1MG2C

Mutation of alpha phe55 of methylamine dehydrogenase alters the reorganization energy and electronic coupling for its electron transfer reaction with amicyanin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine dehydrogenase, heavy chain
publication title MUTATION OF AlPHA PHE55 OF METHYLAMINE DEHYDROGENASE ALTERS THE REORGANIZATION ENERGY AND ELECTRONIC COUPLING FOR ITS ELECTRON TRANSFER REACTION WITH AMICYANIN
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase
total genus 25
structure length 105
sequence length 105
chains with identical sequence G, K, O
ec nomenclature
pdb deposition date 2002-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1mg2C00
4DP1X 1FA4A 2I7OA 3KW7A 4HIPA 2I7SA 2J55A 3X1NA 3OMIB 1IUZA 3SBPA 3IEAA 2XLLA 2IDFA 1AQ8A 2VMJA 4N8UA 4BWUA 1VLXA 3FU7A 3QJSB 5I6MA 1OE3A 2BO0A 5LDUA 4DP8X 1TEGA 2EILB 4G7RB 4DP4X 1L9SA 1SDDB 3FQ2A 2B08A 4DP0X 1PCSA 4G7QB 2N0MA 3NJGA 1W6LA 3NJNA 1NIEA 1W6WA 5B1KA 2QPEB 3D12B 3UGEA 1L9PA 1ZIBA 2UX7A 2YXVA 1ET7A 1SHWA 1OV8A 4PCYA 4GP5B 3CVDA 2GBAA 3CZUB 1KGYE 3FT0A 4PAZA 3T6ZA 4BWWA 3JTBA 1XB6A 5TK4A 3AW5A 4MFHA 1CURA 1PF3A 2NRDA 1PZBA 1TEFA 1ASQA 4HZ1A 3NT0A 3UADA 3QJVB 3MX0B 4G72B 4DP6X 2IDQA 1AAJA 4P5SA 2FQGA 1E67A 2XX1A 4HCIA 1GY2A 2PPCA 3H4FA 4EF3A 2XYBA 4NERA 2EIMB 5I6KA 1KYAA 3FPYA 1X9RA 1GS8A 3FPXA 3CVBA 3CG8A 4KOCA 3FYIB 4YVNA 3WKPA 3NJJA 4UAHA 2IDUA 1AACA 1E30A 1JZHA 1L9RA 2LLNA 2YAPA 3FSZA 5I5MA 3QPKA 4E9SA 2UXTA 5B7FA 1KCWA 2A3TA 4BDVB 5F7AA 4A2HA 1GYCA 3NJMA 5B7MA 1ASOA 1QHQA 4JHVA 4G7SB 1OCCB 3EHBB 4YL4A 2XXFA 4QLWA 3FU8A 3NSCA 3OMNB 3ABKB 1KDIA 2QDWA 1JVLA 1B3IA 1AG0A 1OE2A 3PCYA 4A2FA 2GB2A 1ILSA 2DV6A 4Q8BA 2VN3A 2FNWA 4RH4A 2XV3A 3OM3B 2BZ7A 2EINB 3T6WA 4YSTA 2PP7A 3SQRA 5B3SB 4Q89A 4P5RA 5PCYA 1J5DA 3T6VA 4K9JA 2Y1AA 2I85A 2FT8A 1GY1A 4AKOA 5AFAA 1ILUA 2UXGA 3PLYA 2ZONA 2TSBA 3EH4B 4YSDA 3S3BB 1M56B 2VSMB 1NPNA 1BQ5A 4DP2X 4E9VA 1NZRA 5I26A 2JFCA 3WG7B 1V10A 3UAEA 1W8EA 1NPJA 4KO6A 1SDDA 1NICA 1J9TA 2FQDA 1PLBA 5D4JA 3QJQB 3ASNB 2IDTA 1AZCA 2YAOA 4KO9A 3WNJA 1JZJA 1N70A 1A4CA 2AZAA 2IDSA 4A2DA 2BHFA 4NB7A 2BWIA 2XUWA 2J5WA 3DKHA 2HX7A 4YVUA 4BK5C 4HHGA 5E9NA 4YSQA 1YLBB 3UACA 1L9QA 1L9OA 4KNUA 1QLEB 3ASOB 5I6OA 2VW7A 1OE1A 1J9QA 4W1TA 3EH5B 1PMYA 1WA2X 3EF4A 1IBYA 4GXFA 3AG4B 3AZUA 4FAAB 1WS8A 2XX0A 3FS9A 4DPCX 3PPSA 1SHXA 4HCFA 4KNSA 1BQKA 2QDVA 2BP8A 4W9ZA 3BQVA 3BVDB 1ETJA 5B1JC 3ZX1A 1IC0A 1SJMA 1HFUA 8PAZA 2Q9OA 2JXMA 1J9SA 1PY0A 2UX6A 2BZCA 1AZNA 1BYOA 1ZV2A 5PAZA 1FFTB 2PCFA 3TBBA 3CDZA 3NYKA 4E9QA 5D4HA 2YARA 2BP8B 1FWXA 3OD3A 2CCWA 2AFNA 1F56A 2VM4A 1OCZB 3X1GA 2BW4A 2FQEA 1PZAA 4BDVA 1TU2A 5I6PA 3AG1B 3ZBMA 4HALA 1AZUA 3S3CB 2GIMA 1MZZA 1ZPUA 3IN2A 2XU9A 2MRYA 3IE9A 3PAZA 1KBVA 2HZHA 3FQ1A 3H4HA 2RACA 1NIFA 4KNTA 4DP7X 1JZFA 2PPAA 4YSUA 3CDZB 4GP8B 2WO2B 2PPFA 3GXUB 3ZIYA 3GYRA 2IAAC 2CAKA 3QQXA 2EIKB 2VM3A 1J5CA 2AVFA 3T9WA 4F7KA 2XV0A 3AG2B 3NJFA 1PLAA 2IH8A 3DIVA 2QPDB 1UATA 1JXGA 1HAUA 1TKWA 1IKOP 1KBWA 2VW6A 2TSAA 1GR7A 1JOIA 2OCCB 5IY5B 4AX3A 3AG3B 3V9EA 4E9WA 1L9TA 3V9CA 3ZDWA 1SNRA 4L0PB 3CVCA 1WS7A 1ET5A 1PNCA 1NDTA 2FQFA 1OCOB 2HRHA 2HRGA 1RKRA 4DP9X 3FQYA 4GP4B 1AR1B 1BXVA 1NIDA 1A8ZA 1NINA 3H56A 2OV0A 4CSZA 2FTAA 2GI0A 3ABGA 4E9XA 4HHWA 3MBWB 4N4YB 4A68A 1E65A 3PAVA 1URIA 5B1AB 1ZDSA 1V55B 5B1BB 2H3XC 2R7EA 4YSOA 1NIBA 1ID2A 1MDAA 1BEXA 1NWPA 1R1CA 2B3IA 1AG6A 2YAEA 1M9WA 1GS6X 3GDCA 7PAZA 1AZBA 1I53A 1DZ0A 4AI7A 5I28A 1JZGA 2UXFA 4UANA 1GS7A 4ENZA 3QJRB 1PNDA 4M3HA 1AANA 1V54B 1OF0A 4BXVA 1CUOA 2AZUA 2DWTA 1AIZA 4WTQA 3SBQA 7PCYA 1MG2C 2IH9A 1BXAA 5I5IA 3NJHA 2YXWA 3RYMA 4GYBA 4QKTA 4DPAX 2P80D 3NJIA 1RZQA 2CBPA 1BAWA 2HXAA 2R7EB 4YSCA 2PPEA 4DPBX 1ET8A 2H5UA 2PP8A 2X88A 2YAMA 4E9YA 9PCYA 2DYSB 3ABLB 1JZEA 1AS8A 2ZXWB 6PAZA 3L45A 1JVOA 1WA1X 5AZUA 5D4IA 1MZYA 3QJTB 2WO3B 1E5YA 3TASA 1A4BA 4HCGA 2YAFA 4KOBA 1JXFA 4AKPA 2J56A 5F7BA 2JKWA 5TK2A 3FSVA 2YAHA 1JZIA 1WA0X 2BW5A 3TBCA 3S8FB 2GSMB 4F2EA 2WSDA 1N68A 4A67A 2XXGA 3X2QB 3OQRA 2DYRB 2H47C 1NTDA 2UXVA 2XVBA 1T5KA 1BYPA 1HAWA 1JERA 3PAUA 4A66A 5ANHA 1GW0A 4NAJA 2IWKA 1AZRA 4G71B 5I5JA 4JKNA 3NSDA 1JXDA 3IBOA 3FU7B 1A3ZA 4AKQA 1XMEB 1SF5A 3FSWA 3FU9A 4A2EA 2AANA 2W8CA 4ZK8A 1BQRA 3WIAA 4BXSV 3ABMB 3DTUB 5I6LA 2DWSA 2P80A 1OCRB 5I6NA 1KCBA 4KO7A 3EH3B 1MG3C 2FWLB 3NJKA 3X1EA 2HLEB 3FSAA 3NJLA 2QT6A 2W88A 3N55A 3IN0A 1CYXA 2GC7C 4TXVB 4WKXA 3N2JA 3TU6A 2FJSA 3UAAA 1J9RA 4DP5X 2J57A 2VW4A 3T6XA 4X4KA 3HEIB 3NSYA 1KDJA 1BXUA 1SFDA 1SFHA 3PXLA 1KV7A 1EZLA 2XWZA 1M57B 3U25A 1NWOA 3AY2A 2CALA 1ZDQA 3SBRA 3C75A 4JHUA 2PCYA 4F2FA 2VSKB 4E9TA 2BWDA 1OOWA 2XV2A 2YAQA 3S3DB 3WNIA 5A7EA 2Q5BA 2CJ3A 1A4AA 3OMAB 3T71A 1RCYA 4HAKA 2FT6A 4GY4A 2OJ1A 2YQBA 2IWEA 5B7EA 2EIJB 2X87A 2HX9A 4UF7C 5AKRA 5B1JA 1NIAA 2Y69B 2MTAA 2CUAA 1XB8A 4M4RB 5EHFA 1CC3A 4E9RA 2GC4C 3NSFA 1ADWA 4A2GA 1XB3A 4BWTA 2ZOOA 2IWFA 1X9UA 1ZIAA 2BP0A 2ZWNA 3FYEB 3TA4D 4YSRA 5FC9A 3WI9A 4FA7B 3UABA 2PLTA 1PZCA 3QJUB 3NP4A 1AOZA 1IBZA 1QNIA 3WKQA 1DYZA 4YSSA 6PCYA 1AS7A 1ASPA 1PAZA 4YSPA 4YSAA 1AS6A 2HX8A 4G70B 4KO5A 2PPDA 4YSEA 3G5WA 3JT2A 1E5ZA 3ERXA 3KW8A 4CSPA 1CYWA 1PLCA 1GSKA 1A65A 3HB3B 2GHZA 1RZPA 2BP0B 3S8GB 3X1FA 3NP3A 2E86A 2FT7A 4AZUA 3X1BA 1WAEA 2DY2A 1EHKB 2PP9A 1SF3A
