1OP4A

Solution structure of neural cadherin prodomain
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
136
structure length
136
Chain Sequence
EASGEIALCKTGFPEDVYSAVLPKDVHEGQPLLNVKFSNCNRKRKVQYESSEPADFKVDEDGTVYAVRSFPLTAEQAKFLIYAQDKETQEKWQVAVNLSREPTLTEEPMKEPHEIEEIVFPRQLAKHSGALQRQKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Neural (N-) Cadherin Prodomain Reveals a Cadherin Extracellular Domain-like Fold without Adhesive Characteristics
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords Neural-cadherin
total genus 9
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2003-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08758 Cadherin_pro Cadherin prodomain like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 1op4A01
3QRBA 3PPEA 3Q2LA 2WBXA 4ZTEA 2OMWB 2OMUB 3UBHA 4ZMOA 1L3WA 2V37A 3UBFA 2QVFB 1NCIA 4ZMWA 4APXB 4XXWC 4ZMZA 1ZXKA 2QVIA 3LNFA 5CZRA 2A4CA 4AQ8C 4AK1A 4AQEA 3Q2VA 4OY9A 3LNEA 4ZI8A 4ZMLA 4AXWB 4AQEB 4NUPA 3FF8A 1OP4A 2A4EA 1NCGA 2YQGA 1SUHA 3Q2NA 4ZMTA 4ZMPA 2YSTA 4QD2E 3LNHA 4APXA 3FF7A 4AQAA 2X2UA 4ZMYA 1EDHA 3K5RA 1WYJA 4AQ8A 4NUQA 3UBGA 4ZMQA 2WD0A 2OMYB 2O72A 1WUZA 2OMVB 4ZT1A 3K6IA 4NQQA 4ZMVA 5JYLA 3MVSA 2EE0A 3Q2WA 1NCJA 1Q1PA 2OMXB 1ZVNA 4AXWA 3LNIA 1NCHA 5DZVA 3K5SA 3K6FA 2WHVA 4ZMXA 2OMZB 4NUMA 5JYMA 1O6SB 3LNDA 4AQAB 2OMTB 5CO1A 3LNGA 4XXWA 5KJ4A 4ZMNA 3K6DA 2WCPA 1FF5A
chains in the Genus database with same CATH superfamily
2X4UB 4JR9H 5IEKA 2VN3A 4XXCA 3VE0A 3IU4L 4N90D 2JV6A 3FU0A 2E9WA 1HYRC 3L54A 3PHAA 5DJ0B 2GC7C 3DX7B 1WCBB 4APXB 2JKTM 4GXFA 2I9LB 2D03H 1HQRB 2ORBL 4HSCX 5KVFL 1DBAL 2YAMA 3ML9A 2RCSL 5AD0B 4QOKA 5TPWH 1SRDA 2QT6A 3LXBA 3VFOA 1HL5A 3VXUE 4A7GA 2WGNB 1HHKB 1TVDA 3LEYL 5I1GL 2VW4A 1GHFH 1KTCA 1OGAA 1PAZA 3DX9B 5I8CA 2KUTA 3GNML 5KBNC 4M00A 2GHZA 4BH7A 1XL6A 5TDNA 3SPVB 4WFHD 1YSOA 2H41A 3NH7H 1DSYA 4KFMA 3LB6D 2Z7UA 3HPJB 2XX1A 4XMTA 3HVNA 5I74B 4HWZA 4R4NC 1SHWA 1ITCA 4NM8L 2Q2LA 4JRFA 1XR8A 5HHMB 2VJ0A 2BVQA 1O6VA 4WK0B 1BQLH 4YDKL 4M7LL 3VRIA 3VXNA 3RA7H 4UMSA 2DIBA 2V5MA 4XP5L 5IWLA 4PYHA 3RWCA 1AHWC 3L5XL 4N3UA 3IE9A 4GLRH 1OGPA 4N68A 2RB8A 5CKGA 4L8BA 2BSRB 5DHEA 1I8AA 1LEIA 4WWID 3DXAE 3X14B 4Z7QB 2ZONA 3OZLA 2ZSVB 4IK7A 1I7UB 3G6JF 4KI5C 3ULAB 4ABWA 3RWGB 1KBVA 3PL6D 2OMTA 1AIFA 4IGBC 2BVOA 1MCBA 3SBPA 3S7GA 3IM1A 4N24A 1M7DB 4POUB 1HS6A 3VD1A 2XWBA 3FT2A 2UZIL 4PRBA 3N1MC 2G4EA 5T3ZE 4LCWB 1RIVH 1YEFH 2EEXA 5CLWA 4MFHA 2YA2A 4APQC 4D2NA 4Z7UE 1MFAH 1P4BL 3SGEI 2AZAA 4WVRA 1FGNL 4LEXH 3HCVA 1EAPA 1O9VA 3K5SA 1PD6A 2BNUA 2DTSA 3SOTA 4IOIB 2RQ8A 4AJ0A 2KLRA 4RMRA 4W9DC 3TO4A 4N0YL 1MUJB 5AOJA 1JZHA 1U93B 3EDJA 3NFSL 4NKMA 5K33A 3I6SA 3RGVC 4H40A 1MFAL 1YECL 3BRGC 5EZJB 4TOYH 1F4YL 5GS1A 1TZAA 4LSPL 3BPNB 3ZKMC 2XN2A 1A3RL 2W91A 4JFQB 3FN0H 1NCNA 1OD7A 4DK3A 3F2LA 4KUCD 5D5ME 2YRPA 3T4AB 2GTQA 1S7TB 1BAFH 1IEAA 4H4NA 4WO4C 4U05A 3WKYA 2G75B 1N3NB 4PGJA 4NZUL 1IM9A 2HTLC 3LRKA 1FN4B 1YEEH 3WLWC 3QA3B 3S35H 2CXKA 2H0EA 3OSVA 4E5XG 3HB3D 3QFJE 3QIBC 1LEGB 4K15A 4NT6A 4GRWE 3U1QA 4YHML 3QWNA 4NQEA 5IMOA 4NZFA 2Q3XA 1J87A 3F5WB 2KBGA 2GJZB 3VGEA 1KJ2B 1ASQA 3V4VA 2ZNWA 3ULVF 1WD8A 2VITB 1KENL 3AVEA 3DO4A 5DRXA 1W16A 3FB5A 4WTZG 5DQ9B 3U4KA 5HYJA 5T5FA 4XMPL 1R5VA 2ICEB 4IDLA 4CGUB 2R15A 5HGAB 5CJXA 3IMVA 3O8XC 1BZ9A 1CFNB 4JQXC 4GIAA 1S7RB 1L5GB 1FO0A 3KPPB 2EDTA 2WUCH 2NW3A 1T5KA 4MNGE 1JRHL 3K0WA 5L8JB 5BO1H 1GXEA 1ORSA 3OKNA 4UZUA 3ILQD 4NQDE 3CIAA 3U2JA 5HPOA 5CIPH 1PL3A 3IDJB 4ACTA 3IJSA 1ZWIA 1MJ7L 1SFHA 3EXJA 1PSKL 3G04A 4BZ1L 2Z6FA 1MZZA 1CI5A 3GSQB 1E5ZA 1A65A 2R29H 4Y5VC 5A2FA 1WC7B 5FO2A 1D6EB 2JJVA 3GBDA 3QUYC 5SX4I 3B8SA 3MBEC 1EEZB 4ZFQA 4BD4A 1DUYB 2A6IA 4NBZB 2IWKA 4A38A 2VN7A 5ICZA 4NC1E 5I5MA 2UXGA 4D9LH 3QQ9C 5BV7L 3HVDA 2YUXA 4NBXB 4PR5B 4Z7VF 3UEZA 3OZ9H 3Q48A 4PBDA 5JZ7D 3L45A 3S5YA 1LHZA 1NZRA 4L4TE 3BW9B 3ECVA 1PZ2A 4PJIE 4DQOL 2ITCA 3NN8B 3BWAA 2X4TB 2BNRE 2G5UA 3KYOA 4KO9A 4QIRA 3IAQA 3TL5A 2OK0H 4UDUB 2AW2A 5TF1L 3RZCB 1OT1A 1FNSL 3D9AH 5HY9B 3BVWA 4HJGB 5GS3A 1KXTB 2WWKT 2GQHA 2JJSA 2VE6B 4ADJA 5LBGA 4A63A 1RIUL 1HI6A 2FT8A 3L1EA 2H26A 3P02A 4AV4A 5K9KA 1FSKB 4P2QA 3RVWC 4CC4A 2F53E 1XIWB 3QEQB 5FYLD 1WAEA 2EO1A 1FFOA 2HJLA 2VXQA 2DQEL 2D3JA 1H15B 2QQNL 3ZX1A 5ETUB 2P9RA 4IIQB 2WXMA 2Z8WC 3MLVL 1A0QH 5CUSH 1KB3A 4KO7A 3QAQA 2ITCB 3NN8A 2YA0A 3JWDL 3LHAA 4R84A 1A14H 2PW1B 4NUGH 5E8PA 4LLDB 4X6CE 2HT4C 3VFUB 3ZO0A 1B0RA 1KYOK 5EU4A 1E4HA 1TTAA 1RUQH 4OLWL 1T04A 4FZ8H 5B1JA 4J28A 1JPSL 1NJ9A 4XPAL 4XCEA 5D9SB 1PZCA 4HULB 4MCZA 2AKRB 2N1KA 2V5SA 4AQEA 3MRCA 4FMFA 1SYVA 1R0AH 1V7NH 2F08A 1DVZA 2NYYC 4M5TA 2H5UA 5KJRH 5I1IL 4XAKE 4ZX6A 4J3OG 4H1LH 3NCBB 5D2LB 1MN4A 3U0TA 4AQZA 1J0HA 5BUAA 4G7RB 1KB5B 1AGFB 2R4SL 1AGEB 2OX5A 3LXCA 4K73A 4XNMA 4YXHH 2DQGL 1ORSB 3OKNB 1CBVL 2X9ZA 2ZICA 4WTXA 2HLFC 3QIBB 4WQOA 4OZIA 2VDKL 3CK0L 1IU1A 4KZDH 3Q7JA 2V2WB 4GSXA 4K5NA 1BZ7A 3PV6A 3DSNB 3T8XA 4Y5YB 1MWAB 3CHRA 3EYOA 2AV7B 2B59A 1KNOB 1MH5A 1P6WA 3FKUS 3QZNA 4KY1L 4K4KA 4FI8A 4BBWA 3NJLA 3QRFM 5LQBH 4DEWA 2OXHB 2WXFA 1J9RA 2DLTA 2ZOLB 2DN7A 4N2BA 2BP8A 3GT6A 1KSRA 3U1PA 4J8RB 