1OP4A

Solution structure of neural cadherin prodomain
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
136
structure length
136
Chain Sequence
EASGEIALCKTGFPEDVYSAVLPKDVHEGQPLLNVKFSNCNRKRKVQYESSEPADFKVDEDGTVYAVRSFPLTAEQAKFLIYAQDKETQEKWQVAVNLSREPTLTEEPMKEPHEIEEIVFPRQLAKHSGALQRQKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neural-cadherin
publication title Structure of the Neural (N-) Cadherin Prodomain Reveals a Cadherin Extracellular Domain-like Fold without Adhesive Characteristics
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 9
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2003-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08758 Cadherin_pro Cadherin prodomain like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 1op4A01
3Q2NA 1WYJA 2OMVB 4AK1A 3K6IA 3LNIA 1ZVNA 2OMYB 3UBFA 3PPEA 1L3WA 4ZMZA 1WUZA 4ZMNA 3LNDA 2QVFB 2YSTA 4AXWB 4AQAA 5CO1A 4AQEA 2OMXB 3Q2WA 4OY9A 4NQQA 3LNFA 2V37A 3UBHA 4ZMYA 5JYMA 4ZMPA 3QRBA 4NUMA 1NCHA 4QD2E 4ZMWA 3K6FA 4NUPA 3LNEA 1NCGA 1SUHA 4ZMOA 2WHVA 4APXA 3K5RA 2OMUB 1Q1PA 2WCPA 4ZTEA 3LNGA 2WD0A 2O72A 2OMWB 5DZVA 4ZT1A 1NCIA 3K6DA 2WBXA 1O6SB 4XXWC 3MVSA 2A4EA 1EDHA 3K5SA 5CZRA 4ZMXA 4XXWA 2QVIA 3LNHA 2OMZB 3Q2VA 2OMTB 4AQAB 2YQGA 4ZMQA 4AQ8C 2X2UA 4AQEB 4APXB 2EE0A 4AQ8A 1NCJA 1ZXKA 4ZMLA 2A4CA 4ZMTA 3UBGA 1FF5A 4NUQA 3FF8A 4AXWA 1OP4A 3FF7A 5JYLA 5KJ4A 3Q2LA 4ZI8A 4ZMVA
chains in the Genus database with same CATH superfamily
4BSVA 1CMOA 4Y5YB 2VL4A 5EFIB 4ZTOH 2Z6FA 1S46A 4F92B 5HXMA 3WFDL 4AV5A 1Z66A 3MRHB 4U1KB 3RDTA 4X5RA 3IPEA 5F6HI 2ZXAA 2W95A 1GGYA 4ZSOA 2C34A 4MMZB 2XTJD 4WO0A 5F7FA 1DLHB 1JI2A 2UZXA 5DZPA 1JIBA 4MNQA 3BP7B 1U4FA 2DOCA 5AALA 4DO5A 2D7QA 2EXTA 1YN7A 2WNKA 4JFFD 2ZOLA 4YDVB 4ZMNA 1MCKA 1QR1A 1KJ2L 3HOGA 1PW3A 1X9LA 3RNKA 2XPZA 3G5WA 3TYGH 3RLSA 1IBDA 3QIUC 1KB9K 4AGNA 1P7QB 1RUQH 2EINB 4UANA 4I2XB 4GW5B 4PJDE 2BRRH 4OI7A 4A6YL 3GS0A 1NZRA 4EQ3A 5BRPA 4QRPB 1F18A 4NN6B 4HJJH 4M62L 3LKSB 5DLMH 2X4OB 3E0GA 2VDPB 4LZKA 4XMPL 3V55A 5E6ID 5JW3H 3IJYA 2PTVA 3P9LA 3ARGB 4LCVA 5DUJA 5I71C 4CW1A 1NEPA 1NDMB 4ZPTA 2D03H 2X0UA 2F8OA 3BDYH 5ESAB 2VLME 4DGWC 2W07A 4TNGA 5BMFH 1JTOA 4M4RB 4ZSOE 4F20A 2WBJA 2IJ0C 1MJ7L 1NAKH 4Z7QF 5FYKL 5JIKA 3WNKA 4MNQE 3SE8H 3MGOB 1UOWA 5IM7A 3G6JF 4O02L 4XWGL 3RPKA 2R29H 1LLAA 3DTXA 3COOA 4RBPH 1FZMB 2A6DB 4HP5A 1MWAH 3TCLA 5EA0H 4U2ZA 1BWWA 4BSWB 2AMUA 1NJ9A 5F88A 1DDTA 3TGXA 2NQCA 2QKIB 1NCOA 4GUOA 2VLRA 2WBXA 2DYPB 3QUZA 1NGQH 2VL5A 1H15A 5JR1H 4N2FA 2ZUSA 4ZX5A 4MCZB 2LFGA 4ZS7L 2RFXB 3S97C 5DR5H 5EOCL 1LO3L 4X6BB 4Z76B 3NABH 3RIAF 5KTEL 1J8RA 4M93B 4AGQA 1WA2X 1E4XI 3N5AA 3OR7A 4NNXB 4F2FA 1CGVA 2AXFA 1KJ3H 3WEOA 4JO3H 4P9HL 1EEZA 3LV3A 1GHFH 5E2JA 4I8DA 4N90D 3GK8H 4NXKA 5D5MA 4G1EA 4LSTH 4ODVH 3SDCB 1OAXH 4IKLA 1RIHH 3SQOL 4PLJD 2CWRA 1JYNA 2VITB 5HGGS 3V5HB 4DEUA 1D6EA 3GHEH 2PCPA 2EEDA 2A6IA 1BD2D 3JV4B 5AUMA 4A55A 1XEDA 3K6SB 3MUGA 5KVGE 2VLRE 4U3SB 3T0EB 1XAUA 3NA4A 2ZF8A 3WFZA 2VDNH 4GQ9H 1HVXA 3TNNA 4NO3B 3CDCA 6FABL 3QQDB 2OXGB 2O5ZH 4IJ3C 3IJEB 4UF7C 2WGXA 2XV0A 4X7SH 2NDGA 4LCUB 1N5YH 1NCAH 4IIZA 2KHAA 1R34A 4PP2A 1VFAA 4W9FC 4PD4K 4AM0A 3AQYA 1SBSH 3EO9H 2ENQA 4LL4A 5ICXA 2XUWA 2DTSA 2YD0A 4EKXA 3OHXC 5TQ0L 3PWVB 5D5ME 1ZHKB 3GSUA 1ETJA 5F0JB 2OMXB 2VE6B 5E2WL 1HU8A 1XF3B 4NQQA 4F7EA 5JW5B 4ALAL 1UT2A 1A7OL 2WYIA 3O3EA 2MEJB 1MUJB 4YE4L 2J6EL 2E7LA 5B3NA 5CMAB 1HKFA 4AYEC 1TTFA 1YEKH 1L0PA 4KFZC 2XWTA 1LO0L 2I7SA 3IBEA 4U1GC 3ISRA 4PREA 2VXUH 4G8AC 1JGUH 1MNUL 3E9TA 4L8DA 5LN4A 1NGPL 5KAQG 1NCWL 4P3DB 2QTEA 4QPEA 5AOKA 2C1PB 5HVGB 4Z3FA 5AAWC 3ILQC 4B41A 2WMPB 5HPMB 3V95A 2BHUA 2DLTA 4NZTL 2AQ2A 3SCMA 3LKQA 5D70H 4QHMB 4KKNA 4QI3A 1B0GA 4UI2A 1OQXA 4FTVA 3MN8A 4U0RB 5HVHC 3T3PE 1OSPL 3MJ9A 2OYPA 3QULA 5DYOA 3EO0A 2ICWB 1P9MA 3GZOA 3L2LA 4AUUA 4J7RA 1U3HC 4NBZB 2HSIA 1IAIL 3KPQA 3PJSB 1ID5I 2HLFC 1U8MA 2EC9U 1FAIL 2X4QB 4J4PA 4Z7WF 4KKPA 2NXYD 5IT2H 2B4CL 4RISL 1A9VA 1CZ8H 4H8WH 5AL8A 3UGUA 4JPKH 3O8XB 1RJZB 4EVNB 3B9KA 2I85A 5EFIA 1XFPA 3DI3B 4D0DA 4HUVB 1WT5A 2H5UA 2GBVA 5IQ7H 3KLDA 2A4CA 1E4KA 2XV2A 4BINA 4MAYC 4POZD 4MMZA 4L8CB 5DRXB 5AENA 2JQMA 1IEAB 4QRQA 5JUEH 3DO3A 1KCRH 3QS2A 5DRZA 5CJOH 4ZG1A 2NY0D 3BP7A 2XDHA 1DANT 1V27A 4TNFA 4FTVE 3WNNA 5DD0H 3H53A 1FYHB 1IBGH 3HLKA 4PJAF 1ZGLM 4ZFZA 2KZBA 4IBTA 4FZ8L 1KB5L 1R5IB 4IW4C 4X8JB 1N7MH 4GW5A 1ZK9A 4ZUVB 4J39A 1IKOP 2QGDA 3EYUL 1GGIH 4E36A 4JN1H 2R8SL 4F3FB 3OMAB 4QRPA 4Q9CA 3EFFA 2VDQL 1KLFA 2IAMC 2X4OA 1E5BA 3ARRA 4QKTA 4ERSL 2CNYA 1UM5L 3ARGA 5I0DA 5J6GB 1QBMH 2E9GA 3RFZB 4QEGA 4XP5L 5ESAA 2C8NA 2OQJA 1JNJA 3CU1A 4RSVA 1EDYA 4GRMB 3NT0A 2XVKA 2RB8A 4M4RA 3V0JA 4M56A 3WXWH 4C59B 2GEEA 3RTQD 3LCYA 4I9WD 4F1ZA 2ITDA 4P2RD 1MFAH 1ML0A 4UYQA 3F7LA 3AQXA 1FZMA 4HJ0C 4YJZL 1G9MC 4HWEL 4Y16C 5F7UA 2NTFB 4BSWA 3FO9B 3CQQA 4IRJA 4EI5C 4OB5H 5FYJL 1GMEA 1DSFL 5E1AB 5I2IA 4F37F 4AEHL 3O2VH 4QRPE 3RI5K 3BPCA 3IYLW 1AG0A 3A22A 4U05A 4MCZA 1OE1A 1E67A 2RFXA 1G6RL 4L4JA 4X6BA 4R3SB 4Z76A 4R7LA 1WWWX 5F7YC 3MKKA 1DVFA 3IDYC 2QTVA 4ODHH 2WTRA 2YXWA 3BWUC 4RQQA 1J12A 3ZOAA 2IGFL 3KPOA 4XB7A 