1OP4A

Solution structure of neural cadherin prodomain
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
136
structure length
136
Chain Sequence
b'EASGEIALCKTGFPEDVYSAVLPKDVHEGQPLLNVKFSNCNRKRKVQYESSEPADFKVDEDGTVYAVRSFPLTAEQAKFLIYAQDKETQEKWQVAVNLSREPTLTEEPMKEPHEIEEIVFPRQLAKHSGALQRQKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neural-cadherin
molecule tags Cell adhesion
source organism Mus musculus
publication title Structure of the Neural (N-) Cadherin Prodomain Reveals a Cadherin Extracellular Domain-like Fold without Adhesive Characteristics
pubmed doi rcsb
total genus 9
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2003-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08758 Cadherin_pro Cadherin prodomain like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 1op4A01
1SUHA 3MVSA 3UBFA 4ZMLA 4ZMQA 2OMZB 3LNHA 3UBHA 1ZVNA 2WBXA 3K6FA 4ZMOA 4AQ8A 4NQQA 1OP4A 2EE0A 3K5SA 2WHVA 1NCIA 3QRBA 3PPEA 3UBGA 4ZMTA 3Q2NA 2OMTB 1FF5A 4NUPA 2OMUB 3FF7A 3Q2WA 2OMVB 2OMYB 4ZMXA 2OMWB 2YSTA 3Q2VA 4ZMPA 4XXWA 3LNIA 2QVIA 3LNFA 2A4EA 5CZRA 4ZT1A 4ZTEA 1O6SB 5DZVA 3K6DA 4APXA 3FF8A 5KJ4A 4ZMZA 1NCJA 2X2UA 4AQEA 1Q1PA 4ZMNA 2OMXB 1EDHA 1NCGA 2YQGA 4ZI8A 1WYJA 4OY9A 4AK1A 5JYLA 3K5RA 4AXWB 4APXB 4AQEB 4XXWC 2QVFB 2WCPA 4AXWA 1WUZA 5CO1A 4AQ8C 4AQAA 4QD2E 4NUQA 4ZMYA 4NUMA 2WD0A 3LNEA 4AQAB 3LNGA 4ZMWA 3K6IA 5JYMA 2A4CA 1NCHA 4ZMVA 1L3WA 2O72A 2V37A 1ZXKA 3Q2LA 3LNDA
chains in the Genus database with same CATH superfamily
3KLDA 2DKUA 1UZ6E 1SXCA 3BP6B 2WXJA 1A0QH 5KBKA 4NM4H 4YHPA 5D4JA 5E5LA 2DI8A 2IGFH 4N8CH 4QXUL 5AOZA 3CFIC 5FFOA 2CWRA 4OGAD 3MLRL 5GIRA 3SQRA 4BGDA 2VXQL 5CXPA 4WFGE 5CJXA 3EYSL 3QJFB 2CMRL 1Z3RA 3KWWB 4LPCA 5TQ0H 2UUDK 5DEFA 4NQEB 2M26A 3CSYB 4QJ3B 5HDBE 3L17A 1JZ8A 2NY2D 5IG7B 5C07A 3V0VB 1MH5B 1U8CB 4NQDE 2DMKA 1AACA 1AGCB 2DBLL 3TNNA 1G1OA 2DMBA 2H0JA 3NJKA 3BP6A 2AJUH 3QDGE 4N2IA 4PW9A 4TUUA 5FLUA 5FYJL 5MEQA 4MXVF 2IVFC 5DJ6A 1KWKA 2WJ7A 2WBJA 4M9OA 3UTOA 4GW5A 3DURB 3S9DB 3ESNA 3O3DB 1N6QL 4U1GC 5I6XB 1IBYA 5DEZA 5I1IH 4LQFH 1R19A 3EFOA 4XTRD 1CD8A 2D3NA 4D9QE 1CLYH 2X9WA 3IWUA 4JFVA 1ANUA 2VW4A 3FF8A 4L2YA 5TF1H 4PB9L 4EN3C 3J07A 2AITA 2X70B 3F65A 5D7KD 4LLMA 1GHFL 3ZXAC 2FJGB 2OL3A 3QPXH 2WBJB 2OR8A 5DS2A 5CM1A 3GEWB 1UVQB 1AGDA 1YEDB 2VDLL 4EZJA 1AGFA 3WN5A 1Q72L 3OR7A 1TZGL 1WC7A 4YHOL 3QEGL 1FIGH 4Q0XH 5I1GL 1NEUA 3SDXF 4C56A 1DUZA 1VFBA 1J86A 4XE0A 3UZVB 4HJ1A 1MCOL 1H3TA 5IB5A 3TBCA 3KJ6H 1ZTXE 4XGZB 1DJGA 3LB6D 2LAAA 4J23A 1EZUA 1F90H 1IGJA 3QUKB 5I6XC 1TLMA 5DT1H 5I17B 4OJAA 2IFFH 3ECWA 4HKJA 4M7JH 4R3SA 3MV11 2UV3A 5KG9B 4CKQA 4L3EE 2AVGA 3R4RA 2AJVL 4X8JA 3T0EE 4GRWB 2VLKD 3OB8A 5T3ZE 4MBRA 5IP4A 3Q9QA 1WFTA 3GZPA 1E4XI 4BH7B 4JY5H 1Y7VA 1J48A 4YGAB 5B21A 1XSJA 3BD4A 3WIHL 5E8EB 3CSPA 5E6ID 5ETUB 5DMIH 2WBJC 5FWRA 5B8CB 1J9QA 3RL1A 4S2SA 4GG8A 4HIHA 1JRHL 4XZ4A 2DLFH 5GRJL 4HH8A 5KVDE 2DTML 5G2NA 4E9LA 1JK8A 2EH8L 4LEBA 3HLAA 3WFCL 2UXFA 2YMXH 3II3A 2XIDA 3MXVH 1FZJB 3L4WA 1XSOA 5JUEL 1RH8A 2P7TB 2EE0A 4ZOEA 2KZKA 4Q6KA 1A8ZA 4RWYL 5E1IA 2XCMC 3VNYA 3T0AA 1JPGB 2JI3A 3PV6B 3N1GC 5AKRA 2LGNA 1EZSA 1BDYA 2BP0B 3QPQD 3NA9L 2FBRA 2PN5A 3ULVD 1CFTA 1JZ6A 2H32B 4O4YL 1NIBA 3MRPA 1FZOB 4O51A 3VWJA 43C9B 3BP4B 1RIHL 3Q5YA 2BSDA 1BQLL 5AB9A 3HBQA 1R3IH 3MRFA 2OSXA 3QORD 4JPSA 4ODBD 1FRGL 5AAMC 2PO6A 4H8WC 1Q1JH 4L8BA 1KIPA 2E7HA 5D93C 3S3CB 1IB5A 4F92B 2ZCZA 4GMSH 2VE6A 3T6ZA 5E8NA 4JFPB 1FFNA 4AGPA 2JKNA 4AGQA 2A6DA 2AGJL 3EJYD 3TNNB 4JG9A 5H2BB 1RUKL 3W9DB 4N2AA 4YPJA 2P3YA 3PHOA 4G8EB 3VYNA 2H26A 3LAFA 2CCVA 3CWGA 3TZVC 2FBOJ 4P9HL 5IHUH 2NX5E 3SODB 5I1KH 4ZAKC 3IF1B 1FVDA 1NWOA 3L3OB 4HULB 2VSDA 1CUOA 1UVQA 1YEDA 3U9UA 4N0UE 4AI7A 1TZOA 1XXFC 2EQDA 3IFPA 3MOAH 4JPIB 5AVWB 5J13B 5E03A 2XV3A 5D1XE 1I9RH 1IGYB 3LIZL 1DBKL 3TA4D 5HGHB 5JZ7D 3B9KB 1EDHA 1YPZB 3B3IA 4RDQF 4NAQA 4XNAA 2YZ1A 3TA3D 2IF7A 1XIWB 5GGTL 3OG4B 5DJ8A 2X9ZA 1U21A 3LEXB 1W8EA 3DOSB 2WXMA 3U9WA 1UACH 1A7RH 3OTTA 5BV7B 1UURA 1U3NA 4LSSL 2PXYD 4KI5C 4IBQA 3KNBB 4MKMA 3CIAA 2AK4B 4Z77A 1R6VA 2AEWA 2IC2A 3FYEB 4HPHA 3S48A 5KJRH 3UBXB 2FJSA 3PGFH 2YJLA 5I8KL 3IDXH 4LVNC 4JAMB 2OLDA 3KCPA 2GIMA 1HYSD 1HHHA 3BQUB 5C0BE 3C2AL 1OGAB 1XIWA 5EZPA 2O61B 3KYMB 4NO3A 3QULA 2QLVB 4DKAA 1AS6A 2AQSA 1IL1A 1T04B 3ZE0F 1FZMB 1PKQA 2QVKA 2BJML 4KX9A 4UV7L 2VZOA 4X4KA 5DGQA 1B4JL 4P9MH 3GSUA 2KMWA 3SDDC 3MQIA 5ID0A 2XZCL 1F6AB 1TYJA 1EBAA 4AQ8A 1HI6A 4YK4B 4FFWD 3F7PC 4JCLA 1V8HA 4QLRA 5C09B 2NY3B 1NFDB 3E2HB 3FHQA 1WD8A 4UQBA 1LEIB 1CFMA 4LP8A 2BIHA 1K5WA 4YFEA 4D0DA 1CFVH 4CSZA 1OTUD 5I19H 3QQ9C 3O2DA 2NCMA 1EAQA 1NCIA 4M6ML 2V9RA 2WM0A 4MQTB 4BSVB 3RFZC 1IGCH 4IK6A 3RGVD 3PUCA 2WQWA 5I15H 3MRQB 4YHLL 4Z7VB 4L1LA 4Y4KD 5DC2A 2IAAC 1WBXB 4B6ZA 2NQCA 2Y7OA 4LSPH 2KPWA 4NN5C 4JFSA 5K59F 3AITA 3MV7E 3NTCH 1KLGB 1KPVA 3LZFL 2QSVA 4RVBA 1IM3B 4MXQC 5IW3A 2HSIA 2YPKB 4G82A 3KYKL 4GMSL 3KXFA 3LDBB 1KIRB 2J3SA 1NLDH 1RULL 1BZEA 1KDJA 4MDIA 3W2DH 2O5YH 4M9PA 1X7SA 5E6ZA 3HPJB 4R7NB 4PBXA 1BFSA 1SHMA 3TT3L 3H9ZA 4U1GB 3B34A 1FCCA 1HQ4B 4A04A 1IGML 2WZ0A 2OJEA 1A6ZA 3I3DA 4UAOB 2BVTA 4Y5XA 