3WYRA

Crystal structure of killer cell immunoglobulin-like receptor 2dl4
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
189
structure length
189
Chain Sequence
KPFCSAWPSAVVPQGGHVTLRCHYRRGFNIFTLYKKDGVPVPELYNRIFWNSFLISPVTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVTGLYEKPSLTARPGPTVRTGENVTLSCSSQSSFDIYHLSREGEAHELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYEWSDASDPLPVSVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Killer cell immunoglobulin-like receptor 2DL4
publication title The structure of the atypical Killer Cell Immunoglobulin-like Receptor, KIR2DL4
doi rcsb
source organism Homo sapiens
total genus 35
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00047 ig Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wyrA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wyrA01
2NW3B 1WITA 3ZMRA 3AROA 1NFIB 5IBLD 3VXNA 1U3HC 4H26A 2DOCA 1KPVA 1UB5A 4TUOA 2H1PL 1KPUA 4OQTA 5KVGH 5DJ6A 3FCTB 2XWBA 5IV2A 2DB8A 1S7TB 1OWWA 2H41A 1MHCB 3MCKB 4JG0L 5JPNB 3WEXB 4Y4FD 5E8PB 4IRJC 1VGKA 5CWSB 3MYJB 1AKJA 1IGIL 4ZUWB 3MNWB 2OLDA 3L3KB 3TPUA 1IILE 5A2LH 5T3XH 4D9RE 4OZIB 1R3JA 1PY9A 2YUZA 1UWXH 3DGGB 1P7HL 4U6VL 2OK0H 1TIUA 3THMH 1MFNA 4YFEA 4L9DA 1A6TB 3QIWB 1NCAH 1T22A 5CFHA 5F1IB 3NFSH 4X9HA 2XWTB 2DQGL 1I7RA 2VLLB 3ULSA 4YXKH 1UZ6F 5DMKA 3T3MF 3VRIA 4RDQG 3RVXC 4EI6A 4NZTH 5LGJA 1ZGLB 1N6VA 5D2NE 2E7BA 1J1PL 4OI8A 4POYA 4DVRH 4EI5A 3BI9X 3ULUF 1OARH 1IEBB 3OR6B 4NO2B 2MTPA 3AS1A 4I0PD 2BNRE 2QADC 3FB5A 1JGDB 4PJHE 4MA8H 3EJJX 1CFNA 3QIBC 5C1MB 3IETB 3QIUC 4WI5A 1U8PA 2YA2A 5LWYH 4IS6B 4NN6C 1JYXA 2N7AA 2IBGA 1UJ3B 2OTPA 2XV6B 5KSBB 1FO0L 3WN5C 3VWJA 1F4XL 4ZAKA 3WFCH 1TDQA 1RZKC 4J3WA 3HZYB 3PXJA 5T1LB 3O9WC 2XNAB 2R4RL 3TJEL 1UJTA 4H88H 3GMRA 3A6BL 5C0CD 3GSRB 1TNNA 3RAJL 4Y89A 1QFWL 3LIZH 1BHGA 1HWHB 3T65A 4RGOH 3FB7A 4I0CC 1VFMA 4P3DA 3T1FB 3OHXB 5EIQA 5MERA 5HVGB 2ITDB 3RDTB 4WHTB 5GGTH 4KUZH 2MNUA 2DQEH 3SCMC 4R2GD 1LDPH 4K8RL 4JN2B 1OAZL 1T1ZA 3SDCA 1KCKA 1NAML 4LU5L 3MUY1 1R24A 3QUMB 4HPOH 4QF1A 3L3GB 1GH7A 1YMMA 1FNLA 4WW2A 2AXHA 2V7NB 1BD2D 4K3GA 1QO3B 1JGVL 2EEDA 2XZZA 1SJVA 1OB1A 1EAPB 2RGSA 1F4HA 3G6AA 1OM3L 4PP2B 3VJ6A 2XKUA 2YUVA 2LAAA 3OAZK 2GITB 1FGNL 2BVYA 4OUUB 1A1NB 1WISA 4M4RA 4ONFH 2VZ1A 4PP1D 4X9GA 4L8DB 4GXVL 4RQQA 3H6JA 2Z93A 4Z7VB 4G80B 4P46C 3BZDA 4E0RB 2WBJB 4OD2A 4XZUB 3V2AR 3KYMB 4HWBA 2QSTA 1IGTA 3OV6A 2HJKA 3SE3A 3QHZL 2VRAA 3PP3K 2LABA 2V9TA 5F93C 1MAMH 2F74A 2XN9B 5D7IA 5B38B 2YPLE 4RAVA 1QFUL 1M1SA 3C5JB 1CE1H 1OTSD 3UO1H 5FYLH 2W91A 1IAOA 3CFCL 3D85A 2FBJL 5AWNL 4U1IB 1ZSDA 3N1PC 3MACH 2P5WB 3CX5J 3TBYA 5T3ZD 2WQRA 1ODAA 5IFHL 1U3HB 1AGBB 1ADQA 3NOIA 4JKWA 1BBDH 3JSSA 2XG5A 1OAQL 1F2XK 3GK8H 5ANME 1XCQA 1LE9B 5LXGH 3A0OA 1CG9A 3JV6B 4LKCA 5EZJB 3G5YB 1KPRA 4XB8A 3RGVC 5C0FA 2CUMA 3VWKC 4N9OB 4KY1L 2ADIB 3HC3L 3TWCH 1BZ7A 1IGCL 4OJFH 2Q8AH 4BSWA 4Y2DB 5CP7A 4NQCD 4EN3D 3IJSA 4FG6C 4KK6C 5TQ2H 3LAFA 4WUUA 3S5LG 5T1MB 1BIIB 4Y4KC 3S35H 3WFZA 4WY7L 3D25B 4X5LA 5C0RL 4HH8A 4LCIL 1L9NA 4BZ2L 2BY0A 2WIIB 4ZFOB 4R4BB 5I17A 3MLVH 3F7VA 3MFFA 1XGUA 2GSIB 2I07A 1EFXA 2QQQA 5F88A 3SE9H 4EDWH 4XMLH 5IVXE 1JNJA 1CFQB 2UWEA 3BRDA 3AB0C 5IB5B 1MWAH 2QADB 5C7XH 3C60B 4X8XA 3B8YA 4OBSA 1CXLA 1OP5H 1TZGH 5I8EA 1T03L 3QIBB 4ZTOL 3QIUB 3OGCA 1FH5L 4R26H 2C26A 3QZWB 4UQ3B 3LSOA 3HRPA 4NN6B 5J9PA 4GG6E 3V0WL 5C3LD 5IESH 3S36X 4EDXB 3OR7B 2IH1A 4CMMA 3DHJA 4EI5D 2W60A 4K3DL 4U3HA 3WN5B 3BPOC 4L4VE 4LARH 3MR9A 1NEZG 4NQEB 2F19H 3V5KA 1NPUA 1T21A 4X5XA 3O9WB 1JNNL 2CKBH 3P4MA 4CVWA 5LJYH 3L6FB 3L3IB 4X7SH 2ILLA 2QKIA 2IANA 2XIDA 1U91A 1XF3A 5JW5B 5DRZB 4OM1L 4P59L 2HFFA 1X4ZA 1I3RA 2RR3A 3VWJD 3P9WB 3ULUC 3O8XC 4ZAKD 3OKMB 3O0RL 1HOCB 1E6JL 2V2XB 4H0IA 2MQCA 3UX9B 2D0GA 4UV7H 3UAJC 4GAGL 3LVEA 1WFUA 3CSGA 3V4VL 1U2HA 2Z31C 1LEGA 5F1SA 3SCMB 4JPWH 2NXZD 4JFYB 5IG7A 3ZE0E 2ZNWA 1E4KC 1BREA 2AABL 5H2BB 1WZ1L 1V3LA 2HJLB 4MD5A 1KJ2H 2EYTA 4OGXL 4BFGA 2CLVB 2PW2A 2XTJC 3D39A 3QNZA 4P2YA 2A6JA 1U58B 3GNMH 5TQ0L 3RWGB 1UZ6E 3RUGA 4XNYH 5E2VL 3SDCD 1AY1H 5HYJB 4G9FE 1MHPH 3D69A 3EW3B 1G6RA 1X6LA 3DETC 3VD9A 1CFBA 4K9EH 1BFVL 3CVIH 3PJSA 2BK8A 1JYWA 1YMMD 2ZCLH 5ALBL 1N5AB 1RJLB 3M17B 3RNKA 3QDHA 4BFIA 5HY9B 4X4MA 2EDTA 3H9YA 4ZFOL 3LDBC 4NCC2 5B4MD 2EC8A 3HE6A 4PBVC 4XCNB 1AJ7L 1INDH 3ZL4L 3AXLA 1JF6A 1YEEL 2X40A 4G43B 2HAZA 3W9EA 1CICC 4WO4C 3R06A 4WI2A 5DVLA 1P4LA 4N0CC 4XHQA 5CBAB 5L0QB 1CDYA 2GTWB 3MMEB 5JXAL 2F9BT 4FXGB 3ZE2F 1U8MB 1VACB 2KZWA 3LZFL 4Z7QE 4ZUSA 2MQ3A 1L7TH 4TULL 3JVGA 3VFWA 4HS6A 2AXFB 1J8HB 1JHLL 4UQ2B 3WO4C 3X13A 2HLFC 2IPKA 5F3HA 1WZKA 1RZKL 2FEEL 2P48B 4HKJB 3CDCA 3VDCA 4DKEL 3L3OA 1U93B 3AREA 3ARGB 4NQDE 3CU7A 4EEEA 3NVQA 3CU1A 1WK0A 2F58L 1S5HA 1MELA 3UROR 3RL2B 3QG7H 3X3GH 2X5PA 2NY4D 5BVPH 3WHE0 1I75A 5GJSL 3VWKB 5FM4A 4EXKA 1CI5A 5EBWA 3VI4F 4W68A 2WUBL 1H3XA 2HYMA 1JGLH 4JPIA 1HXYA 5JR1L 2DWDA 4NKQB 4ZFGL 1A6AA 2QSCH 3GSOB 2FWOA 5JIHA 3KPNB 4NZDA 3BO8B 4Z77B 1EGJH 5D1ZC 5GS1C 2UYLA 5CUSH 1QQDB 4LQFH 3MA7B 5EORH 3SBWC 4MNGE 4U1KA 1AXTH 2H2PD 4UNUA 2VDML 4R9HA 2HA1A 1F2QA 1MCKA 3FQUA 1QYGL 3FO1B 