3RL2A 43C9A 4RZCA 3SQRA 1VHPA 4JO8A 4KI1A 4P4KA 2GJZA 3RDTB 5AVSB 3F5WA 2VRAA 1SYSB 4GSRA 3DROB 3I50H 4YQXL 3LQZB 1S9VA 3UBXB 4C56D 1QZ1A 1N6VA 1TO4A 2D2CC 2F5BH 2C7FA 2Q87A 4ONHA 1FN4A 4ZFOA 1JK8A 1GZPA 4CL7A 2K6ZA 1YNTB 3AC0A 1X44A 3V2AR 2AK4D 4ZUSA 3CBKB 4UQDA 1C5CH 3OAZK 3T4AA 5CGYD 4P4RB 3NK4A 4XGZB 4CNIB 3BKJH 5JMRA 4M4RA 5HVFB 3UTOA 5FEBA 1VESA 2SEBB 1JHKL 1S7WB 1AFVH 5CP7A 3FFCD 1KELL 5F1SA 1N5YL 2FJFB 3T6WA 5T3XD 3UZEA 3ATAA 4WV1A 1I8KA 4BWUA 3FTWA 4BFIB 1KF9B 5TQ0L 4H20L 4HOZA 4XNUL 4BE6A 4JZJC 5DFVC 2DYRB 1Q1JL 1WTGT 3BWUF 4I3SL 4JBSA 4KZCA 2YAHA 4NI3A 5I17A 1OAYL 1N68A 1MELA 5D7SH 3TOPA 4Z7UF 5B8CC 4B9PA 4K5OA 4JFEE 4O2CA 5HHOE 4PJEE 2TSBA 3I9IA 5FUZH 1T0NB 4FQJH 5JMOC 2RFXA 4K7FB 5E99L 4RSVA 3L7FB 5C1MB 4I0KA 5DK2B 1CLYL 4IKJA 4JFDA 1AO7B 5F7FA 5AW9B 5I8EB 4Y9GA 5LGJA 5IUCA 3FCSB 4Z6AT 2VITA 1OTSD 1PNCA 3B7TA 3QO0A 4ZS7H 1M42A 2MCG1 5F9OH 4YZFE 4IJ3B 1A02N 1F8TL 3AWGA 4TYUA 5T5FH 3SKUD 3WDJA 1LEIB 2A73A 2M2DA 3B1TA 3HZ3A 3FPXA 1EERB 4UDTB 4A04A 1SN0A 3B9DA 2BHYA 1A7RH 4DH2A 2IAND 1W9XA 4GP8B 2G75A 1ZHKB 1QZNA 5H35B 3FUIA 5LXGH 3U9UA 5C0CE 4BQCA 3TCLB 2FB4H 3UPRA 2YARA 4WEMB 3LZNA 2YPLE 3LOWA 4HWZB 1IGJA 3ARUA 1NLDL 1JWSB 1PLBA 2WVUA 4DZ8B 5L2KE 1LO0L 4AIXA 4PJIF 4M1GL 4G7VH 3DX9A 5I8CB 3MNDA 1J11A 4UOW1 2Y7NA 3WAJA 4KZ0A 3T0VA 1IEHA 1KMGA 1AGEA 4XNMB 4UB0L 2QVMA 4WO0A 1BG1A 5TGBB 3J07A 3EFFB 3QEQE 3CBJB 1VFBB 3KXFE 4QRRA 2OJ1A 5D7LD 3GPEA 5DUBB 4XC1H 4ZS6D 4WK2B 5AZ2L 4JFVA 5DO2C 3MRCB 1E40A 2L7JA 1F1DA 3DJRA 2B08A 2ZKHH 3M17B 4J4PC 5DC0A 4PJGB 5D2NB 1KCSH 3EOBB 4HJJH 5AW0B 1I31A 5DYOA 3LNGA 4X80L 1CG9B 4M7JL 4M5ZL 1X5YA 3IDYC 4HT1L 1J0JA 3QZWB 2IG2H 3O0RH 1DQQB 3CVHA 4FA6A 1P84J 4EI6A 2VXTL 2YXMA 2E4TA 4UUJB 1ZE3C 1FYTA 4AEEA 5GZNA 3EFDH 2Y5TB 4W9ZA 3CXDL 2VM4A 3VRIB 4Z0BL 3UGXA 5FYLH 4HUCA 1YNKL 3ILPA 5E5LA 1V7ML 1SBBA 1CYGA 3AWFA 2W94A 5C07A 4WKXA 3SCMC 1J0IA 1TZIA 3CVHL 1CT8A 1UASA 2FATH 5GRZA 2WXGA 1MRCH 4PEEA 4UOZA 2RH0A 4HAFA 1UXWA 1G7IB 2DRUA 4H1LA 2F5BL 2XDHA 1OGAB 2DWDA 4XPTH 2A83A 2R69H 5DQDL 5HGBB 5EN2B 5TE7L 2NUTA 4HS6B 3UGEA 4BCYA 4HX1B 4LSTH 1IVTA 2V7HB 2WLJA 4N8UA 3ZRFC 4AM0B 3BMVA 4OZIF 1SEQH 4UTAH 1OHQA 5MEOA 1DZBA 4APXA 4ATWA 1FNFA 3BZFB 3V0IA 3FTXA 5EZIH 5E95B 1UCBH 3JWNH 4MBOA 5CCKL 5GZOA 3D08A 4PRDB 1SFDA 1EXGA 4FQ1H 5EU6A 3K0YA 2H4EA 1AANA 1ZT7B 3BUQA 3L6FB 5HBBA 2V5YA 4LKXA 4M5SA 4TQEL 4AC4A 5IEKB 5CJ8A 2V5TA 2YAFA 3BPOC 3CBRA 3QUZD 1U95B 2MQ0A 5HYJD 5T8IA 3CFKB 1OP9A 3GMOA 4G1EA 3CSYB 1KG0A 2OK0L 1KYUA 3OX8B 4HCRA 4WWKC 4JFDD 1WUZA 4F7MB 1CFNA 2GVYA 1S3RA 4FHBD 2ZAGA 2EEFA 1CLCA 1TQCB 2NYYD 5D5MB 4I8DA 4I0PA 3CQPA 4Z95H 3QJFB 5F8QC 4UINH 2IF7A 2FZ3A 4X0KB 1M05B 4ZXBC 2AGJH 2D7MA 1TEFA 1E4XH 4EMZA 3R06B 3CLFL 4OM0L 4DF9A 4NLHA 1NKRA 4PRPE 4Y4HA 3QNXA 2TAAA 4Y4FB 1D9KC 2WP3O 1OSPL 1OM3L 5L2KB 1ASPA 3AT0A 4TNEA 1LEGA 2DMCA 2Y6SC 1ETB1 3VXOB 5HHPB 2YXFA 4ZNCD 2NNXA 2XWJA 2GK0B 2O30A 1OT4A 1KJ3H 1FE8H 2O5YH 2R1YB 3IJHB 4BFJA 1GR7A 1U8PA 5JPMC 1NGZB 4E41D 2LHAA 1SQ2N 4MZRA 2VWEC 3V0VB 3VRLE 3QP3A 1Q9KA 2PTTB 3G6AB 1F90L 4EI5C 3WEMA 3SGKC 4GKZA 1R3IL 2YD9A 4L5FE 3DX2A 1XMEB 4M3KB 4B41A 3MRRB 5BRZA 4H2CA 3CQQA 4HH9A 1C8QA 1F0LA 4RFOH 3T0EA 1M4KA 3MJ8A 5IBUG 1MVUA 4XI5C 1ZGLP 4P23C 1KJ2H 2YKLH 1JZ4A 1FFQA 2KPWA 2H1PH 2QVIA 1AZUA 1N67A 4Q89A 1ZANL 2F15A 3QUXA 2FLBT 2WSPA 4QRBA 1A4KA 2W80C 3BISA 5L88H 3MREB 4JQIH 3QUKB 5LJYH 1A66A 3NYKA 5CJXC 3ME0B 1IBDA 3NACL 4PJBB 4FAAB 4MA1C 1YEIL 1IM3B 1XZ0A 3GSUB 1E5CA 3FB6B 3WLWD 4KKQA 5B3JE 1RZGA 1XEDA 3P0VL 1NDTA 3BSZA 3H42L 3FH7A 5IB4A 2PYEE 4OB5L 3W9EB 2FD6L 5I1DB 4NHUB 2R0KH 4I4WA 5DEJA 5ADOL 1TEYA 3QS3A 1DVFC 1QRNB 5D1ZC 3U2IA 1OOAA 1N8OE 3TO4D 5GS0C 2WGXA 4KZEH 3RX5A 3II3A 2A6DB 4G9DA 3P9LA 5FB8A 4G7QB 1UEMA 4KNQA 5FECB 3CDZB 2I32A 4M7JH 1UXSB 3M88A 2R69A 4RMVA 1QI4A 5IF0B 3HA0A 3UEQA 2EC9T 4KQ3L 1ACYH 2FWLB 3LKOA 3ZR5A 2HZHA 3SYQA 3NIDE 5D70L 2NY0C 2JVUA 3G08B 4QYOA 1BZOA 2XXMB 4QXWA 5EPMB 3N44B 3FQUA 5F3BB 5EOTB 4MD0B 4MNQD 3DPBA 3TYGL 3H7LA 1M53A 2AMGA 4XVJH 2JE8A 5A40E 2WC7A 1S7VA 5T1LA 2EIZA 4S0TD 4H0HB 1BMWA 3PWVA 4KXAA 4XNZB 3W2DL 3WHE0 1E9PA 5A6IA 5A2CA 1B6DA 5DD3L 3ZZSA 2ZXQA 1AQHA 5IQ9A 1CL7H 1WT5C 2XZQH 4YLCA 3MBXL 3HI5L 2ZAHA 3Q5OA 4GAAA 4ZS7L 1Z0MA 3BN9D 3IEAA 2H3KA 2NNAB 1FZJB 4AW4A 1BDYA 1HCZA 1H6TA 4XNQB 3KYNB 3FO1B 1KXQA 1KXVA 4GG6E 2XN1A 4P2RA 1GYVA 5E4IA 2GJJA 5EUOB 2BC4B 4A2EA 3Q05A 4QHPA 5F96H 4HUKB 2VR6A 3OF6D 1ZS8A 3D18A 4UM9A 3U6RB 5HP5A 1O7DE 3I6GB 3ELQA 4U1NB 3S37L 1MCOH 4CUCA 5I1JH 4F8QA 3NCFB 3NPZB 4R4BA 4TNWF 3S4SG 4ETQA 5EC1B 3SJVD 2NY3B 4WHCA 3QXWA 3O6FB 1INQB 4LESA 1MFCL 3AQYA 5HTSA 2X09A 1JF1B 4IGBD 1I7TB 4MDRA 1L0QA 4PBXA 4AQEB 2ARJB 3ARGD 5I23A 5K9JH 5BZDA 1NJ9B 1MDAA 2HT4D 1N0XH 3CU1A 1Y18B 5DRNB 3ZE2E 5IFAL 3QXUA 3Q2NA 1UWFA 3HNVH 4I77H 5LB1A 2M26A 2X7LB 2OL3H 4UQ2A 1EEYA 5LAXA 2ENYA 1RHHA 1YUKB 1QA9A 2W1NA 5D1XC 1Z7JA 1D2PA 4TNWK 4R2GB 3TVMD 1IQWH 3GM0A 4L4VA 1DUZB 2EC9U 2VIRA 4YN3A 3C9NB 4KJPD 3IETB 4BH8B 4NUQA 1R3HB 3UCRA 4FMVA 2K4AA 2VLKE 4Y8DC 2R8SH 2BP0B 5I6NA 2BOCB 4XCYA 3CZJA 1FNEB 2E8ZA 3Q9QA 3L8QA 3BAXA 4P2OA 2B0SH 5E8DH 3IFNL 3B37A 4B7LA 