3WYRA

Crystal structure of killer cell immunoglobulin-like receptor 2dl4
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
189
structure length
189
Chain Sequence
KPFCSAWPSAVVPQGGHVTLRCHYRRGFNIFTLYKKDGVPVPELYNRIFWNSFLISPVTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVTGLYEKPSLTARPGPTVRTGENVTLSCSSQSSFDIYHLSREGEAHELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYEWSDASDPLPVSVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Killer cell immunoglobulin-like receptor 2DL4
publication title The structure of the atypical Killer Cell Immunoglobulin-like Receptor, KIR2DL4
doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 35
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00047 ig Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wyrA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wyrA01
3PHOA 2HH0L 2MNUA 5I1GL 4JN2A 5GRWA 1HXMA 4YBQD 1OSPH 3ZHLA 4EN3D 3HAEG 4PRHB 4ZD3L 4Y89A 3CX5K 3MLZL 3T04D 3CFKA 5MEPA 1E28B 1CD1B 1M1SA 5DJZB 4KJYA 1BFOB 5MENB 4XXCC 3T4YA 1T7YA 3AAZB 5I8CB 3KPSA 2GITB 5CS7A 3ZTJG 3IDMB 1S5IH 3CFDA 5KAQF 5M94B 3OG6B 1KFAH 1IEAB 5F7LB 4LPWA 1DEEB 1EEYB 4WV1B 4XAWL 4PB0H 3ES6B 3R8QA 1T4KA 1G7JB 3QO1B 4P2QD 5FO7B 3RI5K 1XFPA 1CE1L 1W72L 4DWHA 3HI5L 4QHMA 3DX6A 4PRIB 5HHPA 3FQWA 5JOEA 4X8JB 3SHSA 5CEYA 4ZODA 3RWJB 2NY2D 4N9GB 3WFDH 4XP6L 4P46D 3OZ9L 4KVNL 3CNKA 1A0QL 1KJ2A 3FO9B 4HFWB 4NO2B 3ULVE 5GPRA 1R6VA 4UU9A 4WO4A 5F6HJ 3T1FB 4IS6A 5DQ9A 5IEKB 1MFCL 3BYTA 5HGAA 3UAJC 3WFCH 5GZNC 1BD2D 2H41A 4Z7UE 1T22A 2X4OA 1G7LA 5JW4N 3QUKA 5DD5H 1R3LA 4PRDA 3QXDB 1EZVX 4R97B 4HIEB 3DYPA 3ABZA 4M03A 5TE4H 3WUZA 4LHUG 1Q38A 3HC3H 5DTFA 1FG2B 4J6RH 3QZWA 4JKMA 5HI5C 2WQ8A 3G5VA 4NQSB 5E99H 2B1AH 2CDFA 3I02A 1A9BB 4U3XA 5JPNA 1I85C 3RBSA 3HE6A 3MV7E 3INUL 5GRZA 4NM4H 3VMOA 2XKUA 3ZDYE 4IOSD 1GC1C 5E2UH 2FJFA 3RAJH 2BY3A 2R0WL 1I1AB 1GPOL 1JP5A 3QDGB 4K9EL 1C5DB 4LEXL 3A6BL 3ZSTA 3M8OH 5BS0D 5FO9A 3DVNB 1QFWI 3H0TB 2WUBL 4JFDA 4PUBH 2XZCL 2VITA 1DQQB 5DMJB 1FIGH 5LCVL 1CZ8H 4D0DB 4L29B 3GUTA 4ZFFA 4PJIF 4PJAA 2C1OB 2CRZA 3C87A 4RGOH 3UBXI 2XTJC 4ZPVA 2YD4A 1V3MA 4Y5XB 4NRXA 4CDHA 1OAZL 3MUGB 1F58L 3QI9A 4YXKH 4JDTH 2ILLA 5J3HC 1ZS8A 4MXVE 5L8JB 2X4SA 3L5JA 3V4UL 1BGXL 1QR1B 1ACYL 1UXSB 1WC7A 1ES0B 4WI2A 4YE4L 3QWQB 2OQJA 2H32H 1OTTD 2QADD 3D6GA 3GSXB 4Q0XH 3LKNA 1TNNA 5T5NG 1NBZA 4PRPD 4ZFOL 4HBCL 5ANME 3JWDH 2APXA 2DQCL 1T1WB 4G7VH 3B6SA 4U0RC 2VISA 3PP4L 4KVCH 4Y2DB 2GSGA 2WP3O 3WUWA 4TNWF 1QOKA 4YQXH 2IFGA 5TDNA 1G7QA 1VHPA 1QFPA 1A6UL 4NZTL 1J8HD 4KMTH 4NZUH 3BXNB 3KJ4B 2PUQT 2MCPL 1FZJB 4OGXH 3Q6GH 1I8LC 4KK9C 1AKJA 3I85A 4ISVA 1JNHB 1W0WB 3EJZD 1RAMA 3O9WC 3MXVL 4M5YH 2H2SC 1S9KC 4OQTL 1NCWH 1OGAA 3W9EA 3ULUF 1QQDB 3LQAC 3D18B 3RWIB 5BO1H 1KN4H 5DHXB 3PABA 1H3TA 2AK1L 3QB7C 4IEFB 4HV8B 4NP4H 4AM0A 3S35X 1ED3A 1HI6B 4XXDB 2AEPL 4F80A 1Z0MA 3VD7A 2F53A 3WE6A 5E08L 2VDMH 5J1AB 5GGVL 1OP3H 5B4MC 1MCQA 5DFVD 2LVCA 4QXWA 1ZLUK 3MNZA 4M3KB 1NCCL 1IM3B 3NFNB 4KC3B 4PY7B 2PTTB 2ZSWB 3DYOA 3O0RH 3T2OA 1QVOA 3GMQB 1F42A 3SKNB 1RHHB 2YKLL 4LCYA 3MLTB 5I8KL 3EDKA 1ZA6A 4Y4KD 2OP4H 3MGAA 2VXQL 3V7AE 2VLJB 3CCHB 5GGSA 1JWUB 3BKCH 1ZTXL 4EIGB 4PJ8D 4R4BA 4EI6A 2CIKA 4OLXL 5F3HA 3VXRA 5T1MA 1MLBB 4WNQA 3UCRA 4YHNB 3O4OC 3K80A 1EUTA 3MYJB 4HF5H 4MS8C 2VLMD 1ORSB 4WCYH 3OBAA 4OLVH 4RWHA 1IGCL 2EICA 2C3GA 5C08A 1BQUA 1QLFA 5MERA 4GW5A 4ZUWA 4I9WE 3KYMB 2GY7B 5EC2A 3Q6FB 1MY5A 4HUWA 4YDIH 5DZNA 3K3QA 1EIBA 1I1FA 1N6QH 2CDGA 5L0QC 4MHHI 5CMAA 5I18L 2LAAA 2AJUL 5H37H 1NGQH 1DVFC 3GMMA 3PXHA 3VI3F 1CE6A 3QJFA 1BQSA 1X4ZA 4YGAB 2LV4A 5DJDA 1LE9B 1A6TB 3U46B 2WLYA 4OZGE 3B83A 4UQ3B 1IILE 1T2QH 3TO4A 3IAQA 3FMGH 2VSCA 2Z31D 4ONHB 5KOVC 1NCBH 3T2PA 1L9NA 5DMKA 4G8GD 4ZYKA 1HHHA 4ZS6D 2K9UA 3JBG7 2ZSVB 1A4JB 3ZE2F 3IU4H 2D3VA 1FNFA 4KKBD 4MA8L 5IVZB 4NHUB 4HD9A 5C0AA 4IOFC 5E00A 4Z7VB 4RGMB 1FCGA 2YD5A 1LNUA 4U05A 1CDBA 5AYUH 3RWEA 2FO4B 1NGWB 1RZGA 3MLVH 3PWPD 3MRJA 3U4BH 1IMHC 3W0WE 1UEMA 1N4XH 4YC2C 5KSAD 3NIFF 3FHQA 3MRRB 3RVXC 5HHVL 25C8L 1MCEA 1P84K 5ESQB 1KPVB 1HZHH 3U0WL 2IBBA 5IB2A 4S11A 1UZ8A 5BV7C 3MV01 3ULUH 2OSLB 1A3RL 2RAMA 5I1EH 4TUJB 4BZYA 1SHMA 1WIOA 3N85H 2J8OA 1NKOA 2CLVB 1IAIL 4NWUL 5IQ9B 4X6FB 4NUGL 3D87B 4HT1L 3EGSA 4Z7QF 2EIEA 4MQSB 3IXTB 5KSBF 4M7ZB 4MJ6A 3EJYC 2IAMD 5C0FB 3DMMD 5E2TH 4D9LH 3QIWB 3D85D 2QR0A 1ZA3B 4LLVA 1J05A 5IFHL 4P5TA 4K3JH 2HJFB 5H94B 3U30C 3TPUB 2WBJD 3UC0L 3TO4C 3IKCB 4RGNE 1XF1A 1HWHB 1U91A 4X6BB 4JRYE 5D4QA 1LK2A 3IU3A 4FG6C 1VFOA 2O5XL 3QDJE 5CZVH 1Q0XL 3EOYG 2VLRD 3P73B 4E42B 4I48A 3UDWC 1UEYA 1OAKL 4XRCB 3TN0D 4JZJB 1LO3H 1H3UA 3FAWA 2EZ0C 3DNKA 1U3HC 2V7NB 1I8KB 5FGBC 3S37H 2Y6SC 4GG6F 3RDTB 1D5BB 2W9EH 4BA8A 3UTQA 3CDGB 3QUMA 1R3KB 2DWEB 4U6YA 3QT2A 1XF5B 1WUNT 3NFSL 1OLLA 5DRNA 2FYYA 1JTPA 2HT2C 2HT3D 3HMXA 4F7CA 5D71L 1JTTA 1JZ7A 3MV8D 1PY4A 5HHNA 4OD2B 3EYVB 2AV7B 3B9DA 4HWUA 3QDME 4MNQD 2FIRT 5IIEB 3LVEA 1KB5A 4XC3H 4N0CD 3TA3B 5C0IA 2VXSH 2XIDA 3WIFA 1N3NB 1CLOL 1ZVHA 4OGZA 3ARXA 4HAGA 5IHZA 1S9VB 2YUZA 3KPQB 2ZUQC 3VXUA 4WI3A 4LKCB 3S4SA 3D5OF 5DMYA 5IBUB 3WCYA 3OF6D 3G6JB 2ADFL 2BRRH 4JQIH 