2OAAA 3MRFB 4CU6A 3F58L 2VAJA 2F9BT 3CX5J 3Q05A 2W9DH 1CXLA 3HVDA 3U82B 2ATPB 5GJSL 2A1WL 3QHFH 3EZ8A 3HS0B 4U1JB 3WUWB 1BECA 2CIIB 3A4FA 1J0KA 2VOTA 3RNQB 5K5YA 1CI5A 3AQDA 3FQYA 5CGTA 1L9OA 4XC1L 4DETA 4P5MA 3EADA 4XN2A 1OQXA 2QVFB 2XWBB 1QBMH 4OF7A 3LZNA 4YZWA 3KJ6L 5CBEA 1FORL 1MDTA 4K5NA 4RAHA 4YBQC 5BZZA 4F3FB 5DQJB 4ONFH 2H8PB 3G08B 1A1NB 2EDEA 4AW4A 3WHXA 3TC9A 2ZONA 4BXVA 1JYNA 1MCBA 3HC2A 3D5OF 2VR5A 5IESH 3CPLA 5GQBA 1MLBB 3LKNB 5CU9A 4Y2NA 3KDMA 5F9DC 4ZFOA 3TBTB 1I3RB 1OTTC 1E8YA 2HWZL 2WANA 3KGSA 4NO3B 3QUXA 1J0IA 5L88L 5DD1L 1NFDE 3VGGA 2OMVA 3QW9A 3AU0A 2AXWA 2K9FB 4JCMA 3S34L 2G9KA 5E51A 3VD1A 1EAPA 1KBGL 1KGYE 1XGPA 3RTQD 3D48R 1K72A 3U1SH 1T7VA 2QJDA 3SOBL 2O93L 1D3CA 3UBHA 3EDFA 3MBWB 2HTLC 3DX0A 4GO9A 3C6EA 3MJ9H 3SB3A 4Z7VE 4APQB 3U6RB 3AXLA 4JDVB 1C8PA 4JN2A 4LRNH 1N67A 1M2OA 1C5BH 3EHBB 4AYBA 1IBDA 3HHRB 5CJQH 4K23L 3PWVA 2NMSA 1BBJB 3DHMA 3QULB 3TV8A 5AKVA 2ZKHL 43CAB 1RPUA 4DO6A 1O6SA 4MAYA 1N2RA 1BYPA 1JE6A 3CFQA 4JO3H 4K3GA 3UYPB 4K55A 5AZ2L 4P48A 1UT2A 4ONGH 1AYRA 4Y16B 3UJJH 3UTSD 4CSSA 5DS8B 3HI5H 5G4OA 5IM7A 4XWGH 1WFUA 3BE1H 3BUIA 5AB1A 1S7UA 1KXVC 1LEIA 2F1AA 1TTGA 2VKWA 4FNPA 4PJHF 5EEYA 3O6FB 3QDMA 3EUDA 1QLEL 4NHCL 2BIPA 3CHPA 3RAJH 5FO9B 1KFAL 2QADC 2ZG3A 5CGMA 1T3FA 4F7PB 4LSDA 4ZTEA 5D9SB 1DQJA 4MMZB 3N0PB 5C2BL 2EDTA 3VXRE 1JP5A 3ARFD 4HG4K 4TUOB 4X5XB 1OP5K 1K8IA 4BSWB 3FT1A 5E0FA 4FZ8L 1MVUA 4G9FE 5FO7A 1RZ8A 5E2WH 2YA0A 2Y72A 5T33H 3P4LA 4PBWD 4TPRH 1PZCA 3ATDA 3L95A 4WEBH 4HAKA 4IQHA 3Q8FA 4MKTA 4AV0A 1K2DB 2F19L 2B1OA 2XBTA 4WQOA 4FA6A 3V6ZB 3I50L 4MLIA 4FQ1L 3EH3B 3HE6C 3O8XB 5LKNA 4H8WH 4KNSA 1KTLB 3MX0B 1PZ3A 2A0LD 5GSVA 5DD5L 2BH0A 3GF8A 3QIUB 1QX1A 4G5ZL 4PGCB 4YBLC 4HS6A 1DBJH 5FO8B 3WJMA 2ITDA 3CFJB 4C56D 5HI3C 4K9JA 1YNKL 3GXDA 1MFDL 5JHDD 3QCTL 5T1LA 5KBLA 3HZKA 1XB8A 3F7LA 3II2A 3WFDL 2CHWA 2JE8A 4P2AA 3VW3H 1ZHLB 1PX3A 1HDMA 4OUUA 5LBSL 3MRGB 1FFOB 2VZ3A 4UTAL 4YLBA 5SWSD 1BD2B 1TQCC 4N0RA 5KYNA 3UBFA 2V17L 4UT6L 5H8DA 1LXMA 5CS7A 1CICB 4M7LL 4AYMC 2VLRE 1BX2B 5DJZB 4C83A 4D0CB 5DMJB 5T3XE 1JPST 2IGFL 4WKZB 3RZCD 3IFOA 1HESA 2P44B 4PWHA 1AXSB 1GMIA 5T3ZH 4P5SA 4WO4A 4ZS6C 3FUJA 3QZBA 2IBZX 3OPZL 1RL1A 3OXRB 3RE0A 2ZF8A 1PEZA 4GQQA 1LQBC 1ZHLA 3DYPA 3THML 3I9GH 3TCLB 4G80B 4HUWA 4JO3L 1CLZH 3I74A 4P2QB 2A9ML 3EZJB 1UM6L 2VDPL 3D30A 3CU7A 5EZIL 3S3DB 1EJ8A 2C34A 2JKIS 1WA2X 3LIZA 1E9QA 2N1KA 2DWXA 1OAKH 3CH8A 4JPVH 1G7QB 4TNWK 2I9LA 1KB5A 1FL6A 3ZYOA 1SDYA 3HC3H 3NCCB 1TFHA 5IW1A 4JL2A 2B0SL 5DFVD 4WO4B 4DN3H 4PCKA 4Y16C 3GRBA 5J6GB 1U0QA 4S0HA 1A6WH 2H2SD 3NQKA 1NEPA 2K6WA 3C5ZB 4LLVA 1HKFA 4E9QA 1GIGL 4L8DB 5DCCA 4TVPD 1VGEL 1NFKA 4WHTA 3K4DA 4ZYKB 1BIIB 1A1MA 1QRNE 2WQAA 3U7YH 4W93A 2E9BA 1I7ZB 1MJ8H 2HVKA 1HSAA 4PTTB 2W9DL 4ZNEE 4KGJA 3PGCA 3ARBD 1PZSA 1DJWA 4KRMB 3ATEA 1JGDB 3GO1H 4KKRA 1JGVH 4FG2A 2XN9A 2QGDA 3WGUB 3O3UN 5IEHA 3WNLA 1OSZA 5KSAC 1Q94B 3HTLX 1A6WL 1R3HA 3SPHA 3P2DA 2MNUA 4O5LL 2F19H 2QVTA 5C0EB 3DBXA 1R46A 1T0MB 2EYRA 3K2UL 3AG1B 4IBUA 5MENA 1P1ZB 2GYSA 2R1XB 4YE0A 3EYQD 4PJEB 4DSYA 4UZGA 5FEBA 1KIPB 4Y2LA 4MB4A 2FJHB 4KXCA 3JYCA 4JFYB 5J5EA 1OK0A 1U6AH 1A22B 1E9OB 3II1A 5DTFA 1A1OB 2WYTA 1MFUA 1IZJA 4IU3B 4CGUB 4HOZA 3JWDH 3A67H 2W60A 2XPYA 2EDLA 3MCKA 3NCJH 4QT5A 1KB5L 4TUJB 2W0FB 2G5RA 4JO1L 4W9CC 1RPQA 1DANT 4WV1B 4EIGB 4O58L 1KTKE 3ML9A 4ANUA 2VO5A 4LLWA 5K9QI 1BJ1H 4X6CB 2BSBA 3GDCA 2FJFA 3MOBL 2WWKT 4PHZA 5HGHA 1E65A 3EDKA 3IAGC 1PZDA 4DH2A 3QJHA 4DEUA 2R0KH 2KYIA 1F18A 1KCVL 1NCDL 3UZVA 1TCRB 4FD0A 5KN5B 2KL6A 4FOMA 1EUUA 3ILPA 3M7OA 4R7LA 5E4IA 4IMLA 5GZOA 3BZ4A 4XNQA 3MKKA 1KULA 1K6QH 4PRHB 4HJ0C 4LEOB 3S37X 2YGOA 1HCYA 2F58L 2YMXL 5I17A 4QJ4B 3N40P 2W60B 1WIPA 4QT5B 4Z7VF 2YIHA 3OX8A 3TFKD 4HKBA 4TVPH 2O6CA 4RGOH 4A6YB 4BKTC 1EPFA 4Y19D 5EA0L 3HC4H 1UWFA 2MOGA 3W39A 1XGYH 2V2WA 1CLOH 5DJ0A 4NRYB 2O6EA 2HKHH 1NFDF 3PQYE 3QIWD 3EO9L 5K39A 5JMRA 1KELH 1I3VA 4XOBA 4MDJB 3LZQA 3V10A 2DM2A 1ZT4B 4QDGA 3L3DB 5BS0B 3TESA 1VJSA 1AQKH 1FLRL 2Y23A 1D5XB 2R0WH 3V8CA 1G5AA 3KGUA 4Q9QL 1YQVL 3E9TA 2OP4L 2K4WA 4G7YL 2IDTA 3K2KA 1RUPH 2Z0BA 4OQTH 5D1QB 3K2IA 1WC7B 1OAXL 3QUZC 1VZHA 1X3DA 1JWSB 4GRLC 1UT9A 1AC0A 4MAUH 1N5YH 3JV4B 1A6UH 4GKLA 3SKMA 1BF5A 3QNZB 5JLZB 4BSVA 4MJ5A 1A7BA 3BVTA 3E6HB 3P54A 4QOKA 3NFPA 1OQOA 3T8MA 5ADPH 5JTWA 4LHUA 5B1AB 1MVYA 2JIXB 3HNTH 3QRGL 5ITBH 3T4AB 2Q8AL 5TGBA 3MLVL 4KQ4L 1IAIM 3L7EA 4L8SA 3CMOL 5B39G 2K0RA 4U7MA 5D7LA 3PJSB 4P5TD 2IIJA 4JANB 5H2BA 4W68A 3UIZA 1M71A 4JG1L 5E5MA 3MCKB 2QMJA 3B9VA 3L1OL 1R3KB 3HMWH 2P5WD 1OALA 3O2VL 3MLRH 2XICA 4JFFD 1Z9PA 1FVCB 2NDFA 3BAXA 3B7UX 1YNTA 4P5KB 4HWEH 5J9PB 1XGUA 2KDGA 4R5VA 2VSCA 4I9XA 2C7UB 2E5EA 3CVBA 4PG9A 4POYA 1P1ZA 3OMZA 4HMCA 5SWZB 5MI0C 2QPEB 4XVTH 1ZIAA 3BWUC 4XTRC 5ICZB 3F5WA 1EIBA 3LEXA 1UD5A 4NZRH 3KWTA 4FG6D 4K71C 5HHQB 4B9GA 1IAOA 5F72S 3VG9C 1YEGL 2OYMA 2PO6C 3E1ZA 3ARVA 3NSJA 4OZGE 2IGLA 3LN9A 5D4IA 1ZT1B 3L5HA 4B3EA 4B7IA 4QNPF 1WITA 3BUBA 3RTQB 1WH0A 3FONA 4WI2A 1MZZA 1YEKL 4KXBA 4ELKA 5BW7A 3WJLA 3QNFA 3DROA 2DQ6A 1C12B 3WIFA 2IQAA 5EBWB 1UB6A 4PLKC 1KENL 5C92A 2C7UA 3J2PA 4QTIH 2CDGA 3L8QA 2PW2A 