1OP4A

Solution structure of neural cadherin prodomain
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
136
structure length
136
Chain Sequence
EASGEIALCKTGFPEDVYSAVLPKDVHEGQPLLNVKFSNCNRKRKVQYESSEPADFKVDEDGTVYAVRSFPLTAEQAKFLIYAQDKETQEKWQVAVNLSREPTLTEEPMKEPHEIEEIVFPRQLAKHSGALQRQKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Neural-cadherin
publication title Structure of the Neural (N-) Cadherin Prodomain Reveals a Cadherin Extracellular Domain-like Fold without Adhesive Characteristics
pubmed doi rcsb
source organism Mus musculus
total genus 9
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2003-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08758 Cadherin_pro Cadherin prodomain like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 1op4A01
4ZMPA 2YSTA 5KJ4A 4ZMOA 4ZMVA 4ZI8A 2X2UA 4NUMA 1WYJA 3Q2NA 4ZMYA 2OMWB 1NCIA 4NQQA 4AXWB 4AQAB 4ZMTA 1O6SB 1SUHA 2WD0A 3K6IA 2WBXA 3LNEA 2A4CA 1NCJA 3Q2LA 3PPEA 3LNIA 1ZVNA 4XXWA 3LNFA 3UBFA 2OMVB 3Q2WA 4AQEB 3FF7A 2YQGA 2V37A 3MVSA 4AQ8A 4ZMLA 4ZMNA 4APXB 2O72A 3LNHA 1OP4A 2EE0A 4AK1A 5CO1A 3LNDA 2QVFB 2OMTB 5CZRA 4NUQA 4XXWC 5JYLA 3K5SA 1EDHA 2OMZB 4ZMZA 4ZMXA 1NCGA 2WHVA 4AQ8C 4AQAA 1ZXKA 3K6FA 1Q1PA 2OMUB 1NCHA 2OMXB 3K6DA 1FF5A 3QRBA 3UBHA 4AQEA 3UBGA 2A4EA 5DZVA 3FF8A 2OMYB 5JYMA 2WCPA 2QVIA 4QD2E 4OY9A 4ZMQA 4APXA 4AXWA 4ZTEA 1WUZA 1L3WA 4ZMWA 3LNGA 4NUPA 3K5RA 3Q2VA 4ZT1A
chains in the Genus database with same CATH superfamily
2VSKB 2XY2A 3BWSA 3ULSA 1M57B 4LP5A 1AIZA 1ZLUH 1I1AD 4QEGA 3S88L 2NY0B 4P2OB 4U1MB 3ZMEA 3ASOB 2CIKA 5IUCA 4XXCC 4QCIB 4YBHA 1IO4C 2BSBA 1UWGL 2GITB 3QRGH 3UG5A 1L7IL 1RJZB 2B5IC 1I8AA 1KENL 5I75C 5EORH 5IBTL 5EU3B 4NP4L 4F92B 5CGYC 4HIEA 3MLXH 4HC1L 2WXQA 3RHWK 1KGXA 4E0RA 4H20H 5IKCA 4MJ2A 4GT7A 4X9BA 5BS0E 7FABH 4NB7A 2OZ4L 3QZPA 5ELIA 2CD0A 4UDTA 5AKSA 4DJMA 4Q6IB 5KJRL 3NH7L 5MERA 1I85C 3TV8A 4U6TA 5KYWA 2ODIA 3SGJA 2I69A 1MNNA 5FW7A 1MFUA 4Q2ZA 3N42B 4M8VA 3B2PA 1CD8A 1IB5A 5DJAB 1WBZB 3SSGA 2OTUB 4YSOA 3VD7A 3EHBD 4GW5A 4N8VG 5DK0B 3QHFH 1NMBH 1EJOL 1DVFC 1P9MC 4JKLA 3G5VB 4N8PA 4CC0A 4QRSA 4GG8A 5KSAB 4IRJA 4MNQE 1MNUH 3ILEA 3LZQA 2AXHA 4YFLF 2H2PD 4HEME 1F56A 4PGZA 1AO7E 2GG1A 3A22A 2GFBA 3V0WL 3Q8EA 4PJ5D 1F4XH 1AJ7H 3WN5C 1HSBA 3M86A 4QOKA 5KSUA 5A6MA 2XSKA 2F5BL 2IWFA 2YN3A 2WCGA 5LJYH 3QAZB 2ICWB 2J6EH 3C5ZD 4HWBL 1I7TA 1J05B 2DD8L 3RX9A 2R7EA 4OQTA 3REWB 3VXRB 4X7SL 3HRPA 1AGDB 5TJWK 2APXA 1QOKA 2BZDA 1A7BA 4Z7UF 3E2HC 2MCMA 5DUMH 4NSKB 4AOFA 4DGUA 5KTEH 1VGEH 5GSVA 3LQAL 5KVGE 2NR6C 2MTAA 3EYVA 4XPHH 4IJTA 4NHCL 1CT8B 3T0BA 3IJ8A 5F8RC 5DHYB 4X0NA 4XNUH 5B1BB 4EPSA 1V54B 1ZANH 1FL5B 1NC2B 4ABQA 2OLDA 3WKML 2OMWA 5TQ2L 5KW9H 3DO4A 4NUJA 3DV4A 3CSTA 2LLGA 3QZOA 3SYPA 1EXUA 4GMSL 2VN7A 5KZCD 3FQWB 4GKNA 2DMBA 5ERWA 1T7ZA 2P44B 3DETC 5E8EA 1UZ8B 5C0BE 3SOBL 1E4KC 3DOIA 3RVTD 4MJ5B 2NRDA 1EZUA 1A1NA 4FNLH 2ZONA 4MJIA 3QUHA 4KKRA 1I4FB 4DIXA 4G59C 4F57L 4F7PA 3CVHL 5F7DA 1IM9B 2WKGA 3GO1L 2VM9A 3RFZA 2EIZA 2OR8A 2KDGA 5LXGH 3VRIA 3ZKMC 5HYJE 1JWSA 2RA1A 4UTAA 3PWVB 4NUGH 5E08L 4L9LC 1DJSA 3L5WB 3WEMA 3NEEA 3QJHA 4HJ1A 2EYSB 3NPSC 4X2UA 1BX2A 1I1AC 2YKLH 3D85D 1RFDH 4QHMA 1O0VA 1R5VA 2XX0A 4ZAKA 2J25A 1EAJA 3OHMB 5E9DE 2V7NA 3UBXG 5BZWB 3SBWC 3MLRL 3DUUA 4UQDA 1R46A 1E7UA 3COOA 4P59H 4P2RE 1MWAL 2D7PA 4UWQB 2XTLA 5AOIA 1RZ7H 2PYFB 4HXAL 5DVKA 3WTVA 3D18B 4OT1H 5I74B 4HOZA 3KYMB 3VACA 3KXFE 5F1NB 3MLZH 2VKXA 3MQIA 4F8PA 3TA3B 1T5KA 4JM2A 1IBGH 4FFZH 2XVBA 2VABB 5CO1A 4FQ2H 5C07A 3CZGA 2W60A 5C0IB 3T2LA 1NFIB 2K7PA 1JFQH 2HN7A 1JK8B 3IDMA 3TYFA 2YFNA 3LRMA 3ZZSA 4EN3D 4M5YL 3EHBC 2CSPA 5I17B 3H9SE 5A16B 3N41B 3PGDB 3OMIB 2ITDB 4S2SA 5FECA 2DS4A 4FQCL 3K72B 1SN2A 1TIUA 1U8LA 4XNYL 5E5UB 4HUVB 2DQCL 3MLYL 1LE5A 2H2PC 2JJSC 3DX6A 2B2XL 1I7ZA 1WEJH 3BIKB 4WW1B 2FH6A 3BRFA 5AYQA 5I8CA 1V3KA 5TGBA 2Y2WA 2AJXH 3MDJA 4ZOAA 4DEWA 5KOMC 1UFGA 2Q86A 3OKOA 1F13A 5FA4A 3KYNB 1GY1A 4MYWB 3BGFB 4JPSA 3VD4A 1V7MH 3C5ZC 1J5OL 1QSFA 1G1CA 1E30A 3IAQA 1MLCA 2DV6A 5JIMA 4K7PX 4MKTA 3WJJA 4K9EC 1NBVL 1RQ5A 3EO1A 3MUJA 2HT3D 1MW0A 3LN5A 2VMJA 3GJFA 1WP6A 1TO5A 3NDZE 5D7IB 1N19A 5ACZB 1A14L 3AT8A 1KN4H 2QGDA 3R0MA 3B56A 4WWOA 1FFNA 4TM9A 5CCKL 3GTTA 4YFEA 4GG6A 1UADC 5EO0B 4HF5L 3ZHLA 3VXMD 4G3YL 5KJ7E 4PJ8A 3D4YA 3WTYA 4IJ3C 2YSTA 5I6MA 4J3WA 3S37L 4ZO6A 4UM9A 5BOZG 1JVOA 3QR0A 3ZO0A 2XA8H 3NGBB 4X4KA 1SHSA 1DUYB 2XZCH 3GNMH 2BDNH 1CLCA 1D5RA 2NSMA 1BLNA 3P11L 1T1WA 3P2DA 1IGML 4FS0A 4IK7A 4LL1A 2BVYA 5AVZB 2VL4A 2ORBH 4IKKA 4PV9B 1NFDA 4QRRB 2GI7A 1ZJBA 2YXFA 3OKLA 4WFGD 3RVTC 2VLLA 2AC0A 5BUAA 1MCJA 1EHLH 1G4MA 5ICYB 3B3BA 4HK3N 5T1MB 1JDAA 1NDMB 4PRPB 3PIQB 5F7EH 3VMOA 1ACZA 3THMH 4G43A 1TVHA 2P8LA 4DO4A 5FYJH 4JRFA 4YHPA 3KPSA 1S9XA 1JVLA 5J5EA 4UDUA 5KS9E 1G6RA 3PU7A 3FRUB 2DKSA 1HINL 4RDQG 5A7BA 4C54A 5ITBH 1XF3A 1E2ZA 1WZ1L 2X9ZA 4AK2A 8FABA 1M2VB 5IQMA 5KN5B 2EVFA 4U6YA 3NCJL 2HJKB 3EOTH 4HIHA 2WSKA 4Q4IA 5ESQA 2DQEH 4ABWA 1PJ9A 3FTVA 2A7BA 2HRPL 5FWRA 4ODHH 3UG4A 4AKQA 2O61B 3MRBA 1SOSA 1UWYA 2BH0A 3L3OA 1NLDL 2NPLX 4MA3A 4TQHA 5DUPL 5T1JA 2EECA 2PN5A 4PAZA 4JHBA 5AFAA 4NM4L 