5IW6A 3VXUE 2GKIA 4JN1L 4I48A 4PJXB 5CJQH 3GI8L 3R8QA 2A1WL 1GGBH 2ED9A 4KI5F 5E9DE 3ILPB 2DKMA 2X4UA 2VE6A 1SEQL 2CXGA 5I1DB 2V5MA 3BP6A 5JDSA 2VZOA 2P49B 3CLFH 5F9WC 4HIHB 4PRNB 3FL7A 5DMGD 3O6MH 4N8CL 3GSUB 3U0WL 2X44D 2WZPD 4KRPC 3IDMA 1R5IA 3BPOB 1FFPA 2R39A 3BH8B 2DAVA 3DVGA 3WXVL 4BJLA 5JHDD 1UB6B 1MY5A 1HNGA 3UYOD 5EBLA 4PJGF 3Q6GL 1B9ZA 4XNUH 5EOQH 4TOYH 4EZMA 3GMQB 4BH8B 4KGLA 2FYYB 1UKQA 4HXBL 2X4SA 5FYKD 4U1MB 3W9DB 2ZJSH 3T77A 3KXFE 2C1PB 3PWUA 3FRPG 2CJUH 5FO9B 1ED3B 1XT5A 3O8XB 3Q48A 1JTOA 4HH9A 1U8HA 5TH2B 1CU4H 2P7TA 3L5WA 3UTTE 1T2XA 2PR4L 1HH9B 4OZHF 2H45A 2XT1B 4OZ4B 1BFSA 3DV4B 3MV8E 5IM7B 2VYRE 1WTLA 4KK8D 4KZEL 2FEDD 4NQSA 2IAND 1UCTA 4ELME 1KF9B 3MRQB 1OTTC 4H1LB 3GKWL 1C16A 3VG0L 1YEIL 1OT2A 1UXSA 2Z4QB 3BP7B 3DHMA 1INEH 4JEGB 2IMNA 1HI6A 3AM8A 4J8RB 5F7YC 1AC6A 4K7PH 4PS4L 3ZTNH 2XTJB 1U36A 5J6GB 3VMOA 2XZAH 2YN3A 3TJHC 4OGYL 5DHYA 4LCYA 3V6BR 1VGEH 1ZHLA 1G7QA 2IFFH 8CGTA 4UV4L 4G6AD 4LSPL 1DBML 3D5OF 4RNRB 2GUOA 3QBTB 1A3RL 3MGTB 3QB7C 2AAVA 4CNIB 4NYLA 1CXIA 2OZ4A 2NY1C 3QO0A 3I02A 5SX4I 4Z7WA 4DZ8A 3I9GL 4FZ8H 2XQBH 1YN6A 4O5LH 5I1IH 1N4XH 3ET9F 2YZ1A 5DMIL 4ZPVA 2R1XB 3LDBB 5I15L 5BMFL 1AHWA 3LKRB 4CN6A 4MNQA 1NLBH 2IADA 2KQNA 3QQNA 3FO9B 4P2OD 5B39A 1ITCA 2OQJB 1AQKH 3FRPA 1EHLL 4DAGH 2H8PB 3MRLA 2J4WL 4XHJC 2KDGA 4TQEL 4X6DA 2P24A 4ODHH 1ZWIB 3RIFK 4PJFF 5D96B 4YAQA 4PJ8A 2GT9A 4POUB 3KLHC 1GAFH 5DR5H 1DQLH 4U1SB 4UDTB 3WNNA 4C4KT 2B2XH 5CHNB 4LSSL 3MZGB 4DK3A 4CMHC 5GS3A 4P4KC 5EU7C 4ZUVB 1WSST 2X42A 3TO2B 4PJCA 4L8SC 5CEZH 2YK1L 4FNLL 4GW1B 4KKLD 1DN0B 2A6KA 4NQTA 3O6FA 1WJ3A 1MFEH 3QUZC 1R5WA 2SEBB 2YRZA 4ZQKA 4R8WL 3ULUL 4LLMA 4LEXL 1XMWA 3BEVA 2YXMA 1CZ8H 1HE7A 5D9SA 4XP4L 3H3PL 3IAQA 4F9PA 5ICYB 1BM3L 4DZBB 5C0AE 1AXSA 2VZ3A 1FNGB 2YPKB 1B0GA 1B3JA 4NJAL 3OZ9L 2HKHL 1N5YH 4M48L 4PGBB 5I16B 4ZXBC 3TH2T 1MJ7H 2AVGA 1P9MA 1ZVYA 3NIGE 5I8OL 3UMTA 1H0DB 2F5AH 3MRIB 2WBKA 1N7ML 4M5YL 1CVSC 3MROA 3VRLF 2X4NB 1T66C 4J3VA 4XNMA 4C56A 3RPIA 2LU4A 4F57L 3C08L 4NGHL 5F9WB 2C7UB 4RMVA 2IPTL 1NLDL 32C2A 1GOHA 4Y16A 4G8EA 4KRPB 4D3CL 3VXRA 1NGQL 1YNKL 3RVUC 4O9HL 1Z9LA 3JUYA 1DN2A 1ZT1B 3G04B 2DYPA 4R0LA 1SJXA 2VXTH 5MHSD 3D3VD 1JK8A 2F53B 3BAEH 4YR6B 5BJTB 1WZLA 1FZKB 4P5KA 4MD0A 3V4PL 4KI5C 3KHQA 5EA0H 5IOPA 3QI9B 3SGDH 3BKCH 3GSQB 2DBLL 2IWGA 2LQRA 1L6XA 3PV6B 1Q9KB 5JW4M 4OLYL 2VDPH 1MFCH 3G5ZB 1QBLL 1KLFA 4UIMA 2WNGA 4OIIL 1FG2B 4PGJA 3DURA 4NUJA 3HAEG 5IGXL 1DDHB 5FEBA 3L9RB 3BISA 1I7TB 2I9LB 1QBBA 5EH1A 4LGPB 4Z7NF 1K4CB 1LNUA 4HF5L 5ACMA 3TVMC 5HHOB 4K94C 2ZCKL 3VFNA 4OFPA 3UTPE 5D93C 3KPPB 2AK4B 4KTDH 1P5VA 1M6OB 4G8FA 1DBAH 5D71H 5T1KB 1Q9WA 2Y4SA 1E6OL 5FYJE 4Y88A 3C6SB 1KFAL 1V3MA 1I8LC 5CD5C 4WWKA 1AQDA 1R3HB 2AJSL 1HXMB 3P73B 4QY8B 5CZVL 3BIAX 4HIXL 3W11D 4I5BB 3OTTA 4KI5E 3MBED 4S1RH 3A6CL 1UA6L 1BVKA 3UYRL 5EC2A 4HV8A 3SEPA 3ARFD 3ARXA 3CSYB 1VSCA 1QKZH 4LCWB 5IW3A 3RP1A 1NGYB 3TV3H 3U0TB 3W0WD 2QQKH 4XNXL 1RJYA 5EOCJ 3P4NA 4NJ9L 4N0YH 4L9LB 3VI3F 4BQBA 2CLRA 4QWWC 4ZUUB 4NKDA 4HQQH 3GSWA 1MIMH 3K80A 1QHOA 1N0XL 2E8YA 4L8BB 4YPGA 2FB4L 3VXPB 4E41A 5E1AA 4WHCA 1MCJA 3UJJL 7FABH 4BH7B 1F8TL 5L6YL 1DR9A 1FNFA 3IDXH 4KROB 2ZKHH 4KJQD 1KIRB 3SKNA 5GSVA 1CN4A 2I5YH 3TT3H 4MJ6B 2EZ0C 4JHWL 4XP9H 4J3XA 3HAEA 1UQSA 3BXNA 1XIWB 2VLRE 3QJHA 5TF0A 3H9SD 4CMHB 3N85H 3QEQE 4P4KB 4Y19A 1U95A 2D0FA 5I19H 1C08B 2FX8H 3GSXA 4GAJL 2ATPB 4PTTA 1CGSH 2XZCL 2ZOKA 1QSFE 4MCYB 4PJ8D 4JO3L 2AJ3B 5INCA 4QXUL 2KH2B 4OD1L 3FB6A 1MFAL 1HZHH 4HHAB 3UBXI 4JVWA 1ZA3A 1Z3GH 4X4YB 3L5JA 4FQHA 4HKZB 1K2DA 4WUKH 5HGDA 4PRDB 5C07E 5KSUB 4L3EE 1LP9F 3KYKL 4PJBA 4MQXC 3N1FC 1CXFA 4MJID 4WIQA 2E7HA 2V9RA 3O6FD 4ZO6A 4NO3A 4X83A 2O61B 5IVZB 1NCDH 2P5EB 2VSDA 4C55A 5EOCL 2VLKB 4ZO8A 1DBKH 3PWPB 3DX8A 1YEKL 2CDEA 4GSDH 4MXVE 3MRDA 3K2UL 1DFBL 3HZMA 3BH9B 1BGXL 1OGAE 3P77A 2ADGB 4LLDB 1INQA 2VZUA 2CIKB 2QLVB 3QNXA 4GXUN 4J3OC 1AGEB 5EB9A 1F3DH 1D9KC 2JJUA 4IOIA 1CFTA 2ED8A 4KHTH 4NN5C 2QQLH 1NCBH 1IFHH 3V5HB 4HC1A 3FFCA 4XMKH 1S7QB 2ZPKL 3C2AH 4OCXH 4HX1A 4JM2A 4DGYH 3REVA 2X9WA 3REWB 1FL6A 3WFEH 3BRGC 1BJ8A 1BJ1H 2EIZA 3MNVB 2ICWI 3MJ8A 4FMFA 1MLCA 1QR1A 4WJ5B 1EO7A 4P2QB 5C0BB 4F3FA 4YC2C 3ESVF 1NCTA 2NLJA 1S7XA 3J7HA 2OR9H 2HTLD 1JIBA 4Y16D 3KS0H 1OW0A 1IC4H 5FDWB 3DVNB 3P9MB 3QDGA 3VXRD 1Q94B 4G5ZH 3LKQA 2DYPD 1P84K 1X4XA 1MRFL 3SJVE 3KWWB 5LGKA 4J23A 5L8JB 4AENB 4HFWB 1F4YL 5ISZE 3MNZB 3F7PC 2VL5A 4NOFA 5I1LB 2VQ1B 2R15A 3B8SA 5K59F 2G5RA 3MLZH 1U8QA 3PNWB 3AFLA 5FA4A 1J1XL 2CLZB 4FFVD 4F58L 3MXWL 1JPTL 3O4LB 3TVMB 1T1XB 2FHCA 4XVTL 5IB1B 1KEML 4JRXA 5D93B 2IQAB 5CJOL 4G7VH 4Q9CA 3QUKB 3RWDB 4CRPA 4JZNA 4P5TC 4KDTC 5CSBA 1FFNB 4NWTH 4KJYB 2WM0A 5DS8A 3KLAB 1FYTE 4LPWA 1W0VB 1IAIL 1R0AH 5FGRA 2B5IC 2FZ3A 2YD7A 4Z78B 1K5NA 1TETH 3IDNB 4JY6B 1IC1A 4OZHB 5KSVA 4RA0C 4XNZC 5LQBL 2VITB 3QCVH 3QEGL 3BHBB 4H20L 1TJHH 3UBXA 1IL1A 5CJ8A 1RZFL 3TN0D 1HHIB 1JI1A 5CAYB 2R0WL 4YFLF 2DQDL 3RVWD 4JB9H 3TYGH 4WWKD 2DN7A 4KKBD 5E08L 1KGCE 2XA8L 1ZHBA 4XAKE 4LPYA 3V5DA 4WNQA 5GGSY 3ZKQD 1N64L 2Y36H 2VIRB 3GEWB 5J11C 1UH4A 3G9VA 3BYTA 3DX7A 5IQ9A 1DQMH 5IBLC 3U6RB 4KJWD 4L29A 