1NSNH

The crystal structure of antibody n10-staphylococcal nuclease complex at 2.9 angstroms resolution
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
210
structure length
210
Chain Sequence
b'DVQLQESGPGLVKPSQSLSLTCTVTGYSITSDYAWNWIRQFPGNKLEWMGYITYSGTTSYNPSLKSRISISRDTSKNQFFMQLNSVTTEDTGTFYCTRGNGDWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG FAB (IGG1, KAPPA)
publication title The crystal structure of the antibody N10-staphylococcal nuclease complex at 2.9 A resolution.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Complex (immunoglobulin/hydrolase)
total genus 30
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 1995-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nsnH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nsnH01
4HZAA 3PGDA 3QEQA 1ZWIA 1JZ8A 4YX2H 4XPFH 5DDHB 3QUZD 2DJUA 2J4WL 1XF5A 4MS8C 1NFIA 3TWCH 3WIHH 4HC1L 4UQ3A 3H6JA 2HFGH 1OP5H 1M7IA 3GSVB 4RMVA 3RVTD 1VEMA 1U8KB 4XBEL 1AGFA 1F4XL 1Q9OA 2C5DC 4PLJC 2NNAB 4NQED 2WWMD 2ZUQC 1YQVL 2UYLB 1LK3L 1JGLL 2R9HC 4AEHL 4OLWH 1S3KL 4X99A 5DJ6A 4R7DB 3RWJA 1RJYB 1I1FA 5IIEA 5D71L 4M03A 5L9DL 4U3HA 4G3YH 5GRVK 1RZKC 2CDFA 1CDHA 4QRRE 4LU5L 3VFUA 1WEJH 4OZFB 1H15A 4NO2A 1GC1C 1LO2H 5IQ7H 3QSKB 3HAEB 4Y5XC 4P2OD 4XAKD 4KTDH 1I1YA 5DFVD 3I02B 4F80A 1ZHNA 5I8EB 2VZ1A 5DK2B 5E6IA 5TPWH 3MV8E 2DQEH 3EW3B 1U3YA 3VD9A 5I8CA 3MRBA 1IE5A 3Q3GA 3STLB 5FYKE 4OCXH 3D25B 4R9HA 4QRRD 5KW9H 3KPPA 4NC2B 1QTYT 3L1OL 1MCIA 3WS3B 4UAOB 1NCDL 4OZFG 5LGHL 4H0GA 4LKCB 5IMLB 4PJIE 4B41A 2WIIA 3RDTD 1ETZB 5HGDA 4GW1A 3BH8A 5DRWB 4GMSL 1G9MH 3ZE2E 1P84K 4EIGB 1G1YA 3MV8D 1QLEL 1A9BB 3BH9B 4AQOA 5L8JB 1D5IH 1NAMB 1MFEH 4L8CB 1Q0YL 4PTTA 2Y07L 5FYKD 5DMIH 1EEZA 1W8OA 3LS4H 4LSQH 3ULUC 1FBIL 2JJSA 3M17B 5EBMB 3BW9A 3P11L 4IOSD 1KJ2H 2BC4A 3A6BL 1ZLSH 