3PDOB 3SDCA 2DWEB 3P2DA 4PRBB 2VR7A 2K6WA 2VITA 5F9WC 3H6AA 5AYUH 4ZFFB 5LDUA 3L3IA 2DMGA 4MA7H 1JZ6A 3D69B 3JV4A 1S7RB 1DJWA 3K6SA 3ARPA 2ED6A 1JP5A 1I9IH 3NJLA 1NBVH 3BW9B 2YR3A 3FQYA 3VSQA 3QQDA 4ABVA 1LWRA 3IJEA 4LPWA 4R5XA 3CC5B 4X9BA 1XCTB 3GO1H 5ICZB 1TVDA 3QEGL 4YR6B 1N2RB 4DEPB 3Q6GL 3ZBMA 3AABA 4LVNC 4KZDL 1OP3H 5LJYH 4JR9L 2MJWA 4GMTL 3PWVA 1ZHKA 1A1MB 3BZFB 3MRCA 3EIFA 3ZQ9A 1XWVA 2EVIA 2OMXA 2VE6A 1XF3A 5JW5A 5C08D 5I28A 3QNYB 5IWLA 4M29A 3TV8A 4IM8A 1TTCA 3LRMA 1PGRB 4U7MA 1MUJA 5TH2B 1CFQB 3IRPX 2QQNL 5CHNB 2Z7YA 4NM8H 3FSOA 5EULV 4IDJL 3RWHB 4L9DA 1Q94B 2IAAC 3C9NA 5IFAL 2G3XA 3MA9L 4YZFE 5JHBA 4HXBH 4K0OA 4POYA 2W9EH 4MMYB 2FBJH 4I18C 4J3SA 2Z4QB 1OW0C 3WHXB 1JGVL 2YAQA 2EKJA 4P3DA 4AL8C 3QARA 2C1PA 2WLZA 5CSBA 5I15H 3F01A 3LDBB 3OLGA 1E6OH 2WMPA 4G9FD 2CJUL 3BQUB 1G9HA 4QHMA 3AGWA 1AIZA 2P4AB 2YZ1A 4OF6A 5AVVB 1LDSA 1AE6H 5L9DH 2ICWA 4NQXA 1TZGL 5JNYB 2AQQA 1BFOA 2Y2TA 4P2OB 3VWKD 1MZZA 2D3VA 2I24N 4AYMC 3KLAB 3AUWB 3LY6A 2X4QA 1HL9A 2Q7NA 2XBTA 3MRLB 2L7EA 5KBMA 3EJZC 1FO0L 2JELL 4BGLA 3V4VH 3NACH 4H40A 3ZX1A 4KTEL 3VGEA 4Z95L 1V3MA 3O8XA 1RJZA 2OTPA 4RDBA 4HUVA 1KOAA 5DJDA 3H4HA 2FAUA 2GJZB 4NJAH 3T6QC 4MXWL 4Q9RH 1XGTB 4QLRA 4JKKA 1QYGL 4WENB 4X6DF 1T1ZB 3ZL4L 5A6LA 2B5IC 5DRXA 2OMWB 2D7OA 1OARL 4XVOA 5CGMA 4Y9CA 4B0MB 2UXTA 3EO1B 5JOPD 1U8PA 1KGCE 4CKVX 3HHMA 1OY3B 4XE0A 1YDPA 5D96B 2LR4A 3OV6A 4GXFA 4IRZH 1JCKA 3LZLA 2J25A 3FTVA 1Y6KR 4OTXL 1R5IA 1VGKB 4A39A 2HPOA 2MQGA 3CIQA 4OZ4A 2Y25A 4ZUVA 1CXEA 2BIQA 4HDIB 4KRPB 4DHLA 3QWRD 1DVUA 3EDEA 4FXKC 5LVEA 4JQXC 1OGSA 4CDGC 4IEFB 1KB9J 1SXSA 3FUJA 4IBQA 3WHE1 5J6GA 2ZX7A 1W15A 3PGFH 4G42B 5EU6D 5D1ZI 3RFZA 4LE8A 3CFIC 4GRMA 1SPDA 3VXMB 4KRMB 4TSBH 2YRPA 5JHAA 3LAFA 3N1GC 4JUTA 1IBZA 2GI0A 3VRIB 1TZAA 6PAZA 3GRGA 1E27B 2D9CA 2H0JA 1ACYH 1EGJL 3MV8D 5F1KC 3I9GL 4QJ5B 3PPSA 5T3XD 2DV6A 3C09B 5AW3B 2DH3A 5CJ5A 3O3UN 2VLKD 3VXOB 5EZPA 3BX7C 2GY5A 3HVDA 3N1QC 5DJAB 5EZJB 4F9PA 2D9QB 1P1ZB 4JHBA 3NSDA 3CFJB 5C0BD 1IM3A 3GKWH 3GPEA 4HIJB 3VVWA 1F41A 3FO9A 4LSQH 4WY7H 1MFCL 4KK9C 3MTXA 3HC3H 2B1HL 4HF5L 5J6SA 1IKFH 5E1AA 3GI9H 2PCFB 3DXAB 4IBZA 1PKQB 2ADFH 1AY1L 3GSQB 4J3BA 4YMPA 1JYVA 2CPCA 4FQJL 4R3SA 2H32H 4K2UH 4KDTC 2D7PA 1P84K 3DOSB 3PCYA 2H2PC 4HOWA 3FSVA 4OJCA 2LVCA 1BYNA 3VFTB 4PTUB 4OCNC 3BKCL 1LEKA 5DWUH 3VSVA 4YN3A 2PR4L 2A6KB 3OB8A 3V5KB 3WELA 1FPTL 2QSTA 4IIQC 5EU3B 1C5BL 3PDOA 3L4ZA 2QFRA 5D1ZC 5C0AB 2KQNA 3FNKA 4S10A 3W3BA 2DWEA 2HT4D 4PRBA 4HK3J 2W38A 3HAEH 3NJIA 4HBQA 4ZS6D 1GZPB 3LEVH 2B9BA 2FZ3B 3ZHDA 4N20A 4ZFFA 1KJMB 3D69A 1S7RA 3RPBA 5KVEH 3VXQB 5AWNH 1ACZA 2BH0A 2HYMA 4LSRH 5DJ2B 3WTSA 5IFHL 1KEGH 2RQ8A 3ZZLA 4ZQKB 3T8VA 1NBYA 4M3JA 4X7EC 4HIIB 4AYFB 3G6DH 5B1JA 5HJBA 2H3XC 3CC5A 3LYRA 2JKNA 1XCTA 5ICZA 3BGMB 4IQHA 1RXLA 4DQOL 4YR6A 3T0WA 4C4KO 2A1WH 1N2RA 2QHRL 4K8RH 4M3HA 5C0GA 5I1CH 3S37L 4KNQA 1UCBL 1YEIL 3S37X 3GBDA 3NIDF 4X6CB 3AM8A 3HNSL 1D9KD 3GZPA 1A1MA 5JHDB 4WU5B 1J8SA 4X4KA 4Y7OC 2AXGB 3QNYA 4ZO8A 2I5YH 3MACL 5IEHB 3UC2A 5TH2A 2V7HB 1CFQA 2AABH 3UYOD 1HYSC 5CHNA 4N8VB 3ABLB 4EMZA 3RWHA 3KJ6L 4NFDA 4DGIH 1Q94A 4Z0BH 3NZHL 5KAQF 3NEOA 3QORD 1J1OH 3RVUC 1XH3B 1EHNA 2Z4QA 4FA6A 5EU4B 2GJ6A 2ICCA 3VJ6B 3V7AG 4YBQD 2PN5A 2C3VB 3K81A 3HI1B 3BQUA 3IM1A 3THML 3F65A 4O9HL 2ADJB 5DEGA 4YC2C 3V4LA 1LP9B 5D9SB 2VISA 1QZ1A 2AGJL 4LDOB 5BS0B 4GRWB 5E8EB 3GHBL 3FFOA 4H20H 4YZWA 4F8QA 4S1QH 2PKDA 3KLAA 3LH8A 1CFVL 2EEXA 3MRLA 1QLRB 3LRKA 1J5CA 3LHPH 5GRUL 1NBZB 1KNOB 1O9ZA 2ITCB 5ANHA 5JORA 5JXEA 2QSQA 2DQ6A 2O5NA 3T2QA 3WS6A 1T5WB 5IG7B 1IGTB 1RU9L 3U9WA 4OQTH 5I24A 1KIUA 3TLRA 4UB0H 2JI2A 1E43A 3TBYB 1HAWA 2GJZA 3L8QA 4N9GB 1E5ZA 1YEDA 2P8LB 1XGTA 4ZO7A 3VWJC 4DN4H 1E9PB 1ZLVH 2OK0H 3P11L 1JN6A 2OMWA 4ZFQA 3RKPA 3S0PA 3TA3C 1TTUA 1AACA 2WAHA 2QL1A 4PBXA 3FO0H 3EO1A 3LQMA 3NGBC 4CBPA 1QWNA 2WIIA 4NRYB 5F7EL 4QY8A 4IRSC 1MLCB 4PI0A 5JTWA 4E9QA 1G9NC 5D2LB 1HEZB 4KJQD 4G83A 1MY5A 1LK3H 2HAZA 3IDIB 3TOPA 1PZBA 3QIUB 3OKDB 3IAQA 4HDIA 2FIKA 3VMNA 1I7RB 2NUTB 4X80H 4HFUH 5E1HB 2PR9A 2VZ1A 4TQIA 2CRIA 2BSEA 5E2VL 3TCTA 5G4MA 15C8L 5I71B 2WUCH 1MDAA 5JIHA 3ATDA 2V9QA 3OMZA 3VXMA 1YY9D 3LRLA 3VRIA 1XTLA 2UV3A 3H9ZA 4L05A 3GSXA 1F42A 1A9EB 4YDIL 1MXGA 4WLCA 4JKMA 4Y4HC 4OW6A 3RB5A 1EBPA 1F02I 3NP4A 2XZCH 4PCSA 3M8OL 2FQFA 1JK8B 4HIJA 2JVUA 3CFDB 3EBIA 1WFOA 5ID0B 5LNDA 1OTUD 4G7YH 5FA3B 4P2QB 2FVNA 2ZKXA 4JO2L 1Z3RA 2PCFA 3DXAA 3MPCA 1PKQA 3FU7B 3JZYA 3VD0A 3RWGB 1WFNA 2CQVA 4KJWC 3GSQA 3T1WA 5GZOA 2E5EA 3ARFA 3VI3A 4ZX4A 2YUWA 3DOSA 1GGBH 3KPTA 3PGCB 4I0PC 3VXME 1XEUA 4X9GA 3Q1EA 2ZWLT 1HJBC 2FR4B 2YJQA 4K3JH 3VFRA 1JD9A 4PTUA 1FN4B 4X5QA 4X5XB 4YS4A 1CICC 4KUZH 2A6KA 3KPNB 3KBFA 4FD0A 3V5KA 5BOZG 5MP6H 2VC2H 4JMXA 1OSYA 5EU3A 5C0AA 5FW8A 4LPYA 2A4ZA 5F7WC 1NLBH 3U1PA 2D3NA 3NBNA 4OLUL 2BK8A 1YNLL 1JGLL 4X6FB 3UC0L 1GZPA 1QRKA 2R0KH 2FZ3A 4RLDA 4WFGE 1FHNA 1L9NA 1KJMA 5AYQA 5GS0L 3VXQA 1KUMA 3BCDA 5EUKB 3FXIC 4OCYL 5AW2B 4YOKA 3UROR 2Q10A 5IHHA 1TENA 4KXAA 2J1YA 2NXZD 3DXAE 4ZQKA 1PKQE 3RVWD 4HIXL 3TXAA 1V3JA 4HIIA 1ROCA 4AYFA 1IQDB 3BJ91 4WUUB 3QFGA 3A6BH 1RULL 3BN9C 1OCCB 2XBZA 4K94H 