chains in the Genus database with same CATH superfamily
1BBJA 3MRFB 2PO6D 4Z8FL 4YDIH 2UVEA 4XPFL 4O2CB 2QSVA 3L3GB 4JDEA 1C16A 1IUZA 3DSNA 1DQLH 3IGKA 1OF2A 5LNGA 2PWEA 2C3WA 4JREC 5HHPB 3WNLA 4HLZH 3RI5F 1GOHA 5DEJA 1IQWH 4TF4A 4AK2A 2K8MA 2N0MA 2ROYA 4YAQB 3V6OA 5J7CC 2NX5E 2P26A 4FZEL 4M43H 2AK4B 1NAML 1EXUB 3Q1SL 5FUCE 4WWPA 1BLIA 4X7TA 4QJ5B 2CHZA 3V7AE 3O4LD 4NKDB 4WDIA 3D50A 1QRNE 2OJEB 3TYFB 1A1OB 3LMJL 4N1CA 1FIEA 4TLTA 3RZCC 1W72A 3JTBA 2EH8L 4NKQB 3BAXA 2XRAL 5J1AA 4EUPH 2NNXA 5ILTH 3HE7C 3V6FA 1MJJA 5HI5C 2OSLA 3ALPA 4F57H 1CLZL 4GUQA 2HSIA 1KPRA 3EOTL 2YLKA 4KQ4L 5F7DB 1FVCB 4ZMAT 2BSCA 1BX2B 3TO4A 2IC2A 2C5DC 5AENA 1E67A 1UOVA 3AWGA 1G0XA 3EFDL 2XX1A 3MJ9A 1HI6B 4I9WD 1DSWA 3VFVB 2EE2A 4JRXA 3FZUC 3GXPA 5C0AE 3AB0B 3NK3A 4OCWH 3U6RB 2P46B 2XPYA 2CO1A 3ULUC 2F54D 1XGUB 4Z76B 2OX5B 2QQLH 2YMXL 3VMOA 1EK3A 2DI7A 2YC1A 1T22B 4KAQH 5A2IH 5IJKA 1VGKB 3LB6D 3K1DA 4NZRL 3U79A 3GZKA 3EJJX 3HBZA 5I74B 4FXKC 1GYCA 1J0IA 5C8JA 1UM6H 2DWDB 1HH9A 2YZ8A 4JHVA 4GSDH 4X9YA 1OCCB 3MCG1 1GGBL 3FJTA 1Q9LA 1TXKA 1TT6A 2MHAA 2BY3A 2UZYA 3E6HA 4KKQA 4A6YL 3KPLA 4ZNEE 3DO7A 2X10A 2Z8SA 3PQYE 1CQKA 5I1HH 2GTZB 4AH2A 1I1AC 1I1FB 1Q9WA 2YZ1A 4FCHA 3T0VA 3BPCB 2J8OA 2VERN 4O00A 4EIGB 3S88L 1YECH 1IM3D 4M8QA 4PTUA 2ZUTA 4I3GA 1E6JH 3QUZA 2XV3A 1A6UH 2ZF9A 1ZSHA 4CRPA 1YG9A 4MNQE 3B43A 4XMUA 2P5EA 1MCSA 4YR6A 5I71B 1JNJA 4WSJA 4G6ML 1A7NH 3ATEA 3DWTA 3O2DL 3KLAA 2CIIB 2WAQA 4RAUA 5E9DB 3FU3A 2N1TE 5DSCB 4B9FA 1XAUA 3UTZA 4ODBD 1V05A 1BD2E 4IGBA 4MQTB 3TJEH 3THML 5GIRB 2AAAA 3BN3B 2Q10A 5GGTL 1MIEL 4KI5E 3NN8A 1KCUL 2H2SD 1DVYA 2EDKA 1RAMA 2Y1ZA 5C0IA 4X8CA 4Y19B 4FGMA 3Q3GA 2EACA 2CGYA 4M7LT 3D18B 2X3AA 1SDDA 4X5XA 1QLFA 1S7VB 3P69A 4S1QH 5IB5B 3UBGA 2QMJA 5F9JB 5GZOA 3UDWC 4D0DA 2UZIL 4WCYH 1IBDA 2VNCA 2EDQA 4OM1H 1DJZA 4JM4H 4BK8A 5IKCB 4RMWA 5JNYA 3D0VB 5AAMC 5GRYA 1QPKA 2M1KA 2J5WA 4NQXA 3DBSA 2VSCA 3LV3A 3KBEA 4ZXBD 1PFCA 5ENWB 3DARA 1D9KA 3O9WC 5GS0L 3AZUA 4RGNB 1LQBC 35C8L 2VDQL 3MV8B 3M86A 3FUDA 5F96H 4E41A 1T03L 1MFNA 5D1XD 2GY7B 4BE6A 4BZ1A 4Z7UA 1Z3RA 3GLAA 2R2EA 2XA3A 1RZ8A 1KXVA 5ACZB 2MFNA 2QEJA 5E1GA 1THAA 3O11B 1RHHB 1AP2A 4MMZA 5B21A 2V5SA 3MBXH 1KLUA 5EU5B 3VD2A 1X5FA 4NUGL 3L1FA 4GAYA 3IXTB 2CKBL 2VISA 2OAAA 1AZNA 3TURA 2VRQA 3B2DC 2EDHA 4G7VH 1KCKA 3LXCA 1RU9L 3ASWA 2R23B 1NANI 2YARA 4HLJA 5ECJE 4I3RL 3OJDB 3X1GA 2KLTA 1JYNA 1O7DE 1CGSH 2CA4A 4P5TA 1HCZA 2EDOA 3D9AL 3HS8A 5J8OA 3IM1A 1A6TA 1QKZL 1UKTA 1OSPL 3MODH 1N6VA 3NZ8B 5BXFA 3GMMB 4AZ8B 4QLRA 2I60H 5FWRA 4ABQA 1IU1A 1ZPUA 4P99A 4PGJA 3EJZC 2XU9A 4YDNA 4EAEA 3N6YA 4I3SH 3U6XA 3FCBA 1WTGT 5LG1A 3TNMB 2D03H 3PHOB 3CDCA 3ZE2F 2NR6C 2X4NA 1E6OH 3MXWH 3VI3B 3EG9A 4MZ3A 5EF3A 3BOVA 3QQ9C 3DTXA 2AABH 3NJVA 4YPGB 4WU5B 3V0DA 1JZ2A 1A4JB 4RMSA 1EAQA 1T0OA 4ZTPL 1KB5B 4CVZB 4CNIB 2J2ZB 5SX4I 5EBWB 5LBSL 1T0MA 5FOJA 1UT9A 3FQWA 3C5XA 1TO5A 4RDQF 4M02A 5AAMA 1KXTB 3ULVF 4DGVH 4DN3L 4OFKA 3TA3D 4U6HA 1C1EH 3X14A 3G5ZB 1BW8A 2APBA 3D2TA 5F7LB 3E8UH 3FMGH 4LVHB 4E9WA 1LE9A 1KCSL 4QAMB 5GSRB 1RZGA 5FS5A 2W0LA 4JRWA 2QLYA 4OLYH 4NRZB 3A67L 1AKPA 2YRPA 1T3FA 1OCOB 3FTYA 1NPUA 1LEIB 2OR9H 2X0WA 5D7IA 3M1BB 4AIZB 1W0WB 3VA2C 2J6EA 4F9PC 2ZJSL 2PCPA 4OZIA 2BIPA 4YHZL 2H0EA 4XMVA 3SQOL 4BSJA 1U8NB 4WY7H 2G3XA 4MXQD 3BHBB 2QR0A 3EYQD 1MJ7H 1KIQA 3LN9A 4JZJA 1NIBA 3MLUH 1NDGB 4HUWB 4JY4A 3ALWA 3D48R 4X50A 2CCLA 5GRUL 7PAZA 4ZOBA 4HF5H 4Q56A 1HSBA 3DXAA 2F8OA 4PBWD 1EO8L 5IVXE 1T0NA 3HZMB 3GC3A 5FFGA 2ZTBA 4ZX3A 2X6MA 3P02A 3Q2VA 1AY1L 2R83A 4UQCA 1FHNA 4QRRB 2FJHA 5AZ2H 4GW4A 1DQVA 3ZMNA 1MWAH 4I0KA 4YE0A 1XZ0B 2X41A 4DPAX 2A7BA 4F93B 1A3RH 4BZYA 3QG6A 1D6EB 3WTXA 3HC4H 4JG1L 4MDJA 2F6AA 3QQ4A 1N5AA 4NJ9L 3V0IA 4LRIC 4H20L 3BEVB 4ZYKB 2IWGA 5AZEL 5ICXB 5MENE 2AJSL 2ICWB 3ABLB 4RAVA 4MS8C 3VXQA 5JHLH 2FBJH 5L2KA 4LARH 4ELMB 1M1SA 5FCUH 5FKAA 4UAOB 4JFZH 1E42A 3JUYA 5KVDL 1RZKC 1FYTE 2BP5M 2WUBL 4XN5A 2SEBA 2PW2A 2WO3B 3TASA 4TYUA 3N1GC 2YAFA 1BIIB 1YPZA 2BNRA 1A3LL 4JHWL 2ZXGA 5A16B 4ZO8A 5FFOA 4PRBA 3WD5L 4CVUA 4HWZB 4WKZA 1J48A 1LYQA 1AQMA 3P3SA 4XNZB 3OPUA 1EZUA 1G9MC 2C9VA 4LPTA 4ANXA 4Z7OF 2F7IA 1H3TA 3IMVA 2ZG1A 3QFDB 3W0WB 4ANUA 3HI6L 4A66A 1CFTB 1JERA 2W9EL 4JM2A 3GMRA 1NOAA 2H3NB 2JQZA 4G71B 3OAUH 4NUPA 1T6VN 3QEGH 3RL1B 4AEFA 4MTMA 2ZWYA 4WWKA 4JFHE 3HVNA 5D1QB 1WFMA 4NUJB 5DUBB 1G9MH 3QBTB 4B97A 5LO7A 1H8NA 5EU7C 4XP4L 5K39A 4A2EA 1R9FA 1OARL 3L6FA 4OCSH 3D4ZA 3QUYD 2XWEA 2EUWA 5DVKA 3ULVL 5EDXA 2QQKH 5C9JA 1YEDA 3D34A 3W57A 2DYPB 4XN1A 3QXWA 5I0WA 2XTJD 2W88A 1I82A 3MXVH 3N55A 5EEVA 4QRUA 4JUSA 4MD4B 4JKMA 3CHOA 4HT1H 3P9WB 2LABA 5MERA 1DN0B 1Y7VA 3BFOA 3H9SA 5AOMA 1WC7B 3RHWK 2WXPA 2XTLA 4WO4B 4JRYB 4Y4FB 2K6YA 4ZMXA 4WFFD 1KEGL 2GUOA 4FRWA 1KYFA 1P4IH 1E4KC 3WO4C 2NSMA 3TCXA 1XGRB 2BY0A 2FDBP 4TRPH 5KVDE 3SJVD 4GKOA 1IILE 5E4EC 1H3WM 4GNKB 1K4CB 4AYEC 2XV2A 3T0EB 2YBGA 1AC6A 3UO1L 2QGCA 4P2CG 5HVHB 3DECA 4GAFB 3OKDA 3T1WA 2CA3A 3CK0L 4M5SA 1GH7A 2HFEA 