4XP6L 4GYBA 1U58B 2YAQA 3GMPA 4X9IA 2IXQA 4CILA 1ESOA 2F8VA 1ETZB 2QVKA 5IG7A 3BEVB 3AWEA 5A2BA 4Q6YA 1ASOA 3G08B 1FC1A 3ULVL 1HHIB 5JHLL 3EO0B 5C8JB 3JTSB 1ZIBA 2AEIT 1T1XA 4G1EB 1E4JA 4EN3C 2CPUA 1F02I 3WY2A 3SKNA 5I1LB 1IC1A 4N1HB 2P7TA 3GZKA 1J86A 3QDGB 1CLYL 1KB5H 1UVQA 1XFPA 1YNLH 1R3IH 4S1QH 4OLXH 5DJ0B 5D8JH 1HI6B 4KHXH 4U2YA 1DLFH 1QAWA 2PO6A 4LSPH 5DJ2A 4R97C 5EC1A 3K8KA 1KTCA 1E40A 5L2KB 2NT1A 3F7LA 1S9VB 1CDCA 2VN5A 2EDBA 2R29A 3E1F1 1XSOA 3HE7A 5DA0B 3UIYA 3T2QA 3QUXD 4G8AC 3ML9A 4GRLD 4QT5B 1LWHA 3HN5A 1D5MB 3MCG1 3VQLA 1MN4A 1I82A 3X1GA 3KNBA 2VKWA 4YGAB 3INUL 3PWJA 2HB0A 5HGDA 2HT3C 4YL9A 1AR1D 4R6UA 5FYKD 1ZV5A 2P8PB 2VLME 5F1IA 3S2AA 1ZHKB 3BWZA 4Y9EA 4WKXA 1EAPB 4XOEA 4HUUA 2HX7A 1UD3A 4Y4KA 2ATAA 3LZFH 2HPTA 4Y4HB 4OI8A 3ARBA 1BFOA 1ROWA 1ZHBA 5C70A 3F7VA 1TZHB 2H7WA 4FZEH 2ICWI 4GQRA 3MLVH 1JRHI 3TBTA 3RWGA 2FSEA 5KYUB 4YE0A 5F0JB 3WIIL 1SUHA 2CKBA 8PAZA 1JUFB 1KG0B 1OZTG 5FHAL 1E5AA 1PFOA 4O2EB 1YEJL 1CL7I 2EC9U 4MMZC 1AHWA 3KGRA 3ECBA 5B8CC 3ZZ1A 4YHOH 1M9WA 2WLHA 1KDIA 2BNRD 4NERA 2ZKHL 3S88H 1Q9LB 1FIGL 4MCNA 4YDJB 3T4YB 1E5YA 5I8OH 1JV2A 3MNVA 4WZ9A 5DDHB 4QTIL 3CZEA 1XWVA 5I18L 1L7IH 3JV5A 3TCLB 1E3FA 5HP5A 3BP5B 3INOA 1UJ3A 3UJTL 5I0DA 4G7QB 3IMBA 4UIMB 5JOFB 4Y5VB 4JY6A 4HC1H 1ZCRA 3II1A 1LP9B 3VXTB 1ONQA 3EJQA 4KTDH 3X1EA 1M7IA 2VZOA 1HL9A 5INDB 5E5MA 3PHQA 4Z8FL 2YMOA 4NWTL 2FX8L 1IGIL 1N68A 5KJRH 4HQQL 3NH7H 3QHTC 4NWUL 2MSPA 5C0JA 2CJ3A 1NWPA 3CGTA 1NIEA 3UTSD 3MN8A 4PRAA 2XZQL 1IKNA 4OGYH 1AG6A 2AKRA 3TIEB 1RIUL 2FQEA 2G75B 5EUKA 4YS4A 1BVLB 1PIGA 4MNQD 5D7LE 3QRBA 4WFFE 2LTQC 3QFDA 3KPNB 5JR1H 1CU4H 2BNQB 1TUPA 1KLUA 3BHBA 5CMAB 5AKRA 1LJMA 2ADGA 5B1AB 3PWUB 1N5YL 1E90A 3AAZB 4GMTL 5DS1A 4UM8A 3F5WB 4WW2A 4NQSA 3V0WH 5AVTB 1NBZA 1XGUB 4ADIA 1XGRA 3ZYOA 2Y5TA 2H8PB 5I1KL 1JGLL 4NRYA 1IQDA 4JFSA 1WG3A 4PH8A 3STZB 2H4EA 3P0GB 5JW3L 2NW2B 1T7YA 1CF1A 1INDH 1OQXA 4R7VA 3BUTA 3JWOH 4JKNA 1PG7W 1VCAA 4GAJL 1NMCC 4HAGA 3L1FA 5E24E 1FZKA 3F7YA 5I73B 3RYMA 3SY0B 3LQAH 1RHHB 3DNKA 4OJFL 1KLGA 1QRNA 5G4OA 4BJLA 2KQNA 1T04A 4NHCH 5GISL 5C9JA 3SB3A 3HJ0A 5C08E 3LS4L 5E95B 4Q7DA 2PKDA 1C1EH 5GGUB 4JFXA 2A1WH 3QUXC 4GRLC 1CL7L 4GS7C 5DVLA 3IBOA 4AH2A 1EH9A 1BBDL 1PNCA 2MEJB 2X4RA 3I9PA 1AR1C 4LDCA 5AG8A 3MBED 3NSCA 5IVOA 3V4VB 3WNPA 1HOCB 4P2YA 3RVUD 1XXDC 1OPOA 4D9RE 4Z5RA 4GOSA 3C5SB 2HXAA 1SGKA 1NL0L 3IRCA 1RERA 4UU9B 5DEGB 1OAQH 3LCYA 5IW1A 4XNQB 3I6GA 4WEBL 3SPVA 3LPFA 3SOBH 4BQ9A 3F64A 2YUXA 2WAQA 3TF7C 3UJIL 4POUB 1I7UA 2V2TA 4MA7L 2R9HD 4U1JB 3WNMA 1P6WA 3WTXA 2AVFA 5JW5A 4F57H 5BO0D 4PW9A 2G60H 3GO1H 3KDPB 3SHSA 1ZT7A 3SQBA 3CFJA 1PY4A 5E08H 3IKCA 3CDGA 1QMUA 4NNXB 4NS0A 2FB4L 4LNRB 3T2OA 4KKAD 3UEQA 3K74B 5IEHA 2HKFL 3MLWH 4AE0A 2H26A 2CE6A 2OFQA 2C9RA 3L3GB 4P23B 1W8NA 3RIAK 1Z0MA 4FKEA 4JFDB 1NUDA 4HJTA 4ZUVA 4XHQA 3RPIA 1X5XA 2ZX6A 3ARQA 3M46A 5T3XL 3L81A 4PJCA 4Z7QE 1FNGA 3PCYA 3ZRCC 3AGVA 3CBRA 1MWAH 3QCTL 4YNYA 4HKXA 2EO7A 2F58H 4XMKL 1A6ZB 2EH7H 2XQ0A 4FQQB 4ERSL 1MJJB 4C83A 5GGSB 4ODSH 1Z66A 2ZJSL 3KXFD 2MH4A 4U3CA 2QQLH 4Q14A 1HKFA 1YNTA 2CBOA 3ZDYF 4OD1L 1QHQA 2Z31B 3MFGB 1TMCB 3PREA 5KUMA 5IUSA 1IM3D 1MXGA 2Z6FA 3KEHA 3DIFA 4K3DL 1YCSA 4L18A 5H4ZA 4OZGA 2J55A 4ZW7A 1XBDA 4FZ8L 2EABA 4XNYH 1WITA 3L2LA 4X6CB 4AIEA 3BH9A 1QI4A 2ZWNA 5EU4B 2B2XH 3LHAA 5A7EA 3BDYH 4ZUUA 3LZNA 4QUOA 3FONA 4HUNB 5F88B 4YPJA 3L3JA 2NUPB 4BZYA 1Z6JT 5IB2B 3G6DL 3LEXA 1VSCA 2AQ2A 2JB6B 4HKJA 3PNWB 2KS0A 4FYRA 3RX7A 5JDSB 3P9MB 2EIEA 1CIUA 2VN4A 1UCTA 1SDDB 3IJSA 3ROOA 3NCEB 4JFED 3V4PA 3G9VA 1CR9L 2AJ3B 1AXSB 1NBVH 3PQYE 5IR1B 3D69A 1CGVA 3BAJA 3GI9L 4IIQC 4XCNA 5FOBA 2ZUVA 4E5XB 1OCRB 1Z9SA 4H26B 3AY4C 1ZRUA 2O6CA 4NQVB 3H2WA 3T8XA 5ADPL 3DXAD 4MQ7B 5CCKH 1T4KB 2FIKB 4EZMA 2WAHA 1ZVNA 3ELQA 3TURA 1XZ0B 4O51A 3TPKA 3VNZA 1FGVL 4DPAX 3QWRD 1HEJC 1FHGA 3EDEA 1JZHA 3NCWA 1GGIL 3QJVB 4APQA 2DWEB 4DKTA 1BBJA 1W72A 4JRYE 3RVUC 3P11H 4GQ9L 2EC8A 1IGMH 4KGJA 4UQIM 1MI5A 3ECQA 4L9DA 3EDFA 1IEAA 4FQXA 5HGAB 1AH1A 4ORGA 2CPCA 3WNJA 3FT4B 5HHNB 2R9HC 1MJ8L 3IDYB 1MCOL 4WEMB 1YEGH 2CDFB 2QFPA 1NICA 2IBGA 4NRZB 1ZT4A 2VDRB 2YK1H 1PL3A 4PG9B 2UWEA 4KKAC 4YR6B 3DYMA 3VDBA 4PQXA 1AGBA 1GSKA 4LHUB 2YWZA 3HE6A 5HYSB 3VD3A 3V55A 3GLEA 4KHTH 3UGEA 4TTDD 1HINH 3EUUA 4OCLC 3BI9X 3QPXH 1WZ1H 4RAHA 1J7VR 4X9YA 3T4AC 2C9SA 4K73A 4X8CA 3H9ZA 4K7PH 2CJTA 4FG0A 1DO5A 4JFFE 1C5DA 1NWOA 2LT9A 3VI4B 2HRPH 4ZXBD 3CTTA 1WWBX 3SIKA 4DSYA 32C2A 5MP6L 1HX0A 1GC1H 2OULB 1JZ8A 1LEKB 5DUPH 3QIWD 3NABH 3MLSH 5ISZE 4NM4H 2J56A 4J23A 1PKQE 4RAUB 1OGAA 5FGCE 3TEUA 1O9WA 3TV3H 1NANI 5DD1L 1BAGA 1NQBA 3K1DA 4ZNEE 3K2KA 3OWEA 4TOYL 5KAQF 4IM8A 5IGXH 3VG0H 3ULVH 4J39A 5JHLH 3JXAA 5FM5M 2PP8A 2OL3B 4N6QA 5GJTH 1EEUA 3MOBL 7CGTA 2BIPA 1H8OA 1TEYA 4J6RH 2E9IA 2NSXA 4Z7QF 4FNUA 3ISYA 1NGWB 4PBWD 4GAGL 4S0TD 2DPKA 2UYLA 4S0SD 3BVVA 4JANB 4I85A 3O2DL 3IRZA 1UM6H 1JZFA 4NQQA 4YSEA 1QSEE 1OP9A 3SKOB 3BQVA 5EZJB 2Z4QB 4MDJB 4W81A 3FQXB 5D6DC 1NJ9A 4XC1L 4ZJ9A 4LCYB 4U1HA 3WE6A 1HN1A 4AYFA 4JG0L 3GSOA 3REVA 3QIBD 5BXFA 4PRNB 5I2IA 1FLRH 2WLZA 1DBKL 3AUVA 3WIAA 1F3JB 3FT1A 3HPLB 1ASQA 1DDHB 2ZWLT 5DF0A 