4BUGA 2VZOA 4I77L 4Y19B 4Q9CA 1G0YR 5DDHA 3JV4B 4FZEH 2VH5H 4YHLH 2VSCA 2EH8L 5DURB 1QD0A 3VD4A 4C4KO 4BSWB 3O4OC 3GSVA 1U8KA 5A3IC 1AHWB 1L7IL 4P46B 2DQHL 3QUKB 3PHOB 2AS5M 2NNAA 2H2PD 1T20A 1CE1L 3I3BA 5B8CB 3VXUD 3IDIB 1F3RB 3KHQA 4NM4L 5JMOC 2UYLA 2KDGA 4ISVB 3D1MC 4PRHB 2HLFD 3LHPH 4R7DA 1RJYA 4XAWH 5DMKB 1CICA 3S88H 1RZJC 4YWGH 5E8OB 5FUZL 3ZT6A 3RFZC 4DW2H 3TNMB 3HAEA 3BD4A 4OD1L 3I02A 4DQOH 4S10A 4KRLB 1UA6L 1B6DA 3ZT7A 2DMCA 3TT3L 4XP6H 3IDMB 5I8EA 3BKJL 5LWYH 2L4OA 1JJUA 1UH2A 3OJ2C 2ICCA 3K2MC 2IGFL 5DK2A 3TBVB 4PGJA 4QWWC 3DI3B 3ZKQD 3STLA 2YKLH 3GM8A 5IHZB 3D25A 3K4DA 5HY9B 4OZHE 1CVSC 5EU3B 4POUB 3WS3A 2EO9A 4I3GA 5F7DB 4LKCA 1HCFX 1SVZA 2CRZA 5IMLA 2BNQB 2EZ0D 4H0HB 5DRWA 3T0DA 3VDCA 4YZFF 3RAJH 4TSCL 3MXWH 2AK4E 5KANG 2V5YA 3LQMA 3WFBH 3S36H 3BH9A 1FVEB 1Q72H 4PREA 1NAMA 3GNMH 4L8CA 1VADA 3LCYA 4NWUH 2DI8A 2J88L 2QQLL 5GJSL 1C5CL 1WAAF 1SJEB 2WLYA 3M17A 4LFHG 1FQ9C 4HLJA 5EBMA 5I1DB 3ARRA 1OARH 3U4BL 4Y19A 3GJEA 1Q9WB 3N85H 3Q6GH 2X4NB 1EH9A 4I4WB 3TH4T 4EBQH 2AK4D 4ZS6C 2X89A 4BSWA 4IRSC 1DBBH 4PP1C 1AHWA 4P46A 1CXHA 3QUKA 4PJFE 3B9DA 3PHOA 3EO9L 4L5FL 4IRJA 1WFUA 4UDTA 3BGMA 5B8CA 3IDIA 4PY8J 1RQ5A 4B5EA 4ISVA 1CD1B 1KFAH 1KCUH 4W68A 4XNUL 2LU3A 4MX7B 1IAIH 5DMKA 5F3BB 3G5ZB 4K8RH 2CDEB 4NQCD 4LSDA 5E8OA 4YHPB 2X5PA 4OKVA 1T1WA 3TNMA 2ESVA 2VWEE 1QPPA 2XN9D 4O2EB 2UZYB 3IDMA 3FOMB 3FCTA 3TBVA 2X4UB 2XYCA 1DVFD 1NFDB 4MA8H 3ZTJH 3RWCA 1O0VA 1A1MB 1ZXQA 5IHZA 2Y7QB 3H9YA 1YEDB 4DGVL 1OD9A 2R29L 3MLZL 1KPVA 5HY9A 1BHGA 3A67H 5E5RB 4U3CA 5EU3A 8FABB 1LDPH 2DOCA 2EE9A 1S5HA 1T89A 4B7IA 4G6KH 5DS8B 5F7DA 3THML 3RY6A 2BVEA 3F62A 2HT2D 4YHIA 3CFBB 1I8IB 1WISA 5DQDH 2F19H 2AKRB 4LCWB 2X1WL 5T5NG 5HJ3A 4NFDA 1F4HA 4HUKB 5I1EL 1JGUH 4KJWD 4G7YL 5DF0A 3QFJB 3VFVB 1QFWL 1H3PH 4NZRH 3RX7A 1U3HA 4UTBH 2VDPH 4UV7H 