3ABZA 2L04A 4NN5B 4YHKL 2JKXA 5DJ8B 1LD9A 1I1YA 1M7IB 3TV3H 3HG2A 2FYVA 2Y1VA 1QAWA 4TN9A 5B1JA 1LK3H 1CZ8H 2Y69B 4LHJB 3ZE2E 3AMLA 4WGWB 3TIEA 2P7TA 5DVOA 2EH7L 3F6IA 5B3JF 3ETSA 5BVJB 4LCCB 3FNKA 3VXRA 1W15A 1U2CA 1G5AA 4XPBH 1G7QA 4X8GA 3FYEB 3L5WB 4J3OG 4NUMA 4PJAB 4PJ8A 2DQCL 1ZAGA 3CFBB 1JMZA 1UOLA 3H53A 4M1DL 3BSZL 3ZE1F 1J05A 2NQCA 4RX4A 2VO5A 4FJ6A 3NP4A 4LSDA 5DHVB 4KX7A 1AGBB 3WKQA 2ADIA 1IIKA 2C1OB 4BQ6A 2WK2A 5FYKH 4NAMA 4PWFA 3MYJA 1FLTX 1NCGA 1KXQA 1BVNT 3SDDA 3LKQB 4MQ7A 3RKPA 3Q8AA 1X5HA 1XCXA 2WC7A 2Q0ZX 1Z7JA 2YPLA 3RWGA 2FT7A 3LSOB 1G9EA 5A2JH 1H6EA 3LPGA 4RZCB 5DRXA 3SE4A 4L1BA 1E4WL 3S96B 3I85A 4AC2A 4IIZA 3V4VL 3HN8A 3UG5A 1E43A 5CCGE 4HUUA 2WY3B 4PCSA 1N9PA 4R5VA 3OC5A 5FLUA 1E5UI 4YL9A 4LEXL 4N2CA 1ZWIB 4ZTOH 1DE4A 2P8MA 2R1XA 2UUDH 3DUSB 3II1A 2XBTA 1GVIA 1AQ8A 4D9QE 4LKXA 3A24A 3SO5A 4S1SH 4BWUA 4F7PB 2VABB 4PRIA 1XQ4A 1P1VA 3P3RA 4PN6A 3CNKA 3QIUC 4NFBA 3V4PH 3ZDZF 5E5LA 4GQZA 4J3OC 2B08A 5TDPA 1O7SA 1NQBA 3HLKA 5FF6A 3NJNA 5CLWA 5JPMA 2X4QB 5D5MA 1B0IA 1C8PA 2YXVA 1ET7A 4S1RH 1U92B 1D7FA 3RAJH 5C07B 3TZVA 3WDJA 4X9BA 4NN6B 4PCYA 1NJ9A 1DUZA 3GUFA 3QUML 4WW1B 3WYRA 3NQKA 3ESNA 4J3OH 4X6BA 5JIMA 1EDQA 4XVTL 4Y9BA 5BO1L 3QDMD 4R4BB 5ISZA 3ZDXE 4ELKA 4ZMYA 4W9IC 1BVOA 2BCMA 4K2UL 3NEOA 1TEFA 4HZ1A 3RL2B 1M6UA 2ID5A 4RGMC 1BVZA 3A6BH 3QJVB 3V95A 3HS0B 2R4RH 3ZTNH 1AAJA 1PGRB 4OLWH 1LO3H 2V7HB 4FXGB 2ZPKL 4J5VA 3O8XA 2E46A 2XI9A 5TTRA 1FCCA 1AQDB 4YXLL 2J8UF 3OAZK 1FO0L 3QORA 2BCKA 2VSDA 4NFCA 3MJ8A 3HFFA 1UEYA 1OGSA 3D25B 2Y07H 4P3DB 4YO0B 3EBIA 1WISA 1R3JA 4PRPE 5EU6A 3IDIB 2IANB 5D1ZA 2RA1A 2VLKD 4KOCA 4XPAL 4JANA 1N5YH 3GFUA 2WQSA 1YNTB 1JPTL 1DBJL 5E99L 5D7SL 4HIEA 5DJ0A 1O6TA 5LVEA 4LCUB 3PG2A 3FFCE 4JZOA 4GAAA 3WY2A 1TU2B 1DQIA 1JDDA 1ASOA 1H3PH 2KH2B 5HGHA 1VZGA 2CDEA 3EHBB 3VFUA 4ZOAA 4C83A 5IHUL 1XTMA 3NSCA 2D3NA 1SJHA 2QDWA 4PJEE 1AG0A 2YD1A 2CRIA 4YDVA 4R4FH 4XXWA 3M17B 2WB1A 5IG7A 4QTFA 4HKXB 1X5JA 2OYPA 5I2IB 4ICWA 1NUDA 5C1MB 3PQYD 1XMWA 5GXBB 1TG8A 4QRFA 4AUUA 4Z7NF 2JCCB 3HMXA 4XWOD 2E76C 3OM3B 3LNFA 4N0YL 5MEOA 1D3CA 1SN5A 2XN9A 1SBBA 3NFPA 2CLVA 4N0FB 4PSPA 1EZSA 5AW4B 4RMVA 2OL3H 3OAWA 2A0LD 4DJMA 2Y1AA 4UUJA 4Y5YC 2I85A 2FT8A 4ZFGL 4H7VA 3MRFA 1PVHA 3DHJA 1Z9SB 4MNQD 5ADPL 2MCMA 3LX9A 4O2CA 3L3GA 3NIFB 3E8VA 3VACA 1HJBC 2ZCLH 2MQCA 4MAUL 5F9OL 5HYJA 5JQ6H 5E00B 4WTZG 2X1OA 3K3QA 4BUGA 1I8MB 2AQNA 3LKRB 1OZUA 1BD2D 4S0SD 5HHPA 4M6AA 1NGQH 4KI5D 4UNTA 5DJ6A 2HT2D 3ARBC 3BESR 2HVJB 4I0PD 1S3KL 4YAQA 1YQVH 2IDTA 5IUSA 4JMNA 2AK4A 4KO9A 4XO9A 1EXUA 4Z78B 2XWDA 3BVNB 3PP3H 4XBEL 4HXBL 4NKDA 4AK1A 4MCYB 2OJEA 1A1OA 1B9ZA 3O6KH 4D94A 5B3JE 4ZUVB 4AGNA 4OM0H 3KGSA 4J4PA 5ICYB 3WTWA 2JKIS 2R51A 3TVMB 1UXSA 1KWGA 1DLFL 3RUGE 2YRLA 3ZE1E 4AYDC 1QFWH 2K9UA 3UP6A 4P2AA 1TYRA 3KPSB 3QIWB 2XHNA 5F7DA 3LEVH 5EB9A 3VGDA 4QXGL 1BX2A 5IQ9B 3Q8EA 3BRGC 1IFGA 3I9IA 4M5ZL 4M7JL 5GPRA 3GSNH 4NQUA 3QNXB 2C9UA 1ECZA 1HI6A 1QSEA 2YFOA 3SDCC 3VFVA 4W68A 1W0YT 3MRQB 2Y7SA 3ECUA 3LHAA 3OSKA 5CN1A 3U6RA 2HLFD 3JWDH 3D7PA 4UT9L 3T3MF 4BZ2A 3K2IA 1YEFL 3TONA 1WFJA 4Z76A 2IQ9H 3NCWA 2OX5A 1CL7I 1T22A 2ZCHL 5HI3C 2HUEA 4OIBA 1NGPL 4S11A 5CCKL 2E7LA 1VGKA 4JBSA 4A7GA 2OMZB 3E0GA 4MXWH 1Y6MR 1MFEH 2W65A 3HG1E 5SWSB 3SE9H 3LH2H 3F8UB 3DUUB 2Y36H 3EBHA 4N2BA 1ND0B 2AKRB 3ZDZE 2Y6TE 5I73C 2IFGA 2O72A 2UUDK 2ERJC 1B0WA 2VDOL 3O3EB 5IOKA 4KNTA 3LB6C 3ME0B 2GTZA 2KDYA 1I1FA 2OMYB 1L7TL 5LGYA 3TESA 1GHFH 1MHHB 1IZKA 1L6PA 4XMPH 2FO8A 1INDL 4OBSA 1K2DB 4L4TB 1G7LB 2EDMA 3SD5A 4ALAC 3MSPA 1E3FA 4PJ9D 2AQ3A 2CIIA 5E9DA 5T1KB 3UP1A 5DSCA 3TN0D 1PG7L 1NGWB 2Z34A 5JZ7C 5L0QB 4RFNC 5GS0D 5I18H 5GIRA 1JRHH 3KEHA 1Z9MA 4ODWA 4NZUL 2MPAL 4ODSL 4PI0A 3GSWB 1X5GA 1I31A 1JOIA 3LNEA 3SPGA 3QAQA 4Z7WE 2VLMD 1GKOA 4KDVA 4Y19A 4ALAH 4L4VD 4HHAB 4HH9B 2J8UE 3H42H 3W39A 3K2MC 1OL0A 3D18A 1DVFD 3KJ6H 1R3IL 1S7VA 3BMVA 1MCQA 1P6FA 4ZBJA 1KTDB 5F9JA 5IB5A 3PYCA 5KSUB 3CVCA 5HHVH 4N86A 2NY1C 5LWYL 3DHMA 3TF4A 3BN9C 1OAXH 4D0CB 1J1XH 2ADFH 5LXGL 4NO3B 3CBJB 5ALCL 2COVD 5BUAA 1BYNA 5IKCA 3D0VA 3ZTJG 1C5DB 1A8ZA 5TDNB 3WSQH 3SDCA 1SGKA 5IHZB 1I9IL 4HHWA 3GJFH 4N4YB 3PAVA 1BZOA 3WNKA 4P46D 3MV8A 3OV6A 1MRFH 2Z6FA 4IIQA 5EF1A 1R1CA 3L4YA 2A9DA 3BAWA 2FATH 5CS7A 4W4NA 1I53A 3UGUA 1HEJC 4PR5B 2KZBA 5ACZA 2Y2YA 2OCFD 4GW1A 3GO1L 1R75A 1RHHA 3MLVH 4G6AD 1AANA 4M3HA 4WUUE 1IEHA 4GUPB 5F89B 1QHPA 1XGPA 1P0SE 2X2IA 4DWHA 4YHOL 3QRLA 2XPZA 3WNNA 5D1XC 2L4OA 1P4LB 5BOZG 1O9ZA 2DB8A 1BAWA 4JQXA 4XH2B 5AVRB 1N64H 4V1DB 2LTQC 3UEZA 2H7WA 2R23A 1J0ZA 3FOMB 4YOKA 4P2YA 3RE0A 5D7JD 4ANKA 4FQPA 1TJIH 4AVIA 2FE0A 1A7RH 5AZUA 5GJTL 3ELQA 4OGAC 5ID0B 4QRQB 5DVMA 5DGRA 2JKSA 2GVYA 5CIPB 5CCHE 2YJQA 1P84J 5D7EA 4H88L 2KLRA 2PCXA 5IEHB 4JM0A 2DM2A 1OP4A 3VXOB 1JXFA 3A21A 1EXGA 1RZFL 2F53E 1NLBH 1ZY9A 3B2VL 4FQJH 3V0FA 3PV6A 2W0FA 4YHIB 1JAEA 2AERT 3IMTA 5E6IB 1PEWA 2XVBA 5CZXD 1CTNA 1CR9H 1UA6H 1Z5LB 3VWJD 4YPGA 3WJJC 1AQHA 1BF5A 3AY4C 2AF2A 1TQUA 3AJ7A 3NCYS 3S2AA 2WJ7A 4KJPD 4CNIA 2J2ZA 5HHMD 2E27L 1NH6A 4OR1A 5EBWA 3T4AC 3GMOB 1CCZA 4DF9A 4ZFOL 4NIKB 5EN2B 3LIUA 2UWEF 4K5PA 2R29A 6CGTA 