2XQYA 5IJKA 1LO4L 3K6SA 4GAFB 4N3TA 4X5RA 5JW4R 4XNDA 1NFIA 3AJ7A 3ULSA 5I74C 1E4WL 5DI8A 4F8LA 1G9MH 3P30H 3U4BH 1AQKH 3MLWL 2WZ0A 2AXGA 3RJQB 2WOBA 4HDIA 3DX6A 4TVPL 5FGBA 3W0WE 1H9DA 4TQPA 2OMXB 1XCXA 4NS0A 2PO6A 3FHAA 3GJEB 1Z9SA 2BS71 3MRJB 2WTPA 4UU9A 5FW6A 4QXGH 4EZMA 5SWSA 2XETA 2FRGP 2LQRA 3G9AB 4WWKD 3MBEB 3A23A 4MJJA 3X3GL 4WWNA 1KLUA 1IARB 3QEHB 4TM9A 2VUOA 1KGIA 5EZLB 4EUPH 3SDAA 1EFXB 5FDWA 1GS8A 2R1WA 3OQ3B 5DJZB 2KLTA 3I9PA 3IPFA 5EUKB 3A67H 4QY8A 4N0CD 1DE4A 1GYCA 5HVGB 3E8UH 5D6CA 1KLFB 2BOBA 3KHQA 1LMIA 4BFRA 2Z92B 2Z3FA 4F3FA 1YEHH 3VG9B 3G5YA 2CIKA 1VKXA 2CMRH 2LR4A 3QNYA 1D2OA 4F7CB 3OLDA 4DOHB 2YGNA 3NMEA 4MMZA 2JCWA 4J5VA 1DCEA 1MW3A 5HGAA 5E5UB 1WBXB 4P3DA 3MV7B 3N0PB 4JFXB 3QUMB 4L18A 1I3RA 3K2MC 4R7NA 3AMKA 5IHBA 5TPWL 3QJRB 2OR9H 4YXHL 2HH0H 1A2YB 4WHTB 1ROCA 2DQEH 1NMAH 3IJYB 4NRZB 4UQ9A 1RUAL 1NBYB 5T3XE 1N5YH 1CO1A 1L6PA 3SN6N 5E2TH 3OR7B 3FRUB 3U0PB 5D1ZI 1NCTA 4ZOAA 2BMKA 1YPZB 3UGUA 3FN3A 5F1IA 1U3NA 1T2JA 1LO5A 2JCCA 4E9TA 5KSBB 5J5EA 4FTVE 3FU9A 2X6BA 5E9DA 2JTDA 1N3NA 4N0FB 4KDWA 4U0QB 3OZ9L 2WW8A 5D8JL 5KSAD 3WN5A 1URZA 1G4RA 5J6HB 1CVRA 1J1PL 1BJ1J 2AJUH 5IOPB 2QADB 3OKOA 5EZJA 2PXYA 3SCMA 4N0UB 2JKRM 4CU7A 1K6QL 1EFXA 5C71A 1T5WB 3Q13A 2EKJA 3ARWA 1K8IB 2VQ1B 1H0DB 3S5ZA 2VR8A 3L5HA 4OJYA 1PY4A 1RUPH 4KFZC 3LPPA 4UT7L 3MRFA 5FWRA 4S1SH 3ZTNH 3FFDB 4POZC 5MEPA 4XPBH 3SDDB 4K5MA 5AB2A 3QISA 1J5OH 4OCXH 2J88H 3DX6B 2DEXX 5KW9H 1HVXA 1KIQA 3WXWH 3RWEA 1QPPA 5MENB 1NFDE 1ZDSA 4FYTA 3A6BL 1PLCA 2FR4A 3MKKA 4NJAL 4QRPB 2A74B 3P73A 3ZKQD 1CJYA 2BNRA 3V4UH 3EBHA 2C1OA 3MLSH 4NN5C 4R3SB 4KK8D 3IRPX 3FFCB 1KGWA 2XA8H 3QXDA 4XP9L 3FTYA 3ULUE 3O6KL 5D7IF 4NQDA 4WU5B 4DETA 5KSBE 4XPAH 5ELIA 5EOCJ 1A6AA 1D5XB 4RFEA 2ADYA 3FO2B 4N0CC 3KLQA 3SSGA 2A9CA 4Q56A 4N2OA 2DM3A 4KKRA 1E9QA 2X4QA 2DIAA 2APBA 3IFNH 1IIIA 4NO0D 3SDDD 5EU5A 4PYGA 3UP1A 4FZEL 2OMWB 2OP4L 4CU8A 5EDSA 2DQCL 4WFED 1I1CA 4NQCE 2R2HB 2VRKA 3P30L 5HJ3A 1NCIA 1ZSDB 3LD8B 4M8QA 4PJCB 2VXUH 3QQ3A 3AROA 4I89A 1QR1A 1ID2A 4P99A 1HCYA 2IGLA 3UAJA 4NZJA 1SOKA 2MPAH 4AC2A 4K7PY 1V3JA 2CDGA 3EJZC 4BCXA 4PB0H 4PJ7F 4DKFL 5E8DL 4KDTC 4ELDA 4FI7A 3KJ6L 3EGSB 3QDGD 3D52A 3DGGB 4NKIL 1X9RA 4MX7B 2QPUA 1Q9OA 1H19A 4G8IA 1RMFH 1QG3A 3T4AC 4L4TD 2BO0A 4N2AA 4FG6C 2AK1H 3VXTB 5SV3A 5CJBA 5F9DC 3DX7A 4FS0A 3WHXB 3SGJC 2ZPKH 3MLSL 3WIHA 4FOMA 2J72A 3LEXB 2JJSC 3MXVH 4MQXC 1PVHA 2HX7A 4OBRA 2VXVL 3VGAB 2E59A 3VA2C 1KPUB 4DZBB 3GMRB 2RD0A 3DX0A 2HG0A 4A37A 3QUMH 3DETD 2Q7YB 3HIZA 4UV7H 1XGTB 1AZRA 4PVMA 4ZTPL 1QNIA 4LARL 3PNRB 4DEPB 3D25A 1V55B 2WOYA 3WIHL 1GRWA 3PY9A 1IC0A 4UBDC 1XF5A 2XN9E 2CUHA 5E6ID 1AGDB 3LH2H 5T1KA 1DLHB 1DANT 4KMLB 4MB5A 1NICA 3GSNB 1USQA 1UACL 3MXVL 4NUJA 3TNMB 2G3XA 4ENZA 1ND0A 4IU3A 1U2YA 3S3DB 4NPKA 2PW2B 3SZKC 1C7SA 5GHWH 2P8PB 3ESMA 4D94A 4H0IA 1O7DC 1XB6A 2VISA 5DJAA 5EORH 3IF1B 3C60A 2UXVA 4M6OL 2OTUB 4HCGA 4MA8L 3SKNA 1ZV9A 4Y5XA 3EG9B 4WV1C 4X6DA 3RILA 2C1PB 4K9JA 4LEEA 4X2UA 5FM8A 1RULL 2CLRB 5E24E 1DQJA 3DUUB 4XP6L 5FV2A 5CLZA 3PQYB 3LXAA 1GZHA 1KTKE 5EUOE 15C8H 1XCTA 1EZUA 4R7VA 1HWGB 3APFA 5DWUH 3LPOA 2X1PA 2FO8A 3THMH 4CJ0A 4GW1B 3UZVB 3S3SA 1HEZB 1EO7A 1AZBA 2W92A 3BI9X 5KVDH 4WTQA 3V9CA 2N56A 1TO5A 1K85A 1MRFL 3DHUA 1QRNE 3UC0H 1ZLUK 4KXCA 1N59B 4XH2A 1F58H 1DVFD 4L9LB 5E4AA 3FUDA 3SYOA 4M7LH 2A77L 3QG7L 2AERT 4JDTH 1T89A 4P4KC 3KPRD 3D48R 1FZOB 2LV4A 5GRVL 2Q8BH 3HG3A 5EBGA 1MJJA 3HG4A 4E41E 1KJMB 4P05A 2WKLA 3W82A 4EBQH 1QYGH 1BPLB 3LQAL 4OD2A 4ODSL 3WENA 4L2LA 3DV4B 1RAMA 4N6RA 2ADFH 1X4YA 1SHMA 4B95C 4MAYC 1O5DT 2L7EA 3ULVH 1BD2A 2WBJD 1EEQA 1MFBH 2YGQA 2IOIA 4JEGB 2ZYHA 5JPNB 3P3TA 4AL8C 2MOGA 3VXSB 5C08B 4GW4A 2DQGH 4H26A 5FPIA 3TYFA 4B96A 1DBAH 4UCFA 2BP0A 2B1OA 1BVLA 1JWMB 2BRQA 4GMSH 4B3EA 4ATTA 4NC2B 4XCNB 1Q9KB 2PTTA 3BSHA 4HIJA 1SDDB 2CCWA 3Q06A 1T7XA 2J20A 3TO4C 4AQAA 5EV7A 4GKOA 3QEUA 4ZX5A 3SJVB 3OV6A 1IAOB 2WBWB 3H9HA 2NR6D 4HXBL 4GMTL 4GXVH 5HHPA 2KS0A 4P5SA 2BIIA 2XV2A 3WIAA 4JO1L 1HZHL 1OP5K 1PKQB 1NMCB 2J12B 4YXKL 3IF1A 3OPZL 4RMTA 1NCUA 4F2MB 3R7QA 4X50A 1OW0A 4ZQKA 5C0AE 3VI3E 2BJMH 4H88H 4NUJB 4X7CC 3UJJL 1G7QA 5INDA 4AENA 3BZEA 4HF5H 3ECQA 1E5UI 2GITB 4ETQB 2CE6A 4AWJC 3IPBA 4P2OC 3QJTB 2BIMA 4OFDA 4NNYA 5C0FB 2XKSA 4NQVA 4PV1C 2ZUYA 1F2QA 1G7JB 4A6YA 2DIEA 1U92B 3G5VB 3PXHA 4U7KA 3ZDZE 2WLLA 1SM3L 4K3JH 4ES8A 1ZOXA 2H6PA 4MJID 4K55A 1U8OB 2BRRL 5D7IA 5AEAA 4DZBA 1BIHA 5I1HL 5I28A 3DRQA 1BXVA 2E7CA 2QKSA 5E2TL 5IFAH 3VD9A 4UAHA 4PJBE 4BA8A 1FI8C 3O3EA 2NY5C 3F6IA 4XB8A 3PWJB 3ZE0F 1CXLA 4DP5X 5EOQH 5BVJA 4O51B 3KXFB 4EVNB 5I18L 3M86A 4MAUL 3HZKA 2N4IA 4OBSA 1MCFA 3ARDC 3OXSA 2CHZA 2Y7QB 5CP3A 4F15C 4HX1A 4Y1AE 1G7HA 3II1A 3PFUA 5FO8A 4Y16D 3GMPA 4ANKA 1MRDL 1UHVA 2CBOA 2CLVB 3I6LD 4FQ1L 3GXNA 1N7ML 4HEPA 3HC0B 5A6MA 2EICA 4YUEL 4AL8H 5JQIB 3BSZL 2PPDA 1XD0A 5EOTA 5IVXA 1ILUA 4ZI8A 2HFTA 1IBYA 4HW6A 4BDVA 1Z5LA 5F1NB 4NCC1 1YCSA 3AS0A 5F97E 3A4DA 1M56B 1QRND 3VB8A 3RAJH 5F44A 3SKOB 4Z0XB 5GGUB 3EBAA 2Y24A 5JR1L 3O2DH 4GO8A 4OIIL 5EU5B 4Y88A 4IBQA 5IK3A 5JW5A 3BUDA 2YMOA 3H9HB 4MMXB 2R0WL 2CRYA 1PX3A 4AITA 5ILTH 1SXAA 3VW3H 3OBAA 