2MIZA 3SQOH 9CGTA 5MP6L 1S4IA 1I3RA 2GJ6E 6PAZA 4YUEH 3AMKA 4OI7A 1FNEB 4XMVA 1D2OA 5DHMC 3SBPA 3RWDB 4Y4KB 3OGOE 1H3VA 3EO1B 5EWIL 3L3OC 2E4TA 4YQXH 1B88A 3DBSA 3VGDA 3MROA 5B39A 1XZ0A 2XQYK 2VJ0A 5E9DB 3EH4B 3P11L 3N50A 5FFLA 2FWUA 2ZSWA 4E9XA 2NY1D 1FDLH 5BV7H 5FUZL 4WTWA 1NINA 4OVUA 2OXHB 2OJ1A 4L4TB 5C09D 1PG7X 2ARJA 2RMNA 1BM3L 1I85A 4K7FA 1X4ZA 3QNZA 5JLZA 3CSFA 4X5RA 4ZFQA 1R3LB 4ISVB 1EVTC 1QR4A 3EJTA 1I8UA 2WXOA 4U1IB 5J7CC 2IFFL 4DGVH 2AXFA 5E5UB 1UJ3C 1DQML 1HIML 4JHUA 3VGAC 2XYCA 2IPKB 1AIFA 1FI8C 5AAMA 3VFTB 4BKLB 3NMEA 4R7DA 3ULAB 5JHDA 2OK0H 5DZ9A 5I0XA 5FECA 1AZZC 1DBBH 1CT8A 3LS5H 4ZD3H 5KTEH 4ODXA 4YDLB 2XKNA 2NW2B 3ARSA 1C8QA 3VX0A 4BH7A 1FCGA 3IE4A 3QPQC 3O6LH 3ZBMA 2HJFA 4HEME 4I3GA 3P77A 3U7WL 4XPHH 5KYXB 4GG8B 1FZOA 4O51B 2PPEA 3HHSB 2P4AB 3VTAA 4FFVC 4Y4HA 4KMLB 3SZKC 2CK0L 2WYIA 4CGTA 1PTZA 1MUJB 1IAMA 2CIIA 3P2TA 2HX9A 3G04B 4PJFB 5F7FA 5LNGA 4NQEE 1FZJA 2X0UA 4ONHB 2HMIC 1U4FA 4F9PA 4XNZB 3MREA 3SDAC 1ZHNB 4OB5L 5JHLH 2ZX5A 1YEFL 3QC5X 2E76C 4XPAH 3TZVD 2WOBA 3UROR 3V5DB 5DVLA 4QF1A 5F8RC 2ZUTA 5CLWA 1NGYA 2Q8BH 4G59C 1BZ7B 4LRNL 5C7XH 1SN5A 4HFWA 4JJ5B 1QA9B 1YPZA 5CR8A 5F97E 5TDOB 3LKNA 2XG5B 3EG9B 5C0IB 3ULSA 4JQXA 1XR9B 4Y5VA 4LEEA 1D6VH 5DZNA 3RB5A 3IJYB 4PIRF 5D96B 4OD1H 3V0EA 4JY6A 4KWUA 4LNVA 4WVRA 1QWUA 5AZ2H 2VL4A 3EOTH 4LIQE 1YECL 1EAPB 1XGPB 2DTMH 4HPOL 2PXYC 2XDHA 3I3BA 3P4NB 4G8EA 3OR6A 3DV4B 2EH8H 1CXEA 1XAUA 4LVOC 1PX8A 2X4QB 1JDDA 2VLRA 2Z4QA 4GP5B 4UMGA 5CKGA 1HHGB 2ZXCA 1CC3A 3EBAA 2X4TB 1IC7L 1R24B 4U4IA 5BO1H 4IBZA 3RWCA 4L8CB 3MJ7A 2O6PA 4UTBL 4WFHE 3DO4A 4CW1A 1RUPL 1EK3A 2OS7A 4TUKH 5DZVA 5DJ8B 3V7MA 5GS1B 2XG4A 5L6YH 3Q8BA 5K1NA 4RBPH 1IGFL 3ROLB 3TJHD 3JWNG 3AW5A 2BSRB 2NUTA 2Y1YA 1XGZA 3IDNB 5ILTL 5IBTL 3RI5F 4A2MA 3UPRA 4EZMA 2ZPKL 3IT8D 3QUXC 3JVFC 3LH8A 4XMTA 2ZIDA 4FFWC 5E9DA 2YD5A 3CZSA 4TL4A 4KMTH 2MTPA 1GMEA 3BQVA 5E4OA 5AD0A 2QV4A 4L3EB 2ZWSA 2PXYB 2XV2A 3KCPB 1LEKA 3S5YA 1PVHA 2XFGB 5D7SH 2P5EB 5D70H 2VLKB 1XL6A 4Q56A 1ZGLA 5LQBH 2DQUH 3LXUX 1PQZB 1P6FA 2F7IA 2QKIC 5FGBC 1VZIA 3QWRD 4UBDD 5AOKA 3VG0L 1WISA 3BSGA 3OWEA 3OXRA 2R29A 4JHZA 3IS0X 1B4JH 1O9ZA 4XVUC 1XBRA 1NJ9B 1A2YB 5I1HH 3DXAB 25C8H 5K33A 2D3JA 2XXFA 3BAWA 3PY9A 1ZXQA 3FQRB 2IEPA 3QDJE 4NB7A 5DWUL 1CBVH 2DQEL 4PS7A 5E6UB 1K8IB 5DD6B 1ZXKA 4IJ3C 3JWNE 5AD0B 2DWEA 1TTAA 5F89B 4OLUH 3ORJA 4ZOCA 1LO0H 2DY2A 4N2KA 3T65B 4R7NA 4PRBB 2R2CA 1JGDA 4LCWE 3DGCR 3QR2A 2BVYA 1IGCL 3ETBF 4E41A 1MAKA 2GTQA 1Z9NA 2OA9A 3EJQA 1A7PL 2A73B 3SPVB 3PQYD 1FAIH 4ZDHB 1D9KA 4O2FB 5C0AD 1KB9K 4CDGC 5LWYH 4G7QB 1A4BA 4HIQA 4W9EC 1WZ1H 2G60L 3QIUC 5E94A 3KYKH 3FTUA 5E99L 4UNUA 2MCG1 2NTSP 1EV2E 3LZRA 2OZ4A 4PJFA 4FQHB 5IM7B 1XF1A 3H2QA 2WW8A 4R84A 2DKSA 2PLTA 4FXGA 4CAGA 2VMDA 3TYFA 3MRGA 4I0CC 1Z9OA 3BEWB 3QUML 4U1NA 4G7VH 4DESA 2BY1A 5J06A 1L9PA 2X4QA 1RIHH 4WK4B 4P3DB 2NYYD 4JB9H 4IBVA 1VGKA 4YBQD 1ORQB 5DHDA 1N3NB 5DQJA 2A73A 3QS2A 5KSBB 5HBBA 2IANB 1ET8A 1PKOA 4IRSC 1FVEA 5D4HA 4GW1B 5A7BA 1ICTA 4TL5A 4IHOB 4K9EL 4PJ9D 2CRMA 2AGJH 2NLJB 4W1TA 2A9BA 2IH8A 3LNFA 1RJLA 4OZGF 1QTSA 2BNRA 3UJIH 5SV3A 3VTMA 5A3IC 3VI3A 1FNSL 5IJVB 2DDQL 3ZHLA 2LAGB 2XVGA 4M48H 2IH1A 2F5AH 5EH1A 1NEZA 3K81A 1BLNB 1IBBA 3T04D 1OSEA 3NA4A 3CZUB 3GBLA 4XMKL 2YK1L 1S9VB 2WUBL 4KJQD 4OZFH 4IGBD 5JO5B 5A2CA 1UHVA 4IHOA 1N26A 2YXFA 4KTDH 4KJYA 1TOXA 2R7EB 1YMMA 2Z3FA 5L7XH 4JO5A 1HHJB 1I8MB 2FD6L 3HZKB 1OGAE 4BZ1H 3ILPB 4IJTA 3UBXG 5DT1L 5G4NA 4GIAA 3RUGA 2FATH 4RMUA 3DC0A 4WU7B 3WELA 4CVXB 1ZD6A 2FEEL 2K3TA 2JLPA 4ANXA 5BV7C 4NJ9L 4ZBJA 3FULA 1QR1B 1I3GH 1OM3L 2ZXBA 2BVPA 2MOVA 4KC3B 4KTDL 2QPSA 4A7GF 3WIHH 7PAZA 1AO7B 1WAEA 1VCBC 2BVQA 3ZO0A 1MCPH 1NL0H 3NIFF 3W1ZA 1JSYA 3MVSA 1RP8A 3D6GA 4FKHA 4ALAC 2JK5B 3D39D 3L3JB 3KW7A 5EV7A 4F7EA 1JGLL 2F2HA 2DI7A 1JBJA 4N8PA 2A3TA 2ZOLB 2XZQH 2GKIA 1ZK9A 3J8F7 2XHNA 2Y5EA 5H37G 1GOFA 3VXMD 4L23A 3KH3A 1WBZA 4ERSH 3UYPA 3ZDXE 2BWDA 4LCCA 2BX5A 1E90A 3BVVA 1BAFL 1AZUA 1WZKA 2F68X 4EVNB 5KVMC 4WFFD 3GSNB 4GYBA 2I27N 2G0KA 4I87A 4ZW3A 4RFOL 2XXGA 3QDMB 5ELIA 2BVQB 2ZXDA 4OV5B 3UO1L 1WIUA 4FYSA 3QJQB 2FYVA 3F7RA 1LO3H 4V1DA 5KVFL 4OGYH 4DGIH 4OD2A 4PJCB 2MNWA 5ACZB 3ABZA 1OCOB 2AV7A 1E7VA 4L4VE 1O75A 3AACA 4YS4A 2W81C 3ISYA 2CGZA 3SDDA 1BVKA 1KEGL 1A6TA 2BFVL 5I28A 1E2WA 2CM5A 4PLNC 2ICWJ 5SWQA 1BG1A 2XSKA 2Z92A 4L8SB 5FPIA 5F8QC 4BZ1A 2XTJE 1NQBA 1Z5HA 5DO8A 2JXMB 1G7JA 4ZQTA 1UD6A 3L5IA 4HLZG 3D3VB 2AF2A 1P5VA 1FFOA 1EWHA 3NFNB 3MV9D 1M3IA 3P30L 3X1EA 2AXGB 3BJLA 2XT1B 5C08A 1H8SA 3MRPB 3VWJB 43C9A 4MQ7A 1DBJL 1EGJL 4HJIA 5DEGA 2V7NB 2GI0A 3VXRB 1YVLA 2IG2H 3HZYA 3ROOB 3RZCC 3U6XA 5HPMA 4G83A 3C5ZD 4XO9A 3KLHC 4HHWA 4GUPA 4YSDA 2UWEB 5BOPA 1NTDA 4FLRA 3VD7A 3JT0A 5E8NB 4Z5RA 2D9CA 1WRFA 2WNWA 2X1OA 2YWYA 3MUZ1 1T5XA 1TMCB 3T0ED 3T4YB 3CG8A 4FFYL 5ITBL 4ZFGH 5CO1A 5AOIA 3VFMB 2VN4A 4Y2DB 4KY2A 3KBPA 4JM4H 4BCYA 3D4YA 2J57A 1OB1A 3ZY7A 3ZQ9A 5KZCD 4LVHB 3WIFB 1NCAH 2J2ZB 3MNVA 3GK8H 1PX4A 3B9KA 4UTCA 1EMTL 3GSXB 3QJHB 3QEQE 4XCCL 5FYKH 5IK3A 4DEWA 4EZLA 3PNWA 5IV2A 2ED8A 3KS0J 3K71A 2TSAA 3H7BA 4QIRA 4AEEA 3C8HA 4N0UB 4TYUA 5D2NC 1S7WB 1UENA 2FJUB 2H2SC 