2D0FA 4YO0B 1UJ3A 5T3XD 1U0QA 1EEZB 2DWDA 3C09C 4GAJH 1EO5A 4P5TC 4EUPH 5JUEH 2CKBH 5GGTA 3VFSA 2R69H 3WLBB 4OIIL 3MRFB 1BBDL 4ODHL 4XVSL 3MRGA 4L4TD 5MP6L 2BRQA 4N8CL 1HYRC 5KANG 4H25A 4U2ZA 4BSWB 1INEH 5FYKL 4G42B 5IEHA 4KZDH 1FVEB 3BEVB 1ZSDA 1UM6H 4OLUL 3SE3A 4XT1C 3V5KA 3ARGD 4EI5A 4KY1L 5CP7B 1ND0A 5F21B 1XMWA 1CXKA 2FZ3A 1GJIA 3TYGH 4MA3A 3EDJA 5GS1B 1JE6A 3F7VA 3AREB 3BPNB 5E1HB 4ZNEE 5ADPL 3WN5A 2IFFL 1R3IL 3K81A 4I18B 1CDYA 5KVGH 5AEAA 1JHTA 1NLDH 2DIAA 3BGFC 3UTSB 4XP1L 5FA4B 3UJIL 3O3DA 4WENB 4M5ZH 2F19H 1NUDA 4LIQH 4PJGF 2DQEH 4N1HB 3UPRA 3ET9F 2XA8H 5GXBB 2WZPD 5DC4B 4PV8B 3UROR 2EDKA 1QFUL 4WI9A 5IB4B 4NBZB 5SWQB 4OCSH 3G9AB 5EOCL 3DETD 3DECA 5JO5A 2P8MA 3TV3H 5E9DA 3HG1D 2EDTA 3JWOL 2R4RH 1NL0H 4YDJB 5B39A 1S9WA 3FT4A 3AS2A 3KWWA 2NY7L 5IV2B 1CXLA 5CZXC 4LFHG 4RMWA 4KI5C 5FM8A 3HNTL 5D7JB 3OR7B 4LGRB 4WV1C 1AD9A 4FOMA 1EERB 4HKZA 1UJ3C 7FABH 2AP2A 3W11D 3TCXA 1FFPA 4N1CA 2I9TB 2SEBA 4LF3A 4NOFA 5I76B 4LVHB 4FFYL 2ZG1A 3VXMA 4ZPTB 3C8HA 3AY4A 2Q7YB 3ZKND 2CJUH 4JHAH 5EOQH 4O2EB 3IF1B 1CGYA 2PKDA 5F9JA 5DJYA 3V5DA 1HQ4A 3UPAA 3BDXA 3L3GB 5E8DH 5T1KA 4YHIB 5ACZA 1DANT 4BFIB 5D96B 2BC4A 4KK8C 4LARL 3BMVA 2Q86B 3T0DA 4X6CF 5EBLA 3SE3C 4I77L 4EI5C 4YHML 5AYQA 2BSRB 4JKPL 4FNLH 4F8QA 1DSFH 1KB9K 1PW3A 2P8PA 3MO1A 1EHLL 2R1YB 5AUMB 3ZT5A 4JVWA 5K59E 2HLFD 4NKOA 5E5UB 2E7LA 3GI9L 2NNAA 2AXHA 2YD9A 3IDIB 1NCAH 3EYOB 3P4OB 2B0SH 3QEQE 4ONGH 2VXTL 3CH8A 3FN9A 1ITBB 4R97C 2G5BA 3VFTB 1TETL 3BO8B 2F54B 5HHOE 4Y16D 1N5YL 1FAKT 1C16A 3BKML 4L9LB 4OKDA 1KENL 3D69B 4F9LA 5KW9H 3BI9X 1WIPA 3VCLA 1AY1L 4ZAKA 4R2GD 4M62H 5GSRB 1FQ9C 2XQYK 4L8SB 3TFKD 1TDQA 3GKWH 1KC5H 2VN4A 5BOPA 3SOBH 3MRPA 3GRWL 4R26H 1Q72H 1K2DB 4RMQA 5BVJB 1M71A 3A6OA 1F11B 1KIQB 4K3DH 1GSMA 3P30H 3TNMB 3TBVB 4U1KB 3FN0H 5DD0H 4W70A 1U8IA 5JW5B 3GM0A 4S0SD 5FOJA 1G7IB 3KPMB 2ESVD 4HX1B 2X4RA 4POZD 3GM8A 3VH8B 3P2TA 4ODUA 4R4FL 3VFGH 4NPYA 1MCNA 3D39D 2EE2A 4G6KL 4MNHB 4Z8FL 2J1KA 2NX5B 4OQ1A 1FL5A 4HCRH 2ARJA 5D7KD 2HFTA 4HKJA 2ORBH 5D7IA 4Z76A 1R3HA 4XMLL 4XP9H 3RVWD 1DQML 3FRPG 3QHFH 4ONFL 5DC0A 5GHWH 2YMXL 3GMNB 4B7IA 3RHWK 3TWCL 5E2WL 4Z78A 5GISH 5IVXF 3U4EA 5CFHA 1HQRA 4Y2DC 1EV2E 2E7LC 2CO6B 1YEHL 3KDMA 1YQVH 5C6TH 4NKMA 4PY8I 4UIKH 1CFQA 2OM5A 1UWXK 4K07A 3KJ4C 1AR2A 2H32A 5DK0A 4EDXA 4KJPC 2V2XA 3D3VA 1FHGA 1UH4A 2OTPA 4NYLB 4OTXH 3RGVA 3M45A 2ADJB 2C4XA 4N5ED 4OGAC 2R0LH 3QFJD 4U1GB 4H20H 3G9VA 5SWSB 3QXAA 2AW2A 1CXIA 1YC8A 4TSBH 2OJZL 3CFCL 1UJTA 3WFBH 4C83B 4NC2B 1FNEB 2Q3ZA 1MI5A 2O5ZL 1KCUH 3RIFK 3VJ6B 1CK0H 4Q97A 3MGOA 4MD0A 3L3HA 1NEZB 2PNDA 4MAYA 4U1IA 3I3DA 5GGQL 1F6AB 2DM3A 1S9YB 1JGVH 5GS3A 4CNIB 5BMFH 1HEZB 1RIHH 4FQLL 4JHWL 1FPTH 5E4IA 4G9DA 1FNSL 3LY6A 3MOBL 5BXFA 3L3IA 1NSNL 2ZCHL 2EDOA 4JFDE 4HQQH 1EGJH 5IB5B 1JPFB 1KIUA 3UTTB 3MZTA 4BFBD 2AXJA 5AD0A 4PJAE 4PJBF 2X4PB 4IRJB 1JNLL 3VRLF 3CVHB 2UZXB 1KBGH 2L7UA 4E0RB 2OTUA 5A16A 3P9LB 1JI1A 2V7HB 1AO7A 1HCVA 2AI0L 5IW6B 2VZ3A 5IF0A 5FECA 1AGBA 1XCQB 1ZHKA 1FP5A 1QLEL 1RD6A 1FDLH 5AZEH 1IRAY 2J12B 1AFVL 3NCEB 1S7UA 3QA3B 3QNXA 4JO2H 3O3EA 4A2MA 5ESAA 5GGRB 1SEQH 1T66C 3QAZB 4P3DB 1AXIB 4WHTB 1S7TB 1IAOB 4NFDA 1U8LB 2DJSA 2R56L 4X7TB 5L2KD 3O6FD 1RUPH 4MD5B 4ZXBD 1FZOB 2Y72A 1A2YB 1D5ZB 3JWDC 3SDAA 2XQBH 5C0CA 1KUMA 5HDBF 1Y6MR 4IDLA 2D7TH 4C56B 3GB7B 3GMOA 2HLAB 3EO1A 2FEDD 3HPLA 3ME0A 4H1LH 4QXGH 3CVHL 5LXGH 5D6DA 4XB7A 4OUOA 2AS5M 4E41D 4LRNL 4O5LL 1SJHB 4XBPB 4JKLA 4MNGB 1GGUA 4NC0B 5CD3B 2YXMA 3BZ4A 5TE7H 1M7DB 3FJTA 3C8KB 2XFXA 4NN6B 2DI8A 2C26A 2GHWB 4ZTPH 5LBSH 4OCXL 1OGAE 4K2UH 3I9GH 1KV3A 2Z9TA 4C4KT 4PJ5A 1MHHB 2HTLD 3DWTA 3LV3B 4PJ9B 4LLQA 5EU3A 32C2A 4PJIA 4FQJH 4Q9RH 1GIGL 3P0GB 1AQKH 2RR3A 1ZGLA 4AIXA 5FM5O 2XNAA 4JB9H 2F53E 5L7XL 4PG2A 4HLZH 3D2UB 1CU4L 2Z8WC 3GSOB 4R8WL 3ZLQC 2X4NA 2KH2B 4H0HB 3PWJB 5IG7A 1ZVSA 2HWZH 5CJBA 3EUUA 5D8JL 1WIUA 1QBML 5BZDB 4AENB 5LJYH 1CFTB 3CDCA 3FB8A 1NAML 1OAQL 2BNQB 4DQOL 1S7WA 3HMWL 2R2HA 3MNWA 2J6EH 4JE4B 3QWRD 3GBMH 4QYOB 4JLRA 2EH7H 1TJHL 2NQCA 1W8NA 1J18A 4O58L 1I9EA 3MRKA 3VG0H 3O8XA 4NCDA 1V5JA 1T3FB 3V6ZA 1J0IA 1MPAH 3EOTH 3ZYIA 3V6FB 3WJLA 4MDIA 2KZ1B 4TVPD 3FB5B 1U58B 2I25N 5EBWA 3FQUA 3VXRE 1Q9LB 3LH2H 4U6TA 3FO1A 3QO0A 5HYJD 1BD2B 4HIXL 3V0WH 2PR4H 2E9BA 4KK6C 5JNYA 1WBZA 4HZLB 4U2YA 5IKCA 3ZKXC 1JPSH 4U6HA 5DUPL 4OUUB 1I75A 5C08E 4HULB 3IFOA 1FV1A 5D6DC 1YUHB 5ALCL 4OCRH 3S98A 1CG9B 5D70L 1UM5L 4KKLC 1LO0L 1BP3B 1MSPA 4BZ1L 3U2SA 1IL1B 2DDQL 4NNPH 4BKLA 3THML 1F97A 3RU8H 4P57B 2A73B 4YBLB 4RDQF 4HS8L 4LPVA 3MV9A 3U83A 2X05A 5KZCB 1QO3B 3ZKQD 4JZJC 5JXEC 1CD9B 3LS5H 2RB8A 1B9ZA 2EH8H 1YPZF 2VC2L 2HN7B 4ZD3H 1MWAB 4PG2C 4Y88A 3MLZH 2R29H 3A6CL 1L7TL 5CSZA 3VFPA 2WIIA 2YWZA 3KJ6H 1OY3B 3RWDA 3QWOB 2F58H 1KIRA 5ACLA 5C0AE 1D3CA 4N0FA 5BCAA 1H5BB 3T2NL 4O00A 5L6YH 4JFOA 5KVFL 1CBVH 4Q7DA 1Q9WA 1I7ZB 4KK5C 5D1ZB 2QSTA 2QBWA 3L5WA 2CXGA 2JJTC 4DGYH 3ARFA 5HI3C 3ULVD 5L9DH 3FHAA 3TA3C 4LPCA 4XHJD 1YN6A 4U7SA 3ALWA 2UUDK 1QSFB 2FX7H 3LEVH 1A6ZB 3ARQA 4RISL 1W8OA 3HC4H 4XNMB 5FV2A 3VRIA 1MWAL 1NGZB 4JO4H 1WF5A 4MA1B 5F96L 2JIXD 3ULUC 3GSWB 2GK0B 1HSAA 5I30H 4WHYH 