4XCFH 2EIDA 4YIQB 1K4CB 4M62H 5MHSD 4OCYL 2OL3L 4QHMB 1A1OB 1ZHNB 3MR9B 3ZTEA 3UTSD 3IPEA 2OTWB 2WAQA 4RNRA 3WBDA 2WSDA 1XGTA 4WU5A 5E2WH 4PWEA 3MROB 3U25A 1RUKL 1FNLA 1RP8A 4JPWH 3MRHA 5DFWH 2AJSL 5FYKE 2NYKA 1HC1A 2W0KA 5IHHA 1JV5A 4CBZA 3GHEL 3OAUH 3X1EA 3EH2A 3TPUB 1TYJA 1KCUH 4FA8A 1QLEH 1UFGA 4CVZB 4JLRA 4JY6B 1ITBB 2Y06H 1RPQA 2VMFA 4YVNA 4HLEA 3UJIL 1X6LA 4CA4A 2AXFB 4NAMA 2IAAC 2WLLB 5CR1A 4X6CF 4J3OH 1I1RA 3GO1L 2VSMB 1KGUA 3CAFA 2F58H 3LZPA 1UWXK 4AXWA 1L0XA 3LSOB 1QUNA 4PW3A 1SNRA 4G80B 4KK5C 2JIXB 4O2FA 4C56E 3HMWH 5HDLA 5AZ2H 4N0UA 5B39A 2KQMA 4QXTB 2DM2A 1KZQA 3B7YA 3MLTA 4GKZB 4NQED 4OQTL 1OWRM 5CBEA 2YD8A 3N9GH 2GBTA 1U3JA 5E2VH 4IIZA 5L88L 4KQ4L 5F7KC 3QDJB 3RP1A 4XP4H 2YBGA 1LO2L 1QVOB 2APTA 2MIZA 3FONB 4PRIA 1R46A 1E9QB 1T66C 3T0AA 4FC3E 2V3DA 5CINL 3KEDA 2A73B 3OKEA 1J8HA 4Y4FA 5FIEA 2O26U 4LCYA 3NDYE 4HLZG 2YK1H 4AV5A 1ZCRA 2WMPB 5KVGE 1MLCA 5B1JC 1XVSA 5CEYA 2Z4TA 3FFCA 3H4HA 3PNWB 4R9HA 3WD5L 2ZZUT 1F90H 3STZB 3L3KA 1YYLL 5CZXD 5JHDA 4TTDD 2F53A 1BVOA 1FZKA 3U9PH 1OTSC 1CYXA 4TOYL 3MGAA 3QJVB 4Q74A 1BX2B 4NEHB 1JAEA 4X7TB 5AAWA 4DFIA 4PGBB 3RURA 4AGNA 1YQVL 4JMNA 1GJUA 1BVZA 2WO2B 3CSYA 4LSQH 1ZA3B 1D7BA 4H8HA 5DT1L 2VR7A 3RUGA 2P44B 4LOFA 3FT0A 3BVNB 5JOEA 4WI4A 5E8EA 3H42H 3E0GA 4Y19A 1BQ5A 1IGML 4DEUA 4IQHA 3P4OB 1JGEA 4OFPA 3AS2A 4AMKL 2OM5A 5LUMA 4XP1H 3HHMA 3QI9C 4P48A 2AJVL 1KULA 3IMTA 4RESB 5D7JD 3SYPA 3VXPB 2DMGA 5C0RH 3KPMB 2IAMC 1RIVL 1YEFL 3PJNA 3IN0A 1A47A 3PF2A 2WB7A 3EYQC 5HVHC 1RZIA 1CB4A 1I3UA 4R2GC 3OB0H 5IZ7A 3KL3A 3K91A 3IU4H 2OZ4L 3C8DA 3V0WL 3LN5A 1JYNA 1RXLA 2D3LA 5FLUA 4N9GA 1A4BA 1U8IA 2OSWA 3BJLA 5JQ6H 2WTOA 4M61A 3MRGB 2CDGB 4KROD 3GIVA 1ZTXH 4NO0A 3VFGL 1HL9A 1UD8A 3OB0K 3MRMB 5B22A 4RRPA 3UTTD 1NCAL 4KRPD 1MCJA 2R2HA 2ZP8A 1PZSA 3MUUA 2KZ1B 5CEYB 1CURA 1OQOA 1PYWB 2IJ0C 3GJFH 5D96B 4RISH 3H9YA 4MNHA 5EUOF 2CBTA 4CVXB 5KYWA 1X5KA 4NUMA 4JFEB 4PP2A 4QTHA 4HIXH 3FS9A 3IDIB 3EO1A 3BN3B 3VGHA 5LXVA 1JWUA 1DVXA 2AITA 2R7EB 4FTVA 2PNDA 4GKNA 2G2NA 3B9EA 3ZY7A 4DKAA 2XV3A 4PGEB 4ZMNA 4GMTH 4GXVL 1QVOA 1CDCA 4FQXA 3TV3L 5IMMB 2GJ6A 4P9HL 3BIBX 1ZT1B 3CIQA 1UH2A 1DBKH 2WZ5A 3WNMA 5I1KL 5IHUL 5ESQB 2WQVA 4NQXA 3ZJAA 3RB7A 3HMXH 1Q94B 2CD0A 2EH8L 4N0RA 4BFFA 2FYYA 2OCFD 4ZMAT 3MV7D 4OV5A 2EH8H 3MUGB 5DMIH 2OI9B 2FX7H 4P2QE 3MODH 4R0LA 4TULL 1SYVB 3S2AA 1G4MA 1VFBA 4S10A 4GUQA 3GBEA 1DVQA 4HPYL 4Q9RL 3NSCA 5FA4B 4FLQA 5AW7B 4LRNH 1WBZA 1R3JA 2YEZB 3N44F 1OAUL 4KU1A 4XPBL 1TG8A 3V6OA 3QR2A 4TNGA 5DS8B 3OWEA 3DSFH 1P6AB 1QLFB 1TQTA 4HDIB 2P8LA 3AGVA 3BGMA 5E2JA 4Q9QL 1LD9B 2IH8A 2Q1EA 3GXMA 3BPLB 4J3BA 4CVZA 3JWOL 5DRWB 3VFWB 3X17A 4JN2B 4FHJA 5GSRB 1IGJB 1F13A 5JHLL 1QR1B 3P11H 5IW6B 4MRCA 3NCCB 1WWCA 3L1OL 1SXNA 2JKSA 4LHUD 2R2EB 1RUQL 4MS8D 2CH8A 1R1CA 2X2IA 3ZUNC 3S9DB 1AOHA 1QFUL 4HJGA 4CN6A 4R0LC 4XAWH 4UDTA 5ANME 4LLVA 2WD0A 5CWSA 1XXFC 3HC3H 1BYNA 3SZ6A 3BAEL 4JO4L 5JHLA 1DCLA 4Q52A 1G9HA 1GJWA 4ZT1A 5DFAA 3S4SB 4YFEA 3TZVD 1H5BA 3BAIA 2X7LA 4NQDB 1UZ8B 2ADJB 1TZHB 4RWYL 4QYAA 1A2YA 1HILB 1W91A 4OZHB 5ALBH 3UTSB 2JLPA 2VW7A 2ZD0A 1K3ZA 3EFDL 1GOFA 2XBTA 2AXWA 3IAGC 3OWRA 1QHOA 4K7PX 3FYEB 3EO9H 3N06B 3VQ1C 4WJKB 7CGTA 4AIZB 3HPLB 1EZVX 2RFXB 4L4VE 3MGTA 5DEGA 1A7RL 1SXSA 2XIBA 3O4LD 5TQ2L 1CICA 4QHKJ 2L7UA 3CC1A 3HUJB 4HMEA 3KCPA 4G43B 4XPHL 1IV8A 4TSBH 5DJXA 2WO4A 2Z92A 3R0NA 5FB8B 2FQEA 2DQTL 3LNDA 4D9LL 1ZS8B 1MPAH 1UUSA 4XXDB 1A21A 2WKGA 3FUFA 2F58L 4I77L 2YN5A 1CDIA 4JDEB 1AI1H 3WGVB 4UV7L 1FQ9C 5JHDE 4LGSB 3ZE0E 5IMKB 2Z91B 4R96A 3P4NB 3N91A 3EKCA 2H0JA 4HWBL 5DD1L 5T3XL 1MCHA 5HI3D 2VC2B 3QFJB 3M46A 4H25A 8CGTA 1INEH 5I1CL 4W9IC 2VXVH 2Z1KA 1QLEL 3N6YA 2HWZL 5IVZA 5C0EA 5IOPA 2FTAA 4UU9B 5I1LB 3FB5B 2IANA 4Y89A 1VENA 3MREA 4WI2A 4JG5A 1NC2A 3T0WA 2DKMA 1WFOA 4M5ZH 1U92A 3G5VA 4PJAF 4OVUA 5KWYC 1P1ZA 3ZT5A 3RTQB 4PJ9D 4YO0A 3PWVB 4NN7B 5BOPA 3KGSA 4NO3B 3RI5F 1FYTE 1LQBC 3V5DB 4PUBL 2GITA 3TZVC 3VD7A 1CMOA 2DQ6A 3MQIA 3SE4A 3DHJA 4KNSA 2F7PA 4XHJC 4J1UA 2B1AH 5B4MD 3VXUD 3WFDL 2A4ZA 4AZ8B 1UA6L 5I19H 5LWYH 43C9B 3O2DL 4BH8A 1OB1B 5D72L 2VL5A 3CPLB 2OW7A 1J8HB 2AQ2A 5J9PA 4LAQL 1IQWL 1HH9B 1X5FA 2J73A 3D7PA 1Z9PA 3FCGA 1IKFL 1CICC 2DL2A 2JI2A 5L0QC 2VDOB 4K71C 1WZ1H 3G5YB 4OGXL 1YDPA 2DBJA 2YLHA 3GZPA 4YHIA 1ADQL 3KW8A 3QIBA 3O2DA 5AYQA 3ZHNA 3NA9L 2EUWA 4HBQA 2X4PB 3UX9B 2PXYC 1SXCA 3U0WL 3ZKNC 5FFGA 2FD6H 2MQGA 3NFPA 2BNUB 1I7TA 4G59C 4WFGD 2EEAA 3EOTH 3MRLA 2XSKA 4BSVB 4ZMVA 3KH3A 4X6EA 3I6KB 4E68A 2XIIA 4PCYA 3L4TA 4U1KB 1SJXA 4P5RA 2ZTBA 2J57A 3ZO9A 5IV2A 4M8RA 2W0LA 3H6JA 1E27A 1S7XB 4X7EC 2PMZA 2WZ6A 1ADWA 4S1RL 4W9FC 4XODA 1QBLH 3R1GH 3D0LA 4CC0A 4AKOA 4IBTA 1FFRA 1BVNT 4EIBA 4N8PA 4Q6KA 2XPGA 1FA4A 3RWGA 2EACA 3M1BA 4F92B 2A5UA 4JQVC 4NLAA 5DHDA 1BZEA 3GLAA 1YG9A 1JHTA 4ZYKB 1IFRA 2NY0D 4LHUA 5CSZA 1BD2E 3SE8L 4ESKA 5AB9A 5EU6B 4Z7QE 2P24B 1FZJA 2OMVA 4HIIA 4DKFH 4XPHH 3VXMA 1QSVA 4PGDA 5KJRL 1L9SA 2RALA 3BH9A 1OAZL 5DCCA 3AAZB 5CAYB 3UTQB 4QOKE 2IDTA 2W9DL 1NKOA 5IM7B 2B2XH 1R3IH 4CKQA 3KD4A 1ONQB 1S2EA 3UJJH 5HGBA 1UB6B 2VQ4A 3KPLB 4MNQA 3V5KA 3T4YA 2XPYA 4G9FB 4HV8A 4NWTL 1DUZA 3FOLA 4YGVA 