4PBWD 4JFQA 2OSLA 1UKSA 4M7LT 3EO9H 2D4DA 4BSJA 2BOBB 2BNUB 4Y4FC 5I1EL 4LAQH 4A6YL 1EVTC 1FV1A 4X98A 3R1GL 1A2YB 4G6ML 1EK3A 3PL6C 4F7CA 1DBBL 5DUMH 4E41D 1OSPL 4HWEH 1JF1A 3O2DA 3GJFH 1EXUB 1H8NA 1IARB 3NCYS 3EOBB 1U41A 4IOFD 5D1QC 3S6CA 3ZZ1A 1W72H 2FGWL 3Q5TA 3CUPB 2ICWA 2HRPL 1CL7H 4QHUB 4GRWB 5D72H 5IHLB 4Y5XA 1TQBB 2K7PA 4Y19D 4C83B 5ESVA 5FECA 1MCCA 3EO0A 1EVUA 4JR9H 4PJIF 4OZFG 4NNPH 2NY6D 4PJFB 1NGXA 4G42B 2DM2A 4XBGA 2NY2D 2YC1B 3L3HB 4MQ7B 4ERSL 3H3KA 4HS3B 1OAXH 4QRUA 4XAWL 3BP4B 4K7PY 3TO4C 1DBJL 3EYQD 3P0VH 3SO5A 2W0LA 1QR4A 1XGPA 4F33A 3O3BA 3GMLA 3WHXB 3LS4H 1TJGL 5EU6D 3VXMA 2CKBA 1AGFB 3HMXA 5DFTA 3GMMB 3EOYG 2DRUA 5F89B 4XCCL 3X3FH 1CFVL 5GRWA 4NN5B 2C3VB 1T7ZA 4DWHA 3VFOB 4R4FH 2EEBA 1PG7W 3ARDA 4PV9A 1QRNA 4HBCH 3TPKA 2A74B 1DLFL 2M1KA 4AEIH 4NUGH 3J8F7 5K93A 2D9CA 1AXIB 1LK3L 4JO4H 4YC2B 3JTSB 3RTQD 1CXEA 4RDQF 1IC7H 1GC1C 3PHQA 3BGMA 3FFCD 5I2IA 4JM2D 4NDMA 8FABB 2DI9A 1LEKA 4WW2F 1PFCA 4M8VA 3TFKC 4HEME 1JRHH 1XCTA 1HIML 5HI3D 1Z5LA 4S2SB 25C8H 2OMBA 4P23A 3CJJA 4YHLL 4MWFA 2ESVB 3OKNA 2YBRB 4P2RB 4XCEB 3QXAB 4ODWA 2ED7A 2P8LB 4OZFA 5D1XB 1ZANH 4OFKA 5F7LB 4DFHA 1PX4A 3QDGD 4NPYB 5BS0D 4UINH 3TBSA 3NA4A 3WKML 4NBZB 1LP9E 3KPLB 1P84J 3RWJA 5J12B 4RX4A 4FFYH 1K4DB 1KELH 1NCCH 5D7IF 3C09B 4PP1C 4X6CA 1JZ3A 3NCEB 1L7IL 4ELKB 1T1YB 3KPQB 5J89A 1G9MH 5BV7H 4QRRB 1QFPA 3MRPB 3T0BA 1RUML 2B5IB 4N5ED 3AAZB 3DROA 1F3JB 4EOWH 4JRXD 3CFEA 3BZ4B 2P8PA 3U83A 1V7MH 1ZVHA 3LPWA 3WHE1 5D70H 5HHXL 4OCYL 4XNZB 1ZLVK 5GJTH 3VD5A 4DTGL 3W82A 4PG9A 1OTSC 4GRLA 4ZSOB 2ZZUT 5C86A 5IKCA 4Z18A 1QA9A 1QVOA 5FYLD 1YQ2A 2GAZA 1BD2E 1AR2A 2AEPH 4JAMA 5IVOA 4LSVL 5J11B 1MCBA 1KJVB 5BQ7B 1JN6A 3O4OC 5GS0D 4FQJL 5FGCE 5EIIB 4G3YH 5DD0H 2ITCA 1I9RL 3FJTA 2FX7H 2QHRH 4POZD 4RCAA 3RA7H 5A2FA 3ZKMD 3HG1A 1ZLUH 4PB0H 4Y4FB 1NBVH 1T20B 4HIEB 4LVOC 1EGJA 1A7RL 3FT4B 1J10A 2AJZA 2NNAA 4JFFB 3PL6B 5EC1B 4D9QD 1LILA 4CADA 1A4KA 4F2MB 2A2QT 1U3JA 2BJML 1MQKH 3PGDA 2AGJH 2DDQL 1NMBL 5DTFB 5HTSA 5I1GH 5D1QB 3KPRA 3ARPA 1NDGA 5CP3H 4JFEA 4YE4H 2W9EL 3GUTA 5CIPH 5E2TH 4NZRL 3QWRA 4OM0L 2KQMA 1U3ZA 2AKRA 3DUSB 3FO2A 4RISH 4RGNE 5ICXB 1IAKB 4LHUG 4FQXB 3EIFA 5JO5B 4X5WB 3ZT7A 5T3ZE 4JG1H 1KXQE 3HUJF 5D7JA 4M03A 4HZLA 3BEWB 4QRSB 3WS6A 4IDLA 2GK0B 2V5YA 4HUUA 4OLWH 1QUNA 3TO4B 2EICA 3KDMA 5CKGA 3FQTA 1PLGL 1RK1B 4JO2H 3V6OE 4S1DD 3STLB 4NRYA 1FO0A 1BQLH 2DM4A 4ZD3L 4K3EL 3WFHA 1N3NA 1OAKL 1J0IA 1G7IB 4EI5C 1XGRA 4XXDB 1WCBA 2DMKA 5DRNB 3BGAA 4Q9QL 4MDJB 2AQ2A 4NQCE 3MRRA 3FOMA 1VADA 2Q86A 4UT6H 1ZKAA 5HJ3B 1OAYL 3VXMD 2XPGB 1LO2L 4K7FB 2F54B 5H35B 5C0CB 3ZSSA 4NM8L 3IKKA 1KTLA 1VESA 3CFDA 4S0TD 2V5RA 1SM3H 1FL3A 4WGVB 5DI8B 1NUGA 3VWJC 2LU7A 1Q72L 4ZAKC 1NUFA 2BY1A 1EMTL 4QRPB 5FKPB 4MX7A 2PCPB 2R69L 4OLVL 4ISVA 1OTUD 3ZDYF 1DANU 4Q6IA 3ARDD 1QBML 1QRND 1P6FA 2BVPA 5F6HI 1NAMA 1VFBB 4QGTA 3M8OH 5DUBB 3RUGF 3VFUB 3BWAA 5DJ0A 3ZKXC 4F7MB 1MCSA 1RUAL 4D0CB 2ZOLB 3VXSB 3QH3A 1S7VB 5GZOD 3T2NH 1DEEA 4BZ1L 1A8JH 4XPFH 4ZFFB 4JRYA 2YKLH 2ARJB 2DQJH 1JNHB 4N0UA 1MCPH 5AZ2L 4GW5B 3SDCC 1LO3H 2EE9A 2IBZY 3KJ6H 3A67L 4RA3A 3LMJL 3DBXB 4QKXB 1AP2B 1KJMB 1SEBB 1DUZA 4MGXA 5E2UL 3I84A 4WW2C 1KJ3L 4GKSB 3BDYL 2FLRT 4ETQA 3PXHA 4H8WC 4RX4D 4TUJB 4JZJA 3KHOA 5EDXA 1T5XB 3CXDL 2VLJB 1QLRB 1UYWL 1ZLSL 2DI8A 1MIEH 3BSZH 1FORH 3PG2A 4CJ0A 4XBPB 4AEHH 2PO6B 1FLRL 1MWAB 5CJXA 1ES0B 1NC2B 4AK1A 4YDIH 3D87B 3MLTA 1J1OL 4X6EB 5CINL 2X2YA 1FN4A 3SGEI 1M7IB 3M45A 4HGMA 4H5SB 5JXEA 4PYGA 3LRSA 5ICZA 3SE3C 3IXAB 3MC0A 5I18H 4KHXL 4HUWB 1IBGL 4ZODA 4YHOL 1GGCL 4ONHB 3K0WA 1Q9OB 3GSNH 5FOBB 3O4OB 1EAJA 4HBQA 2AXJA 3MV9A 4GRLD 2BSSB 1J7VR 1PKQA 1CLOL 1GHFL 1SYVB 5CGYD 1YMME 1HKLL 1D5BA 4Q2ZA 5HGBA 4J2XA 1QLEH 1F4WL 4LVOB 1U8NA 4NKOA 1QSVA 1CBVL 3E8UL 4Z0XB 3IDUA 2DQIH 1X5ZA 2AV7B 4H26B 5TF1H 3MRJA 1KOAA 1UB5B 2HFGH 2IAMA 3MRCA 2NY5H 2Z35A 5DJ6B 2ZUVA 2J7LA 1GC1L 3D9AH 3HG1D 3PDGA 4MQSB 4BFBD 3C9NA 1UXWB 4TSCL 4YFDB 1T83A 2VZTA 4YZFF 4MNHA 2UZYB 2GTZA 1AKJB 1CIDA 1E4XH 4M61A 2EKSA 2H2PC 1AO7A 2JCCA 3GO1L 3H42H 1Y6NR 2AEQH 5F96L 3AS0A 4O4YH 3EOTH 3K1DA 4RMTA 1IQDB 5ETUA 1R3JB 3F7RA 4NIKB 3LEYH 1CD0A 2CUIA 4FHBD 1XF4A 4R97C 3W5MA 3BZEA 1KJ2B 3GHBH 4LCUA 3KPRD 3DYMA 1MRCL 3K4ZA 4R4NC 1HHHA 4BQ8A 1RZJL 2FEEI 4MAUH 1NSNL 1I7RB 4NC1E 2R1YA 1YY8A 3F6LA 3QWRD 2EH8H 3SDDA 5MP6L 4FQIH 2MFNA 3WFBH 4DKAA 2B39A 3Q3GB 2CD0A 4JDTH 5DMGC 5DURD 1AGCA 1S9XB 2FECL 5D7JD 2OBGA 3P4OB 3VCLA 1DLHA 1KT2A 3FQXA 4JJ5A 3SDYH 5I66A 3MLWH 5T33H 3S4SG 1FL5A 5FCSH 2YEZB 1NGZB 3FB5B 4FXKA 4NO0D 3KPSB 1MJUL 1CFNB 1I8MA 1U8PB 3DO7A 4N5UA 4PJIB 4I8DA 4Z7OF 1NCUA 2PKDA 3INUL 3U36A 1Y6MR 3PWLA 1E27A 1IGJA 1YEDB 4ZAKB 4TTDD 5KVDL 4PRPA 5ESQB 4IRZL 2XOTA 4JY4A 3HN3A 2YD1A 1B0WA 1U8JA 3DTXA 5D2NA 2VDRH 1J12A 1BVLA 4KK8C 2FEDC 3ES6B 5DD3L 4LPVA 1UEYA 5T3ZL 1UACL 2BNRA 3T2PA 4U6VH 3ZKXB 1FAKT 5HHMB 3C8KB 5JUEH 3FB7B 2WUCL 1FDLL 3DGCR 3QQ3A 1CD9B 1MI5A 3QRGL 1T80A 4WFHD 5MERB 1G7LA 3HI5L 2UWEE 2Z0BA 5JMRA 5JHDE 4XP1L 3U7YL 4WU5A 3TYFB 4Z7WF 3Q6FA 2YSSA 2MKWA 2ATKB 3QAZC 1F58L 1J1PH 1S9VB 3U9UA 1T0PB 4G6AC 3SDCB 4EVNA 4Z6AT 5IB3A 3M1BA 1YMHA 2NY3B 4OQTL 5FYKE 