2J8OA 2JV6A 3SCMB 4R7DA 4QXUH 5ANMB 4JG1L 4N0FB 3RIKA 1J18A 2CK0H 2J72A 4JPVH 1N64L 4M6NL 5FDWA 4AQ8A 1KOAA 1SPDA 4TLTA 5IBUB 1NUNB 2FD6H 1LO5A 3DWTA 4IMLB 3GSNA 3ULUE 5CJQL 3S9DB 4PD4J 3LKSA 3ILPB 4Y4FA 5AOJA 4FNSA 1A8ZA 4NZTH 4CU7A 3G6JB 2K9UA 4N2KA 3DPBA 2WNWA 3TBYA 1SJXA 3MUY1 2ZKHH 3BSZA 2WOYA 1FIGH 4WI0B 4NZRL 4L8DB 3LRLA 4ANVA 3HG3A 5DRXB 5E23A 4E68A 4F9LA 1U8OA 3D12B 4UMGA 3UJTH 2Z0UA 5FW6A 3CQPA 4DN4L 1ORQA 3B7UX 4P57B 1GSMA 1A9VA 1N3NB 4PY7A 5EBWA 3DVNB 4I0PA 1RPQA 5T1KA 2HMID 1DLHB 3MACH 3OPZL 4Z8FH 5HHMD 2VXTL 5IW6A 2FX8H 1IGIH 5DSCA 3V6BR 2J44A 4HPOH 1FH2A 4IRZH 1NOAA 1CXHA 1RJLB 2X40A 3ABLB 5HYIA 5FYLD 1HVXA 4KVCH 4ZXBC 4DGYH 3NBNA 2BP0B 5E00B 2YPKA 3VFWA 4MBRA 1BEXA 3FUFA 4LF3B 3KYKH 2ZCHH 1KPRA 5FM8A 4XR8C 4ZMVA 3DLQR 3FKUS 5EFIB 1Z0NA 1W0WA 2ARJB 1XDTT 2EH8L 5CS7A 5DVPA 3IMSA 1N5YH 2NW3A 4J2QA 5HHOD 5BZDA 4QHUB 4AWJC 4YSUA 2ATKA 4FTVB 2N01B 4YEEA 3V8CA 4DF9A 4Z7WB 5LHDA 1WFMA 1B0RB 3EJRA 2X2HA 4NC2B 1JGLH 3GMMA 3VFOB 4D94A 3UAJA 4R4BB 4CMMA 3VWKA 1PFCA 3N06B 4QAMB 5FO8B 5JW3H 4ZTPL 3TYGL 1NEZB 1CI3M 4JN2B 3FMGL 1DJHA 1D9KD 1PKOA 4AG4H 3SDDA 3R7RA 4UT9L 3HHRB 5FB8B 2IDFA 2GI0A 3GXDA 5J13B 2NT0A 4QJ4B 2CO6B 3CIAA 2FLMA 5DYFA 3H0TB 3QZBA 4CDHA 1FZMB 3WKQA 3DTDA 3BH8B 4CU6A 5GISH 2IC2A 4XPTL 3VXUB 1Z5YD 3M1CA 4OLYL 3D8MA 4H88L 3QIBC 4WJG3 5LN4A 2G2PA 5EULV 1JAEA 4QCIA 1HNYA 2H2SD 4NKIL 1KJ2A 2GITA 3ALXA 2PTTB 1M3IA 3JWNG 4KMTL 1RJZA 3BAKA 4G5ZL 1N6VA 4ZW6A 2BERA 4XMPL 4YZWA 5ICZA 4ELMF 1GKOA 2H1LM 1DBBL 5A2AA 4QRFA 4C55A 4P04A 3KCWA 3RIAF 4LLUB 1A22B 3FB5B 5A1AA 1PZ5B 4WEBH 4X5LA 1L7TL 2XWCA 3MRKB 1DCEA 2ZCLL 3N9GL 5A2IH 4YWGH 3CDYA 5AAMA 5ALBL 1A6PA 2IANB 3PXLA 1VB9A 1JMXA 4IOFD 4Q6IA 5D1XD 4DFIA 4L4TA 5LBGA 3PJSB 4JJ5B 2Y36H 4MJIE 3ARDD 2EVJA 3POHA 5CLTA 2HAZA 3OLDA 3H4FA 1BMWA 5DJAA 1WBZA 2OTUA 3IN2A 3QPKA 1HCZA 1GYAA 2P28B 3G5VA 4U3XA 5KSAA 3MA7B 2Z3FA 4XP1L 5A40E 3UGUA 4HXBL 1KCRH 2W95A 5TQ0L 4BFKA 2Y0SA 2C26A 3ATDA 2XV2A 3K71B 3SGKA 4G6ML 1OP5H 2QSCH 1GS6X 2ITEA 4MD0B 4EI5B 4MAZA 4JQIA 5CEZL 2JQAA 2VB5A 4AL8L 1WO2A 4NRXA 5F89A 1JYXA 3TONA 2IV9A 4Y2LA 2C3VB 5IT2H 1TJGH 3UBXB 2ICWA 3P73B 1J05A 3DMMD 1XGPB 2HMIC 4ERSH 1EEQA 3P77A 1Z9LA 4FQ1H 2NNRA 1AGDA 1H0DB 4JX0A 3RGBA 5D5ME 1IX2A 2Y06L 2JKTM 3RAJL 2B1HH 3DX1A 4K71B 3WE1A 4BINA 4MCMA 1E4WL 4NSKA 1CTNA 4PJEF 3TZVA 3PFUA 2QVMA 4G7VL 4BSWB 1MCPH 2ZWSA 5C07E 3TT3L 4L4VB 2BOCB 1TCMA 5CN2A 5GS1A 3D09A 5DHYA 2G3ZA 4K3DH 5TDPA 5I1HL 1A25A 1FL5A 1NC2A 1J5CA 2WQWA 1GGYA 1NCOA 7TAAA 2Z35B 4C4UA 1H5BC 4YLBA 4HFWB 4ZBJA 5G55A 1DQKA 2BHZA 3D34A 1NCCL 4FNQA 3MOAH 4PJDA 5CGBA 1P6FA 3ASWA 2XN1A 3FQWA 5F3FA 4NO2B 2JI2A 3VXPB 5F0PB 1UZ8A 2JCCA 4Q9CA 1HJCA 1GXEA 1URIA 2Y5EA 1N2RB 4MJ5A 2NCEA 1T66C 5HYFA 1E4XI 2WXOA 3F6JA 1SNRA 3NACL 4KROD 3TM6A 4P9HL 1J8SA 1I4FA 1KFAL 3MRGB 3GI9H 4JO8A 4F8QA 4K8RC 5EV7A 1U3HB 5EUOE 1YNKH 1EZSA 4ONFL 3IFOB 3L5WA 4WNJA 3S0PA 1ZD6A 3ECUA 4LRIA 4AVKA 2EYSA 1PBYA 1RU9L 4MVBD 4GG6E 2VDLB 3S2CA 4D9QE 1BMGA 2X4TA 4XODA 4JFZH 5F93C 1BLIA 1FGVH 4BRJA 1OV8A 4AYDC 5DYOB 1JJUA 1GGIH 3MRMB 4RWYH 1FF5A 3EYOB 1QR4A 5CJ8A 1ZLWH 2EVHA 1YYCA 3ZDXB 2JVUA 3FPXA 3C6LB 4GQ9H 4PCKA 4LRNL 2PYFA 5J1AB 3BRGC 4ODVL 2A2QT 1DDTA 1A6VH 3D18A 4BFOA 3GS4A 3KYMA 5I8KL 4XPBL 5F1NA 1U8JA 1Z5LA 1NFDE 5D1XC 4AXWA 3LKQA 4J4PD 3TA3A 1KEGL 2XWTA 1OCOB 2AV1B 4IQHA 4O9HL 2VABA 3WKPA 1N4XH 3RRQA 1UG9A 3ARDC 3LAFA 4G9DA 5C0IA 5F21B 4LAJH 5J6HA 3N40P 5DC9B 1PVHA 3OMAB 4MYPA 4F8LA 1VENA 4DUXA 1KIRA 5A16A 3PGDA 5K9QG 4TVPL 2ITDA 2K6WA 3ESMA 4JFOB 4HUVA 1AFVH 1K85A 4GQZA 5C09B 3QDMA 4HIXL 2BZCA 3ERXA 4BCXA 2ICEC 3TNMB 3FXIC 5D7KD 4GXVH 1DBAH 3T0EA 4NNYB 1KTKE 2VDRL 3V6OE 1PU0A 4JFFD 4LVNC 3V0GA 4AVJA 2VDML 4ZMYA 1P7HL 5IFHH 3DC0A 1DJIA 2EDLA 3FB8A 5GJSH 1X5ZA 3H54A 4M6OL 4NPJA 5MP6H 4KPHL 5F70A 2WXMA 3DMMC 2NZ1A 3PHAA 3QFJE 4PBDA 5HD8C 2K0RA 4M1DL 2OXGB 1ZLSH 1WA0X 8CGTA 5ISZD 3GIVB 1A02N 3NQKA 4GNKB 2I85A 1NPJA 5T5FL 2WBJB 1CN4A 3C8DA 5DD1H 1Z9MA 5D7IA 4ZTOL 2GY7B 2W91A 2YSSA 1J9RA 4DO5A 4TOYH 1L0XA 1QKZH 3EDJA 3QQ3B 3EGDB 5D72L 4HUKB 5EO0A 3D0VB 4W9CC 1S7SA 2OJEA 3QXDB 2MQ0A 4DESA 5JA8B 2JKWA 2XXCB 1MH5A 4NCC2 4QLRA 3IJYB 4GAGH 1KIUB 3TN0D 2PR4H 2WVTA 2DWXA 3B5TA 1ZLVH 1YECH 1D7CA 1R4XA 1IGFL 4H0LC 4NHUB 3WFZA 5MI0C 5D5MF 4XO4A 1S7QB 4KKLD 5FC9A 3SDYH 3D07A 4L48A 4UT6L 1W6WA 2P24A 3V9CA 4TUKH 4JG0H 3TEWA 4PV9A 1FN4B 4HJIA 4YAQB 1TJHL 2ARJQ 2XPGB 4LEOB 4NQDB 1DBKH 1ZWIB 4P5RA 4KROC 4N8CL 4LPUA 1KCVH 5T1MA 4JE4B 3AT0A 4A6YH 1NDMA 1WFNA 2EICA 3PIQA 5DC2A 3X12A 4JG1H 5C2UB 1FNSL 2D73A 4WV1B 5D4JA 5EBMB 5DQ9B 1N64H 3VGAC 2XQYA 2AZUA 4PJ5B 4ZFOL 2XXFA 4E2OA 4NQEE 4O00A 1SUJA 1JGVH 3EG9B 5I6PA 3FRUA 1OAKH 4CADB 2FBJL 2JKNA 3EGXB 3ULUD 5CJQH 2NY7L 1FG2B 1M2VA 4H44C 1EFQA 1SJEB 1UM4L 3P0YH 5ICXB 4Z7NB 1NCDL 1A7PL 1DQJB 5EZIL 3L6FA 4L3EA 2O61A 5DRZB 2DKUA 3Q5TA 1FV1B 4MLIA 3RY4A 1TKWB 5GHWL 5IMKB 4Y1AD 1KJVA 1F6LL 4Z3HA 3NRFA 5EUOF 5HGHA 4E9LA 2L3BA 1B3IA 4FE9A 2F6AA 2E76C 1F2QA 1U58A 2GK2A 4XPGL 3KH4A 3GB7A 3H9HB 3BEVA 2BK8A 4L29B 3GMOB 2OJ1A 3H55A 1BZ7B 1HXYA 4OW6A 4P2CG 1HHIA 4YJZL 4AV5A 5C8JA 3JWDC 3JTSA 1X6NA 1Y07A 2C9AA 3VX1A 