2DQJL 4KVNH 5EU4B 4QCIA 5B3JE 2MJWA 1ZWIB 4JDZB 4NJ9H 1I4FB 2J7LA 2ZG2A 2VL5B 4M7JL 3ULSA 3FFCD 4UV7H 1KLUB 3JUYA 2YPKB 4PP1D 1NCTA 3MLUL 5DUBA 3ARYA 4OLYH 2E5EA 3UYOD 4A2LA 3BH8A 3GIZL 3QIBB 1XGRA 1YY8A 3CH1B 4X98B 4BH7A 3A67H 4I5BA 4YR6A 5F9OH 1MEXH 5C07B 4CMMA 4EUPA 2CKBA 1XR8B 1U93B 4LSSL 2CGRH 5CIPA 1A1OB 3QDAA 4GQ9H 5J6GA 3AREC 5EN2B 3LZFH 3BPNC 1WICA 4JAMB 4Z5RA 4I18C 2PW2B 3Q1SH 5I71B 1DBMH 1O0VA 3RL1A 2LVEA 5FUCC 4HWZB 2X4UB 2RFXA 1LMKA 5DJAA 1EDQA 5CGYD 2VO5A 5F1NB 4K9EH 3MRIB 4QRRD 1EO8L 4GBXB 3J7HA 1CDJA 2FBJH 1G7PA 4G9FD 4AMKH 1N0XH 2AGJL 4ZTOL 2GSIA 2MQ3A 2WUBH 3V4VL 1EA9C 1BPVA 5IBTH 1N2RB 3K1DA 1TZIA 3EZ8A 4JFQA 4GUPA 2HVJB 1RZJH 1TQBB 2GAZA 1F2XK 5D7JC 3EBAA 5JIHA 2OL3L 2GTZB 2Z93B 5KSBA 1CI5A 2E7MA 3X13A 4XPBH 2NY4B 1ACYH 1CGUA 2D4DA 4I0PA 4OT1L 1JHLL 3BHBB 3GHEL 3NCCB 4LVHC 3S6CA 4ETQA 4HKBB 5EIVA 1VGKA 1CGSH 4DOHB 1JV5B 3RVTD 2CRYA 4MJID 2IANB 4OF8A 3VXUE 3IXAA 1OGTB 2DBLL 1ROWA 4HC1L 4TSAH 4JANB 5EZOL 5J12B 1YY9D 5C0GB 1KELL 2VDLH 1FFOA 3VXQA 2RHEA 2IQ9H 3RNQA 5FYLL 1IAIM 1MF2H 1A6UH 3WL9A 3V5HB 1CWVA 4NZTH 1H0DA 1RUAH 2VAAB 2HFEA 3OKNB 4PJEF 5DMIH 1ZHNA 3AB0B 2Z31B 1IBGH 1YDPB 3L7EB 4RBPH 5JOFA 3KPNB 1FZKB 4GSDL 1JCKA 3MXVH 3MZGB 4LP4A 1UFUA 5FYJE 2A77L 2KPNA 2BMKB 1I3GH 4UILH 4GG6A 1BHGA 4RIRA 3SDCD 1QRNA 3AXLB 2AERT 3SCMD 3VFVA 3L7FB 3IRZA 1RZFL 3NABH 2CLRA 4J3OC 4HDIB 2WIMA 2Z92A 1WBYA 5KG9B 2ENYA 1HDMA 4LLYB 4ZUUA 2HMIC 2XV6B 4WVRA 3VD4A 1CTNA 4MCYA 4HW6A 2OX5A 3OG4B 5CD5D 4NO5B 1TQCB 1YEEL 1NDMB 1FBIH 1WZ1L 4Z7NF 2J3SA 3VWKB 5T3XH 1IGML 1JN6A 1ONQA 4X7FC 2AEWA 5IMLA 2AJ3B 3RPKA 2V2TA 5EOCJ 4I9WD 5CP3H 5DFTA 4K7PY 1J0YA 4F37K 1NGYA 4WUUD 5I17A 3LKOB 5E9DE 5B22A 1BOYA 2EYTB 1ZLUH 1RUKH 3C5ZB 3IETB 3QHTC 4KUZH 3F65A 4G7YH 3D25B 3MBED 5DGQA 4LGSB 2Y5TB 3BWAB 5DEFA 4AH2A 3C6LD 2IAMB 5A2JH 1FNLA 3D85B 5CBAB 3UJJH 1FYTA 4FTVE 2CH8A 3QUYA 1XEDA 3I2CL 2ED9A 5BJTB 2PXYA 3VXME 4EVNA 5I1KH 1TCRA 3DVGB 4XPHH 5SX4H 2WBJB 3MLXH 4Z7WF 3IDGA 3HUJF 3O2DA 1Z9SA 3IDXH 3QUZD 2Z4QB 1VFMA 5IJVB 1F5WA 2BOCA 3G5YB 5I18H 1YMMD 3OQ3B 2YEZB 3B3IA 5LGJB 1FGVL 5LWYL 2DQTL 2NPLX 4QHLA 2HVKA 2V17L 1NPUA 2X4QA 2WUCH 3CVIH 2I5YL 2DYPD 2W9DL 5K9JH 2IPUG 1PFCA 3TVMB 4YHPB 3DX9A 1WBXA 4TUKH 4ODXB 4YHYB 2PYFB 1F2QA 1CLZH 3WFEL 4LEOB 2RIKA 1IC5L 1V8HA 3FB6A 1E6JL 3VGHA 1J1OL 1NCNA 4L1HA 3OKEA 5D1QB 2BXZA 3MV8B 1NC4B 3SDXF 4OFPA 4OV5B 3PL6D 4PJ7B 2BNRD 2H8PA 5D2LB 2BSTA 4CADA 2YOCA 3HE7D 1UA6H 2P7TB 4ZO6A 1EMTH 3H7BB 4APQB 1VERA 4JFFA 2CR6A 4AEEA 4HK0A 3B2UC 3X3GL 3OHXA 4U1NA 1TJIL 1OARL 1X9QA 2Y7QA 3IFNL 4KRPB 3MSPA 2UVFA 4P2QA 4ODWB 2O93L 4IRJC 4X6CA 1DE4B 1T80A 4RGND 4DW2H 2Y36L 2A6JA 3ARRA 1IAIH 4LSRH 4H26A 4M02A 3GMLA 5CJXC 3QDJD 4I0KA 3GSRB 4JGMA 4K7PH 1YA5A 1R0AL 4L4TB 4P46A 4KKCD 5D7IE 4ZUVB 2AJXH 3KXFB 4QRPD 3UZVB 4JY5L 4QXUH 1INQA 3T4AB 2J8UB 1K6QL 1MAJA 2X7LB 5T33H 2PF6A 1YNKL 2OZ4A 1T20B 1OP5K 5I6XB 2PYED 2O5XH 3T65A 4HXBL 1HILA 5E8EB 1MRDH 4X5XA 4JJ5A 2FL5A 3N1PC 4ZOCA 2D7PA 4YBQC 4GW1A 4EN3C 2OI9B 3U4AA 3DUUB 4LK4A 3HLAB 1JYWA 3D3VE 4UINH 4GAYA 4O9HH 4PV9B 4TRPH 4Q6IA 5IQ7H 3W39A 4PJ9C 5DJCA 2VWEC 1RJYA 4H1LA 1CT8B 3OKDB 4N0YH 2FD6H 4DUWA 1FORH 3KR3L 1RIVL 2P8LB 2BHUA 3T0ED 5IVOA 1MI5E 1JPGB 1U2CA 5D71H 1I9JL 1PDKA 3FZUC 5FA3B 4OF3A 1A1NB 5DD1L 3GIVB 2VL4A 3TZVD 4IM8A 2AXFB 1TZHB 3DV4B 3QRGH 2VXVH 1YEDB 3S37X 3K4ZA 3C60D 1BJ8A 3N1GC 4GRWF 3G04B 4ZQKB 4F33A 3SO3B 2R1XA 1G7HA 1RU9L 3FN3A 2R8SL 4GRMA 2AJZB 4MZ2A 3S97C 5IVXA 1R5IB 5AWNH 2BVEA 1YJDH 4NT6B 1EAJA 3CXHK 4P46C 2YWYA 2BDNH 4CVZB 4HFUL 2WBKA 3PQYD 5CUSL 5CCKL 2Z91B 4FZ8L 4L8DB 5FO8A 3N06B 5ITFB 4NHCH 4XP4H 2QSVA 4YX2H 2MSPA 5DEGB 4NOBA 1H3XA 3AROA 3WIIL 3NACL 1LO4L 4PRPA 1AO7E 4JFYA 3S5LB 4HUVA 4OIIH 2P5WD 2ADGA 1CF8L 1GRWA 3DARA 4PJDB 4FXGA 1SYSB 2VQUA 4HUMB 1BFVL 1RK0B 5F7NC 4J4PD 1U8NA 1YYML 3WKMH 3FTGB 2J6EA 1JUFB 1V7NL 3TT3L 4M6NH 4TUOA 4OCWL 2B1HL 3SEPA 1J8HA 5F8QC 1BZ9B 1MFEH 1R24A 2IPTL 3LN5B 1HYSD 3FO2B 4OLUH 1UKSA 4XVTH 1QSEB 5GJTL 4XPAL 4KY1H 3KPPB 2J88H 1I7RA 4FRWA 3RWCB 1RULL 2C7UB 4LCWA 5FHBL 1M7XA 4Q6IC 5C0CE 4IRSB 5I1IL 1K9TA 3K4AA 5HXMA 2D9QB 4OZHB 2IFFH 4HHAB 5I66A 2VDOH 3S7GA 4U3CA 2Y9RT 43C9A 5DSCA 1RZIA 3ZKSD 1BF2A 1N26A 3QG7L 1EH9A 4R96B 3NZHL 4GG8A 3HZMB 3SY0A 5LQBH 3P0YH 1EUUA 2ZCLH 1T1XB 1MCFA 4FQPA 1YEKL 1FZMB 1Z0NA 1VEMA 2YD6A 4P9HH 4PJ5E 2NXZD 2D0GA 2NY5L 4Y5VB 1BMGA 4PJIE 1ZHBA 2ZPKH 1S7QB 4PJBA 5H35B 4MMXC 2MCG1 4NQXB 3KGRA 1LO2H 3PGCB 1PG7H 1FN4A 1CICB 4Y4FB 5D1ZC 5CEZH 3HNTH 4D9QE 1CXEA 4OIAA 1S7XA 2EXWD 1T2XA 2V6HA 5EUKA 1VFUA 4Y4KA 2QQKH 1SM3L 1OTTC 2QADC 2GKIA 1PKQB 1U8PA 35C8H 2IALB 3FT3A 3D0LA 3GSVA 4M48H 5KSVB 4PJ8A 5FGSA 3VWJB 1KIPA 3MOAL 4M3JA 2OS7A 2XWJB 3QEGL 2DICA 3C08L 4HMDA 4HWBH 2EIZB 3T0XA 3UTZB 3ULVF 4F2MB 4K71C 4P4RA 4HS3A 1XGQB 1CXFA 3BPOB 3Q5OA 3LIZH 3JVGA 2HKHL 1MFBL 3ARTA 2BVPB 3RNKB 3NIDF 5EA0H 3ALPA 3QQ9D 3NAAH 4I77H 3EJZC 4S0TD 2V2WB 1WFNA 1W72A 3CD4A 4DGIH 3DHJA 2BXYA 5H37G 4Z0XB 1LK3H 4PJHB 1NBYB 4NCC2 3ULUE 5HPMB 1UYWL 1MUJB 1FO0H 5C2BH 3U82B 4GRWH 1U3ZA 4XBGB 3I6GA 5MHSE 1MLCA 1RURH 4X83A 3V95A 4JREB 3H9HA 4CU7A 4P49A 3P9MA 3PJSA 3FQTA 1SYVB 