3WYRA

Crystal structure of killer cell immunoglobulin-like receptor 2dl4
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
189
structure length
189
Chain Sequence
KPFCSAWPSAVVPQGGHVTLRCHYRRGFNIFTLYKKDGVPVPELYNRIFWNSFLISPVTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVTGLYEKPSLTARPGPTVRTGENVTLSCSSQSSFDIYHLSREGEAHELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYEWSDASDPLPVSVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the atypical Killer Cell Immunoglobulin-like Receptor, KIR2DL4
doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Killer cell immunoglobulin-like receptor 2DL4
total genus 35
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00047 ig Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wyrA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wyrA01
1WBZB 1SVCP 2YRLA 3NBNA 1M7IB 4DKFL 3RA7L 2H41A 3ULUC 4HUXA 3VDBA 4YO0B 1IT9H 5GS3A 1K9TA 3SDCA 1Y6MR 2X10A 4KRPC 1RUML 1JGUL 4MD0A 5HGAB 5IR1B 4BKLA 5LCVH 4KDVA 1MRFL 1WBYA 1CCZA 1MCPH 1Q9KA 3PL6A 2F8XC 2ESVD 4LLDB 5GGVL 4HEPG 3WHE0 3D25B 2APVA 1U91A 4P9HC 4E41A 4HJJL 5D7LB 1TQBC 4I0CC 3OJDB 1JRHL 1RIVL 2UV3A 4P0DA 5D2NA 1I3RB 4RNRB 1JGEA 3BPCB 4XBEH 5DGQA 4UZGA 5DK0B 3OB0K 3PHSA 5EO9A 3DHJA 1WZ1H 5I8KH 5EZLA 1LO3L 2CMRL 3SDCD 5HD8D 2J8UE 4CNIA 1Y18A 5DJ8A 4JY4B 3WIFB 5F96L 4K2UH 3LB6C 3OX8B 3EO9L 1Z0MA 1NFIA 2F19L 4WHTB 4L8DA 4YXLH 1QSFA 2YXMA 1NAKH 4MDJB 3KLAB 1S7RA 3TZVC 4OCSL 5DWUL 1BMGA 5GIRA 5FGRA 1RUQH 1OY3B 1AD9B 2AABH 2BSTA 3WUZA 4U1GC 1SYVA 4FTVB 4ZNEA 4Q2ZA 5D7SL 4N8VB 4NM4H 5GRUL 4ZODA 1K8IB 5BV7H 4PRNA 1S7UA 3QZWB 2XQBH 5GGRY 3VJ6A 3OKYA 2CGRL 4IIQC 2YPKA 3P11H 4M7KL 5FO9B 5F9OH 5LBSL 2Y4SA 3IFOA 4WEBL 2IBGA 4MJ4A 3U4AA 2X4UA 4NCDA 3HR6A 1HQ4A 2HJKA 3HE7A 4M1CD 4MA7H 3MXVH 1AO7B 3LKOA 1NCWH 1FYTA 4NO0B 5DA0B 4ODVL 2IADB 3PP4L 3QJFA 4NKDA 4P5KB 1GXEA 5E2WL 2XNAA 1RK1B 1KT2A 1ETZB 5ADPH 1C7SA 4QTHA 5DD0L 4D0CA 4QRQA 2A9MH 3DMMD 4NKMB 3E6HB 3DTXB 5DJCB 4HF5L 1L0QA 3VXTB 3H6JA 5CJQH 4OCYL 4WHYH 1WWAX 1D5ZA 5CZXD 5D1ZC 5CGYC 5DJDB 1TZGH 3MMEB 5T3ZE 4N9OB 4G3YH 4JFQA 4HUUB 3IXAA 5ADOH 3O6KH 4KJPC 2YN5A 4NJAL 5KAQF 4S10A 1AH1A 5KOMC 1T1YB 1U95B 5JORA 2VE6B 4L29A 3VWKC 1HWHB 5FK9A 3ZT7A 1U42A 4YIQB 3L3GB 1E0OB 1P9MC 3HR5B 3JWOL 3MRJB 4FXGA 4U6TA 3VMOA 3K7UA 4ONFH 1FSKC 4FQPA 2OR9H 4WNQA 5E03A 1SM3H 3DMMC 5DQ9B 2DQIH 1A6VH 3O9WC 5D96C 1N0XH 4JRXE 2FD6L 1CLZH 5E1AB 1MCHA 3NIGF 2YN3A 2F53E 3MJ7B 12E8H 4PJ7E 4J3TA 3IDNB 4WFEE 3RUGE 1MCBA 4D9LH 2RGSA 1JPFA 1QA9B 5JPMB 5CBAA 2ATKA 3IFPA 4NQUA 5DLMH 1TZHB 1IC4H 3QDHA 4MJIE 4LEOA 1NBZB 4PPTA 2APBA 5BRZA 3LKPB 4H88L 3D25A 4H26B 1JPSL 3BKML 3O6LH 1HCVA 4R26H 5TFSH 2OSLA 5B22A 3IF1B 2BDNH 1OAXH 1NBVL 1KLFA 2GI7A 2LFGA 3U46A 3ZSTA 4JQIH 4Y19A 1E4KA 4RWYH 2KQMA 3MLWL 4ZDHB 4MX7B 3V0VB 1A6PA 3MX0A 4QF1A 3U4EB 5LGJA 3GMMA 2WNGA 3H8NA 5C0EA 5HBBA 2XWTB 3T0EA 5CZKA 2ESVB 3HAEB 3HCVA 5A2FA 1QBMH 2EXWD 1W0VB 3HZKB 3JUZA 4CNIB 2VKXA 2D31B 4TVPD 4MJ6B 3ARFA 4FHBD 4RGMB 1ZHKA 2AJSH 1U6AH 3LV3A 5CCKH 3DYOA 3RAJH 1N26A 2DI9A 5I71C 4GW4B 4LCIL 1BBDL 3NFNB 4Q9CA 1BF2A 1XEDA 1CE6A 1F6FB 5FFLA 4OLXL 1EMTH 5DJAA 1BP3B 1ULVA 3WE6A 4UU9A 1E28B 4GAYA 3PG2A 3MV7A 5ETUA 3MA7B 1YYMH 1K4CB 3AU1B 3DUUA 4I0KA 1IGYA 1A0QH 2F74A 4PRPA 4LCUB 2WLYA 3UJJH 4QTIH 5DI8B 3ARFC 4OUUA 2IPKA 1OGAE 2J5LC 1IC1A 1BZ7A 1SYSA 4OZFB 2EXWC 3FO0H 2DLHA 4J3UA 4DUWA 5IV2B 5AZ2L 3RX8A 4U1MA 1IAKB 4NUJB 4X80H 1NCCL 3PHOB 2UZIH 1VPOL 3F5WA 4GQ9L 1PKOA 1XCQB 4O02L 1YECH 4Y16D 2PO6B 1IAOA 4F33A 5E6IA 2ITDA 1IAII 3RBSA 2V7NB 5DHVH 4EIGB 5HVHB 1OT1A 2GAZA 3S5LG 3SKMB 4RIRA 4NFCA 2YEZB 1KN2H 2P5EB 3VXMA 4QT5A 1SQ2N 4JHBA 2R2BA 4GW1A 1P6AB 3L5XH 1BQHB 3OV6A 4LLMA 1BQLH 5I1EL 4GMTH 4OCRH 1NQBA 1BHGA 1XT5A 1N4XL 2WBKA 1M7XA 4MHHI 2AV1B 1ZT7B 3C2SA 5HI4C 4HXAL 4QWWC 5HHOA 5I76B 2J4WH 3GSOA 1NCUA 5GRUH 4EOWL 1HXYB 1HZHL 5GSVB 1EEYB 3DMMA 2HH0L 2F5BH 2FX9L 3HNTH 4QCIA 5GRZA 3CSGA 2BC4B 3FZUC 1CK0L 3P0VL 1A3RH 1BGXL 3HG1D 4YDLC 1H3XA 5EZJB 5JNYA 5KZCD 5ESQB 5SWQB 3NH7H 3ARDC 5FKPB 3C6LD 3LRHA 4KKAC 5I1IL 3BRGC 2OS7A 4CJ0A 3H7BA 4D9QE 4XT1C 1IVLA 4PJ7F 3VFUA 2P1YA 4WO4C 5A40E 1RUKL 3QWRA 2BFVH 5GJTL 3UTOA 4IRSA 5C8JB 1EHLL 2V17H 1H0DA 4Y5VA 5BS0B 2VH5H 2WQ8A 3IYLW 5GGSY 3MGOA 4K07A 1Z2KA 5IB3A 4R4ND 4BZ2H 4XPBH 8CGTA 4M8VA 1MWAB 5D1XC 3MRBB 2CRZA 4YDKL 3QUXC 4P5MB 3OMZA 1LO4H 2Z35B 3F6IA 2EIBA 2FL5A 4LOUD 3RWFB 3VXQB 1S7RB 5LXGL 4Z8FL 3STZB 3GSUB 3K2UL 3TT3H 1A47A 4IS6A 4AEIL 3UMTA 3MRCB 2WP3T 4KRNA 5HI3D 1ZVHA 2B2XH 4Y4HB 5HYJE 4ZFFB 2X4QA 4HBQA 3ARED 3GUTA 1MI5B 1F11A 3HUJA 3U79A 4X6CB 1CFVH 5D5MB 4LVOB 3NABL 4PG9A 4R90L 1I3GL 2B20A 1NGWA 3IFOB 2EDLA 4ZTPH 1FVCA 5CEXB 4MLSA 4F2MB 1Z9OA 2IANE 1CGSL 5HDOA 3EOBB 3UTZB 5HDLA 3WHE1 4R4NC 1QR1B 4LVOC 1G7LA 5FGCB 1DSFL 3ZL4L 1T1XB 5FV2A 5C0CD 4Z78A 3OKEA 1U8LA 2X1WL 4UI2A 1AIFB 3MRHA 5DQDL 5LCVL 4POUB 1RI8A 4PJBA 3NZ8A 4HX1B 2Y07L 1KCLA 2YR3A 5D8JL 5DJCA 1CXEA 3LKRA 3VXTA 3RWEA 5F3HB 3MPCA 1NC4A 5I17A 1XF4B 1H9VA 3RVTC 1GVIA 1EHNA 3ULUH 1RMFL 3CH8A 4XTRC 4HZAA 2V2XB 1A7BA 2H3NA 2Y25A 5E8NB 4PJFF 1NUGA 5C7XL 5IW1B 4F8TA 4P5TB 5FHBH 4GBXA 