3X12A 2HMID 5GZND 4HWNA 3MLUL 2PXYB 5I1JH 1IRAY 2A83A 4JRYD 4Q74A 1PY4A 1OB1B 4UDUB 2MQ0A 2GK2A 2CXKA 3VGAC 3G6AB 4X6DF 4J6RL 1RU9L 4NT6A 5I0ZA 4FRWA 4R90H 1AGDA 5I76A 2IANE 3N0PB 4Q97A 1WC7B 4F7EB 1OD7A 2YD6A 4KQ3L 5J7CC 4RQQB 2Z93B 1HKFA 4XCFH 4AG4L 4OD2B 3TJEH 4CVUA 1O7VA 1N8ZA 3A6BH 1RZ7H 3RAJH 5GGSB 1MPAL 3ZTJH 4PJCF 1QFWH 3S3SA 1N6QL 5ITBH 3HE6C 3QFDB 3MOQA 5D7IB 4CU7A 3T0EB 1XGQA 5CEXA 1TJIH 1T6VN 1S7RA 3IS0X 5F9AC 3RY6A 2J88L 4DN4L 3D85B 5D7SH 5JXED 5ENWB 3OJ2C 4OCNC 4YDKH 1OAZH 4KKLC 1WWAX 5CEZD 4PGDA 3TBYB 1M05A 3MX0A 4X6BA 2QSVA 5BCAA 4FXLA 1CCZA 3UTSB 2HP4A 2DTML 1U2CA 2FR4A 2BP3A 4FQQA 2F53E 1CXKA 1XCQB 1QNZH 3AREC 2MHAA 1JGVH 4QXGL 4LSTL 1CG9B 2YPLA 2EYSB 3WYRA 5TE4L 5C0FB 4LVEA 1EO8L 4X4ME 2X4TB 3LN5A 1J0ZA 1VERA 1FGNH 4D0DA 1GGIH 2IAMD 1BZ7B 3F62A 4LHQB 2CUHA 3U4EB 1T3FA 1ZOXA 5CP7B 4YHPB 3IJSB 3STZA 4Z7UB 4R97B 4WUUB 4MAYB 1C1EL 2WINA 2JELL 1G7PA 2GYSA 2YMXL 1XGTA 3QHZH 5ACLA 3C8DA 2JIXA 1AO7D 4U49A 4Q6YA 2H2SD 5ANMA 2H3NB 5I17B 4OF3A 3F7VB 2AQ1A 1TPXB 3MFFB 1EFXB 4A2MA 4Z0BL 2YXFA 4WU7A 3CFCH 2UUDK 1GZQB 3LKOB 2FBJH 2DQTL 1FHGA 4ZUTA 4HK0B 5F72S 2Q7YA 2C1OA 4HPYL 3QWQB 2IALA 3VW3L 2WP3T 3BX7C 1RZGA 3MLSL 4LNRA 5IFHH 1I1RA 5BVJA 1MCRA 3TIEA 5J9PB 3C6LB 3EKCA 1TLKA 4CMMB 3HUJB 1W0WA 1OAQH 5EO9A 3TM6A 5TDPA 1J87A 4LMQI 3TLRA 1QP1A 4RMSA 2KBGA 1MY7A 1WTGT 4EUPH 3QEUA 4HWBL 2R9HD 1T21B 2CH8A 4X5XB 2VN4A 3P4MB 2FO4A 5AUMB 4HWZA 2IMMA 2NR6D 4LASL 4KY1H 5CSGA 5IVXA 1KN2L 3HC3H 1XF3B 2DQCH 1IGCH 2HFFB 2APFA 2HWZL 4AJ0A 2HG5B 3ZDZF 3T4AB 5HDBF 1RAMA 1YECH 3X11A 1QOKA 4PRPD 4HUXA 3V7AE 5C0RH 2BCKA 1XGYL 2O5ZL 4GG6A 3FAWA 4LCIH 4YZFE 3ZO0A 3S5LB 4BZ2H 3ISWA 1LEGB 3AU1A 3I6KA 3FT2A 5A1AA 4FTVB 4L4VA 3FTGB 4M9PA 1MF2L 5L2JA 2BNRD 5C0NC 2ICES 3D3VE 4TPRL 1ADQL 2R4SL 1NC4A 1MI5D 3FB8B 1KB9K 1YN7A 3E6FA 1F6LL 3W11C 3AM8C 2Q6WA 4B50A 5KJRL 3WD5L 3D39B 1T03H 3GSVA 1U8KA 4ZTOH 2WLZA 3RUGB 2VUYA 1KYOK 3KPMA 2A9ML 3EYVB 4K3DH 3D69B 4FABL 2ICEA 1G6RB 3G5XB 4LNVA 1GL4B 2R2EB 3GRWH 4G9DA 1YEGH 3MA9L 1JNNH 5D5MA 1ZHNB 2XKSA 3MFGB 2ADJA 2DL2A 3RNKB 1NEZB 3B2VH 4BFIB 3S3JA 4JVPA 4Y5YA 4OM1H 1JZ8A 5FUCE 3FMGH 3MRFB 1TCRB 1AHWC 5JNYB 4ODXA 3HE6B 1A6VL 3G08B 1EERB 2G5BB 3CIQA 1ND0A 3BFOA 1HSAB 2X4OB 4GAGH 2Z92B 3T08A 3H7BB 2PW1B 4G9FA 4PY8I 4PJBF 2HVJA 3B2UD 3C5ZB 2YA0A 2YWYA 3MJ9A 5EBMA 3DMMA 5IK3A 4ZUSB 4PJ8C 4G8GB 3MBXL 5SWSB 2AABH 5FYKL 2YOCA 4L3CA 3X13B 1PYWA 4DGIH 2X7LA 3W0WE 1IKNA 3LD8B 1Y0LA 1CDBA 1KIPB 3AREB 3GIZH 3MJ6A 4O2EA 3CFKB 2V7HA 4Z7WE 3FN0L 5E2VH 1FNAA 3O6FC 4Y4HC 4TRPL 3UZEA 2FJHB 5L2KA 4JGJA 3LCYA 3WS3B 2AXGA 4M62L 1GSMA 1BFVH 1WFOA 4TNVF 5KAQG 1CFSA 4JPIB 4M5ZL 1HXYB 2DWDB 5ALBH 3KAAA 4NO5B 4UI2A 4I3RH 4ONOA 1A6AB 2BVOA 4YDVB 4JM2F 4F9PC 2VR9A 5GXBB 2XFXA 2X4QA 3CH8A 1I7ZA 3H9HA 3NA9L 2YPLD 4X6FA 2VDQL 5TFSL 3H9SE 5FUOH 3HCVA 1DQJA 3QUYA 4W81A 5IWLA 3WDHA 4X0KA 5I9QC 2OI9C 3HE7A 4XMPL 5IW6B 3ZL4H 3HNVL 1YEEH 4WHYH 4YHNB 4NQDA 1TZIB 3DVIA 1OGTA 5C2BH 4I48B 1VB9A 1P2CB 4QTIH 5D8JH 1MH5B 5DLML 1YPZA 2H6PA 5IBTL 3UJTH 4PRHE 3BE1L 1X6NA 2VE6B 4GBXA 2WP3O 1OSZA 2CK0L 4AY0A 3D0VB 4WI9A 5KSAC 5C0EA 4MJIE 2UZXB 4M6AA 3BP6B 4PJCE 4TULH 2B1HL 5J1TC 4OKVA 3EDJA 2J8UB 1JHLH 4U1LA 4Y16C 4XI5D 1RZKH 4NCDA 1I7UA 4MNGA 5DJ8B 5GGVL 4DJMA 2OL3A 3DXAA 3AMLA 5E70A 2VSCA 3DVGB 2PETA 4PJDF 4PD4K 5CEYA 5EBLB 4PJEF 3F5WA 3DSFL 3FKUS 4N8VG 4FS0A 5JORA 3VXUA 4K23L 1SHMA 1OL0A 3GM8A 4P99A 2X4SB 1UM6L 5B22A 4DQOL 3T77B 2DLGA 3PWUB 2BX5A 4KDWA 4ZFGH 5IROA 3C2SA 5JTWA 2F15A 4X7DC 4HH9B 4FFVC 1MJJA 1ZVSB 4TUKL 4Y1AA 3QG6A 1AD9A 5IMOA 3MJ7A 2JK5A 1M7DB 4XC1L 4IRSA 2PTTA 4DOHB 4DKDC 3ARSA 3IYLW 4ODTH 2VXVL 1PEZA 4W6YB 3TGXA 3LEVL 1QYGH 1ZK9A 5IF0A 3OAZH 4M4PA 2YD3A 2R29L 4WFFD 3MCLL 5FXCH 5EZLA 3AMKA 3GI8H 2A1WH 3BKJL 5JZ7D 5IJKA 3V6FA 3B4NA 1SEQH 1HK6A 4Q7DA 3ARRA 1KCLA 3HPLA 3ZDXE 3DV6A 1H15A 5AD0B 5T1DH 3RWIA 3PP3H 3KXFA 4HDIB 5DHYB 5H94B 4LKXB 5E8OB 4LCYB 4HAGA 2JKXA 3DSNA 1ZHLB 1G7QB 4N8CH 5ADOL 3U0WH 3UTTA 3WUWG 4RMWA 3RVWC 3EJZD 3IFLH 5LAXA 4WWKC 2P47B 3MV8A 4KKBC 3WXVH 4MA1B 4PJ9A 2GCYA 3ESUF 4NYLB 35C8H 3Q6GH 3I02B 4X4XA 1XR8B 5E6IA 1SBSL 1EH9A 1J05B 4DZ8B 3GHEL 1MJ8L 4KJWC 3D48R 1YN6B 4NQVB 5HGHB 4FQ1H 1U92A 4ZPVB 4N8VA 1P7KB 4QHMB 2VB5A 5EU5B 4MNQB 4UTBL 3VFTB 4DKFH 1IAII 1KLGA 1ZT4B 1GYAA 5EUOB 1B0RA 4QCIB 4KZEH 3CMGA 3ELAT 5CGMA 3MRLB 4MYWB 3VXTB 4X6DB 4ZOAA 5J13C 1NBZB 1IEAA 5HVFB 5DVMA 5F9OH 5FHBL 4YAQB 3GKWH 3L3DB 2COQA 3VG0H 1QPXA 5IHZB 1B90A 1C5DA 3VFRB 4S0SD 3FONB 4HLZH 4QRQA 1JPST 1EEQA 4PS4H 1L9MA 1G7JB 4G9FD 3OL2A 1ZA6A 3UTQB 3SDAD 3DRTB 3H0TB 4PB9L 1YDPA 4OGYH 4BK4A 5F7DB 3DMMD 1CLYH 3KNBB 5HDQH 3IU3A 3N1GC 2A6KB 4UV4H 4Y4HB 4LSPH 5DJ2B 1DBMH 1DUYB 4ODSH 1A3RH 4R96A 4M8QB 4LLYB 1NBYA 2ESVE 4LLMB 5KVFH 2AK1L 5DEZA 5MEPB 2O5XH 4RFEA 2VZSA 1ZLWK 2YD8A 3EYQC 4TYUA 3WUWA 2VWEC 3B9DA 2B4CC 4YGAB 5BRZB 4DUXA 1LO4H 3NIDF 3SDXB 4KXZH 1AIFA 3TESA 9CGTA 5L2KD 1AXSB 4I9WD 15C8H 4Z95L 4P3WA 3S35X 3O3AB 4GKOA 3LN9A 2VXUL 3I2CL 2R23A 5BMFH 3F8UB 5JDJA 3TIDA 1B0GB 3GMOB 4P5MA 4U6YA 5I74B 1HQ4A 1MNUH 4KK5D 4OB5H 5HHQA 5HYSG 2BOCB 1EHLH 1T5WB 3HR6A 4AIZA 3NCJL 2J4WH 4I2XB 