2A9MH 4OFIA 1QSFD 4WSGA 2JI2A 3MRDB 5E9DE 4QAMB 1JXJA 3RZCB 1FGVL 3JTSB 2VKXA 3DX3A 4PTUA 2YS4A 2AJZB 1FYTE 4QHKI 2CCLA 5DRWB 2C9QA 2CO7A 2A77L 3EH2A 2W80C 1YHPA 3P9LB 2HYMA 1MPAH 3GMMA 1V7ML 2GBAA 3KDPB 3OKKB 4FQJL 4OJEH 1JMZA 3ARBC 4X7SH 3CH1B 4XBEL 3SYAA 3TL5A 1L6ZA 3FTYA 1G7QA 5LNEA 2L7EA 2VDQH 4GT0A 2E7LA 3VRIA 5B4MD 3L5WA 1T0PB 3QZMA 1H0DB 1F4HA 1XB3A 3KD4A 2DLTA 3GJEB 3SO5A 3KR3L 3QH3B 1CYGA 4Q6IC 1S7XA 3IB4A 3DBXB 5HI5D 1NC2D 3PWLA 1EHLL 5SWZA 1PKQB 1QI5A 3S4SG 3EYQC 5B38G 4XBGA 4LCCB 4EDWL 5F1NA 2Q3XA 1AGBB 3EFDL 2IAMA 1BYOA 2J1YA 5HHQA 3EYUL 3F00A 4KTGA 4K71B 3OQ3B 2VDKB 1IEBA 3NIFE 3TXAA 1JI1A 1CVRA 2NY7L 3V5DA 3X12B 4JRYB 4RLDA 4ZT1A 4GKZB 4HVBA 3CDZB 3NJIA 5INCB 4F5CE 1G0YR 3ZDWA 1A21A 5EEVA 2APFA 1IAKB 2X2JA 4MAYC 3ARPA 4GI9A 5DHYA 4M48L 1MZYA 3HE7A 4FP8H 3U2SA 5CILL 3WNNA 2UXVA 1EZVX 1AFVL 2EIZA 2X1WL 2C4FU 3REWA 2YQGA 2VDNL 2XZAL 5DLLA 2FQEA 4WU5B 5H35B 3VFTA 2OTWB 4AYFB 4UIMA 1S5HB 3VFPB 4DZBA 2YKKA 3EGDA 3GWJA 3ZDYB 2OX5A 4JDEB 3VFUA 4BZ1L 2VZVA 4PY7B 4AJ0A 5F9OH 1M4KA 4S1RL 5IJCC 1O5DT 3LXBA 1HQ4A 4FNQA 5DHEA 5E2UL 1R24A 2XWZA 4NQCB 1IAKA 2R0KL 5F7DB 4QXUH 2XYBA 3PYCA 4XI5C 2OJZL 1CURA 3ZYIA 2F7QA 4JJOA 2H6PB 3VMPA 4LEXL 2AKRB 4LCUB 1ILUA 4TQEH 4FQCH 3RFZA 1ZEAL 5F1SA 3BZ4B 2HFGH 2BMKB 1NBZB 1MF2L 2QQLL 1Q9KA 4XNQB 5HGDB 4B97A 2DL9A 4CC0A 1K5NA 1I7RA 1D6EB 4PS4L 4ETYA 1EHXA 4D94A 1MFCH 3MACL 2O5ZH 5C7ZA 4AE0A 4BA0A 4WSKA 4K7PL 4BEIA 2GTWA 1DLFH 3NCFB 2FIRT 1FL3B 1UXMA 4N5UA 4J8RB 5T3ZL 2MFNA 1Q4NX 1CL7H 1UASA 4GKSB 5MENE 3M88A 2FX9L 4KDVA 3RWEA 2H3KA 3FB5B 4GRLD 4I1NB 2CO1A 1WBYB 4ODSH 5IQLA 1YZZA 2HJFB 1TU2A 4P46D 2QGBA 3CFDA 4ZAKB 4LPWA 5B8CA 2CKBA 4U0RB 2VXUL 4N0UA 4X8CA 5BO0D 1PZAA 3RTLA 3TWYA 3TH4T 2FCBA 4WWKB 2R1WA 5DLMH 4Z7QE 2OMUA 1GS6X 5G55A 3APMA 5HHPA 5F21B 3UP6A 4F33A 5HPOA 5KVDL 3QNYA 4XMPL 3PL6B 4RH4A 5KS9E 3L2LA 3UTTB 4G1EB 3V7AE 3H56A 2K6ZA 3VFGL 2R56L 2GUOB 1XV8A 4P5TC 1LK3H 4RNRA 3B43A 5KYUA 3A6CH 4XHJD 3GYRA 3V2AR 1EJOH 5IW6B 4R4ND 2VO8A 3QJVB 2QQKH 5CZVH 3R8QA 3ZR5A 4FQLL 5HJ3A 3ZT5A 1FHGA 1O7VA 1A5FL 1W0VA 3FO0H 3RIAF 4H7VA 3QC6X 1BZ7A 3QP3A 4ZO9A 1AZNA 4AVIA 3ARFB 5C0BD 1R17A 4G6ML 1MRCL 1RK0B 1FP5A 2I07B 1QSZA 2NCEA 2Z31D 3NJMA 4KXAA 2YWZA 1IBHA 2E6JA 2YPVA 2EDOA 5IREA 3AT9A 3FTSA 4FHBD 1IGFH 3FAXA 4JKLA 3VWKC 4K2UH 4TVSa 4FG6C 3O0RL 2VDNH 3BDYL 3BN9D 1IEHA 5D96C 2YLKA 2PO6D 1JZHA 2HT3C 5I1IL 3HJ0A 4M93B 2EILB 4J3SA 3VXTB 4EBQH 4WJKB 5IVZB 2W0KA 2X12A 1LP9F 1UA6H 3GI8L 3LPFA 2VZUA 4PY7A 4HJGA 4UM9D 1SOQA 4ZUVA 2BHZA 3RWJA 1YYLL 3MGOB 5DA4A 4UB0L 1N3NA 5I8CA 4R97C 1RZKC 1QWNA 1X44A 3WL9A 4ZDHA 1A0QL 3ZIYA 4DFHA 5D7SL 3D34A 4RWHA 4AQAA 5IHZA 2Q86B 1T66D 3GMPA 5AW7B 2K3HA 5I6KA 1NOFA 4OF8A 4AH2B 1UGKA 1SFHA 1CBJA 4MDRA 5AYUL 3EJPA 4XNZC 1R0AL 3RFZB 2XA8L 3ROLA 3PRZA 1G9MC 4Z0BL 1DJXA 1JL8A 4I13B 4YSAA 3OJDA 3QNXA 3VXMA 3HNTL 3QRGH 1LO2H 3FFCE 1JTOA 2UUDH 1CJYA 4YE4H 3EO1A 4PS4H 2ZXEB 1H3GA 2EDHA 2YBRB 1JWMB 1MCOH 2HRLA 4DKEL 3VWKB 3TIEB 3CFCH 4P2RA 1EBPA 4N68A 3Q1SH 2NZIA 2V2TA 2NY1C 3VO0A 4GQZA 2WQSA 5IUCA 5IBUB 3CE1A 3B3IB 2CDGB 4BCXA 2OXHA 3IMWA 2Y7NA 1TU2B 3GMPB 3PWUA 4L4TA 4PWFA 5DO2D 4M7LT 4R2GD 5TFSH 1FN4B 4BFRA 1E9PA 4HJJH 2HRHA 1AR1D 2Q6WA 2O61A 3V0FA 3ULVE 1CTOA 4ZTOL 4YE4L 4XHQA 4C56E 4FMFA 2NY3D 3APFA 4TNVF 4L0ZA 1BVOA 4GW4B 2WO2B 4IS6A 2RCSH 3MHZA 1XGRB 1B0GA 3QCVH 2W38A 4L37A 1BEYL 1NOLA 2WZAA 3BUQA 2CG9X 2NY4D 2K7QA 4IRJD 2DQTH 2WNGA 2X87A 5DRZB 3BVWA 2V2TB 1O0VA 1U8MA 1KCSL 2I7SA 3RIAK 3IBOA 4D0DB 1PCXA 3FTZA 4W9ZA 4KRLB 4F2MB 4CW1B 4QKXB 3QG6A 1UXWA 4KUZH 4I4WA 1OGPA 1R3LA 3PL6C 4LCCC 1LE5B 5DDHB 4F1ZA 1YJDC 2D7TL 1FLTX 4G70B 1JCVA 2O5YL 3WENA 2DBLH 1J11A 1OKEA 2A4EA 4DGUA 2AJUL 2PO6B 5DI8B 5KAQG 4OQTL 4IS6B 4XO4A 4DWHA 2NY6C 4XO8A 3E3QC 4JZOA 2Y22A 3NCYS 4K2UL 1OAYH 2GK0A 2J8HA 4Q6YA 5C71A 1JNNL 3F58H 2IWFA 3GJFA 5B3JF 1Q1JL 4DP2X 3QUYC 4NO0D 1JD9A 4DIXA 3RWJB 3IDXL 3L6FB 1G6RL 1BD2E 3K5RA 2M8XA 1LP9E 5KSBE 2EDYA 4OD2B 2AZAA 1RUAL 1E8WA 3K8LA 3LTVA 1QTPA 4AQZA 4RCAA 3AREA 2R4SH 1I9IH 4Z7QB 1A6TB 1MFAL 1NGPH 3NDYE 1JGEB 2ZWYA 4RA0C 4JN1L 1U8PB 4KY1H 3V4UH 4IKIA 4WWKD 2XACC 1BA9A 4JY6B 1IUZA 1MREH 4XPFH 2FATL 5CIPB 3AT8A 1ZHNA 2QLYA 4I9WD 3MLTA 2HT4C 4I48A 1FNFA 4EI5A 4CNIA 4HAGA 4UDTA 4PD4J 4HWEL 1G9HA 1AJ7H 1CR9L 3S35X 1GZQA 3LKQA 2HH0L 3WDIA 3H9HA 3ILDA 5IMKB 4Q89A 3ZT7A 5I19L 5AKSA 3FQTB 1FJ1A 1MCPL 1NL0L 4WF7A 4WUUE 3MJ9A 2JLLA 1BBDL 1LNUA 3O6LL 5EU7E 3NBNA 1XCQB 5C0IA 3SE4C 4XPFL 1N5AB 2EIEA 2CKBL 3SSGA 1PFCA 5DUBA 3LEVH 2CJ3A 3GSVB 4WW2F 3C2SA 1OLLA 1EX0A 2CNZA 5AAWA 3SE8L 4H25B 1ULVA 4MD5A 4BH8A 5A2AA 5M7QA 4EN3A 2Q2EB 3FRPA 4KVCH 4NN6C 4U1SB 4IHBA 3SQOL 1FE8L 4N0CD 3T09A 2C3XA 2RIKA 2X09A 3FQTA 3VH8A 1U2YA 1A7QH 2HFEA 2CGRL 5D2NA 3LV3B 2F08A 1PZUB 2ENJA 1FO0L 4GI8A 1DEDA 4UBDC 3CQFA 4V2BA 5JHBA 5LN8A 4M1DH 5IIEA 4QXVA 2IMNA 5F7NC 4PGDB 4NOBA 5A7EA 4H4NA 4L8DA 1MQ8A 3ZTNH 3P9WB 1OXYA 2JJSC 4U2YA 5I8EB 2ZT9C 3LX9A 5HY9A 1BVZA 3BP5A 4PRIA 2CJUH 3DUSA 4ZO8A 2UY7A 1UFGA 1KTDA 3Q8CA 2IAMD 9PCYA 2NYZA 1NCUA 3MJGX 2FYYB 1O5PA 3VXSB 2D7PA 1SF3A 1XFPA 4GEJA 4PD4K 1H3XA 4Y9FA 1YN6A 5AL8A 4ADIA 5IBLD 1GSMA 2R83A 