4CVUA 1DUZA 1V3MA 3IKCA 1IQDA 4UNTA 4JY5H 4M62H 3QQ9C 2PCPA 5E2VL 2ITCB 2YSSB 4K2UL 2AJXL 2X1PA 2ICWJ 3MZTA 2A83B 4YXLL 3SDDB 4G6JL 3V4VL 3T0DA 4PJDE 5KS9E 2VLKE 1ZGLB 5CSBA 2Z31B 4WW2A 5GJSH 3KR3H 3TBTB 2P8PA 5MP6L 3Q6FA 2WINA 3QUXD 2DYPD 1NGZB 3ZT5A 4JZNA 1EUTA 2HFGL 3CFDB 5DHYB 3MNVA 4LOUC 4NM4L 4FQJL 4IEFB 2XQBL 5MEPB 1CDUA 1YEEL 2DQTH 4GKZA 1QUNA 1ORSA 2V5SA 3TYGL 5FB8B 4KTDH 1UXSA 3U0TA 4NRXA 4NCC2 2FJHA 1MSPA 4CVWA 1FAKT 1FLRL 4ODWB 1UT9A 3MRRB 3LPFA 1NKRA 3STBA 3BRFA 4Y4FC 5F9DC 3UZEA 4ETQB 3V6ZB 4EKXA 2VLRD 3ZYJA 3QUYA 4OLVH 3A6CL 4YC2C 3ETBF 4Z0BH 4ZDHA 2G60H 4D0DA 1NFDE 1QNZH 4IDLA 5ACMA 4M6OH 4ZOAA 4DZ8A 3VI3F 3GZKA 2ATPB 4FG6D 4IHOA 2A9ML 5AZ2H 4PJ8D 5TH2A 4G43B 4OV5A 3O11A 4PTTB 4LCYB 4X80L 2UY6A 4M6AA 4KJQD 1VPOH 2IAMC 2CXGA 1JZ5A 3HMXA 4JQVC 2FX7L 5EBMB 1KIUA 2IQ9L 4BK4A 4DCQB 3LQAL 1UJ3B 3B5HA 4R7NA 2V6HA 3BZFB 3PWNB 4U31A 1UYWL 2F54E 4FQQA 5I30H 4OCLC 3ROLA 5T3XH 4IDJH 3VXRE 1MHHB 4J4PD 1RZIB 4PB0H 4DVRH 1EVUA 5FYJD 4ZFFA 1Z5LA 2EDJA 2MMXA 3MNWB 1JPTH 1MJ8H 1W8NA 1T7YA 3S4SA 3BKJH 4XCFL 1NCDL 4GMTL 4LLWB 2AJYH 4ONFL 4LK4A 2EYRB 4WI7A 3ZTJH 2DYPB 1A9EA 3HC4L 3QQ9D 1UZ6E 3MV8A 3O6FD 4XWOC 1GAFL 5HHPB 1A6VL 2P7TA 2W60B 3Q48A 5HXMA 2J4WL 2EKSB 3RUGA 5FUZH 3C09C 5BJTA 4PRPD 2X6MA 1JIBA 1YPZE 4L3EE 3W0WA 1MLBA 4XMLL 35C8L 3BP7B 4JKPL 3JV4A 4POZC 4BFIA 1S7VB 1H3WM 4K94L 1IC4L 5GPRA 4F15B 4KFZC 2ITDB 3K80A 3R1GH 2LV4A 5HDQL 3DURB 2V9QA 2OJEA 4H88H 4U49A 5L7XH 4R26L 5BRZD 1FL3B 1KTLB 2BDNL 4MMZC 3IRZA 5IB5B 1YMHB 1KSRA 2RFXA 3UX9B 3OXRA 4HS3A 5IJKA 2DKMA 1CT8B 2X40A 4AH2B 2VZOA 4LLMB 4MNQE 3WO4C 4NP4L 1JF1A 5FM4A 1F45A 5DO2D 3GBLA 2R29L 5JXAH 5IMLB 2JB6A 2JKXA 1IFHL 5F7NC 4OUOA 1HHJA 1FJ1A 2VDQH 3S37H 3ULVE 5D9SA 1BLNB 3GKWL 4KMLB 4C83A 1FFNA 1I7UA 2CR3A 5BXFA 3RZWA 2OLDA 4PJBE 1I3GH 1CLYH 4P2OA 4OM1H 2WUBH 5T1MA 4YHIA 1KCSH 4HIXL 4PGEB 2EE3A 2RCSL 3NACH 1ZLUH 4YX2H 4Z7OE 4UILL 2R0KH 4EEEA 2QSTA 4DGVL 4XNZC 3KYNB 2XKSA 4LNRB 1EIBA 2WWKO 4L1DA 4UTBH 4HHAA 3PWPD 2NY5L 2GJZA 3AROA 2W65A 5K9OB 2HTKD 2WBJC 5ESAB 3UPAA 3S96A 5DQDH 1N64H 4OGAD 4XXDB 3FFCD 1TJGL 4ETQA 4YXHL 1F8TH 4PJHF 2C3VA 3IS0X 3ARBB 1NGXB 3T0EE 5DMIH 2MPAH 5ALCH 4P2OC 5D7LE 1MHEB 4X6FB 5BS0D 1U8JB 1QPXA 3OZ9L 5FHAH 3WFEH 3T09A 5HHMD 5FHBL 1F3JB 3C5ZA 4MAYD 4WI5A 3HN3A 1AD0B 1N2RB 4D9RE 2HRPL 1MFAH 1KN2L 1IEAA 5IJKC 4H1LA 5BCAA 5HGDA 1GH7A 1MIMH 1QYGL 5D72H 4Y5XB 3DX8B 1NAKL 3WD5L 6CGTA 5ILTH 2BY3A 4DJMA 1F6LL 4MQXD 1MAKA 2I24N 2OL3A 5INCA 3QQ3B 1P2CA 1NL0L 5IBUB 2BSED 2BNUB 1J1OL 3DRQA 3AVEA 4PJ5B 4AQOA 3GIVB 2M26A 1BGXH 2KKQA 4TVPH 3HC3L 3VI4E 1D5IL 2UYLA 3H3KA 5F7LB 3HNVH 4Z7NF 5FYJH 5I1JH 1QBLH 2VDRH 3T0VA 2ILLA 3QI9B 1C5DB 4XPHL 4MNQB 2FH6A 4B0MM 1JHKL 2CUIA 2P24A 1D5MA 2CLVB 4U6VH 1AGEB 4LASH 4NQCD 5E8PB 4N68A 4JPVL 5KW9H 3QIWB 3JV0A 5EBWA 4M6MH 1ZKAA 3BVNA 4MHHG 5ICXA 3QJHA 3WL9A 4LRNL 1IBGL 3BD3A 4YDKH 4OCXL 4YDIL 4OGXL 4PJHE 1UB5A 5LXGH 4OZHB 4EZMA 4GKSA 3WJLC 3HZMB 1RHHA 1MY7A 2VIRB 4M9PA 1H15B 3EDJA 3S34H 1EEZB 5ITFB 1X5GA 5IB5A 2CUHA 4JZNB 2BJML 1JBJA 3VFPB 2PKDA 3C60A 1X4ZA 4X6EB 1TZGL 5EFIB 4Z5RA 4Z18A 4IDJL 4XBGA 1B0RA 4LDLB 1YMMD 5D1ZB 1D5BA 3TCXA 4U2ZA 1FC1A 3IVKB 1DANT 1MREH 1J10A 4L8BA 2FSEA 3RHWF 4ZNEE 1IM3A 3P9MB 3SE8L 3SGKA 3KPSE 5DR5L 3MLXL 3DV4A 3VXRB 3KPLA 1KT2B 3VXME 4YGAB 3MRPB 4ZPVA 4UOW1 3BGFB 5JW3L 3BQUB 3G08A 4Q9QL 3R06A 4WIQA 1T1ZB 4K7PX 1YY8A 2GJ6B 1GGIL 1QOKA 4P4KB 4OLUH 4F7MB 2A6KB 3BH9B 4N8VG 5MEQA 1JYXA 1G9MH 3GJFB 4R4FL 5DJDA 1OSZB 2OTWB 4AIZB 4MD5B 1DQJB 2XQYK 3SDXB 2R0WL 1W72B 4MLIA 3CFIC 4X5XB 3ZKNC 3G6JF 5D2LB 3HTLX 1GPOL 1F3RB 3QFDB 3GHBL 3H42L 5ESVA 5DXWA 1JPSH 3BKMH 2ICCA 5GISL 5JORB 1A6ZB 1A22B 5TFSL 3U9PL 2HMID 1RD6A 4M62L 2P45B 4PJAA 3RPIA 3MLWH 3UEZA 2R2CA 1J8HD 2AJ3B 3UAJC 5HTSA 2X4SB 3V4VH 1R5VB 4TPRL 3VXPA 2CKBB 4HKJB 5FXCH 4RFOL 3BGMA 3D5OF 4OFYD 3P3YA 2BCKB 5EORL 1FL5A 3PL6C 1DN0A 5DA4A 4PJ5E 1KELH 1U6AL 5CCKL 4UQ3A 4WV1B 5F93C 3OXSA 4NPYB 4NQEE 4LSPL 3DXAE 3TYGH 5LGKA 4U4BA 2G5BA 1ADQL 2VWEE 4AMKH 1Q1JL 4YX2L 3PQYA 2IJ0C 4ZUVA 3L95B 4F9LA 4N5EC 5KVFH 1PQZA 4NM8H 1QLFA 4BQBA 3FT2B 4CDGC 4NO3A 3C6SA 1T2QH 2YD1A 1I3UA 2CIKA 3QUYD 4QF1B 1BOYA 5LGJB 4HS6B 5DZLA 5GGTH 4J2XA 2W1NA 5CD5C 4WU7B 4IRZL 1AXTL 2H8PA 3BPNC 3TBSB 5D6CA 4TSAH 1AC6A 1T4KA 1Q9LA 4XVUC 2CSPA 1ONQB 4Z7UF 1GGBH 1I9JH 4KHXH 1XGQA 1FVDB 4NC2B 4RMRA 5DRNB 1YEJL 3LV3B 5M94B 4BH8A 4Q7DA 5CP3A 5DEFB 1RZGB 2NR6C 3SCMD 1NCBL 1YEHH 1R3KA 4TSCH 4RISL 2I9LA 1G7HB 3SDAB 2FZ3B 4FNLH 1MFAL 1QZ1A 3PXJA 1UWEL 3QDGD 4UUJB 4CVZB 3MYJB 4PGEA 4KQ3L 1UACH 1JWUB 3TVMA 3KPSB 1MIML 4X6EA 4PUBH 1QFWH 2IANB 4XCEB 1NCDH 5SWSB 1QFOA 4ZTOH 2OZ4A 1NBYA 4XC1L 1T80A 3TBWB 4HHAB 4RNRA 3CD4A 4YDLB 3BPCA 2W65B 5K9OA 4BZ1L 3L3DA 3T2PA 5D2NC 3HHRB 5DEZA 5DVLA 4Y4KA 3ARDA 2DKUA 2EECA 4MQSB 3DLQR 2IALB 1I1AB 1JHTB 4UV7H 1N59B 5I2IB 3C08H 4N8CH 3HNTL 5C0AB 3BJ91 4XNQA 2HKHL 1DEEA 4OQTL 4QHNB 2BVUA 4XPHH 3S97C 3BPLB 2DQJH 1FGVH 1QSFB 4FFWC 4NKIL 1WICA 5KAQG 5IFHL 1M6OB 5HDQH 3BGAA 4RFNB 3HI1A 2BERA 1CD1A 5KW9L 2K1MA 3GHEL 2CPCA 3ARPA 4KAQL 3D85A 2P5EA 5D7LD 4F7CB 1E6OH 1FG2B 5T3ZL 4OD2A 4LRNH 1MLCA 5F71A 