1TFHA 4TQEH 1GRWA 4DEPC 3TBWA 3BUYA 3QUYD 4C56B 3H8NA 4MXQC 4HUNB 1YYML 5KSAB 4ZFZB 3HE7D 1R3KA 1D5XA 5E94A 1OLLA 1Y18A 1QD0A 3RZWA 3VRJA 32C2B 3O3EB 2D7TL 4FZEL 3WIHA 4PGEA 4JM2C 2OZ4L 1S9WA 4LSQH 3I75B 2RFXA 3IJYA 1CGTA 4GBXD 5HI3C 2Y5EA 5C9KA 3CVHA 2EDHA 3GB7A 4UTAL 2VWEE 2YK1H 3VGDA 4FNLH 5EU6E 3MOBL 3EGSA 1PGRB 5E0QA 5FCUL 3HZKA 1EEZB 4O00A 2ZSWB 1FBIL 3QCTL 3B43A 4TSBL 3HFMH 3OX8A 3O81A 1JYVA 4TNVK 1JVKA 4R8WH 5D6CA 3RHWF 3ULUH 4LEXH 1WZMA 1OW0C 4MD0B 3H3PH 1N26A 2R2HB 3DXAD 1RMFL 1SBBA 2VC2L 4J3TA 4PD4J 1C12A 3VXUD 2YRLA 1AI1H 3GJFB 5IT2L 1PDKA 1VPOL 3UCRA 2HKHH 4UIMB 3OXRA 3EHBD 3MRKA 4M48H 4JFFE 4NUJB 4TTGA 3QRFM 1MAJA 5FK9A 3B3IB 3PABA 3MXVL 4PLJC 3JWOC 1WUNT 4JZOB 4Q0XH 5I8OH 2H26A 3FFCE 3IXTB 4Y1AD 5HYIA 4N5EC 4M5YH 3G6JE 2D4FA 1PEWA 4GLRI 4IRSD 4OZGE 4YIQA 1IZJA 3VA6A 1K8IA 3WSQL 3ULVD 4F57H 4XPBL 3C08H 1MFDL 5ACZB 3GSNA 4ALAL 3ILQD 3P30L 4LEOB 2IPTH 1WBYA 1NLDH 1FIGH 1QHPA 5DQJA 3P9LB 1F6AA 1QBAA 4O51A 4D3CH 4HFUL 3EJYD 1AQDB 1NGQH 1YNKH 4Y5VA 5I8CB 5LGHL 4O9HH 2W0PA 3U7AA 1TZHA 1ONQB 3QDGE 1A1OA 1GPOH 5IMLA 5D7LD 5J1AA 5BS0E 1BOGA 3CX2A 3WIFA 2XI9A 1CE6A 1QLFA 3KXFD 5IFJA 5GS0C 5H37H 2AQ3A 4PJ7B 3UTTD 1RURH 2RJMA 3C5SB 4G8IB 1A6ZB 4A6YA 1KB5B 4K3JH 3ZKMC 3P4NB 4GUPA 4PJ9D 3K7UA 2DBLH 2CLRB 4NQXB 2L7UA 1A22B 1N0LA 2J2ZA 5E6ID 2IFGA 5DRXB 1L4IA 5EN2B 3P0YL 1QBLH 2DS4A 4YPGB 2DQHL 5E8NA 3IDGA 2W9LA 2F54E 1IVLA 3WJLA 5IGXH 2JJWA 4QYOA 4XVUD 3TZVC 3WFDL 5KN5A 5HYQA 4HF5H 1DJSA 5ITFA 2Y5TA 2ZCKH 1UQSB 5FYLE 1R3IL 2LU3A 4GMSH 2D7NA 4QRPE 1A14H 3R0MA 2JJSA 4Y19B 1K6QL 5JIPA 1SQ2N 4PTTB 5ESAA 3SY0B 1ZT7B 3D6GA 1E6OH 4UU9A 1Q38A 3VFMB 3MODL 5J6HA 4BUHA 3QWOB 2P46B 2NYYD 5INCB 1I4FB 3FB6B 4YDJA 2AJSH 4MJ4A 1U8OB 5TDOB 4HIXH 4LCCC 4Y5XC 1A1MB 2VO5A 2PTVA 1K2DB 3A6CH 4HKXA 4IHOA 1JHKH 4U1JA 4PJBB 4I3SL 2QR0B 4X80L 4S1DC 2YUWA 4WFED 1HN1A 3CC5B 4BFEA 2VZVA 4F7TA 4NO3B 4JVUA 5JIKA 2VLRA 2FHFA 4NJ9H 3OPZL 5CCKL 3QEQA 1S7UA 5FIEA 1BQUA 2AJVH 2VQTA 3QSKB 3U1SL 3NIFE 4IIQA 3HPJA 2VDKH 1CR9L 3P77B 1ORQA 1UZ8B 1INQB 1Z6JT 4DEPB 5CKAA 1F8TH 3MGAA 4KJPD 3OJDA 1DVFD 3E1F1 5FV2A 4IOIB 2VLMD 4HT1L 5C07A 1DQQB 2D7OA 5A16A 4JHWH 5DSCA 2OTUB 3KPOA 1MSPA 1P4BH 5GGUA 3RKDD 2IG2L 3L1OL 5C92A 2Y6SD 1YJDC 3NMEA 1LGVA 4GAJH 1QSED 1Z0NA 1A6WL 2XZCH 1NL0L 3D2UA 3MJ8B 3RIAF 4F3FB 5HD8D 1MFAH 1EIBA 3W2DL 2Y06L 3UPAA 2GFBB 3U82B 3O41A 1OGAA 1QZ1A 4NRZA 2C3WA 3KYKH 4YPJA 4P4RA 5GS2H 4MDIA 3QQ4B 1REIA 3CK0L 1FZJA 3VXME 4P23C 1U8LB 2ZUWA 3EDKA 3ZSTA 1A9EA 3G5VA 3WIIH 3O2VH 5EOCH 1QEWA 1YEKH 1X44A 1S7SA 1U8QB 5IVNA 5IBUB 3K2UH 1DFBH 2GJ6D 4HAFA 5MI0C 3TF7C 2A6IA 4PJDB 4PJEB 3LKSA 3NAAL 3ZKND 4YXKL 2G60L 4JRXB 3NIDE 1JI2A 5DJAB 5DJYB 3JV4B 4ZMAT 4JZNB 1CDUA 4N1EA 3WL9A 4NFBA 4DVRL 5F3BA 2E7LA 2ZPKH 1KG0B 1T6WA 1LMKA 2M26A 3S98A 3RZCA 4E9LA 2NW3A 1K5NB 2DLFL 5KSVB 1R5VB 1WICA 2B4CL 3FO0H 3Q5OA 1NFIA 2BDNH 5LWYL 4RFNC 4NHUA 2ZNXA 3RHWK 2OXHA 3RWFB 5KOVC 4V2CB 1S7TA 1MHCA 2YWZA 4L4TD 5SWZB 5JPNA 1CGUA 3WEXA 3WFCL 4N90D 5TDNA 5E8PA 1F4AA 5CWSA 1ZHBB 5CGYC 1CIUA 2RCSL 3MYJA 5K9OA 4XWOD 4YBLC 1MRFH 3MNWA 4PRIB 3QDMB 4P49A 4E42B 4D94A 1CLCA 1ZMYA 2IGFL 4OZIA 4JFQB 5EU3B 2OSLB 2BY2A 4LLQB 4G6JL 4F9LA 4RGOL 3UJIH 3TZVB 3QIWA 1MCFA 4HC1L 4X6CE 2DJ4A 2XWTA 2ZUXA 3MXWH 4QHKI 1JPTH 1KCSH 2NY0D 1NGWB 1FV1B 2VLLA 4XVTH 4KUZL 4KMLB 5B8CB 5FYJD 2DQEL 5DWUH 2KUTA 3QJFA 4K55A 2DJSA 4BKLB 4JKPH 4PGCB 4TVPH 5CZXD 4NO2A 5F70A 4PREB 5C09B 1YY9C 5C6TL 1JGDA 3ZYZA 2AI0L 4LCCB 3EFFB 3EOAB 3IETA 4XCYB 3CMOL 5FECB 5LQBH 5ESVB 3KGRA 3B9KC 4IS6A 4OFDA 1G0XA 3EO0B 3MRGA 1UJ3A 1RZFH 2F5BL 5HBBA 5IEKA 2R0WH 5KS9E 4XBGB 3QFJD 2DQDH 5D7JC 1H3UA 5IR1A 5DK0B 1UG9A 4ONFL 4QRUB 3WS6C 5E08H 3HZYA 1TTUA 2XA8H 3JWOL 4R7DB 2XNAA 4R7NB 4UZGA 1N64H 1B88A 4F33B 3GMLB 3GSRA 3L7EA 1T0NA 3RU8L 3U4BL 1YEHH 1MAML 3FQRB 2X1XR 3QDJB 3JUZA 1P4IL 2VLRD 4HWUA 3T1FA 4PJHF 3ROOB 1CE1L 4WWID 3RDTA 3NFNB 5FYLL 3SKMB 2ICWJ 3R1GH 3KPRE 4G6MH 4XXCA 2V2TA 1JJUA 5M95B 1DBBH 1OCWL 2MWCA 1F11A 1OSPH 4JN2A 3LV3A 4MLSA 5GS0L 4JCLA 2A73B 3BPNC 3EBAA 4UT7L 4J4PD 5F8QC 4LQ1A 4XT1C 3QUMA 4LSRL 2FGWH 5BZDB 2XICA 3L3GA 3CZFB 3DO3A 1KXVC 3GBNL 5I2IB 3PQYE 1QO3A 4LIQH 3FOLB 4JFDB 4NDMB 4K8RC 4Q6IC 4XX1E 3ORJA 1A64A 5CSZA 3MQIA 2G2RA 5GGRY 1EUTA 3D2UD 5E5UB 2PYEB 4P23B 3OKNB 2GITA 4ERSH 4ODWB 1FIEA 1V3KA 4OJFL 4L8DA 3QT2A 4OZFB 4PJ5E 4NOBA 1VFAB 4Z7VA 3O45B 1OGAD 4G80A 5GZNC 5TQ2L 4E0RA 2WBJA 4XZUA 3Q5YA 3MRNA 2EDBA 3MRBB 1TJGH 3IJHA 3N50A 4K94H 5MI0B 4YHZL 2CRIA 5JA8B 1C5BL 5FB8A 3T0DA 1ACYL 3O2DL 3BD3A 1D7FA 4QHLA 5C08B 1OQOA 3FHQA 2DMCA 3C5JA 4I0PA 4AEEA 2XZQL 4EDWL 1MHHA 3IT8D 2BFVL 4YGVA 3QZWG 2VQUA 4WFHE 2D03L 3DROB 4U1IA 1ZAGA 2P5WA 4JZJC 3CFEB 3BZFB 2N1KA 3B9AA 2P8PB 4R26L 4Y7MA 1LK3H 4RFNB 1AGBA 5EO1B 4MLIA 4WEMB 1KN4H 5CJXC 1QA9B 3RZCD 3MV7B 2F19L 1VKXA 1BLNA 2B0SH 2OJEB 4M6MH 5C9JB 5JXEC 5DJDA 1HIMH 3JV6A 2X41A 3G5YA 2CKBL 2CK2A 3HMXL 4JAMB 4JRYE 4YBLB 3B9VA 3IDYC 3SKUD 4YHLH 5IMKA 2EDEA 1JGEB 4N0UE 2ADIA 4RBPH 4Y2DA 3FT3A 2ITCB 5T1MA 4PBXA 3D25A 3WE6B 3HG1B 2Q3AA 4KU1A 4RMUA 3WKMH 3BW9B 4UV7L 4PJAE 3L7FA 1YZZA 1YJDL 2AJZB 1B2WL 2WIIA 1DL7H 4R4BA 1I1FB 