1AD0A 3P0GB 4RGMB 4UF7C 3GSXA 4FG0A 5IK3B 3JWNC 5I1EH 1KCUH 4R0LB 1P4LA 1RHHB 4PG2C 2EZ0D 4R90L 4XP1H 5JIDA 3IJSA 3S88H 1IKNC 3EBHA 2B1HH 2W9EH 4APXB 4HJUA 4BQ8A 1RUKH 1A4JB 3N44F 3QORB 3ZTCC 3EJCA 3LOWA 1JHLL 4Z7QF 3VAEA 3QFGA 1NC2B 3QUYB 4JN1H 3RNQA 4JRYE 2UY7B 5HDBF 1G7JB 4BSJA 4KK8C 1RVFL 5IB1B 1U30A 2P5WB 3IMVA 5FLVA 4UV7H 4ENEC 2CO6A 5G5DA 4M8UA 2WXQA 2BHYA 3A21A 4LMQE 2NYYC 5LBVA 4A7QA 3X12A 4QYAA 1FAIL 5EUKA 3L3JA 1DE4A 4X4YB 3IS1X 4YDKL 4CUCA 5BXFA 4NXKA 4V2CB 3MTXA 4IRSD 1GOHA 3CBKB 5DEGB 3W57A 4FCAA 4HZLB 5DVPA 5IKCB 4TLTA 3EJJX 5KSAA 1TETH 4B9KC 5IJKA 5HP5A 5ISZB 1T21B 5HHMD 4QTFA 4CSPA 1Q9LA 3MO1B 4OT1H 3SN6N 2TRHA 5CN2A 2P42B 3X3FH 2R0LL 3DTXA 3O9WA 4WU5A 4J8QA 5GXBB 1L0YA 2GBVA 3ZX1A 4YZFE 4J1UA 4FX5A 5ES4B 5C7XL 1KZYA 3B83A 4KROD 5EBMB 1EQWA 3ENEA 3O11B 4N0YL 1NAKH 1FVCA 5JHDE 3H9SD 4IOSA 3WKYA 2VDQL 5ACZA 5HHVH 2YC1B 3NGBC 3DYOA 3ATBA 3ESOA 4JG5A 2OMBA 5FYJH 3RHWF 1DBMH 3VXME 2BOBB 4J3BA 1QFOA 1JWUB 2ZXAA 4TSBL 2D7QA 2BNRB 1MCIA 3T2QA 4X8GA 5GRUL 1XX9C 2OQJA 4ONOA 4ODTL 3ARGC 3RVXC 4PJXA 4YQXL 5CR1A 5I0DA 2GABA 4OZHE 4U0QB 1JZ3A 4G9FD 3BIKB 1PMYA 3SBQA 2X9YA 1Q9WB 2WP3O 3M1OA 3UABA 4DP4X 2FYYA 3L9EA 3IDJA 1SYVB 4C59B 1TTCA 2SODB 1HN1A 1G9ML 1HH9A 1NC4A 3R7QA 2PTTB 3VI4B 1JWSA 3V5HB 5C0AE 3GI9H 3TYGH 1QZ1A 2X89A 2MRYA 2DI9A 1MJUH 3V4VH 3CFBA 3EKCA 5GGVY 5DJDB 1H15A 2WCSA 2LLNA 2W07A 3NVQA 5DMKA 3S96B 3F12B 2NY6B 1ZPUA 4OM1L 3VRJB 1C16A 1E6OL 2OMXB 1DZ0A 2VR4A 3OWRA 4HC1A 1NLDL 4Z5RB 3IU4L 3REVA 4K3DL 3DHJA 4NZDA 3SDCD 4B50A 5I1LA 1PNDA 2PPFA 4HV8B 5HY9B 1T80A 5CSGA 5ESQB 1OP3H 4A7TA 2IQ9L 1ZA6A 2D31B 3VM5A 4P8QA 4OFPA 4J39A 3O2DL 1H3PH 4J3OC 3FCSB 4KMQA 5IMOA 3ARGB 3MFGB 4GKSA 2UWEF 1JPGA 1CD0A 1TEGA 1U8OB 5AAPA 4D9LL 4NNPL 3U7WH 3WE1A 1KXTA 5E2UH 2X4UB 4LAQL 4MB3A 1JN6B 4GFTB 4YDLC 5I5RA 1Z3GL 3OAUH 2C9UA 1KTLA 2Y25A 1EZVY 2NY5H 5IKCA 1YC7A 2JV6A 5I1AB 2X4SA 4U1HA 5F1IA 2Q1EA 1W80A 1OWWA 4Y5YB 3NCJL 1J9RA 5A2FA 2AJZA 1V3MA 1J5DA 2XV6B 2KQNA 2FD6H 2C9PA 5D6DC 4JFYA 1HI6B 1FFNB 5I5JA 2BJMH 4ZMQA 3X3FL 2EVFA 3KAAA 1U3HD 3PP4H 1I9JH 2Y07L 1KXHA 2NY0D 3BQUC 3FOMA 4KO7A 1DUYA 2C3GA 5EBMA 2Q8BL 1JGUH 4HUVB 3ETBJ 3QXAA 2HWZH 3I6KB 3TJEH 1EO8L 1GW6A 3CZJA 4JFZH 4B95C 1SEBA 1BVNP 1CFVL 1IFGA 1IC5H 4TQHA 1YAIA 4H8UA 3BN3B 3FT2A 3FU8A 3IXAA 3IGAB 2EVGA 5HHVL 3UTSB 4HQQL 4XRCA 2EDXA 1RSFA 1PD6A 4NKIL 1TQVA 1T03L 4HOXA 1OK8A 3B5GA 4L9LB 1Q9LB 1CVSC 3I6LE 1D7DA 5ALCH 3KEDA 3NPSC 4NZUL 5HGDA 4IOIA 4JCWA 4DGYL 4Y2OB 4PV8A 5PCYA 3U7YL 2WSKA 4K4KA 4UOJA 1UJ3A 4B9YA 2WLJA 1AMYA 3ZKQD 4TUJA 1E8XA 4F91B 3LRHA 3VFMA 1Y07A 3FN9A 4QHKJ 4MB1A 1TKWB 3FN0H 3Q43A 3CDZA 5I1JL 1AGDB 1C5CL 3C9NB 2E7DA 4C55A 3ZHDA 3G5VB 5T5NG 3BVDB 3KPOB 2I9LB 3F04A 5C9JA 1DQDH 5DK3A 1XH2A 1DVFC 4JQVA 5DR5L 3VXUE 3FO1B 1SLXA 4RA3A 3HI5L 2MPAH 1T2QH 2ED9A 5JHLA 4P0DA 1CXIA 3MYJA 4U1IA 4OM0H 3GRWL 4AYFA 4HK3N 5IEKB 2RD0A 3TLRA 4ACPA 4DUWA 5FA3B 4HCIA 3N91A 4Y2DA 2YN3A 2BSCA 1TO5A 3BDYH 2XA3A 1HOEA 3NCEB 1N10A 2X0VA 1FSKB 1J8SA 2X44D 3DWTA 4F9PC 3ZDZF 4GPVA 1ZHBB 3ARZA 3D69A 4BFBD 4JREC 4J3XA 3PHSA 1MLBA 1JNLH 2FUTA 1E5YA 3TV3L 5GZND 3R4DA 3EGSA 4OLVL 1J8KA 5FF6A 5KJRL 3V6OA 4XNDA 4BFGA 5HI5C 4Z3FA 4NSKA 3PGFL 3BD3A 4LASH 1A7OH 3IJ9A 1PJWA 4JG1H 4TLKA 2W92A 25C8L 3QJFA 2CUIA 1X7QB 3L9RA 2NTFB 1PSKL 3HS9A 4YFLF 5F3HB 1M05B 1XF4B 5KSVB 2X4OA 3U30C 5KBNC 3CU1A 4N8VG 3M07A 3T8VA 4TSAL 1CGSH 3T2NL 1L9SA 1SUJA 2AJ3A 2APWA 5IR1A 5AW2B 3LH9A 2P80A 5EFIB 2CIKA 1A7OL 1IM9A 4XMLH 1BEXA 4F2MA 1T89C 2IV8A 3OC5A 2YQ2A 4X9HA 1DCEA 3GS7A 1QYGH 4C58B 4PLOB 4XN7A 2J5LC 2EEXA 3A67L 4HWBA 4WI5A 3KPNA 1QBLH 5I1AA 5I71C 3W0WD 5KEZA 3CVCA 2JJSA 5DVMA 3ZQWA 4XP9L 2YQBA 3H3KA 2P5ED 3D05A 1G9NC 3VXQB 3WUWG 2OR7A 5IVXE 4QO1A 2VDML 4JFUA 3VGEA 3CVHH 3UX9B 2JQMA 3DLQR 4GRMA 5BZDA 3CDYA 4OGQC 1AKPA 2OTWA 3U25A 5FYLE 1G1YA 3NK4A 4FI7A 1TDQA 1AZBA 1KEMH 4HUUA 3LKPA 4NPKA 1QPKA 4WI4A 2H1PL 4X80L 4YL9A 4L4VA 2FIKA 4FL4C 4H8QA 4X6BA 5DMGD 4MAUL 2JH2A 3JUYA 3CVIL 1M3JA 4J3OH 1JV2A 5IROA 4YX2L 2VISA 5TF0A 1NFIB 1FL5B 1WHOA 3TASA 4FNSA 4YHZH 4P2OC 3GZKA 2GQHA 3KPSA 4HX1A 5LBSA 3U2IA 1X5ZA 4P04A 4BSWA 5FW7A 1CLVA 2VLRD 3FB6B 2V3FA 4Y2OA 4YLCA 3C6LA 4N3TA 5T5FA 2WIIB 3IE9A 4WTQA 3L95B 4JFED 1L5GA 4ZUWA 1GL4B 1MJ7H 4N8VA 3FTGB 3C8KB 2ZWKA 4W81A 2VDRL 1ZSHA 4P05A 1NOAA 2QBWA 5EU4B 1Q0XH 3D0LB 4J12A 2B1AH 1RLWA 4U1SA 4OCWH 5F9WB 5T3XH 3V79C 3WL9B 2DJMA 3QEGH 1CPUA 4DVBB 1IBGH 1JVKA 4P23D 5D8JH 4M5YL 3H2PA 1DJHA 3T5WA 3W9EA 3FT3B 5E2TH 1II4E 1MIEH 1JYVA 4OZHA 3AG3B 1MFCL 1RJZB 4QD2E 4W9KC 2JCCB 5AALA 2P48B 4FQXB 1DLHA 1XIWD 3C6LB 4WO4C 1KC5H 5LG1A 1X6NA 4F80A 3KNBA 2O1AA 2XN0A 3KS0H 3IMUA 2Q0ZX 4YPGA 4LLYB 5F7LB 5D1ZD 5BCAA 3PWPE 4A7SA 5D8JL 4R96A 1IGIH 5DJZA 4HDIA 4YHIA 3D50A 4R4NC 1BMWA 3OHXB 4WZ9A 3SY0A 3FSWA 3FMGL 3SD2A 4M7LH 4ZSOB 1C9SA 1SEQL 4Y5YC 1LP9B 1NIEA 1UUSA 3VRLF 2PWGA 1GYUA 2CLVB 1NCNA 4X5LA 3H4HA 1G1CA 2V5YA 4LSTH 5F7WC 4LOVA 2DQCH 1A02N 3N1PC 3NDZE 4H0LC 4FTVB 3VXQA 3U4EB 5FCSH 4KITB 2DICA 3VWKD 4PLJD 1KN4L 2DD8L 2PKDA 3FQUA 4D0BB 2QEJA 2XX1A 4NN6B 3PAUA 3CVHL 1URIA 3UH8A 4MS8D 3TO2A 4I48B 3Q9PA 5HYSB 4ZG1A 2AI0H 1QLRB 4HDIB 