1EGJL 1ETJA 1R4XA 4U3SA 4W70A 2CDFA 2X4TA 5E5RB 2YUZA 4G8EA 1RHHB 4OF6A 1FP5A 2E27H 3ZU8A 5TDNB 3SPVA 2ODHA 4R4ND 3ZDWA 5H4ZA 4H7VA 3WY4A 1JGLL 2ATPA 4N87A 2YD4A 2BP5M 4N2CA 2Z35B 5I6PA 1FCCA 4ZS6C 4UM9D 3QNXB 5FKPB 4NZRH 5A7BA 5BZDB 4E9SA 2DDQL 4XVUD 3ZHKA 1O0VA 3DIVA 2Z7ZA 2XUWA 4Y2DC 4FCHA 5D70H 5FHBH 3TNMA 4U3XA 5I5RA 2OMYA 3SGKA 3ECBB 1UGNA 1SJMA 3BP6B 3LIZA 1WEJH 1PTZA 3A6BH 4JMXA 1PZDA 1SUHA 2PCFB 7PCYA 5FECA 3U46B 2E6QA 3KXFD 1M7UA 2IAMD 2X88A 3KZ8A 2O5YL 3ARFA 3QWOB 4BV1A 5EBWA 4N4YB 1D5BA 2JXMA 2NCEA 2IQ9H 3LNHA 4LBEA 4PD4J 4V11A 5HGDB 1K72A 3EYQD 1LE9B 3DNKA 1YY8A 3OL2A 1MFBL 5DYOB 5AUMB 4G82A 4I4WB 3TIDB 4P5TB 3LS5H 4HU2A 2QL1A 4YFLF 3X1GA 1QBML 5BMFL 3HI1B 2QKIC 1AZCA 2J8UB 3QDMA 1F1AA 4OF7A 4FYSA 4KMTH 4AGQA 1BSIA 4NPYB 3HMXL 1HXKA 5HHME 1KJVA 4ZW5A 5LBSH 4TMPA 2NNAA 2LTQC 4AVHA 1WA2X 3CC5A 2NXZC 1B0GA 3C6LA 3PWNB 4OD3L 4JR9L 3QUKA 5AKTA 1GGBL 2BHUA 2QSTA 3GZOA 4LSTL 4XMLH 4BELD 4HYTB 4NRXA 1HIMH 4AM0A 2C34A 2DW5A 1I1FA 3MVSA 4M6NH 1F4WL 1VACA 1JDDA 3FQYA 1TLMA 3WFEL 4QPEA 2GYSA 4YDVB 4F7KA 1SVBA 5C0NC 1JZ3A 2WCSA 5GSVB 1A6ZB 2OYMA 2ZXEB 1WQVT 4D3CH 4EOWH 2IEPA 2J44A 1NPNA 4FKEA 4F9PC 3KPNB 1YJDC 4JREC 4L48A 2JKJA 1Q0XL 2ZT9C 5ABZA 3D51A 3GD1C 1UB6A 4HIXL 3RFZC 2O5XL 5B7FA 3ARQA 1GZQA 2VLME 4E2OA 5HHQA 4PV9B 5DHVA 3ZXAC 3GZKA 3OGOE 4WY7L 5FGBC 1FL3B 4N26A 4MJ5B 4K3DH 2XQYG 2Q8AH 4K9EH 1HE8A 1RJCA 3EYVA 4YDIH 1RERA 3DKHA 1AQMA 1MY7A 3MCLH 4G9DB 3I75A 3US9A 2ZX8A 3X1NA 4JM0A 3IDNA 5B1CA 1CXKA 2L04A 4N8CH 1RZQA 2H9GA 2EDJA 2LU3A 4NHUA 1P7KB 3CLFH 2VR4A 1HK6A 1ZXKA 1N70A 4GQRA 3UDWC 5GXBB 4L8DA 4OTXH 2FIKB 4YXLH 1BJMA 4L5FH 4JGMA 1WIOA 5EEXA 5EIIG 3TJPA 1SJVA 1IX2A 3VH8A 2CA3A 1X5XA 3FTVA 5HYSA 3BQUA 4AQOA 3G6JB 1RJYB 4JAMB 2DLIA 4JPIA 2B4CL 5D1XA 4AI7A 4P4KD 4L8CB 2YQGA 5K1VA 4AJWA 1FORH 4S11A 1U95A 3VWKB 4NXSA 3IK2A 1TJGH 3HLAB 2WYIA 1OKEA 1U42A 3WE6A 4LAQH 4QRPD 3HZMA 3F01A 1V5JA 1KTRL 3GB7A 3C8KB 5JOPE 2CG9X 4X99B 5DHVB 1KFGA 1IFHL 4XMKH 3UG5A 1MIEL 4HS3B 4JE4B 1W15A 2E47A 4KXDA 3TEUA 4YDLC 2XTJC 4Y2DB 3ZIYA 4F8OA 4KAQH 2EXTA 5T1LD 1XBDA 1F11B 4JM2C 2CDEB 5CFHA 3SQBA 5KYXB 4M3JA 4ISVB 1NDGB 1U8LA 4URTB 1TT6A 1NEZA 1PZBA 3WXVL 2WIMA 4WW2F 5FWQA 1AXIB 2B9AA 1U3HB 3E6HA 1MOEA 4KK6C 3DIFA 3QC5X 4KWUA 4XPFH 4MJ6B 1FIEA 1F45A 1KXVC 2VOTA 3EJYD 3JBG7 4XPFL 1J8HD 2OMBA 3FO0H 3NIGE 4PRIE 3MU3A 1UUNA 1FFNA 1RZKH 4KROC 1PDKB 3Q6GH 3GKWH 4OQTA 1UOKA 4OQTH 4KTDL 5E8OA 2XWXA 2OSXA 1Q90A 2A0LD 4MA7H 3OG6B 4KQ4H 1KCLA 4ZUTA 4KTYA 1OE1A 3NTCH 5DJ0A 1JI1A 1GL4B 4UQIM 4C83A 1RZJL 2AHIA 2APSA 2GUYA 1WZKA 3HRZB 1XF5B 2IOMA 1VADA 4OIAA 1WZMA 4QTIL 4TQIA 2Q10A 3DWTA 4YE0A 4NPYA 4YHOH 4Y5XC 5BUPA 1AC0A 3QI9D 2JCCF 1A6TB 1I1AB 3EYOB 4WW2B 1XSKA 4R96B 1KEGH 4NQDD 1WFJA 3GNMH 2PO6D 5HJDA 3BWZA 4ALAH 1VPOH 4HMCA 4LPTA 3LEYH 2FNWA 5D6CB 1KCVL 5BQDA 4HIEB 5EU3A 5LDSA 2H32H 5FYJL 4G8GA 3ZT7A 3U46A 1M6OA 3ABKB 4PJ8B 5FDWB 4KV5E 3RKPA 4YHNB 4EKJA 2UZXB 1QFWH 3VXRA 1YEWA 4W68A 4LOUC 1CF8L 1CLYH 1CYWA 3RWJA 3B1UA 1PD1A 2SEBA 1Z9SB 2G2PA 4LP8A 4MD4A 2ZPKL 5BJTA 5DSCA 2GCYB 1TZHA 1XSIA 2IBZX 2JB6B 4BQ9A 3U2SB 1Y7VA 3ALWA 2VO8A 3TO2B 3RIFF 2Y2YA 4I85A 3A4AA 1MNUL 2EDDA 3OZKA 4HPOH 4X83A 2ZCKH 5IESH 5FYKH 2WKOF 2Z8SA 3MTXA 5F9AC 3PHOA 3UBXI 2ZCLH 2YFNA 4G9FA 3QQ3B 3KPRE 3P2BA 5LWYL 1DJZA 1KCRL 1CBJA 1BQLL 1HSBB 1UD3A 1CK0H 4XCFL 3WNPA 3OKDA 4PY8I 1X5LA 5D7EA 4C59B 3AWEA 1C5DB 2DQHH 4LLWA 5DZAA 3WO4B 1IKNA 1DHKA 5F7MC 3EO0B 4NO2A 1BEXA 2VKWA 4NJAH 3CVHB 4FHKA 1U8NA 3EYFB 1W8NA 5I0ZA 3GTVA 1HDMB 5D93B 2AMUA 3A0OA 1CG9A 4XZUA 5I16B 3FU5A 4HPYH 3O81A 3QUZB 4TLKA 5KBDA 1CGVA 1CGWA 1KXQE 2A7BA 1JZIA 5FUOL 2F2HA 4HFUH 4Z7IA 2C1OB 3CHXA 3BKML 1AR1D 4ANUA 4MMXC 5CF3A 2ZKXA 1YN7B 4X6BA 2XBDA 2IAMB 5I1IH 3T1FB 5HPMB 4U1KA 5IHZB 1E4XL 3LQAC 4MXWL 3A67L 3OJDB 5JPMA 4ZZKA 1YO4A 3KVPA 4MXWH 5K93A 2AABH 4POZD 3RWEB 1VAHA 3L4CA 3SD2A 5I5JA 1ZPLA 3FU7A 3C5SB 3GMNA 3UTPE 3H4FA 2FVNA 4PRAA 4AUUA 3ZW3A 3OKKB 3IBOA 4WSKA 4FRWA 4YSTA 4YHIB 4BK5A 4ENED 1TFHA 1NBVH 5BVPH 4LQFL 2J88L 3APCA 3WUZA 4WEEA 4N2GA 1IRAY 2VLJA 3CZFB 3OKMA 1KIRB 3GQFA 2ZYSA 4H20H 1HH9A 2W60A 4OCWL 1WEJL 5JUEL 5F6HJ 1C5BH 32C2A 3FZUC 1SOXA 1E42A 2RTTA 5DQ9A 3BZ4B 1I8IB 3HE7D 4I0PC 5KBKA 2QGCA 5FAAA 3S88H 2VL5B 2QVTA 3TCLA 3VM7A 2VZ3A 5C7XH 2V17L 3APMA 3WS3B 3X11A 2G3MA 2AK4A 2B77A 3GI9H 2FCBA 4OJEH 1BM3L 5FUCE 1CN4A 5EIVA 2H1LM 4EKXA 4OLVH 4CADA 4JVWA 4KHXH 2EZ0C 4QO1B 3V8OA 2DQUH 2I07B 2EIZB 2X89D 3PFQA 1GGCH 4DP1X 2DJMA 3QCTH 2NXYD 5K9QG 1B3IA 3MRQA 3LCYA 4WU7B 4WEUD 4FQCH 5HDQH 3KYKL 1P1ZB 3ZHLA 4EEEA 3VDBA 5K39A 2TRYA 1LTXA 1NBYA 4ZK8A 5F3BA 4IBUA 2O6EA 3GI9L 3T2OA 4LEOA 3JXAA 1VDGA 4JFQA 3BVDB 4OI9A 4QYOB 2ZOLA 3MV7E 4S1QH 3B3IB 3FMGH 4ZO8A 2Y7LA 2KT6A 3OAWA 4B0MM 2F1AA 2IPTH 1KBBA 1OGAD 5BXFA 2AV7A 2B59B 3F05A 2HH0L 1ESOA 5LCVH 4KJWC 2CIKB 3NJHA 4Z3IA 3ARGA 3FC8A 4BK8A 4GINA 4OUOA 5DZPA 2NUPA 3TN0A 1CFVH 1JRHH 4Y4HD 2G60H 2DMKA 35C8H 3VWJC 2AEPH 2OX5B 4XCCH 3ZRSA 1MFEH 2NW3B 1PZ3A 3D33A 3GLDA 2V5RA 1BG9A 2R1WB 2NXYB 4P2CG 1XD1A 3QXTA 2R1XA 4JPIB 4M1CD 3QIWC 5D1XB 3H2QA 2NR6A 1IJNA 2EDEA 1RZGB 1J0ZA 4MLIA 1DQLH 3FB6A 4HK3J 4GW5B 