4DVRL 3D3VE 2KPNA 5I1DA 2XZCH 1IKFL 5CJ5A 5LGJB 1OGTA 5GPRA 2NZ9D 1Q9WA 3CU7A 4GSDH 2X4NA 4I4WA 1T1YB 4JGMA 3SHSA 3SGEI 4ENEC 5FKAB 1C7TA 4ZO8A 1YDPB 2BVOB 2YSSB 1EERB 3JXAA 5JXAL 4OQTA 2GK2A 2GJZB 1MQKL 1IILE 4C54A 2GT9B 2QADD 3BGFB 5J56B 1TLKA 4L3EB 5DLMH 1NJ9B 3D3VD 1HILB 4UUJB 3EO1B 4NT6A 3N06B 4BJLA 5F9JB 3IJYB 1CD1A 3X13B 1T22A 1CCZA 3OHXB 4MX7A 3T8XB 5JO5A 5GSVB 1QYGL 3RWEB 1VEOA 1J7VR 3CLFL 1V8HA 3MLWL 2CDEA 2CXGA 4EKXA 3EOAB 5KG9B 3RX8A 1C7SA 4KKLD 5JDSB 1YC7A 3OMZA 1MI5E 4NGHL 4O2EA 2ZNXA 1I8LC 2X4UA 1BECA 3BEVB 5GGSA 4HV8B 4ZO6A 1NFDA 3WL9B 4WW2C 3X17A 4QRQA 4XHJC 1AGCB 1H3VA 4FNLL 1A1MA 3EFDL 1IGFL 2Y7QA 1YEDA 5CZVH 2YD4A 1LO3L 1IGTB 2YUVA 8FABA 1MHPH 1W0WB 4HJ0C 5IBLC 3GMPB 1Z0NA 5DS8A 4M7KH 4ZTOH 3NZ8B 1MI5D 3PP4H 1EO8L 3CFBA 1I8IA 2AKRA 4LCWA 3HMXA 5ITBL 3QJFB 2YC1B 5EU7E 3WBDA 4HWEH 3QFJA 3JSSA 3PL6C 4PJEE 5D6DA 4H0IA 5HYQB 1A6WL 1YYLH 4FQHA 1FAIL 5B3JE 5FHAL 3VFOB 2J8HA 3G6DH 5GJTH 2VYRE 3QRGH 2VE6A 5DR5H 5I15L 3CXHK 3GSWB 5LGJA 3T09A 3OF6D 4PUBL 3K1KC 5CWSB 2CLZB 1FFPB 1T1YA 4X6CE 2VOTA 3NCFB 2I9TB 4QXGL 4ZOAA 4CNIB 3KYNB 1QBMH 1YDPA 2BVOA 1YN7A 2YSSA 1TDQA 3MUZ1 1B4JH 4WFHE 4JPVH 2GJZA 3I85A 2HTKD 1QSFB 2LTQB 2PR4H 4O5LH 1X5ZA 1M1SA 1TZGH 3C5SA 2GT9A 4LHUD 1UM4L 1ZOXA 4L3EA 1A7NH 1MLBA 1FCGA 1QFPA 1FIGH 1HILA 3LKRB 4UUJA 1EHNA 5F9JA 4WEBL 4O4YL 3IJYA 4H8WL 3F8UB 2R15A 3TJHC 3X13A 1NMCB 4YHKL 4RISH 3WD5L 4JHAL 2ZCHL 4JE4B 5HYJB 3OHXA 3T8XA 5GSVA 1P6AB 3HS0A 2D7PA 3RWEA 1JGEB 2WUBH 4JRYE 2ED8A 1ZEAL 4Y7MA 4WDIB 3EOAA 4HGKC 2K1MA 5K33A 4OB5L 4D94A 2O93L 3NCMA 1UKQA 4UTAH 1K2DB 2HFFB 1RUMH 4UT7H 4L3CB 4AYFA 1F13A 2FLBT 2O5XH 3NN8B 5GGTH 4Z78B 2XKNB 4HV8A 2BVYA 4KRNA 3RVUD 3WL9A 3P4NB 2KH2B 1AGCA 2EDDA 1YYML 5C92A 5T33H 1ZE3C 5C0ND 3N9GH 1IGTA 1D6VL 1JPTL 4JRYD 4Q9QL 3BJ91 4J3WA 5T1DL 4TSBL 3NZ8A 