4G1EA 3P2BA 4L8CB 2D7NA 1FJ1B 3KE0A 2GJPA 1JPTL 2GY5A 5I1LA 5IOKA 2DWDB 3OPZH 3MRQA 2HWZL 6FABL 3ZL4L 2O5NA 1N7ML 4K0OA 2YZ8A 3SPGA 1R3JB 2LGNA 1EANA 4HCRH 1JD9A 1WS7A 3GBML 3O4LB 4HMCA 5DJ0A 2WO2B 4EBQH 5K9OB 2YPVH 5T3ZE 1K2DB 2BIQA 4DP4X 2IADA 3V79C 3O3BA 4PWGA 1IGJA 2ALAA 1UUSA 1SLWA 4DVRL 1D5MA 3VFMB 2FATH 3RKPA 1W80A 3FCGA 1UD5A 2NX5B 3FQTB 4IRJD 2DEXX 4JO1H 3AQXA 4W6YB 5FFOA 5A2FA 3KLHD 1ZHNA 1ZV2A 5CJXC 1MEXL 1FWXA 2JKIS 2P8PA 2WXPA 2JKRM 4FA6A 1ZHKA 3D85B 1U4EA 1OGSA 3SZKC 1ET7A 3JV6B 2MCPL 3ZGHA 2VE6B 1SZNA 1DVSA 4UAHA 3AY2A 3S3PA 2AITA 2LAAA 3JWNH 4QOKD 4Y4HA 5I1GL 1OB1B 4U05A 3L4WA 1OAXH 1TZHA 1X5YA 3BGMB 4X6DB 3V52L 1K5NB 3ARSA 1N0LB 3OC5A 4FQIL 3UBXI 3P9LB 1RPUA 3V2AR 1WC7B 3FMGH 4UV4H 4F20A 2CGRL 5KYUA 4ODWA 4BXVA 5L0QB 3OKMA 3TN0C 4S1RL 1VFUA 4UT9H 1YEFL 1B0GB 1JUFA 1KG0A 4O2EA 5BQDA 1GZQB 1RIVL 3UOAB 3ZZLA 1W9XA 2QQKL 1QI5A 4FFVD 4JO2H 5DU7A 2JE8A 4OT1L 4KKLC 3RGVB 2WGXA 4ZX4A 5BRZB 1H6FA 2CO1A 3WTSA 1CGWA 1QRNE 4H88H 1Q9LA 1YYML 3X1BA 5J7CC 4YDJA 4QWWD 3T4YA 5D1QC 1ADQH 1A4AA 2O1AA 3CSPA 3EFOB 4GSXA 4NKIH 4R0LB 3ZKSD 5GZOA 5JORA 1BVNP 3ARUA 4B5EA 1AZCA 1WT5C 4UIMA 4X7EC 3V4LA 4TLKA 5JOFA 4A55A 1LP9A 5GGRB 1Q0EA 3VXTA 2C4XA 1SEQH 3LMJH 5JPNA 3S3BB 3P4MA 2F53B 2ZCLH 3EBGA 2Y72A 3ZE0B 1WQVT 4R4FL 4XO3A 5CKAA 3OKKB 1BREA 4NX0A 5L8JB 4PJ7B 3U0WH 3OWRA 2F54B 5EU6A 5BJTA 4LCCC 4YQXL 3RZWA 5L2JB 1C16A 2APVA 2DI9A 2UZIL 1ULVA 3NZ8B 4MJID 5AZ2H 2JFCA 4N85A 3HBQA 2Y1YA 1M6OB 1GPOL 1USQA 2PPFA 4PWJA 5DJXB 1S9YB 5LB1A 4FYQA 2P3YA 3TIEA 2VISA 3ZOAA 1XEUA 2G75A 4I3RL 5EWIH 2OW7A 2DMGA 1HS6A 4ZZKA 4OM1L 3WMPA 1ZTXH 2BNQA 1OTUD 4XVTH 4HXBH 4JHZA 2R1WB 4WWID 1DN0B 2EO9A 5SWZE 3PWUA 5TQ0H 3V5HB 1Q9OB 3AAZA 2J6WA 3WJLA 3CHOA 1J1OL 4LIQL 2GUOA 4ZQKB 1E3XA 2IPTH 1BQRA 1XGUA 2AAAA 3MODH 4G8GE 3W57A 4AGOA 1ZGLP 1JNJA 2H8PA 4RMTA 1DUZB 1OEZW 5FKAA 4XB8A 1IC5L 4OF0A 1TLKA 1IFRA 4NN5B 1XAKA 1XGYL 3L7EB 2AXJA 1HCVA 1Z3GH 2NW2A 4TSAL 4Y2OA 4GI8A 1ZE3C 3MGTB 3E6FB 3KPOB 5EIIG 4CDGC 4JZNB 1M71B 4WGVB 3TBWB 2Y06H 3WNKA 4ZMNA 3L8QA 1QA9A 1I8LC 1L4IA 1RHHA 4JM2D 4FNTA 2FJFB 2IAMB 3KPRE 5C07D 3SGJC 1HJBC 3D9AH 1JS4A 2BFVH 1MCCA 1YN7A 3VG9C 4MCZB 3FSOA 3AREB 4TVUA 1SXSA 2PPDA 3B2MA 3BFQG 1WFTA 1CG9B 2DLEA 2FBOJ 3UADA 1UKSA 4Q0XL 4XT1C 3VWJA 5M94B 1R3HB 1YYLH 3DA0A 3EFFB 3KLHC 3NRQA 4WDIB 4ZO7A 3R7QA 4R2GB 1NCCH 4PJHF 3MYJB 4HK0A 3V4VA 1HOCA 3GBEA 1NIDA 3C5SA 4UU9A 3ZTDC 4RGNB 5DEGA 4Z77B 4K94L 1UC6A 4O58H 4XNQA 2J6EA 1UKQA 2CO7B 4PB0H 3MFFA 4PRHB 1RLBA 1DVUA 2VXQL 1QSFD 4P49A 4GKSB 1QLRA 1RV6X 3NACH 1K5WA 1T1YB 5T33L 1KXTB 2E46A 3SODB 3VSTA 2A77L 4PLNC 1GCFA 2R15A 4ONFH 4EKXA 4FFVC 4NNXA 3I6SA 4YHZL 3IFLH 4LNRA 4RESB 4URTB 5FS5A 3Q5OA 3A6CL 5I1DA 3KLKA 2AEQL 2H0FA 3CXHJ 3WSQH 1CD1A 1TFPA 4PJ8D 3L3GA 4P23A 1T1ZB 2WN3A 4QXTB 1PD1A 2F8XC 1OE2A 3IDXL 4UM9D 2VXUH 4AYID 1L0YA 5TDNB 5DGRA 4CVZB 3LKRB 1T2QL 1IIKA 4JKKA 4YIQA 4Y9GA 2VDLL 2XTJE 3V0JA 1G7PB 1SF5A 3MRCB 4LRNH 4KQ0A 2YEVB 4FQQA 4PD4K 1CFBA 1P7KA 2FGZA 2OXHB 3ALWA 4R90H 5I0XA 5K33A 4EDWH 5I8KH 5HPOA 3PL6B 4XPBH 3DURA 3KPQB 3NIDE 1KEGH 1Z2KA 3TJEH 4JFVA 4K5MA 1X4XA 3OVUB 3C6SB 3KR3L 1U95A 2IFFL 2DF3A 4FXKB 3WIHL 3WL9B 4S1SH 2DRUA 3R1GH 3HCVB 5GSRB 3RFZC 3IU4L 5D2NB 5HJBA 5D7JA 1RULL 2P5WA 1QW9A 2Z92B 1MFVA 3QWQB 5IHZB 2FGWH 3T1FB 4TVPH 2XWBB 3SE8L 4H8PA 3KPSD 4DP5X 2R0KL 1CXIA 4KVNL 1OTUC 3ULAB 1UOLA 3A4DA 3M1OA 4N2LA 5EU4A 4NQXB 2YQGA 1WCBA 1GR7A 1U6AH 2RH0A 4UB0H 4LARH 1AIFA 1R17A 4LQ1A 4MXWH 4TRPL 4C8XA 2N3JA 2VDMH 2NUPA 2OSLB 4W9ZA 3EDKA 5IB2A 3K80A 4HCIA 3PNWA 1FORL 3BJ91 3VFUB 3NUKA 3KMDA 5JDSA 3P9MA 5A6LA 1EDHA 5E1HB 3A6OA 4M1DH 4DZ8A 4HT1H 2APBA 5LWYL 3CZUB 1AXSA 3U4BL 5IR1A 4H5SB 1AQHA 2NY4B 1B0WA 4H1LG 1FO0B 1NCGA 4FFZA 4PCTA 4LSUH 5TDOB 2VZUA 4H26A 1N10A 1SOQA 4JM2C 4MQ7A 1NCHA 2V0AA 4GSUA 1T4KA 1WHOA 2KDYA 2FIKA 5B38A 3ZGIA 1BG1A 3HI5H 3FTYA 3DJ9A 3SD5A 3L4VA 3MRNA 3KWUA 5KVDE 4DTGH 2F19L 2R2CA 5DQJB 3D39E 1T89C 1JTPA 1OAUL 4OZFG 2QGBA 4TQEH 1JI2A 3E7JA 2DWEA 1VCBC 2ZXAA 5BS0B 1ODUA 4UOQA 2XFGB 4FQLL 4H7VA 2ZOKB 3EUDA 3OAYK 5DD6B 1XIWB 2XQBL 2ZSVA 4AITA 2PUQT 4NNPH 1WWAX 3L4UA 2JTDA 4AQOA 3C87A 2AV7B 5AVYB 5HGAA 1R3KA 1TJHH 3BP6B 3ARPA 2DJSA 2D3LA 3IJEB 3HE7D 2PCPA 3MC0A 4LLAA 3FT4A 2A74B 4OGAC 4PU2A 5F1KC 5HHNA 3RWEB 1T6VN 4N2DA 4NBXB 3S97C 2GIMA 4L5FL 3SBPA 3ZT5A 1NLBL 5LN8A 4LKXB 2RCSH 3BDXA 5DS8A 5G4MA 1AXIB 2J1XA 1AO7B 5DA4A 1JHTB 3OLGA 5CWSA 3SN6N 4FQHB 4YR6A 5E1GA 1CQYA 2PP9A 4Y4KD 2VSDA 2ZPKL 5KVFE 3ARBD 2FBJH 3AWGA 4C58B 3CSFA 3Q6FB 1QD0A 1YDPA 2N0MA 1KJ3L 5CAYB 3OZKA 4PJ8C 5EEXA 5FW8A 2XVGA 1JZIA 1UM4H 1TR7A 3GXPA 4G6AD 5JHMA 3VI4A 2ZUQB 3IDGB 2Z8VC 2CBMA 3U9WA 3VQ2C 3KWVA 3GXNA 2RACA 5GHWH 1TTCA 4OFYA 1IEBA 4QHNB 3QUZA 4B9IA 2L8AA 5EPMB 4JDTL 1LEKA 1U0QA 3ZTNL 1AG0A 3DBXB 4L1HA 1RZKC 1RURH 4XPGH 4Y0GA 2UZXB 4A6YB 4MAYD 3P30L 3PDOB 1RP9A 3UTQA 1OSYA 3MV7A 5IY5B 4HS8H 3SO5A 1CXLA 4NENB 1DQLL 2O5ZH 2OL3A 2VR3A 2BCMA 4XVJL 1SM3L 3MBEB 2QVFB 4I18C 2WINA 2OK0H 3TH2T 5LKNA 3VGHA 1HH6B 1DZBA 1NGWA 4JFYB 3H42H 4CSSA 1RZGB 4JANA 4LDOB 5AYTA 5IVZB 5C0BB 4DK5A 4FFTA 2L7JA 2TRHA 2F8IA 3SKOA 2X4PB 2Z4QA 3LIZL 3EJCA 