3HFMH 4W6WB 4DZBB 4E5XB 4P23B 3NH7H 4XNUH 4G8GA 4XP5L 3LSOA 5DHVB 1GHFL 4X6DF 3TBSB 4OBSA 3MV9E 1Z3GL 1RVFL 1U6AH 3DTXA 1E4KA 1IEBA 3GRWH 4PS4L 2Q6WA 1IT9L 1CVSC 3PWPA 2KBGA 1OOAA 3S96B 1MJ8L 1XGPA 5KSAA 3T08A 3LB6C 4OZIB 2FB4H 4Y4KC 2FJHB 3V6OC 4FQCH 1VGEH 1IE5A 5KJRL 2A83B 4TVPH 4XCYA 5IBUG 4MXVF 2HRPH 4ZDHB 2GCYB 5FUCE 4KZEH 1TQBC 3O2WL 3JXAA 4D9RE 4R4FH 1EHAA 1MJUL 1BZ7A 1OTUD 2A9NL 1G9NL 4FQ1H 3HRZB 3KPRE 4LSPL 1RIUL 1IEHA 4DN3L 4KI1A 3U9UA 2ZUUA 4WO4D 4CAGA 5I74C 5FUOH 3BP7B 1TZGH 2C3WA 3EHBD 1LEKB 1HINL 4YIQA 2C4FU 5BRZB 1RJLA 1CLYL 3O6FB 4WW1B 2PTVA 3H42L 1IGJA 4ZXBB 2WM0A 1RZKL 1J86A 5J12C 5CBEB 4XH2A 4K3GA 3DMMA 3HTLX 4OI9A 4PLOB 4UIMA 1H8SA 2P4AB 3H3PL 1I7UA 3LEYL 4P2RB 4UDTA 3VI3E 2IMNA 2AJVH 2P5EB 1MNUL 3NCYS 1EJOH 3FRUB 4WW2F 1ZLVH 3AB0C 1YPZA 1HSBB 2Z31C 2DQDL 3FB7B 1LEGA 2VMFA 3H3KA 2A74A 2ITCA 2LU3A 4ZFOA 4YHKL 5EZIL 4ZS6C 2CQVA 2EDYA 2VLRA 1ZLSL 4KKBC 1MCPL 5K9OB 3TBWB 2NLJB 2I07A 3K2UL 3ZE2E 3GSQA 5CHNA 4R3SA 3RPIB 3TN0A 3SKJH 2R0KH 4YHZL 4JFDD 3U9PH 3B5GA 1E4KC 3GZKA 3ULVH 5E8NB 3L5HA 3MLSL 1MFAL 4X5WA 4M6OL 3V52H 1H3PL 3UYRL 3NIFE 4XPTH 5C09D 3TCLB 5GGQH 4K7FA 1UXSA 5DJ8B 1J88A 5HD8D 3QI9D 1TQCC 1I3UA 2FHCA 3CFBA 1F00I 4X99A 3VGFA 3BDYL 4YWGL 5IMKB 3VWKC 1H15B 1IC4L 3BGMB 2DQHL 4G6FB 4MNQA 2E8YA 1HH9A 2XWTA 3Q3GA 2LABA 1UCBH 3QHZH 3C5ZC 1P7QB 5TF0A 3FQXB 3KPTA 4NC1C 5EO1A 3OAZK 3REWA 5IMOB 1RZJC 3DURB 3GMRA 4H0GA 2IAMC 4FQIL 4Y4HB 4Z7QE 1JVKA 3DMMC 5KSBE 4HS6A 3CUPA 5C0JB 2K7QA 5HY9B 3FQNA 1JI2A 2QHLA 4OF6A 3UO1H 4TPRH 2HG5A 5CP3A 1AKJD 1MQKH 1RV6X 3K2MC 2WBJC 4LSTL 2C3XA 3U0PB 1P4LA 1XGYH 1HOCA 3VMPA 1PBYA 5C9JA 4DCQB 3P77B 2OK0L 1D5XB 3M07A 1OAUH 2XKSA 4GRLB 5HYQB 3EYFB 3ARGA 3CGTA 2BERA 4JZNA 3TN0C 2GUOB 2PETA 1A7PH 1HK6A 1Q94B 4ODVH 4J1UA 4L5FH 5HHMD 4ZUSA 3VFNA 4U1JB 1MRFL 3TVMC 1V3KA 4OM1L 1EPFA 2B2XH 4GG6E 1YMHA 3LHPH 4LCUB 4UT9H 4OLWL 1WWBX 3NFPA 2CDEA 5I2IB 1QRNE 4EXKA 4F8TA 2BY2A 2HT3C 4WI7A 5TGBB 1FNGB 5D1QC 5IK3A 4F57H 3C5JA 3L5XL 4WY7H 3MRLA 3MRHB 4EJ1C 4ERSH 4LLDA 3VH8G 1MJJA 1NMBH 2L0DA 5FKPB 4AK1A 4N0CC 1GZPA 1J0JA 3F12A 1CU4H 2IGFH 3HG1A 4MQXD 4MWFB 3ZL4H 5ESVA 4APQC 4HUUA 5D2NA 4RFOH 4MD4A 2DQGH 5DVLA 2VKWA 3IVKA 5D8JH 2MPAL 4YHLL 1QBMH 4KDVA 4X9IA 4Z7UB 5FF6A 1BZQK 4O2FA 5EU5A 3KLHD 1ZV5A 3BE1L 5C08D 1D9KD 1MH5A 1TJHH 5EC1A 4KRPC 5IFJA 2GJ6D 4HGWA 2N4IA 3SGKC 1F6LL 2VDKL 1J1XL 1WGOA 4L8CA 4P2OB 4KPHL 3EO9H 3MV7B 3NN8B 1M05A 3AC0A 2XXCB 4FABL 1IJ9A 2QKIA 2OR7A 1GGIH 4HWEH 2XA3A 3HZVA 3IS1X 1QA9B 2DKMA 3RL2A 5IT2H 1FYTE 2C5DC 1UKQA 43CAB 5HGBA 2XN9D 3ARGC 2XWBB 1NQBA 2AVGA 1KYOK 2EO1A 1AI1H 3OKLA 1KTDB 5ALCH 4F7PB 3NOIA 1UM5H 3OXRB 1LO0H 4UMGA 5D1XB 1A3LL 4IOIA 4Q9BA 5JR1H 3OJDB 4KQ4H 1Q9OB 5I16B 1G0DA 3NZ8B 1ETZB 1JPST 3GSNB 2FR4A 4JO3L 4RAUA 4XX1E 3TM6A 4NFBA 3BOVA 3MRRA 3QSKB 4Y16A 4HS8H 1XR9A 2AXGB 3WHXB 1P69B 1RK1A 2OI9C 1NEZG 5IHUH 3TH2T 1OP9A 5L2JA 5INDA 2MQ0A 3RWHB 2VC2H 3CFJA 3STZA 4DKEH 1NUFA 4OSUL 4X5LA 3JV4A 2ID5A 4IJ3C 3QFDA 1AGFB 3DETC 3I50L 3B9KB 3HPJB 5ANMB 3SPVB 3VD5A 3MJGX 2Y07L 1SJEB 2APFA 2GQHA 5FOBB 2O61A 5ERWB 3T2NH 2FH6A 4XCEB 4QRUA 3WO4B 3STLA 3VXSA 2H26A 2AABL 1IM9D 2GTWA 2W59A 4MCZB 3W11C 2VDQL 1VA9A 3GSNL 1R5WB 4DK3A 2DTML 3CIQA 4PGEA 2ESVA 2FX9L 4XMKL 2JJSA 4L8BB 1IAKB 3SO3C 3PHQA 3VFOB 2LU7A 4XBEL 3D39A 5HVWA 5L88L 4JO1L 4JFFE 4G6ML 4Z7WA 3TESA 4LBEA 1UWGH 4XX1G 1RPQA 1F3DH 4GJTB 5FGCE 4XPFL 1C08B 4JM2B 4P2QE 2VQ1B 1W0VB 1ZHLA 5ILTH 4X6CE 2H9GA 1F3JB 3ARDD 4NKIH 3F7YA 3BZFB 5SWZA 4M7JH 2UUDH 3MCKA 4Y7MA 3F5WA 2D7MA 2HLFC 5ICYB 3KS0H 4OFIA 4Q9CA 3L3KA 5MEQA 3KPLA 1RUQH 2BVQA 4POYA 2A6IA 3T2QA 1TCMA 4RFEB 5FUZH 2XZQL 2P43B 4AL8H 5IJKA 1XGTA 5IWLA 1CFNA 5TH2A 3BPCA 3HI6L 4OCMC 2QQNH 2X9WA 3VMNA 4EOWL 1T7WA 4QNPF 4RMUA 4UOW0 3OWEA 4IRSC 2ED8A 3TFKC 5GSVB 1P5UA 3SDXA 3HI1A 4Q9QH 3OKMB 2H1PL 3QFJA 3EYVA 4QTHA 1EHNA 4EKXA 4WGWB 3UTOA 5F7YC 4Y1AD 4JZOA 1JGLH 1R5VB 2UWEF 5DDHB 3VFRA 1MCOL 5MEOB 4KUCD 2DLTA 2ZOLA 4LLMA 1U2HA 2XOTA 1XH3A 2AGJH 4NBXB 3O6LH 1BVKA 1DFBH 1MCWM 3ALXA 3WXVH 2EE6A 3OGCB 3MA9H 4Y5VC 5ALBL 2JJSC 1SBSH 5F6IB 2WWKT 5GS0L 4CL7A 3W5NA 1S7SB 3FOLB 2JCCF 2YD8A 3MRQB 4QXTA 4I3GA 4M43L 2AJYL 5HBBA 1YECH 3MBEB 3X12B 1CICC 5C8JA 2Y23A 3HA0A 5I75B 1U8QA 1ZT7A 5EZJA 5F9WB 4G5ZL 5DFWH 1IZJA 5FIEA 3BZEA 2DN7A 4PG9A 3V0VA 1GZQB 3NA4A 3RVWC 4OV6F 3I6KA 4OZGB 4OT1H 4NSKB 3JTSA 4D0BB 5HYSB 1IGIL 3FCTB 5FYJD 4P4KA 4JG0H 3X11A 2ARJQ 1NANH 5E6ID 3QUXD 4P5KA 5IVXE 4JQVC 2DBLH 2C3VB 3BPOC 3KG5A 1YJDC 5FHAH 3S34H 1GYAA 3K0WA 2BVOA 4TULL 5CILH 3BKYH 1T21A 5IW3A 1MHEB 3N9GL 3S36H 3TNNA 2BX5A 5IJKC 1NDGA 5F89B 3MGTB 5L2KA 5F7KC 3WS6C 2F15A 3W0WB 4PRPE 4BQ6A 1OAYL 3H2WA 1MFDH 3VXTB 3CXHJ 3G5ZA 4XCCL 1MJ7H 2HP4A 5E4EB 4N5EC 1XIWD 4HWBA 1OW0A 15C8L 1A7QH 3DVFA 1J8HE 1WT5C 1IQWL 4N1EA 5KBNC 4E41A 4JPKL 5T5FL 1F4WH 3IYLW 3QH3B 4B7LA 4OIBA 1I7TB 5GQBA 1C8PA 4UQ2A 1S8DB 1HHKA 4P23C 4X4YB 4LCWE 2G60L 4WFED 5M95B 1KTKE 4CVXB 1BJMA 4QWWD 4KHXH 5E6ZA 1Q9KA 3EOBA 3OKKA 4RCAA 2FWOA 3HE7B 4MJ5B 5HSFA 3W9DB 2LE9A 2X1PA 4V1DD 5T1LB 4DN4L 3OKYA 1FO0A 3WNPA 4JY6A 4NQVB 4HLZG 3QJHB 3HR5B 4FTVD 2HRLA 3BQUD 4H5SA 4CVUA 4NJAL 