4XP6L 3VI3E 2Q3ZA 4IJ3B 1RZQA 4JBSA 3SE3A 1MQKH 2VO5A 3SJVD 2DMKA 1YYMH 1KTDB 2JXMB 3EH3B 2Z7UA 2FX8H 1UKTA 4J3OC 5EBGA 2BHFA 3OD3A 3SPVA 5IVXB 5C0AE 3B3IA 3OHXB 3QHFH 4HKJB 1LO4L 4MB5A 4XMZA 2LW3A 4DKFL 4CMMB 5JHDA 4WU5A 3HMWL 2ZCLH 1J5OL 4JHWH 5IEHA 2GFBA 4IMKA 3BSZL 2V7HA 4S2SB 2NTSP 3UPRA 1BQKA 1IO4C 4IOIB 4N8VA 2BRQA 6PCYA 1XGQB 3MUZ1 1PCSA 1JZDC 2WZ5A 4Y4KC 4NRXB 3UMTA 4M6ML 3IF1A 4U1GB 5JPNC 5I9QC 5EU4A 3U9PL 1PF3A 3DRQB 1AR1D 2X4RA 3OAZK 4OF7A 1E3FA 1FL5B 4UWQB 3S3PA 4HZ1A 5E99H 2BNRB 3HI1A 4ODTL 5FFGA 5EZOH 3SBQA 3QJHB 5T5NG 4DSYA 2ADJA 5JDJA 2I9TB 4PJ9C 1A9BB 1LP9A 3VSTA 5D8JL 4NQED 5BS0A 3ISWA 1AHWC 1OAZH 4XHJC 5DTFB 5HVHB 5E8EA 3BKYH 3QT2A 1F11B 5ANMA 2WPGA 2BSDA 5JHDE 3BFQG 5C2BL 3UZEC 4HPHA 1U3HB 3FONA 3QXUA 1QLRA 1NBZA 1KNOA 3DJRA 2ITCA 2IG2L 1GAFL 1J5IA 3OKEB 1T5WA 4HGKC 1IGTA 5IG7A 2J1XA 4P5RA 4H5SA 3B2UD 3T2OA 1G7LB 4EF3A 2VABA 2CO7B 1LVEA 3BP5A 3TBYA 2P8LA 1FVEA 1SLWA 4LVOC 2JIXD 1E9PA 1JPFB 3VQLA 2VQ1B 1URLA 4MAYB 2H26B 2WXOA 4C56D 1TTGA 3KMDA 3L6FB 3L4UA 4I9XA 2EABA 4QMEA 1LP9E 5HHXH 1SEQL 1S7SA 2MQ0A 3F2LA 4NRYA 5KN5B 1MLCA 4YH6A 1ASPA 1AYRA 3RE0A 4MXQC 5BS0E 3T0XA 4GRWE 5D2LA 4HFWB 5ANME 2H3NA 3NSJA 3TEYA 3T71A 3IDIA 4XP1L 3QIUA 2WB7A 4RAUB 3OKDA 1GW6A 4BFFA 5BZWB 4AKQA 1I7RA 3HS9A 3QCVL 5K59F 3JWDL 4HOMA 3QCUH 3STLA 3QG6A 3ZUNC 4M6AA 2IAMB 5FXCH 1CS6A 2K0RA 1JE6A 4Y5VC 4ZMPA 3D1MC 5CZXD 3WLBA 4EDWH 4FQLL 1FC1A 3D4ZA 3W81A 2IANB 1KJ2A 5DC4B 1H8SA 2GT9B 4BZYA 4NZUL 5J56B 1SYSB 5AKTA 1SUHA 1UCTA 2K1MA 4KMQA 1T66C 3L2NA 4A6YA 4N5ED 1R3IH 1DBJL 1X5IA 2E6QA 2VXSL 3AW5A 4GYBA 2P46B 4NSKA 3ULUD 5T1JA 1X7TA 2AMGA 5D2LE 6TAAA 5JO5B 3NOIA 1JK8A 4G11A 1QSEB 3CFDA 4FQHB 1N6QH 1FV1B 1AAJA 1TZOA 3MUJA 4QRRD 5DD6A 4BDVB 2E59A 2JF1A 4L1HA 2N7AA 5FA3A 1X5XA 1IM9A 1ZY9A 4P2QA 4I77H 1OAKL 4EI5B 5C92A 2EILB 3ETTA 2APBA 3FU7A 2UZYB 3N1PC 2FQGA 1CGSH 5DD1H 1C12B 5DMJB 3RJQB 3RWGA 4B97A 1JRHI 4ZODA 4ENEC 4UT7L 5IB2B 4FC3E 5AW7B 3WIFB 1JF5A 1AXTL 5FK9B 1CDYA 1J0KA 4KKBD 3N9GL 4UBDC 3Q3GB 2XN9D 5CF3A 1J9TA 1FN4A 1WGVA 4X5XA 5IB1B 4MA3B 3U9UB 3UG3A 4Z7VB 2QSCH 4R90H 1P84J 1GC1L 1QW9A 4FKHA 1O7DC 3ENEA 1ZT4B 3NJFA 3QPKA 5DEZA 4B9GA 1J9QA 2QQLH 3UERA 1C9SA 1Z7JA 2R0ZH 5E7FA 5CEXB 1J88A 4IJTA 2QZ5A 5DHVB 5I8OH 5F9WB 4XHQA 2QGEA 3WKMH 5EUKA 2E3VA 4P2QE 3A47A 1P2CB 4TLKA 1ZGLP 2OR8A 3O3AB 4HCRH 2F15A 1IQDA 1SLVA 3SQRA 3KGSA 3L9YA 4WUUA 5FYKE 2ZXCA 4UT9L 1WTLA 3OWEA 3CDGB 4PGEB 3CBRA 2XRAL 3H7BB 4DPCX 3FCUB 1KTDA 4R5TA 4NWTH 3OSVA 2H8PB 2R23A 4CGTA 4MMXC 4WI5A 5DT1L 1PY0A 1Z6JT 4LVNB 4HBCH 1BPVA 5J5EA 3DTUB 2WKOF 3OHXA 4CMMA 4HETA 5HYEA 3GRWH 4OCXL 1KCLA 2CM5A 4S2SA 4FNQA 2DMBA 1HXYB 1XGQA 1J9RA 3UBHA 4PV8A 1BVKB 2WXKA 5JYMA 4QYOB 3CMGA 4NRXA 4W68A 4UNVA 3GBEA 4QD2E 2WAQA 2W0FA 4WUUE 4W9DC 4I18B 1X5HA 2RD0A 3BFOA 4P5KB 1FL5A 4ANKA 2E9BA 4ZQTA 1KY7A 2WLKA 4WWKC 3S2CA 2BNRA 1KTCA 3DSNB 3OAUL 5AAWA 2P5EA 2BDNL 2WVUA 2YXFA 4DGYH 4B9YA 5L2JB 2Q2EB 1A6UH 1A9BA 2I9TA 2UZIL 5FF6B 4ODSL 2V17L 4Z3EA 1F11A 2EECA 2HJLB 2ZQKA 5J1AB 3NQIA 3F12B 1U3HA 2C5DC 2NMSA 5D55A 3ZT6A 3VFMA 4URTB 4N2KA 5DMKA 1RK7A 1EERB 4G7VH 2D4FA 5FGRA 3V4PB 5IQMA 4HPYH 4H88L 5FUCC 3TBTB 3FHQA 1G7LA 3FT2A 3FU5A 4BZ1H 2F53D 2HPTA 2ZX9A 3M86A 2WLMA 3SGEH 2CO7A 5KSBB 4G5ZH 5M95B 4GFTB 5C8JB 1JPFA 4LLUB 4XC1H 4MAYA 2BNRE 2H26A 1R3KB 3D85B 1CTMA 4HS6B 1XXFC 3STBA 2B5IB 1P7KB 2YKKA 5TD4A 5TFSH 5KOVC 2P5EE 4KO9A 4H8UA 3DUSB 1VFOA 1OGAB 5KN5A 2DDQL 2ZOOA 1TVBA 4HH8A 1S8DB 5BJTB 4LCWB 4JKWA 3CMOL 4HFWA 5KJ4A 5L8LB 3POHA 1FNEB 2H0PA 1J5HA 1MH5B 1W8OA 2EP6A 4PP1D 5D1XD 2BJML 2GTZB 2X2IA 3I9IA 4YWGL 4RESB 2NCEA 2BVTA 3FMGL 5BZWA 4P23D 3JSSA 3MUY1 4FCHA 3RA7H 5E51A 1IILE 2DQUL 2R1XB 3ZGIA 5KSAC 1QAWA 2V3DA 3LIUA 3FUIA 4FXKB 4L23A 5D7EA 4Z7OF 1FIGH 2IAMA 1H6EA 3OR6A 1HKLH 1QX1A 5DEJA 4AKPA 3PHSA 3RVVD 1XCWA 1KELL 4ANVA 1JPTH 3C5ZD 4M5ZH 2NT0A 2GT9A 4K9JA 4M1CC 2NQDA 3PL6C 1XF4B 3RG1C 1SYSA 4EIUA 1G0DA 4NPYB 3HN3A 4RRPM 1WPCA 3DA0A 3GIZH 3GSOB 4BK5A 5HYSB 3KL0A 5CEZL 5I66A 5I0VA 1K3ZA 2CBQA 3GZQA 4MJ5A 3QC5X 5JO5A 5GISH 1IV8A 3FCSB 5IBLC 1QSEA 3T6VA 1DCLA 3PWUB 3MLTB 4PVNA 4BDVA 4BQBA 3RDTD 4Y16A 3M7OA 1F58H 5D6DC 3D09A 3LRHA 4GUPB 3CGTA 3FN9A 4KUCF 4X8XA 4DP2X 4QJ3B 5AVZB 4UIKL 1HQRB 1GCYA 2DM4A 1TJIH 2VQ4A 4MNQD 1JWSB 3AQZA 4XAWL 4GINA 1BW8A 4P46A 2X0VA 4AITA 5IB2A 4HULB 1MHPL 2JKIS 5IW6A 3TN0D 3BEWB 3WIFA 4MA8H 5KVFL 2EYRB 2LU5A 3QISA 5FK9A 2VKXA 2XJLA 3MBEC 3F8UB 4UQIM 1W8NA 3Q3GA 5IB1A 3OKOA 4MA3A 2LV4A 1MJUL 4Z7VA 25C8L 3L1EA 5HYJB 2YEVB 4PRHD 4YHOL 3QI9C 2YK1H 5KANG 4GW1B 4AG4H 5CLYA 3B6SB 5BNXD 1Q0YH 1ZT4A 3GBNL 4IIQB 5EUOA 5FCUL 4LRNL 2F5AH 3QR2A 5D1ZB 4Z3GA 3ULVC 4KKZA 5KJ7E 3WN5A 3L48A 1WD8A 4HEPA 2BY3A 1QI3A 4GLRI 2EDFA 4D0BB 5CEXA 2DQCL 2YWZA 5DHVA 1QSEE 2X28A 4J2XA 4RVBA 2H47C 2CSPA 3ZZ1A 2FUTA 3Q5YA 5F8RC 5BXFB 2Z35A 1I8LC 4OF3A 1CU4H 2J56A 4LCCC 3KBHE 4XBMA 2CM6A 2HJKB 3MNVB 4B60A 3O3AA 2E7BA 2VQUA 1IGMH 3M7FB 4HS8L 3H9HB 2G3ZA 2QPEB 2RGSA 1JNNH 1I1AA 3OM3B 4XH2A 5IMOA 2QGBA 4J27A 2DKMA 4MSWA 3FK3A 2LABA 1XGRB 3H7BA 1BLIA 1NCDL 4N2BA 1BM3L 2H8PA 2YPVL 4WKXA 4Z7VE 4KOBA 3ZTEA 5IOKA 5DJ6B 3L9RB 1EPFA 1TQWA 5EUOE 