3PJSA 3TC9A 4CJ1A 4TTDD 2XPGB 2VLKA 5EZOL 2WP3O 1EK3A 4S1QH 5DRWB 5ESVB 3S34L 4H25A 1U8NB 2ZUWA 4KMTH 1G7JA 5C08A 4KQ4H 5DJZB 1UJTA 3WIHA 1SJXA 3G6DL 1IQWH 5EZJA 2DLTA 3TM6A 3HPJB 2JF1A 1G0YR 1CF8H 3NABH 4MWFB 5CWSB 4QNPE 1I4FA 5E9DB 3OKMA 3MYZA 5IIEA 3JVGC 3MODH 4NQTA 1CDIA 4WDIB 3OTTA 4BSWB 5IB2B 5F9AC 5KSVA 2BVTA 1RIHL 4ZUSA 2R0KL 5C3TA 2AGJL 4XPTH 4OFVA 5CP7B 3FB5B 4X7SH 4JZJB 3LOWA 5SX5K 2Y72A 4P2QB 2EDTA 1ND0A 3ULUD 4JM2B 5CIPH 5C0JA 2NY6C 4R2GD 4EN3B 3VD3A 1AR2A 2GT9A 1RJYB 3WLBB 3AFLA 5J9PA 3GO1H 5E2TH 4IS6B 1BVKB 4HIHA 3SDDD 3MV8E 4HMCA 2AK4A 2UUDH 3OJMB 3W82A 2IH1B 5J0BA 1NAMB 4CMHB 3ZDYF 2J1KA 1UENA 4U1SA 4MXVE 3BKYL 1TQCB 3FO2B 2PTVA 5I15L 1WFTA 1FVCB 4JQVA 5D96B 1A7NH 5FIEA 3JV6A 1K85A 1KTDA 2AV7B 2IAMA 2ZJSH 2R8SH 1KJVB 4UOW0 4OI8A 2Q87A 1EO8L 5GGUA 2ADJA 4QYOA 3C9NA 1DQLH 1I85A 2O93L 2UZYB 4XZUB 4WO4B 4KJQC 3IAPA 1QSEA 1TZHA 4HQQH 4DUVA 5JIPA 4FQXD 2DQDH 4P49A 2MQ3A 3SDDC 5I1HL 4PJBB 3RPKA 3MA9H 1I85C 3QCTH 2PYFB 4WJ5A 3LCYA 1HQRB 1LQSR 2YD3A 3AM8C 3HC3H 5IBTL 3BMVA 5B4MD 3KVQA 3L7EA 2VMFA 3T0AA 3D2UB 5IWLA 2IH3A 3X12A 4UIKH 3SJVD 2ZG1A 5C0DB 1KACB 5D2LA 1DUZB 2I9TB 5DFVD 4EI5B 1AXIB 2XWJB 4X4ZA 3A6BL 2CK0L 3HNSL 3O9WA 5JQ6L 5LWYH 4U3HA 2ITCA 1FGNL 1OP5K 2VLJD 3FRUB 4XP6L 1J1PH 1OTUD 4JRYA 3ARFD 3FB8B 4HWEL 4OIAA 5AZEL 2H9GA 2XZAL 1JK8A 3C6LB 3RX5A 3VW3H 4X9HA 2PXYA 4BYHA 1BD2A 3T0ED 1MCRA 1R5WB 2BJMH 5KVEH 3PE9A 3MLSL 4MVBC 3L3OB 5EU3A 5TDNA 5D1ZD 4OFYA 4XI5C 4LLVA 2QADC 4HIJB 5F9WB 2OTUA 3EO0B 4UAOB 1ZVSB 3O3DA 1EX0A 2G75B 2M2DA 1F4YH 5IV2A 4OKVA 4LARH 5JUEL 1D5XA 1C16B 4Z95H 2MHAA 3QUMA 1C5BH 4HWBH 4LSUL 1J12A 3H9SD 5D93C 3FT2A 4GRWB 2OJZL 1WFNA 2KDGA 2YKLL 4FXKB 4NO3B 3T1FA 4Q74A 1BJ1J 2Z91A 1YC8A 1P5VA 4XXCC 2MCPL 3SY0A 1WSST 2WW8A 4RGOL 1V7ML 4XNUL 3FFDA 5HI4D 3VD9A 4RA3A 2ADIA 3O9WD 5B8CB 4EBQH 3L6FA 5D5ME 4RDQF 3ULVD 4CAGA 4OV5B 3BESR 4MXVF 1KOAA 5IFAH 3TO4D 4MVBD 2IMNA 5C92A 3QB7C 1XGQB 3RWCA 4PJXF 1KXTB 2X4NA 4MNQD 2RB8A 1FCGA 4KKAD 3I50H 5HY9B 2XIDA 2FGWH 3V8OA 4WHTA 1V3JA 2VAAA 1I1RA 1GPOH 4K8RH 3ARGB 3SDAA 3P2TA 4HWZA 3HZYB 3FAXA 3LEVH 3P4LA 7FABH 5T3ZH 4ETYA 2DQHH 5C07D 4Q9RH 4I48B 1PKQB 2ZUVA 4KVNL 4Y8AA 1FFPA 4EDWH 2VXVH 2BNQE 1DL7H 2R1YA 1J18A 4NN5B 4M7ZB 3I02B 1FDLH 3WIIH 1QKZL 1OTUC 4HEME 3TIDA 3MLZL 4PRDA 1KTDB 5ANME 2EDEA 3HE7B 2R29H 5JXAL 3J7HA 1TVDA 4NBZB 3R0NA 3PHQA 2VDQL 5EN2B 3KPNA 5BQ7B 1IQWL 2EYTA 4FTVE 3BP7A 3EOAB 4JFED 4HK0A 1AQKH 4BFIB 5CUSH 5INDB 4IMKA 1FO0B 1RJZA 3Q0HA 4TSBH 5TQ0H 5KTEL 3KLDA 1AJ7H 3HPLB 1J8HA 4NQDA 2DICA 5F96H 2FX8L 3NACL 5BV7B 5KVFL 4MNHA 2R2EB 3WMSA 3RKDD 2C1OB 1IAMA 3IDXH 1MQ8A 3BUYB 4HV8A 3IDJA 4N0YL 5DWUH 3OXRB 1MFCH 2D7OA 5L2KE 1DVFB 4GG6A 1D5ZB 1ROWA 4QHUB 3VFNB 3I3BA 1TJIL 3NGBC 3WNKA 5CIPB 1CFQB 4EDXB 3MREA 3QO0A 5EC1B 4JDZB 1R3LB 1FFOA 2DIAA 2HN7A 5C0GB 3PWUA 2DM4A 1OPGH 4WEBH 3TIEB 1HKFA 3TO4C 3PP3K 1CG9A 3CDCA 4WNQB 3B43A 3QA3A 4JPIA 1NCWL 3I6KA 4LMQE 4JKMA 3EZJB 4ODVH 3QH3B 2VLRE 1J86A 4C57C 3OL2A 1CU4H 3QFJD 4JFXA 3RBGA 3KNBA 5DD0H 4ZTOL 4H5SB 4L9DA 5FA4A 1KB5A 5CP7A 1QYGH 3TO2B 2D9CA 5FYJU 4CGTA 4NQDD 3IFPB 1A1OA 3U1SH 2OZ4L 1YNTB 2G75A 1OOAA 3OR6A 5I19L 1DE4B 5MENB 1DDHA 1PEZA 4P5TA 4NKOB 4PLJD 3IKCB 2GT9B 2D4DA 3T3MF 3UO1H 3TN0A 4L4VB 1BZQK 2I5YH 4RQQA 5CKGA 4M9OA 4QRRA 4CADB 1JCKA 4Z7WB 3M8OL 2DQJL 3TVMD 4QHMB 4OZ4A 1UCBL 3DX6B 1T04B 3OAYH 3V5DB 1JNJA 3RWGB 2WMPA 3NZHL 2OI9B 5IESL 1TQBB 4CN6A 4LPVA 1NCAL 2XWTA 5MI0B 3KS0J 3MUHL 4NRYA 4P46B 1B9ZA 3UROR 3OR7B 5DGRA 4XNMB 3BSZH 3GI8L 1AO7D 3FTGA 5F3BA 3VFRA 2DIBA 4HWEH 4DTGL 2GW5A 4Y5XA 5EZOH 2FD6H 4FG6C 3IJHB 3VXOB 5DDHA 1HSBB 3HB3D 4DEPB 3B2VH 4I1NB 1MUJB 2ED8A 2FO4B 5F9JB 3LMJL 3U0WH 3MV7B 5ETUB 1D6EA 1FZJA 5DLML 3MNZA 4YZFE 2BSRB 4S1SL 3KHOA 4LPWA 1NEZB 1PAMA 3OQ3B 4NGHH 4PLKD 2IBZY 3O41B 3TFKC 4U3XA 3V0AC 3IFLL 3RL2B 5C9KA 4I2XE 3ARTA 3MODL 4MNQA 5FF6B 2QHLA 4M3JA 1RZ8B 3V5HB 3LKQB 3E6FA 5BV7C 2HG5B 5SWZD 1UM4L 4M7ZC 1ZEAL 5EBMA 1IAOB 2Y6SC 1TFHA 1JGLL 2N7AA 2EDXA 3VGDA 3GSQB 3QIBA 4YFEA 4F33B 2H2PC 2FGZA 4O51B 4HCRL 4JFDD 4GKSB 1E4JA 3S36H 5HYJD 3HG1E 2R1WB 3BH8A 4Q2ZB 4XHJC 5J8OA 4JVPA 4JFPA 4KJYA 4NWTL 4OLUL 2A0LD 3WNNA 4XGZB 1G9ML 7CGTA 3TBVB 4GLRH 3DYPA 3BKYH 4LCWA 4LPCA 4PP2A 2FJFB 4ODUA 4S2SA 2DB8A 5IP4A 3QUZB 5J13B 7FABL 1D5BB 3TVMC 2OTUB 1OGAB 4QY8B 3LS5H 1HHKB 2CDGB 2CIIA 3JZ7A 2R8SL 1T5XA 5E6ZA 3V6FA 1H3TA 5DJ0B 5CD5D 4P5KA 3RDTD 2PTUA 4HDIA 4ONGL 1RUPL 1L0XA 1KEGL 1KN4H 1U8IB 5AEAA 3GMQA 5DF0A 3CK0L 5SX4H 5EOTB 5E08H 1VGKA 4UINL 1WV7T 3SN6N 3S88H 2B0SH 5C70A 1EEQA 1YUHA 2CKBH 4HKXB 1VA9A 1R3IH 4BQ9A 1SVZA 3QAZB 1I7TA 3MA9L 1DQML 5DRZB 4M5ZL 2AEPH 2XZQH 1V7NL 4RFEB 32C2A 5JQHC 4OCWL 5IGXH 3R0MA 1PZ5A 4S0TD 1J0JA 2NZ9D 5JXED 4FQCL 4HBCH 3BDYH 2VUOA 5IMKB 4RBPK 2BZDA 2NY7L 5T3ZD 1BIIB 3WS3A 1U8OB 3L3IA 5ISZA 3F7VA 3PNWB 4UDUA 5FO7B 4CADA 4K7PY 1X4YA 1UADC 3O4LA 5ICZB 4NM8L 4Z7WA 4I48A 1FGNH 4LP4A 1DBML 4DFIA 4FZ8H 3U7WH 4UNVA 1G7IA 1XIWD 3V4UH 5JR1H 1TJIH 5J6HA 2GTWB 2AK1H 1HZHH 5GGTL 2GSIB 2APWA 3JTSB 3MRIB 4GAGL 2FX9H 5E5UB 4YFLI 2B5IC 4JO1L 3ZHDA 3CH1A 5JDSB 1A3RL 2XKUA 3MBXH 5EOCL 2H2PD 1J88A 3LSOA 5TE6H 3X3GH 