1KXTA 5BV7L 4G6KH 2Z8VC 2W9LA 1U8MB 4KMLB 3WIAA 2GHWB 4OGYL 3G5ZA 3D3VD 4N8PA 2IH3A 4W6XB 3OKEB 4P9ML 1AI1L 4CJ1A 4K5NA 2B0SH 5GSRA 3MRLB 5DD1L 3ZOAA 1FZKB 4M62H 4NRZA 3HEIB 1HHKB 3DVGB 2A9MH 3NSYA 1E3ZA 5HJBA 3SD2A 3DSFL 3FO9A 1LEIA 3TEZA 1CD0A 3M1BA 2WXKA 5I17B 2G4GA 3D1MC 4AIZA 1W0WA 3VB9A 5GISH 2JELH 2CALA 1GYUA 4BK5A 4AQ1B 3LNHA 1RP8A 2CO4A 1U8NA 1SUJA 2BLFA 3BHBA 2WV3A 3N9GH 1N0LB 3ZTCC 2O5ZL 3H2PA 1A4AA 4HUWA 1NDGA 1ZLSH 4JMXA 2FUTA 4Q0XH 1AHWB 3G6JB 5IROA 2K7PA 4OLZL 2Y5QA 2BOCB 3U1SH 4F24A 4KQ3L 4V11A 3HZMA 4PJ5D 2QADB 4BQ8A 1I75A 5DZJA 5AYUH 1MFDL 4ZUWB 4FQIH 4D9LH 1V7NL 2YOCA 4EDXB 1Z3GH 2FX7L 3MJWA 4OIAA 1BJMA 1CBJA 2DQJL 4HKJB 2EXWC 4MAYD 5I8CB 4MHHI 3PHSA 5CILL 3RURA 1XZ0A 4C4BA 2UY7A 2AMGA 2NQ3A 2BP0A 2AJUH 4TNGA 1D6EA 4KVNL 4UWQB 1B9KA 1UT2A 4EBQH 3BEVA 4BV1A 3LRGA 1WZKA 2F58H 5KN5B 2ICWA 3JTTA 4MCZB 5E2TH 4KQ0A 1CTMA 1SDAB 5ABZA 1BA9A 5DHDA 4ELMA 3VXNB 4RFEB 4FJYA 2P42B 4V2BA 3UC0H 5SWQB 1VENA 4LIQH 4PUBL 4YXKH 1Z9LA 3ERXA 1FYHB 4CSPA 1F4XH 1BIIA 3ULVD 4UNIA 1TFHA 5A16A 4IDJH 2A2QT 2YXFA 4HWZA 3ZQ9A 3NSXA 4KK9C 1K4DB 3TT1H 3ZYOA 1YEIH 1DBML 2R27A 4RISL 3MRBB 1LO2L 3L8QA 3QFDA 5DD3L 3W0WA 4M6OH 1TNMA 4HWBA 4MNGE 2ISDA 1CFTA 1ZLUK 1LO5B 2R0WL 4TLUA 5EO9B 2H3NA 1JNLH 3DVNB 2ATAA 2ZUQB 1MW0A 3RL1A 1OP3H 5FW7A 2BVQB 2X4SB 3I74A 4UT6A 5IB4B 4PJHB 4NUJA 5DUBA 1AE6L 4L3EA 5LDUA 3D2UB 3SKJH 3ZSTA 3ES6B 4UQ9A 2ZUVA 2ICWJ 4JDZA 4NC1C 3GRWH 4DP0X 1QBMH 3GJFK 4APXB 2PR4H 3NJGA 4U3SB 2XXMB 3NIGF 3ZE0B 1ZIBA 4FP8H 2DYPA 1VPOH 1SHWA 3MBED 2YRBA 1OAYL 1RL1A 4OD3H 2AP2A 4MD4A 4TM9A 3RVXD 5C08B 4MAZA 5TK4A 1DN0A 4G3YH 5DHMC 1WC7A 5K5YA 4JPKH 2YKLL 2JSFA 4WO4A 1T21B 4JRYA 1MHCB 3IU3B 3RGVB 1YYMH 3GHEL 4CN4A 3P4MB 3KZ8A 4LHUB 1X6NA 4PY8I 1XGRA 1MIMH 3B37A 2XTJC 4G72B 2C3GA 1IE4A 1VKXB 1K4CA 3T0EA 2X4OB 1F5WA 3OZ9H 1HN1A 3MV9D 1CTOA 4B60A 1YCSA 4HCIA 1F6FB 3U9UB 2PPCA 3JQOB 1VZHA 1JGIA 4PGEA 6FABH 1TZOA 2OTPA 3ZKNC 2ZYIA 5DJ8A 5G4OA 4OLEA 4X6FB 4Q9RH 1I3GH 4PJCF 1PG7X 3GHBH 1EJOL 1OAZH 1CPUA 2ZXQA 3HZKB 2ESVA 1PY4A 2ORBH 2VXTL 4CBZA 4QI3A 1TQBB 2VR4A 2IDUA 2K4WA 2DDQH 3DHUA 4LCCA 5BVJA 4H5SB 5K1VA 3QI9D 1J88A 3INOA 4PJAA 3L5WA 3L13A 4LLQB 4NAQA 3OG4B 3CFBA 3ZKXB 5BCAA 4N2EA 5IQ7H 3LKOB 2XC8A 1IBFA 3V0EA 1RJCA 5KSAD 4GKZB 4L4JA 5C0FB 5DHVA 2X4UB 4OI7A 2Z91A 1AGBA 1E9OA 1HEZB 1V3JA 3FFCD 3TL5A 4ZPVB 5DC9B 2C1OA 2ZOUA 5AUMB 4DKTA 4G8GD 4WFHE 3T2NH 1I4FB 2DV6A 2MNUA 2VXSH 1OW0C 3LKQA 4DZ8B 2ZX5A 3K1KC 1IAIL 4DW2H 2BZ7A 1IX2A 3LQAH 3VUAA 5MEPB 4Q89A 4PJXF 4DGIH 5PCYA 3DX2A 1H0DB 4RZCA 1H6FA 2ZKHL 2EE9A 3RILA 4UM8B 4OV6F 3S96A 5C3IA 1ACXA 2VAJA 2ADJB 4P06A 3U0WH 1EHNA 3QYNA 1QI4A 1ZWIA 3DUSA 3QQ3A 5DLMH 5CD3A 1J0HA 2G9HB 5KSBB 1YMME 4F7PA 3VDBA 4PWJA 5I26A 2FX8L 2VABA 1AXTL 3KEDA 4JO4H 5LCVH 3DNKA 1G6RB 1A6AB 1L9MA 1NPJA 1CDGA 3SPJA 5AW5B 2X4QA 1SOQA 3CVHH 4HDIB 2WCGA 3DUHA 3L9BA 3LZFL 3WO3B 3MRKA 1U92A 1J11A 4GXUN 3N50A 4CKVX 2AV1B 4WW1A 4P2QD 2EDJA 3O6LL 1T1YB 1MW1A 2VRKA 5E1QA 4PIBA 5FR3A 1VB9A 1F3RB 1MNUL 2CDGB 2JJUA 2DI9A 1UWGH 4XX1E 5J0BA 2Y3NA 3AWFA 4UV4H 1JWSB 3CX2A 4W9ZA 5DUMH 5IWLA 3HS0A 4KK8D 5D96C 3C6LA 2PTTB 3U4AA 2V7HA 3APMA 1TVHB 5FUCC 4B95C 1UTDA 3C60C 5DVPA 2E7DA 1AQDA 5BS0D 1HS6A 2AXHA 4X6CF 5CGYD 1KY6A 3FUNA 4ODUB 4JQVA 3JVGA 4P3DA 4YO0A 1CFQB 1MAMH 1P7HL 4CGUB 1CGVA 1AFVL 4OU3A 3BIBX 4NM8H 3IDIA 2V0AA 2IANA 5FGCB 4JPIB 2NY2B 1UD2A 2PCFA 5EWIL 3RPKA 1GOFA 3NACL 5IVZB 5DDHA 1YNTA 5GGUB 4KHTH 32C2B 5FX3A 4WNJA 3MV7D 2WJ5A 4XP6H 3SYOA 4LCUA 4OSUH 1TQVA 2R56H 2LAAA 3BP5B 3ARWA 3QR1A 5ITBH 1TU2A 5KVEL 1H3VA 4ONOA 3WFCL 2I69A 1L9NA 1VADB 4AUYA 5GGRY 4Y0GA 2G60L 5HDBB 3UFIA 2VDML 3OLGA 1OP3K 2BY1A 3H4HA 5IM7B 2H6OA 3U9WA 4JEGB 4BA8A 4I4WB 2TRYA 3CZFB 4HS6B 1XWVA 1YNLL 3M17A 2D9QB 3NIGE 4B9JA 4HKXA 4CBPA 2FAUA 5I2IA 1YJDH 1NFDF 3WXWH 2CO6A 3VB8A 1NM4A 2DD8H 3D39B 3UJTL 4XP9H 5HGAB 2JCCA 3P54A 3WXVH 4O5LH 4PB9L 1RSFA 1J9CT 1TTRA 2YPVH 2XV0A 3ARDC 2L7UA 3P4LA 3RIFK 4QHLB 1GZHA 1Z9SA 2ZXAA 2R4SL 2XWRA 4HFUL 4Z8FH 2X1PA 3C87A 5I1JL 1X5LA 2V8LA 1XTLA 5KTEL 4FTDA 1QVOB 2A9AA 4H44C 5A43C 3LKRA 5IY5B 4X5WB 4H26B 5T3ZD 3RWHB 1N0XL 4CC1A 4KMTL 4GG6B 2J12B 1IB5A 4I2XE 4XP5L 3PGFL 4WK2B 3UTTB 5JA9A 1B6UA 2A0LC 2HVJA 4L0PB 5HDQL 1X7QB 4FZEH 1WS7A 3EO0B 4MJJA 1NAMH 1PY9A 4L3CB 5JW5B 3Q1SH 3DOSB 3BVNA 5IVOA 4HEME 2HMID 3LVEA 3R18A 2HRGA 3L7FB 3V4UL 1JDAA 2ZUSA 1QWUA 2B4CL 1IC7L 4PRNB 2A6JB 3LMJH 1J5HA 3IGAB 3PNWB 3UX9B 1UZ8B 4UV7H 2UYLB 1FNLA 2NXZC 2EH8H 5ICYA 4GQPH 2XRAH 4KI5C 1U2HA 1DQML 3TVMA 5KVEE 4I0PC 4YGVB 1CLZH 1M1XB 5IMOB 4JG5A 4K3EL 1T7YA 2B3IA 3EH1A 3EOTH 5FV1L 3GBEA 3KPSA 3QIWA 3L95A 3QWRD 1VESA 4KQ4H 4Y1AE 5HGBA 3RB7A 4YK4B 5IQ9A 4DH2A 1FFNB 4ENZA 4MCMA 1QEWA 4NPYB 5I1CL 3QNXA 5DQ9B 4BXVA 2OQJA 2XZAH 3EFDH 3QDJD 3MGAA 1IT9L 1AIZA 2OMTB 3MRQA 4QCIB 2E7CA 3RWEB 4WUUD 3QJHB 4YC2C 4G43B 2GPZA 3QFJB 4CSSA 1HTYA 1A3QA 4ONFL 5DHYB 2YMXH 3BQUC 4PJXE 3BKCL 3CSYA 5BRQA 4FCAA 2FHFA 3HC2A 3LEXB 4R0LB 4BK4A 3FHAA 3L45A 2R8SL 2EDEA 2OMZA 4NZRH 5C0JB 2VH5L 2HLFC 5SWSA 4QHMB 4X9IA 2NY0D 4PI2A 4DNLA 1JMXA 1U8IB 1AGFB 3DUUA 3SKUD 1ND0A 2AKRA 3ZL2A 4A6YH 3HLAB 4WF7A 