4KX9A 1ED3B 1BJ1J 1EFXD 3UIYA 5EEWA 5EWIL 3BH8B 1D7CA 3RY6C 3EJTA 5BUAA 4JY6B 4KROD 1J1XH 3R7QA 5EV7A 3NCBB 1WFJA 1BVKA 2Z34A 4QYOA 4O5LL 3O6ML 5B3JE 1Z5YD 3QZPA 4DW2H 2IIJA 2A9MH 4I18A 3MLVH 2IFGA 1OW0A 1YEJH 4P5KA 1A1OA 3UBXB 2EVFA 1ET5A 4U1JB 2LLLA 5IR1A 5GRJL 2UX7A 2GEQA 2DKSA 5GGVL 1EFQA 1K2DB 4GEJA 5DSCB 3BKJL 3ZT7A 1TCRA 3BH9B 5L2JA 3B2DC 5FF6A 3LIZL 2XQBL 4YC2B 1SY6H 5CGYC 4F1SA 1TYRA 1GJIA 5T1KD 4A2GA 2HJLA 1I85C 4LHUB 5I1IL 5E56A 3F12A 3KPLB 2FLMA 4Q4EA 3OVUB 2R1WB 1DJGA 4XN8A 1BYPA 2XTJC 3CFEB 1VFBB 2VDOB 3IU3A 4ZW5A 2VR4A 1CFSA 3V4PA 4ZW7A 1SLUA 3EHBD 3TBTA 4WTQA 3ARDC 4MNHB 1AHKA 5I16A 3N42F 4WFEE 3BRGC 7FABL 3PXLA 3S5LG 5E03A 4WF7A 5KSBA 4HLZG 4L4VD 2VXTL 5C8JA 3VWJB 3D85A 1R3KA 2VO8A 1PD0A 1BSIA 1P7KA 3FJTA 3N43B 2DLEA 3TA3B 4TLSA 5AVTB 3D52A 3DUSA 2VGLM 4Q97A 3LKNA 1OGAA 3BRDA 3NGBB 5HI3C 1FO0A 1U42A 2ESVD 4UNIA 1PZ2A 1S8DA 3CVIH 5E6IC 5BJTA 4LCWA 4IRSB 3KG5A 1RZFH 3SHSA 4LLDB 4AQ8C 5IW1B 5JZ7D 1MH5A 1RI8A 1VGEH 2GTZA 5KYYB 3CN0A 5TE4L 2ZKYA 3NESA 2ENSA 1TNMA 2R1XA 2FCBA 3SCMD 5SX4H 4MJ6A 4JQXA 4XPFL 4PJBA 1L9TA 4HJIA 3A6CH 4LB8A 5KSBE 4L18A 4J8QA 3RVXC 5EF1A 5H37A 2FGWL 1R3JB 5LGHH 1XF4A 3QWOB 3C6SA 4LT7A 5DC0A 3X14B 4CILA 4NPYA 3TZVA 5FHAL 1ZHNB 1MRFH 2XA3A 3CXHK 1OGAE 2E4FA 3GSOA 3K6IA 4Q9BA 2BCKB 4Y4HB 4UOZA 4H1LG 4XRCB 2Z8WC 4LCWE 3X3FL 4XNAA 5HDBF 3MLTA 1MG3C 4EI0A 1NANH 2C7UA 2ZXDA 2ATAA 2BW4A 4AMKL 1MRDH 4PW3A 2Q0ZX 2R2EB 2DKUA 1FFQA 5B7EA 1XZWA 2H6UA 4XVSL 3E8VA 5DVLA 2NR6D 3HI6H 3NZSA 4BZ2H 3X13B 1IJNA 3BUPA 4WFFE 2OL3H 1MHEB 1JWSA 3WIHA 1HNFA 4PJBE 4XR8C 1RMFL 1LNUB 3I6LD 1MCQA 3BEWA 3QJSB 1Z9OA 2BY2A 4OY9A 4PLJC 1U9KA 2X6BA 4A38A 1CDCA 1E9QA 4KDTA 4K7PL 3WNLA 4I0PB 3ROLB 4K7PX 1N9PA 9PCYA 1P7QD 2VN5A 1PLCA 2K78A 2YD4A 2XQYA 2YMXH 2LVEA 1CICB 3T65A 3ISYA 4OI8A 1YNTF 3UTPE 3B6SA 1MCWM 4IIQA 2HT3D 3S96B 2YZ8A 1DBKL 3NPZB 3Q5OA 1NGYB 5D1ZA 2QPSA 3BVDB 4F57L 1BG9A 3DPDA 4D0BA 3F58L 4PB0L 4RFOL 1R0AH 3EW3B 5A3IC 4JCLA 1MFDH 4PWJA 1KC5H 2P8PB 1CDIA 4HK3N 1WHOA 3MNVA 3VGHA 3FU9A 3ZUCA 1DUZA 1B88A 3A67L 4Z7WB 4PBWD 4FNLH 3WE1A 4AMXA 3T8XB 4RAHA 2J88H 3IE9A 5DMGC 3H56A 4UM9D 4MQ7B 4Y1AB 4Y9EA 2E0PA 1XGRA 3ZTNL 1CT8B 3L3KB 1F1GA 3R7RA 2EDOA 2OMBA 5DUPH 2DY2A 2DYPD 5DJ6A 5FOJA 3L9RA 4OCWH 1L6PA 2VZOA 2NY7H 1ED3A 3PWLB 1F8TH 2VR9A 3GSVB 1AI1L 1CFTB 3RB7A 3BH8A 1PD1A 1AZCA 1DFXA 4F7MB 4OR1A 4G6AD 1HE7A 4JY6A 3HC4H 3V7MA 2DJSA 4K9EL 4P57B 3VDBA 4XX1E 1U30A 1BMGA 1WF5A 3VA6A 1D7BA 4JRYB 5MERB 3LKOB 3FO2B 4FQQB 4MAUL 3DGGB 2BFGA 2IMNA 3LD8C 4X4YB 4HKBB 3CVHB 3BAYA 2PYFB 2MOGA 4N4YB 4Y4KB 4YLQT 2FHFA 1W0VA 3SDCD 5I9QB 2X41A 3T08A 5JPNB 1UTDA 1W80A 2KZKA 4YDMA 3DHJA 5AYTA 1T03H 4XOEA 1L6XA 3HUJB 2APFA 1K2DA 5DSCA 4OZIF 3O0RL 2J4WH 1FFTB 3BH9A 1SXBA 1BX2B 1OO2A 5FV2A 4ORZC 1CLCA 4LLQB 2C9VA 5BV7C 4NNYA 3T0ED 3EJUA 1D5RA 4PJ9B 4OGYL 3AVEA 1E3XA 2GIYA 1AHWB 2AF2A 3RBSA 2WY3B 5LXGH 3EZJB 3KPLA 1T89C 3VFNA 3QPXH 2R1WA 4LEOB 3QQXA 3CTTA 1AD0A 1BHGA 4POZC 1VIWA 1T2JA 1DQML 3MRJB 4FQ1H 1OK0A 3CFEA 2AQSA 1T0NB 4TMPA 3W56A 1F6LL 3MXWL 4MNHA 3VD1A 3I3DA 1GXEA 2CCWA 5LGYA 3V5DB 3R19A 4IKIA 5HHQB 2VB5A 4QGYA 5FDWB 2GIXA 1ETZB 4JJHA 4Y8DC 3KLHD 1NTDA 1BVNP 3L5XH 2HVKB 1ZTXH 3EJYC 3VWJA 1HOEA 4LVOB 3I02B 1N64L 1M2OA 4FRWA 4H44C 2P5WB 4GAGH 1EXUB 5EOQL 2R2CA 5E2TH 3TA3A 2DQDL 3WUWG 4TOYH 2YUZA 1PVHA 4JPQA 4ZTPH 2BY0A 3EYSH 2V2TB 1JV5A 3KD4A 4IRSA 2ZOWA 4LLDA 3ILDA 4XC3L 1AGBB 3H3PH 4YAQB 2F5BH 2F19L 4K5MA 4O2CB 3OF6A 2EC9T 3BP6B 3HBGA 3CN4A 4NM4L 2O4EA 3MTRA 1F90L 3RTQC 4A2EA 4M03A 1BEYH 2ZOKB 2RALA 4E9XA 5HGAB 1M7UA 4Y5VB 4LNVA 1MCPH 5FWRA 3NFNA 1ZJBA 2VRQA 1BAWA 4OZGB 2LAGB 1BG1A 1R3JA 4XVTH 3QWOA 3D87B 4ZMQA 3X14A 2ICES 3X2QB 1G6VK 3T4AC 1ZHNA 3O6KL 4PQXA 4TV3A 2OI9C 1KTKE 2BCKA 4Y4HA 3W11C 1PG7W 3PNRB 3HZVB 1CG9B 2AAAA 4Z23A 4JAMB 2X70A 1YECL 1BFTA 4LEBA 3ZRFC 1U3NA 4YE0A 2R2EA 4FQ2L 2EE9A 3S6CA 1RPUA 1PKOA 3FTSA 4A7GF 4LCIH 3X13A 1FCGA 2DJMA 4PJEB 1MHEA 3UZVB 1IL1B 4TNVK 1MCFA 4UQEA 1TEGA 1IC5L 1WFUA 1LNUA 1XD0A 4ELKB 4BQ6A 3BE1H 2G2RB 1DZ0A 3QUXA 1WBZB 2R0WL 4D0CB 4J12A 4OLVH 5LCVA 3ROLA 4DERA 3ARXA 4NKQB 3VDCA 4PWKA 4XOCA 4P06A 5I1HL 4KVCH 1RZKC 5B7MA 1CICA 3CH1A 3CX5K 5ILTL 3F7RA 2DWDA 4BKSC 1NGYA 2JV6A 4LEXL 2R27A 3FT1A 3LNDA 2OLDA 2Q8BL 3DARA 5F1IA 4BUGA 2BPBA 1T80A 3QXAA 1HZHL 4NGHL 4ZX6A 1E42A 3GI8L 2TRHA 3GJEB 2NSXA 2EE2A 2P8PA 1ZRUA 3LMJH 3ULUF 2WYHA 3IVKB 4KXZI 5JIPA 5E9AA 4KKCD 5FGCB 4R4BB 4Z7WA 4C83A 4Z7UB 1PZ5B 1RUAL 3IMTA 2CGRH 1RPQA 4WDIB 4MQ7A 4N6RB 2NY5H 1CT8A 1BJ1H 1UYWH 3ILEA 4KHTL 5BO1L 2Y7OA 1CXLA 2IFFH 4FABL 1M4KA 1SN2A 2VMDA 3TV3H 2CCVA 4KXBA 1PZCA 4BH8B 4MMXB 1FE8H 3U4KA 2G60H 2JE8A 5LAXA 3PWLA 3RFRA 2XJKA 3GSVA 3C8DA 1ZWIB 5FLUA 5EBMB 1S7WB 3LN4B 1DVQA 1ZOXA 4FQXD 4P57A 4WEEA 4E41B 4DUWA 3UPCA 3N0AA 3O2WH 3L1OH 4ZT1A 1B0IA 5MERA 3LKOA 1HILB 1MXDA 4PJAA 1U8OB 1UADC 3FO2A 4FQQA 4XNXL 2KDYA 3DGGA 3PU7A 1P0SE 3DHPA 4Y4KA 1HSBB 1ZLUH 2ZAIA 4Z7WE 3AS3A 2CDGB 1EAOA 2CLRA 5JPNA 3OAZH 2C9PA 3MFGB 4AQAB 1CO1A 4M5YH 2X2UA 4O2EA 4NO0D 1VKXB 5CINL 2AQRA 1D5IL 3WLWD 4WWKB 4BH7B 5GGTA 2H6OA 1BX2A 1YYCA 3IFNH 4O58L 4LLQA 3BSZA 1X5YA 1OSZB 3KWXA 3OPZL 