3GFUA 4KQ4L 5DUPL 2BSED 4CW1A 2IC2A 4N0RA 1R3LA 1M7XA 1L7IH 4CADB 1A4KB 3QIWD 3LQAC 3FQWB 2YD5A 3PGDB 5IB5A 2H9GB 1HDMA 1NDGB 1T83C 4JFEB 3C60A 5F7MC 5ABDE 3QIBA 3QIUA 2AKRB 2IBZX 5HHXH 2H2SC 3FO2B 3QZWA 4OCYH 3B9KB 4XNYL 5F1NA 4EDXA 1IGFL 1X5AA 2QL1A 2ERJC 3OR7A 1AY1L 4B41A 5CEZE 1MHPL 1JNLH 4XP5L 5D7JB 4I1NB 2L4OA 4HZLB 1KBGH 2Q1EA 4MVBC 2OCFD 2E5EA 4HUUB 1FVEA 1FVDA 5EU4A 3RI5F 3KDMB 1X4YA 4YBQD 3FQTB 1WT5A 3SDDC 2EDYA 3WNKA 3L3IA 2R56H 4JLRB 2CIIA 2EXWD 4XP6H 1PSKL 3N9GL 1FO0B 1IC5L 4NRYB 5DRZA 4FQJH 4APQC 5IVXF 1NANH 2A9NH 3QULB 4CU6A 1XGRB 1I9RH 1WCBB 3OKMA 5T1LD 5F6IC 3MRRB 1VADB 1A7RH 2YPVL 1YUHA 2DWEB 4GG6F 4IJ3B 3ARZA 2H32H 2CRMA 2NR6C 4JFYA 1LO0L 5L8LB 1AO7E 2JCCE 1L7TL 4JO1L 3BPNB 2BJMH 5H2BA 2FLBT 2FNBA 2HJLA 3RDTD 4CDHA 2W9EH 3V6OA 4CKVX 1ZHKA 2IBBA 2CLVA 5D2NC 2Q87A 3O6KL 4JPKH 4P9HC 4OM0H 1U58A 4RMQA 4W4OA 3G6DL 4WV1A 1Q9LB 3ME0A 1NAMB 3BQUC 3WNPA 2DIAA 1QSZA 5HYJA 3X3GL 5BVPL 2WWMD 4NQCA 4EN3A 1X9QA 1O5DT 1A7NH 1IJ9A 3QO1B 5DDHA 5SWSE 4LHUB 1N5AA 4XH2B 2QSCL 4QOKB 5D5MF 1PLGH 1EGJL 4OF0A 5CUSL 1I1YB 5JA9A 5L8KB 3ZE0F 2UY6A 2HVKB 5K9QI 3D18B 4KI1A 1AXTL 1OAKH 4XCNA 3LEXA 5A43C 4G43A 4RWYH 4Q9QH 4GAYA 2WBJD 1AD0A 3OKKB 5DEGA 3BKML 1GGBL 5DVKA 3MMEA 4LPTA 1LO2H 4PRPE 4FXGA 4NM8H 4ETQB 4LVHC 1JHTA 5E2WL 4CAGA 4JZJB 5IFAL 2XN9D 1Q72H 1NMCC 2XRAL 4BQCA 1J8HA 4JFHD 4UQ2A 1EMTH 5JLZA 4JPVH 3O6ML 1OY3B 2HN7A 4A2LA 1FRGL 3F7YB 4OLVH 3GM0A 4HKJA 4JM4H 1MI5E 3V0VB 2BVQB 2Z8WC 3ARGA 3U2SB 1FN4B 4NWUH 4KK9D 3LRSB 2P5WD 2RQ8A 3B2UC 3HLAA 3RL2A 2GY5A 1U3HD 4HD9A 4LPXA 3VWKA 5K9QG 5ALCH 1RUAH 1LE5B 4RAUB 2ZJSL 3MV9B 3RY6C 5EZIH 3GSOA 4EUPB 3BO8A 1PKQB 4BZ1H 3VE0B 1FNSL 1QFWM 5J4MA 4Z7QF 2FIKA 1QQDA 3MA7A 4JJHA 1D5BB 1F90H 4H1LG 1RJZA 5HGBB 5A2KH 3DI2B 1LD9B 3F65A 5AZ2H 3TCXA 5DGQA 1CLZH 2EDFA 3A67H 3RJDA 2D3VA 3FO1A 3MRJB 4Y2DD 5E2UH 1KTRL 2EXYD 4PJXA 2Z35B 3TCLB 1KJ3H 1N59A 3BPLC 3ILPA 3SQOL 1INEL 2G9HA 1YPZF 3BDYH 1FCCA 1SVZA 3VFGH 2NX5E 2HKFH 5C0GA 4K7PL 3ZTNL 5SWQB 2AJUH 4EIGB 1RV6X 3DIFA 1FYHB 3CXDH 4BSVA 2O93L 1UYWH 4HIHA 4PRNA 2ZUYA 1T2QL 1XF1A 1MRDL 4YDLB 1VGEL 1A7PL 3GSUA 4QO1A 2ERJB 1G7MB 3MUJA 1ZTXL 1FLRH 4OTXL 1XF4B 2EH7H 5CINH 4LOUD 1PZ5B 4LCUB 2QADD 3HC0A 3C60D 3UPRA 4AM0B 5HDOA 3QIBD 1YY8B 4ONGH 3QIUD 4KHXH 1IBGH 3GMQA 2OTWB 2XQBL 4FZ8L 4YHOH 3SDDB 5E4IA 5I1IL 1N4XL 3VGEA 4APQB 4U1MA 3W9DA 1AGCB 2C1PA 3HB3C 1ED3A 3O8XA 4KKAD 4KH2A 1NLBL 3VCLB 1DLHB 3WKNA 3FQXB 4DVBA 4JJ5B 1CLOH 5I66B 1GHFH 1ZGLM 1HH9A 3O9WD 2NW2B 4OZ4A 3DV4A 1F4WH 5KAQF 5IM7A 4DAGL 1I8MB 4ESKA 1MCWM 1GJIA 3MRQA 4ODHL 1BF2A 1HEZA 4H1LA 1MVUB 4N0FA 1E4KA 2HFEB 1GAFL 1PG7X 2Z4QA 4GS7C 4OLUL 1GC1H 4YX2L 3BP7A 2DMBA 3WXWL 1TITA 4TSCH 4RGND 3OAYK 1KACB 1U8JB 3DTXB 3ARVA 4WI6A 4XTRD 5D2NB 5J6GA 4KTEL 4NNXB 1BVLB 1TVHA 1ZE3C 3UTZB 1SY6A 2BNQE 2WMPA 2XKNB 5CEZL 3BQUB 4Z9KB 2BZDA 5GSRA 4U2YA 1MFEL 2JB5H 4DGVL 4PJHB 3QQ3B 4I77H 2GJZA 5JZ7C 1MRCH 4IRJB 3WUZA 5FO7A 5GGQL 1NSNH 1PW3A 3RI5K 4ELMF 1ZS8B 4AL8L 5MP6H 3T04D 4WU5B 3Q6FB 2P42B 5DC4B 4DK6A 5HYJD 2Y7QB 4U7KA 1J5OH 4AIXA 4EBQL 5DJZA 3ZT6A 5TE7L 5J1SC 1N5YL 1YMHB 3K4AA 1BZ9A 2BC4A 2YD2A 3FO9A 3LQAL 4HCRA 4QHNA 5D2LE 4P3CH 3GGWA 1MJUH 5LBSL 2A83B 2H8PA 5HHPA 5BOPA 5JOPE 2DKUA 4AMKL 3F7QA 3S4SB 3INUH 5FGSA 4NT6B 3BDXA 5HGGS 5I76B 4U1SA 4M3KB 3ZYIA 4UDTA 5JHDA 2I24N 5CHNA 4WFFE 5F1KC 4IRZH 3RVTC 3VMPA 4ZUVA 3S37L 1EEYA 4X4ZA 3TO2A 4MD4B 4ODUB 1S7WA 4Y5YC 4EQ2A 5T3ZH 1UACH 4YXLH 4M6NH 1XR9A 5IHUH 1X5HA 1J8HD 3W81A 2SEBA 3BAEL 3N1MC 3GJEB 1ORSA 3QRGH 1S7RB 1LEIA 4URTB 3HI5H 4MCZA 3ARGD 3BKCL 5ICYA 4YNYB 1KLUB 3U7YH 2X9YA 2AJYH 2DLEA 1A21A 1I8KB 3SGJA 3VWKD 2YPKA 1H3PL 5MEQB 4OQTH 2W59A 4X6BB 2ARJQ 2E6QA 4PGBA 3OB0H 1IKNC 4KK6D 3HC4L 1G7HA 1ZXQA 3UTOA 4JHZA 3BPLB 1WV7T 2MHAB 3MRIA 2M8XA 5GHWL 5D5ME 4P9HL 3CH1B 2X4NA 4J6RH 3RIFF 1OPGH 5TGBA 1H3GA 2AJXH 1MCNA 2C7UA 4OT1H 1XEDA 4RIRB 4D0DB 4FQLL 4UB0H 4KQ3H 5KZCB 4KK5C 4QNPE 2FSEA 4L5FH 1SJEB 2LTQC 1T4KB 1DCLA 1UFUA 4KV5E 5I6XC 1QG3A 2EDLA 3GI9H 4S1RL 1MPAH 3QUYC 5IWLC 2JIXB 2C4XA 3RX8A 1QKZL 3HE7C 2F53A 5ANMB 5GRVK 4P2CG 5GISL 4LLVA 4HUVB 2BHZA 1FZKA 2VABB 3BGFC 12E8L 4P2OA 3NIGF 5E8EB 4P46B 2QQKL 3V52H 2J88H 4QT5A 3QI9A 4N0YL 4WU7B 4DN4H 3PV6A 1Q9KA 4ZUTB 5E2JA 4GBXC 5ERWB 3G5ZA 4HQQL 5SX5K 3V7AG 1MIML 2C1OB 4H0GA 1Q1JL 1CTNA 2IALB 1GVIA 1RZGB 4AYFA 4LF3A 5BVJB 3AY4A 1FG2A 2J6EA 5L2KE 4I9WE 5HHVH 3TIEB 5JIIA 2Y1VA 7FABL 1NDMB 4LMQE 4PRAA 4XNQA 4AH2A 3LPFA 3O8XD 5EO9B 1RVFL 3OMZA 3L9RA 3RWHA 2EDRA 2I9LA 4Z8FH 3CPLA 1IM9B 2I5YL 1K4CA 3PV7A 4QXGH 3TT3L 4LSTH 4ZOBA 4D0BA 2VISA 1I1AA 3N85L 4YEFA 2FO4B 5TE4H 4HWZB 5I19L 1M6OA 2FX8L 2GIYA 1HH6B 5HHNA 5T1KA 5HXMA 5GGRB 3EHBC 3BVNA 3C6SA 1PX3A 3NPZB 5IROC 4BELD 1R3HA 2KPNA 1HXMA 3P73A 1C1EH 4QY8A 1Z3GL 2JELH 4I5BA 5TPWL 3W39B 4U1GC 2YMXH 4YEEA 1YPZE 1JPSH 2XTJD 4IRSC 3RGVB 3CFJA 4U1NA 1CD1A 4GG6B 1CGVA 1J0HA 5I1AA 2QV2A 4JRWA 3CSYA 3HNSL 4OSUL 4L4VB 3ILQC 4LCWA 3HS0B 1EX0A 3U0TA 5GRXG 4MA7L 1NC4B 2B20A 2BSTB 2FD6L 4L9LA 4Y4KB 3IF1B 4BQ6A 3EJYC 3DUHA 5IJKC 1YN7B 4ZUUA 3BRFA 2DQTH 3MUGA 5I30L 3DXAE 1ERNA 3RVVC 1RIUH 1C8PA 1JMZA 4H8WH 3VXPA 4M1DL 2BSRB 