1PG7W 1T6VN 3VXMD 3L9RB 3GJEA 4DVRH 4LLWB 3L3GA 4LLUB 4X7SL 1GGCH 4S1DC 4XVJH 4F7MA 2PO6B 4P9HC 2GY5A 4RGNB 4RZCA 3QXUA 4P2YA 4PJBE 3VRLE 2EC8A 1TVHA 2VXUH 4JRYB 4PGDA 4MX7A 5T1KD 3ZDZF 1JFQL 4YNYB 1RJZB 5IBLD 4KWUA 3QDJB 3BW9B 3C9NA 3QWRA 3GRWA 3OX8B 1ZT4A 1BIHA 1BEYH 3EZJB 4WDIA 1EJ6A 2GIYA 3PWLA 5DWUL 3FQRA 2ICWB 2P49B 4WHDA 3D9AL 3O6FC 5HDQL 3TJEL 3U1SH 2W65A 3VFTA 5E8OB 4ZXBC 4RMVA 3MOQA 1BVLB 4LMQI 3KYNA 2BCKB 3WEXA 4U1HA 5HYJA 4L9LA 4WJ5A 1XF2B 2VLME 1OD9A 1CFVH 5I15L 8FABB 2FEDC 1RZ8B 5HDBE 2V5YA 1G9ML 1MIML 3MA7A 3QQ3B 1G6RL 3MACL 1INDL 4XPGH 3KYOB 3I6LD 3QDMB 1EFQA 1FL3B 1KACB 3OKOA 1BX2A 5IROA 2QHRL 1N6UA 5CGMA 3R1GL 2UYLA 4S2SA 4XGZA 4HIJA 2H3NA 1XGUB 2I5YH 3FO0L 3DRTA 2HTLC 5L8KB 1A6VL 2XZAH 5K93A 1KTRL 2IADB 2QTEA 1X5JA 5BZWB 4FQQA 4N8VA 4HLJA 3R06A 3FONA 3O3BB 1E6JH 5T3ZL 1J1OH 1S7RA 1QNZL 3T77A 4WU5B 1QPXA 1JZ6A 4L3ED 2I9LB 2IH3B 4H8WL 2X9YA 4G8GE 3S35L 4UTBL 5HDOA 2ICEB 1D7FA 1VFBA 2ITDB 4NDMA 3PXJA 3WXWH 2ATPB 4J8RB 3VFMA 1E4XL 2NTFB 3IGAA 3PWPE 1NJ9A 1MVFA 3PIQA 3DO7B 4ZSOA 1TTGA 5F7HA 1XZ0B 4YHOH 1TJIH 1OARH 3BIAX 4TOYL 4UT7L 4HUXB 5FAAA 4TSCL 3GKZA 4PP2A 4R0LB 1FLRH 2YD3A 1XF3A 5C7XL 2D0HA 5HGHA 1E0OB 3O3UN 2W0PA 3DX8B 3QXVA 5GS0D 3HS0B 4N5UA 5J6HA 2YK1H 3NCFB 4WHYG 2JIXA 1BOGB 1R0AH 3BH9A 3G6DL 5F7WC 1I9RH 3DI3B 1A6AA 3EFDL 3LMJH 5IMMA 4AZ8A 4I2XA 3MJ9L 3MQIA 5D6CB 3VRJB 5KVDL 3DHMA 3FFCA 2FBOJ 4D0CA 2D4FA 1MHCB 1JNNH 5DYOB 1N64H 4M1GL 4K7PX 3LKPB 4GRLC 3T0VA 3LRSA 5IOPB 1D6VL 4X6DA 3MFFB 1QBAA 5DURB 1QEWA 1HHJB 3SGJA 4RQQB 4JVPA 1IQDA 4MAYD 1YPZE 1D6EB 4KAQL 3ZT7A 3CC5A 2C1PB 4JPIB 4OKVA 3LDBC 4ZG1A 3NA9L 4OD3L 1T83A 4PTTA 3CDFA 3VW3L 1LVEA 4ACPA 5FKAA 3RZCB 3VXNB 2VLRE 5KTEL 5EFIA 3SBWC 2DI9A 4U6XB 3PGFL 4LPYA 1OP5H 4YXLH 3CU1A 5GGUA 4YDVB 4QRRA 1KJ2H 1RIVH 4ORGB 3OPZH 3R0MA 4G9FA 4GKSB 2M1KA 4NUJA 1DN0B 3QQ4B 3EYQD 1VPOL 2BVYA 4UOW1 5JIKA 3ULVC 4JQXA 1AJ7L 4LP5A 4XHJC 5DD1H 1TVBB 2YHGA 2FCBA 2Q8BH 4NQCD 3WNOA 4LSUL 5B8CB 1CDIA 2NZ9D 4PRBB 1A4KB 3IRPX 3QCTL 3QEQB 5GJSL 5C0BA 5EO0A 2A1WL 3LS4L 4MNQE 4ZFZA 4KJQD 5C92A 5HHOB 1UM4L 3CPLA 5I9QB 4JRXD 3EO0B 2FH8A 1ORQB 4MJIA 5EIQA 1NCUA 2AQ3A 4P2OC 3RTQD 3SKOA 5C0CD 4WW2A 3BP6B 2X44D 4FQXA 1NAMA 3DRQA 4OAWB 4RRPA 5T3XE 3PHOB 2DQUH 1D5IH 4JN2B 1V7NH 4D8PA 1HXMB 3EIFA 4OD1L 3U7WL 1HKLH 2B1HH 3DSFH 2XPGA 4DAGH 3CFKB 5MEPB 1QTYT 1U95A 3FOMA 3SGJC 4KJYB 5LG1A 3HB3D 2ICWI 5D1XC 1DLHA 5EWIL 3T4YB 1A7BA 4PJ5D 1SY6L 1Z9LA 3KPSB 2YBRA 5I1JL 3K1KC 1T83C 5I1IH 3CFDB 4NGHL 3SDCA 2MKLC 2Q7NA 2ZNXA 1KCLA 3SCMA 4D9QD 5CGYC 3BKJL 1DN2A 3SKMA 3Q0HA 6FABH 1F8TL 2W60A 1T4KB 3NZHH 2JELL 4X4XA 5E6YA 1KTLA 3OTTA 2DJ4A 4FXKA 4IRZL 1N8ZA 4QHMB 3DX6B 3OV6A 1TJGL 3H9SA 5CEXA 5HHPB 1EXUA 3FQWB 3EKCA 2NY5H 5CEYB 4MA7L 5J0BA 4M93B 2Y06L 3WO4C 1NCDL 5EO9A 2ZJSL 4HKXA 2CSPA 1HXYA 4L4JA 1KJ2B 4KXZI 4P9ML 5F1IA 1FC2D 1GC1L 1V7ML 3BVNB 4UU9B 5F93C 4WO4B 4WUUA 1DBKL 3HG1E 3ARZA 4IS6B 5DQ9B 4EXPX 5D2NE 5HGAB 2AQ2A 4JR9H 1MREL 2I24N 1A47A 5AZ2H 1T22B 2VJXA 4YUEL 1I1CA 2X4OB 3MOAH 5IVNA 3S3JA 1YY9C 3C6LA 1G7LB 3QUKB 3C08H 1R3LB 1PG7X 5ITBL 2F5BH 1YYLH 3GEWB 5MHSD 4GKOA 3MRBA 3QPXH 5DTFB 4AIZA 1MFBH 3QZWB 5E5RB 3G5VB 1N7MH 2CDFB 2WWMD 3I02B 5JPNB 3QCUL 4X0KA 3HE6B 1QO3A 3QUZA 1CL7L 3DI2B 4LVOB 4AG4H 1DUYA 3TT1H 3EYUH 2FJFB 5FDWA 3V4PL 1YMMA 1F4XL 1FNAA 2DMBA 1FFNA 5FO9B 1NBVH 2FEEI 4TVSa 2AEQL 4JFDB 1EFXB 4K3EL 3BP4A 2VITB 2BHZA 2W38A 1JHKL 1T03L 3EYSL 4RFNB 4KROD 3GUTB 4Y19A 4ZFFB 2DYPA 4PJAB 2DQFA 3MCLL 4ZPVB 2R0ZH 1WCBA 4OGYH 1FVDA 4NRXB 3O11A 4O4YL 1AQDA 4CU8A 4S1QL 3QI9B 5CD5C 1JZ2A 3U6RA 1T1ZA 3SQOL 1ZS8B 1U8JA 4G8FA 2X4SB 3KPRD 1Z3GH 4HEME 4M7KH 2R2CA 1P6FA 4PJXF 4R90L 1U8MA 4Z77A 1WC7B 3IJHA 5GRJL 3VA2C 9CGTA 3LQAL 4PS4H 4Z7NE 4CVWA 2OQJB 2EO9A 4LDEB 4WWID 2G5RA 1MJ8H 4NQDD 6CGTA 3PL6A 1P4BH 3P11H 2BNRA 4WEMB 3LKNB 2W0LA 1NBZB 2WWKO 3U36A 5F6IC 2FLRT 3B6SB 3MX0A 2VISB 4F7TA 5KS9F 1JJUA 3ROLA 1J5OL 5TQ0L 2GSGB 4QHNA 3WUWB 3HNVH 3MBEC 1KEML 4KTEH 4LCIH 5TDNB 3O2WH 5TPWH 1G7QB 2UZIH 3C6LC 3F7PC 1M7IA 4OZ4A 4YBHA 5F9WC 3VXSE 5I19L 1WZKA 4HJ0D 1OHQA 2YRZA 1A5FH 4U6VL 4XVUD 1FH5H 3CXDH 1TPXC 4GKZA 2X89D 3S5LG 1DUZA 3AM8C 4YFLI 3WYRA 1AKJB 4ISVB 3SN6N 2ESVE 1S7VA 2PCPA 3WJJA 3D39E 1HINH 1OGAB 3W9EB 5L0QB 1P7HL 3MLWH 1CN4A 1WZLA 2X4TA 2XKNA 2HFGL 2W07A 4PGCA 4Z7WE 3QUZC 1T89A 3L5IA 5D7KE 4BJLA 3EDEA 3PABB 4OF0A 4PJFF 2OL3A 4WWKA 1ITCA 4AM0B 4NO0D 2W91A 1ED3B 3C5SA 4QRPA 2A9MH 3H3PH 2OR9H 4N0UA 4L4VD 1WFTA 2F53B 3WE6B 2G2RA 2KUTA 1J1PH 1JMXA 5SWZE 2FGWL 4QRQA 3MNZB 5E4EC 3E8UH 2FX8L 3ILQC 1KSRA 4HC1A 1T04A 3NIGF 2PYEA 5EZIH 4M00A 4I1NB 1QVOB 1QUNA 3K8KA 1KJMA 4KV5F 3VDAA 4X80H 3GI8L 2A6DB 4LCYB 4YC2B 3REVA 4DKFH 1ZA6B 5JXAL 4S10A 1WFUA 2DI7A 5A3IC 5DQJA 5GGSB 3T1WA 3PL6C 3SDYH 4AEHL 4PRNA 3SDXE 3HE7C 5C2UB 4R4BB 3QFJE 1H3PH 2A0LD 3UYRH 2CIKB 1X5AA 4EI6B 5F3HB 3ARWA 3VXRB 1DQDH 5T1MB 5JIIA 4WNQB 2HKFL 5GIRA 5GRYA 5BV7B 3LKQA 2FSEA 3T0EA 4K8RD 1FFQA 3MLRL 4WEBH 3B2VL 4GMSH 4I0PD 3BDYH 1AGDA 5C08B 1QLFB 4MDJA 5MERB 4GW5B 4ZUWB 4UOJA 3CLEH 3TZVA 4Q58C 5EC2B 4HUWB 5IP4A 4W4NA 3C60A 5J8OA 4RGNC 1I1FB 3DBXA 2CDGB 5FYJU 4JG1L 2O5YH 5D7SL 