1USZA 1YLBB 2W59A 1QFWM 1S8DA 4Y5XC 5I66A 4L18A 3CZNA 1JRHI 3QEUA 3DA0A 3UXFA 4DGIL 2FWLB 3L9YA 4JM0A 4K07A 5K9KB 5FKAA 3NA9H 2GJZB 3E9UA 3N1MC 4MA3A 3QJRB 4XZUA 4EUPH 2NXYB 3PABA 4I77H 3FNKA 2J5WA 4JPVL 4XP6L 3LRKA 2NXZD 4O4YH 4OCYL 5EBWA 1JV2B 5EU6D 1MAMH 2XC8A 4HWZB 4NKMB 4AZUA 4HIIB 1N5YL 4ZPVB 1QLEH 2X4RA 4NHCH 1L9QA 2W88A 1QI3A 3R06A 1PGRB 4PP2A 4KKQA 4PJBF 1Q72H 3UL4A 1SLVA 2YEQA 5EN2B 3D33A 4KGLA 4TVPL 2XWJB 2HVKB 3VQLA 1DR9A 3Q0HA 3IXTB 3RUGE 2YA1A 3U36B 2FE0A 2K8QA 3DI2B 3CK0L 3DX8B 4HIXL 3Q7JA 5CCGE 3CSTA 3OKOA 3IETB 2JKWA 4TXVB 1IC1A 1HAWA 5GS0H 4GQPH 4X9GA 5DJXA 2NQ3A 4I3SL 5E2VH 3QEQB 1TMQA 4JY4B 1SGKA 2BNUB 5HVGB 4I9WE 2KLRA 1XGQB 2AJVH 1HEJC 1VEPA 1SBSL 4MA8H 1GGIH 1AR1C 3ZSTA 2W1NA 4HWUA 3CFMA 4YHMH 1T1YB 1WT5A 4HWNA 1Y6NR 5T1KB 4BHUA 2QGCA 5IWLA 2AV1A 2IDSA 1F6AA 1O7SA 3QQXA 1IM9D 1COBA 3KPTA 1YNKH 2X9XA 3BPOC 2NY4C 1HINH 3TU6A 1SY6H 2JB5H 3UTTD 3ECUA 4LLWB 2CD0A 2PPAA 1Y18A 1T1XB 2YD3A 3BSZH 3ESMA 3DKHA 3WN6A 3U6RA 1IGIL 4DN4H 4AITA 3KJ4C 1SJEA 3F01A 3O6ML 4ADJA 1G43A 1UXWB 1P7HL 5ACLA 3PL6D 4PJ8A 5L8KB 3CMOH 3QUXB 43CAA 3ZL2A 1SOKA 3BSZA 3HBPA 4N5EC 4TSCL 2RCSL 1THAA 1W0WB 2B7DT 3M86A 3VRJA 1BYNA 3MUGA 3K6FA 1IEAB 4HPYL 1YECH 4E36A 1DSFL 4XP4L 3CXHK 3GSNA 4NBYB 3US9A 1NMCC 3ARDC 1KIRA 4L3EA 2IFGA 2VN5A 4ZX6A 1SYVA 3OM3B 3GSOA 4QRPA 4TM9A 3QCUH 3GB7A 4WKXA 4AEFA 3MJ6A 2XN9B 4KRPB 1GAFL 5EOQL 4ZMTA 4M6MH 3T0XA 1A6PA 4DK5A 3SBWA 5C0NC 4AL8H 3ZKMD 3QUMH 3UERA 3HVNA 2F0CA 4X7DC 4WFHD 1M7DA 4P2RE 4WWKC 5ESQA 1ZANL 2UWEE 3AM8A 2LU7A 3X1BA 2B39A 2O6FA 5DTFB 3QAZC 3B2VL 5DJCA 4N1EA 1E28A 2ZQKA 3H9SA 3NIGE 4XMZA 2D7NA 1T20A 4OFKA 2CBMA 4B60A 4H88H 1JN6A 4NEHB 4ZMZA 1T3FB 4OLYH 2MEJB 2BHFA 4NKMA 2LOEA 4JPWL 3LQZA 1F3DH 2ITDB 4P5RA 1JWUA 3KPQA 4R83A 2E7MA 5KVEE 3MV7A 5CSZA 5EN2A 2O6DA 4WWNA 1JK9A 4DPAX 1QHQA 1S7RB 2BS9A 3FO9A 4GFXA 1ZVSA 4AXWB 3RVTC 1CBVL 5B3SB 5C08D 2VDKH 1JOIA 2DKMA 4GBXD 3ZL4L 3F6LA 5HDQH 2ZX8A 4Z7NB 2JB6B 5J3HC 5LN4A 3P3UA 4H25A 2EYSA 4MD5B 1TKWA 3UYRL 15C8L 3WHE0 3WY3A 4IRZL 2W8CA 3IDJB 2AERT 2XWTA 1TQTA 3QHTC 5EULV 4C83B 4ONFL 1SYSB 5EOCJ 1OOWA 3KCWA 4AJYV 4KMTL 4R97B 3ZUNC 1JYXA 4Z23A 3KPQB 3I85A 5HDQL 5JQ6L 4HIJA 4Y9GA 4DKEH 3QG7L 5JW4Q 2P5EE 5H35A 2VXQA 4ODUA 1SVBA 1WHPA 4UQDA 4WDIB 4UOZA 2C4FT 1HAUA 5CEYA 4FXKB 5FCUH 4BBWA 1S3KH 1IEAA 1F90L 1VSCA 3FO2B 4LLUA 5K1VA 3VSVA 5IF0B 2HVJB 3SPCA 2EYSB 3VXUB 2IAMC 3U2JA 1MCHA 2QADB 1X9UA 1S7UB 1X9LA 1TTFA 4JO8A 4HC1H 3BRGC 1IAII 2VXTL 3QJZA 2J7LA 2FX7H 1XF5A 1SJEB 3VFRB 3O45A 4RISL 2EZ0C 4RGOL 1NGXB 5GGUB 5EA0H 4NGHH 3SE6A 4JFHD 1CE6A 3KPMB 1KUMA 5FCUL 3N3EA 4EF3A 4XMPH 3R19A 1AOHA 3QUMB 5EEWA 2V2XB 3ASOB 5F1NB 3V7AG 2Y2TA 4UILL 4L5FE 2Z8VC 3QUYA 1M05A 1XF4A 3LHPL 3UACA 3KPRD 2G3ZA 3UGUA 3M8OL 2CR6A 2P7TA 4JANA 3CC5A 3LRLA 4OBSA 3VXSA 2R23A 4FULA 4GSQA 4QRPB 4AT6A 2NXYC 4GBXB 3VU1A 5BVJA 2P8LA 4ZUTA 3WDHA 2MHAA 2JJVA 4LHQB 1MCNA 3QDHA 3O45B 1OTSC 5BS0D 3GXFA 3BZ5A 2OCFD 1ETZA 5KVFE 2BSTB 3QWOB 4UT7L 8PAZA 5K69A 4G7VL 2ROXA 1MRFL 1G6RA 1OZTG 1QO3A 2BSED 3CPUA 5LXVA 4TV3A 5C0CD 2ICEC 1KGUA 4P06A 3S37L 3K6SB 2ZCKH 4YWGL 4E9WA 2F54E 2CBPA 2IPKA 2ZWZA 2IADA 4QHMA 1MRDL 2YD9A 5D7IE 4FFTA 4XB3A 4ZMNA 2WQRA 1HIMH 3P0VH 4JFOA 3VFPA 1K4CB 2ZAIA 4M8QA 2OYPA 2Q7NA 3M45A 5A40E 3HRZB 4KROC 4X99A 2G2NA 4M62L 1NEZG 4DP6X 2AXGA 5DD1H 3MGAA 2OBGA 1A14L 1QSED 1UG9A 4AYSA 2H1LM 1PZ5B 4MX7B 1A47A 3QZWB 2ZOOA 4HZLA 2QSTA 3T2PA 3UDWC 1N8ZA 1UM5L 3CUPA 5TE7L 4JO2L 4L0PB 2H6PA 3OJ2C 3WEBA 4ANWA 3D39A 1JTTA 5IQ7H 3U9PH 3G5ZB 2VUYA 2DOCA 1MKFA 1YY8A 4WGWB 4ZMWA 1F97A 3QCTH 3ARGD 3VFNB 3RVXD 4NQXB 1VEOA 1PSKH 3VFVB 1JHLH 2CH8A 5CD5D 2BRRH 4QHNB 3OX8B 5BRZB 5MERA 2X3CA 5F3BA 5EU3A 3OKMA 4BRVA 4Z7OF 3NRFA 2IOIA 5TDNB 3VXUA 3AAZB 3HAEG 4CN6A 4ODVL 4AEHL 3HN5A 5MI0B 1ODUA 4EUPG 5IQ9A 3IXAB 4XMLL 3P3YA 3O4LA 5I8KH 5TDOA 4E9TA 3TBWB 3O3AB 2ZUWA 3KL0A 3VFRA 4Y5VB 4HA1A 4YDKH 3W11C 1SQMA 5CJOL 4AWJC 5BRPA 1OF2B 4LPTA 5JPNC 3S6CA 4XGZA 4L1TA 3EBGA 4FERA 1QUNA 4WHTB 4ZYKA 1LVEA 3T8XB 2KT6A 2GJJA 2WGNB 2C26A 4BCZA 3PWPA 5DYOB 4LDEB 5CJ5A 1AGFB 5E08L 2H4EA 1TF4A 2Q7YA 1GYVA 1L6XA 1R3IL 2CUAA 4BXSV 3IN2A 5CFAA 2WBWB 4BUGA 3TO4B 4KQ3H 1OHQA 1YDPA 4YFLI 1KCLA 3QZOA 2OR9L 3FCBA 4FMVA 5E8EA 1YC8A 3LQAL 4LO9A 5ENWB 3PNWB 5CLZA 5FS5A 4YR6A 5IV2B 2EIKB 2DYPD 5DVOA 2XQYG 3V9CA 4KKNA 2DM3A 5GIRB 1T0MA 3E6HA 3H1ZA 2JF1A 1OPGL 3HG2A 4K7PY 3HUJA 4WUUA 4RIRB 3FB7B 4NWTH 2IXQB 3H55A 5AW5B 4N28A 1PPIA 2D31A 5I9QB 4F7MB 2I9TB 1U3HC 3DVFA 1NBYA 4ZUSB 3D3VA 1H6UA 3FRUA 4KI5F 3U4BH 3TVMB 4FLSA 3PQYB 1NM4A 3JV4A 3KH4A 1ZGLB 5ITFA 4JG0L 3B37A 1X5MA 4MQ7B 2R9HD 2WTRB 2G5BB 2Z1PA 1TIUA 2GCYA 1GVIA 1W6LA 2X4SB 5EB9A 1XT5A 2ADIA 2DEXX 3FT2B 1QEWA 3KVDD 3ZDZB 4OH2A 3EHBD 5D2NE 3MLWL 3DUUB 5T1DL 1MREL 3PP4L 5F3HA 5IVNA 2F5AL 3FQUB 4D0BA 1J9SA 1IAOB 5K59E 2XN9D 2CALA 3EGXA 3VFVA 2IBGA 4YSQA 3QJTB 5MEQB 5EUOE 3A47A 3FTGA 4TMPA 4TQEL 2QTVA 5ITFB 4LCVA 2ADGA 1NMAL 3FU9A 3LSOB 2EKJA 1J9CT 3T3PF 2OULB 1OAZL 4G2AA 5BZWB 1NSNL 5C08E 4PIBA 1KXQA 5E6YA 4NKOA 1UOKA 4QY8B 3QYNA 1P69B 3UAFA 4UOQA 1GGBH 1MEXL 1ZT7B 4QRSA 4XWGL 4NBXB 1PJ9A 4S10A 4XODA 5D72H 1WEJL 3WE6A 