3NIDF 1OSEA 1FAIH 3O3DA 4J8RA 3LH2L 4LCYA 4RA3A 3O6FA 4GIOA 3APMA 5DJYB 5FO7A 5H37G 5F3BB 5E2JA 4PRNA 4R5VA 5TK2A 4CA4A 4DVRH 2O6DA 5HYJB 1SDAB 2FWSA 3L3OC 3DRQA 3L13A 1FZOA 5FLVA 1F3JA 1I8KB 4JY4A 4JQVC 2FJGB 3HG4A 5TTRA 1DQIA 3RJDA 5BO1H 1GH7A 4Z7VF 5ANMA 4IHOB 1R6VA 4N0FA 1V3LA 1GZPB 1L0QA 1EMTL 3KJ4B 2ZX5A 4QY8B 1G6VK 5E9DB 3SGEI 3Q1EA 3BVNA 2VTFA 3DV6B 1E5CA 3UTTE 4YDVB 2X4OB 4P2RB 5I28A 2AQPA 2CGRH 4FX5A 1BW8A 2YJLA 3S3JA 3EOBB 1A8JH 3CZFB 4N24A 3ILPA 4M7ZB 3EH1A 5FDYA 3FFOA 1LVEA 3FQ1A 2AK1L 3KXFB 1RIVH 3AADB 1FHNA 1WFJA 3WI9A 4RFNC 2QQKH 1MFNA 2JJWA 3E3QE 1HT6A 3EOAA 3KWXA 4WJ5B 5CD5D 1OE1A 3G6JA 4JAMA 1JL8A 3GINA 1QRND 5C7ZA 4G7SB 1FPTL 3FOMA 4AMXA 1OALA 3C08L 1IAII 4KO7A 4FCAA 4WI0A 4LLYA 3HE7C 4PS4L 3H9SB 5DHVH 4ODXB 5DRXA 4YFLI 1KMGA 1QEXA 3U36A 4FAAB 4JGJA 2VAJA 2DTSA 3MRLB 5I8EA 5C9KA 3O2VH 1X5JA 2DM4A 4N1EA 4P57A 5BV7B 5F97E 4MKMA 3SGDH 1N3NA 3SPHA 1U8HB 3QJOA 3C5XA 3HBGA 4Y4KC 5FK9A 5GRVL 2CHWA 3LNIA 4LK4A 2DQTL 3ARBC 4R3SB 2H0EA 1CBVH 4WI4A 3N04A 5FAAA 4XCFH 4OH2A 4JS7A 1RJLA 1N18A 4UTBL 4G6AC 5AZEL 2HFGL 3U7WL 4L4TE 1UZGA 3F3HA 4X7FC 2W9LA 3OSKA 3FT2B 4JM4H 4W93A 2R0WL 3CN4A 3ARYA 4ZFQA 5E00A 2EE0A 5DEJA 1WK0A 1Y6KR 5IB5B 5DD0L 4LF3A 4OFPA 4DWHA 3AU1B 3I9IA 3WHXA 4N8VA 5EFIA 2ARJA 3OQ3B 4G8IB 1U2YA 3KS0H 4OZHA 1RK7A 4QHUA 1J1OH 4FTVA 3EO9H 4MAYC 4Z7WA 2YD6A 1B0RA 2R23B 3DSFL 5KYYB 3KZ8A 2NUTB 3VFOA 4FDWA 3WEOA 4R4BA 1UJ3C 1CLZL 4GFTB 3ZKXB 1SMDA 4FEMA 4PY8J 1XGYH 5FO8A 5LAXA 2YMXH 3MRDB 4XMTA 1KC5H 5C3LD 3LHPH 1I3GH 4JN2A 1JDDA 1QLEL 3A6BL 2VM4A 3IPBA 3HR5A 3S3DB 4J3OC 5FB8A 2V4LA 5L7XH 1FSKB 5L6YL 5AYUH 2BVOB 1XR9B 1YN6B 5D7EA 5I16B 2JLLA 5J11C 3DVIA 1Y18B 1FZMA 4MA8L 3ARWA 1TTAA 2YEZB 3BH8A 2CA3A 4X7DC 3CC1A 1XD0A 1IKNC 3L5XL 2R1YB 4DPRA 3FW6A 4GLRH 3VH8G 2MOVA 4ZUTB 4OJAA 4XCCH 2PTTA 1LWRA 5KS9B 5GS2H 3L2MA 5IM7B 1Y1DA 2X9YA 4WW2C 1IAIL 2B77A 4KFMA 1UXSB 4QXGH 1E3ZA 3F65A 3DTXB 2Y7OA 4PJDE 4D2NA 3BPNC 3FB5A 4OJCA 4WFHD 2K7QA 3MUGB 5F7NC 5FFGA 3E80A 4N6RB 3CXDH 4Z76B 3MRKA 2VXQH 4ZI8A 1TQCB 1T0MB 2Q5BA 3OKEB 2IANA 2JCCE 2CXKA 2FNWA 2OP4L 4QKXB 1EGJA 4Y16A 2VJ8A 3BO8B 3C60B 3J2PA 4JJ5A 2P43B 4F7EB 3Q1SL 3QIWB 5E2TL 4UCFA 1XH1A 3SYQA 2R69A 3X2QB 4HUCA 3F84A 4P3CL 2V33A 3AW5A 5EOCH 5CD5C 1IVTA 1A4KA 4HPYL 4IHBA 1CDUA 1NCAL 2V2WB 3A6CH 4FULA 4LDEB 4N0UE 3MA7A 3PHSA 3BC9A 1KJMB 35C8L 2H0JA 2P4AB 2J73A 5DJ8B 3TO2B 4IBWA 4NLAA 2OMVB 3BKCL 3IE9A 4EI5A 1KXQE 2E4TA 3IDXH 5ETUB 3H3KA 3O6KH 4LPWA 3CQQA 5IVXE 4APQD 1T2QH 1RUML 4LPVA 5LVEA 2VRKA 1FFOB 2C3VA 1OPGH 1UZ6E 2KZWA 3RWDA 3UBXA 4WUUE 3WDIA 1YRKA 2HJLA 2WLNA 3DJSA 3EZJB 4EQ2A 5C6PB 1MI5D 1I9EA 1OAYH 3FCBA 1GCYA 1H0DA 1OK8A 5JLZB 1OD7A 4FQXD 1X5MA 4ZDHB 4AGPA 3AT9A 3EJPA 3KR3H 1UM5L 3PGFH 1AC6A 1XSKA 2CM6A 1S9WA 5I1EL 2ZUXA 1ODAA 4BFBD 5HDOA 4YLCA 3IDUA 2BOCA 2RTTA 2Z7WA 4L4VA 2JKLA 5KVEL 1RULH 4OLWL 4P2AA 3GRWA 2W88A 2TAAA 4B9FA 1AKJB 4EI6B 1JWMA 2R0KH 4KVNH 2Z35A 3HE6D 2DWTA 5I6NA 4G8EA 1ETA1 1ZKAA 2PWEA 4X80L 3CVIH 3QDME 5PAZA 3X1FA 3ZYZA 4YDLB 5LUMA 4KZEL 4X4MA 1VEOA 4G8FA 4RNRA 5IWLA 3T0EE 1J8HA 4NO2A 1MJ7L 4G7YH 4XVUD 2CO2A 5GS3A 5HVGB 4I77L 1OKEA 1WA1X 5LDUA 1MCDA 3KVQA 4DO6A 4W4OA 2ERJB 1N2RA 1I1YB 2RAMA 1H15B 2Z8SA 2QZ5A 3GZPA 2XPYA 4JO5A 1AXTL 2Z1PA 5JO5B 2CNYA 3WS3B 2O93L 1BXAA 3NA4A 2FX7L 3O4OC 1EIBA 3CU7A 3RWJB 1JCVA 5SWQB 3MRGA 2XN9A 4P46A 2Q7NA 4XP5H 1GIGL 1OGAD 3ZDYB 3B7YA 1U3HA 4MAUL 2HT2D 5D7IE 3S98A 4BQCA 4DH2A 4YHYB 3IFOA 4AYGA 4M7KH 1F11B 1MQKL 4KBPA 5GRZA 3SDAD 4DVBB 2W0FA 5HYEA 3GMNB 4KJYB 5FUZH 1KBGL 3M6DA 4BQBA 4F7TB 2V6HA 3IU3B 1UH4A 2F19H 4FP8L 2C7UB 1IBHA 3JVGA 3GSVB 5GRYA 4IRSB 1CFMA 1YZZA 2ZNWA 2Y7SA 5DYOA 5E8NB 4JREC 5FR3A 4FQLH 2PXYA 5AAWA 1U2CA 3ARFB 3C6LA 3SKMB 3SBQA 1I7RB 3L16A 3WXWL 5J1AA 4FABH 2ENJA 1UEMA 2D03L 2WBXA 1Y7VA 2JIXB 2X1XR 4K15A 3VXQA 1PLGL 1VDGA 3O41B 4W9LC 1AMXA 3GGWA 5L88H 4K2UL 4QHLB 1R1CA 3J8F7 3QUMH 2YPLE 4OD3H 5IB3A 1EDQA 2QSTA 1THAA 5D7LB 4I48B 4YN3A 3Q44A 2WWOA 4YHKH 1R5IA 4G9FE 5IB4B 3FF7A 3H7BB 3VFNB 2B3IA 12E8H 1SMOA 3GHBH 5KYNA 4TNWF 5AVVB 5HHXL 3U9PH 2E7HA 3C2AL 2ZPKH 1QFHA 4JFOA 2QR0B 3IVKB 5CJOH 3MCKA 3IKKA 4PJDF 3UEZA 3HNTH 3TNMA 2PABA 4NNYA 1KGCE 5BVPH 1NKGA 3K1KC 3MV11 1JZGA 4APQC 5L9DL 1AKPA 2AQRA 1W0VA 1D9KB 2X41A 3MCLL 4TS6A 4Y4FD 3OXSB 3FB6B 3QORB 4RZKA 2PYEB 4L3EE 1R33A 2GAZA 1AGFB 2EDRA 4PGDB 1LHZA 4UF7C 2EYTB 2OXGA 4JDTH 2N1KA 1R3LA 3N1GC 1AOHA 3ZTNH 1HILB 1CGSL 3GIVA 2J5LC 1NBCA 5FUOL 5C08B 5EEZA 4FQXC 2WBJA 3PP3K 1E9OB 1NIFA 3CSGA 4AVIA 1OTSD 1KYDA 2O5YH 4K9EH 3O6ML 1IGYB 3P30H 3RNQB 3V6FB 3ZE2E 5KBDA 3GUTA 2FJUB 4OIFA 1WAEA 3QQ3A 4AJWA 1QG3A 3EGDA 1H3PH 3W0WA 1JDCA 3D0VA 4G82A 43C9B 4ILDA 4KUZL 1MRDH 4UYPA 3QXDA 5IVXF 2LE9A 3CFMA 4U3SB 5E8PA 2V2XB 5T1KD 5A43C 3IJYA 3HNSL 5LGJA 3HE6C 1KIUA 4OD2B 1DE4B 2VDOL 5LCVL 2I25N 3OBAA 5CEXB 1JOIA 2NY3D 2FEDD 4FJ6A 2NY5C 2XXMB 1MRFL 5C0EB 4NHUA 4QHKI 4C47A 4RSYA 1FL3B 3LH2H 1AE6H 4XVUC 5C0RH 3LN4B 3S3SA 3W81A 4KNUA 2CRYA 2GIXA 1FN4A 3FFCA 1UACL 4CJ0A 5I0WA 2VDNB 2AJYH 4LEOA 1G9NC 3H9YA 4NQDA 1ZWIA 3MR9B 2VDQL 3A67L 1OM9A 4YPGB 3EFDH 3L3KB 1XR8A 3RGHA 2EXYC 3EYUL 3WFCH 3VFTB 3R4DA 5T1LD 