4FQXA 2IOIA 3CN0A 1Y18A 4Y4KA 4P5KA 4YQXL 4HPOH 1NGWB 3ZMRA 2ZWZA 2X2IA 3F7PC 4CC4C 3UACA 2AK1H 2H26A 3VB9A 4YHNA 5ICXB 2Q8AL 2F7QA 1JNNH 1FF5A 4Z7WF 1YPZB 2EH8L 3BIAX 3FB8B 3SCMA 5JXAH 4O4YH 4UV7L 4ELKA 2CWRA 3N06B 3B9KD 1O7VA 2Z1KA 5FM5M 2Y1AA 3Q8FA 3IJYB 1DBAL 4QEGA 4I0PC 4WWPA 4IK6A 1KCRH 4NQED 1DVTA 1P4BL 5EV7A 4Y89A 5E1IA 4AG4L 3M17A 2D31A 4KH2A 4PFEA 1U93A 5KSBB 1XGUB 2YD2A 3GJFB 2AANA 4WK4B 1S7WA 1ZHBB 1KGCD 4BZ1H 3QEQB 4U6VH 3MNMA 4DKAA 1CGSL 3CBRA 3KM2A 1Q9KA 4U31A 4XVJH 5IEHA 4YAQB 5D93C 4JLRA 1KJ2L 1AKJD 1XB6A 2QSCH 2JJWA 4R5TA 2VLME 3VI3E 2J1ZA 1RY7B 4P59L 4LE8A 4XNZB 5E51A 5HDRA 3W0WB 4Q9RH 3L8QA 3WYRA 2D7OA 5LGJA 1SJEA 3P2TA 4OZHA 1E4XL 1JGEA 3BUPA 4PWHA 1S8DB 2ROYA 4BH7A 2PTTA 1N59A 3LNIA 4IYKA 1QHOA 3OGOE 4GBXD 3PNWB 3NAAL 3FU8A 2PETA 1N19A 1RIVL 2XN0A 3IU4H 5KBKA 3IJHB 5ESAA 1S9YB 2GCYA 1NBZA 5EN2B 1SBBA 2V37A 2NW3A 3V4PL 4AV5A 4I3RL 2VLMD 2XQYG 4J6IA 4J2QA 4LNRA 3RL2A 1JK8A 4E9LA 1AGEB 3EFFB 2N1KA 4JO2H 2X4PB 1ZTXL 1FIEA 1OCWL 3IRPX 1AZRA 3OMNB 2BIPA 3HLKA 1B9ZA 3ARBB 3B37A 2I9LB 3X2QB 1U33A 3KYNB 3KYOB 4WTZG 3W57A 2DLIA 5IHUL 3JVGC 1MKFA 4AJ0A 4HW6A 4Y4HA 2VMJA 5B1JC 3I84A 1WFMA 3O6KH 3S98A 3ET9F 1C5DB 1OF2B 1WBYA 4XOAA 3HR6A 1NICA 4Z76B 1LP9B 5GSVB 2KPNA 4AT6B 4DKEL 2JQAA 5SWSE 4HEPG 1IUZA 2AJUL 1PJWA 3D39E 4Y8AA 1P5UA 4NQSB 3TO4C 2W92A 2CJ3A 3ZKNC 4ODSL 4ZMPA 2YKLH 1CYGA 3GXNA 4NQCB 1N6VA 3WN6A 1LE5B 2QVKA 1H3VA 2F5BL 1I1FB 3RDTB 5GXBB 4R83A 5DS8B 5FGBA 4A7GA 1Q0YL 3WJLA 1MHPL 1U58A 2DMCA 3ARDB 5SWSD 4J4PA 2MNWA 3O45A 5JHAA 5DLLA 4AGLA 1W0WA 4E5XG 5IQMA 2OZ4A 2JJUA 2ZP0T 1NAMB 3CTTA 1E8YA 3F5WA 2BNQE 2OSLA 1IZJA 4K7PH 4MQ7A 4GW4B 1UH2A 2YAFA 3QS3A 2WKGA 1G7HB 4PRIB 3MV8D 2ADIB 1FL5B 5F6HI 1ZHLA 3C9NB 3WE6B 2VDLB 1I7TB 1F42A 3X1FA 1A4BA 2FIRT 4HKXB 4HOZA 2P80D 4KJWD 4P2QA 4H8QA 4U1JB 5F9OH 3KVPA 2CGYA 1URLA 2X6UA 1KXVA 3AWGA 3P69A 4L9LC 3TJPA 4QAWA 3X13B 3ILDA 4XXDB 3MNZA 1J0JA 3J7HA 3SO3C 5CHNB 2IMMA 2V5TA 3FYIB 3MRLA 4TPRL 3WTUA 1LNUB 3KPSE 3KH3A 2X9YA 3U48A 2CKBH 3O9WB 4YVUA 2WYZA 4W1TA 2HRPL 2LQRA 5JR1L 1N4XL 3B9AA 4WHDA 3WS6A 2IH1A 3ULSB 3FO9A 5JLZB 1FYTE 1DSYA 4K9JA 5D71H 5HHPB 1YDPB 4JZOA 1JPSH 1TVHA 4XOCA 3ZKQD 5ADPH 1EXHA 4PLJC 4BKTC 5BQDA 4JR9L 3MRNA 2BSDA 3KPSD 2OMZA 