5HHME 4XAKE 3DX1A 2E47A 5GSRB 2GJRA 3HB3C 4HKJB 3MAWA 4R3SB 1UJTA 3W5MA 2WP3T 3FONB 1BOGB 3OKMB 3PGDA 4HSQA 4Y7OC 1LE9A 4AE1A 3Q01A 3BP7A 5JIHA 4R96B 2GBTA 1E7UA 3QYCA 5SWZE 2CNYA 4EPSA 2WXHA 3GHBH 4V33A 5EO0B 4U6VH 1NH6A 1I4FA 1XAKA 4JFZL 4U6YB 4X7SL 5HDBB 5K9OA 1QFWI 4XPGL 2DV6A 4LHUB 4UAOC 5DUBB 3I9GL 2Y7MA 1ZV5A 1P5UB 2CZNA 3EOBB 2EC9U 4KK6C 2WV3A 4GSDL 1FLRH 1EEZA 3CDGA 1AQ8A 1C5DA 2EINB 1SXNA 5L6YL 3PJSA 4ABWA 4YDVA 4IJ3B 5E95B 4YWGH 3GNML 3ZMRA 1HXKA 2H6UA 2X6BA 4U6VL 1N6UA 2BOLA 5CHNA 5DEJA 4JDZA 4YR6B 3OF6A 5ENWA 3H6AA 4DP8X 2R7EA 2XI9A 2XQBH 4UYPA 5F7EH 4HUKB 1RZIA 5BVPH 4ADGA 4GEIA 1QEWB 2KERA 1G7LA 1QBML 3N55A 2ICCA 3TCTA 4BQBA 3MRJB 1ZLVH 1FNGA 2L7QA 2NXZB 1G0DA 3OVUB 4HD9A 4MA1B 5EOTB 1YG9A 2VR9A 2WINA 1KPUB 1ZS2A 1C08B 1J1XL 1SJHB 3R7RA 2J55A 4D7BA 3GKWH 5LHDA 3MXWH 4EQ2A 2E8YA 5JW4N 2F7RA 5E6IA 2FH6A 2LE9A 2BP0A 4LK4A 5F7KC 1I85C 2A9CA 1X6LA 2FHBA 2IO5A 1GZQB 3LKQB 3LNGA 1N6VA 5BVPL 4EZKA 2LTQB 2WQXA 5CN1A 1WAAE 4L3FA 1BWWA 2FL5A 3AS2A 5EUOF 5CCKH 3WN5C 2BRRL 1UB6B 1VAHA 3BVUA 4GW1A 1ITBB 1YSOA 2V3EA 5D71H 3SY6A 3SCMC 4FQQB 3VWJC 1E5ZA 2GSIB 3PLYA 4M8RA 4P2OD 3VRLE 1FPTL 3HC4L 3LNHA 3BFQG 1T0NB 2WB7A 3K1DA 4MCYB 3SGJA 2JI1A 3AGVA 4G1MA 1CE1L 5INDA 5LGYA 3RRQA 4GRWE 3RWDA 4EN3D 1K5NB 3TO2B 2P5WA 4KK5C 4UWQB 2EXYC 3PIQA 5AL0A 2P8MB 5CCKL 1HWHB 3LRSB 4JREB 3S36L 3OMIB 3BO8A 4FNUA 5EUOA 5AB2A 1M1SA 1AYOA 4DN3L 2AHIA 2OJEB 3K5SA 1U91B 5DFTA 4NPJA 4A66A 1VPOL 3BLBA 5KUMA 4AIOA 2K8MA 4WW1B 4P23C 4XBMA 3ZRSA 5IFJA 3WKNA 3CX2A 4LPUA 1A6VL 1CU4L 2YLHA 3T3ME 3E7JA 1YQVH 2WXKA 1BEYH 1F41A 2NNCA 4NDMB 5FYKU 4XWOD 2VB5A 1TVBB 2P1YA 1GKEA 2VITB 2PWHA 2CR0A 3LB6C 4J4PC 3WEAA 5B7MA 2OMYB 1A3RL 4G6JL 2JXMA 1QBAA 3A4AA 3W0WA 4FE9A 2GITB 4URTB 3L3KB 5IY5B 3BDXA 3HNSL 5PAZA 4X5PA 1NDTA 5AVRB 1TSRA 2WXLA 1I3UA 3ES6B 3X11B 5DR5H 4IKNA 2I26N 1ADQA 1U4EA 1U8MB 3N41B 3WNPA 1P9MC 1PLAA 2PW1A 3WTUA 4JY4A 1O9WA 1PZBA 5E6IC 3BZEB 5FKPB 1AR1B 1F4XL 1WWCA 4OLYL 3MBEC 5KOMC 2YKLH 4NKDB 4P49A 1M56B 2QQKL 4AM0A 4LSRH 5JW4M 1G7LB 3MBXL 4Q2ZB 3ZHNA 4PN6A 2N7AA 2WLIB 2XA8H 4YSEA 3JWDL 4J6RH 3TPKA 1FG9C 3BX7C 2DIBA 3HG1E 5AW4B 3TVMC 2FRGP 3I9IA 2Z31B 3FUDA 1ZEAH 2JCCE 1HSAB 4M1CD 4PTTA 1OCWH 1T89A 4LLDA 3BUPA 5DJCB 5T1DH 3CFTA 3KPLA 4A2FA 3KZ8A 3MOBH 5IJBC 4PVNA 1MW1A 1OPOA 1BF8A 3TA3A 4QF1B 3MGOA 1WS7A 1DE4B 4X4YA 5I75B 4RFNB 3QUZA 4Y7MA 4Y8AA 2NXZC 4PJCA 3FUNA 3EH1A 4JJ5A 1D9KB 2VT0A 2JKTM 2Z34A 4KU1A 4NI3A 3A24A 1QVOB 4XCYA 4BDVB 3LNDA 3H9SE 3I3EA 3PWJB 4IBWA 1ID2A 1T0NA 3GPSA 2CO7B 3NEXA 2OSWA 5INDB 1EFXB 3CN2A 4BRJA 2XRAL 1U8HA 1WGOA 5ANHA 4P2QE 2A2QT 3QZWG 4J1UB 4PRPA 5KVDH 1K4CA 4M8QB 4ZAKD 3CXDH 5BJTB 2WVVA 2VQUA 1Y6MR 3OPZH 1BQKA 3MLXL 1H0DA 5HHOE 2DJ4A 5GS1C 2FJFB 4EJ1C 1WAAA 3PCYA 3X14A 4GAFB 3SD5A 4KZDH 3K91A 3CFJA 4OV6F 4GB9A 4MCYA 4Q9QH 1MHPL 1R9FA 4DW2L 3FJTA 3F85A 4LEOA 5EBGA 3G9VA 3PPSA 4G9DB 3VD4A 4KI5D 3S36X 3CQQA 2JIXD 4LPYA 4WHDA 4F8TA 4BK5A 4XT1C 3G6JB 4ZMXA 1MNUH 2OMNA 4FLOA 3DX4A 5FX3A 1JXFA 3PWPD 5M94B 2PCPB 5AZEL 3WTXA 2IANA 1SZNA 1G6RH 1BCIA 2J2ZA 3EDDA 2PTTA 3VI4A 2P49B 4QJ5B 2N56A 4QTIL 4TS6A 3MLSL 3LQZB 2J6EH 3HG1B 2JELL 1ECZA 3GNMH 2DQTL 3OD3A 1NGXA 2BP3A 1DJYA 3VFGH 3U4KA 2ERJC 3ELQA 4N5ED 2VITA 5C0DA 3P73A 5DUPH 3QGVA 3Q6GL 3RWFB 2Y69B 1Q1PA 3C08L 3COOA 1RUQH 5EWIH 1Q90A 1TZIB 5IBTH 1FNAA 2VERN 3ZN6A 5LCVH 5DRXA 2A1WH 3OGCA 4C47A 2O4EA 2C3VB 3ES6A 3WG7B 3DUSB 3JV6B 4H0HB 3ARDD 4P9HC 3FO0L 3VNZA 3S88L 4QMEA 5ALBH 5E70A 2VCOA 4MRCA 2JELH 1JZGA 2KZWA 1JZ7A 1RJYB 2ZWLT 3ETSA 1ML0A 4BE6A 2NT0A 1JJUA 3FO1A 4EKJA 2HKFL 1ACCA 4O2EB 4GXUM 4ES9A 1ZVYA 2DW5A 1A6UL 1OF2A 2JJTC 3FU0A 5CD3A 5AEAA 3UCRA 1N2RB 4MMZA 1MW0A 5FFGA 1WFNA 1VACB 1Q9KB 1ORSB 5LCVL 1KBWA 5J12C 4UV4L 5BQ7B 1JK8B 1LILA 4LZKA 5I2IA 2BNQA 1B6UA 3AB0B 5L4FA 2DMGA 5DYOA 2GTWB 1T1WB 3LYRA 2J1ZA 3ZJAA 5EO1A 2DQEH 1AY1H 3BEVA 4PR5A 5EO9B 4DJMA 3MLVH 4KQ4H 5L88H 4S1QH 1FPTH 4CNIB 4GLRH 3FOMB 2OMZB 3TVMA 1SMDA 3NIDF 3OLDA 4PYGA 3K46A 2RHEA 3VX1A 5J56B 4XPHL 4HBCH 1F56A 4HOWA 5ID1A 1G84A 1NAMA 4K3EL 2WZ6A 3B7SA 3UTPE 2FQGA 4G42A 1FNHA 1ORSA 4TLUA 1NPUA 3WS3A 4Y4FA 2JFCA 2P28B 3PFUA 2AI0L 4UDUB 1E4XH 3K80A 3RWGB 2F1EA 3ZHKA 1HK6A 2IPUG 2GJ6B 1XH0A 4IIQC 3WS6A 3VXUD 1N4XH 1HL4A 3ETTA 4D3CL 4GBXC 4AMXA 2C4XA 3SDXE 4G7SB 1PAZA 3IDGA 1R5WA 1DVTA 4PW4A 3N40F 3NESA 1NUNB 1BM3H 3AAZA 4CN1A 4U3SB 2A74A 4OKDA 4H2AA 3VSQA 5ID1B 2CXKA 4QRRA 1NGQL 1XZWA 5I1EL 5BQDA 3ARFA 5IOPA 1KYDA 5C9JB 3ULUE 4PGBA 4V1DD 3B2UC 4U31A 3K6SA 2BW5A 4IEFB 2BCKB 3MLUH 4JS7A 4G7YH 4PREB 3FO9B 3P73B 2V3DA 1OSPL 3QIBD 3I75B 4OUUB 2Z35B 5ICXA 3RTQC 1MIML 2X4PB 4JFOB 3B56A 3UAJD 4NQVB 1RERA 3O8XD 4YXHH 2KZBA 2NT1A 3WFBH 1F11B 1HH6B 2NNAB 3C08H 3H4FA 3MROB 5B39B 4HJGB 3N85H 1HXMB 1NPNA 5C08B 1FV1A 2TSBA 3L5JA 5B1CA 2QZQA 3IMBA 3DURA 2HZHA 1E3FA 4H5SA 3TO4A 1YEIH 2VLJB 3WNOA 4I85A 4DNLA 1NDMB 1DANU 3OAYK 1ZPLA 5IOPB 5BZWA 5BV7L 2V5SA 2BNRD 3APDA 1OCZB 1Y6KR 5GGVL 4ELDA 3X3GH 1S7SB 4IDJH 4LSVL 1I53A 3E0GA 4YXHL 3C5ZA 4LLVB 3I6SA 5CEZL 2AJSL 4AJWA 3FC8A 1XF2B 1OD9A 4MNGE 1YEFH 4L29B 2VWEC 4GG6F 3GMQB 3LVEA 4LOEA 4HFUL 4X9FA 1JI2A 3VA6A 4NO0A 3QSKB 