5I1DA 1G6RL 3RZCB 5GSRB 2NY0B 4HC1L 3BQUC 4V1DB 1RUKH 3B9VA 3D18A 2C5DC 3SQOH 2G5BB 4APQB 4KK5C 4G8EA 5E70A 1IEHA 4WI4A 4FNLL 4C56B 3PGDA 1ZSDB 4NKQB 1A64A 4K3JL 3T77B 3R4DA 1DBKH 4L4JA 1QFWL 3NA9H 3GNMH 2X44D 1BD2D 3ZHKA 5T5FL 3RDTC 3VDAA 2IPUG 4RDQG 4I3SL 4PV8A 5KSBB 1T7ZA 4Q58C 4EBQL 1FVEA 1Z6JT 2AJVH 4WFED 3BP4B 3WXWH 1MI5D 1F90L 15C8H 4X4ME 4PJ9A 5IOPA 3ILQC 4JY6A 4GG8B 1H8OA 5GQBA 3VRLF 1IEBB 5J06A 1U0QA 1FVDA 4JRXD 3M8OH 3LIZH 4OF6A 1Q0YL 2UUDK 1ZLSH 4F58L 4HZLA 4KK5D 5KSAD 2YS4A 4OLZL 4JPIB 5E6YA 1L0YA 1FNFA 3V52L 1SY6L 4ZXBA 1CVSC 2NZ9C 3MLUH 5B3NA 3MOAH 3Q6FB 1DBBH 1NEZG 4L8SC 3EFDL 3BXNB 3NPSC 1CGVA 5IQ7H 4LPTA 4XPGH 1O5DT 4YH6A 1FNSH 1RJCA 4W4OA 1P4LA 4H0GA 5CZXC 3UBXI 2LU4A 3BPOC 5L8LB 4JDVB 4OQ1A 1MJJB 3VFSB 5IKCB 3ZTNH 1U8PB 2FJHB 2ADGB 5FYKE 2YPVH 2VZUA 2Q20A 3O8XA 4PGDA 1IZKA 1IL1A 2HAZA 3V6ZA 4JFZL 3WL9B 3L7FB 5DMYA 1CFSB 1JFQL 2R2HB 4K7PL 1DTUA 4MCYB 1M6OA 3EYFB 4NFDA 2P8MA 5K9KB 4E42A 3I3DA 1MRDL 1A1NB 1WK0A 1WIUA 4RFEA 4DFHA 3K4ZA 5IQ9A 1ZEAH 4RGND 4LU5L 2J8UB 2X4TB 5C0BE 1ZHLB 1MH5B 4U6HA 5FKAA 4DCQA 3HZVB 4ZD3H 4PS4L 4XB7A 4ZNCD 4MJ2A 2VYRE 1M4KA 1YN7B 2BNRA 1CXKA 1NMCB 5GGQH 1WCQA 2PUQT 2NXYD 4HH8A 2B1HL 2VR9A 2YMXH 4ODBD 5CEZL 2G9HA 1OAQL 3MROB 4Y16B 1WGOA 1JGVH 1KCRL 4PREB 5KANI 4Y7MA 4PJHA 4X0KB 5H8DA 4QRPB 2Z4QB 2A77L 4OJFH 4X6DA 4XCNB 4YE4L 2V7HA 5DFVC 2YPKB 4JR9L 3QNZB 1FCCA 1T66D 3QEQE 4MAYC 4ZPTA 1CQKA 4OLVL 5HHPA 4M8QA 2AI0H 4CU6A 1QTYT 2LU7A 1IGJA 1OW0C 3ZYIA 4PFEA 1U3YA 5ENWB 3IDGA 4UBDD 5T1DL 4LL9A 3TZVA 1FN4A 4JLRA 4DK6A 3C60C 1YQ2A 2IADA 3MRBA 5E08L 1T5WB 5C0FB 4HXBL 5FOBA 4NDMB 4PGZA 1RK1A 3LKNB 4PG2C 1N5YL 4X5XA 5ALBL 1FBIH 2X4PA 2E8YA 4QRSB 2B4CH 5I1HH 2XWBA 3DURA 5J6GA 4K7FB 4XCYB 3FOMB 1NMBL 1YEGL 2J8OA 2I60H 2R9HD 4Y5VC 5C2BH 3CPLB 1MI5A 3DUSB 4G6FD 3QEGL 1FRGH 3TN0D 2A6JA 3EBAA 3VRJB 4R7DB 1RZKC 3QIUB 4TUOA 4DZBB 1KIRB 1D3CA 1RZ7L 3VH8B 5CEZD 5GHWL 1S5IH 2C3XA 2MOVA 4QRUB 4Q6IA 1RZFL 4F2MA 1JPGB 2E7BA 3UTSB 2P5WD 4AEHH 2C3HA 1WC7A 4OZIB 3C8HA 2YZ1A 3SGEI 5GS0C 5JQ6H 1T5XB 3W9EB 4XBPB 5JIIA 1UXWB 5IVXB 3MRDB 3MFFB 3I2CH 3KG5A 2V9RA 5C09B 4NPYA 3MACH 1ED3B 1MVFA 3T2NL 1U8MA 1C12A 1X44A 3QT2A 4XMLH 3RGVB 3B2VL 35C8H 5GRVL 3TA3B 4YBLB 4G7YH 4M1GH 1VFAB 2QLVB 2IGFL 3MRFA 2QQKL 2ORBH 2RAMA 1A4KB 2YPLB 3C5JA 1CFNA 1CD8A 1G0DA 3QEHB 2CJUH 4YHKH 4HC1H 4PRBA 4S1SH 1HHGA 2ZCKH 5J1AA 3D0LA 1XF2B 2GJZB 3SCMC 4XPAL 4FMKA 4ZAKA 5IG7B 4DEPC 4WFGE 3EIFA 3IFLH 3GMOB 1HN1A 1ZT1B 4OI7A 3HMXL 1NANI 3B5GA 3C8KB 4G7VL 5IKCA 5L2JA 4OZGB 2IH3B 5IB4A 3OJVC 2FEDC 1P5UA 1XGRA 3V6OE 1F00I 4K9EL 3QZWG 3TF7C 2GYSA 2VO5A 3JSSA 3SPVB 5JUEH 1UQSB 1NEUA 1YNKL 1LP9A 1H5BA 1QFPA 4UQ2B 4DKEL 2A83A 5C0RH 3GBNH 2O5YH 1MAML 4HPOH 3VG0L 3FRUA 1MNUL 3FZUD 4J7RA 1R3KB 1BFSA 1ZVYA 4EI5D 4N5UA 4F7TA 3G04B 5H35A 1S8DB 1VKXA 3CMOL 1JUFA 3N06B 4Y16C 2YD5A 1MFNA 4NWTH 2VDMH 2YWZA 5I1DB 3TCLB 1IARB 4G6MH 4WHDA 5A2LH 1G7QB 1EZVX 4KC3B 2QSCL 4YHNB 1HKLH 4UILH 2OMBA 4DVBB 2FEDD 4JM2F 3V52H 3OKNA 3F7YB 2VR5A 3MRRA 2C3GA 1X9QA 4PREA 3MOAL 5E7BA 4QRPA 3LN5B 2CDEB 3CLEL 1JHTA 2E7HA 3QIBC 2HMIC 1N64L 5E00A 3MCLH 2D03H 1KF9B 4TTDC 3E1F1 3CK0H 3IDIB 4QWWD 3BO8A 3QUZC 3RWHA 2ATPA 4UINH 4AY0A 1G6RB 3MQIA 2X7LB 4HWBA 1GRWA 4XP1H 5J3HD 2XG5A 3DXAD 4HFWB 1DCLA 1T0NA 3JWDC 2YPVL 4K3HA 1S9XB 1J0HA 2O5XL 2O26U 5J12C 2E7LA 3FB7A 3ARDD 1OP9A 3C6LC 1TTUA 5ICXB 3KPOA 5L2KB 3BVNB 4OT1H 4RFNC 2OCFD 4DN4L 3EKCA 1VEMA 2FX8H 1TVHA 1CGUA 1RURH 5LJYH 4MQ7A 5D72L 5T1LD 5EB9A 2HFFB 4OM0H 5DSCB 5D1XD 5DJZA 4BQCA 4PS4H 5SX4I 2AABL 1IZJA 4GW1B 1U91B 5D7SH 3V4UL 5D7LA 5JR1L 1AGFB 5GGQL 2GHWB 3WUWB 4X98A 5JW5B 3ARXA 1TDQA 3TT1H 4M61A 1HNFA 5HI3C 1BFOA 1UVQB 5IIEB 5F9OL 4BSWA 4MJ5A 2XA3A 3EAKA 3MRQA 3NCYS 3CFJB 4WU5A 1U3HA 3OGCB 5FYJL 1IGIH 2A77H 5FGBA 1C5CL 1DQQB 4QOKB 3FO1B 1BJ1H 4KTEL 4WW2C 2EYTB 2OX5A 4X4YB 1IC7L 3HRZB 1A5FL 4ELKA 4JAMA 2CRYA 4HFUL 1Y6NR 5DD1H 5J11C 4ZYKB 3B8SA 2PETA 4EN3A 5J4MA 2PO6C 5DJ6A 5FUCC 3EGSA 4E42B 3NA9L 1RJLB 3RIFK 3JVGA 1GZQA 4TNWF 4TUJA 5IB3B 3CDFA 4HUWA 4HSQA 3QDMD 1NMCC 1W72A 1H5BC 3HKFA 3TNNB 2JLLA 3MUGB 5CJ5A 3HE6B 4KROB 3VXQA 4W6YB 5F7FA 2VDPH 4X83A 4KK9D 1I3VA 5C2BL 1T89C 1HK6A 1FFQA 2FB4L 3EYQD 3U36A 5C0BB 3QRGH 3TPUA 1BQHG 5EU4A 4KKNA 2JJUA 2PNDA 5SWZB 1U3ZA 3OJ2C 5ACZB 5EO1B 3UTSD 5LQBH 1S7WA 3RKPA 2OR9L 4YDJA 5CZVH 4RX4A 3UPRA 4P2CG 1G0XA 1URLA 3KAAA 1QRND 2N7BA 3F7QA 4YQXH 2X42A 2IAMD 2Z8SA 2NY2B 4YWGL 3QXDB 3QCUH 3V6OA 1JZ4A 2IAND 4P9HH 1H8SA 1T0PB 1HINL 1U8LB 4Z77A 1I8MA 5HHNB 1KV3A 3WBDA 1OTTC 2F53B 2N4IA 1QLFB 3EYSH 5C09E 3WDJA 4JQXA 3ALXA 2FR4A 2QADD 3QDGE 1SJEB 1RQ5A 5BRZE 1NBVH 1KB9K 1U8HA 4TUOB 4Y4FD 2CIKB 2PYEA 4YHLH 4NNPL 2EC8A 3BDXA 4I5BA 2K3TA 5IBLD 3D69A 5IM7B 2ICES 1MRDH 3VXNA 1L9MA 3TPKA 4P46A 1NDMB 5KVMC 1I7ZB 3UTPE 3Q3GB 4O2FB 3KGRA 3ULVL 4PJAE 4L3ED 1Q9OA 1S9VA 3ESUF 1HYSD 1PFCA 3EO0A 2QQQA 4M4RA 5AG9A 3CMOH 3DJ9A 4UUJA 4CL7A 3AY4A 5DSCA 1QLEL 5HDBE 1DQTA 3CZFB 3PWJB 4G6ML 4IOIB 3RTQD 2IANA 1GZPA 1J0YA 1FC2D 3DPBA 4I0PC 3OKDA 2OP4L 4ZXBC 3OAZK 1CQYA 1QHPA 1AKJA 3DV6B 4M1DL 3LD8B 5F89B 2YPLD 1NLDH 3QI9A 2AS5M 3L5WA 2P24B 4WI6A 3QEQB 