1RY7B 5DQDH 3TH3T 4CVZB 4KHTL 1YNTA 3AB0B 3BPCA 1NCBL 3CDYA 1IFHL 2W1NA 4MJ6A 4PJ9C 1UWGL 1N2RA 4HWBH 1XIWA 4XMKL 4OCXL 4X99A 4CN1A 5E6IC 4P4KA 4Y1AE 1C08A 1ZEAL 3D3VA 4LSUL 3WFEL 1JWSB 1NQBA 4LBEA 1PQZB 4CJ1A 2HWZH 4XVUC 3ULVE 4M6OL 4ODXB 2OR9L 4QGYA 2MOVA 4NKMA 1R6VA 2BVTA 1A7OH 4HJGB 2GI7A 2LFGA 1XGYH 4UT9H 4G9FB 5D7LE 5C6WH 1GGUA 2I60L 3GBMH 5B39G 1MF2H 3IFNL 5IK3B 4TPRH 1ADQH 1JZ2A 1JWUA 4HIJA 2VLKA 3GIVB 1HCFX 1Z9SA 3JTTA 3PWPA 4PRBB 4ZDHB 5TE6H 3MLZL 1BJMA 4HLJA 3RQ3A 4YHIA 1ULVA 5KJRH 2ZP0T 2Z31B 3BH9A 1NJ9B 2J12B 1I3UA 2ADGA 4LLDA 3VD4A 1PKOA 2V7HB 1OHQA 3BWUC 4G7VL 2A9MH 5L9DH 5DFWH 4FABH 1V8HA 3WJJC 1IGYA 1D6VH 4NWTL 2Q76B 3V5HA 2NXYC 2L0DA 1CFSB 1S7QA 1WBXB 3MBEA 3QPXH 1NKRA 1R0AL 2UZIH 4W70A 4JKMA 5MENE 3OKLB 3REWA 3IFPB 4FA8A 3H9HB 3ARFA 5LG1A 4HULB 5I6XB 3MNVA 4X6FB 1IZKA 4KUCF 4WFGD 4RZCA 4WJ5A 3RWEB 2FRGP 5C0BA 3QCVL 3W0WA 3K74B 2AEIT 4G6KL 4KJPC 1BECA 4X0KB 4M3JA 4MXVF 1UCBH 4NQDB 4KRPD 3BGFB 3P9MA 3VXOB 4JB9L 1Q94A 5IMMA 2H6PB 5FUZL 5D6DA 2Y6SC 1JPGB 4WDIB 4XC3L 1MCIA 3KWWA 1OSZB 3PDOB 4AENA 1RUQH 1DQML 4HFWA 3MNZA 2F53D 4WFEE 1IT9L 1QRKA 4OKVB 2WWKT 2B1AH 2FBOJ 4LLUB 3MGOA 1CICB 3PNWA 4U1LB 4WO4B 4HMEA 3QI9D 3FZUD 3H9SA 4MNGB 3VFVB 4LAQL 4PFEA 1CDIA 3TVMA 5SWZE 1T1XA 5IB1A 4K2UL 3F5WB 5A3IC 2IQAA 3FN0H 2JLLA 4KAQL 4OCRH 1JBJA 2Y23A 3OQ3B 1JZ7A 2ZUQC 5DHVA 4M62H 1CK0L 4KJYA 3WO4B 1OTTD 4PRHA 5E9DB 2VLME 4R3SA 1W72L 1UGNA 4NP4L 5HHOD 4Z78A 1MJJB 2K9UA 4MJIA 5CGTA 2W65A 1I1AD 2VDQH 3QG6B 4U1GB 5TFSH 3ZKNC 4G6FB 4YWGL 4NSKB 3BHBA 3MJ9L 4JR9L 1QSEE 1S9KC 5T1KD 1JPFA 1BMGA 2LAGB 4XMPH 5IF0B 3HNVH 3PGFH 2WW8A 1H9VA 5EZLB 5CD3B 5DLMH 5IBTH 3WLWD 3SHSA 5D1ZB 5GS1B 1OVZA 2HLAB 5INDA 3B6SB 3P0VL 5JW4Q 5B3NA 5C09E 3TC9A 2CK0H 3LS4L 2QEJA 4ORZC 1H15B 1P1ZB 4MJ5B 4OZIF 4LCWD 1G6RH 5GRVL 2BOBA 3UTTB 1SMOA 2BNUA 5GGVH 5LAXB 3OF6D 1RK0B 3MV8B 5AYUL 3WDIA 4WTXA 4X4XB 4XWOC 2GJ6E 5E6IB 2OR7A 1W8NA 4ELMB 4K23H 1HQRA 2W9DH 3B5GA 3B5TA 3EOBA 3OKEA 4LRIA 1OF2B 4KROD 1RHHA 4AEIL 2OM5A 4JDZB 1UM6H 5DHXB 4DQOH 1CDJA 3KLHD 4FQCL 2EIBA 1B4JL 4GKZB 3CUPA 4PY8J 1IC7L 43CAB 4TUKH 1XIWD 4IMKA 4QHUA 1KLGB 4HKBB 2NY0C 5T5FL 4UUJB 4XC1H 4P4KD 4C83A 3HR5A 4FMKA 3IDIB 4WTWA 4G42A 2YC1A 4XVSH 2R29H 4MQ7A 4U3CA 1HILA 3MCLH 4HS3A 4QTHA 5EOTA 1C7TA 1F6FB 4TVPD 3PUCA 3BKJH 1ZANL 5IB2A 2OL3L 4L4TE 4QRQB 4UOW0 4N90E 4ZPTB 2GSGB 5FO8B 2JJSC 3TA3A 5F7KC 4PV8B 3TNMA 3L5IA 1CTOA 4M1CD 3IU3B 5ADOH 5DJXA 1LO5B 1VFOA 4FFWC 2VLKD 3I50H 2CRZA 4HMDA 4QXWA 3PWPD 3ABZA 4PR5B 1NBYB 3ARYA 3KPTA 1RSFA 1C7SA 1RZIB 2DIBA 2NXYB 1G9ML 3VFOA 5BV7L 3T3PF 1WAAA 4RFOL 3FRUB 5CILL 3WUWB 4K3HA 1MJ8H 3P11L 1M71A 3TN0A 5JQHC 1X5YA 4LLWA 3MO1A 43C9A 1V7ML 1X5IA 3ULVL 1S9YB 4C58B 4UTBH 4P5MB 4AT6B 5L7XH 4U6YB 2NY1B 3S36L 1HQ4B 1I3GH 8FABA 5FF6A 1JFQL 5C0IA 5HHQB 3VFSA 1GIGH 4IIQC 2R8SH 4MJ2A 4S2SA 2MCPH 2CO6B 1PJ9A 3QPQD 3GMPB 5C0BD 5I1CL 2ESVA 1RUKL 1NFDE 2YBRA 4WI7A 4L8CB 4P2RA 4XCEA 4WI3A 3P2TA 1OWRM 2R2BA 1R3KB 4HSQA 2P8LA 2XXMB 5D1XA 4JFOB 3ALXA 3QFJE 3VRJB 3PGCA 2QHRL 3GMNA 4NPYA 3MREA 2XY1A 2FIRT 3T09A 3U0PB 5C0AB 5FDYA 1S9WB 4PYHA 2RFXB 4PB0L 3NACH 1NBVL 3IJYB 4JFZL 4PB9H 2XG4A 3KPLA 1D5IL 3CVHB 4MS8C 3GB7B 2E9WA 2JTDA 1K4DA 1EBPA 3HZKB 4C4KO 2P4AB 3PWNB 1MQ8A 4JGUA 2ZUQB 3U9PH 4J1UA 4ELKA 1T1YA 3DWTA 3KPQA 5KTEL 1MQKL 4NHCL 5I1GL 4QRRA 3MRPA 3K1KC 3O4LD 3TVMD 3KYNB 2N7BA 1F3JA 4L8SB 5E2TL 3BZ4A 2VXQH 4RISL 4E5XA 3OJVC 5I71C 3I2CH 3QUZB 2OMNA 1HSBA 4NZUL 2ARWA 3S7GA 3ARQA 3IRZA 3IVKB 4PRHD 2W0FB 4M02A 3MRKB 4JG1L 4ZSOA 5FK9B 1RUPH 2RB8A 3PABB 3FN9A 1MLBA 5IB4A 4GKNA 5EU6A 2H26B 4YHYC 2P45B 1VENA 3NCJH 1ETZA 3PDDA 1HINL 1U8IB 1WGOA 3ZHLA 1DE4A 1UT9A 4JO2L 3K81A 4JCMA 2HT2D 5HYSB 3HI6H 5BOZG 4JANA 1FAIL 3EFDL 3QHFH 2G75B 4ZXBB 2D7TH 4FZEH 2E7LC 4UBDD 1F6AB 4NBYB 2OZ4H 5KANI 4U33A 5C0DB 4QWWD 1T20A 4X9IA 5IMLB 4UT6L 3FT4A 5J1AB 4D2NA 3MOBH 1BOGB 3H3BC 4JFFA 5FCUH 4U6HB 5BZWB 1QLFB 1FBIH 3QCTH 4OLZL 5IFJB 1K85A 2JJTC 4L1DA 4XGZB 5EC1A 3T0WA 3TNNA 3RTQA 4NFCA 1KENH 1CGXA 4F2MA 2X89D 1AE6L 5DT1L 5DTFA 3G6JA 1RIVH 4A6YB 3UBXG 3QUXA 1Q0XL 4OZGA 5GGTA 1V7NL 4V1DB 1JZ5A 2EZ0D 4WVRA 1SYSB 1RMFH 2VC2H 2NY0B 5CS7A 3DUSA 3SPVB 1H8OA 4JQXA 5BXFB 5IT2H 4HJJL 5ICXA 1IAKA 2MCG1 3MZTA 4FQXA 1EFQA 3M8OL 3T8XB 5JO5A 5JPMB 4F9LC 3LRGA 3IDGB 4S1SH 4OFIA 3X14B 1S5IL 4DUVA 1A6UL 3MXVH 1FVCB 2RIKA 5C0JA 3QIWC 3BEWA 5GRZA 4OD3H 5KN5B 4QRSA 4AIOA 5BS0A 2CGRL 3WIHL 5HYQB 2HT4D 2GK0A 1KIQB 5B21A 5ITFB 1FC2D 3TO4A 4NNYA 3T2NL 5L88L 1J86A 3EO1B 5EG6C 4XPFL 5D7KD 5KANG 4MZ3A 3CVHL 3STLA 2VDLL 4WHDA 4ALAH 1WIUA 3P30H 1LO3L 4UU9B 4XXDA 4OCSL 3KJ6L 2EYRB 5J6HB 5EPMB 4PLNC 1CF8L 4Q58C 2WAHA 2X70B 3TP4A 4PJGB 5DMYA 3EYSL 5BW7A 5HJ3A 4OGAC 2XPGA 4IHOB 4YBQC 1WLHA 2F54A 4YHML 4U1JB 1KNOA 3TA3D 5FFLA 5LCVH 2EXWC 1UJ3C 4U0RC 4AQOA 1BAFH 1JUFB 2I27N 1OP9A 2GW5A 4IMLB 5DI8A 2FDBP 5F7EL 2AV1A 4OZIE 4F7TB 4ZS6C 2X10A 2VLRB 4QRPA 3QA3B 4OLXL 5FKPA 3PWJA 2PCPA 3QEQB 1S7UB 3B83A 2CDGB 2Z8VC 3L95A 1XF5B 1QSFB 3P0YH 4IIQB 3HPJB 3S3PA 1VFBA 5DUBA 2DQHH 1ORQB 5I18L 4ACPA 4F7MA 4B0MM 1J0YA 3GSNL 3WFDH 1HHKB 1F42A 4D0CA 5C07B 3IAPA 3VXSA 2HT3D 4L3EB 