2OMYA 1BMZA 3ZSSA 2EC9T 2HJLB 2V9TA 3PU7A 2C7FA 2J1ZA 2F53D 4I18B 3S88H 3H7LA 3NIDF 4BKTC 4BFJA 4P8QA 5JPNB 4GUOA 1O7DC 5I16B 2WMPB 1GJUA 4CADB 1K2DA 4PLKD 3CN3A 1G7LA 1RMFH 3ZT7A 3HCVA 4PM1A 3QR0A 4G6MH 4WNSA 3O2DH 4OQTL 5T1KA 1T2XA 1M2OA 3U9PL 4HMDA 4ZG1A 1NGWA 4XBGB 4GIPD 2V3FA 1TTGA 5JHDB 4DGWC 4X7EC 4ZOEA 1MCCA 3THMH 3AXHA 2RH0A 5GGTH 3GSWA 5CP7B 2XQYK 3MQIA 3OKLB 1M71B 5FOBB 1KCUH 3J07A 4HUVB 2DWSA 2P80A 4FKKA 5BUGA 5I6NA 5KBLA 1PL3A 1JSYA 4HHAA 1PG7W 4PJ9C 3TN0C 1JTOA 3N2JA 1KTDA 1MQKL 1S7WB 1SJXA 1J9RA 1WAAF 2FJSA 2UZXB 2VMCA 4JFFB 4NXKA 3VI4B 2UZIH 4YHPB 4DCQB 3UAJD 4TSBH 4HVBA 4D0CA 3J2PA 1Q9OB 4NO3A 4Y5YB 3WLWD 1T1ZA 1N2RB 1MCWW 4AXWB 1C5DA 1E5CA 2QPUA 1IGCL 1WITA 5TDNA 5I75B 4X4MA 1A9VA 5FGBC 3VG0H 3QIBB 5IHZA 4KJQD 3RY6C 1S5IL 4M00A 2PCYA 3KL5A 2D0HA 4EKXA 2AQSA 4JRLA 5IBTL 1A5FL 5GS0H 3TCLB 35C8H 3T0AA 2VDQH 3CFMA 5E03A 3T71A 3TTYA 2X6CA 4BCZA 5T3XE 3V8OA 3ARBB 4PB0L 3ZYIA 1ZA3A 4HAKA 4TSAL 2PO6B 2YQBA 3F7RA 5TE6H 3T0BA 5D8JL 1I8KB 2N56A 4GUPA 5I8EB 5F89A 2E4TA 5E1IA 4EIUA 4A2MA 4P46C 4EZLA 4NUGH 1LM8V 2DH3A 5DRZB 3GSNB 5JXEA 4MB4A 1CFMA 2CKBH 3GXIA 1P4LA 2HA1A 4N0CD 3CWGA 4XH2A 2XACC 5A7BA 3WTVA 2JK5B 3I75B 1RU9H 4OFVA 2PLTA 3ARZA 4I3RH 1O5DT 3GSUA 3O4LB 3Q5YA 1QNIA 4WI8A 3AQDA 4U7MA 3ZUNC 5ID0A 2YS4A 3NCXA 4QRQA 5CJOH 4C56E 1QKZH 3SCMC 1OSPH 2WPGA 1LE5B 5CIPA 4ZD3L 1CYWA 1MFMA 3Q9QA 5IEHA 3CLWA 3Q6GL 5D70L 3VXOA 3N41B 5ACLA 4FNQA 1XH2A 1F4WL 1Q4NX 5HJ3B 4X5RA 4NBZB 4GRWF 4AYGA 3P4OA 2HG0A 2X09A 5E6IA 1T5WB 1TQWA 1IGTA 5H37G 5IR1B 2Y7LA 5JA8B 5D1ZI 5LBVA 2DEXX 2ODIA 2D3LA 3V0VB 2MOGA 3ATBA 1PDKA 2E3VA 5ETUB 3RVVD 2N59A 4EI5D 2F54B 2F68X 2WM0A 4OZGE 3GMOA 1E3XA 4PJBE 5LBSH 5L8LB 3DROB 3GTVA 2ZKWA 2R9HC 2FHCA 3STLB 4JFPA 5FGBA 4HZLB 2YQGA 3GB7A 2EE0A 3VWJC 1QFOA 3SIKA 3WMSA 3OKEA 4WIQA 1VCAA 3US0A 2W0KA 3B7TA 1KCSH 3U46B 4UYPA 1CXHA 4KJPC 3MRLA 5F9AC 4NNYA 1DBBL 3FT0A 3VH8G 3ZRFC 1FZKA 4ZX6A 2Z8WC 4R5TA 1HHKA 3A67H 3AW5A 3DVGA 5CJQL 3N1PC 2HN7B 1NAKL 2VR3A 2HPOA 3VQMA 1UVQB 5I17A 4RFNB 4ERSL 3UL4A 4HK0B 3CSPA 2ZJSH 1KYOK 3L1EA 4AQ1A 2LQRA 2YJLA 4E2OA 1UJ3C 2ZCKL 4YHZH 3SQOH 4FI8A 4P5SA 4PJIF 5EFIA 1N0LA 4WI5A 1ZHLB 5INCB 2VZ1A 3R1GL 5J9PA 1AHWA 5GRUH 3QWNA 3G6JA 4P0DA 3ZRSA 4HJTA 1B0RB 2Q2LA 4AGMA 2BOCA 5C2UB 1EO8H 1I1CA 1OTUD 4GLRH 4ZUWA 1SLWA 3FPXA 4MLIA 1AY1H 2G3MA 5EZOL 3CG8A 4EDXA 4NLAA 1BVLB 2NY6C 4LCWE 2K4AA 3FYIB 4P04A 2V5YA 4HKJA 4PWKA 5EEYA 3NIDE 3IETB 3FH8A 5BVPH 3MHZA 5JIPA 4HGMA 4JG1H 3PWPD 4NJ9H 1DBAL 2FEDC 5B7MA 4H20H 4HGWB 4LXFA 2WZ0A 3IJ7A 3NZHH 4NNXB 4X9FA 5AZEH 4MCZA 5KN5A 4GBXD 3ILQC 4LEEA 1E8XA 2H1LM 2R69L 3BIAX 3VXNA 1T7XA 4MAYC 4RFEA 1PIGA 3D51A 5TGBA 4S0HA 2WUBH 4W4OA 5AW7B 4ZXBB 3B2UD 5JW4N 3QZMA 1A3LH 3ESUF 5IHWA 1DVQA 3WDIA 1FRGL 4WFHD 3ATAA 4WU7B 4POZC 3KG5A 5FGRA 5F1OB 1WAAE 2EINB 3WD5H 1PX8A 1JI2A 1K4DA 3VNYA 5HVGB 1UKQA 2FWSA 2OMVB 3MRBA 1QUPA 4PJ7F 1JG9A 1GY1A 3H3KA 3HI6H 2YEVB 4YDKL 3RI5K 1LO5A 4QXWA 5EO9A 3DVNA 1EEYA 2H8PB 2BVQA 2X4SA 4ZMPA 1M56B 4FFZA 5KJRL 4GEIA 4F8OA 3E38A 5IB4A 1UB5B 5SV3A 4CU7A 4XO4A 3IDUA 3D2UA 3ES6A 4XNYL 4XP4H 1NICA 1YMMD 1OARH 5FWQA 4D3CH 2V33A 2WQ8A 4U3SA 2ZXDA 5C0EB 5I1LB 1Y6NR 3ULVH 4IU3B 4Z7VB 1N70A 3OB8A 4Y5XC 2X44D 2F8IA 3EBAA 1FNAA 5IIEA 5DZAA 2BIIA 1MCNA 4HJ0D 2VDLL 4Q6KA 5CJ5A 4JY5L 4W6YB 1NLDL 3VDAA 5C08A 3L5XL 1ZLWH 1E8ZA 1B90A 3B1UA 1OM9A 3EOYG 3SGEH 2Z0UA 1T21A 1IBYA 1MHCA 3IU3A 3RGVA 4WI2A 3BZFB 4N1EA 1MFCL 3P4MA 4LHUA 5AVWB 3SE3C 2BK8A 2HTLD 1VKXA 3GSOB 4JO5A 2X4OA 3O6FD 1P2CB 2WNXA 3UO1H 3LJ3A 1T2JA 2BPBA 2HCZX 5DC2A 1NMBL 3U9UA 5KWYC 2NNFA 1PKQB 2OTUA 1A0QL 1XO8A 2WBJB 2WLZA 3CK0H 2ZICA 4JFOB 4NQEE 2ZYSA 1HK6A 3HG4A 4YHKH 4GT0A 4X6FA 1KTJA 4YUEL 4GRWE 2IOOA 3HZKA 3TA3B 1CFNB 2H1PL 4HFWB 2J5LC 1EH9A 4LEOB 2EH7H 4BQCA 4WW2F 2VM4A 3O0LA 2QSCH 4QNPE 4RWHA 4H4NA 3C08L 1CGTA 4LLQA 2DQCH 2FWUA 3BSZH 5I6PA 3LKOA 3WE1A 2EP6A 3IJYB 4L8SB 5C0FA 3H0TB 4GKZA 1NCJA 2X4UA 1HEZA 3IN2A 3NAAL 1DTUA 3OQ3B 4TULL 4ZPVA 4LSUL 1RULL 2HZHA 3D85D 5AUMA 4TV3A 3QI9C 2KZ1B 1I4FA 1LWJA 2WXGA 4MA3B 5EUOB 2JJTC 5JHLA 3KXFE 1KJVB 1T66D 3SEPA 4DZ8A 4QWWC 5C0DB 1SVBA 3WNPA 4PMFA 4ADJA 1S8DB 2AS5M 2K6WA 2ZAIA 3QE5A 5KSAC 3EXJA 4PJGB 1G1KA 3RFZB 3D0LA 3LXBA 1WTLA 4OZHE 5A1AA 4UM8A 1BSIA 4EIZC 3QUKB 4LL4A 4FQ1L 2ADJA 3FBQA 3V4VH 3DURB 4CA4A 4MJ2A 2X9XA 4U1HB 3C5SB 4NQTA 4NO0D 4LEXH 3GSQB 1EHXA 2BY2A 2G9HA 4MX7B 4AE1A 4JFQB 4IRJD 3DHPA 1UB6B 4A7QA 1LTXA 1G6RA 1A6AA 1L9TA 4TOYL 4AYMC 3LAFA 3LKPB 1HHIB 3WS6C 5D7LE 3P30L 2XSKA 1Y6KR 2NW3A 4HDIA 2FHBA 2FQFA 2HRHA 1AD0B 1TZHB 5SWZA 1OQOA 4M9OA 1WBXB 3QUMH 4HMCA 1CICD 4NZFA 1BJ1J 2FRGP 4G9FE 4XVTH 2P5WE 5BO1H 2H0JA 5SV4A 3IJHB 2Z7WA 2CXKA 2LU3A 5AEAA 2R7EA 1WVZA 4K2UH 4LP4A 1SN2A 1JWSA 2MNJB 1OAKL 4B5EA 1DCEA 2LV4A 3FT4A 3QYCA 4XHJD 4UANA 1TVHA 2ZPKH 3VG9B 1OF0A 1K6QL 3DX7B 3IDXL 3A6CH 4YXLH 1HX0A 3C2SA 4PRDA 4OCRL 2OJZL 4R6UA 4ODUA 4H0IA 2BJMH 1BXAA 1MRCL 5I5IA 4ZMQA 4JKLA 1CFQA 3TJHD 5EG6C 1RZQA 3F6JA 3A4EA 2E7MA 3BZDA 2YKKA 3QUYB 4M29A 4JPIA 1SMAA 4NC0B 3F12B 3DJRA 5IVZA 2DYSB 5DMIL 32C2A 4UTBL 1JPTH 1DBJH 3QULB 5E99H 5D7SH 1HNFA 5E6UB 5AQ0A 5CGYC 