1ZA3B 1XGRB 3HCVB 4I0PA 3LQAC 1HCFX 3ARQA 4V1DE 3DNKA 3GRWL 4GSDH 1AXTH 4FABL 2IALA 1MRFH 3ZZ1A 2Q6WA 4J3XA 5I2IA 5IMOA 1HILA 1XF5A 4O02H 4O51A 1VB9A 2VIRA 1A3LH 4IHOB 3P4NA 1CE6B 1MCWW 1UWGL 5JZ7D 1AFVL 2VN7A 1DQMH 2UWEF 4F7CA 5KG9B 1PKQA 1JUFB 5DVKA 3OKLB 2JJSA 3JXAA 2EDOA 1MLCB 3WKNA 2ENYA 4QXGL 3EO1A 1UWEH 4UOJA 4HGWA 1MCIA 1S7XB 5KJRL 1RZ7H 1IC5L 3T2QA 3M07A 4YHNA 2FJFA 3G6JE 5JA9A 2KH2B 1M7DA 1KNOB 1I1YA 1S3KL 4G6AD 5DS8B 3FMGL 3PWNA 3C5SA 3VA2C 4EVNB 5TGBA 1LE9B 1S5HA 3L1OH 4OM0L 2CIIB 4L8BB 2GTZB 1CFTB 1KC5H 5DJ0A 2OI9C 4PTUA 2VXTH 5I16B 5IHUL 1CLOL 2DQUH 1OTSC 1Q9WB 1T6VN 2F5BL 3MACL 3F5WB 4P2OD 2CUMA 3TT1L 4OLWL 4MWFA 3MJ8A 2PF6A 3P0VH 1A6UL 1DQDH 5E9DA 2XXCB 3G5VB 3V5KB 1UFUA 1HI6B 1PVHA 2J88H 3CLFL 2DMCA 5CWSA 1HYSC 1YDPA 5HVFB 1CIDA 4WVRA 3QO1B 5I73B 2A6KA 3AM8A 4MJID 4ZUUA 1TCRB 5ELIA 1OSZA 1OD7A 4OF3A 2G5RA 3AREA 4WI9A 4G7VH 1T2XA 4JZJA 1OQXA 1U2CA 4P3DA 4BZ2L 4EI6A 1OP5H 3SGKC 3VE0A 2GITB 4GW5A 1UJ3C 4JM2A 1XR8B 1I7RB 4NNYB 3TV3H 3KDMB 4GMSL 1T03H 3TESA 1YNKH 2FHCA 4EJ1C 2KZ1B 1FL3A 1MJ7L 4OGAC 1MIEH 4GH7B 5DTFA 3THML 5E5MA 5EUOB 1MNUH 3P0GB 4DUXA 1MWAH 1XZ0B 4KK6C 3PDDA 3B8YA 5J6HB 2GSIA 3JTSA 3MRIA 1NH6A 3U9UA 3S4SG 1FL5B 5CSGA 4KKCD 4PJCF 4YPGB 4FZEL 5FO8A 1I1CA 1KJVA 4JFXB 4ODTL 3QRGL 5TF1L 3ZKXB 2FECL 3EZ8A 1CF8L 1JV5B 4ZTPL 5JOPE 2ZNXA 3MV9A 4GG6F 1LEKB 1U58A 3LRSA 4ZOCA 4QNPF 4KK8C 4RGNB 5E8OB 1NC2D 1AC0A 3C87A 4G8EB 2XY2A 4JFOA 4YFDB 3QDMB 1KIQB 2BY1A 1CXFA 4NRZA 4G6AC 4DKFH 4GS7B 5FYLL 1BWWA 4P5TC 2NXYC 2VLLA 2YRPA 3RNKB 2VKWA 1OQOA 4CU7A 4Y4HA 2LE9A 5D8JH 3CSBA 1HQRA 2BOBB 3QIWC 1GZQB 3LS4H 1F11B 1MCPL 3FQXA 2ICWI 3FAWA 4PBVC 4MB4A 2H8PB 3H9YA 2HVJA 3V2AR 1E4XL 3EJZC 5TDOB 3D9AL 3B6SA 3U83A 2B4CC 1FNGB 5L0QB 3OAYK 5F88B 1GJIA 3EOTL 5MI0C 3CXHJ 2H45A 5J7CC 1VSCA 4OD1L 3ME0A 1RIUH 2OR8A 2AEWA 1IEBA 1T1YA 4PLKC 3EOBA 1WT5C 3UTZA 4RRPG 4D8PB 1XF5B 3P73B 4P4RA 2DWEB 1JFQH 5I8OH 2HLAB 1NGQL 1KFAH 2H9GB 3ALPA 3D3VB 2ZJSL 4QXWA 3VXOA 4JM2C 4JQIL 1M05B 2Y5TB 1KPUB 5L88L 5ANMA 3MLRL 3KWWB 2ZUYA 5D2NE 3MV9D 3FFCB 1RZJL 2ERJB 4U1NB 3RKDC 1JWSB 5D1XB 3ULVH 2AK4E 3EYVB 1P1ZB 2EH7L 4ZD3L 3WFCL 2VLME 4L4VE 4HUNB 2CXKA 1AHWA 5ERWA 2HLFD 1TNNA 2DM7A 3QCTL 5MEOB 2Z92A 3M1BA 1NUDA 2VISA 4KK6D 4PBXA 3RY6A 1MCNA 2VJXA 2GTZA 5ECJE 5I16A 1AGCB 1QFHA 5HHNA 3NCCB 4ODXB 2EC9T 4PD4K 2F53A 2BNUA 2A6IB 1CBVL 3ZMRA 1DUYB 3T4AA 2YWYA 3MBEA 1A5FH 4JREC 4K55A 3VFWA 2R2HA 4YEEA 1K3IA 3HI1B 1YMMA 4F7PA 4MX7A 5HHOD 3V0VA 3IAQA 4KY1L 3VGAC 4N9GA 4Z7UE 5IROC 1A7PL 2QQLH 3GRWH 4GSDL 1EZVY 2ICWA 3R8QA 4G9DA 2NX5D 5IJVA 3CFDA 5DHYA 2ZG3A 3VW3L 1GGCH 3HZVA 2EE2A 3VD7A 2X1OA 1J05A 1U3HD 4HXBH 3VE0B 2WAHA 1A3LL 5JLZA 3CVHL 4HUXB 2IQ9H 4ISVA 3O3EA 3I75B 1FBIL 4OI9A 2GEEA 2QSQA 2ZOLA 5J13C 1M71B 4U1JB 2Z0BA 2Y06H 3DO7A 4M93B 1NMBH 1UWXK 1XIWB 4N5ED 3QULA 3QSKB 4X9GA 4B50A 2NY4B 3QDJA 4ENED 4LPUA 1K4CA 3X3FL 3DUUB 1AKJB 3DV6A 3TIDB 3B83A 2WANA 4BA8A 1CVRA 3QUYC 5DK0A 1V3KA 1MFDH 2OJZH 3CDGA 2VZSA 1KCKA 3NTCH 3CC5A 3BEVB 2RR3A 3CCHB 5FAAA 5I0ZA 1WAAE 4I18C 2FIRT 4YHYB 3UDWA 3ULVF 4X4MA 3UBXB 2FSEB 4PRPE 4HPYL 2VLMD 4L4VD 4TVPE 5INDA 5FUCE 1A6UH 4PRIE 4X6DE 5IFAL 2EIDA 4R96A 3EOAA 3T2NH 3G5ZB 4IIQA 3GB7B 4D2NA 1NANH 2YD9A 4ZG1A 5IF0B 1T20A 1T83C 2DQFB 5ID1A 3BZFA 2WIMA 3NH7L 4WCYH 3BFOA 2YXFA 1MHHA 1B2WL 1X7QB 2W0LA 5CFHA 3R06B 5DUMH 2IH1A 2W92A 3EYSL 5DHVA 4X9IA 1E6JL 4M6NH 1N3NB 2BNQB 4M02A 4BK5A 2O61A 4ENEC 1K8IA 3K4DA 2BSTB 1CR9H 1T6WA 3CU1A 2XTLA 3ABZA 4U6YB 5BZWA 1YJDL 1IGCL 1QR4A 5BOZG 3S5LA 1ZE3C 4KVNH 4BH7A 1FNGA 3IJSB 1ZTXH 1I1YB 1R3LA 2HN7B 1QEWB 4TNVK 1U8QB 3S36X 4HWUA 4ZFOB 4DKEH 5C0RL 3HMWH 1FFOB 3K2UH 4NO0A 3NFPA 4NNXB 4WUUE 3BZEB 5HYQA 4WO4A 4CMMB 4DAGL 3K46A 1GSMA 3DVIA 3QWOB 1X5IA 2MWCA 3VXPB 3ROOA 4CU8A 2CKBA 1C12B 1U3HC 4HGKC 4NKMA 1CLYL 1ETZA 2EH8H 5HVWA 2DQEL 5JDJA 4HIXH 4OLEA 2A0LC 1QSFD 2Z93B 5KVDH 4JB9H 5ERWB 1AJ7L 4XAKE 5MEOA 5KSAC 5BS0A 2RFXB 1HIMH 1EEUA 2VDKH 4E5XB 3IXAB 2FIKB 4UT7H 3NIFF 4N0YH 4QRTB 4C58B 2WBWB 3N1MC 4Y19E 4EI5A 1GGUA 2XRAL 4J8RA 3UDWC 3W0WD 3O2DA 4LGPB 4Y4FA 2VSCA 4Z6AT 4LHQB 3VFOB 2NMSA 3L3HB 3LDBB 3STZA 2FATH 4LSSH 2A9NL 4XRCA 1UH3A 3VWJC 4QHMA 5ALCL 3MSPA 1O0VA 3BIKB 5JW4R 1NCCH 2JELH 4MQTB 3GSXA 2UZIL 1KBGL 4YBLC 3MUZ1 4P2OB 4X99B 1T89A 4YNYB 5E5RB 3WFEL 1I8KB 1IGTB 4OD1H 1AFVH 1VEOA 5JHDA 3GMLA 2L7JA 5C7XH 1Q9LB 2GFBA 1OWRM 5EPMA 1CICC 1ONQA 1A7OH 1NGQH 4G8GE 4WWKB 2DBJA 4EXKA 4GS7C 3B3IA 1O7VA 3MV9B 1A4JA 3OAZH 3IJHA 4EUPA 4U1HB 4HWNA 3FQTA 5ESAA 3LB6D 3FMGH 4XXDA 2RJMA 4R2GC 1D5XB 4MCZA 3MNZB 4RGNC 4HG4K 1KLGB 2DRUA 1DFBH 5MP6H 1JWUA 3D0VA 5EA0H 4KGLA 4OSUL 4N0FA 3QG7H 5F1OB 2X41A 4K71C 3KYMB 2FWOB 1KCUL 1FNLA 3N9GL 2VLKD 4TVPL 1KGCD 5L8JB 2I5YL 3L6FB 3Q6GH 3V7AG 4KZEL 5BZDB 4JN1L 5D70H 3NIDF 2P43B 5FF6A 1A1NA 1JHKH 5I8CA 1FLRH 1OARL 1Q0XH 4XP5L 3G6AB 1NUFA 4N0CC 4GJTB 4L8CB 4QHKJ 1KJ3H 1DANU 4IIQB 4BELD 4LASL 1NPUA 2I25N 1TITA 3KPMB 1LEIA 3GSVA 3S6CA 3P73A 1QO3B 3H9SA 1I8LA 4J4PA 4RAHA 4H8WH 5D2LF 3HC0A 3MLPA 1RULH 1IBGH 3SDDA 2UZXB 1OAUH 4YLQT 1FYTE 4LVNB 4JFPB 4PJ9C 4HH9B 4G8IB 5B38B 1P2CB 2EE6A 3CVIL 4F37K 1MIEL 1WUNT 