1WTGT 4BGLA 1X5XA 1HNGA 3KBEA 1WFIA 3P9LA 3VWKA 2J4WL 2R51A 1EJ6A 2YSSB 4WSJA 1DJZA 1TO4A 1QRNB 1HH9B 4GBXA 3BYYA 3O4LB 2FLRT 2QADD 3PWUB 3BPCB 4N9GB 3KPRE 5HHXH 1AQMA 3B1TA 1NMAH 2V17H 4KVCL 3CTTA 1U41A 1DQQB 3NFPB 4KDWA 4KKBC 5EU7C 5TPWH 1YNLL 5TTRA 2WNKA 3ARFC 1C7SA 4XC3H 5BPPA 1XF2A 2ED7A 5FUOH 4BJLA 1A1MB 4IM8A 1D5IL 3TTSA 4ZTOH 3MLZL 3RJQB 2VJ8A 1HOCB 1E4XL 2A5UA 4YPGB 1NCWH 1SJHA 1RHFA 3L4TA 3OJVC 1ZGLP 3JVGC 5C6PB 1R5WB 5KW9L 2J8UA 1Q94A 2SEBB 4Y19E 5DC4B 3PFQA 2DB8A 2YAHA 4YXKH 3SDYH 4X6CA 1MCLA 5IHWA 1U8JB 4J2QA 5E8DL 2EYRB 1KACB 4Z18A 3ROOA 2HLAA 3BDBA 2G2PA 4Y4FB 2UZYA 1ND0A 1JUFB 1OSYA 3RGVA 5TGBB 1CXHA 4ZUUB 2CHDA 3SIKA 3BIBX 1E9OA 1DVUA 3DIFA 2B59B 4YSUA 1DBML 4G6MH 1JZEA 1ZV9A 4DUXA 1HILB 3O3BA 5CD5C 4MD0B 4E68A 4YDIH 5DJ6B 1S9WB 4A68A 4WEUD 4PJ7E 2Y36L 3KXFD 2DQUL 5INCA 1T2QL 3DPBB 4PCYA 1T22B 4M1DL 4XZUB 3RA7H 4OCRL 4NNPH 1OAUL 4UT9H 5TE7H 2DJSA 1P2CA 3WHXB 1TQCB 4NI6A 1EAOA 2WKOF 2JJUA 1JF6A 4EBQL 2Y5TB 4AG4L 1NC4D 4K7PX 2ZG1A 1AE6H 5ALBL 3ZVVA 4NENA 1I3GL 4JRXD 4ZS6D 4FABH 4L1DA 1T5WA 2VLMD 1L0QA 3DRQA 2A83B 3OPUA 3W0WE 5IJDC 1E50A 5I82A 2DWDB 2BERA 3O3EB 2AK4E 5T1MB 4EIBA 1P5UA 1JZ4A 1DDTA 1W8NA 2RACA 2H7WA 3K2UH 3OKNA 4Q14A 4FQIL 1EXUB 3A22A 4ZOBA 4NUMA 5TQ2H 2N0KA 2YEZA 4HSAC 1CDHA 2ENQA 3IF1A 4BINA 5BUGA 3F7YB 2D0FA 1KCUL 4CJ0A 1O7DE 1IKFL 3INUH 4HMDA 2J1XA 1RK1B 4WIQA 5B8CC 2BOCA 2ZOUA 5F7DA 3QVAA 2JJWA 5LWYL 1MDAA 1NCHA 3HRPA 2H3NB 1C5BL 4H13C 4XAKD 4Y9CA 5C0RL 2ICEB 3IFNH 2RJMA 4YIQB 4Y16D 3QK0A 5CGYC 4Q7DA 3EOYG 2BSSA 1XF3A 3VGBA 1XCWA 5TQ2L 1A9BA 2AEOA 4A63A 3BAEH 4HW6A 4WI6A 4Z78B 1CIDA 3CLEH 1X5YA 2EC8A 3SZ6A 2XKSA 4Q58C 3GTNA 5ANMA 1XSKA 3JT2A 1RAMA 1KEGH 4JNXA 3EFFA 1P7QD 2BVOB 2CLZA 2UXGA 5KANI 3KPPB 5KSAD 3WHE1 4GQRA 3V9EA 1RURH 3PU7A 3S5LG 5J1TC 4JGNA 1IQDB 2ZNWA 2R9HC 3LKOA 4N2FA 2G5BA 1VERA 1ZLSL 1KJMA 1M7UA 2LLLA 4JHWL 2ZP8A 3G6JF 2OMUB 1MI5E 1L9NA 2YD0A 2PR9A 3T6QC 3QI9C 4HHGA 3RY6C 2G9HB 4G8GD 2YOCA 3SCMB 1ZANH 2WBKA 1OGAD 1AKJA 1BAFH 1OGSA 1PAMA 1D7BA 2DQGL 4U4BA 2ZKWA 2Z31A 4PGZA 3WKMH 1EANA 1EEQA 3UFIA 4B5EA 3L3GA 2W91A 4H0GA 3HE6A 1ZLUK 4HUUB 4NNYB 3ZE2B 2WOYA 3GB7B 4PJ5E 5G4MA 3MA9L 5CHNB 3ECBA 3UDWA 1GCFA 4OBRA 5GRXG 1AGEB 5KVFH 3FSZA 4XVJL 1CGVA 4NCC2 3WCYA 1T22A 4X6BB 4LHUD 2G2RB 2WXGA 4C54A 2DS4A 4FTVD 3S2AA 3AY4A 3WXVL 4P23B 4L8BB 3WKML 2EYTB 3F5WB 2AKRA 4LCUA 2B2XL 1X5HA 5T5FL 3S7GA 1C7TA 1N5AA 4CMMA 4EI5D 4GUQA 2ICWA 4HZ1A 4X7TB 1SNRA 1JG9A 1B3JA 1ZY9A 3O2WH 4GRMB 4RAUA 1R5IA 4BA8A 2A4ZA 3SGEI 4JM2B 1M9WA 2D2OA 4L1BA 4JFDB 5IJVA 3KPSD 1PS3A 4TVUA 4LSVH 4P3CH 5E1AB 4PS8A 4S11A 3CN4A 1YNTF 1X4XA 5AWNL 3VDBA 1HHGA 4WY7H 4E5XA 4F9LC 1NGZB 5SWSA 2Z8SA 2DYRB 2J44A 3HKZA 2E9WA 4AQAB 2QHLA 2C1PB 1L3NA 2EEFA 4MQSB 2HG5A 3BKJL 2WXIA 3IJEA 2WZPD 4FQQA 3QIWC 4AKOA 5KWYC 4LT7A 4ZX4A 1WFJA 3CZFA 2N01B 2Y7QA 4ZJ9A 2ZUVA 3KL5A 1E4JA 4Z7AA 3AS1A 3LH2L 5K93A 2BSRA 4AUYA 4ORGA 4KI1A 1HQRB 1S3KL 2WIIA 5EZLA 4DT2A 2G3MA 2AK4A 2QSCL 3GRWA 4PJXE 4BZYA 4PRIB 3PHQB 1YPZF 2XWEA 2BPBA 2BOCB 3QUZD 3RWCB 2BDNH 2NZ9C 4NQDD 4AL8C 3LS4H 3OSKA 3BWSA 1I7TB 3LRMA 1VA9A 4XNUH 1HTYA 1SDAB 3DVGA 1W0VB 3LMJH 2AQPA 1PQZA 2VDMB 4N3UA 4UAHA 3MZGB 3US0A 5I75C 3MGTB 4OZHB 1TVBA 2B5IC 4KHTH 2L04A 4IK7A 4S0TD 2NUTB 3DX9A 2ZXQA 4QUOA 4TLSA 4WCYH 4EDXB 2C9VA 4J5VA 3EOAB 3VACA 2MQCA 3JV6A 4RMTA 1D5RA 3IDMA 5ICYB 3B2PA 1MAML 3FQWA 4I0KA 4NO2B 4PJCE 3OHXA 3N42B 4XXWA 4ZFFA 4JMNA 4UT6A 4FQ2H 3I9PA 4XNXH 4I4WB 4N2MA 4YDIL 1IGMH 5HHNB 1O6SB 1A4KB 2RQEA 3IRCA 2EUWA 4HIXH 1N64L 3SCMD 5FUZH 4QRUA 1J5HA 4Q2ZA 4M6OL 4P23A 2ADFL 2V6HA 4XXDB 5DEFB 3T2LA 5BQ7A 3L16A 2FLMA 4B41A 3EFDH 4PJIA 4UM9B 2H0EA 1RZKL 3DV6A 2HTKC 5DZPA 2JCWA 2IOOA 4G72B 4X50A 1WYJA 5CKAA 5TE4L 5BRZE 4QXGL 1MFEL 3IDUA 2HX7A 2OW6A 3ARGA 2DF3A 3C6LD 1HEZB 4TF4A 1TLKA 4P5TB 3CBJB 5KBPA 2J12B 1IT9L 2H0PA 2NNXA 2Z91A 4FQCL 4XCCH 5FYKL 1BXXA 1ORQA 5EUOB 5F7HA 3G3LA 2A74B 4RRPA 5B7EA 3G5XA 2F5BL 2KH2B 4JL1A 2OZNA 3CC1A 5J0BA 2FO1A 3O3DA 4XCEA 4OGXL 4O2FA 4ZPTA 2X5PA 1LNUB 2ZYHA 4PJHB 5EIVA 3WO4C 2HN7B 4ZFOB 1YYML 1Z32X 4XWOC 3GMLB 4UINL 5TK2A 5HYJA 3NZSA 2E6PA 1XEUA 3UGEA 2Y7QB 4J4PD 5C0DB 4Z7UA 3FQXB 1AD9B 1TQWA 4K5LA 1KN4H 1CICC 3NSDA 3OR6B 2ZSVB 4PRPB 3ILQC 2V7HB 2NNAA 5CBEB 3WLBA 3THMH 1JGLH 3TONA 1B2WH 3KBFA 3T0EA 5BMFH 1NGZA 5DMIL 3RJOA 3RP1A 2BP5M 4QHUB 3MX0A 5CSBA 1RJYA 4JFTA 2CKNA 1YPZE 1I8IA 4ICWA 4XPAL 3BZEA 4PJHA 4XP6H 3T4AC 5I76B 3W38A 3TBTA 1ODAA 4NQED 4M3KB 1P7QB 2HCZX 1H15B 3G5ZA 3HIZA 4TN9A 4AMKH 1P84K 1UKQA 4LQ1A 4BUHA 1WFOA 4MZ3A 3WIIL 4JZNB 1DO6A 1PU0A 1YUKB 1AQKL 2QQNH 2B3RA 2LU4A 2D0GA 2O5NA 3TVMD 3T6WA 3MOQA 2X2IA 2CQVA 1NEZB 5HGAB 4NUPA 5EO9A 4BZ2H 3JWOC 2GTZB 3DXAE 1WA0X 3GBDA 3BFWA 5TH2A 3VUAA 2E7CA 5IMOB 2Z93A 1QRKA 1JPSL 2B4CH 4WENB 2G4GA 4MJ6B 4ANVA 3RLSA 1UB5A 4A7UA 1NGQH 4MJIB 4QTHA 3E8VA 4G7RB 4X0NA 4BZ2A 1IX2A 1S7SA 4HF5H 2VC2H 4FFVD 1UA6L 2YAOA 4WI8A 1W0YT 1RFDH 4GY4A 3U0PB 1CB4A 3QHZL 1QVOA 4XCYB 4BWTA 4QAWA 3GMQA 1I1AB 3BWAA 3HLAB 4ZOAA 1UA3A 3O4OC 3FFOA 1UCBL 1NC2A 4AQ1B 2X41A 2MJWA 1XR8B 2HMID 2I69A 4J3OG 3ULVH 1JF1A 1KTDB 5JIIA 1MVUB 3M1BA 3SDAD 3SYPA 3VD5A 4F8OA 1E9Q