3FFDA 4PJ9A 3QRGL 4HWBA 5E9DB 1YQVL 3SQBB 4F7TA 1ULVA 4HUNB 3EJRA 1AHWA 3MJ9H 1OIOA 4PM1A 4WI7A 2Z93B 1CIDA 3NVQA 3P02A 2VDRL 2ICEA 4LEOA 3UZEA 4OVVA 5DQDH 3MRJA 4FKKA 4P5SA 2HRPH 3E8UH 3ARZA 4L5FL 1T0NA 5T1MB 3VD7A 4HUKB 3A0OA 5TE6L 5J9PB 3LB6D 4TS6A 5FAAA 3FQXB 4PVBA 5HHQA 2XV6B 1F4YH 4GW4A 4R5VA 5AAMC 2Y06L 3TH3T 4KU1A 1K8IB 1GKEA 3W39B 4AVIA 2Y5QA 1MPAL 3REVB 3I02A 2WJ5A 3UTOA 4LCYB 2P5WA 4OI9A 4M5TA 4WFHD 5D7HA 1Y18B 5CR8A 5ITBL 3HA0A 4G3YH 4MNGA 3CDFA 3KPMB 4OUUB 2V2TA 2G4EA 3FT4A 1QLEH 2WWOA 4DPRA 5LXVA 1XGYH 1T20A 4CSSA 3Q2CA 1QHOA 4JUSA 1N5AB 4YAQA 2ZUTA 3JUYA 2LHAA 5B7FA 1TO5A 4GIPD 2MFNA 4O2CA 5T3ZH 4PVMA 3BP6A 5ACZB 4B7LA 1UM4L 3ZKXC 3JUZA 1SDAB 1BV8A 3TEWA 4GSDL 3D4CA 2YAEA 5A2KH 1RURH 1SUJA 3ATEA 4BRVA 5KSAB 2Y7MA 2ZOKA 3L81A 3RUGB 3Q06A 4YDKH 4PW4A 3TT1L 5HGAA 3KPPB 1NIFA 4PJ7B 3N1FC 4Y5VA 4XMUA 4QKXB 1FYTA 4FQPA 4P2OD 1QBLH 4LSSL 3Q05A 2P5WE 2C4FU 1IE5A 1TFHA 3LQZB 4H13C 4KPHH 3PL6B 1TNNA 3HMXL 4MNGE 3QK0A 3HZVA 4RMQA 1GZQB 4NAQA 1T5XB 4JAMA 4MJIB 4WI6A 2Y6SD 3P3YA 5HGBB 5T5FH 4JO1L 4YLCA 4CA4A 4LARH 4AYDC 1X4ZA 3QBTB 1ERNA 3TVMA 1T22B 1KPUB 3DPBB 1KYAA 2NX5D 3LTVA 3O81A 5DMIL 1EHAA 3V0VA 4FEMA 4PJEA 4UV4H 3UZVA 3Q44A 2K4AA 1IL1A 1R46A 4RRPG 2CHWA 4ELKA 2G2RA 1WA0X 2HT4C 5EBWB 3LQAL 1WBZA 3MFFB 4D0CA 4L4TD 5JXAH 1FYTE 1T7WA 1JZ3A 2J5WA 4UCFA 1TEFA 2KT6A 1E8ZA 4QRTB 3G5YB 1BXAA 3MBEB 5GGSA 4YPGB 4KRPD 4WW2C 5ADOH 5HVWA 1FGNL 2J21A 4D9RE 3K2MC 5AD0B 4V2CB 3T6XA 3L7EB 2WNGA 4RFNC 3QI9B 5TDNA 1LO2H 1J0IA 5LG6A 4PJDF 4XBEL 4M8UA 5IMKB 1X5GA 1NCCL 3BWAB 4LP4A 2WXJA 3M17B 2ZWSA 1F4WL 2XZQL 2CBTA 4FZEL 1J9CT 2R56L 4AIEA 1UENA 3GJEA 1U4EA 4M8RA 3L3GB 3QZBA 1MAKA 1VFUA 1CK0L 4LCCB 3IVKA 1I3UA 4PJEE 4YGVB 3FUDA 5ALCL 5DVNA 5HI5D 4M6OL 1HNYA 4R4BA 4QXUL 1ZLDA 3WKNA 1D9KC 4KAQH 4Z7UA 1HHHA 3QO1B 5KYUA 2OR9H 2FX9L 1ADQL 3ETBF 4FI7A 5MEQB 3NIGB 5G2NA 1DCEA 1FGVL 3IETB 3PAUA 4NLHA 1G84A 3FOMA 4CL7A 1EJ6A 3QFJA 4AXWB 2V5YA 3FH8A 3PHOB 3D07A 3HG1A 2CE6A 2ZG2A 2R2HB 4XN1A 4FNUA 1MHHB 4XNBA 4PS4L 3K2IA 4OIBA 4MDIB 4QTHB 3DXAD 5HHPB 4BH8A 3DX9B 4K23L 1O6VA 4G8FB 2CXKA 4I88A 3EDKA 3AJ7A 3T6ZA 2IPKA 3EUUA 1ZWIA 4J8RB 2EO9A 1RZJL 2QDWA 1SXAA 1XAKA 1A6ZB 2ZNXA 3LN4A 3O2DL 1Z1WA 2MCPH 4YBQC 1A64A 2IPUK 4UT9A 1DSWA 4DVRH 3PFUA 3VNYA 3EOTL 3BYYA 1HILA 1U8OA 2GY7B 2MKLC 3WY4A 4XO4A 1HSBA 2DQIL 3RKDD 2FJFB 2CDGA 4Z7UE 4UTAL 2YD6A 2DAVA 4KTDH 3WSQL 1QUPA 3U7YH 4KKRA 2X3BA 4K3EH 1VKXA 3NAAH 2EVGA 4Q7DA 5IHUH 4GS7C 3HG1E 1OSZA 3U1SL 1U8HB 4PWEA 4WUKH 1NCNA 2XY1A 4HK0B 3SQBA 5E9DA 4PMFA 3GJFA 4LGRB 1OM3L 4LK4A 2XFXB 3EADA 2DTMH 4EIGB 4NRZA 2Q2LA 2Z93A 4XMLL 2MWCA 1L5GA 3LJ3A 1V5JA 3ESPA 2X3AA 3CPLB 4ZNEA 3DDGA 5C9JA 4G72B 1FH2A 4E41E 1W91A 1GPOL 1KGUA 2XTJB 3BUTA 5C3TA 5J9PA 5LBSH 4FXTA 3GHPA 1CPUA 4HMCA 3UJIL 3WJJC 5A2JH 4NQSA 2EDHA 3ARDB 2BOLA 4HCIA 3HBPA 4JFFB 1K8IA 4KJQC 3UGXA 3REVA 1DDHB 2A2QT 4YSDA 2ZOTA 3GBMH 1ESOA 1Y18A 1MVUB 3N85L 4TVPH 3BPOC 5D5MF 3KPSB 4FQCL 4EAEA 3SO5A 4BCXA 3KPMA 4OUUA 1N19A 5A2FA 4KQ3H 5E9DE 3C08L 1I75A 5E6IB 3W0WB 3D4YA 2V3EA 2HVJA 2YBRB 1UD6A 3CVBA 4DKTA 5I1EL 2ED8A 1RVFH 3FB7B 5GQBA 1Z9MA 2JKLA 4OQ1A 4DGUA 1UACH 4WKZB 5ACZA 2X53A 3C5JA 5TE7H 2YRLA 1URZA 4I1RA 4X42A 3CNKA 5F1NB 2IPTH 4CJ1A 4PRNB 4XN7A 2G2NA 5KSAA 1EMTH 3RUGA 4N2DA 4C58B 3FCBA 4PJ7A 1BZ8A 3BPNC 1ONQB 3ZHNA 3BUQA 5F7HA 4XPGH 1LJMA 5I30H 4H8HA 4LVEA 3T3PF 1YSOA 3LQZA 4HUWB 3PL6A 4LP5A 1MEXH 3KDMB 1S7TB 4AE0A 2Z31C 3KW8A 3WY3A 3ZYJA 1GZQA 1T5XA 4KXCA 2F0CA 3GXFA 1TZIB 1KTRL 1Q72L 1JPGB 1ZT7B 1B6DA 4LAQL 5KG9B 1A0QH 2GIMA 1BOYA 1H3XA 3O6LL 4LASL 4YLBA 1KPUA 3DPBA 4YHZL 5D6DA 1BPLB 4D7BA 4MQTB 3V9EA 3WTVA 1NGZB 4O51B 3ZDXF 4LLYB 4JQIL 3NCEB 3RUGE 4U3CA 1P5UC 1WZ1L 2L7UA 1BZQK 4NZJA 3MFFA 4PJ7E 3QGVA 1QSZA 3G5YA 3MBEA 3OGOE 2H0EA 1LGVA 5LKNA 4YPGA 3MZGB 4JPVL 2KMWA 1BD2B 1OCZB 3DBXA 5KYNA 5AD0A 2NXZC 1HIML 3L7EA 2Q76B 3RVWC 1FL3B 2DQJL 5HD8C 5AB0A 5DD5H 2A4EA 1JTPA 4JFEB 2XG5B 2FWSA 1A2YB 1UZ6F 1XXDC 3A4FA 2VJ8A 4YSAA 5IMKA 4W9ZA 4PPTA 3BWAA 3VXUD 4NBXB 2WQRA 4IBSA 3M17A 3FN0H 4FFZL 2AV1B 3H2PA 4HG4K 4DFIA 4E68A 2VDMB 5D7LA 3VH8B 3L3GA 1I8LA 1UD5A 4LCCA 2Y36H 1X5JA 4YGVA 1N67A 1HWGB 4WI4A 2CNZA 3O4LD 3SKJL 5I8CB 5EOCJ 3QO1A 3QP3A 5SWSD 1MCJA 3QZWB 4XPHL 4M43H 3MRQA 3B9DA 5MEQA 3IETA 4PJ6A 2OS7A 4HH9B 1T1WB 4OJEH 2CJ3A 4W6XB 4AXWA 5JQIB 3PHOA 1EXHA 3U6XS 3QEQA 2YGQA 2R2HA 1MHHA 2MNJB 3KXFA 5C0DA 1TOXA 4MDIA 4RSYA 5KUMA 3Q2NA 1OP9A 2B14A 2EH7H 3KHOA 5EMYA 4P2YA 4ZXBD 2EDXA 3UIZA 4FCAA 4QXWA 3S3JA 8FABB 2OZ4L 3ULVE 1AR1C 2OMYB 1BP3B 1DBBH 1ZV2A 2AW2A 1K4DB 2JJVA 3ALXA 3DX2A 3NN8B 3RY6A 4XO9A 1XBRA 5FGSA 2X0WA 1CDHA 3L17A 4LOUD 3S36L 1HXMB 4YSCA 5I5RA 4LDEB 1GSKA 3S36X 3PJNA 1BF2A 1YEHH 3D2TA 3IDUA 1D2PA 2YPVA 2FJFA 3LD8B 5KANI 4HJGA 4U1HB 4XXCA 2HWZL 4JFTA 2CD0A 1XR8B 5EN2B 3NIGE 2ATKA 2QADD 3A21A 4F9LA 3TT3H 4LIQE 2PXYD 2BC4B 3H2QA 3QEQE 1BDYA 3JWOC 1CE6B 3OZ9H 4OCSH 1U8HA 3KXFE 3DSFH 4DTGL 1E4JA 5BV7B 3B2UC 5GS3A 2XFXA 2FT6A 5LB1A 3OLEA 2JK5B 4M8QB 5IJKC 1R17A 5IQLA 5TDPA 4YDLC 2P80D 3CPLA 4NQUA 5LN8A 3VYOA 3X3GH 1D2OA 5C97A 5CBAB 4R7VA 4EN3D 4BM7A 3SGDH 1AIFB 4PW9A 4WIQA 4EUPB 2PP7A 