5CMAB 2F74A 3MLPA 5BW7C 2X5PA 5HI5D 3GMMB 1I3RA 5I1HL 1T89C 5TDPA 1CE6B 3HAEH 3QJFB 4DKDC 4P59L 2B39A 1SVZA 5DR5L 4ALAL 2OLDA 3PQYA 5DJDB 5EU6D 1N5AA 4MXQD 3MXWH 4BH8A 4M1DH 3U30B 3TO4B 4CW1A 5BV7L 2C4FT 3WNLA 1F4YL 3IFLH 3WDHA 2P5WA 1BM3L 2ZCKL 4ZYKB 1HHHB 1BIIA 3QUMH 3IS0X 4YXHH 3BRDA 3KPOA 1G84A 5C0AB 2D03L 3D1MC 5E00B 1JRHL 1LNUB 4IMKC 3E6FA 4UB0H 3ZTNH 3RWEB 2XTJD 3SO5A 1RZGB 1BQHA 3DXAD 3MRJB 5DT1H 5L2KE 5E56A 4S1RH 2UWEA 5J3HD 1VKXA 1BBJA 2DD8H 1BJ1H 1RFDL 4OM1H 1YEIL 5DI8A 4WUKH 5IB2B 4D3CL 1UZ8B 2VE6A 4E41E 4URTB 3T0EC 3IJYA 2JCCA 2UV3A 12E8H 3GNML 1WAAF 4M7LH 4NNXA 5T1DL 1HIML 4MXWH 2B5IC 3J8F7 2VTFA 4XTRC 2H2PD 2YPLA 2F5AL 4WTWA 2EDBA 1KEGL 2EEAA 1HWGB 4ODSH 2IC2A 5DVMA 1E4WL 3EGSB 3SQBA 1RSFA 2DRUA 5FYJH 4PRAA 3QNYA 1NGPH 4GRWE 4MJ6B 3QULA 4MSWA 5BJTA 2ADIA 1NAKH 2MPAH 4FFZL 3GJFH 2QR0B 1W0YT 4WFGE 5E7BA 3D48R 4LLVB 1J05B 3C09B 5KOMC 2F8XC 4P5TB 3MROA 1K8DA 2CKNA 1RHFA 1U91B 1UVQA 2VLKD 1LK2B 2X6MA 3IU3B 4GLRH 1HHIA 3TH3T 4ENED 4J4PC 5LGHH 4TQEL 2B4CH 1YNTA 3DIFA 1MIEL 4I48B 1UXWA 4TTDC 5D93B 4BFEA 4PFEA 3MLYL 3GHBH 1KCSL 3KVQA 4XZUA 1RZ7H 4XNXL 1HYSC 5KVEL 4WTZA 2FJGA 1XF4A 2VZOA 4PGJA 1NMAH 4N68A 5HYJE 4LNVA 1LDPH 4I3SH 3UTQB 3BGFB 3Q5YA 3QUMB 2R4SH 3CLFL 1G1YA 2KQMA 3DOSA 4HXAL 4U6YB 3QIUA 5DRNB 2FYYB 4U1SA 2P45B 2VDPH 4F7CB 3SGDH 4KFZC 1K8IB 3BMWA 5HHNB 2VR5A 2R1WA 4HMCA 4HPYL 4X9GA 5I1CL 1KB5B 2Q20A 5EZLA 4Z7OF 1CDUA 5C0IB 5IGXL 3O6ML 1U92A 2CK0L 3ARBD 3P3YA 4OSUH 3WIFB 1RUML 5IHZB 3RZCC 1Y6NR 3O2VL 3VXUB 1MCHA 1CFSA 4JFFD 5F1SA 3KAAA 3RQ3A 3NCJH 5D72L 1AXTL 4WU7A 1UJ3B 4JM4H 4XC1L 5F7EH 3PGDA 2DWDB 1FE8L 2R23A 4EBQH 2BP3A 2AABH 3KLDA 3BRFA 1IGFH 3VFSB 1BQLH 2XQYG 1DVFD 2EDLA 1S3KL 4ZUVA 5B8CC 4U33A 3S9DB 3CZFA 3DX7A 4JHZA 5C1MB 3MRGB 3R8BB 4J3SA 4V2CB 4HG4K 1KB5L 4H25B 1AP2A 3WNNA 3W2DL 5D5MF 1JGUL 5IEHB 2BFVH 1A6WH 4PBWD 4ZSOE 2APBA 1ZSDB 3V5KB 1PGRB 4EI5B 1ND0B 5I9QC 2FZ3B 2FATL 4LSVL 1DBBH 2GFBA 4MA3B 3QQ9C 1JRHI 1OWRM 3F7VB 3NIDE 2ATKA 5A2KH 4GAGL 1QHPA 4OF5A 3WN5B 4BZ2L 3BUYA 3U7YH 3UP1A 1JHTB 5HGDA 5GGTL 5DUML 1ADQL 4KMLB 3O3DB 3VFWA 1EZVY 4I3RL 1FRGH 4MZ3A 2YS4A 4I2XE 3UPRB 4LVNB 5E2VL 3SDDA 4WTXA 5D7LD 4FP8L 4MAUH 3FFCE 3WLWD 3H8NA 1ZGLM 5JO5B 2P8MB 3HI6H 4K23L 2D7QA 5E9DB 4RNRA 4C55A 5B39B 1S9WB 1PSKL 3JV0A 2OXGA 4ZNCD 2N7AA 1UACH 3FT4B 3KWWB 3P4LA 5ABDE 4P3CL 4P0DA 3S3SA 3IDJA 3TIEA 3O4LB 1ZKAA 2QSCH 5GRUL 4X6DE 4Q2ZA 5EDXA 1KCVL 1AD9B 5E24E 3LQZA 4HKZB 4KRNA 3CSPA 1FFPB 1I8MA 4UUJA 1MCOH 1OM3L 2SEBB 4LF3B 1VSCA 3AFLA 3EJYD 3VXMB 2ENSA 2J8HA 3L1OL 1DL7H 2WINA 5C09A 3BN9D 5HGGS 3G08B 4U31A 5F9JB 2ZWLT 5DJYB 3V5DB 1T0MA 1HQ4B 1JZ4A 4M93C 5T1KB 3N1MC 1YEFL 5ACZB 4QRRE 2BC4B 1OTUC 4M43H 1QYGH 4LAJH 4G9FE 3VXPA 3LKSB 5EBLB 4FG6D 5J57B 4H88H 2J5LB 4WO4C 1LO5A 5IR1A 4RBPK 3PWUA 2P8PB 3MO1B 3EHBC 1OSPL 4YPGA 3SE4A 5GRVL 3EFFA 3PUCA 4NKOB 1DEDA 2NNAB 2IG2H 5J13B 1AC0A 3TIDA 1HH6A 5C0BE 5DJ0A 3IKKA 1U3HD 5DRZA 3AMLA 2G5BB 1C16B 1VFAB 1S5IL 2MWCA 4ODBD 4C56E 3OAUH 5TQ2H 3JUZA 4OFYD 4LCWD 1QFHA 4HHAA 3N9GH 3VCLB 4ZAKB 4MJIE 4PJCF 3HE6C 1KN2L 2HT2D 2ZOKA 4LVOC 4OLZH 1IGYA 4LRIA 5I8EA 4A6YH 1QSZA 3MRPB 3DJ9A 1KCRH 4M6ML 5DJ2A 3MJ7A 1T1YA 2JTDA 5E5MA 1M71B 1A8JH 4RFNC 4LNRA 3BD5A 2FIKA 3MR9A 1JGEA 3WFDL 3AVEA 2VDRH 1U8IB 3W81A 1A14H 2G60H 2X4RB 2CUHA 4ODUB 4NPYB 1TITA 2DMKA 5HD8C 3QI9C 4JPVH 4QY8A 1FL5B 2R2BA 3ILPA 2ARJB 3WFCL 5LGKA 4IHOA 4G43A 2YZ1A 4HKJB 5D7IB 5IFAH 4Z76B 3VWJA 2CMRH 2BY0A 3PP3K 3WHE0 1R3HB 4R7DA 5H8DA 1MRCH 1AD0A 5DD5L 3MODH 5LAXA 3TBTA 1S9XA 3AMKA 1N59A 3H9SE 4I8DA 1F02I 4JFHE 4Z78B 3U4EB 4PTUA 4OCLC 3HC3L 2DLFH 4J6RL 1HQRB 3KDMB 3CFEA 4NIKB 5E99L 2B1AL 4NKMB 5FV1L 5IESH 1RMFH 4CN1A 1CFQB 1D9KA 2FRGP 4NM4L 5DA0B 1A9EA 5JDSA 3PV7A 2O26U 2VZVA 4PYHA 2H32B 5E2UL 2AK4D 4XNQB 2GJ6A 3RAJL 4WUUE 3OR6A 4Z9KB 5DK0B 4EDXB 3M8OL 2V2XB 4WI4A 5FCSH 1C5BL 3D3VB 3CMOH 5DWUH 1DR9A 5C0RL 4PRHD 3RGVB 4PUBL 1D5MA 2WAHA 3EDDA 1FIGL 4LRIC 1CZ8L 4NRYA 3QXAB 4LU5L 5MEND 1U36A 4RGOL 5I15H 3WIHL 2XN9A 2Y5EA 5J1TC 3TYFA 1MI5B 4YDKH 3V7AG 1G1CA 1G6RH 3MACH 4YXKL 1INDH 1Y6KR 3H7LA 4JDTL 3MGOB 4MD0B 1YEJH 3L3HB 4MAYB 4U1IB 3AS3A 2AKRA 3KHOA 4JFPA 4K94H 3HHRB 3R1GH 3OL2A 1YMME 4CKVX 1AXSA 5F1OB 4QRTA 4G9DB 3U0TA 4KTYA 3BEWA 4Q0XL 5BXFB 3L3IB 1X5FA 3JWDL 4HH9A 4G7VL 5DK2A 4ODTL 1Z9MA 2E7HA 2VQTA 2HT4D 1A22B 5ETUA 4OZFA 4L9DA 4YQXL 4Y19E 1QNZH 1DBAH 5KN5A 3BT2H 1DQJA 5EG6C 4CDGC 4KK8D 2OTUB 3ARVA 4MQXC 5A16B 4KMTL 4NZUL 1AO7B 2VH5H 4G3YH 4OGXL 3Q6GL 2IPKA 2NW2A 5IF0B 5I1AA 5FECB 2BOBA 1AGBB 4M5YL 1ZHKB 4PREA 3R4DA 1NCWL 5HYIA 1IM9A 1S7UB 3QNXB 4KQ3H 5DZLA 5HI4C 3O3EB 5HYSG 1JIBA 5ESAB 5BO1L 1KN4L 2GW5A 3N1QC 2BNRE 4NP4L 5ID0A 1QBLH 1SBBA 4CGTA 1X7QA 1X5HA 3SDAB 5JPMA 5C0CB 3KNBA 2VDML 3CX2A 2E8ZA 3ZKXB 4EQ3A 3GMOB 3EO1B 1P9MA 3HPLB 1L4IA 2BVTA 3LN4A 1OT2A 1H9VA 3E2HC 1ZT1A 2E6JA 4PGBA 4UDUA 4QF1A 5DK3A 4F3FA 3G6DH 3UX9B 3OJVC 2NW3A 3O0RL 1I1AD 3ARDA 3BZ4B 3QDGD 2XFXB 4HIHA 5K9OA 4PD4J 2IWGA 1KCKA 3NPZB 1FSKC 2X1XR 3QG6A 2G75A 4PJ5B 2UY7A 5HHQA 4LLQB 5EU3B 4ORZC 32C2B 4PJIB 2EC9T 2OP4L 4M9OA 1IARB 4QHKI 3HAEA 1KXTB 5C86A 1M6OA 2BJMH 4QRPE 3BKCL 4KMQA 