3LN4B 4MA7H 1KSRA 3QIBD 3MSPA 2YC1A 2CIIB 5FYJU 4YDVB 4RMSA 2GAZB 3DVNB 4K7FA 5AZEH 4S0SD 4YE4L 5KSBE 4L4JA 3E3QE 4P2QD 1KCVL 3OB8A 3FN9A 3VFOA 1FYTE 5TFSH 2A6DB 3MRHB 2ENYA 5CJ8A 3GSWA 1R5VB 5DJDA 4ZUWB 5CWSA 2CLZA 3NIGF 3WIHL 1J8HA 4F8QA 1ZVYA 3CVIH 3TBWB 1FFPA 3FQTB 4PJ8C 2I9TA 4HKZB 3V52H 4CNIA 3TC9A 2ZUVA 1QSFA 4WI9A 3TZVB 3VA6A 3L7EA 3LKRA 1FYTD 1U8MB 3LN9A 4OLWL 5IFAH 3EDJA 1CDBA 2OS7A 3PF2A 4L4TB 1K4CA 5CZKA 5HYJA 3B5TA 2E5EA 1WEJL 1A7OH 4JZNB 1ND0B 3JV5A 5C7XH 4Z95H 1JGEA 1RUQH 1I7TB 5F1IB 5LKNA 2P42B 4KTDL 5GXBB 1T3FB 2HLAB 1ZA6A 4WDIA 1OTTC 2IC2A 3DROB 1XF3B 3QIWD 3ETBF 4E41B 5C2UB 1ZSDA 5TPWL 1K2DA 1DQMH 1NGPH 3RJQB 4APQD 2HFFA 2XG5A 1QFWI 4L3CA 1J1PH 4X4YB 5FGBA 3NFSH 3ULVE 1VGKA 4Z78A 4L4VB 4OCXL 3P4NA 2BVPB 4OLXH 1FRGL 5KW9L 3LEXB 5KVEL 4J8RB 4R0LB 2Z4QB 1ZK9A 4M4PA 1RD6A 3WNPA 3IXAB 1G9ML 1V7MH 3OKOB 4X7CC 3SO3C 1FG9C 4N9GA 4QLRA 4XMKH 3LN4A 1EIBA 5FYLH 4WHDA 5DK3A 3ULVD 2WLZA 4MD5A 2CIIA 4YDVA 5DMIL 2GAZA 3DVNA 2RAMA 3LS4L 3TYFB 2G5BB 3STZB 1ORSB 1UJTA 3MOQA 4JANA 2Y6SD 1CLYL 2EYTB 4WY7H 5D96C 2O5ZH 4UBDC 2A6DA 3NIFF 4CGTA 5F7FA 4FZEL 1R5VA 4FXKB 4PTUB 1F00I 4ZUWA 4YHLL 3K81A 1ODAA 1I3GH 4PLKD 2FX7H 4MA3B 1S5IL 1U8OB 5I18H 2MNUA 1HIMH 4JHBA 3EIFA 3ZKSD 1YUHB 1EK3A 4FQ2H 2XXMB 4KFZC 4OFIA 1G7MB 1UB6B 4U05A 5CZXD 4JB9L 5GGVY 4FN0A 2XACC 3TZVA 3BVNB 1NGXB 1OTUC 1ZT1B 1U8MA 3TBSB 3RWFB 2DYPB 2B2XH 4L4TA 4Q2ZB 1PVHA 4AIZB 2E6QA 3O6FC 5GISH 4OI7A 4FP8H 4YEEA 3QG7H 5F6IC 5E6IC 4IRZH 4YWGL 1I7TA 5F1IA 4DW2L 1OB1A 1GYAA 3EYFB 1IL1B 4DQOL 4J7RA 4JHWL 4GKSB 3MYZA 4ZG1A 3DROA 5LWYL 1CVRA 1XF3A 3DMMB 3SCMC 4E41A 1WK0A 4D2NA 2DMBA 5D7IB 5SWZA 1W8NA 4X4YA 4X6DE 5EORL 1YNTB 4M8QB 1S7RB 4L4VA 1BVLB 1X3DA 4OF7A 5IOPB 3W5NA 3W2DH 4PJCE 4FRWA 2BVPA 4JM2D 4AT6B 2OZ4A 4F2MB 4ETQB 4R0LA 2Z4QA 1D3CA 3W0WB 4HPOH 4X5XA 