3ZQ9A 1N0LA 1Z3GH 4LSVH 4XR8C 1LK2A 5AWNL 5HYSG 5LGHL 1R5VB 2F8VA 2ICEA 2YA1A 2X9XA 4X6BB 1P6FA 2Z8RA 4IK6A 4L37A 1LL1A 4PJ9C 3STZA 4WUKL 1F58L 2DWYA 2J1WA 4HKJA 5KVDE 2DYPD 1TOXA 4P2OD 5D1ZB 3W56A 4P23D 2WMPA 4LXFA 4DT2A 4I7ZC 3TA3B 1RULH 4NCC2 3S4SA 3CN2A 4G3YL 2JIXD 3BD4A 4NNXA 3K2KA 1JPST 1S9VB 1MW1A 3VRJB 2EDWA 3ESUF 1WIPA 4WCYL 3T0EB 1A7OL 3MV8A 4PSPA 5T3ZH 3QZWG 1CWVA 4FJZA 2BOCA 1A9BA 2E6JA 2AK4B 3ARFC 4UILL 5D72H 3LV3B 3ZN6A 1WHOA 3KPSD 1T89C 3RL2B 4O58H 1TNNA 1X9QA 5E1HB 3NQIA 3ISWA 3QPKA 2RR3A 3DJ9A 2XKNA 1FH5H 2IFFL 2WXNA 2UWEA 2V4LA 1PBYA 1TR7A 4HG4J 5IGXH 3K72A 3SY0A 4XN2A 1BXUA 2Y1VA 4IOSD 3TT3H 4AH2A 5LGYA 3ZT6A 3O11B 3DSNA 3ZE2B 1NAMA 4OZGE 4DKDC 3ASOB 1U8CA 3VJ6B 3KL5A 4X8JA 1QUNB 3ABLB 2W9EL 3MRIB 3QWRA 3PUUA 3RGBA 2A4CA 4ODWA 1UKQA 4A7GF 2WXPA 4XVTH 1M7XA 5G5DB 3H56A 2CAKA 1IAKB 1NBQA 1D6EA 4GBXC 3D3VD 1XF1A 3L5IA 1O9WA 4N5ED 4A7TA 3FTUA 3VFTA 1RZJH 3AADB 2GUOB 4DUWA 1B0GB 3C6LB 3G7TA 4LDLB 4M6AA 5IBUB 3HAEB 2FLRT 5E00B 2XPZA 1LK3L 4PJ5A 1ADQA 1IC4L 3ATEA 5D55A 2B5IC 5D1QC 3LRHA 5IMMA 5B1AB 4DUXA 5BZXA 4TQ8A 1MFDL 4KTEH 1PIGA 1BGXH 2XRAL 4OF8A 4AGMA 4JCMA 2H2SD 5EU7E 1G0YR 4HK3N 1HNYA 3RG1C 3KLHD 4W9CC 3IFLH 2BSDA 3QWOA 4M03A 4CMHB 4MJ5A 3TYGH 4JZOB 4KVCH 1RPKA 2QELA 4YSOA 5I6OA 4N8VG 4Z8FH 1JD7A 2CZNA 2OMYB 3C5XA 3VXME 5HYFA 2ZYIA 1G7MA 4PLJC 5TE4L 2XYBA 1X5IA 1QFWM 5GZNC 3TBSA 5I1EH 2J6EA 5FGCB 4N2IA 4GAGH 3AMLA 4YE4H 2VLJE 4M56A 3TTSA 2ZXDA 3KLDA 4OGYL 2IANE 4O02H 2NY2D 3NH7L 1PX8A 4ZAKA 3B2UC 3Q2WA 2XN0A 3QXVA 5IB1A 5JDJA 5DMYA 1KJ3L 1EAQA 1X5ZA 5E2VL 1XHHA 1FPTL 2LAAA 1GIGH 1JGVL 5HVHB 4NC1C 3ZQWA 5BJTB 4B5ZA 2YWYA 1JP5A 4X7FC 3HW7A 5FV1L 1DUYA 2A6IB 3VFOB 1LM8V 2IVFC 2ORBH 4CGTA 1NGQH 1JHLL 2D9QB 2Y5TA 3WXWL 3S34L 5GRUL 1ZTXE 3T65A 2XWEA 3BSZH 3UO1H 1UC6A 2O6FA 4S1QL 5I0XA 1PZ5A 2A74C 1VFMA 3KXFA 2Z31A 1JGEB 1SHSA 3RY5A 1BLNB 5F89A 1NGYA 1E7VA 5A3ID 3P9LB 1G9EA 1ZLEA 5GGTH 4WGVB 2CQVA 4UT7H 2GBUA 3QRBA 4KY1H 3UYOD 2HVKA 4BWTA 3GJFB 5C86A 5IKCA 2RA1A 2YRLA 2ZXWB 4YDIL 1AGBB 3KNBA 1CFVL 4OCXL 1X9UA 3CSBA 4KJQC 1PG7W 2ZOWA 3QIUA 3LIZL 1A3LH 2ATKA 2FX7L 3ROLB 4YSAA 2H0PA 3ARFB 3ME0A 3QJOA 1RUPL 3ARED 3HRZA 3QO1B 4PJBA 5DJCA 4BE5A 4AQ1B 5EZOH 2PR4H 4G7YL 2BY2A 3MA9L 4JO2L 3D4ZA 3MRLB 2EDYA 4PJFA 2NOYA 2CJ3A 1TQSA 3PAYA 4GFXA 2K4WA 4TTDC 3RBGA 4KQ0A 4X4XB 1JRHI 1A7OH 2G3ZA 4WI9A 2BOLA 4N2DA 4UV4L 1KFAH 3HMXA 5DA4A 4YZWA 2HVBA 1U8CB 3VG9C 3VJ6A 1ZVSA 5C2UB 3PGCB 4Q4IA 1OXYA 1MREL 4FFZL 3UG3A 4U1SA 1IM9B 2X9YA 1QSEB 4PSRA 5SV4A 4EO5A 5FFOA 3K72B 4OU3A 3SDAC 4A39A 2D4DA 4YLBA 4N20A 5CUSL 5AVQB 1A4AA 4QJ4B 4R26L 1NDGA 1U8LB 4RAHA 3KWVA 5BRQA 3C6LC 3LHPL 4XCNA 5C0CB 4MXQC 1XGYL 1KN2L 3BKYH 3QT2A 2DOCA 4JO1H 2Y3AA 2F18A 4YVUA 3FBKA 4ZMQA 4YBLB 3K71B 1I1YA 3HJEA 4FFZA 4JPKL 3TZVB 1TJIH 2CBQA 2YZ8A 3VXMB 4TVPD 2KLSA 1ILSA 4O2FB 4W4OA 4BHUA 1QSFB 2QFRA 1HWWA 3HNTL 3SDCC 3IFOB 5CZVL 4GG8A 2GT9A 1I53A 1I1FB 5MHSE 4OM1L 4HC1L 1T4WA 1J5DA 3RU8H 2XQ0A 5DGRA 2DQMA 4X80H 5I71B 3TCXA 4OD2B 3ARYA 3BQUB 2AI0H 1H3GA 2GTZA 2UWEE 1MJJB 2OPCA 4NM4H 3GSOB 5E2UH 4U0RB 1FIGL 4XAKD 4YC2C 4S0HA 1ACCA 4E41B 3ZKSD 2ZKHL 1R0AL 1E6OL 5IJVB 1Z5YD 5M94B 1Z2KA 3MNWB 1RCYA 1CFQA 3IDGB 1T1YB 2R1XB 2R0LL 2FX9H 1AGBA 1KG0B 3L3JA 4OD1H 1F97A 1LE9A 2CJTA 4JRXB 4ODHL 3DXAA 1NCCH 1QYGL 3SOBL 1YQVH 1QSFD 2OJEB 2YLKA 4M5YL 5DJDB 1MJUL 3RIAK 4L8BB 2D2OA 3JWDH 4MMZC 5DEZA 4BEIA 2PCFA 1A8ZA 5IT2H 3MV9E 3T6VA 1F42A 1L3WA 4BFIA 3RFZB 2GJ6D 4JY4A 5DK0B 2JLLA 2KERA 3QNFA 2XWCA 2C3XA 2EXWC 3SBRA 4K3GA 5DJAB 1QFWL 1GW6A 2VGLM 5CZRA 1I8MA 4PJ7A 1OTUD 2X1WL 5ICXA 1WCQA 3OF6A 1MF2L 3EHBB 5HDWA 3CDGA 3BSGA 3TN0C 2PYEA 3X1FA 3MRQB 3K81A 4ONHB 4WU7A 1TZIB 1TPXC 5B3SB 1W80A 1YNTF 4R8WL 3VSUA 3T0EE 2V0AA 3SGJA 3S3JA 3IN2A 4ZMTA 2NZ1A 1G7HB 3GSRB 2CR0A 3TBSB 1WJ3A 1F8TH 3ARTA 3BVXA 3UABA 5EEUA 3FSZA 4KI5E 1HQRA 4PMEA 1W0YT 2FX8H 1DBML 4XT1C 1A3QA 3AAZA 3FSWA 1V7MH 3ARRA 3LY6A 4FQIL 5CCJA 5D4JA 5BVJB 1CDHA 1IGMH 3CFNA 1Z5HA 2FNBA 5FM5M 3U4EB 2NY3D 2GW5A 3VE0B 4BZ2L 3M1OA 4HD9A 2VR5A 4I0CC 1UM4L 4PBVC 1MWAA 1T7ZA 3C60C 2ZQKA 2Z91A 1QLFA 2H2PC 3IDMA 4IMKC 2IGFH 4EDXA 3ARZA 1MWOA 1FDLH 3B2XA 4O5LH 2NTFB 5DR5L 2DMHA 1RLBA 3SO5A 5C3LD 5GQBA 1E4JA 2Y1AA 4M1GH 1EXHA 1CIDA 1PY0A 2G2RA 1EEUA 1JV2A 1T1ZB 2ZUQB 4QJ5B 2XZCH 2ZF9A 1JZ5A 1UEYA 1MWAL 1EO5A 4ZZFA 1DBBL 3HHSB 4XOEA 5HHMD 4JPWL 5I6LA 1WDAA 4C54A 3EJCA 1G7PA 4B9GA 4OZGB 3LZOA 4N1CA 2MOVA 3DURA 1KXHA 1ZT1A 3IFPB 4X6CB 3FO9B 1VFAA 4ZDHA 4MGXA 3TJHC 1LWHA 1KGJA 2F7RA 1YN6A 4HPOL 3KDMA 2WLHA 1IAOA 2MKWA 1TYEB 4YDJB 2F9BT 1S78C 1AGCB 3SPJA 4F58L 3MRDA 3QH3B 1R17A 3EYFA 3ILQC 2WTRB 1FGVL 2VH5H 4GO9A 4NXKA 4HXAH 1JPGB 3ULVE 2JKNA 1F6LL 3VD4A 4KQ3H 5IVNA 1E65A 4UNVA 3LH2L 3NIFF 3B9AA 3MV8B 2VJXA 3ULVD 3O45B 2HT3D 2AEPL 1BLIA 1JCVA 1UT9A 3WFDH 4NN5B 4HIIB 4JG0L 4NO0B 4NOBA 5IHLB 5EF0A 3WE1A 4MQ7B 4KKNA 2H1XA 3K2UL 1A22B 1CGXA 4PW4A 4GUPB 1F02I 3VDAA 4J3UA 1NAKH 4JGJA 3L9RA 4YLQT 4ZXBD 2GCYA 1MHCA 4U6VL 3X3FH 2WBJC 1H8LA 3B2VL 3I84A 4QAMB 1JSYA 4Z7QF 3L95A 2B4CH 3IMSA 3RWDA 1CGYA 4JFFD 5IV2B 3WIIH 2MKLC 1PEWA 3INUL 4WNQA 1PQZB 1OV8A 4K7FA 2E9GA 4MWFA 1T0NA 3DOHA 