3W38A 1U42A 5EBMA 2F2HA 2HT2C 1T0OA 2EIMB 4N2MA 4GRWE 5F6HJ 3NFSH 3PRZA 4MWFA 3SDAC 4YC2C 1KYOJ 3UC0H 3MRJA 3UAJD 4Z7QB 2V8LA 3VWKD 2W9EL 1JXKA 1LO2H 4IKIA 3EGXA 2JI1A 1HL4A 2V9TA 1FG2A 1KBKA 3V5KA 3LXAA 9CGTA 1LEGA 3VFSB 1SJEA 1TQBC 2YXVA 1DQJA 4NO3B 3SDDD 3L3IB 3AU0A 4U7KA 5DRZA 5C3IA 4X7CC 1FV1A 2R2EB 2BM3A 5DMIL 2WY3B 5MHSE 2FE0A 1QFPA 1TKWA 1MIEL 5IMKA 3CDFA 2BP3A 1Q8MA 1FPTH 2E9JA 4XBMA 1X7TA 4I4WA 3RWIB 4U1KA 1OIOA 4HJJH 4F7KA 4PS4H 2HKHL 3VYPA 3H9HA 2PR9A 3MREB 4Y19B 1P1ZB 4L29A 3KW8A 3GMOA 1R0AL 1BZ7A 1ZA3A 4LAQL 3Q5YA 2WLMA 3CXHK 4GW1A 3U4AA 5GGVH 4L8CA 1EWHA 1OW0A 3V0IA 3EYFB 3B2VH 2BWIA 1FJ1A 4NCDA 4AQ8C 2BRRH 2V3DA 1LP9E 2DWDA 2EEBA 1BP3B 4JPKH 1UTDA 3F7RA 3ATEA 4K3HA 3MMEB 1R3JA 2XYCA 1DJZA 2FCBA 3LTVA 3O4LA 1RZJL 1J9SA 1UB6A 4U1GB 5G5DB 5AZEH 1UYWH 3FBQA 5LGKA 1PEWA 3V95A 2FTAA 1D5IL 5EU6E 3DK2A 2CALA 5F9WC 3PQYB 5K9OA 4Y4FC 1OLZA 4KK8D 2W1NA 3WEXA 4Q6KA 2V5RA 1PCXA 1CK0L 2BSTB 4JFHD 4ZS6D 3P3RA 3VFMA 1WZLA 1AGCB 5KSAD 4XNZB 2KYIA 2NX5A 3FQTA 2H6PB 2JH2A 2PW1B 4UNUA 2B7DT 2FVNA 2Q6WB 4BA8A 3SD2A 1SJHA 3Q8AA 5DHVB 3WAJA 3KM2A 4PVLA 5JIQA 2ZOWA 1B2YA 2EDFA 3DSFH 1BVKB 1S7WB 1WBYB 1S5HB 2DQFB 1OB1A 1CLZH 3Q8FA 5DR5L 5DXWA 5I26A 5DURB 4JRYB 2YD4A 1K5NA 4LO9A 4QJ3B 4WHTB 4WU7B 1FE8L 3BUIA 4D9LH 1WC7A 1PD0A 1TVDA 3VE0A 1DSFH 1QLEH 3A6BH 1S5IL 5DEZA 4IRZA 1B0GA 2DBJA 2FQFA 3AG2B 4FFWD 2NY3C 4S1DD 2FEDC 5J3HD 5EIIB 1X5FA 3BKML 1EXHA 4YXHL 4EOWH 2VMCA 2R1XB 3B43A 4KQ3L 3TZVD 1X5AA 3MSPA 2VSMB 3G5WA 2WXNA 3NAAH 5BRZA 5FCUH 3H7LA 4QHPA 2VJ0A 3MLUL 1O6SB 3CFEA 4S10A 3CSYA 3ZXAC 1WE5A 4BZ2L 3BUDA 4FOMA 3ZHDA 1NC2D 2B9AA 4NJAH 1BWWA 3VI3A 4R0LA 4N90E 4WI9A 3S36X 3VFGL 5K9QI 4Z3FA 2Z1KA 1OT2A 5I15H 2DM7A 2GJZB 1GJWA 2UY6B 5HPMA 5ALCL 2AJUL 1B0IA 2E7BA 4NKMB 4JFFB 2F53A 4JRXB 1UA6H 2A9AA 1NGXB 3UAJC 3VWKC 4XAWH 4HFUL 4ONGL 4LLQB 3OKKA 2ESVA 3VAEA 2OP4H 5LBSL 2M2DA 2F54A 4V11A 1ZS8B 1RIHL 5JW4M 2VL5B 3NZ8A 1G4RA 2B4CH 3SDDC 2P42B 1M6OA 5IV2A 5DJXA 4D0BB 5ISZB 3UC2A 1IM9D 5GZNC 4NFBA 1J1XL 4F80A 3AMKA 1KTJA 5GS0D 1C12B 5I1AA 2UXGA 4KJWD 3V5HA 1DN0A 4GRWF 1Q9OA 2NY0C 4P2OC 2H32H 3QO0B 5ANHA 3NK4A 3UACA 3W39B 3CMOH 4DKDC 2B20A 3II2A 2OBGA 2X6UA 5ILTH 1LE9B 1UB5B 1DUZA 4U1SB 2AHIA 3T2PA 2WLIA 4XN9A 3UBHA 4E9SA 4FFYL 1II4E 1XTLA 2KC0A 1QSEB 3L7EA 4G1MB 5DRWB 5IMOB 1RK0B 2ZUSA 4M43L 3KPOA 4JZNA 1M71A 4LP4A 3TBWA 1VFAB 1M7DB 3LKPB 4UQEA 5H4YA 4ZFFB 2VW4A 2X88A 3QIUB 4PWFA 5AAMC 2YD9A 2Z91B 2MPVA 5F9AC 2XIBA 1HL8A 5CLZA 3RWFA 3U7YL 3TA3D 4XN1A 5I1EH 3M88A 1TPXB 2A6DB 1MZZA 2IAMA 4Y5XB 5E1QA 2ITFA 2WMPB 3MRHB 1FFPB 1T5WA 3AXIA 5T5NF 3Q2VA 4WRLA 1ERNA 4BBWA 5CD3B 3AREA 4X6EB 2C1PB 3IDJA 4G6JH 2P5WE 3FT3B 5IMMB 3UYRL 5E6IB 1CG9A 3L5JA 4N0YL 5KSAC 2X1QA 4MCYB 1R3HA 2IH1B 3BD4A 1CGTA 3EFFA 4JCLA 3FOLB 1PX8A 4AM0B 3QDMD 1XH3B 2BOBB 3SGKC 1BZOA 5DUBB 5FYKH 5IQLA 1QPKA 5DZLA 4Z77A 3QJFB 2CO7A 4PRHA 9PCYA 1P4LB 1IC4H 3HS0C 3QAZC 2BHYA 1E9QB 2FHFA 5DUJA 5F7BA 5KSBE 5T3ZH 2WD0A 4GKSA 1T1YA 1ICTA 4JDEB 2FX7H 1MFAH 4ELKB 4Z7UA 4GXUN 1GRWA 1KYFA 4OV6F 4YZFE 4IIZA 4FFWC 2NSQA 1GIGH 4PHZA 5AWNH 3ZE1E 4PJEB 4S1DC 4BZ1L 1EO8L 2O4EA 1WAAE 3UTZB 4H1LB 4L3AA 1MQKH 4KXCA 2OCJA 3D48R 4QYAA 5I23A 3O8XB 3VXSE 1KBGH 3QNZB 2KHAA 4FP8H 1PAZA 2JJVA 4XBPB 4Z0BL 3HKZA 2E6PA 1T1ZA 4QXTA 4FLQA 3N0AA 4HIEB 3C9NB 4ZOEA 4ZNCD 5TDNA 2VR5A 2QV4A 4CVZA 3CHXA 4OZFB 1J0KA 4P5SA 3TT1L 5EA0H 1SQMA 4UDTB 1G7PA 3MRCA 3WXWH 4MMXB 5JPMB 2ITCB 2DTML 2VYRE 1INQB 3QUYB 2OXHA 4RFEA 2YD3A 3PL6A 1W6LA 4Q2ZB 4FCHA 5FO2A 1IAMA 3HUJE 4MS8D 3ZRFC 1BECA 3C6SA 5DO2C 4X7TB 4FXKA 1V5JA 4QRSB 4GG8B 2BJMH 3HCVA 4PRPD 2YUWA 4KXZI 5FYLL 3HRZB 2NY6B 2Z92A 4KWUA 2Y6TE 3OR6B 4FG6D 4LP8A 2GFBB 3C2AH 4XN4A 3NOIA 5GS0C 4WTWA 1D6VL 1MF2L 1HSBB 2B0SH 4KJWC 1M56B 3PS6A 4F7MB 3O0RH 4V33A 2YLKA 4L8BB 4WCYH 4GSDH 1T80A 1TVBB 2WPGA 1TJXA 2W81C 1CXEA 2OSLA 3U1QA 3MCLH 1DP0A 5AKTA 5C0AA 5AOZA 5I6OA 3DRTA 1CZ8H 3O81A 3QJZA 1SXCA 3MNZB 5L4IA 3VI4E 4Q52A 4F2MB 3S35X 2EEXA 3K6SB 4Y9BA 5GSVB 4CNIB 1CGSH 5I82A 5I74C 4YXLH 3QUMB 1E6OL 5D71L 3IJ9A 1FO0A 3KPPA 3RL2A 2DJ4A 1K3ZA 5TDOA 3MKGA 3WN6A 3QISA 1ZA6A 3TA3C 1PZAA 4BEIA 3B6SB 3MV7E 5FO9B 1ZEAL 1IARB 1ADWA 2A99A 2OMWB 1MCHA 1NCIA 1BAWA 2VM3A 3AM8A 3DV4B 2YBGA 2AEPL 3O9WB 3PNRB 4M62H 5FYJE 2CJSA 1BEYL 1EXUB 3O3AA 1I9RL 1FLTX 3ZRSA 3BAYA 4M00A 2Q3ZA 3OM3B 4GKNB 2VDOH 2ZP8A 5BS0A 2NYZA 2QV2A 4FNRA 5ERWB 2P45B 4LCWA 4M56A 2GHWB 3D30A 1Z32X 1H3UA 1XIWA 4HEPG 5DD6A 3SEPA 3MJ6A 1DO6A 5DJ6B 1Z3RA 4PI2A 2AV7A 2ZG2A 3VA6A 3BGFC 1UACH 3MRIB 3IJEA 3BZDA 3EH4B 1AQKH 2A74A 5ABDE 1JWSB 4WGWB 1F4WL 4PJFF 2CHZA 2YOAA 4QYOB 4PSPA 3QJHB 4CSPA 1KB3A 1B9ZA 5HI5D 4XH2B 4ABVA 4J6IA 5FGBA 1BX2B 5CZVL 1G7HA 2DEWX 2VT0A 1AO7A 5E56A 4QHMB 4HUWB 2HTLD 2VDNL 2XIDA 4ZAKB 1C08A 4Y4HD 3SGDI 3JSSA 2QPSA 2LLLA 3Q6FA 1TXKA 3UO8B 1A7NL 1RZ8A 5GGQL 5EZLA 1NCNA 4YSCA 2ZWYA 1ZXKA 4HIIB 1KTLA 3SE4C 5KSBF 3IS0X 5E4IA 1TJIH 5I9QB 1A3RH 1N8ZA 3NGBC 4M61B 4O02H 3DARA 3IDGA 4OUOA 4OTXH 5D5MB 3V0EA 4MTMA 4LFHD 3BCDA 4JZOB 4YZFF 1MIEH 2DEYX 3ZE1F 4QHNA 4DQOH 1UUNA 4U4IA 3AC0A 1WAAF 4PWHA 4CBPA 3AS2A 5CGTA 1B88A 4M7JL 4LSVL 1IFHL 1A7RH 4ODUB 2OMYB 