1YNKL 2AI0H 3NRQA 3HNVL 5LUMA 1B2WL 4U49A 4JFFA 3B1UA 1TJGL 3QJQB 3ZTCC 1KBGH 4RMUA 1DDHA 4HQQL 1W6WA 1W9XA 2GG1A 2XCMC 4WNJA 1QFHA 4NHUB 4D3CH 1A3ZA 3SE9H 1MVUA 1ADWA 4DKDC 3WTUA 1ORQA 4U6VL 5D7IB 5DF0A 3UO1H 1ZA3B 4FOMA 4HUMB 3ULUL 3MLUH 2B0SL 5AW5B 5GGRA 1WO2A 5E6IA 4HHGA 1Z32X 4WSGA 3DOIA 2YBRA 5B1KA 4AQ8A 1INDL 1FG2A 3FB7A 4HGWB 4P3CH 1YEFH 1AGDB 5E7BA 3QUMB 2AJYL 3PE9A 4WKZA 5CIPB 1NBCA 2XTJE 5F1NA 4RNRA 3WL9B 4PRNA 4ODXA 4DIXA 4P4RB 4XZUB 2ARJQ 3RTQB 4N5EC 4FG4A 2X89D 1J9SA 4R8WH 1TMQA 4BCYA 3LEYL 4JFFE 1ONQA 2OTUB 1A47A 1EO5A 1SOSA 2VDKH 4MX7A 4CBZA 1P6FA 1ZDSA 1E6JL 4F2MB 2O1AA 3L4XA 4XCFH 4TLTA 3B37A 4JKPL 2HLFD 4HUWA 4AUYA 3QR0A 4YHML 5IB3B 2XVGA 1MIMH 3WY2A 3KPSE 3KDMA 3KGUA 3T0BA 1S7TA 3T4AB 1A66A 1HH6B 5AB2A 1MW0A 1CWVA 3VE0B 1MN4A 2O5XH 5E8DL 2OI9B 2W59A 3ZMEA 3MGTA 1RIUH 1CL7H 1GYUA 1TZIA 1VF5C 2X6UA 5DK2A 5BMFL 2F74B 2JSFA 3V0IA 5DLLA 3QXVA 3MYJA 1IEBB 3ZHKA 4ZAKC 1THAA 4GXVL 3L5WA 1XZ0B 1KIPB 4HC1A 4N8VG 1HZKA 1NGZA 4O51A 4LLYA 1MF2L 1NIBA 5CR1A 2AEPH 2HN7B 3GDBA 1X5AA 2BIMA 4X83A 5DFVD 5EA0L 1OAYH 2R1YB 3V9FA 1EEUA 3W2DL 1FORH 2VXQH 2HT2D 2ZG1A 4OSUH 43C9B 2CO3A 4OGAD 3FQ4A 3P0YH 4N0UB 2GPZA 5F3FA 4LU5H 5CJQH 1RJLB 3D0VA 3GIVB 1PZ3A 3UG5A 1BD2A 3VA2C 3ZR5A 2RTTA 2N4IA 2Q76A 3UTZA 1FL3A 3FUKA 3NABL 4R83A 2IAMD 4JFEA 2XG5A 3QC6X 1A2YA 3IMWA 5DZJA 2ZCKL 5I1JH 4CGUB 1JYWA 3WNMA 4A2LA 2GSIA 2Y24A 2IAND 3GSNL 2AV1A 3ARSA 3VH8A 4NN5C 3FU3A 2EEBA 3PHAA 1A6VL 4JG0H 1G0XA 1ZE3H 4WQOA 4NB7A 1BAFL 2QVMA 5I8CA 2R4RL 4N90E 3LEXB 4RIRA 1O6SB 2D0FA 1I8MB 5M94B 4YSSA 4YHLL 1FFPB 1T1WA 4ELMB 2J44A 4MCMA 1U92B 1NMBL 3TJHC 1P7BA 4EI5D 2F68X 1BD2E 4QAMB 4UQ3A 4OD1L 2O5ZL 3QWQB 4JFEE 5IP4A 8FABA 5JPMC 5I1AB 2OMYA 4M6NH 3TBSB 3CZGA 1FHGA 1YEEH 5E94A 3U4AA 3QIWC 2Q7AA 1HXMA 3N44B 5A2IH 2XLLA 4EN2A 3UABA 1ZHLB 1JFHA 4M4PA 4C4UA 4JJ5B 4UQ2B 2ROYA 2WV3A 3QIBC 1SMAA 3QO0B 5IF0B 2OSWA 4JZJC 4LEEA 3OLDA 2OJZH 3A24A 4U1HA 1BQUA 5EN2A 1E28B 1XR8A 2EIDA 4NT6A 4OZFH 5JA9A 3KPRD 1YEKL 3ARBC 1ZVNA 2BC4A 2VM3A 4KNSA 3KJ4C 1CE6A 1IZKA 3BXNA 3G08A 4UZGA 1WCBB 1F4AA 4J23A 2JK5A 4NUGH 4XPAL 4JS7A 3SO3C 1T89A 3QHZL 3K91A 2K3HA 5HGDB 1Q8MA 2ORBL 3AITA 4JG5A 5DS1A 2X9YA 4XMWA 3OGCB 2FYYA 2F7RA 2E6PA 2A3TA 5ACMA 2H2SD 2V7NB 4MJ4A 4MKMA 4WEBL 2B1AL 1QO3A 2YFNA 1FC2D 4L3CB 3C2AL 4M7KH 1BQLH 35C8L 3MX0A 1DBMH 4PP1C 1WAEA 1KTJA 4MZ2A 5D1XC 5DJXB 3VMOA 1VADB 3BD4A 4NHUA 4Y9BA 3IFLL 4H8WL 1NCHA 4P23C 4AM0Q 2OJEB 1WWAX 3MRRB 1Q1JH 1R3LA 4PB9H 4R4FH 1ZA3A 1BMZA 4DP5X 2HG5B 4WFED 4LSDA 4ZUUB 1OHQA 5C3IA 1A3LH 2AQTA 3RYMA 2UUDK 3RVVC 3K5RA 3NQKA 5EU6B 3HJEA 4HGWA 4KX8A 1AGDA 2WVVA 1I53A 4GQRA 1KCRL 2WOYA 5CIPA 3LN5B 3WFDH 2WO3B 4C47A 3GUTB 1UH3A 2F08A 3WL9A 3ZKXB 4GT7A 2W0LA 2O61B 4XZUA 4PWIA 3H85A 1OALA 3RTQA 2XTSA 1KN2L 1YCSA 3EYQD 4NC1C 5SX5K 3ZDYB 1O6TA 4N2IA 4WI8A 4LSUL 5CZRA 3RGBA 2OTUA 2EQDA 5HHVH 3UYPB 3NUKA 4F2MA 3CLWA 3CN2A 5DVOA 5IB3A 2YGPA 3CSYA 3CZLA 2YPKB 4DJMA 5EEVA 1HH6A 4HPOL 3VE0A 4A6YH 2E8ZA 3BZ5A 2Z91B 2F74A 3TN0C 4LFHD 1S78C 4MDJB 1YG9A 4XMPH 1A7PL 1IEBA 1OXYA 2WZAA 5PCYA 2NCMA 1NDGB 2A9CA 3WNJA 3IXAB 4WJG3 1XZ0A 1KIPA 2YO3A 1UXLA 1ZLSL 1HHGB 5L4JA 1F2XK 3DMMD 4JM4L 5BQ7B 3MRPA 1MJ7H 2HN7A 5IIEB 2UWEF 2R1YA 5E1QA 43C9A 3PXJA 1ID2A 1JNHB 2SEBB 2JI3A 2Q3AA 3BO8B 5CGBA 2DQTL 4N0UA 1IC7L 4S0TD 4F2ME 1G9EA 4O02H 3O2VL 3NJMA 5FKAB 3GIVA 5D2NA 1GR7A 5KVDL 4GAJL 5J11C 2L7QA 4K5NA 2EIMB 4WW2B 5JIMA 2FECI 4JB9L 4H7VA 5L2KD 4XN9A 2VM9A 5FECB 4MXVE 2QGCA 4RFNB 3RL2B 3SY0B 2DQGL 3IDMA 1GGTA 4ZS7H 1J1PL 4PEEA 4JY5L 5EOCH 1LO3H 5BW7C 4RBPK 3O3DB 3R8QA 2EXWD 1S9VB 1NAMB 3SE6A 2MH4A 4AYGA 2JH2A 1WWCA 2NYKA 2VH5L 2LLGA 2D3JA 4B53A 5E6RB 3BT2L 5FUOL 4P9HH 1S4IA 3VD5A 5AYUL 5A2CA 1D9KB 1O6SA 1I8MA 2IH8A 1WIUA 4WWOA 1FFPA 3IMVA 4ELMA 2DPKA 1U92A 4N0UE 5DHYA 4AQOA 4DVBB 2IO5A 3SQOH 3UZQB 5I18L 3SGKA 5D2NE 4UDTA 1GA2A 3CC1A 5F8QC 2O26U 5E5UB 2XKNA 2G4GA 4S1RL 2VDLL 1TLKA 2OMVA 3HNTL 2R59A 1EEYB 3MC0A 5K9QG 2XWRA 5I1AA 3FRUB 3TBSA 1F3DJ 1C7TA 1EBAA 5H8DA 5IMMB 1JVOA 4LXFA 3NJXA 1WS8A 4ZK8A 3U0TB 6FABH 4F8OA 5BVPL 2H2PD 2X9XA 1JWMB 2K6ZA 1PX8A 4G9FA 4A66A 1ZHLA 3BLBA 3SKOB 4JJ5A 5HYJD 5IF0A 3IPFA 4EO5A 3IRZA 3VB8A 1YMHB 2W9DL 4N2CA 5D1ZD 2CKBL 1CLOL 4UTBA 1S9WA 1E28A 2NDFA 5ISZB 3B8SA 3CFQA 3VWKA 5TQ0H 2B08A 4YO0B 4RMRA 4ELME 1KDJA 2DI9A 5E2WH 2Q3XA 2FO1A 1HAUA 1YHPA 4ZO9A 1IT9L 1JL8A 1OAQL 2VSMB 2FBJL 1A7OH 3AADB 1SDDA 3EHBC 4GS7B 3UDWC 4BJLA 2EADA 4F5CA 1ZK5A 2J6EH 1S7UA 1WCBA 4YE4H 2Q7YB 4A1RA 3VXNB 8CGTA 5I15L 3GYRA 4Y1TA 3U6RA 1LO0H 4NEHB 4DPBX 1NIEA 4NBYB 4R97C 5HGDA 3K0WA 3U30C 2AERT 3EZ8A 1NBQA 2IOOA 1NCWH 3AWFA 2EO1A 3F7QA 4G9FE 4IHOB 4ATWA 3CDZB 3EBHA 4ZW6A 3MLRL 2V7NA 4NZTH 4PN6A 1KF9B 1XHHA 3E1ZA 3SODB 4B27A 4EUPH 3GKZA 3GTNA 4L3CA 3ZE2F 5AAMA 2E9JA 3CFCL 5JZ7C 1PZUB 4XNZC 5IB4B 2Y7SA 1OSPH 1SHSA 3IT8D 2EUVA 4Z7OE 4N0YL 4YEEA 4BKTC 2OJEA 1ZA6B 1USZA 1IAIH 2ZXEB 3MRRA 4LP8A 1L7IL 1MJJB 1HYSD 4R2GC 3L4CA 2EIZA 3BPOB 3QWRA 2ALAA 1FAIH 2ED9A 3H9SD 2B4CH 3K2KA 4ZUUA 5CO1A 4F5CE 2APXA 4RISH 2IEPA 4D8OA 1K5NA 5F7KC 3RVUD 3D12B 4KV5E 1AOHA 5EU6A 4HEPG 1WCQA 5FM5M 3QDGB 1TG8A 3VX0A 3LN5A 1NH6A 1BVLB 