3RDTC 2HFTA 3LOWA 1S7VA 1YNLL 3MRMA 5ILTL 3TT1L 4ODVL 3IAGC 3KPOB 4ZFFA 4XXCC 3KVQA 5GGUB 3JWDC 2I26N 2GHWB 4QRTA 1K6QH 3V4UL 1JNHA 1UVQB 1WIPA 4GW5A 4JY5H 4NRXB 2ESVD 3PIQB 5CZKA 2DQIL 5DMJB 1G0YR 4P2RD 3MODH 2FL5A 1A7BA 3QDAA 5SX4H 4JKLA 5D1XD 4OCWL 5KSBE 1AP2A 1KJMA 3N1QC 1KTDB 2CRYA 3O11A 3E2HC 2NY5L 5ADPL 3EZJB 2FJFB 2X6MA 1OGAB 3D9AL 4GKSA 4P4RB 4I3SH 4X80H 5AG9A 1G9NC 5EFIB 1OQXA 4MDIB 5T3XD 5JQ6L 3E3QE 4TUJA 2X4RA 5FYJL 2HH0L 1E4XL 1T5XA 1QLRA 3H42L 5I71B 2BMKB 5AAWA 5CCKH 3PHOA 2BRRL 3MSPA 2PO6A 1MWAA 2WBJC 1ES0A 1NC2A 1LQSR 4QRRD 4X6EA 4RAHA 3CFBA 1I3VA 3LQMA 3T3PE 4YUEH 3IXAA 3CX5K 3LKSB 3S97C 4ZS7L 3UEZA 4ONHA 3RPKA 1Q9OA 4FQIL 4AZ8A 5FOBA 4I18A 3AS2A 3BT2L 4I0PC 2HJFB 4JDTL 5AZEL 1T7WA 4FN0A 5E1HB 4IOSD 3SDYL 4F80A 3MLWL 1TVBB 3V0AC 3SJVB 3KYOB 1SYVA 2IG2H 3DOSA 5DQ9B 2NY7L 4KK9C 3UXFA 1T0MB 4XB7A 5C2UB 5ISZB 1A6WH 4TNWF 3MRHA 1NL0H 4Z0XA 1G6VK 5F7NC 3FQNB 1DQDH 2VKWA 3QEHA 1KTKE 2AV7A 5I75C 1D9KB 4NHUB 1HWGB 3W2DH 5E6YA 2Y06H 1UADC 3SKJL 1KB5H 4HS8L 4XWGL 4PJXF 1UXWA 2DBJA 4Z7VE 5TDNB 4OAWB 1PG7H 3BN3B 2H32B 1BX2B 3CK0H 1URLA 4TSAL 5K9OB 1JMXA 4XPAH 2VDRL 4JFFD 1XF2A 3PL6D 5DEFB 4F7PB 5HYEA 1K3IA 4KGJA 1FYTB 1MHEB 1IQDA 2XN9E 4Y2DC 5T5NG 2EXYC 5DYOA 5JUEL 4GAFB 5D1QD 3MJGX 4JFHE 1KJ2A 3QUXD 4C59B 1I9JH 3HAEH 1ZLWH 2Q8BH 4R2GC 2R0LL 3NAAH 3P4LA 1KCVH 2G60H 1CGYA 3K8MA 3VH8G 4FQXD 2P5WE 4BUGA 3Q3GA 4LRNL 3QJFB 5HI4D 1S8DB 1S9XA 1IKFH 4BQ9A 3P4OA 2N56A 1RZJC 4LOUC 2YEZA 1NGZA 2VXSL 3C60C 3RL1A 4BM7A 2DLFH 3TO4D 4OF7A 3VD3A 3HZVB 5I73C 3KPSA 3IKCB 3BJ91 5I1JL 4P9MH 2B4CH 4P57A 3OAUH 4PJIA 1JV5B 3DX9B 3MRGB 4P5TB 4KVNH 4U0RB 5IEKB 4R90L 4KKAC 1YEDA 5IR1B 3HKFA 3KG5A 2VR5A 3GDBA 5ESQA 2RCSH 1MCOH 4XCFL 1RPQA 2XWJA 2FJGB 4CN4A 5IP4A 2F54D 1WT5C 2ZUUA 2YR3A 3ES6A 1G1YA 1RZ7L 2WK2A 3L7EB 4XX1G 2IGFH 2Z8RA 4ZOCA 1T0NB 3ZE1E 4G6JH 1A7QL 2ZSVB 5GGVY 4L1HA 2NZ9D 5ITBL 3C8KA 3IU4L 3VDAA 4QRPD 3FFDA 4P0DA 3M07A 4HC1H 1MUJB 1TJIL 5F1OB 1BVZA 3MLRL 4RGNC 3I3BA 4FFZL 4LK4A 4XTRC 5D7SL 3TFKD 2V2TB 1KCRL 3TYFA 5KS9A 1MEXH 2ATKA 4I3GA 1F11B 2BHYA 4YDKL 3RX5A 3LV3B 1S9VA 2ZG3A 3CDGB 3VH8A 3VXSD 2EC9U 5C6TH 5F44A 1JP5A 3NCYP 3V6OC 4XRCA 2PXYA 1BFTA 3E2HB 5JOFB 5DK2A 4NQEE 2AI0H 1F5WA 1QNZL 3CMOH 3EYFB 4W4OC 4UDUA 2IQ9L 1SJHB 1IQWH 4WV1C 5CSZB 2G2RB 2F5BH 4EN3C 3F12A 1WC7A 4F7EA 2UWEF 1GGIL 3NCMA 2K1MA 5HGAA 3JWOH 4WW1B 1AR1D 1YQVL 3MRNB 1FGVL 3KYAA 5EUKA 3IJHB 1ZV5A 5GGSA 3RU8H 5IIEB 3OKOA 3U4BH 5FB8B 2VLJD 3IFOB 3QFDA 1P4IH 4QHLB 3T0EA 3PQYA 4I0PB 2PO6D 4O2FB 1NC2D 5E7BA 1MHHB 4NO0A 5HI5D 4B53A 4YGVB 1DSFL 5L0QC 5ENWA 1WBZB 2Z9TA 3H7LA 1OCWH 4KRNA 4M1GH 2O5YL 2V6HA 1Q0YH 3E6HA 4MQTB 1GXEA 4PJ5A 5GS0H 3OKDA 4UT7H 1A47A 5I75B 1CT8B 4LSRH 4HG4K 4OKDA 5HYJE 5DRWB 3UTSA 4WEBL 3GBNH 1NEUA 4KZDH 1LP9B 3ARGC 4YH6A 5DFVD 1VKXB 1BLNB 3V7MA 4KKCD 5DJDB 2E6JA 2EYSA 3LS5H 1O0VA 4JGMA 2QQNL 5IMKB 2X4TA 2DI7A 1EV2E 4YK4C 2DQCL 4QHKJ 4ZOEA 3U4EA 1MCDA 1F97A 3WNOA 4YHPA 3HRZA 3FT3B 1NGPL 4Z7UA 5GRJL 4MAYA 1YECL 1TMCB 1NCWH 4DN3L 4YHZH 1AKJD 5KVEL 2NXZC 4R2GB 3JWDL 3L7FB 1C5BH 3P40A 1ACYH 4ZNCD 3O2DH 3AUVA 5FGBA 5EBGA 3VXQB 5FA3A 2YA1A 3I6GA 2DL9A 2H3NA 3OB8A 4CW1B 1I9IL 4IBLT 4DCQA 1R3LB 2XZQH 3QUML 1FLTX 1J8HE 2BFVH 1A0QL 1BD2B 5J06A 2C5DC 3NZ8B 3LKOA 1GZQA 3L3JA 5IJVB 1G84A 1HDMB 2D03H 4HK0A 3S96B 4UIKL 4TNWK 3SGDI 5I73B 4HIIA 1CD8A 5FGCB 1G9NL 3R8BB 1A3LH 4XPGH 3ALPA 3S88H 5GQBA 4ODBD 5KG9A 1K8DA 5F1NB 1H5BA 1WEJH 3C6LA 3O6LL 5CBEB 2J8OA 1XAUA 3HUJA 1TNMA 3T4YB 4YHKH 2IH3A 4YXHH 4PJAA 4NKIL 1OP3H 3RY5A 3GRWL 4X7TB 1UWEL 4M7KL 4QLRA 1YEGL 1WVZA 3LKNB 3KPSD 4MB5A 1FVEB 3HMXH 5AUMA 1FVDB 5EU4B 4O2CA 5B4MC 4HGWB 3B2VL 3LH2H 2CIIB 2CMRL 1CWVA 4GG8A 3FMGL 2HG5A 3T4AA 5GIRA 4PTUA 4QXTB 4PJXE 4FQPA 1FZOA 4RGNB 4CUCA 3JZ7A 1YUHB 2APWA 1YJDH 3S5LA 3SGKA 1B2WH 4GQ9H 3PP4H 3TBVB 1D6EA 4FTVA 3FTGA 4KQ4H 5DUPH 2GJJA 4Y0GA 3GKZA 1I8IA 4XPTL 5HHMD 2D9QB 4K07A 3FB8A 4NC1C 4GW4B 5J3HD 1EJOL 1Z2KA 4DGIL 4Q9RL 1ZHKB 3TEUA 2NY4C 3VXNB 3GIZL 2V17L 4JKKA 4WV1B 1KPVB 3T3ME 4TUOB 4D8PA 1IGFH 2VDOL 1KPUB 3EYVA 4XBEH 2QBWA 2XWBB 5IV2B 4NQCB 2NY3D 4EN3B 5DD5L 4XP5H 4PUBL 4OZFH 3G5XA 3NZHL 2R2EA 3HNTH 3S8WA 1VGKB 5DDHB 2PXYD 3ULUE 3U7WL 1ZHNA 4I3RL 3I6LE 3DUUA 3TPUB 1NEZA 1JZ4A 1P7QA 1PSKH 3N9GH 1IC5H 5FUOL 2NTSP 4CU8A 2PUQT 3MRFA 1TCRA 4MSWA 5I8KL 5JNYA 4ZYKA 3G08A 2NTFA 3LEXB 1MCQA 1T22B 2G5BA 1DEDA 1JWMA 4KRLB 4GAYB 4UOW1 2ZUTA 1HSAA 5C2BL 1AD0B 2X4OA 4QTIL 5D8JL 2YPVH 5DEGB 3SQBA 3ULSB 2VAAA 2Z92A 1FE8H 2Z91A 3UJTL 5DMKB 3H7BA 2PW1A 1WF5A 3VRIB 1D5ZA 5IHBA 4EI6B 1MCHA 4PG2A 1AFVL 3C5ZA 5LGJB 2XTJE 5D96C 1JHTB 1LO0H 4G8GA 5SWSA 4EI5B 3RKPA 3T0ED 4JO1H 1X5JA 3PQYD 4O02L 1NMAH 3ZT5A 1TTGA 5JLZB 2HN7B 5E95B 3UZQA 2EIDA 1EUUA 4JQIL 4YO0A 3D85D 2E6PA 3O6KH 1KIPA 4OIAA 5EWIL 3G6DH 3WMSA 3CFIC 3CFKA 1RFDL 5DA0B 2H1PH 4PJ5D 3HLAB 2FJHA 3ZHDA 1GGTA 1CDCA 3VWJB 3WS3A 4JG0H 1SVCP 4EJ1C 3UTSD 1PBYA 4YK4B 2R1WA 4HG4J 1UH2A 2P8MA 4NO5A 3MUHL 1F45A 1IGIH 4YDVA 1KEGL 3GMRB 4WTZG 2FIKB 3SE8L 1RJZB 2NXZB 4X8JA 4ZO7A 3SGJC 1YC8A 3T65B 5JW4R 3QYCA 4ODTL 4P3DB 3CDFA 4YHNA 2DQGH 4DW2L 1TZIA 1BBJA 4WUUD 1P2CA 1KSRA 1MH5A 4MAYD