3BP5A 3X3FL 2DOCA 1OK8A 5J13C 4BKLB 3MLXL 4HU2A 1QBBA 3B2XA 5I0DA 3ALXA 5AW8B 2D2OA 5ECGA 3DETD 4Q52A 4MMXC 3HB3C 1ZVSA 1RERA 4YBQC 2GEQA 5IHUH 5IM7A 3FSVA 4U1IA 2AW2A 1F90L 4QHNB 4I4WA 3CZFA 4HS6A 2DJSA 5DD6A 3SJVB 1UYWL 2WSDA 1KTBA 2Z92B 4PJEA 5F44A 4DGUA 2Q7YB 1JWMA 3N0PB 3CPLB 1E7UA 1H8SA 2V9UA 1W91A 2B8OT 3ZDYF 5DK3A 3D39A 4ZZKA 3DMMD 1GYAA 5HGAA 4NENA 3IKKA 5ANHA 4F8TA 2HVBA 2VDNL 1EBPA 1DLHB 1M42A 3KL3A 2E7BA 4N0YH 4DETA 5EDSA 4RRPM 3HRZC 4L8BB 4XCNB 5C09B 3SODB 3QEQE 4WJKB 4BGDA 2IXQB 1A3ZA 4HJIA 1AO7D 1TSHA 4IBSA 3N91A 2Z31C 4RRPG 3OF6D 1ZLWK 1BQHG 2V37A 5IFHL 3MNVA 4MAUH 2H41A 5F9OH 4F5CA 1QVOA 4X5WA 1JPSL 3EH3B 4NQDB 3RWHA 4CMHC 1PKOA 4N9GB 5H2BB 4HLEA 3FSAA 5SX5H 3NCJL 3UTTA 1S3KH 3EJYD 1X7QA 4DP5X 2XQ0A 1XFPA 4FZ8L 3EO0A 4L3CA 5JW5A 1M6OB 4UNUA 3DOSA 4BINA 3EOBB 3BGFC 4JGNA 1UA7A 3L7FA 4HXBH 3K72B 4PRNA 2A6JA 4JZNB 3IGAA 3PNWA 2DQHL 3RTQD 1UZ8A 5HD8C 2UYLA 3CVHB 4ZS6D 3S0PA 2X2YA 1GGTA 4YGVA 4ENED 1J0YA 1DLFH 4AM0Q 2AJXL 2PWFA 5IMOA 1Q90A 4JPWL 4TKWA 1WICA 5BZXA 4OFPA 4FLHA 5HHQA 4IBZA 4QXGH 5L6YL 3VU2A 3CIQA 5T3ZH 1TQCC 3UMTA 1FFNA 4M7JH 1S7TB 4M5ZH 3CMOL 4KHXL 5DS2A 4NPYA 5DQ9A 3MRIA 3SGDH 3G5XB 1NIAA 1CLVA 1WE5A 4M4RB 2OMTA 4I88A 7FABH 4QCIA 4WWNA 3RWEA 1JJUA 2O5XL 3QJHA 2ZG2A 4MMXA 4UT9H 1URZA 4Q4IA 1YEFH 3QFJA 3TA4D 5IJDC 2CM5A 4L3AA 1FZJB 4H8QA 3CX5K 4APQD 5GS1B 1HZLA 4O02B 2ZCHH 3WFDL 1NGPH 3LEXA 2W91A 4NGHL 4R0LA 5CCKH 2GK2A 1DYZA 3LRSB 5C0RL 3K81A 2VN6A 6PCYA 5LBGA 5C0JA 1AKJA 3F64A 3HJ0A 2XT1B 3CQQA 2PPDA 1Q0XL 1FNSL 4QHMA 4JCMA 3FF7A 4MQSB 1U8IA 3QDMB 4D0BB 3S37L 5IBUG 4Y9EA 3BKJL 4X5PA 3H7BB 5D2LE 1U3YA 1RZPA 1J87A 5A2CA 2VDOH 4H1LH 3HLAA 1PTZA 1NKOA 1MCFA 3O3BB 5GZND 3KBFA 1L7TH 2WOYA 2HJLA 2Q7NA 5KSVA 1YY8B 1AG6A 1INDH 1WZ1L 5JPNA 4K5MA 5KAQF 4NWTL 2DQEL 1HOCB 5CF3A 2WMPA 5I16A 1EUUA 1DHKA 3GZQA 4CADA 4P4KB 3WUWG 4MJ6B 4P2RE 3SBPA 5FA4B 2WLJA 3B8SA 1IFHL 1KJ2B 1PG7H 4XBGA 2CLZB 1ID5I 4MD0A 3ZZSA 1BBDL 4C59B 5JHDA 4ZAKD 2VLKB 4ZO7A 3UJJL 1TZGL 3FT9A 2X6AA 1XR9B 3PHQB 2MPAH 4NZUH 5CP7A 3OKLA 5FOBA 1M71A 2YD5A 3D12B 1HNYA 1KZQA 2CJUL 1SEBA 1OANA 2Z7UA 4P4RB 5C6TL 4HUVA 2UX7A 4WFGE 3BSGA 5F7UA 1WEJL 3ECBB 4LESA 2Q86B 3BP4A 5DMGD 5C9KA 4GP5B 5J57B 1R3IH 3GT6A 4DIXA 1S7WA 2UZXA 4I48B 3U0TB 2MQ3A 3MZGB 3VI4A 4DCQA 4ZX4A 4YHPA 5CZRA 2WXFA 1W72L 5LWYH 4NCC2 4WJG3 1Q9OA 2K9FB 3C8KB 4KXDA 2AQ1A 1EMTL 1KGCE 3DX8B 3ULUF 4KRLB 3U82B 4ES8A 4FEMA 2O6CA 1I3UA 3CFDB 3QPQD 4AXWA 1N2RA 2WUCH 4RRPA 1JD7A 4G11A 3JWNG 4H2CA 3QIBA 1I9IH 3BAIA 2F2HA 4FQCL 5IGXH 2N01B 2OI9C 3TCLA 3ETBF 3RWDB 4O58L 2JJSA 2CBTA 3MJ9L 4Q97A 1D2OA 4OLUL 1HHHB 1F3DH 3WLWC 1QNZL 2ZYRA 4N8VB 1S3RA 2PO6A 1BREA 4WWID 3GO1H 1S7SB 2HRLA 5I8EA 4CN1A 4ONGH 4KJQC 4M7KL 1O9WA 3CFKA 5C7XL 2FUQA 1HHGA 5CGMA 5JXAL 2IOMA 2OMWB 4Z7QF 4OW6A 2X9WA 4YHOH 5K1NA 1L9RA 5DRZA 3BDYL 1AVAA 1E9QB 2P45B 3VD7A 1B0GA 3AREC 4AEIL 4FG0A 5I6XB 2VUOA 3G04B 3V7MA 2J1XA 3CAFA 2F1EA 2JK5A 3I75A 4BFBD 1QHQA 3SDAD 2MCAA 2CJTA 4JO2L 3O4LA 5AB2A 2A6DB 5GJTH 3V6OE 1OD7A 2E75C 4PJFB 1XT5A 3MNZA 3GHPA 1OE2A 1LE5A 1ILSA 1BF2A 1FAKT 4N0CC 4Q8BA 4H88H 5LNEA 1R19A 2AJYL 1RZFH 5HJ3A 1SMOA 5LAXB 3B2VH 4YC2B 1FV1B 3L3HB 3QA3B 5IBLD 1YEWA 3C5ZB 2E9IA 3HZYB 2OFQA 1G1CA 4JG9A 1T5WA 5SX5K 4DSYA 5IR1A 5BV7C 4TNWK 2XNAB 4PCKA 4B9YA 2BFVL 2W38A 4LAJH 2YK1L 2B1HL 3GEFA 3TEUA 1KPVB 4AIXA 1QATA 1NZRA 5ETUA 4HJEA 3FTSA 4HIQA 4JHBA 2E27H 4Y5VC 2B9AA 2OYKA 1A7BA 2C3XA 4JRXE 3TS8A 3DROA 1UFUA 2ZZUT 1S7XB 1XCQB 4L1SA 4HIJB 5BV7H 2E9WA 3ATDA 4H8WL 3FT2B 3STLA 1AZCA 4M93B 1VHPA 3GMNB 4OGYH 4HZLA 1N8ZA 1AR1C 4YXHL 1H3UA 3VWKD 4P9MH 1AI1H 4TVPD 2CG9X 3KGUA 5F3HB 1KB9J 5DD1H 4OZIF 5F7EH 4YSQA 1HQRB 3IKCB 3QDGD 3IDJA 2K3TA 5GHWL 2V3DA 3DSFH 5BQDA 3T2QA 2IBZX 1E5AA 1UVQA 3KPMB 5E4AA 3HZVB 3PJNA 4MMYB 3ULUL 5DJZB 1FZMB 1R5VA 3NDYE 1JI1A 1T2QL 2W1NA 4HK0A 4IRSB 4I85A 4DEPC 3AS0A 4BZ1L 1AMYA 4I8DA 2VC2H 2CDFB 2K8QA 3S2CA 2A74C 1MFBL 3AU0A 1ZHLA 1ACCA 2O5ZH 5INCA 4PRHA 3DJ9A 1R24B 4XMKL 3KWXA 1U3JA 1B0RA 4OFDA 3LKSB 3Q2CA 4OLZH 5BOJA 2P5EE 4KQ3H 3BWZA 1MY7A 4G8AC 1MFDH 1V7NH 3ARXA 1BVLA 3MLYL 2FX7H 3NYKA 1OB0A 2BP8B 2DQJH 3E9TA 4IJ3B 4L4VB 1OCZB 4UYQA 5B22A 1DVFB 2A77L 1PZAA 3NSJA 4LVNC 4P23D 4KVNH 1FI8C 4J3WA 4YDMA 5DS8A 4F20A 5HYFA 5LKNA 4OKDA 4HGWA 5EMYA 4NNXA 3MLWL 4IRZA 4A1RA 1QR4A 2NDGA 1BG9A 4KKNA 4Y4KD 2MRYA 2XKNB 4FQXC 3EKCA 2QSQA 5CINL 1EPFA 5MHSE 1D6VL 2X2UA 1JZFA 5EUKA 4PUBH 1T89C 4ZXBA 1KIPB 1EEUA 4GFXA 4F9LA 5AVQB 3GYRA 4JM2F 3EF7A 4OZFG 4D9RD 4Y5VA 4XE0A 5KBMA 1BQLL 4WU7A 2V2TB 2EIKB 2R15A 1BVNP 1M7UA 3K91A 3IJ9A 4GBXC 1J5CA 1OM3L 3ULUE 4RISH 5DJCB 1JGDB 5JR1L 1LO2H 5DD3H 4QYOA 4E41E 5BRZB 5HSFA 3DIVA 2BIQA 4J6IA 4PWEA 2BSTA 3X13B 4KUZL 1DL7L 2R0WH 4Z7UE 3SZ6A 1GJWA 3GMQB 2H8PA 1U8QB 1GGIL 3BC9A 5HTSA 3EJPA 4AX3A 1MCEA 1RJLB 2H6UA 2QGEA 1AE6H 1A21A 3CZJA 1WIOA 3IXAB 4UU9A 5B4MD 4XX1G 3MNWB 3RGBA 5BJTA 5D7JB 5C0EA 5HPOA 1KENL 4IU3A 4LCVA 1J8HD 5F93C 2H2PD 4TLKA 1PLGL 1JWUB 4B9IA 2A74A 1I8AA 1OAYH 1NINA 4FFYA 4Z7QE 1KNOA 1O6SB 3IBEA 1XL6A 3L5IA 5IB2A 1EEZB 2J6EL 2GI0A 3RDTC 2PYEA 3S37X 3B7RL 3EBGA 1M4KA 3KPTA 4MS6A 4DK6A 4L1HA 