2DD8L 2G5UA 4LBEA 1FDLH 4JM2D 3WIAA 2X2YA 4W6YB 2O61A 2OW7A 4I0KA 2E46A 3ZKMD 5JOPE 2A7BA 3LXBA 1SBBA 3MI6A 2KC0A 4LHUD 2K8MA 1D7DA 5FW6A 3UYPA 1K8DB 1I8KB 2EDMA 3BPNB 3PIQB 3D25B 3QSKB 1YN6A 3WXVL 1IC0A 1MW2A 1I8AA 4GXUN 1TYJA 3K72B 4X6CF 3ZE1B 3KLKA 2NR6C 2YPKA 4FZ8H 4HLJA 4WZ9A 3CBJB 1KB5H 2VDPL 3DUHA 4TSCL 4OLXL 1N12A 5HDWA 2R8SH 1PTZA 3EYUH 2Z31B 2HKHL 3RY4A 1XH0A 2DEWX 2VDQH 2UY7B 4ERSH 1YLBB 1PAMA 4OKDA 1G7QA 5EU6E 1UM5H 2ZUYA 1LE9B 1NDGA 3DGCR 3HHRB 3LPFA 4X2UA 5DFTA 4ISVB 3P4MA 3IXAA 1WIOA 3ZTJH 4XP5H 5I0WA 3PV6A 4CC0A 4E2OA 1NEUA 3LKPB 1HHKA 5CWSB 3E38A 3T77B 4AQEB 5BQ7A 2HT3C 2V3FA 2R2BB 1MREL 5T3XE 5IIEA 3ARVA 1ZD6A 2PF6A 1P5UB 4LSQL 1JDCA 1N8ZB 1JNHA 2SEBA 3QNXB 3TPUB 4DP1X 5ALBL 5FYKU 1SJMA 5T3ZD 2O6PA 1MCSA 1LP9F 3OF6D 5FKAA 3AROA 4NDMB 3T2PA 3KYKL 1L0QA 1WFMA 4GRWF 4HWEH 4FAAB 1RZIB 5FYJH 1RZKH 3RL1B 2NXZB 5PAZA 4GNKB 2Z8VC 1DSFH 5FECA 5BZXA 4H0HB 4NAJA 4AEHH 3B9KB 3BLKA 3RL2A 3CFMA 3SY0A 2G3MA 4XWOD 5BOPA 5DFWH 2H6PA 1G6RH 2YA0A 3H0TA 2WW8A 3NFPB 3O3DA 3DRTB 1NAMA 3T1FB 2Z3FA 1UWXH 4WI0B 4DKEL 4P07A 1JXDA 1GTFA 2E86A 3CFBB 3HZKB 4XMTA 3J8F7 5L88L 3UCQA 1T2XA 4KJYB 2IGFH 1D9KA 4XNMB 4G8GD 1UFGA 3CHSA 4XB3A 1S9YB 2AJXL 2Z0UA 3N2JA 3S3SA 4G6AC 4W81A 2HCZX 1T2QL 2K70A 2YRBA 3D51A 5FV1L 3FUEA 2E27L 1DL7H 5JHLA 3DV6B 1FVDA 4YBHA 3GZKA 1VEMA 3PDDA 2MPAL 3Q1SL 5D2LF 3TIDB 1M1XB 2FJSA 4W9CC 1ODAA 3IDGB 5EOTB 5LWYL 2ZCHL 4X6EB 2UXVA 3J7HA 3S3DB 4KJWD 3X1EA 1DZBA 3FRUA 4YHKL 5DCCA 4JLRB 5J89A 1AR1B 5EEUA 3U0TA 4RDQG 2YXMA 4I0PD 1AH1A 1EJ8A 1JWMA 2ZXQA 3PQYB 2R9HC 3QEGH 1O9VA 1DJXA 3CE1A 2VN3A 4JZOB 4UZSA 1DBAL 3Q6GH 1YMHA 1HCFX 4QHPA 4KZDH 2J1KA 5F0PB 4JVWA 1X9UA 4JR9H 4KXDA 3SBWC 2AC0A 2TSAA 4GMTH 5HYQA 5K9KA 1AANA 1JFQL 4LLVB 4YO0A 1ZGLA 3PJLA 4ETYA 3D33A 4K8RC 1GYAA 1Q9WA 2Z92B 3D39B 4JG1L 3BWZA 4AE1A 4JHZA 3DJ9A 1A4JA 3MUHL 4GMSL 4B6ZA 4F8PA 4RGOL 5K9JL 1VZHA 2AZUA 2QQNH 5HYSG 2AKRB 1JZHA 3VXNA 2JKRM 5HJ3B 1OP3K 2UY6A 4NZ8A 3KLHC 5IFAH 1IKNC 3MA9H 2YSSA 4G8EB 4MAZA 5IBUB 3RI5F 1URIA 4YDLB 4Q0XL 3KLLA 2JIXB 1H9VA 5AG8A 4MWFB 4Y1AD 5AOMA 5ETUB 1JGVH 4KI5C 1TITA 3CSTA 1Y1UA 1M2VB 3EJSA 4JFYB 4U1MB 1FNHA 4ZJ9A 4BE6A 4RGND 2WTPA 3CDZA 2DM3A 3UAJC 3WJJA 2CJUH 5LLIC 3F7VB 3MXVL 2EZ0D 1SXCA 2DB8A 1TJHL 1PAZA 5AW1B 1Y07A 2RAMA 3VXTB 1FFRA 3HRPA 3QJVB 3PAZA 4U6TA 5IB4A 5ISZE 1CQYA 2OSLB 1HFUA 3TO2B 2LT9A 2NY3D 1TZGH 1ZA6A 1MJJA 4JRYD 1MJ8L 1VENA 3FF7A 4L9LA 3VW3L 2CUIA 2NNAA 1SRDA 3CIAA 2JELH 2NNXA 2UX6A 2E7HA 4Y4KD 5DEFA 2MCAA 2GYSA 4KTEH 4MQXD 4Z95H 2WTOA 3LXUX 3CN1A 4NXSA 3RWFB 3HZ3A 1AJ7L 1C1EL 2HB0A 4K55A 2H1XA 1BVLA 5L0QC 3M07A 4WSKA 2FHBA 3AUVA 1QYGH 4U4BA 4XBPB 2IH1B 3ZL4H 1QEWB 1FWXA 5HDBE 1F4HA 1HDMB 1OARH 2J8HA 4M02A 1OP5H 1P4LB 4XHJD 1WVZA 1K8DA 1I8KA 4K3DL 4Y7MA 3RILA 3PIQA 1ZDQA 3QQ4B 3D25A 4JDTL 2KLSA 4WRLA 4QRRB 4W6WB 3V6ZB 5IVXF 2YD5A 3K72A 2FWOB 3S3BB 1DQLH 1A6WL 4OTXH 1DR9A 2CHNA 2YFOA 3H2WA 3HBQA 3UJTL 4EDXA 3VFWA 3KYMB 4LHJB 3AQDA 4R7NB 1ECYA 2UY7A 4NP4L 1SOXA 3OJDB 5ID1B 4Y19B 1MCBA 1LE9A 3EYVA 1CTNA 4ISVA 2DN7A 4XI5C 3H8NA 4TVPD 5AZ2L 3IKKA 4ZAKB 4ABQA 3D0LB 1NCGA 3LKPA 5CWSA 1A7QL 3T77A 2GUYA 5HDQL 4Y5XC 2R2BA 1YY8B 2XZCL 2H9GB 2RACA 4G6KL 4NYLB 1EGJH 2PP9A 3I9GH 3KAAA 1N8ZA 1H3PL 1VZGA 2IMMA 3QNXA 4OLEA 1I9JL 3S34L 3TPUA 1DO6A 5D6CB 3UBXG 2EUWA 5MI0C 4MCNA 1RD6A 4H2AA 3BH4A 4NDMA 4DAGL 4OFYA 1VDGA 3QQ9D 4JDVA 3TEZA 3ZE1E 1FLRL 5CZKA 4LO9A 3CSGA 1MFCH 1DJZA 2B1HH 4HF5H 4KKCC 5D7JC 1KFAL 4BA8A 1UWYA 2G9HB 5FYJU 4F33B 1KLGB 2UVFA 4B3VA 3PREA 4LHUG 2PW1A 3MLXL 3C5SB 4S0SD 1CXFA 3LZNA 1W16A 4XAKE 4UM8B 1MWAB 2EDWA 3U0PB 4Y9GA 3DRTA 4BQ9A 3SJVA 4N0CC 1A6AB 2VUYA 4NN5B 4YFLI 5DVPA 3T1FA 5I1DB 4S1DC 4Y8AA 3CVCA 4PMEA 4PHXA 4AGPA 3CFBA 2XYCA 3HZKA 4UT6L 4RWHA 4JFZL 3BKCH 3PY9A 1AZNA 4KJYA 4KVPA 2PR4H 1XH1A 5C70A 4XNMA 3KNBB 1FPTH 1S9YA 5FO8A 4RX4D 1CIUA 3WI9A 1ECZA 4Z0XB 1RLBA 1I7TB 5CUSL 4FQXC 1DLFL 5DA4A 2QZQA 3HTLX 1P5VB 2P8MB 4Z8FL 2CXGA 4M1GL 4ICWA 3P3RA 5GZND 1EXGA 3P4NB 1F3DH 3TIDA 2DIEA 3P77B 1M1XA 3LS4L 1JHKL 1WSST 4WGWB 5EOTA 3IDGA 2ZYRA 4X6EA 4RMBA 3I75B 5K93A 4JX0A 2MMXA 3KW7A 5IFHH 5BVJA 2BIHA 1FVCB 4LL1A 4JLRA 5DZLA 5DYFA 5JPMB 2V2WB 4BFBD 1WIPA 4XT1C 5T33H 3QIWB 3SJVE 1NGWB 3UJJH 4FFYA 4DQOH 2ZSVA 1WBXA 2ZUWA 4JZOA 2QHRH 3CFNA 4N3UA 2VDNB 4MKTA 4NQEA 3S37H 4BE5A 3QIBB 1UCBH 1MG2C 4K94C 1YEIH 1FNGB 4JZJB 2FATL 1FNFA 1SHMA 5CAYB 3APFA 3ML9A 2OSXA 4JFHD 4LLVA 1ZEAL 3RURA 2FQDA 3ARED 2EO7A 3ARBB 3NJGA 3MACH 3KJ4B 2PPFA 3LB6C 2AKRA 2ZKWA 3KJ6H 1PQZB 1OVZA 4WSJA 4XMXA 2N1KA 5HJ3A 2J8UB 5EF3A 4QRAA 3NZHH 3KLSA 1BGXL 4G8EA 4XNYL 2ZWNA 5IJKA 4QHLB 4TPRL 1SVCP 5E1GA 2JIXA 1KPVB 3SO3B 4MWFA 5ETUA 3B56A 3VXSB 1ZVSA 4PV9B 5BZZA 1M2VA 4C56A 4U1MA 1KCVL 3HN5A 1EAPA 1GOGA 3FSWA 2J5LC 5L6YL 2XY2A 2A99A 4H26B 1S7XB 1JHLL 5EEYA 2F7QA 3HVNA 3LS5L 3THMH 4GQZA 1B4JL 3F7VA 4O9HH 4NQEE 4O00A 5L8KB 2HA1A 3VXTA 1FBIL 2DMCA 5DGQA 3BWUF 2XVLA 1XO8A 2AGJH 2OSLA 4Z7VF 3TO2A 5FIEA 2Y72A 1S9XA 5D1XB 3GHBH 1JPSL 1HESA 4TUJB 3RQ3A 4E41D 3FYEB 1KEML 2X2JA 3QJUB 4P23B 5J57B 1TMCB 1XB3A 1AGCA 1CFVH 2AAVA 2OBGA 2QR0A 4ONGL 5SWQB 1DHKA 5E4IA 5GRUH 4J6RL 3BGFB 3MJGX 