4G8EA 1ZGLB 4N0UE 2XNAB 2PTUA 4JPWL 4XWGH 4HF5L 4PJXA 2HFFA 1QKZH 2X4NB 4WCYL 4OLVL 5IG7B 1ZVSB 2GYSA 4KAQH 3O41A 1CYGA 2JKXA 4XCFH 1FNHA 4JFEA 3NA9H 1UB6A 2PYEE 4M4PA 4OLEA 3FB8B 4YDIL 1S7WB 2R2HB 3MNWB 4Y1AA 5KS9A 4BFGA 1MHPL 3RWFB 1N6QL 2NZIA 4AQOA 3MRKB 4Y2DD 1NGQL 5ADOH 1I3VA 3O8XB 4J12A 1K4CA 1Q1JH 3V6ZB 1VPOH 4ZS7H 1AJ7H 4MDIB 3TO2B 5EBWB 3OAYH 3FQUB 4Z95L 1NBQA 2I60L 3O6KL 3FO1B 3QO0B 4GO6B 1T2QL 2PW1A 2QJDA 3T0EE 5JNYB 1WBZB 3DV6A 3I75A 1NCBL 5IKCB 1VEOA 1P9MC 3QCTH 4U6HB 3U0PA 5DRWA 4JGUA 3IFOB 1FV1B 3BUTA 5CIPH 4LSDA 1KLGA 4PJFA 1WFOA 4OGAD 4UAOB 5EORH 4AT6A 1J12A 4PR5A 4BELD 4Z6AT 4OI8A 3U2SB 5AYUL 3JZ7A 3HCVA 4QKXB 4BKLB 5E6IA 3QUXA 3U4BL 5HYFA 5D93C 4JFXA 3RIAF 3GJFA 3V6BR 3MV9B 1CDGA 4LHUA 2V5MA 3FFDA 3PQYE 3PDDA 5EUOF 4KDWA 1HZHL 3EW3B 4RA0C 3RUGF 3U7WH 3WFZA 3KHQA 1IVLA 2P5WE 4W6YB 4CN4A 2EDRA 1OLZA 5CSZB 4FZEL 4DVBA 3VFPB 2WIIB 5I1EL 3RWDB 1XIWA 3L3DA 5IB1A 4QNPE 4AEIH 1KIRB 3HZYA 3N85L 4N0FB 4FQ2H 3H6JA 4JFOB 4K8RH 1Q9WB 1NC2A 3WFHA 4WRLA 2GT9A 3L5WB 4PLJC 3G5XA 3ARFB 2DJUA 1SEBA 4O51A 2UWEE 1TFHA 4D9LL 4AYFA 4KHTH 1YN6B 5IB3A 5DHYA 4HPOH 3WSQH 1CD0A 3JV5A 3KYKH 4KH2A 4V1DA 1TJGH 4NQEA 3VRIB 1KXVC 1MELA 4GT7A 4X6EA 4MA7H 2JCCE 4FTVA 1HSAB 3BQUA 2A2QT 1NCDH 1FJ1A 2ZJSH 3RWGA 2EDQA 5CZVL 4QCIB 3ORJA 1WISA 4P9MH 1KG0A 3QEHA 2YPLE 1V7MH 3F58H 1O7SA 3ULSB 3C6SA 2XRAH 3ZZ1A 1LO3L 5FCUH 5DUBB 3WD5L 2R2EA 1FCCA 5E6IC 5EBMA 3BH8B 3WHE1 3P0VH 4J3VA 3L6FA 1XGRB 1YN7A 4YUEH 3S37L 1YY8B 3SGEH 4ZFGL 5F3BA 4BH7B 2W9EL 4I5BB 4YR6B 3UJTH 4CMMB 4EUPB 2CKBB 2N1KA 1IC7H 5CIPB 3RJQB 5J6GB 4UTAH 1JGDA 3CZJA 1JK8A 2EKSA 4Z5RB 3WN5C 1MAKA 4AJ0A 3QCUH 1YNLH 2OR8A 3RL1B 1XIWC 1CL7H 4XC3L 1FAIH 2VXSL 1MCCA 2B4CC 2RFXB 4LSQL 5DJAB 4IIQA 5ICXA 4LVNC 3T0BA 1UGNA 1OL0A 2Y1VA 1G7PB 5C0EA 1WCQA 2WK2A 2GSIB 2AEQH 2E9JA 2Z8RA 2BRRL 1WAAA 1JPTH 1C12A 4QWWC 1TZIB 1WZMA 1NFDF 1NLBH 4JFQB 1KPUA 4GUPB 4GAJL 3E3QE 3JWNC 3MJ6A 2R69L 2DF3A 2GAZB 2EYRA 3CDYA 4NZRH 5C0DA 1UQSA 3VXSD 5KSBB 1BLNA 3SQOH 2NXYD 4L8BA 1A1MA 3X13B 4BQCA 3BQUC 4I0PB 3OJ2C 4R90H 1GCFA 2Z35A 4NWTH 4L3EA 4JFZH 4Y5YA 1INEL 4ETQB 3AY4C 3QIWD 1U8KA 4KZDL 1VGKB 1UM6L 5F1KC 1Z6JT 3O2DH 3JTTA 1Y18A 4QTIH 3IXAB 2WNGA 4IMLA 3TYGL 5L8LB 5IBLC 1FFOB 3E0GA 3ZDZE 1VACA 4UT6H 3VXQB 3QNZA 3BZFA 3RNQB 4YDLB 5KVGL 5IW1A 1QFWM 1R3JA 3WV0A 1UWEH 2J5LC 3WL9B 1ZLVK 1LE5A 1NLDL 1RI8A 3MREA 1CR9H 1H0DB 1LQSR 2G9HA 5JHDA 3MRNA 5JW3H 1ZHNB 4M5ZL 5SWZD 2F19L 4LIQL 2DQEL 5JOFB 5JXED 3MNVA 2XA8L 3B9AA 1TIUA 5J13C 2Y4SA 4GG6B 1GAFH 4OCSL 4RIRB 2A6KA 5DS8A 3TV3L 5HPOA 1QRNB 2R4RL 1NL0L 4PB9H 3RDTD 3BSZH 3A0OA 4IIQC 3VFVB 4LGPB 2KL6A 5GRXG 1AHWA 4F9LC 1F90H 1KPRA 2CLRB 4ZAKC 2YUVA 3K4DA 3QXTA 2Z92B 4P99A 4HG4J 3F8UB 1WBYB 5JQ6H 1KNOA 1HDMB 1QFOA 4ZUUB 4KK5D 7FABL 1DLFH 4MCYB 3M1BA 5JHLH 3MUJA 3P9WB 4GS7C 5FYKD 4YGVA 1GGBH 2IH1A 4JHAL 3AU1A 1FGNH 5EOQL 1ONQB 2X40A 5IMLB 5FB8A 4QO1A 2V2TB 3MRCA 5E8DL 1RY7B 1NGYB 4Y5YC 4O2CA 5I17B 5JXAH 2DLIA 2IBZX 4J3TA 1IFHL 4S1SL 4A6YA 3ISWA 3QQNA 3MRDA 4FNLL 1DSFL 3ESUF 4RWYH 3MJ8A 5DEFB 1EEQA 2DMCA 2HJKB 4NN7C 4AH2B 4OJFH 1A3QA 3QBTB 4O02H 1YEGH 1FL6A 1FYTB 3IT8D 4QOKA 3ZYZA 3B2VH 1NCAL 1E6OL 2B0SL 3EDFA 4ONGL 1LP9F 3QUYB 5D5MA 1G7MA 3QRFM 4AIOA 2PXYB 4EVNB 5INCA 5F71A 1TCRB 3VA6A 4NQCA 3B8YA 5C09E 4X7EC 3IDGB 5TF1H 4P4KD 4LCCA 5DEZA 4G8IA 1A7NL 4LASL 5KW9L 2OZ4H 5HVGB 2BOCB 3MGTA 1JWSA 2JF1A 2YSSA 3ARED 1AIFA 3QZWG 3GKWL 3B3IB 3SOBL 4QHLB 4JRXA 2HVKB 3UTSD 1ZEAH 2AJSH 4R26L 1KGCE 1Q72L 4PJGB 2X4QB 4Z0BH 4NKDA 3RTQA 3RGVC 1F4YH 4QGTA 2NYYD 3NTCL 3P30L 3DX9B 1WBXB 1DQLH 5DD0L 3DLQR 1J8KA 3HZKA 3GBNH 3IDYC 4LQFH 1I1YA 4EN3B 2D03H 3FB6B 4DFHA 3LEXA 3RY6A 3OKEB 1A7RH 1B2WH 1MCKA 2YD2A 3W9DA 4HCRL 4MAYC 4Y8DC 4DKAA 1J11A 1CGVA 2ORBL 5DLMH 1ERNA 2H8PB 2BSTB 4CADB 4XP9L 1MAML 2D31A 2R9HD 2BSSA 3QHFL 5GHWL 4JFFB 4CBPA 2CIIA 1RFDH 4XMPL 4HK0B 3IDUA 3PDOA 4WFGD 1P1ZA 3OHXB 5FGCB 4U1NB 1G6RA 4DJMA 5HHME 2Y7QB 1YQVL 3EYQC 4P2QB 4G80A 2JB6A 5C6TL 4KTDH 1DBJH 4X6CB 4UIKL 3BP5A 2NY3D 3WUWG 4JY4A 2OJEA 2XTLA 2A6JB 1QFWH 4H26B 2F5AH 3GMLB 2Q76A 4JN1L 4LCCC 1I9IH 1QLRA 2NZ9C 2NY2B 1ZAGA 4P46B 1LEIB 4DGVH 5J9PA 4M7LT 1I8IA 3GK8H 4OTXL 3EOAA 2YPVH 1ZVYA 3X3FH 4FFZH 4KJQC 1REIA 3S88H 2R0LL 1INQB 2ZKHL 1B0GA 4KRMB 4TSBL 3WFBL 3HNSL 2F54D 5EULV 3ECBA 2Z8VC 3SDAC 3BAEH 1KCUL 4YEEA 4UV4H 4XAKD 1CK0L 2VLLB 3T0AA 4PJCA 3ARUA 1DTUA 3T65B 1K4DA 1HILB 4X5XB 4JJ5B 2FL5B 4MQ7A 1JGVL 5BMFL 4GW1B 2HMID 2GJ6E 1RIHL 1A02N 3G6AA 3QCVH 4B5EA 3RY6C 2LAGB 2NY0D 1FPTL 1SJVA 2EEDA 4GAYB 4Q6IB 3MUY1 5CJQH 3VU2A 1HHGA 4HQQL 1EGJL 3L3JA 3W39B 5DJCB 3SJVA 3CK0H 1RJYB 4H1LB 1KBGL 2HH0H 2IH3A 2KZWA 2BHYA 5BS0B 5I1GH 2XN9E 4NRZA 1GL4B 4MJ4A 3MJ9A 2NX5D 4HK3N 5AZEL 1F3RB 4JO2L 4LOUD 1KF9B 3O6MH 3T8XA 4F33B 4K94C 5F7FA 2CK0H 2R1XB 1SEQL 1G7HB 4GRMB 4ZMAT 3KPRA 1RUPL 2E7CA 5IVXB 3OXSA 1IGTA 3KLAA 3B4NA 1QD0A 2XQBL 4XAWH 1AXTH 5FM4A 2D7TL 3O8XC 5FO8B 2QADB 4IDJL 4NQDA 4QXGL 5EPMA 1CE1H 1W72H 3WJLC 5LXGL 3HI5H 4PRPB 4HUVB 4JFYB 3VE0A 5JORA 2ADGB 1PAMA 4FXGB 3CJJA 1U8NB 5TE7L 4WFFD 4K71B 5IM7A 4ZTPL 4XP6H 5LBSL 4K2UL 4TUOB 5F9AC 3I9GL 3OZ9H 1J8HB 4Y8AA 1A0QH 