2NY6D 2YA2A 4LHUB 1HSAA 1MWAL 3LMJH 1JWMB 4Z7VB 4E0RB 3O81A 4JZJC 4ODUB 4QGYA 2B2XL 1VHPA 1J1XH 3VWJD 1YPZB 4L3EB 1ZT4A 4YO0A 4MJ5B 1I8LC 3PHQB 2IPKB 5EN2A 1WBZA 1T21B 1UB6A 4FOMA 4NQDE 1DQQA 4QOKA 4ELME 3ILQD 1BM3H 5D7JC 3X3FH 1FN4B 2EEBA 3RTQB 2MJWA 2DMBA 5DURD 3T4AB 1T5WA 2DM3A 5C0FA 4CBPA 1MJ8L 3SKNA 1R6VA 4Q97A 3SE8H 1CGSH 3SOBL 3DBXA 4OFIA 4PJCE 3QR2A 1JGEB 5EOTA 1UB5B 4ELMB 4C4KT 3TH3T 5DJ6B 3EFFA 2BK8A 1YMMB 1JGLH 3OSKA 1PGRB 2C1OA 3EGSB 3BUYA 4HV8B 2YBRB 4HPYH 5K93A 2WBJA 4NC0B 4R7DA 4H20L 1PZ5B 1S7SB 1ZLWH 2YRZA 5CJXA 5I0DA 4P9HL 5TPWH 1FV1A 4Z5RB 2CQVA 4R4FH 1FPTL 3BAEL 1HINH 4Y4FB 4WI2A 5E95B 3I75A 4K3EL 3LQZB 4Z7VF 5FO7A 5MHSD 1UM6H 3KLSA 2ZOLB 5B4MC 1QRNB 5GSVA 3SE3A 5IVNA 1SEBB 2UVFA 3BP6A 3L3IB 3ARZA 5I76A 1OGTA 1SYVB 2RHEA 3JTTA 1HXYA 1YJDH 3TPUB 2NLJB 5EU4B 4P59L 1NMAH 2HJLB 5HJ3A 4EXPX 4YXKH 3MLRH 2F54A 5IVZA 1BBJA 4YGVA 1LK3H 5SWQA 3K8KA 3QDJD 3AXLB 1FNEA 4HUKB 1JRHI 4OF7A 1K2DB 3LSOB 1YY8B 5HGBB 3N50A 2EH7H 4P4KA 4AT6B 1Z3GH 1FL6A 5IVXF 3KYKL 1KJ2A 4MA8L 3UBXA 2HFGH 1JN6B 1SHMA 3MXWH 3RIFF 4FQJH 1PLGL 2X1XR 4LSPH 4PY7B 3WEXB 4GBXD 5IGXL 2PYED 4X8JA 4HKBA 4QTHB 4Y1AA 4KTDL 5I9QC 4RAVA 2OJEB 1YQVL 2ZCLL 2DDQL 1HIML 2LTQC 3AS2A 5DEGB 4M1DH 4TRPH 1PDKA 1JMXA 1P4BH 1ZV5A 3KHQA 5CEYA 1J8HE 1BQSA 2XICA 1PEWA 3MMEA 1VERA 5E9DD 3RVWD 2XRAH 3A6CH 3PABA 4JJ5A 2JTDA 1TNMA 4IMKC 1A7PH 2QQLL 5DMJB 4IRZH 5T33H 2NTFB 4TNVF 4EQ2A 1F42A 3SDYL 3NCFB 4F37F 1LDSA 4GAGH 3RGHA 4LSSL 1W8OA 4G80B 3WSQL 1NGYA 4PJCA 5DMIL 1CL7I 1OGAD 3MLTB 4LLQA 5DUBA 3X3GL 1I9IL 1AKJD 4PRHE 2AXFA 3GSWA 4JPWH 4GBXC 3K3QA 5BXFB 1DLHB 1NCBH 1YEHL 4TSCL 2DLEA 1UWGH 2Y06L 1BD2B 2VABA 1IAIM 1K8DA 3K2MC 4HX1A 2FECI 3NZ8B 1ZA6B 2OM5A 4QOKD 4ZUWB 3RWEB 3MOBL 3EO9H 1W2KT 3PV7A 1OF2A 5E1AA 3RY5A 3RZCC 5KJRH 1KPRB 2YD8A 4XC1H 4MD4B 1KENL 1XH3B 3MTRA 4HFWA 4NQCA 3L9RB 2AXJA 4NSKA 5IW6A 4BFEA 5EA0L 5EIIB 5C07A 4XAKD 2I07B 4H26A 3E2HC 4DK3A 3NPZB 1IQDB 4UV7L 4FFYH 3GSQA 3U46B 3WXWL 3QP3A 4M03A 4L9LB 2HKHH 5D7IE 5HYJB 3HNVL 2P8MB 5K9KA 3GSXB 1QBLL 4FFVD 1UA6H 3CU7A 4JG1L 2VDOH 4CVZA 5IQ9B 4XH2A 3GJEB 1PZUB 2NW3B 1N8ZB 4WW2F 3MRNB 3TBVA 4TQEH 3KPSD 3O4LE 3RZCD 3KJ6L 4I3RH 1AGFA 4B41A 1UXSB 3U0TB 2G2RA 5HY9A 3UJIL 3H9HA 4XPGL 4OGXH 4XMPL 2R1XB 1QSFE 1QLRA 2Y7QA 4PJXA 4KZDL 3AC0A 3ARSA 3NFNA 2H32A 2OTPA 2HJLA 1T22A 4ELKB 5HHQB 3NCYP 3CFEA 2Z4QA 3SGEH 4X6DB 2VQUA 1C1EL 1F5WA 4MS8C 4D0DB 4PRPB 2V7HB 4QHNA 3IU4H 5DI8A 4MMXC 3P40A 4F7EA 2IPTL 1HI6A 5GS1C 1B0WA 4KK9C 4JFZH 1YDPB 4EN3D 4I4WB 3EYQC 1NFDF 4JM2D 5ACLA 4LSQL 5BW7A 1KJ2B 2W9DH 3GJFK 5FYLE 4GRWE 1D5MB 4N0RA 5SWSE 1VADB 3QWRD 3JWOH 1LEGB 1JP5A 3K81A 2D7PA 4TN9A 3IGAB 3NCJH 3PWVB 1KJ2H 3WEXA 3T0BA 3WS3B 4A2LA 3MLXH 2NY1C 3KLAA 2XWBB 1N0XL 3HPLA 4NQDB 2HLFC 4CVXB 4Z9KB 4ZFGH 2BVEA 5CGMA 3CFBB 3SKMA 3WO4B 4ZS7L 4CUCA 3AMKA 5JHLH 4RIRB 4JCMA 1OAKH 1F8TL 4OCMC 2I26N 1NC2B 2DJUA 5GS2H 4PJAF 2V5MA 4GG6B 3HPJA 3PDOB 5HSFA 2NTFA 1UM6L 3D9AH 3UTSA 3ZDXE 1WC7B 4QRUA 5BJTB 1UH2A 3W9EA 4TUKL 3UTQA 4OF0A 1MLBB 1TQCC 1Q38A 2XXMB 3H42H 4HLZH 4V1DA 2DAVA 4LBEA 5BVJA 1CE1H 4OZIE 2KPNA 2AV1A 4MNGA 3LRSB 4R4BB 2AXHA 5EDXA 1DQLL 1S7TA 2GIYA 5DD3H 3FHQA 5F8RC 3TA3A 2P47B 4ORZC 4L4TB 4KRMB 3SJVA 4HQQL 2C1PA 4KI5C 4WI8A 3KXFB 5T1LA 4RMSA 1BVKA 3QNXA 2FBOJ 4IMLA 3I3EA 3H0TA 3E2HB 1F4WL 1KCUH 3QNYB 3QUMH 2AEIT 3GMOA 2GJ6A 2XY1A 5FA4B 1PLGH 4N90E 4HLZG 1ZLWK 5EBLB 2IBBA 1WISA 1YMHA 5I18L 4JQXC 4NUGL 2N56A 3S35L 4HS3B 1GOHA 3QUXB 4F3FB 4KZEH 1FRGL 4AH2A 3HG1A 5SV3A 4OLXH 2ZUSA 3FFCE 4AK1A 1YQVH 2ZCLH 5BVPL 3WN5B 3TN0B 3O2VL 1L7IL 3BIAX 3QFDA 4CRPA 4P46D 5B39B 1LP9B 4GKOA 1FZOB 2AQ1A 2CK0H 3HNSH 3HE7D 3UJJL 3MV9E 5IWLC 3LHPL 1KLUB 2MNUA 1M05A 2R4RL 2AJ3A 4X6CA 4ZXBB 5T33L 5D71L 4MA3B 4CN4A 3RWGA 3PWLA 3I85A 5EU6E 2BVQA 4X7FC 5FUOL 4ZQKB 2DKSA 2NY1D 4MJIB 2ZSVA 4YR6B 2Z31D 4LNRA 3P4MB 43CAA 1E4KC 5DYOB 1I9IH 2IGFH 2FEEI 2QQKH 2E9BA 1GGBL 1I9JL 4BM7A 1G7QA 4YHKL 4WENB 1YEJH 3J8F7 1S7QA 1XF3B 3BHBB 1IMHC 3RIAK 5GS1B 4GKNB 4LPXA 2HA1A 1K3ZA 4I0PB 1AR1C 4OZIF 1EFXB 4ACPA 4JEGB 1NGXA 3RDTA 3BYYA 1ZHBB 4J4PC 1G84A 5MERB 4U2YA 2A6IA 1LWRA 1CFSA 3ZKXC 1PJ9A 5DJYB 1WIPA 4NN6C 3KPRB 1QSED 4GRLB 1QFUH 3O41A 4MCYA 5IUSA 2J6EA 2NY5C 1XIWC 5CEYB 3U4EA 1N4XH 1O7SA 2AP2A 3IB4A 1X6NA 4HLJA 5F97E 3QI9D 1MAMH 1F3DJ 1G6RA 2NCMA 1X5LA 3PABB 4JJ5B 1V7MH 3CFKB 3MLVH 2Z31C 4JFFD 2PXYC 4J6RH 4Q9QH 4LSVH 2C4FU 1AGBB 1J05B 5F1KC 4JE4B 1GGIH 5EUOE 3B9KB 3D39A 3VWKA 2PW2A 1CTNA 5B21A 5DMGD 4Z7QE 4POZD 1ACYH 5F6IC 5ISZD 2Z31A 3I50L 5GZNC 1OTTD 3HAEG 2MTPA 4LIQE 3OG6B 2VH5L 5GGVY 1C16A 4F9PC 4PY8J 1XIWA 5FM5O 1N5AB 2DQHL 1Q9WA 4WTZA 3WUWA 5GISH 5I1GL 3UJIH 1JYVA 1IGCH 4DGIL 4YXKL 4CW1A 3U9PH 5D7JA 4JHWH 4GKZB 3BP5B 1ZTXL 4Q9BA 5HPOA 2D03L 1FDLL 3VXRD 3IDGB 2F54D 4PRAB 3TT3L 4FXLA 4AEIH 4RGMC 3F7PC 3V6FB 3DX9A 4RFOH 4OCNC 5IR1A 3UBXG 4FN0A 3FO1A 1Q9KB 4EQ3A 5DVNA 2HFEA 4X4YA 4P4KD 3O45A 1CFVL 3G5ZA 1N7MH 3SJVB 4I2XA 2GJ6D 4JAMB 2QADB 1AQKL 4HIIB 4KJWD 3KXFA 3V6BR 3FONB 2V7NA 3RWJB 1INQB 1NDGA 1AE6L 5I71B 4K7FA 4IJ3C 4LSQH 1I3RA 1EEZA 2FCBA 1I7TB 4G8FB 1W0WA 3HZMA 3VFPA 2F9BT 5H94B 2VLJB 3FJTA 1SMOA 