3GHEH 4HP5A 5GRVL 5JO5B 3WEBA 4G9FD 2HT4C 4NZ8A 3LPPA 1ZGLM 4F92B 1H5BC 5D93C 5I28A 3S3SA 3V8CA 2HPTA 1ZVYA 5CZVL 3GSOA 2EECA 3COOA 4M7ZC 1P2CA 1MN4A 1CUOA 4P05A 4AQAB 1NMCB 3SBQA 1PKQA 2WBJA 3FAXA 4LU5H 5AVVB 3WN5B 4JFOA 3S3JA 5I30L 3ML9A 5HHMB 3KPRD 4P2OC 4NLHA 2X6BA 1S9KC 1M7DB 3WIIL 2HUHA 1EJOH 3BIKA 2HTLC 2BVEA 3TA3A 1CFNA 2X2HA 3DLQR 5I0VA 4HFWA 2VXTH 1E4JA 2YAMA 4LEOA 4FDWA 3J8F7 3D3VB 1S78D 1U8HA 4BFEA 2G2RB 2FIRT 1RZJH 2OMXA 3ILDA 5F7WC 1EAOA 4N87A 2ED7A 2ITDB 5E51A 3ZYJA 2ADYA 3ZR6A 4XBMA 5TE4L 5FUZL 3WEOA 4XNDA 1HC1A 3FQUB 1P53A 2HT3C 3IJYA 2QVMA 2Y0SA 3H0TA 3IFOB 4L8SA 4ZFQA 4EZKA 5F70A 5FXCH 3SDXF 3O81A 3M1OA 2V7NB 3MNMA 4KROD 5TK2A 3ZVVA 1NA8A 2BW5A 3STZB 4F15B 4YDZA 4F2EA 4KVPA 2NY3C 2E56A 4QKXB 3ENEA 4A67A 4MA3A 1UD3A 5EUOA 3RIKA 1G4MA 5D7IE 4PJ6A 1KJVA 3SKNA 2LLGA 5C0DA 1TYEB 1NTDA 3PAUA 1S8DA 3MLSL 2WYTA 1IAIH 4HOZA 1B4LA 4OZIE 1AZRA 3ILEA 4PJGA 3RZWA 3VTAA 1EV2E 3SDYL 3RFZA 4GI8A 4U1NB 3BDXA 1F18A 2ZKHH 4PJ5B 3IBOA 1YUKB 4RZKA 3QUXB 1PZ2A 2WGNB 4WUKL 1SF5A 2WQAA 4JX0A 4U1HA 4LLVA 3FB8A 4U05A 4MAYB 3KCWA 3GSQA 4JJ5B 3MMEB 3LH9A 5D5MF 4MX7A 5KEZA 5D72L 5BW7A 4C4UA 2FX8H 5KW9L 4KTEL 4BEIA 3UYPB 4QJ4B 4OZFA 3TWCL 3GXFA 3LKPA 1HHIA 1TVDA 2XQYG 4B50A 1DO6A 1A8JH 5FYJL 1I7UB 1LMKA 2L0DA 5I24A 3KYMB 4N2FA 2GJ6B 4KWUA 4XNUL 3LZFH 3BX7C 1AD0A 3D4GA 4JFWA 1TZHA 1SFHA 1VACB 4R84A 2Z0BA 1WBXA 3US1A 3LIZA 5L2KE 4K8RD 1ZDQA 2FGZA 4QRPD 3O6LH 4P2OA 1U21A 4XB7A 2P43B 4LAQL 4HX1B 1MNUH 3IJHA 2BWDA 2NY5L 2Q5BA 2X42A 1YPZE 2BNRE 2N7SA 5JHAA 3MUGB 2ICEC 4KH2A 2Q20A 1UT1A 2QPFA 2AJ3B 5KYUA 5C2BL 3DJTA 1X5AA 5LJYH 3AXIA 4KKBD 3VCLB 5BRPA 5ANMB 1MHPL 4DFIA 1FNHA 1U3HC 5MI0C 1CICC 4LF3B 4QOKD 4M3KB 1IGML 4AL8C 1RH8A 3PWUB 1RZKL 2G75B 1CC3A 1F3JA 4XGZA 4LL9A 5BMFL 2I9TB 4WVRA 3I50H 1PJWA 1U58B 3FOLB 5F0MB 1AFVH 2AEOA 1L6ZA 1UFGA 3QUYA 3L3IB 4JB9L 4BCYA 1UGKA 3EAKA 3F12A 3LDBB 5EWIH 3HR6A 4MA8L 2YD2A 4FA7B 2ARWA 2GT9A 2MKLC 3NACH 1C5BL 4WI0B 2VAAA 3MBEB 3B9KB 2APFA 4RFOL 5FUOL 1AS7A 1QR1B 4P07A 1AS6A 1WBZB 3G5WA 4BKLA 3TJHC 1Z32X 5KVEH 2FEEI 4N0UB 1FSKB 1KBGH 3N3EA 4XNAA 3IB4A 2G60H 1I85C 1GOGA 2IJ0C 2VDMH 5FYJE 2X53A 4J3OF 5F9WB 4QHNA 5LUMA 3H9SE 2WWNA 3NPSC 2Z92A 2APVA 1YNLH 2Q7YA 3X1BA 1OGAD 2VXQA 3CPLA 4C8XA 1EHKB 4NQSB 4PP2B 2YBRA 3UJTH 2P8LB 1IAOB 3MV9B 2VE6B 1X5ZA 3KM2A 1CBVL 4PB9H 1DLHA 3X1NA 3QZBA 4FI7A 4I5BA 4KZCA 2NTSP 4L8BA 4N2AA 4XCNA 2F74B 4N1HB 4UBDD 4UZGA 5CUSL 3FU6A 5C09A 3V10A 3VXTB 4OLXL 4A7UA 5A6LA 4FG6D 2R4SH 1INEL 4HFUH 5FM8A 3K71B 1BGXL 4JFDB 5I1JH 3MOAL 4U1LA 3DMMC 5KTEH 2QPEB 1NSNL 4OJDH 2B4CC 2ZUXA 1Q8MA 4NQDA 3VGHA 1I3RB 3ZY7A 4Z7OB 4N9GA 5H2BA 1N0XH 2JH2A 4KMTH 1IL1B 4XP5H 3PGFH 1XIWD 2ZUWA 3UZEA 3VXRE 4PAZA 1AYOA 3T6ZA 3ZL4H 5HDQH 4WFGD 1YY9D 2H4EA 3FFCB 1M6OA 4XWGL 4LQFL 1U8LB 3EOBA 1DANT 4NN7C 3KWUA 2F7OA 3V4UH 4G8GB 1U3HA 3K72A 1IC7H 1VSCA 3LRMA 1N12A 4JZNA 3POCA 3W9DB 3CVHA 3FQNB 4ANVA 1KGCD 1X5IA 3K6OA 4XI5D 1KGJA 5EIIG 4G1EA 4ZQTA 3KLSA 2KS0A 1A7OL 4ZUSB 1KXQE 4K3EH 4EF3A 2KPWA 4NERA 3VRLE 2XQYA 4M8UA 3ZHNA 4TQPA 2YPLE 1S7TA 3OKOB 5I1CH 5FO2A 2PUQT 3BRDA 3G5XA 2VZSA 2G4EA 5D7KE 1IT9H 2B5IB 3KYNB 3BYTA 4M4RA 4ENEC 5DVLA 3T1FB 4A7GF 4B0MB 4MRCA 4Y89A 4WZ9A 3K46A 5SX4H 5CAYB 4ONFH 1WG3A 1FZJA 4PRIE 5GS1A 4O02A 4DUXA 4KDTC 3LH8A 3KJ4B 4KRPC 3LRSA 1Z9OA 2ENJA 1JVLA 2VDKL 3PWNA 4AJVA 4P2QB 1CDIA 3FB7B 2VH5H 3MA9L 1BZ9B 5D7HA 2L3BA 4TQHA 2DMKA 3QDMA 4D0BA 2IPUG 4PYHA 4HV8B 1UD5A 2Q3AA 4APQC 4FERA 2EYRB 1BQSA 4BD4A 4TVSa 2Y72A 3FO1B 3QPXL 3UMNA 3HMXL 4G83A 2PP7A 3O3BA 1PEZA 4H25A 2CZNA 3ZE1B 5ISZE 4PBDA 1YO4A 5CHNB 2QV4A 5F0JB 1YY8A 3B2PA 5BS0B 4M61B 4P4KA 4YQXL 1TKWB 5FA4A 4IBWA 1UWYA 4FL4B 4WV1C 5J13B 2D2CC 3JXAA 4OQTH 1UACL 5JIHA 1KJ2A 3C8HA 2VOTA 4U3HA 2CLZA 5GZNC 4N5ED 2NLJB 1MI5A 3TO4D 2O5NA 3KDMA 2VLKA 4NHUB 3OHXC 2YPVA 5D4JA 3UPRB 5FLVA 4MDIB 3OXRB 1XR9A 3PHQA 5GRXG 3MV7B 5EU6E 4P4RA 4JRXD 3O0RL 5E6RB 2XWXA 3ECBA 2XUWA 5F7NC 3V5DB 4EIBA 1IV8A 3L9EA 2AQRA 3U0TA 4I48A 1MQKH 1TJGL 1YLBB 2OTWB 8FABB 5I1GH 5A40E 3ASOB 5I6OA 3C8KA 4RSVA 1JVKA 3DX8A 4W1TA 2FSEB 4TSCL 1DFXA 4WHTB 4AGQA 3CFDA 1WS8A 2HFFB 3MLPA 5IJVB 3MRJB 3OPZL 4KTDL 4U1GB 3TFKC 3ZLQC 2NYKA 3NFNB 1FVEB 5DMGC 4XO3A 3AXLB 1S5IH 2J20A 2GCYA 4WSKA 1ZS8A 3PNRB 5IBTH 4CMHB 1A5FH 3RWDA 3FTWA 3K6DA 3V52L 1N6QL 1DUYB 5EOCH 1MXDA 1HHHA 4PB0H 1QWHA 1P5UC 4N8VA 5IQLA 2UX6A 5AWNL 3GJEB 7TAAA 2XN9E 3L9RB 4BZ2L 5D8JH 4HJ1A 3GUTB 1P9MA 4UDTB 4LSQL 3CDZA 2OMWA 5K9QI 3E6FA 2P5ED 1E9QA 2DQIL 1QI5A 5EIIA 5HYJE 1G1OA 2OSXA 4QT5B 3UPAA 3S3CB 1VAHA 2RMNA 2WVVB 1F97A 3VGAB 4PW3A 3PIQB 4PJFA 2AK4E 1MLBB 4CMMB 3HE7D 3ZL1A 2DI8A 4WHDA 3DRQB 1HWHB 4E5XG 4EN3C 1REIA 2OYLA 2MCG1 2IAMB 2NXYD 3BCDA 4ZD3H 2W92A 4Q58C 3Q2WA 3Q6GH 5J11B 5D70H 1G4RA 4XPTL 4EDWL 3P3YA 5LAXA 1F4WH 4W9KC 2CR3A 1FV1A 3L54A 3L3HA 4OGXL 2IGTA 2CWRA 2Z64C 4Q6IB 5CJXA 3C5ZA 3HZYA 3O3AA 2J88L 5C0CB 5FO9B 5HYIA 1QACA 1YHPA 1T83C 4HS8L 3QDJB 4HUMB 2XNAA 4FQHB 2YD0A 3IJEB 4YLQT 1WT5C 5J56B 2HJKB 1D9KD 4YBLC 3ULUD 3HAEH 1KPVA 2O61A 1OY3B 4L9LC 5JHMA 1TIUA 1TMQA 3AM8A 5HPMB 1NL0L 1ADQA 5IBLC 1QTPA 1JHTB 1F41A 1S7XA 1XCQA 4Z7NB 