6CGTA 2AXJA 4KK5D 4QXGL 5AVQB 5GJSL 1RU9H 3RWFA 1JJUA 5EZIL 3KWWB 3CWGA 1OD9A 3JXAA 4KOCA 2FNBA 2B15A 3MJ7B 1AG6A 4WWKD 4XBPA 4C56E 1HYRC 2VZUA 1QEWA 1UVQA 3L1GA 4F8NA 1OK8A 3P11H 3LZPA 1HDMA 5EORL 4NOFA 1JZ5A 2BSSB 4N8CL 1P4LA 1RZ8B 4R26L 1BQRA 2QSVA 3RGVC 3VFSB 4QRRA 3V6ZA 3HCVA 3H4FA 3RWDB 1NINA 2FWOA 2XZAL 1ZLVK 3T4YB 4ONFL 3WE6A 3CFKA 1GSMA 3N41B 1KACB 4J3OG 4R7NA 3KBEA 1UZ8A 3OJDA 5IB5A 5ID1A 4Y19A 1PU0A 5E2VH 3TN0B 4AI7A 5EU5B 3HI5L 2CAKA 3DV4B 2YSTA 15C8H 1WV7T 3BAJA 2GKIA 4LQ1A 2XN9A 3PWPB 2I60L 3D0LA 2WIMA 4LGPB 1L9PA 5B38B 3DIDA 3R18A 5KJRL 4PJXB 3OG4B 2GITB 4PRHB 1YY8A 4L37B 2H9GA 3MYZA 4YDIH 2WQXA 1BXUA 2DW5A 3RAJL 3EOBB 4NYLA 2NQ3A 5D6CA 1YEGL 3U4BL 4ZRGA 1MW1A 4JPIB 4QRRE 2C4FT 4PGBA 3S9DB 3M8OH 2WNXA 4JQVC 4PJFB 4BFKA 4B9PA 1YPZB 4GI6A 5J11B 1E5CA 1B4LA 2F2HA 1HXKA 5HI5C 2NW2A 4ZOBA 4JO2H 3OQ3B 4BFRA 4F33A 1KLGA 2BP3A 2EE3A 2R29A 1WGOA 4Y19E 1XIWC 1MWAA 3U0PA 5FA4B 2B9AA 1A6AA 1MAJA 2OX5B 2X4SB 3ES6A 5I1DA 3O9WC 2YEZB 3ECBB 4ZZFA 5KSBF 1OCWL 3FC8A 1PJ9A 3HLAB 2LQRA 4F7CB 4GKSB 1PFOA 4MJID 1EFXB 4Z0XA 4ZD3L 1I7TA 3PV7A 2QPDB 3APDA 4OLUH 2P8MA 4LVHC 1YNLH 3HRZC 1JGLH 3O41B 4X0KB 3UC0H 2MNWA 3P4NA 4FA7B 4J1UA 1FRGL 4UNTA 3CD4A 3D3VB 5GS0H 1QFWM 2ITFA 1A65A 4RDQF 4OCYH 1G7IB 2ZF9A 3I75A 2Y4SA 1QUNB 4WWID 5AL0A 1LDPL 1UB6A 1FVCA 3FAXA 5JPMA 4HIXH 2V2WA 3SE4C 1ICTA 2CO4A 1T4WA 5I74C 5GS1C 1RULH 5C0CD 4XP6H 3FTYA 5F7DA 4FLHA 2WQUA 4KRNA 4KTYA 2YC1A 2JLLA 5KOMC 2BP8B 3IWUA 1KLUA 5FDYA 1HWWA 5HJDA 3QI9D 3QIBA 4HUCA 5KW9L 4POUB 5T1KB 1VCBC 5KS9B 2QBWA 1Z9SA 4GP8B 1XVSA 4KO7A 1LO4H 4P49A 2XT1B 5DJ8B 4DKFH 3HMWH 3N0PB 1BQHB 4XGZA 1J5OH 3ARBA 4KBPA 1QFPA 3BSZH 1H3UA 2OJ1A 3EHBB 2HUEA 1PQZA 2F53A 4ZYKA 2J8UA 1JXFA 1QSFB 4NO2B 3SGEI 2WWKO 4X9FA 4M6MH 3TIEA 3HZYB 3C75A 1KPVA 43CAB 5JOFB 2FWUA 3U9PH 5F9JB 5FO9A 4MZRA 1N0LA 3PRZA 3UL4A 2FD6L 4R97B 1KV7A 2BHYA 3U30B 1CF8L 3FCGA 2H1PH 2D2CC 4HXAL 2BVPA 4FP8L 4ODTH 1GIGL 4H26A 1S7XA 5DZAA 3FH7A 5E8OB 2ENYA 5FM8A 4AEEA 3B9EA 1RUML 4B7IA 2ESVB 1OPGL 3FTZA 4ZMYA 4BKLB 5D8JH 4WV1C 5B1AB 3TH4T 2BVQB 3LRSB 4XNZB 5D1XA 4CC4C 2DBLH 5C2BH 4P23A 1RHHB 5F9DC 5SWQA 5LGKA 5AOZA 4OLWL 4WW1B 4X5LA 3CLFL 4R2GB 4DNLA 3SGJC 2XWZA 1SNRA 4MB4A 3PWJB 4U6XB 2IG2H 1GAFH 3B3BA 2F53E 1LWJA 2J8UE 3L4VA 4B9JA 3ZZQA 1TIUA 5EB9A 5HPOA 2AQNA 3KWWA 2WYTA 4HIQA 3C5ZA 3WKYA 3VXSE 3P4LA 2HH0L 3FB6B 1TR7A 5F44A 5JA8B 1VFMA 3V4VB 3KE0A 3U2IA 2CDEB 5I1LB 1QVOB 4JRXB 2DEYX 1J7VR 1ZHBB 1H8OA 4KK8C 2BSSA 4CVUA 5F0LB 4JDZA 3ROOB 1RZ8A 2OMTB 1T4KB 3UO8B 1SEQH 1ET8A 3A23A 4LDLB 3VB9A 2G75B 1MFVA 2WCSA 3V0DA 5D1XE 1CI5A 3EDFA 2AQ1A 5SWZD 5C7XL 4XP1H 1SJVA 5IKCB 1HKLL 2XSKA 3VD9A 4QRFA 5E2UL 3QCVH 5HY9B 3EUDA 3ARDD 3MLYL 3JWDH 1BZ7A 1ZJAA 1YUHB 1H5BC 4DETA 1CVRA 2XIIA 3TN0A 1DN0A 2QEJA 2JB6B 3DV4A 2Q6WA 1C5DA 3D08A 3BKML 4FQLH 4GO6B 5CSZB 3SDDC 3KPSD 5B38A 4F7PA 1I3VA 1F4XL 4PJXA 3SZ6A 4PRHA 1NFIB 4L37A 4NZUH 3Q8AA 1S3KL 5AFAA 1MSPA 1SHWA 1X9QA 3EOBA 5HI3D 4Z77B 3NH7L 4NC1E 2GC7C 3U25A 3GB7B 1IZJA 3W0WD 1P4BL 3WDIA 4LSPL 1DBJH 2VXSH 2WK2A 3AXHA 1I1YB 4NS0A 4Y9FA 4JPIA 2MPVA 5CFAA 1A3RL 1L3WA 4PJFA 1NC4D 1IGYB 1P53A 4I1NB 3TC9A 5I5IA 3DNKA 3AC0A 4YK4C 1OAKH 2HTLD 1G43A 4FS0A 2AJ3B 3UTTB 5DVMA 1ZSDB 2ENJA 1IFHL 4F24A 2CK0L 2QHLA 4UT7H 4UM9B 4OGXL 5FA4A 5H2BA 4AQZA 4PVLA 5TDOB 2IVFC 2X4SA 4YL4A 3RVXD 5BW7A 1AXTH 2GK0A 1UH4A 2YEZA 3PWPE 2P7TA 3N9GH 2F5AL 3S5ZA 3HLAA 3QRBA 4PJXE 4PRHE 3QPQC 4ZXBC 5JOEA 3VRJB 1U8LB 2BVEA 3H54A 4GKSA 2P47B 1MIEL 1GC1H 3QG7L 4CRPA 3QYMA 2GAZB 1EFXA 3N43F 1QNZL 2H32B 3CVDA 3U2SA 4UQBA 1KYDA 3IS0X 4FTDA 1YC7A 4PI2A 5KYXB 2XI9A 2VWEC 4X0KA 4LOUC 3O41A 3E6HB 3FL7A 3QUYD 4A2HA 1OB1A 3ZQXA 1B0RB 1PY4A 4PJFE 4PGDA 2Q8AL 3WUWA 3D3VA 1NFKA 1UKQA 3VYNA 4D9QD 1G7IA 2ODHA 2F8IA 1A1NA 4IBYA 2R0LH 1HHIB 2G0LA 3HAEB 3UPAA 1AXSA 4DWHA 3VD4A 2QADC 3ZRCC 2FO4B 4IBLT 4LF3B 4UQAA 2PXYC 4P5MB 4UT9H 4YXHL 4PJCF 2XVBA 2HJFA 2BP8A 1GJWA 4QO1B 2XRAH 3E6FB 1AHMA 5KVDE 1K4CA 3VQMA 4JFED 5T1KA 5DT1H 2XHNA 5ITFB 3WGVB 1E4XL 3VI4B 2DBJA 5K1VA 5E08L 4IHBA 5DU7A 4AGMA 4ZX3A 4ZOCA 2P5PA 5E4OA 1K6QL 1OOAA 1BQHA 4OCXH 5A3ID 1SVBA 4V1DB 4GBXD 4EN3C 4N22A 5DUML 1R6VA 1AVAA 3D3VE 3QNFA 3UDWA 2JJSC 5GIRA 3HFFA 2VAAB 3OAYH 4PR5A 2ZSWB 4NO2A 3UGEA 1SXZA 3CG8A 4JZNB 3HZYA 2ZZUT 4L4VA 4YXKL 2V5MA 4P5TD 43CAA 5JOFA 4FEIA 5DMGD 2CKBA 5F9JA 4Z3IA 2B59B 4ELDA 4L8BB 3CQPA 4QRSB 2OCJA 5JW4R 5E4AA 3G04B 2KZWA 1AZUA 3Q6FB 3UOAB 4AZUA 3OAUH 5E8OA 4JFPB 3C12A 4U33A 2BDNH 3SOTA 2ESVA 2XOTA 3U2JA 2UZIH 3LZQA 1ZANL 4ODSH 4BKLA 2V17H 5K9QI 1MFUA 2BVQA 5FW7A 3US0A 3BFWA 3HE7C 2D7TL 2YN3A 4BK4A 1RHHA 1JCVA 1U2CA 4DCQB 2E6JA 2Y0SA 4X7CC 5I6KA 3U4EB 4WW1A 3X1FA 4CVXA 5D4JA 3ZGHA 2ARWA 1FNSL 3PWJA 5SX4I 3S8WA 1CF1A 2PWGA 4H88H 4NZFA 1KIRB 4LLWB 2WQ8A 3Q9QA 1TO4A 3L7FB 3TESA 4L4VE 3MCLL 2O5YL 3KR3L 4MHHG 3BQVA 2I25N 3ZRSA 1KIQB 1FSKC 1WICA 2H45A 3AB0C 3PYCA 3CUPB 3U7WL 3V4VA 4C57C 5L0QB 5I1LA 2CDEA 1QVOA 4JRXA 2XPGA 4FFWD 1ZHBA 3R06A 4FFTA 3MKGA 4ABUA 4AQ1C 2V33A 3QXDB 2ESVE 2OMTA 1T4KA 4X9YA 3F6LA 4BWUA 5GHWL 4Y5YA 2BVYA 2DDQH 3HJ0A 2WVSA 1L7TL 3ZDXE 3MRHA 3CMOH 4U1KA 1CUOA 4TRPL 1GS7A 1NANI</