2HN7B 2UZXA 3IDMB 3TYFB 4A6YA 2VMDA 4LCVA 4OCYL 1A9BB 2E8YA 3FUNA 4XN5A 4XMLH 5GZOD 1LMIA 4NENA 1ACYL 5J1SC 4PBVC 2Q7AA 2MKLC 2Q8AL 4ELDA 3TF4A 3GK8H 4W6XB 3BVWA 5DT1L 3AUWB 4JFYA 2VR7A 1RZGA 2JF1A 5AVQB 5IVZA 3OKOB 5C0BA 3NJVA 3HC3H 1O6VA 4IOIB 5DO8A 2P5EE 2X4PA 1A4CA 1F1DA 3QHZL 1D5ZB 3GLDA 3HUJF 3ZKND 4G7RB 5D2LE 3GXTA 2GTWA 5F3BA 3UGXA 5EUOB 5HYJA 4XB7A 5GRXG 1S7TA 1JXGA 4WIQA 5E2VL 4G70B 1ZDSA 1I8KA 3UH8A 5I1JL 1FFNB 2BNQD 2FJGA 5EEVA 4GG6B 3RTQB 1IC7L 2DJMA 4IHOA 4PREA 4MD4B 4OZHE 4DP1X 1GZPA 2WUBH 3Q2LA 3ORJA 4Z7WE 5E9DA 3RU8H 3W37A 4YGVA 4WTZA 3NJGA 3HI6L 3BKYL 1GAFH 1HE7A 1HKLH 4AMKH 3ILDA 3PXHA 4TUOA 3TJHD 3LS5L 1NBYA 3QXUA 4YDVA 1JF5A 3RDTB 1NKOA 4JN1L 3HC0A 5EOTB 4MB5A 1T1WB 4HCRA 3EOBA 4LOVA 3CZFA 1U41A 2HT4D 1M9SA 3RA7L 2V17L 1ROCA 4XPFL 4PWEA 1NFDB 4RAVB 2Q0ZX 1U91B 2YPVA 5DD3H 4DK3A 2VLLB 1YEWA 1URLA 2YWYA 2COQA 3ZQ9A 3WUWG 3CX2A 1T22B 1FVEB 1MREL 4AM0Q 3HVDA 3H9SA 4G43B 1TVHB 3U0PB 2P8LB 4N90D 2WGNB 1EEZB 1PSKH 3I9AA 2AJVL 3VH8B 5HI5C 4KTEH 4UDUB 1NC4A 4G72B 1G6RB 3CU1A 4HLZG 3ZL1A 4M7LL 3RPBA 1U8HA 3QWOB 4P3DB 1XF3B 2EUXA 1RVFH 8FABB 2HTLC 3JWDL 4NJ9L 1KF9B 4WKZA 4Y4HC 4HIHB 2QJDA 3BFWA 1S4IA 5ESQB 3MA9H 4HFUH 4R3SA 4EVNB 4FF9A 1AYOA 1SBSL 3MRBB 2IANE 3QFJB 1DBJL 5CCGE 3NCMA 5DHDA 1EEYA 4M5SA 5DK2B 2FLRT 2FSDA 1K9TA 4PGBB 1WUZA 4M9PA 2TRYA 2PP7A 1FUNA 3DI3B 4M03A 5CEZD 5IB5A 3BE1L 2IXQB 2Y4SA 3LRHA 2XNAA 4LSTH 3K5RA 2GBUA 3AU1A 2YZ1A 2EDTA 2Y6SD 4G8IA 2ED7A 4I9WE 5CUSL 1ADQA 5HHQA 3ZHNA 4HU8A 1IKOP 4BKLB 4YDKH 3ARGA 3EXLA 2JKSA 4ZPTA 3QZNA 4P23D 2FO1A 1CDYA 4Z95H 2DZEA 2GUYA 2R23A 4JFDD 4TUJB 4MQTB 3RY6A 3SKNB 4E9XA 5KYYA 1YJDC 1DQDL 4NQCA 2NUTA 1E28B 5GZOC 5IJKC 5KANI 1X5LA 3B2DC 4AEFA 3L3DB 3ZQWA 4LBEB 5FV1L 4GT0A 4MLSA 4Y5VC 1TJMA 2LOEA 3DO3A 3MRDA 4K5NA 4B60A 4YMPA 3SQOL 3EBAA 1CE1L 4MASA 5GIRA 2PO6B 4PLOB 3U6RB 5DJ2B 4AQAB 3B2UD 4NO0A 2BVOA 4IU2B 1P4BL 1J11A 1YN6A 2IOMA 4J3OF 5KBLA 2C9VA 3LNEA 4EDXA 3MRFA 3TNNB 4FC3E 2YEZA 2Z31D 3ZKNC 2EQDA 2WQUA 2OJZH 3IPEA 5HHVL 3CZSA 2DH2A 3A4FA 3OKNB 5HGDB 1KCBA 5D7JD 3H4HA 3LEYL 3UYRH 3BUBA 5F1IB 3I6KB 1MHCB 2ZXGA 3MV8E 3MZTA 4HUUB 3WFBL 1A3LH 4NQEB 4HLEA 3HTLX 4BELD 1IT9H 4WK0B 2YD7A 4JVUA 4EUPG 1BFOB 3B9KA 5E99L 3F7VB 3SKJH 3WJLC 4ES9A 1JZEA 3EJYD 3TASA 3V0VB 1WPCA 1MAML 4FA7B 3DI2B 2FSEB 1J8HE 4N6RA 3L9EA 4Z76A 1BQLH 1BQ5A 4MJJA 2ENYA 1T0MA 2IG2H 3TJHC 3OKEA 2YOCA 4I0KA 5D2LF 2WLJA 3Q8BA 4PUBL 4TQIA 2WQSA 4KI5D 3ZTCC 5BQ7B 2DQHL 1AHWB 2WXIA 2P47B 5CBAB 1PJWA 2VXSL 3BO8A 3ECBB 3ULUL 1G7MB 3C60A 1CDJA 4F7EA 2G4EA 2HT4C 2F7RA 3OKYA 1TETH 3PG2A 4NC1E 2XN9E 4PRIA 1QR1B 3DVGB 3VFPB 3Q3GA 4OCXH 3GLZA 2V2WA 2E6QA 4KRPB 4OZHF 3JVFC 1KJMA 5C3TA 5DJ8A 3LPWA 4HWEH 1G0DA 3P4OB 3TO2A 4Z0BH 4W9EC 3RUGF 1NGPL 2OMVA 4JE0A 3QZWG 5E4AA 3VDAA 5SWSE 3ES6B 4PJHB 5ETUA 1XH2A 1ONQB 2IWGA 4F9PC 1SYVA 1FFOA 1IUZA 1KYOK 1QSVA 3TT1H 4MD5B 2WNKA 3WKNA 1ZOXA 4L4JA 2DTMH 2EXWC 5E1AB 1J48A 1RJYB 3ZPDA 1EFXA 1SVZA 5JLZA 5F71A 1TZOA 1ZMYA 2N56A 2J43A 3T3ME 4G6FB 1EAQA 1BAFH 4W9DC 3T08A 2ZT9C 2Y9RT 15C8L 1DQTA 3FYIB 4I3SL 1TO4A 1MRCL 1ED3B 3S5YA 1C8QA 5HVHB 1TTGA 1WH0A 3CD4A 3QFDB 4PJXF 5FYLH 1KLUB 4DW2H 3CFDB 2MNJB 3E8UL 3NT0A 2IF7A 2DBLL 5LQBL 5JW4Q 1AKJA 4EI6A 1NBZB 4LHUD 1RI8A 1ZSDA 4LESA 2Y6SC 2Y5TB 4MNGE 3I85A 4MZRA 1NAMH 3DX0A 3NTCL 4P23C 1W8EA 4LCIL 3CLEL 4LOUD 3CC5B 4N26A 3WDHA 1JZ6A 3JV0A 3U1SL 2BXYA 2A4CA 2UXVA 5J4MA 1DN2A 3HFMH 5D4IA 4CSTA 1N8OE 3D25B 3P4NA 2NZ9D 4CBZA 1I1YA 2J57A 1XQ4A 1H15A 4KDWA 1FZKB 4OFYD 1X7QB 4D7PA 5JO5A 5JXEA 1BF2A 3QUZD 3UO1H 4QRQB 3BP4B 3OAYH 1CICA 2X38A 1KLGB 3N43B 1QRNB 5SWQA 5D71H 3FDWA 3E1ZA 5TE6L 3B2UC 2FQDA 4OQTL 5T5NG 5C0FB 2V37A 1KGYE 5GPRA 4FQPA 2YARA 4N5EC 2MMXA 4K8RH 2O26U 2XU9A 4ZMLA 3MV7D 4N2IA 1F11A 1ZEAH 2Z31C 4DVBA 4HALA 3QXTA 3SKUD 3GMNA 1WDAA 3MRRB 2X0UA 3W0WE 2X4RB 1RSYA 3IU3A 1FVCA 4YSPA 3K6OA 4NQTA 4OM0H 5F7FA 2C7UA 2QKSA 4AZUA 2I5YL 4IRSA 1IBZA 2WTPA 5FOJA 4Z5RB 3NA9L 4LMQE 2VDPL 3JTBA 3P40A 4JVWA 4F8TA 2R8SL 3QVAA 3I6GB 3P4LA 4PI0A 1XF1A 3K91A 1CBJA 3ARFA 3S48A 3SKMA 4YSQA 2DQ6A 1EA9C 2M1KA 3EJYC 4P9HC 1I7RA 1VPOL 1I7UB 1A0QL 1LK3H 3CBJB 3HZVA 3VFVA 3NSXA 3O41A 3O6FD 1I3VA 2BWDA 1XCWA 3QGVA 4QHLA 1OCCB 4PV8B 4KI5C 5LGHL 3FFCE 4NGHL 4ENED 2I9TB 1F2XK 3G04B 1LWJA 2QKIA 2VLKB 3CDGB 2YN5A 3IWUA 4FRWA 4OCRH 5D7LA 4I48A 5E4EB 4Q58C 3WFDL 2D3JA 4B3EA 1MY7A 1WZMA 5IB4A 5SWZB 3HIZA 3NJFA 2H26B 2ZOTA 4I5BB 1W16A 4I1NB 1SFHA 2EEAA 3GS0A 3ULVE 4G8GB 1L5GA 3M8OH 4HJGB 4ZUVB 4UTAL 2QR0A 2WKOF 3IVKA 5M7QA 4PJGE 2QPUA 4NN6B 5GGQH 2EIDA 1FNGB 1QHPA 4RMQA 3CFKB 2NDGA 5EF1A 2YAPA 2OTWB 2GTZB 1EPFA 2IBZY 3M7FB 4Z7NE 2ZOLB 5AW6B 1NM9A 3OXSA 3FB6A 4JKPL 3QORA 1URZA 2PYEA 5GGTH 1YVLA 1OXYA 1R34A 2HLFD 4HW6A 1AGFA 4KAQH 4KO9A 4PGDA 43CAB 2EYTA 3CN3A 1T5XB 3KPRB 2OYKA 1HILA 4F5CE 5C08A 1E9OA 3DX3A 4QDGA 3RNQA 2FUQA 4WNQB 4PB9L 2GEEA 4LVEA 1JD7A 2E75C 2HUHA 3IDYC 4N3UA 2BHUA 3O45A 4HIJB 1UOKA 2XUWA 1CLOH 2XN0A 3TBCA 3KPLB 3LY6A 4OLVH 1MXDA 2NYYD 2Q8AH 1U21A 2AXGA 4ZUUB 1S8DA 4LSSH 4U3SA 5EG6C 3GKWH 2V2XA 3MTRA 2NXYD 3NIFF 5BUPA 5IFJA 3LNFA 4P4RB 4OD2A 1ZY9A 3EYSH 3LEXB 4JZJB 1GGBH 1HEZA 5CEXA 