3PGDA 4KDVA 5CEZD 5I9QC 2PWFA 2X38A 4ZD3H 2APVA 4Q9CA 3IDJA 2CK0H 4MMYB 4KJWD 4V1DB 1UB5B 3HE7C 2LAGB 1TPXB 1FYHB 1IBFA 1MCPL 2WK2A 4LCCB 4LMQE 3ZGHA 1WFUA 4JQIL 3V6OE 4MAYB 5MI0C 5JHAA 4FQPA 2R0WH 3BN9C 4AIOA 4IDJL 3EW3B 4K9EL 3ZPDA 4CMMA 4B9ZA 2P4AB 3AREB 2KI6A 3EUDA 5I1AB 1RUAH 2XNAA 1TTCA 5D1XE 1M1SA 1HE7A 1DQTA 2ITDA 1UOVA 3L3KB 1HNFA 2P5WB 5G2NA 2BVTA 1A4CA 2IXQB 1KYDA 3L3GA 5AFAA 1DN2A 4GB9A 4K7PL 4Z7WA 1JCKA 3I9GL 3VMNA 3W3BA 1JTOA 1CUOA 2BS9A 3VGAC 1N7MH 3R4RA 3FT4B 3RZCD 4JZJA 2H8PA 2CU9A 1W72H 1TJXA 3L2MA 3P9MB 2VQTA 5DJ8B 5KYUB 2HN7A 1IB5A 2BM3A 4QTFA 5E6IC 1YC7A 4LVNB 3E9UA 3GHBL 4JRYA 4R7DB 4U6HB 1ZEAH 4DCQB 5KJ4A 2AI0L 3ECUA 3SE3A 5KYXA 4Q0XH 1OALA 1QPXA 3I2CL 1F18A 1DDHB 4EJ1C 2W60B 5F3FA 4HFWA 5E6UB 2YBRB 2WBXA 4NZRL 3Q5YA 2Q3AA 2V33A 2V37A 3PWUB 3NJJA 1RZKC 1LWRA 4O9HL 1JNJA 2FHCA 5AW2B 1DJGA 4JN1L 1UJ3B 3N42F 4APQD 3N55A 3FU7B 4JM2A 4KXZH 4F93B 3B5GA 1DEDA 4LCUB 5E94A 2V3EA 1SBSL 2KPNA 3MGTB 5DEGB 3LHPH 5SWQB 2HAZA 5DI8B 2FWOB 1MLBB 1GGUA 5IHZA 4A7UA 1I1AC 2R8SL 3X3GH 1YN7A 1MRFH 3I9AA 5GS2D 4M1DL 3MRKA 4QHUB 1K2DA 1OAXL 3WJMB 4JPVL 1H3WM 4DKTA 5CIPA 3D4CA 5IHUH 4G83A 4HJ0C 5GRJH 3C09B 5F9JA 4F58H 2ADJA 4IBZA 3VFUA 4EN3C 4DQAA 4FJYA 1RH8A 2FATL 3HBQA 1CZ8L 1LP9A 5BQ7A 1P4UA 3C9NA 5FF6A 1GMIA 1AZNA 5TF1H 1JK9B 5A2LH 3ARFD 1P2CA 2AJXH 3ILDA 2LGNA 1PAMA 1MNUH 2GG1A 5JLZA 2XQYK 3FQRB 3VXQA 1Y1UA 1L9RA 3RWCB 2J1YA 3L81A 4OJFL 4YHPA 2H26B 3BEVB 2XI9A 1FC2D 1RV6X 2JKIS 3NAAL 1NFDA 3RBSA 1BVNP 1QWHA 4Z3EA 4KKBD 4KVCL 5CIPB 5FYJH 4KO6A 4XRCA 2BNRB 5HVWA 1UJTA 1J0KA 2EINB 4Z7NF 1L0PA 4AMKH 2YD3A 1QI5A 3K6IA 2E8YA 1I7ZB 2V6HA 4G1MA 4R4FL 2F1BA 1QTPA 4G6FB 4D7PA 1UQSA 3NZ8B 2FO4A 4PM1A 2ZOKA 3KPQA 2G4GA 5JDSA 2JB6A 2A0LC 3LX9A 4KO5A 4Z23A 3NP3A 5HGHB 1BVKB 2O1AA 1IFGA 4LK4A 4OZHF 3L3OB 2AAVA 2H32A 4B27A 2P26A 3CSPA 3ALXA 1NUNB 2OR8A 2B7DT 4UANA 4J6RL 4MA7L 1H3PH 2EUXA 1MHEB 4ZUVB 2DD8L 1TSRA 4RLDA 4Y4HC 3UG4A 1F86A 2AJVH 3SCMB 1M6OB 4MS8C 3ZYIA 5CEXB 2H2PD 4GSDL 5I0DA 1A4JB 2WQ8A 4X5PA 5DEFB 1BW8A 3QUZC 2O5ZL 1E9OA 5DFVD 4IJ3C 4X9HA 3T2LA 5D96C 3OAZH 3CFCL 4IRZA 5FA3A 2VDLB 4DGYH 3W5NA 3U0WH 4HWUA 1Q38A 3PREA 1RK7A 3Q6FB 4AE0A 3P3RA 3N85L 3N43B 1IZKA 2YUWA 3K4DA 1FBIH 2HN7B 5DUPL 3UBHA 1KPVA 2HFEA 3GXDA 4R90L 5JIQA 2FJSA 4A7SA 2QGDA 3KDPB 5DD6A 4FTVB 1EA9C 5C0FA 1XB8A 3JSSA 5F71A 3D2UB 5KUKA 1CTMA 3TBVA 3FH8A 3NEEA 4K3EH 1LO0H 2IWFA 3FPYA 4PY8J 4PLKD 4OT1L 4ONOA 5JOFB 4ZQKB 3F7QA 4DIXA 4PJFF 1SMDA 2P5WA 5FKPA 3KL0A 1J9QA 2VM3A 1M7IB 1FFNB 2F7IA 1JPTL 1OP4A 1ZHLB 3EJUA 1MFVA 5ANHA 1RU9L 1RURL 5FM4A 3CFIC 2OULB 4WIQA 3RWIB 3C08L 4PS8A 4N9GB 3CMOL 4F7EA 2YGVA 5ADOH 5KVEE 1V3MA 3DK0A 3FOLB 2CO6B 4YGVB 1TVBA 2WJ5A 2WN3A 4L3EE 3KPLA 4MNQB 3LS4H 3MXWH 1JTTA 1ICTA 3F04A 5FXCH 4ZXBB 2YS4A 2CUAA 4X4ME 4QNPE 1I7RB 1OANA 3GUFA 5PCYA 4KDTA 5DHYB 4FQJL 4OFKA 4AQ8A 2X44D 1Y6NR 1WLHA 1ET8A 4U1LA 3C09C 4O51A 3IGAA 5CSBA 5GPRA 3S37H 3P4OA 3PGFL 5H37G 4JJOA 3MBWB 1OZUA 4S1DC 1GS7A 3O41A 5D7SL 3L95B 3RWDB 5J89A 1FDLL 4O5LL 1AH1A 3CLEL 5FHAL 1QQDB 3CMOH 5C2BH 4IOIA 3AXIA 1NANH 3FUNA 1KBWA 3DTXB 2K6YA 4WHYH 3MFFA 2PWDA 3QDME 4PTUA 5FUZL 3GO1H 3SDXE 4HUWB 4N28A 3OTTA 1GGIH 1ZVHA 5D1QE 1IBBA 4XHJD 3VO0A 4OLZH 4XAWL 3WO4C 1MG2C 4LCWA 2G9KA 4GQZA 4GAJL 4OT1H 2M8XA 1K6QH 1LJMA 2F74B 3F7KA 5BS0B 4UBDD 3K6SB 3ZMNA 5ESVB 4A6YH 3ESNA 4RAVA 2XZQL 1KIUB 2MQ3A 3CHOA 2OMZB 3VWJB 2QMKA 2D3NA 2AJSH 4KRMB 2ETWA 1I7RA 2M83A 3QUXD 4IKLA 4LCYB 1JI2A 3QEGL 1A1OA 5J3HD 2GIMA 1MRDH 1YDPB 2UV3A 2DQIL 3IKCB 3O4LA 4Z76B 1EZVY 2ZOUA 2VRQA 1DQJB 5FO9B 4WI0B 1GAFL 2AEWA 4HD5A 2V17H 2ZWNA 4FXGA 1B2WL 4NRYB 1FFPB 1XR8B 3LKRA 3UC2A 3KH4A 3MRBA 3KVDD 1NDMA 3CXHK 4LASH 3WEXB 5DMIL 4PJEF 3MYJB 2X0UA 1Z5LB 3ARBB 3CVCA 1GA2A 3FCUB 4IMKA 5F1NA 5CLTA 3KBFA 2AEQL 5HSFA 5DD0H 5KSVA 3CZNA 1XQ4A 3O6LL 2VDLL 5D7LE 4AQ8C 1OGSA 3MKGA 4ODUA 4OGAD 5I15H 5CCGE 3D09A 5JZ7C 4UQ3B 1JXDA 1NBVL 3QJQB 1UCTA 4JZNB 5CZVH 4I0PB 2HTKC 2WUBH 3NCJL 4FXKB 4AXWB 3I6GA 4U1NA 3BPCB 2C3WA 3VMPA 4L23A 4IBLT 4KRPB 1NCOA 1NCGA 3V5HB 4DGIL 4C55A 2EDHA 2SODB 5L2KD 4UT9H 1B88A 2XFGB 4XBPB 2LU5A 4XO4A 3OXSB 4U7MA 5ECJE 1GJIA 1NEUA 1GC1L 2IQ9L 4E9RA 1ORQA 2NY6B 1VZGA 4QD2E 2Z7YA 1FWXA 4PWIA 2P43B 1H5BC 1MFUA 2UZYB 1IAIM 2APFA 1GYWA 1WFTA 1WA0X 5D8JH 1IGYA 5D1XD 1E0OB 2E27L 4QGTA 5LKNA 1JZJA 3RDJA 2HT2C 2AV1A 3P4NA 1NUFA 2AJYH 4HC1A 1IBHA 4KKZA 1FG9C 2VQUA 4JDEA 4F2FA 1F3JA 3F58H 1CCZA 3AY4A 3F12A 4OFVA 2MCPL 3GTTA 1QABA 3LZQA 4I1RA 4IW4C 1CZ8H 2N7SA 3LDBB 3NIDF 5I73C 1QKZH 4FLSA 2PABA 5GGVL 2OJZH 1E4WH 1F6AA 3EGSA 4H2AA 4GEJA 3BZEB 3ELAT 3BAYA 3HUJF 1VSCA 3RVUD 4DW2L 4G42B 4O02A 1BXXA 1HKLH 2F54B 2IADA 4OLXL 4QT5B 5D1QB 3MX0A 4DP8X 2OR9L 3MYJA 5FW8A 1XL4A 5GHWL 1E3XA 4GQ9L 4Q9BA 4UOQA 3RJOA 4E5XA 3ILPB 4FXTA 2VWEE 5SX4H 3NFNB 1CE1L 1GKOA 2NXYC 3TM6A 4JB9H 2PP9A 1MCNA 1KT2A 3WU1A 3KMDA 4KBPA 4ZNEE 2VT0A 1Z32X 4DQOH 1PG7H 1AS6A 1UH3A 4ZMXA 1B4LA 4LL9A 3F85A 2VR3A 2R27A 1OVZA 2PN5A 3EJJX 3EYSH 5IFJA 1IGFH 2VLRB 4U3SB 5AW1B 5J1SC 1JK9A 2BIPA 5FUCC 2KZBA 4HIJB 1IGYB 2CJUH 2K7QA 3IJ7A 1BBJA 1IEBA 4F9LA 4ZTOH 1A64A 3F12B 1OAQL 2CHNA 2HLEB 3MOQA 4A2LA 