5J89A 1G6VK 1R24B 2X89A 2ZUTA 4UAOC 3RKDC 4FQJL 4Q9RL 5DJXA 5SWSD 1I7RB 1NGXA 1AQKL 4LCWB 2WWMC 1MFCH 4JB9L 5F72S 1KJVA 4HJGA 4QT5A 4YK4B 5DJ6A 4PBXA 5I66B 2FECL 1NUNB 3ZMRA 5DSCB 1RZIB 4NO0A 5GGVY 1JF1A 2HWZL 4NO3A 1WEJL 5DUMH 4L4VA 1T5WA 4GG8B 2GJZA 1JZ8A 3SY0B 4I4WA 1BFTA 2BZDA 3FT2A 5E2VH 5E2JA 3HC0A 3PWVA 4KROC 4JEGB 5D9SA 2EH7L 2NY6D 3INUH 4KKAD 1UCTA 4K23H 4GXVL 1ZHBB 4PJBB 5DD6A 2VRAA 3UTTD 2DIBA 2R0WH 4FFWC 1MPAL 2ZNWA 1GPOH 3EOTL 5TDOB 4LEXH 3E6HA 3A6BH 2UY6A 4DZ8A 1FN4B 2CRMA 2RBLA 1TVDA 2APTA 1S7XB 3LH2L 2HJLA 3V0WL 2PR4L 3ARFC 2XZCH 5EUKB 3TBYA 4Y4KB 4PJXE 5ENWA 5LCVH 1A4KA 1JPSL 3CSYA 1DQTA 5JMOC 2C9AA 1U8PB 1PEZA 1F6FB 1JWMA 3GSVB 3D0LB 3FT3B 4PJ8B 4U49A 1T0NA 1VADA 4JFEE 1FFRA 1KIPB 3P4NA 4XCNA 1X44A 4OCRL 4DTGL 1OAZH 5CLTA 1F58H 5I1DA 4Y1AE 5C0BD 5KS9E 2EDFA 5F7DA 4P4RB 4HS3B 2W0FA 3FRPA 3V4UH 1BGXH 5DO2D 2MHAA 4U1LA 3GSUA 4NNPL 4XVUC 4YE4H 5I74B 4C56D 5A2FA 1H8NA 4YAQA 4J2XA 1JF6A 1MVUA 1Z9OA 3RJDA 1W72B 1XAUA 2COQA 3LS5L 2EH8L 4BSVA 4HBCH 2DQCH 3PP4H 3BIBX 5ID1A 1EEUA 4LAQL 4HZAA 4FQXD 1FVCA 2R29L 4FN0A 4M61A 5CKAA 1I85A 3KJ6L 4TNVK 3I6GB 5EU6A 1MLCB 3IFPA 4OF7A 2F58L 4PJ9D 4PJFE 2MCPH 3VFUA 3H9HB 3P9MB 3PJSB 5C3LD 5L6YL 3FQTB 5E94A 1CBVL 4OCYL 5JLZA 4G8GB 2BNUA 5J56B 4M8VA 4OQTH 3LSOB 4XWOD 1KN2H 4DGYL 1LWRA 3FZUD 5L9DL 2EE9A 3D2UD 3GMPA 4F58L 2AK1H 1QPPA 3NGBB 3NIGE 1WWWX 3DTXB 3PV6A 1IEBB 2FX7L 3LEVL 4M6MH 2AEPH 3DXAA 4Z7VF 2Q6WB 2VZTA 3PWPB 4PY8J 1X4XA 3HC4L 5HJ3A 2CLZA 1XGPB 5KSAB 5E08H 4KV5E 2BNQD 3B9EA 4JO4L 5GGVH 4OFDA 3H9SD 5HHXL 3BYYA 4JFHD 3S4SG 5I30L 4XCYB 3DROA 1NCCH 5DXWA 4NJ9L 2A0LC 1PZ5A 5FK9A 3BVNA 1BZ7B 4UV7L 4K8RC 5K9KA 3PNWA 2JB5L 3OGOE 4I0PC 4OLYL 2YKLH 3U9UB 5I8KH 2IJ0C 2WANA 4WFEE 5E1AA 1U8HA 3N1FC 2VXQH 4YIQB 1RJLB 3A67L 4L3CA 3RX8A 1ZTXH 5CSBA 5F9OL 1MEXL 1OQOA 1OSZA 4V1DE 1IGJB 4NQEE 4OLXH 4RX4D 2CGRL 2X70A 1I8LA 4XH2B 4GQ9L 1J0ZA 3DMMB 3LZFL 3O9WA 4UIMB 5SX5K 4YDLC 1I7UB 5DA4A 1HN1A 3Q1SL 1IGCH 2ZUXA 1DBML 4UDTB 5CWSA 3PP3H 4MXQC 1LDSA 1K3IA 2FECI 1NFKA 4KJWD 1YPZB 3GO1L 5EUOA 3RUGA 5KZCD 2VLKA 1LEGB 2JLLA 1C5BH 2A74B 2ITCB 2FBJL 1NFIA 4ZFOB 4AMKL 1N0XL 1DDHA 5C0RH 2AJUH 1EFXA 2VLRB 5IBTL 5F88A 2I07B 3GSQB 5CHNB 4R3SB 3TN0B 4LU5H 3X14A 3CSGA 1KOAA 3WIHH 1RZJL 5I1LA 5B39G 4Y19D 3DUSA 4X5WB 2D7NA 4PLKD 1AGCA 5D1ZD 4RAVA 4XPBL 2QQLL 4GKNA 2YA0A 4K7FB 3RVVD 3PWNB 3MPCA 3AUVA 4MA8H 4F7EA 3CFBB 1CGSL 4X99B 1EX0A 1AGEA 1H3WM 2AAVA 1QSFD 3I6LE 4TSAL 4MNQB 4ODTH 1G0YR 2YC1A 4NZDA 1HH9B 1Y0LA 2XWTB 4NKQB 2VDLL 1WAAE 2PN5A 3Q3GB 3BD3A 3ARBA 3F62A 2H2PC 5HHVH 2IQ9L 1JYXA 1MF2L 25C8H 1KT2A 2M8XA 4MVBC 5EO1B 1RUAL 3REWB 5ICZA 3U0WH 2VDNL 4PIRF 3GMRB 5DMIL 5H2BA 1E27A 2XXMB 1IBGL 2VIRA 2BVUA 3GGWA 3CUPB 1BAFL 4HS6B 3G6JF 1A3RH 3FQNB 5JOPD 4LMQE 3H9ZA 5K33A 3QUYC 2HG5B 4L3EE 1I3GL 2VYRE 4UILL 2PXYC 1DVFA 3QIBD 3F6LA 5BOZG 2P24A 5EOTA 4NWUH 3L3OA 1P4LB 4NUGH 4ZOBA 4TTGA 5EH1A 4HT1H 2CRIA 5C07D 1HOCB 5C9JB 3D0VA 1MY7A 2EYSA 3NABL 1JBJA 4ENEC 4NNYA 4WWKD 2OXHA 1GGTA 3VGAB 3ARGB 5IFHH 4JZNB 5JHDE 3ROOA 3QEUA 1S5HA 2V5TA 4JDVA 4J1UB 3UC0H 4ZUSB 3VFNB 3RZWA 1URLA 1FBIL 2IQAA 1BFSA 5T3XL 4DEPB 1Z5LA 4LQ1A 4GBXD 2J2ZA 1EBAA 1NKRA 2VABA 1YMHB 1Q0XH 2A6DA 1OB1A 2H6PA 3LB6D 3NFPB 2CDEB 3IDNA 5FYKU 1NFDA 4KU1A 4B0MM 1RUKL 1OAKH 5EIIA 4KUZL 5FYLD 4G7YL 5IK3B 3C5JB 5E8PA 5D7LA 1B6UA 3MRLB 5ISZA 4LLDB 1B90A 4JPWH 4C4KO 4IJ3B 1MJJB 1GZPB 3F12B 3HG1B 1P4IL 3UJJL 3ARBC 4Z7OE 5ESVB 2NY4D 4HUUB 5D2NB 5F70A 4MD4B 1FIEA 5I1KL 3IVKB 1Z2KA 3NFSH 4XPHL 3JV6A 3MLXL 5FF6B 4O2FB 4QRSA 5EU5B 4ETYA 1B0RA 3LKRA 3IJSA 2B20A 2IAND 3IDXL 1MHPH 1MH5B 5EC1B 5IFJB 4HGWB 4LKXA 2CO7B 5J4MA 2VERN 4WIQA 3GDBA 1CLOH 1XCTA 4L8CB 4ZUTA 1T5XA 4PJEB 1M05B 2NY2C 2QKIB 4Z95H 3RY4A 2I60H 3O6KH 4HIIA 3VXOA 3TJHD 4MB4A 2WUCL 3CVIL 4U4BA 2ADFH 2AV1A 3HZVB 3P4MA 5K9JL 3RL2B 3RVUD 3BIKA 4QOKE 5DD3L 3O3AA 4HJJL 4GW4A 5HGBB 5J11B 2FHBA 5D5ME 1HCFX 4TUKL 4HBQA 2XY1A 1CLZL 3OKLB 4NQCE 5FDYA 1KLFA 3UDWA 1PQZA 4LPUA 1BBDH 4FQHA 4R4ND 4IOIB 4ODHH 4XVSH 4W68A 1U8OA 5DRXA 5KSUA 5MP6H 5KAQG 1OF2A 2FR4B 4N8CH 1U3HA 5GZOD 4NQUA 4RAUB 5FGBA 5FYKH 2X2YA 4Y16B 3WS3A 3UBXA 1VEPA 1CQKA 1XR9B 1P2CA 1UA6L 2DL2A 2VSDA 1EMTL 1RK1B 4JRXE 5B38A 5L2JB 3MRMA 3MMEA 2QQQA 5INDB 4OFYA 1T6WA 3CFJB 3STZB 4LDLB 1UB5A 4R2GB 3WLWC 3JV4B 3QFDB 4KDTA 3VWKD 2YUWA 5ADPH 2OTWA 1R3IH 4FZEH 4LL9A 4XP1H 2O61B 3QR2A 4DW2L 3UJIH 3P40A 4QRUB 3STLB 3C5ZD 4LSRL 1P7KA 3VXSB 2H26B 3ZYJA 2NXYB 3WNKA 3L95A 2GTWB 3DGGA 4K7PL 3NVQA 3WO3B 1QFUH 2YPLD 4M8QA 1NMCB 4PGEB 5EOCH 2ESVB 3U79A 5A2IH 2AJXL 4N0RA 1LP9A 3JWOH 4JHBA 3BN9C 4DUVA 3PHQB 4QXUL 3D39B 4U1MA 5B3NA 2W1NA 3O45A 2NY7H 4Z7WB 4QHUA 3HUJB 4LBEB 5T33L 3T3PF 2DKUA 2EDEA 3VG9C 1PVHA 1ZHLB 2DM7A 1K5NA 4FFYH 2H9GB 4HEPG 1MRDL 4ELMA 4JCLA 2JK5A 3F7YB 4MMZC 1EAPA 5SWZB 4ELKA 1I1RA 3MCKB 3F5WB 1BF8A 5C70A 1PYWA 5JMRA 3ARSA 4CU6A 2R39A 4MJ2A 3L3KB 5MEQB 3MC0A 3M17A 3KPLB 4UINL 1B4JL 4O9HL 2BVQB 4TRPL 2A6IB 3WD5H 5IQ7L 5EU7E 4LARH 4XHQA 4P5MA 3TVMD 4ZFGH 5T3ZE 2AK4A 4N0YL 1XGTB 4YHMH 2FD6L 4JKPH 1CFNB 1FORL 5TH2B 3BPCB 1EHLH 2EECA 4PRHA 1CS6A 4KDTC 3GI9H 1K8IA 5D1QD 1E28A 4PJCE 1EBPA