4MSWB 4DAGL 4JB9H 3QEGL 5C0EA 1MKFA 3FK3A 5JTWA 2XZAL 3O4LE 3GXMA 4LOUC 5K9JL 1QABA 3G7TA 3PABB 1FL3A 1HNGA 4MS6A 5IQNA 4N2EA 3ROOB 3T3MF 3V4PB 2CBQA 3LN4A 3DGDA 4OB5L 1L9TA 3X3GL 3D69B 1F6AB 2NZ9C 3HMXA 1P5UC 4HD5A 4WY7H 4FHJA 3FULA 2V5MA 4OCMC 5I1JH 2A9MH 4CVUA 4YPGA 5CINH 3C75A 3FU7B 1COBA 5I76B 4KZCA 3SE3C 3VFTA 5SX4H 4FTVD 1G0XA 4CVWA 1LM8V 5GRJH 4XMVA 4JHWH 4MQXD 3KLLA 1F3RB 4Z3TA 5EN3A 3QRFM 3LS5H 1O7SA 5CJ5A 1W72B 2XTJB 4N9GB 1E9PA 4FJZA 4JN1H 4PG2A 1I1FB 3NZHL 4X5QA 3VFSA 1MCWW 1X7SA 1BV8A 4NO3A 1CC3A 5JQ6L 2QADB 3SJVA 2R4SH 2FECL 2MRYA 2V17H 2QQNH 3L3IA 2LQRA 1XSIA 3NIDB 4KC3B 5D7HA 4JO3L 4OLZH 3NP4A 1KXVA 4JNXA 1EO7A 3BSHA 3HNVL 4GAYA 2BRQA 5EOQL 2XKNB 3VXUD 4WF7A 5ABZA 3RWIA 3UIZA 2ZAHA 4Z1PA 2J21A 2KMWA 1TNNA 4ENEC 4Y19A 3TJPA 1RZKL 4JCMA 1CVRA 1ZVYA 4H40A 2D7OA 4W9HC 1DANU 4Z7VB 3SCMC 3VI3E 4UT7H 5TFSH 3VMPA 4MX7B 3FC8A 2X4QB 3W1ZA 2AXWA 2Y07L 2G5RA 3OX8B 4ATTA 2GJRA 4KKZA 3JWDH 2IBBA 1SF3A 4NC0B 1SVCP 4HAKA 4NIYE 1MFBL 3U46B 1C5DB 2F53E 3MMEA 3ZE0E 1JN6B 4E9YA 4CC4A 2IAND 1SBSH 2LU7A 1E27B 1G6RL 2WV3A 2ESVE 3AQYA 4Y16D 5G5DA 3HAEG 4N2GA 3T09A 3TU6A 4PGJA 4ADJA 2AERT 2YD8A 2CXGA 4OLUL 1NZRA 3PQYA 4ZX3A 1R24B 3PJLA 1M1XA 1EVUA 3QQ9D 2ZWKA 1AZZC 3BMVA 2HLFC 2X0WA 3MTXA 3ABGA 2BSTA 3PWPE 1SXZA 4Q8BA 5B38G 3MX0A 3LH9A 1AGCA 1JNNH 5E9AA 4I9WD 1U8KA 2H6PA 2PW1A 1FRGL 4IGBA 1FG9C 2Q6WA 3ULVF 5DHVA 2H6UA 4AGNA 3FQRB 3HB3B 3MBXL 3QYCA 3GMRB 1KPUB 4P0DA 1BVKA 2X42A 1S7WA 4PJGF 4EI5D 4PJ9B 1O75A 1DQDH 3D39B 4K3EH 1WBYA 1S5HA 5DCCA 1KYUA 1QVOB 1EHAA 3FO9B 5JHDE 4EUPH 3KLAB 2OYPA 4WLCA 4BIKA 4JRYA 5EO1B 1A2YB 4HSCX 4WU7A 1D3CA 1FL6B 2Q7YB 1CE1H 3ZDZE 1CDGA 3FTUA 3ATBA 1BJ1J 3S5LG 3J07A 1NJ9B 5CP3H 4U1HB 5DMYA 1P4BH 4BA0A 5EIIA 1JZJA 2RFXB 5BXFB 3PE9A 5I2IB 2R1XA 4KI1A 3K4DA 4F33A 3SPIA 1P6AB 1QFOA 4L4VD 1O6SA 3VO0A 4RETB 1OM3H 4NXSA 1E7VA 2VH5H 3QG6A 5AW3B 1ND0A 5C92A 1DFBL 5TF1H 2G2NA 5IJDC 2R29L 5KBMA 2I32A 5HGBB 2UVFA 3QZMA 5FDWB 3UTPD 1KTRL 5DK3A 4U6VH 2NLJB 3UJJL 1K6QH 2UY6A 3VVWA 3GSNB 4PLJD 2OQJB 4ODTH 1JZ4A 1J8HD 3LKSB 1FDLL 2Q87A 4AC4A 4JRXA 1U9KA 4HCGA 4UBDD 1NGXA 4UINL 3KBEA 4LLQA 2PLTA 2DQHH 2F0CA 1VFBB 4WQOA 2VXSH 4TNFA 5INCA 3IT8D 2E6JA 3NFNB 5A6IA 2VL5A 5AW5B 2C7FA 4HGWB 4Z7UE 4D0BA 2XN9D 2J8HA 4AYMC 2OCFD 5J13C 3QUGA 1C7SA 1U3HD 2CKBL 2QVTA 3FHEA 2V7HB 4ZNEA 2AABL 4I13B 2AEOA 5ESVA 1C12A 2W65B 2ZXCA 3N3EA 2Q20A 3JZYA 1L6ZA 3M1BA 3QO0A 3C8KA 4XXCA 1GTFA 1IE5A 4AEEA 3W39A 1HOEA 5EBWB 3FHQA 4M3KB 4I0PB 4ELMA 5T1KB 1SXBA 4KKBD 4E41A 1LE9A 5MENB 2ZCZA 4KQ4L 4U1SA 2N7AA 3C6LD 3B9DA 4IW4C 1QSEA 4G1MA 3SDXE 5EU5B 2WC7A 1RK0A 2VXQA 5B3JE 4ZFFA 5AEAA 1VFAA 1M7DA 3LKPA 3RB5A 3APCA 1ZE3H 2IOOA 1Q0YL 2Z91A 2X4NB 4I2XE 2F68X 4XX1E 2YPKB 3WFEL 4I3SH 4XAKE 3VFWB 2VR4A 2ZNXA 2Y7NA 3MXVH 3MRHA 1E6JH 4Y7OC 3NEXA 2BSRA 1TQSA 2VXVL 4XBEL 1PZBA 5CD3A 2VDKL 2ID5A 3QQ9C 1ECYA 2C1PA 5BZDB 2KQMA 2BSEA 3N42F 5CIPB 4C4BA 3FT3A 5GXBB 5E6IA 1CCZA 3NZSA 4UV7H 4MCYA 1F42A 1OOWA 2F74A 2IH1A 1KNOA 2J4WL 3SO3B 5C09D 4KV5E 2BOBA 1CYXA 4CMMB 3UTTB 1PZ2A 3O2WH 4EJ1C 2M26A 3CLEH 3QSKB 5DUBA 3WN5A 1HH9B 4EI5C 3GT6A 3U1SH 3ZSSA 3QJFA 1MFEH 5C0AE 2UUDK 5D7SL 4OUUA 1E9QA 2WQ8A 5F7MC 4J3OG 4PR5B 2BLFA 3TO4B 2KLTA 1VZGA 3QQ4B 4JDEA 1NMAL 3O6LL 4M02A 4ELKA 2DH3A 4OQTH 4PJEA 4EO5A 2WBJD 4DOHE 4K71C 1N6QL 3UTZA 1FYTE 2QEJA 4H1LA 3H3PL 3TFKD 1EK3A 3O8XA 4H8WL 1KJ2B 3W0WD 2EDHA 3L54A 3QNZA 4FL4B 4TSCL 3FRPA 3BKJH 4WJKB 4XBPA 5ICZB 4QD2E 4CU8A 2JCWA 4K94C 5JA9A 3UPRB 3LQMA 3C9NA 3VFRB 1NAMB 2VDPH 3RQ3A 3ARXA 3LQZA 2QPEB 4M48L 3RX8A 3ZDZF 4OZFA 1QBBA 4LCWE 5C6TH 3LV3B 5JPMA 3L4CA 4MMXA 3ME0B 2ITCA 5IWLC 3HS9A 4H4NA 4PLJC 5JIDA 4L4TB 1INQA 4S0HA 1VFOA 2CMRL 3QUYA 4PIBA 4UBDC 4JDVB 6CGTA 2UZPA 3ZT7A 4XCEB 5CLWA 2VQTA 4YSDA 3FFCD 4W4OC 5LGHH 4Q56A 4NQDD 4LLVB 4D0CB 3O11B 4PRDB 4X7TA 2VN6A 4XWOD 2AQSA 2J71A 4HMDA 2VC2B 5E8DH 1F6FB 3QA3A 1FVDA 1SVBA 1U3HC 2C9UA 3HRZA 3PP3H 4L9LA 3OR6A 3PWNB 2Q10A 1UCBH 1I9JH 4PBXA 3K8MA 4F7MA 2J8UE 4NRXB 5F89B 1SYSB 3F83A 4L8BA 2P48B 1F00I 1TVBA 3JVGC 2K4AA 2ZXBA 5HJGA 2MHAA 5ID0A 3SBWA 3MNWA 4KKBC 2ENQA 3AG3B 3W11D 4ZMAT 3P77B 3OF6D 4WWPA 4F2MA 3MNZA 2Y7QB 3MGOB 1ETB1 1Q38A 2Q8BL 3C6LC 3T6XA 3CMGA 4OZIE 2VLJE 3ESPA 3FUDA 3K6SA 3IMUA 4PS8A 4RGMB 4KXAA 5F9OL 4M8QB 3HR6A 4CNIA 3TZVB 3QUMA 5DD5H 5JUEL 1SBBA 3WHE0 1RXLA 5GS1B 1REIA 1T4WA 1PZDA 2FK9A 3BT2H 3TEXA 2R4RL 5TDPB 4PGEB 2OR9L 1JSYA 3B6SA 3QB7C 4R4ND 4Z6AT 5FO9A 2OMZB 3G5YA 5AL0A 1JHLL 5C0CA 1EUUA 2ADYA 2COVD 3DUSA 3FQNA 5J6SA 1YQ2A 3O9WA 4QRTB 4YUEL 4PJDB 5SV3A 1QFWM 2A83B 1N70A 4HP5A 5JQHC 5CF3A 3SDXF 3N41F 2DN7A 2IV8A 2W0LA 5B3JF 4DAGH 1AHKA 2JCCB 3QEGH 3O4LD 2XG4A 3EXJA 4HMEA 4H25B 3PDDA 3TLRA 4N2HA 3CG8A 4KDTC 5DJ6A 4JMNA 1XF4B 2B8OT 1X5HA 2HG5A 2EXSA 3KM1A 3MRIA 5K93A 2C1OA 4JBSA 3T6WA 3CZNA 1JNHB 4N0UB 5H37A 4FA8A 2EAEA 4QYOA 2NX5D 3T3PE 4JPIB 4K5LA 1ZK9A 3MUZ1 4XH2A 1QNZL 2WBJC 3V4PL 1YEHL 1L6PA 4L2YA 2CHDA 4NKOA 2X4TB 1KCUL 4HUWA 4KV5F 4TPRH 3TFKC 2FRGP 2HYMA 5IVXB 1F90L 1OAZL 2FWOB 2HFFB 4QTFA 1JK9B 3FCSB 3NFPA 3T0VA 3QUKB 4DGIH 3VW3H 4WUUB 2V5TA 3V10A 3HG1A 5TE7H 4HIIA 2TSAA 1DJWA 4OCSH 4JR9H 4NT6A 1IBB