3S8WA 4DN4H 4N0UB 3KPRE 4TUJB 4KK8D 1FFPB 5A1AA 2NYYC 4PRHD 4LCYA 5EOQL 4F3FA 3W5NA 1T2JA 3I02A 5FYKH 4JY4A 1JGDA 3AAZA 2HTKC 1NFIB 1G7MA 4UTAL 5GXBB 4AIXA 4X7CC 5CJXC 5HGHB 3MRDA 2OQJA 1XGUB 4OBSA 5JW4Q 1DBJH 4Z7WF 3NFPB 4LCCC 3QIWD 1EGJH 1R24B 4P57A 4TSAL 2BXYA 3SBWC 3DV4B 3VXRA 2PXYD 3ZE2F 4JCLA 1P6FA 1S7WB 1J8KA 4PRNB 1ZLUK 5CHNB 4JFOB 2AEQL 5EU6B 1S78D 3UPRB 5I1LB 1MY5A 1NFKA 3I6GB 3PWPA 4KUCD 5TE7H 4U1KB 2DQGH 1UKSA 3G9VA 3ES6A 4IRSB 4LAQL 1A7OL 1A7NL 2PN5A 4Y2DA 1MELA 3VGHA 2EDDA 1LP9E 2AJXH 3DUHA 1UACL 2YC1A 3IDYC 1VFBA 3GSNA 3IETA 4KI5F 2OXGA 3MRLB 3BD4A 1KENH 4FQLL 5D7IF 5H2BA 3ZE1F 3U1SL 1J0KA 1CFQA 3RI5F 3SPVA 4LKCA 2W0PA 3Q5YA 1S7VA 2VQ1A 1IM9A 4G9FE 4BZ1H 3B9EA 1DJSA 2A2QT 1RJYA 3DTXA 4BQ6A 1IKNC 2HLAA 3HE6D 3N9GH 4KROD 4PJAB 3RPIB 5ICYB 2BVYA 2QTEA 1S8DA 1WWCA 1LK2A 3EDEA 3BISA 1VKXB 2X4SA 3KXFE 4KPHL 4X99A 4YNYA 4YHPA 3SKOA 5CINL 4JN1H 2R0ZH 5D70L 4WTXA 4AENA 2JJTC 5DFTA 1LO2H 1CT8A 1A6AA 4WW1A 2VC2L 3BP4A 2H1PL 1I7ZA 2E9IA 3UTPD 4I13B 5IMLA 3HUJF 3EOYG 4DKDC 3WO3B 4AG4L 4OD3L 2X1QA 3WLWC 2JJWA 5IT2L 4YZFF 5CZVL 3EJJX 5LWYL 1DP0A 1UEMA 4KAQH 1ZAGA 4R4BA 1I7UB 5JPNB 3LEXA 3QUKB 3FQTB 4WEUD 2IG2H 3ZO0A 5FUOH 4XWGH 4FQ1L 1TTFA 2BHUA 2LVCA 2X89D 5F1NA 4KZDH 2C7UA 3BWAB 3I9GL 2QEJA 3D0VB 5BW7C 1A02N 4P23B 5F7MC 5T1MB 2HWZH 2R9HC 4KMTL 1GZPB 5D7JB 3TN0C 3BP5A 1TIUA 3K1DA 1V5JA 2VXQL 3IU4L 1M1SA 1H3VA 4UDTA 2V2XA 8FABB 1AP2A 3LKSA 1JPFB 1QA9A 3TBSA 4P3WA 4M43L 5CD3A 1OAZH 3D87B 4NBXB 2W9EL 2PR4H 5L2KA 2C3VB 1PG7H 1JPTL 4L8CA 4LSRH 2JK5A 5KN5B 3MCKA 1FORL 4RGNE 5DEFA 3T8XA 4G42A 3HC4H 1BVLB 3SOBH 5DRNA 3B2UC 4UBDC 4LF3A 4OFPA 3X13B 3P4NB 4AIOA 3FOLB 5GZOD 1MHEA 1LD9B 1NFDA 2HP4A 3C60D 3U2SB 2FJGB 4HCRH 5EWIL 3TWCH 2DD8L 2A73A 3MR9A 4JG0L 2ZCHL 2X70A 5SWSA 3UYRL 1BAFH 4HAGA 1HHIA 2YA1A 3AS3A 4JFEE 5HGDB 5JO5A 4JFYB 1JTOA 2BY2A 2W59A 2OQJB 5I1CH 2AXGB 3V5HA 4PJFA 4TUKH 4LFHG 1RVFH 1MFBL 5L7XL 1ZVSA 4Z7UB 4YHZL 3LEVL 2F15A 4ZSOA 5I1GH 5DJAB 4PTUB 4HJ0C 4UU9B 4P59H 3X11A 1FIEA 5GS2D 5CBEB 5EUKA 4JHWL 4HK3N 2UYLB 1T0MA 1EO8H 3DBXB 4NP4H 4ELMA 1LK3L 3RWIB 5A16A 4QGTA 3DGCR 5C07E 3V4PH 2B39A 3FFDB 3O11B 4PTTA 3P0YL 2CLVA 2DQDL 1Z3GL 1EDQA 1MEXL 3MUJA 4U6YA 3RFZC 5H2BB 2EDHA 4XGZA 4R0LC 3VXUD 1BREA 3T4YB 2AEPL 5MENE 2DTML 1LNUB 1EXUA 3HE6A 3B9KA 3D39B 3VWKB 4OIIL 2X4NB 5IB1A 2PO6A 4EI6B 4OZHA 1G7JB 1NAML 2AVGA 5C08B 4DKAA 1JYWA 1WZLA 1L7IH 1H15A 4DGVH 1ZLVH 5DQJB 3GKZA 1IGFH 4ZO8A 5EOQH 5ICYA 3JTTB 4HDIB 4WHYG 2K7PA 1WBYB 3WNMA 1P4BL 5JTWA 5FYKL 4Y4KD 3D3VE 4LFHD 1DBMH 3ROOB 2GSGB 3QUZD 1J87A 4Y89A 5D71H 3V7AE 3PGCB 1LMKA 1WCBA 5TE4L 4YXHH 4ZUSB 2VSDA 3AXLA 1Z9LA 1DQDL 1HXMB 3MBXL 4M7JL 3K4AA 1B0RB 2MPAL 3QXDA 3WSQH 4MAUL 2J88L 2ICEB 1UXWA 3CLFH 4QXTB 4LCWD 3MFFA 2C26A 1K6QL 4U1GB 4OIBA 4XC3L 3PXHA 4P9MH 3DX7B 2X4OA 5B38G 5B3JE 1I8MB 5C0CA 5TE7L 3QPQC 3FQNA 2OR7A 1LP9F 1CICD 3EUUA 4MA1B 3MV11 1HHHA 1J8HB 3FN0L 4J12A 5FGCE 1ZWIB 1FIGH 2VLJA 4K3JH 1J9CT 1XF2A 3MOBH 5C8JA 1CDGA 3TLRA 1NCTA 4XVSL 4JGMA 2VXSL 2L7UA 5T5NG 3D69B 2VLJE 1MFEL 2AJZA 4MD5A 4LKXB 4I3SH 3VJ6B 2JB5L 2OZ4H 2X4RA 1DVFA 4HJGB 5GRJH 3MLVL 4JRYE 2OYPA 2NXZC 1UGNA 1QG3A 2GY7B 4X6CE 5EPMB 2Z35A 5FGSA 4J6RL 5HGHA 4DW2L 1K5NB 3SJVE 1JF6A 2DWEA 4TTGA 3DYMA 4F9PA 4PR5B 4HW6A 4LF3B 5F9WC 3LIZL 5FCUH 4ZS6D 3RWDA 2RBLA 3GUTB 3DRTA 1YEKL 4F7TB 5EULV 3MO1A 5H35B 4L8SB 1UCBH 1YA5A 2FYYA 1YNLH 4OLZH 1HH6B 1AQDB 1WZKA 2BCKA 4N0CD 4U6VL 4WJ5B 4ZO9A 3REWB 2A74A 4AG4H 4HG4J 1OLZA 2OK0H 4U1NA 4M6ML 3KJ6H 4I3RL 4XX1G 3ARGD 3O3BA 1HHIB 5JO5B 1EGJA 3BSZL 3BPOB 3QQ4A 1VFBB 3GSNB 4FQ1H 4YDIH 4DTGH 3VGBA 3FB6A 3PQYB 3WIIL 2IFFL 4ZUVB 5DVOA 5D7IB 3FT4B 5E00B 3QXWA 4GG8A 1T0MB 5IEHA 3U0PA 5CSZA 4Y88A 2VXQH 4QRRB 4F7PB 3DIFB 1XF4A 3QG6A 4JHAL 1AE6H 1KTRL 4GRWH 4NZDA 1CFBA 1A7RH 4IBLT 2W9DL 3KPOB 4HT1H 2BRRH 3G6JB 1I8IB 1UM4H 4PJGF 5SWZE 2HT3C 1E27B 2Q3ZA 5HVHC 2G2RB 3INUH 1RZGA 4I77L 4O2EA 1MJUH 4WFFD 2EDQA 2H6PB 5JLZB 4JZOB 2W0FA 3EYUH 5EC2A 1U8PA 2IMMA 3TWCL 3FO9A 5GGRB 5F9JA 2RQ8A 3F7RA 4PRHB 1NGZA 1SEQH 2VZTA 4MSWA 2YA0A 3T1FB 4BZYA 2MHAB 1OWWA 4APQC 3G5VA 1NBYB 4MAYB 1MVUB 4MXQD 4P46C 2AEQH 1VGEL 2Z9TA 4XCEA 4JJHA 4AL8H 5HYFA 3MRMB 1EAJA 2W0KA 5LG1A 3GHBH 5CAYB 1UKQA 2YBRA 5CILH 4NRXB 1IRAY 4NQSA 5DJ2A 3IKKA 5D5MF 4K94C 4KY1H 1P4IH 3DX7A 3QDGA 2JJSC 1ZHLA 1AO7E 1YEIH 4KDWA 2C4FT 4JKKA 1RUPH 1N59A 4MJ6A 1KIPA 1I7RA 4NNYA 3CX2A 3V4PL 2VDNH 2XT1B 1HH9A 3S88L 1U93B 2VAAB 1N3NA 2BNQA 2P5WA 1XCTA 4NO5B 3CVHH 4FQXC 1MEXH 4HWZB 5TF0A 1UH4A 5I19H 2P49B 4NZTH 3RTQC 1GHFL 5SX5H 1X4XA 4JFFB 4XCNA 1MCSA 1SBSH 4I3GA 4KJYB 3CDYA 1CI5A 3S5LB 4LKXA 4MXQC 2K7QA 5BZWB 4ALAL 2X70B 4QHLA 1BBJB 3HA0A 4Y2DD 3IXTA 4RAUA 1MQKL 3MUGA 1UJ3A 4J23A 1BZ9B 4YEFA 2VC2H 4JRXA 3WS6A 4H25B 4NZRH 2VLKB 3BDYL 4FQCH 4P2RE 3UTQB 5E8EA 5DRWA 1SYSB 1CD0A 4LBEB 5IT2H 1J7VR 1NCAH 4UMGA 5KVGL 3MRKB 4U0RB 3LHPH 1EFXD 4HS8L 3K8LA 4BKLB 4FP8H 2P5ED 4HK3J 1E4XI 2R4RH 2HT3D 4XWGL 3R8BB 3LKNA 2EYRA 4LQFL 3TBYB 1F02I 3ORJA 1CIUA 2VLLB 3RNKA 4PJ9D 1YUHB 4NN7C 4BUGA 3UC0H 5TE6L 4KHXL 3GJFH 3GMNA 1A3QA 3MLYL 3PQYE 4IRJB 4WCYL 5GZND 3T3ME 2NY1B 2LTQB 1G6RH 5T5NF 1B4RA 