4HIJA 3N44F 3FT2A 4FHBD 3GMNA 4EI6B 3TNNB 1V3LA 4C57C 5F6IB 5FB8B 3F00A 3LPWA 2IPKB 4FABL 4XXCA 4AWJC 5K59E 1QW9A 5F3HA 1PD6A 2KUTA 1LO0L 1TJMA 2NY0B 2WINA 3CSGA 3I6SA 1DBBH 2AV7B 3EJQA 1G84A 1HQRA 3IKCA 5FYLL 1IC4L 3RNQA 5CJQH 4A68A 2DJUA 4Z1PA 1NAKH 2IG2H 5B1AB 3KPMA 3WTSA 4N24A 4MMYA 3NABL 5AYTA 4TVUA 5DJZA 3REVA 1FZMA 2YAEA 3VRIB 4ERSH 2JF1A 2WNWA 2KDGA 4HIIB 4IRSA 2VZUA 1Y07A 3QHFL 3D69B 1ZSDB 4DN4L 2ZCKH 2ENPA 2EYSB 1LMIA 4FNRA 2APWA 5AD0A 3I3BA 1V54B 1Z9NA 3BPOB 3JV0A 1L3NA 3R1GH 1IEBB 1CIUA 4BFIB 1MCLA 3LKSA 4UIKL 1U41A 4TNEA 5EIVA 4TVPH 2D4DA 5E9DE 4ODTL 2XWBB 4N3UA 1OOAA 1T80A 4JUTA 3GS7A 2HTKD 4FKEA 5EZOH 1M2VA 2PP8A 3U83A 2EDXA 2FO4B 1SQ2N 4HSQA 4L4VA 4XN4A 2F8VA 4ELMF 1JVOA 3SE8L 1DVFA 1AZVA 4NCDA 4P3CL 1DBAH 2QL1A 4Y19E 1R4XA 2ICES 1A4BA 1ZT1A 3VXSD 5K9KB 1ZJAA 1BZ8A 3MNDA 2F5AL 3ULAB 3T3MB 3M45A 4JHAH 2OW6A 3L3JA 1WT5A 1UH2A 3O9WD 1TYJA 3IRPX 1SLXA 4R8WL 1N68A 2ZOLA 1HH6B 2EZ0C 3DV6B 4P23C 3O3UN 3OWRA 4GRLC 3NCYP 2DYRB 4GSQA 5E95B 1MAJA 3FDWA 5FYLE 5FKPB 1GW0A 3Q5OA 2ZKXA 2CNYA 2VXUL 1OD9A 1UM4L 4FI6A 5DJCA 1JGDA 4GRWH 3MV8E 4JO8A 5BRZA 3MLZL 4NP9A 5DUPH 4YDKH 4J8QA 3X13A 1FJ1A 1U8QA 2R29L 5KJRH 2EEDA 4E5XA 4NI3A 5E24E 2WLHA 3VXUD 3F84A 1RJLA 4J1UB 1HEHC 1D5MB 3IXAA 3DXAD 1QFUL 4X7FC 1T4KA 5D7JA 2FD6H 3U7WL 2JCWA 2Y7NA 2WZAA 1MFVA 5HHXL 5ID1B 3AWEA 1LXMA 3IPFA 3DIFB 4NFDA 5HP5A 1JWUA 3EJZD 3MV01 3U25A 3T8VA 4JY5H 2A9CA 3DYOA 1NWOA 1O6SA 1NLDH 2XY1A 1EEZA 3L5XH 2BSEA 3MACL 3PL6C 1DZBA 1R33A 4JHUA 3LYRA 1KBKA 2XA8L 3BPLC 4X4XB 4LBAA 3II2A 4XC1L 5A7EA 2G5UA 2C7UB 2NR6D 1IBGL 1A9BB 1MFCH 4WHCA 4Z0XB 1DFBL 5JO5A 2H2PC 2HRPL 2ZX7A 1ED3B 4GRMB 2BNQD 2R1YB 1OWWA 2KT6A 2XOTA 2JKTM 5F8QC 1RFDL 4AIOA 1CXFA 1GGUA 2CMRL 1PZ5A 2IWEA 5BUPA 1DEEB 2RBLA 4KKAD 3GEWB 2B39A 3FO2B 4AQAA 1U8KB 4ZMVA 1Z0MA 2EEAA 3WN5A 4EI5B 5EHFA 1A0QH 5EBLA 2VC2B 4YLCA 3WTTA 2RALA 4XN2A 1CO1A 4PJAF 1M7DA 4YUEH 2GBTA 3EUUA 5C92A 3BD5A 4JM2D 2H1PH 3KHOA 5DJYB 3AGVA 3D3VA 2G2RA 4M9PA 5FA3B 3N04A 3A3YB 3L3KA 2FJUB 3C08H 2ITDA 2O30A 4I87A 4X2UA 3WJLC 4YSAA 2OM5A 1GMIA 4IMKC 1LQSR 2MMXA 4G7YH 2VQ4A 3SOTA 3T3PB 2Y25A 3FQUA 3RX9A 2Q3ZA 2RIKA 3HR5B 3IFOA 1PLCA 2IFFL 4OFYA 1WF5A 1EGJA 2QVTA 3KBHE 3HE6C 5D71L 4BRVA 1I3VA 1A65A 2V7NA 3NAAH 2GHZA 4OJAA 4TULH 3ESPA 5H35B 4LSUH 1RULH 1S78C 3STZA 4P3WA 5E0QA 1DJHA 2E86A 1XF5A 4U2YA 4LLWB 2WWOA 3J27A 1JPFB 5FYJD 4DQOL 3SGKC 4Z3IA 1QFWI 4HWBL 3KXFA 1ZD6A 3OMIB 2IGFL 2L7JA 2IDFA 3HHMA 4U1NA 3OR6B 2PWGA 4UT6L 5G4NA 1IGFH 4N8UA 4ZFFB 4PJ5A 2R1WB 3GTTA 1OTSD 3QJSB 3QUXA 4OVUA 1WV7T 4FQ1H 2QV2A 1OAQL 4XVOA 1OT4A 3RWIB 1QLRA 4JJ5A 5F7MC 5A3IC 1W6LA 1NIEA 1XEDA 5B1KA 5E94A 3PL6A 3RJOA 4CGTA 3PWPB 1E0OB 3DYMA 4MS8D 3UYPA 4TOYH 1XDTT 3ZW3A 1KGYE 2YUZA 3RIAK 2DLIA 4PS3A 4TQEL 3I84A 5T1JA 3CJJA 2K0RA 4ESKA 3KYMA 2GJ6A 5CMAB 1AHMA 4B0MM 2A1WL 3VXRD 1MCBA 1VACA 4BA0A 4KNQA 3PF2A 3V6ZB 5E08L 1ZEAL 1FGNL 2HWZL 2UWEB 4PJ8D 3L4UA 4ELME 3MRDA 3P11L 3EGSA 2WBKA 3SSGA 4HX1A 3GI8L 4AGPA 2YD9A 1WD9A 1XBRA 2Q3XA 1I9RL 4KRMB 1G1YA 3MUGA 3UIYA 1GY2A 3FT3B 1OAKH 2AJ3A 1A4KB 3O4OC 2WYZA 5FK9B 3X17A 2GJZB 3Q6FB 4K3JL 2NYZA 5ANMA 5JOFB 1ZPLA 4LVOB 1RURL 3SDDD 3CCHB 4LF3A 3QNZB 2DKSA 3WJLA 1EIBA 1K6QH 4IMKA 5LGJB 3IDXH 5LNDA 3W0WE 2JKRM 1YNTF 3PWUA 4GB9A 4HEPA 2OJZH 2YPLD 4OCRH 2HH0L 2H45A 2I9TA 4WW2C 1UCBL 1MRCH 1U58A 2YGNA 2YUXA 3FOLA 3I2CL 3A23A 1KCWA 2X12A 5GGRB 4KY1L 5E1HB 3NJMA 3L3IA 5D1QE 4K8RH 1SUHA 3BGMB 4PVLA 4DFHA 4B5ZA 4WI0A 5DMIH 1EVTC 3MBEA 2IADB 2KERA 1QZNA 3B9KA 3MRCB 3OR7A 4UTBH 5JDSB 4ZFZB 6TAAA 4PRID 3GM0A 3X3FH 1WBZA 1B4RA 4ZRGA 2ZSVB 1GC1L 3MLXH 4N0UA 4A2FA 1Q94B 2GFBA 4YFLI 3GBNL 1ML0A 2O1AA 3P1VA 4B9ZA 3QB7C 2P8PA 1G94A 1F90H 3KPQB 4HUNB 2IBGA 3TZVD 5B3SB 1SJEB 2EDYA 1NOLA 4JRYE 3C5JB 4LLDA 4OT1H 1EDYA 4NQSA 3O6FB 2P8LA 1O5PA 1IAOA 3MV9A 1ILUA 3Q05A 2VE6A 3NIFF 1ICTA 5ISZD 2XIBA 1R3LB 3T4YB 2G30A 3T0EE 4DP2X 5LLIC 1QBLL 3DGGB 2A99A 3VXTA 1V10A 2WYIA 3E1ZA 2AVGA 3HUJA 3KGRA 5GGVL 2RGSA 4K3DH 3AGWA 3T8MA 4KO6A 3NK4A 3K71A 2PXYC 1SLUA 4JFDA 5FYKD 5FM5M 1KTRL 4Q2ZB 5IFHH 2QKIB 1KCRL 3DK2A 2OZ4H 1VFAB 1SY6A 2VQTA 3FU5A 2IIJA 1I3RA 1JPSH 2BHFA 1HESA 1CF8L 1IL1A 1AGEB 1SEQL 4U0RB 3GKWL 3NCJH 4CSTA 1QPXA 5EU6D 2ZX6A 1MEXL 1RUPL 2VQ1B 3UACA 3UBXB 4FZ8H 4OJFL 4PJAE 4X42A 5FCSH 4DO6A 1U8LA 4BGLA 3D85B 3QGVA 2J8HA 3EF4A 4UI2A 4DKFL 5F0LB 1AJ7H 3FUFA 4G8GA 4Y2DC 3PPSA 3W9DA 1F42A 4F8NA 3FQNA 2FJGB 1X7TA 3SO3B 2GIYA 3BQVA 3L3DA 2WBWB 3NZUA 4LLAA 5TDOB 1R47A 5TF0A 2X6UA 4ZUSA 2AJXH 5ITFB 3CX5J 1NBZB 2DS4A 4JPWH 5DYOB 2VZOA 3QO0B 1OAUL 4PHXA 4URKA 2CO7B 4G82A 1GIGH 4B6ZA 5C97A 2ZNXA 5L6YH 4HBCL 4J12A 3N40F 3CMOH 4KHXH 3BW9B 2ADGA 3OKOA 4NO0B 5GGSY 4BSVB 5BZDA 5J6HB 3QCUL 2GYSA 3QXTA 2EE3A 3L17A 2DQDL 4YNYB 4IRJB 3PREA 4J3OD 1FWXA 1IKNC 2CCWA 2HFGL 2AFNA 4FNLL 3MPCA 4LOFA 5AOKA 3RWCB 3T1FA 5CFAA 4JK0D 4JFXB 5EA0L 3KH4A 1OEZW 1K3IA 1UZGA 2EDBA 1OHQA 5CR1A 3ZO0A 4X4YB 4KJYB 1VFMA 1LL1A 3WFDH 4IS6B 4NGHH 3VGFA 5HYJD 1ZLDA 4R90L 3ZR5A 5B8CB 3BZ4B 4OZ4B 4AYFA 3FQ1A 4HKBA 4AIEA 2XZQL 1EA9C 4PG2C 3F58L 1ZTXL 4PJCB 3FB7A 2EXYC 4ZMWA 3VU1A 1BZ9A 1FNSH 5I9QC 3ZT5A </