4UM8B 2HCZX 5GGTA 1BBDH 3QXDB 5J56B 4PB9H 4A66A 2UY6B 1WTLA 3N41F 5C08A 2YIHA 4Y9CA 3UC0L 5IW6A 2DTMH 3KGRA 2G0LA 1CQYA 2DLHA 1A7BA 2FGWH 2P24A 3T9WA 3TBYA 1T0PB 4MCYB 3GWJA 4OGXH 1IKFH 3AACA 2EDRA 2IH1A 3BOVA 3BGMB 3BO8B 4WSJA 4LCUA 4UQCA 5E94B 3U7WH 1SLUA 2QPSA 2J8UE 4PTUB 4M9PA 4LGRB 3WKQA 2CKBA 5GGTL 4F80A 4J2XA 4XNBA 3HE6D 2D7NA 4YMPA 3CHQA 3GIZL 4DO6A 2OXGB 4GQQA 2FSEB 5B39G 4WENB 2YXVA 2NNCA 1RU9H 3DRTB 3QR1A 3I9GH 3P3UA 4FERA 4N2LA 2WUCL 3R0MA 4W81A 4Z77B 5JA8B 4QI3A 2YPVA 2F53D 1A1MB 2HMID 4YX2H 4JFZL 2FYYB 2IPKB 4F91B 4HFWB 4NKDB 4FKHA 1JTPA 4PWHA 2WJ7A 3G6AA 5I6XB 2GY5A 3F7YA 4H8WH 4WI8A 3TT1H 1CL7L 1YC8A 3DVNB 4OFYA 2DMBA 4APQB 2AQ3A 4R7DA 1SN2A 1WVZA 3WNNA 1RJZB 2ISDA 5JQ6L 1GVIA 3CHSA 3GPSA 2YPVL 3AY4C 1MQ8A 5AG8A 1G1OA 4BSJA 2NTSP 3GXIA 2QBWA 4P2AA 3JV6B 4BRVA 1C9SA 4F57H 2JCCB 3T0BA 1WS8A 3QUML 4NDMA 1T4KB 4MA3A 4U1IA 4XB7A 3N5AA 4XP4L 1ZHBB 4ADIA 1E43A 4Q8BA 3MGOB 1D5XA 1P4IH 2YD7A 2AS5M 2ZJSH 1ZAGA 5ID1B 4MJIA 3HLKA 2UVFA 4PRPB 4HUVB 3TWCL 2DQFB 2ZG1A 4W4OC 4QGYA 1NFAA 1I9RL 4I18C 5DVOA 4CC1A 3Q2CA 1ZLWK 3RE0A 2LTQB 5BS0A 1N6QH 2AK1L 4TQHA 4OLYL 3QUMA 2ATKB 2Q86A 3IJEA 4IHOB 5EBLA 5J06A 3QDMD 3OR6B 1BD2B 1J86A 1Z1WA 4F7CA 1F6FB 3F7LA 2VLLB 4Y4KD 3ZRCC 1KTLB 4PJEB 2DQTH 2CO4A 2HKAA 3BKCL 4P9MH 3FFDA 4FEIA 4JKKA 2DF3A 1RK1B 4XN1A 4ZPTB 5C09B 1DFXA 1OEZW 5FYLE 1HHIB 1KBPA 4HA1A 3KPSE 4EN3A 1WH0A 4LPUA 5CEXA 1VGEH 2BH0A 3D87B 3NT0A 1I9RH 4GKSA 3D39D 3LZFL 3N1FC 2X4OA 2FECL 1E4XI 1KLUB 4XVTL 2WNKA 5AL0A 4TTGA 3MBEA 2F8OA 4N90E 4MCMA 1KDJA 5ACMA 5C97A 2GPZA 2ZX5A 3HS0A 2E0PA 2X1OA 3CZLA 3GLZA 4YPGB 5DRZA 4ORGA 2XQBH 1K4DA 1KTLA 1NGPL 4X8GA 5IMLA 2Q2EB 1DFBL 1VCBC 5BUGA 3QFJD 2N7BA 3RKDD 2D7QA 2L0DA 5KVGL 4KHXL 1EMTH 1T80A 5BOZG 3U9WA 2JKLA 4YDKH 1I7ZA 1A7NH 4WZ9A 2IO5A 4V1DE 1JG9A 3FW6A 3MI6A 3TVMB 3ULUD 3W81A 4ADGA 1M7IA 3C75A 5C0AD 3GRWL 4U6YB 3C6SA 4G9FD 2NY2C 5L4IA 2DWTA 4QCIA 1QSED 4HUVA 1DVUA 5DD5H 3DSFL 3PYCA 3ZE1E 2EZ0D 4YR6B 3QHZL 4YH6A 4UZGA 2QDVA 1AGDA 5T1KB 3FB8B 1A6WH 2P5EE 4NDMB 3JZYA 3V10A 4DGVL 3LZRA 1GPOH 1JZ7A 3ILEA 3NRFA 3K1DA 4YDJA 4I0PD 5C6TH 5C08D 3I50L 4P5MA 1YN6B 3UACA 5KVFH 4Y5YA 3COOA 4Y9FA 4WHYG 3DURB 4PJAA 5IQMA 2E76C 1G7PB 5I1GH 4PQXA 5JW4Q 2R4RH 2CO2A 1KCUL 3MLTB 5F0JB 3WEAA 2K45A 1FIGH 3DJSA 1WAAA 2B4CC 3IXTB 2UVEA 4JN2A 4HQQL 3SDAB 1V27A 4B6ZA 4HCIA 1E90A 4FQCL 1FSKC 4FNSA 1JD9A 4JM2B 1BZ8A 2E9IA 5E2WL 5FKAB 2FK9A 1RUML 4YDMA 3TEWA 1OOWA 5M7QA 1UT2A 3DMMD 1A14L 3FL7A 4DN4L 1Q1JH 3MLVH 2MH4A 3MNVB 4RISL 3LKQB 2NNFA 4ERSL 4UAOC 2F68X 2ZOKB 3TBTB 4AYID 2NY4C 2W0FA 1B3JA 1MCCA 2IDQA 3QJXA 3WJJA 4KI5D 5ESQA 3PP4H 4HWNA 1CICD 1CC3A 3G9VA 3N43F 2DH3A 2VMJA 1URLA 4Z18A 1A3LL 4XCYB 3S2CA 2GJ6B 3U7AA 5I0YA 5H35A 5BV7B 4ZQTA 1R3HA 2R51A 1FRGL 5LO7A 2VN5A 4U0RC 4F7PA 5C7ZA 1SQMA 3BQUC 1OM3H 3RZCA 1SXBA 4GBXA 5DK3A 3PDOB 3FO2A 2C8NA 2HJKA 3BYYA 4PVLA 3MJWA 4RGNC 5AAPA 4XXWC 2NRDA 2R4RL 4JREB 1NMBH 1E4KC 1Z0NA 2VLRD 5AKRA 5EPMA 2YGOA 1BJ8A 4R3SA 1PF3A 4WSGA 5ICZB 3I02B 3IDUA 4OCWH 4HJSA 3KYAA 2ARJA 4OV6F 3LS5L 3RTLA 4QWWC 3E3QC 5BO1L 1AQ8A 3CFTA 4MMZB 3BDBA 4HT1H 5SWZA 1QUPA 1MCOL 3QARA 4JL2A 4UI2A 4R4BB 4Z7NB 3TA3D 3WTYA 2P5EA 4FQQA 1G9MC 3SGDH 2J56A 1XV8A 3NABL 5C0BA 4JPKH 4N1EA 3T3PF 4ZBJA 5JW3L 2C9UA 1OZTG 4DP4X 3PWUA 3FQNB 1XMWA 3WLBA 3FCTB 3ZKXC 2AV1B 1T1YA 2D0FA 3DYPA 3O6ML 2OQJA 4PTTB 2X4OB 2KMWA 2JQAA 3APNA 4WV1B 2NLJB 1NGQL 1WRFA 2FJFA 1E4KA 4EN3B 4E41A 2I60H 1CDUA 3APDA 4KK8C 3DGDA 1WAAE 1ADQH 4JW3A 5DURB 3M07A 4CNIA 1TJMA 1LWJA 3MBXH 3EZJB 1EGJH 4JZJB 3H0TB 4C56B 2EEBA 3KPSA 5AOMA 1WP6A 2FQDA 1MZYA 4XVSH 2Q86B 5KSBA 3RDTD 5JO5A 5T1LB 2F53B 2GSMB 4L1TA 2E75C 5EO9A 1OAZH 4I2XE 3VG0L 3AUVA 4JFZH 5KW9L 1IUZA 1XB3A 3PNWA 1OARL 1G7QB 5INDB 2ED7A 4YDLB 1E3FA 5H94B 3BKCH 4CMMB 3SPHA 3EJYC 4A55A 1W6WA 2GJRA 2ICWJ 4ODVH 1NWOA 1V3KA 2MCAA 1SJEB 2GSGA 1KB5L 1OTTD 2ITDB 4U33A 1UACH 3TEXA 2X3BA 2X4RB 4U6XA 4PJIB 2EXSA 1YMMA 4Q2ZB 3MV7A 4IBYA 5KJ7E 2G3NA 5D4HA 2C3HA 2X40A 4V1DA 5AVXB 1TIUA 3UIYA 2WCPA 5DU7A 4IOSA 2H45A 1L7TH 1BZ7B 2BSCA 1ZV2A 1OLZA 5L2KA 1WBYB 4EIUA 1VB9A 3AFLA 3RGVD 1QFOA 4X42A 1KB5A 5JIPA 1QI3A 5DJZA 3HHSA 5I76A 4PJXE 4UQBA 2OMZA 3DMMA 4FI6A 3TH3T 2XXFA 3VXSA 1HSAA 3M1CA 1PW3A 4WNQB 2G2RB 3QRGH 1CU4L 3MV01 2AJ3B 2XWBB 5IVXF 5SWSB 3WAKA 1GGYA 4JRYE 5EBLB 2F54E 1M2OA 1NIAA 3IJEB 2WVVB 3CFMA 2EDMA 2ESVD 3D39B 3GM8A 4N5EC 4NFCA 4QHKI 4RDQG 3RVVC 4WRLA 4OIIH 3S5LA 4G1EB 3PCYA 4WY7H 1H3VA 3TT3L 3C87A 4LCWD 1YLBB 3ZSTA 1NGXA 4MZ2A 1I85C 1K3IA 4ZJ9A 2IFFH 1JGUH 5JXEA 1ECZA 3RA7L 1BQKA 3QPXH 1XCWA 4MZIA 2VSDA 1P1VA 3TA4D 1N59A 1LLAA 2ADGA 2MOQA 2QQQA 4XH2B 5E7FA 3TCTA 2UY6A 2W65A 4FNTA 4HCFA 1P7QA 2UUDH 4F20A 4MDIA 3QUYB 3ZMEA 1N4XH 1N10A 2BFGA 2HT2D 2Q0ZX 4RZKA 4KTGA 4I87A 4NNPL 1HSBA 2OTWA 3MLZL 1HOEA 3N50A 4N6QA 2VIRB 3H85A 5BCAA 2IBBA 2WTRA 3S35L 3TH2T 4OCRL 4D9RE 1FL6B 2G9HB 3JVFC 1FORL 1O75A 2VLRA 3KPRB 1ZLDA 5GISL 3U6XA 4P07A 5E08H 4AEFA 4JCWA 1NCCL 1TFPA 4MMXA 5EEWA 2Z64C 4ZAKB 5B7EA 2Y1YA 5FLVA 2ENJA 3HE7B 1ZHLA 3NZHH 4BZ2H 5B8CB 4YGAB 4XPGL 3UOAB 5B4MC 2WXHA 4GOSA 4HIHA 2XJKA 3BCFA 4HWBH 1NMBL 3ETBF 1L9PA 5JOFA