1LE5A 4Y2DC 4G6KL 5TDOA 1MCEA 3VA6A 1BQHA 5E4IA 4I0PD 3HMXH 4ZXBD 4FQIH 1PYWB 1A6TB 4XAWL 3SQOL 5TQ2L 5C0BD 2XTJC 2Q8AL 4JRYD 4M3KB 1P7QD 4NQEA 4J8RB 3QHTC 1PG7L 1LHZA 1X5JA 5HHME 2VZ1A 1KPUA 2YK1L 3VD4A 1U8HB 2BY0A 3CJJA 3KWWA 2GUOA 4QHKI 43C9B 4N8VA 5JNYB 5BO1H 4P2QD 4UT9L 4ZFZB 4AQ1B 3PIQA 1JF1B 2ARJQ 2AJVL 1I8IA 5EU5B 4WWKA 2DD8H 4JG0H 4K3GA 1HHGB 3S36L 4CN1A 1JZ6A 3SDAC 2SEBA 4FTVD 4O2EB 4KXZH 4WTWA 1Q0YH 5E56A 5AUMB 2ZNWA 2X4OB 5CJOH 1FFNB 5D1QA 4NKOA 1FYTB 5I1CL 3D6GA 1CDYA 3MCG1 4ZUTA 1KGCE 4JO2H 1RUAL 2VDKL 3ILPA 3DROB 1IKNA 2D3VA 4KKLD 5FDWA 3LS5L 1ZWIA 3RA7H 3WS6C 5GS0H 1MVUA 3C6SB 3JWDL 1CDCA 4L9LA 3VG9C 1KN4L 2FATL 3SE9L 1WT5A 1OTSD 3X12B 4ODSH 1IAIL 5C0DA 3D2UA 4KRLB 4KQ4L 4FQXA 4PRIB 3P4OB 4HUUA 3TCLA 4JN2A 5F6HI 1I9RH 1NGPH 2DTMH 4X7TB 4X7EC 1INEH 3HC0B 4TVSa 1OB1B 1FH5L 2XZQL 2R39A 3IRPX 5HGGS 1XCTB 4Y4HC 3REVB 2FZ3A 1Q72L 4KTYA 3OAUL 1D9KC 4G8IA 5FCSH 4GQPH 1NEZA 2YHGA 4LVHC 5IROA 4AM0A 1F2XK 3BZDA 1YEFH 5KSUB 1UCTA 4LU5H 3V95A 4CW1B 1AXSA 4GO6B 1NC4B 1BZ9A 4LDOB 1S9YA 4NHCH 3D39E 3CDGB 3RVWC 1P4LB 5TE4H 1T21A 4UTAH 3BKCH 5T1KD 4PJEF 4PLNC 2B1HH 2YMXL 2IF7A 4JDVA 3VFSA 2FH8A 4M7KH 1JHLL 1UB6B 3H2WA 1IGIL 3MGTB 1DVFC 3QUMB 2VL5B 4KTEH 2V5RA 4P9ML 4XNQB 3RY6C 6FABL 3O45B 5IF0A 3BUTA 4OJFL 5CEZE 4FXKA 2D4FA 3QCVL 1CL7L 5CILL 1WVZA 3SCMB 3UZQA 4U3CA 2D0GA 4Y19B 3ARRA 4LSDA 3BWUC 3EFFB 3CFBA 3UJTH 3SY0B 4OZGF 5J11B 3F12A 3W9DB 1F6AA 2A38A 2QQNL 1MHPH 4PJIA 4HULB 1J0IA 2IWGA 2KZWA 3GDBA 1P53A 5T1DH 1YY9C 4KDTC 2VXSH 1FAIH 3G6JA 4ZFOL 3PJSB 1MH5A 4U6HB 5FKAB 4U7MA 3ECBB 5AYUH 1YN6A 4RMQA 5CMAA 2E7LC 1MPAH 4WWID 3UTTD 3CMGA 4S2SB 2CDGA 1ZHKB 5E2UH 3KYAA 4ZFOA 3TYFB 3QUZA 5ALBH 3C2AH 5HPMA 4NZTL 1G1CA 4MD0B 5HGAA 1XGUA 1SBBA 2ZUUA 2ZUQC 3EHBC 1CZ8H 5HJ3B 3GM8A 5C0IB 3H3BC 2V9TA 3C60B 4YGVB 1YEKH 1BM3L 5F7DB 4ZYKA 5D2NB 3PIQB 1B3JA 1KCVL 1YNLL 3QNZA 4TULL 4U1KA 1NJ9A 3QBTB 4PRID 2OK0L 1G6VK 2D7TL 3G5XA 4HMDA 4XP6H 2YC1B 1FL6B 4PGJA 2EYSA 3HI6H 1QQDB 2XZAH 4NN5C 5BQ7A 4ZUTB 3TNNA 1QRNE 1WAAA 3JV5A 1P69B 2OL3L 4TOYL 2P5WB 4U33A 5E6IB 1FPTH 3BAEH 1A2YA 2BVPB 1PY4A 4MNHB 2BMKB 2HWZL 3BI9X 2E9JA 1EVTC 4YHMH 1QACA 4YK4C 2R2EA 1FYTD 1FO0H 3G5YB 5EO1A 1IJ9A 1LK2B 1HEZB 3VXMB 4HJ0D 3RI5K 1F4AA 3IXTB 4RAUB 4D3CH 4ZQKA 4YHLL 4KGJA 3E3QC 2ZSVB 3OB8A 4ERSL 1NGYB 4PJCB 4R3SA 2YUXA 1I1FA 3E3QE 4HWBL 4LSUH 4QXUL 2YK1H 4EUPB 3C9NB 3OF6D 3NIDE 2YKLH 4NN7B 1U3JA 1JI2A 3GBNL 3P9WB 3PWUB 3INUL 3QI9C 4Y5XC 4RGOH 5BO1L 3OBAA 1EEYA 3JV4B 4YHOH 3B9KD 2AJUL 3PGDB 3D18B 2VABB 4N0FB 3GMRA 5EWIH 4QRQB 4C56A 3V9FA 3IAGC 2VXUH 1LDPL 1BBDH 1SEQL 1A4KA 3C5JB 4LLYB 4G9FB 1YYLH 1AXSB 3KPRA 2VDML 4GRLA 4DGYL 3N85H 1JGVL 1TETH 2MFNA 3BW9A 5CJOL 1VFUA 1EMTL 2KQNA 3EHBD 3L7EB 5L0QC 3VGFA 1KPRA 1NLDL 3LRGA 4AL8L 1AP2B 3LKSB 4JO2L 1TMCB 4Y4KC 1G9NH 1YNTA 3QHZH 4WTZG 1MAJA 2R69L 4Q9RL 2PTTA 2BHZA 3OR6B 2CLRA 2GK0A 3AGVA 3OKOA 3O9WB 3JWDH 3VCLA 1YEIL 2X5PA 5IOPB 2XA8L 1H5BB 2YD4A 3SDYH 5HYJA 3HR5A 3B9KC 4ELMF 1QKZH 4H0HB 3MLZH 2D7QA 4YIQA 3ESVF 3W9DA 3QEUA 4RWHA 2PXYB 3KJ4B 1N5YH 4L3CA 1YECL 5I8EB 5D5MA 1GHFH 1NGPL 2JCCA 4PG9B 3BXNA 3FTGB 1FH5H 5CUSL 3TGXA 3W39A 2WWKT 1YPZA 4L3EA 2DWDB 3W0WE 4HUVB 3SDCC 4KMQA 1L6XA 2ZSWA 4XNMA 3GBMH 3BGFC 3JUYA 1GIGL 4LLVB 2ED7A 3TYFA 5HPMB 3W11C 1MCOL 1Q72H 2R1XA 4DVBA 2MCG1 3IDNA 3O3DB 1G7HA 5JXEC 1XF1A 3E8UH 3WFBH 3O2DH 3CFCH 3LH2H 3ZKSD 1IL1B 4YAQB 3LPGA 4UT6L 2VUYA 4D9QD 2WZPD 3OWEA 4OAWA 3HE7C 5IHUH 1D6EB 1FZJB 1Q94B 1JMZA 3HS0B 4HXAH 2D2OA 2MSPA 3WXVL 5EOCJ 2P4AB 2VZVA 3RWJA 3WFHB 5F3HA 4P48A 4GUPA 5I17B 2ADIB 2F5AL 4ZS6C 5F7KC 4I4WA 1PW3A 5IW3A 2IQAA 1JNLH 4M1GL 4MAUH 3DVGB 3T0EB 2EYSB 3NFSL 3FQRA 3UTTE 2Y36H 1REIA 5I73C 2J3SA 3BQUD 4R6UA 4HKZA 1PKQE 3O4LD 3QIBB 4Q6IC 1EHLH 3UJTL 2G9HB 3E0GA 4FA8A 5GGSB 1SEBA 2Q8AH 2WK2A 4O00A 1DR9A 5LAXA 1CFTA 3KYOA 1FIGL 1BEYH 4NWUL 1AGDB 4MQ7B 3CX5J 2HFFA 1CLCA 4NFBA 3ARBD 3DHMA 3NOIA 4AM0B 4LSTH 4JHZA 5K9JH 1ZGLP 5KSUA 4IOSD 4OD2B 1MPAL 2GKIA 5F1IB 1NC2A 3UYPA 3MJ8B 2O5YL 5J1TC 5E99H 2JB5H 5AYQA 4M8QB 5GRJL 1IE5A 5I6XB 3RVXD 2PW1B 1C1EH 4LCWB 1QEWA 4PP2B 2X09A 3TNMB 1C5DA 1U8QA 4JVWA 4O58H 5E0QA 1CICA 1L7TH 3VI3E 4KJPD 2VDPL 3ULUF 3CFJA 4WU5B 4JLRB 4LCWE 3KPNB 5ENWA 4C56D 3PWPE 3S9DB 1S7TB 3FN9A 5BVJB 4R97C 1ZOXA 3PHOA 3D39D 3VWKD 4L1HA 4LLDA 5DMGC 1XCQA 1X3DA 4U1MB 3CXDH 1WEJL 3GMRB 3NZHH 3PL6B 3OJDA 3FQNB 25C8L 2BNRD 1ORQB 2ARJB 3DVNB 1R3HB 5DRZA 3FOMA 5FYLH 1R3JB 1NSNL 1P7QA 4LLUA 5E5MB 5EUOA 4ZS7H 5JHLL 1GCFA 4QHUA 4IOFD 4QT5B 3SE9H 4HUWB 3QRFM 3RVXC 5CIPA 4AENB 3ZSSA 4ODSL 3ET9F 1ND0B 4WW1B 1XMWA 4PB9H 2P5WE 1F4HA 1U8OA 4JM4L 3EOTH 1RMFH 1CXHA 5IMKA 2DMKA 1H3PL 1RIUL 2B1AL 4EUPG 1RZJC 1DN2A 4KJWC 5E7FA 1IM3B 3SO3B 4NQXB 4I9WE 1VFAA 3VFMA 3SE3C 1A14H 1H3UA 3RGVA 4YC2B 2NNAB 3UCRA 1I1AC 3BWAA 2BVQB 3KNBB 5F70A 1RURL 3WJLA 3JV6B 5F6HJ 2CK2A 3SBWA 2NYYD 2IC2A 3B2UD 1XGTA 5FECA 3WFCH 5C86A 3BH9A 5MEQB 2IBZX 3W0WB 4APQA 4FQHA 3O6FB 5EIIA 3RDTB 3FB6B 4YPJA 5J12B 2I07A 2HJFB 4U1LB 3SDXA 4LCCA 1F97A 3LEYL 3TH4T 3N85L 3VFTA 1TETL 4ZMAT 4RQQB 1H8NA 5T3XD 2XKNA 4G42B 4RX4D 1CBVH 1C5CH 2X4QB 2NY3C 3T2OA 1JE6A 3QCVH