3N43F 3WFCL 5HDBF 3VGGA 1IAIM 4FYQA 43C9B 2XWTA 3HMWH 3TN0A 2XZCL 2QQQA 5C0AB 2DI7A 2WNWA 3FHAA 4TSAL 2MQ0A 3UEZA 2ZOLA 4UF7C 5I1EL 4P06A 4ABQA 4P23B 3ZLQC 3EDDA 4UNTA 2C7FA 4KU1A 1F97A 2AQ3A 4EN2A 1HH6A 3VU2A 1TJHH 2PP9A 3MCKA 2YA1A 3WN5C 2R0LL 4PJFE 1DVUA 2CZNA 4JQIA 4XC1L 2FT7A 4GKSB 2VLKA 1E9PA 4WNJA 5EN3A 4HYTB 4WTQA 2TSBA 4Y9EA 3GB7A 3IFNL 4YSTA 2D8KA 2BVOA 3SE3A 3BAWA 3V0AC 2ZOKA 2WBJA 3CXHJ 3WE1A 1DYZA 4LU5L 3RA7L 1WAEA 2E7MA 2DOCA 2G3MA 4FNUA 1AG6A 2HXAA 3HB3C 1CBJA 3L08A 4WSGA 1T1WB 3DJSA 1JZIA 4I0CC 5CS7A 5CGBA 2Q87A 4LDLB 1CFBA 3L3HA 2V7HB 5FUZL 3UTQB 2JE8A 4G82A 5L4IA 3N0PB 3RTQD 5IMOB 1BX2A 2Z9TA 5DMJB 5CNHA 3EBAA 3AXLA 2UXVA 2OJZH 3KJ6H 1DLFH 1LO4H 1N70A 5BRZE 3PAUA 2HN7B 3SKOA 1CU4L 2DWDA 4BKSC 2A9AA 4X6DE 1Z5LB 2FO8A 3KLKA 4QXUH 3EBIA 1OTTD 1I85C 1CDYA 2L7JA 3U46B 3WKQA 2FIKA 1DQQB 3ZO9A 1B6UA 4IBQA 5GGSA 1HJBC 3WNJA 4Z7IA 4HAGA 4WK2B 5CEZH 2Y06L 4FQIL 4OVVA 2EECA 1FPTL 4HWEL 5I1KL 1UZ6E 2XVLA 5DK2A 2I5YH 1H8LA 1P7BA 2EDRA 1U8KA 2YN5A 2F1EA 2BCMA 5CJXA 3VUAA 3ZE2F 2G75B 4YWGH 5HDLA 3H2PA 4ZXBD 5T1LD 3QYCA 3U7WH 2C4XA 2LTQC 3MNVA 3NQKA 2GTWA 2DQMA 5AKVA 1TQBC 5AYUL 4JJOA 4WFED 5MEOB 4LMQE 3PDOA 3LZOA 3Q7JA 2XKUA 3P1VA 5D7JA 2OR8A 3KL0A 1BF2A 3CXDL 3TT3H 1GSKA 4MRCA 1ZV2A 3EJRA 1HNGA 1PZ2A 1T0OA 5C08E 4NJ9H 3TFKD 1FNSL 4WV1B 1IC7H 3SPVB 5FGCE 5GZOD 5IB1A 1UA6L 1O0VA 2EDMA 4BZ1A 4MZ3A 1W8EA 3OGCB 4PWFA 5AW6B 4KY1H 3I75B 4ZQKA 1DP0A 2R51A 3FXIC 3HUJA 3QGVA 4IIZA 4CU6A 4XWGL 1GW6A 1Q1JL 2JNZA 3L4ZA 4UT6L 2GJ6B 3AREA 2VN4A 2K6YA 5C08D 4AYFA 4M93C 1JHKL 3H0TA 4OFIA 4GRLA 4XCNA 2YBRB 5C0GB 1TKWA 2OMBA 3O0RL 1SQMA 2UX7A 3VE0A 3IJEB 4PJ5D 1MXGA 3O3DA 5KSUB 1RZKH 2DKMA 3F7YA 4L8DA 5EU3A 1ZSDA 1NL0H 2HT4C 1OE3A 1RVFH 4BSWA 4ZFZA 1UD6A 5AVSB 3D3VB 2BVTA 5D1QC 3BZEA 1C16A 1CF8H 3RB5A 2EH7H 3CHRA 4WLCA 3WO4C 4XZ4A 5GRJH 1V7ML 3OTTA 1KLUB 3M1CA 3IMUA 1XQ4A 3SOTA 1ZLSL 2XT1B 3S37L 3PL6C 5CBEA 3PPSA 1DDHA 3E8UL 5MEPA 3VRIA 5TTRA 4JDTH 4XPFL 4WI4A 1INEL 5DJXA 2HT2C 1EZVY 3EO0B 4NWTH 4MJIA 3H55A 1QRNA 5I28A 1EVUA 1JSYA 4HIJA 5C07D 3ZKMC 4NKDA 1F58H 3VXRB 2VZ3A 3GUTB 1U8QB 5T5FA 1M2VA 2BC4A 3PQYB 4GQ9H 4OCSL 1E4HA 1WH0A 2WP3T 4J6RL 2N0KA 2FWOA 3EYSH 2GJPA 2OTUB 2R83A 1D5IH 4PJBA 4H8HA 1NDMB 1Q9OB 1RUKH