4HJGA 3RAJL 5CBAB 3OKOA 5D1XD 1NFDF 2HFEB 3MXWL 2JJSC 3PE9A 5FM5M 2EDHA 1A3RL 1Q72L 3DO3A 3GNML 1SY6L 3VGGA 5K9JH 4LVHB 4NWUL 3MO1B 1GZQA 4U31A 4LCCB 3TYFA 3QI9B 1NLBH 3ZDXF 4XNXH 3M8OH 2DM2A 1ORSA 5C0CE 1WVZA 4DUVA 1OARL 3ULSB 2EYTA 3ZL4H 2P46B 2W9DL 3Q6GL 4X0KA 1EGJL 3UJIH 1VHPA 4CU8A 4FXKA 4PTUA 3OAZK 4PG2C 3K80A 1MPAH 3CDGB 4MA3A 1MRDL 4XP9L 1U8OA 3R0MA 1Z3GH 1YUHA 3QR2A 1DBBL 2XZAH 3H9SD 4OZGB 3HC3H 2FATH 1UB6A 2CGRL 3RY4A 1CICC 3QHZL 3BVNA 1NGXA 5DO2D 5DUBB 4DFHA 3LQAH 1AXIB 1ZT1A 2NXYB 5D5MB 1KCUL 3UJJH 2W60B 3U46B 2IBZY 3K8MA 4HCRA 4Q2ZA 5HHVL 4AIZA 4P23C 2VUYA 4K8RL 3VJ6B 5ANMB 3WNMA 4WV1C 1P5UA 4RGNE 4HAGA 5IEKB 3PV6B 3QUZB 4PR5B 3MX0A 1T2XA 5GS0H 1QO3B 3EYFA 1IL1A 2VL4A 1AC0A 4GKSA 3IDJB 1YEGL 4U33A 3O3EB 3DMMA 5D6CB 1G6RB 2P24B 4X6BA 4Z76B 4HUWB 4BA8A 2BVUA 4NKQB 1EV2E 5CGYD 1YNTA 5F88B 4M8QA 1S7RA 2ERJC 4NN6B 4WTWA 1BVLA 4RFNB 4HFWB 5IOPA 5C0BE 4OZIB 3A67L 1HXYB 4RGND 5KTEH 2A9NL 4AT6A 4H5SB 4UOJA 3F12B 4F2MA 3T3PF 4G6KL 5JR1H 1T5WA 2EEBA 4BQ9A 4JEGB 4AEIH 4ETQA 5KVDH 3DO7A 3W0WA 5DQDL 5CBAA 4NRZB 2HFEA 1JGUL 3F7PC 1A14L 2X1PA 4P2OB 5GRJH 3BEWB 2UUDK 2LU7A 3MO1A 4LCIH 3VWKD 4LCCA 4WI6A 4Z7UE 4YO0B 5C0BD 1XGUB 3QI9A 2P5EE 4PRBA 4Z8FH 2XZCL 4IHOB 1FVDA 1T0PB 1KIQB 3ARUA 3PWNA 4JFZH 3HUJE 4GSDL 4KDTA 3ZYJA 4QRRB 2FJGB 5F8RC 3DYMA 1YA5A 3GSQB 4IRJC 6CGTA 3CDGA 4WI5A 5B8CC 3FT4B 3RDTB 4PYGA 4PLNC 4MJ2A 1UCBH 43CAB 2HJLB 3CSYA 4PY8I 4OZGA 5ALCL 2PF6A 5DLML 5IB4A 4LVOB 5EC1B 1DQDH 4HIJA 1I7UA 3MV8B 2P5ED 1MCRA 4PGCA 4I0PD 3L6FA 3OR6B 2W60A 3B2VL 3KJ6L 3U46A 4YBQD 3QUYD 2IBZX 3SKUD 5D7JC 4OM0H 2WP3T 4N1CA 3VJ6A 3MYJB 5ANMA 1OHQA 1S7WB 1TQBB 1CXIA 5IEKA 3PV6A 1MCNA 4PJIB 2E7HA 1ZVHA 3CMOL 3IDYB 2DWDB 1EHAA 1QO3A 4FABL 2IFFL 5DTFB 4XMPH 5IGXH 5CIPB 1QLRB 2P5WD 4QHUB 2VABA 3VI3F 2WP3O 1U91A 1K4DB 3O3EA 1D9KD 5D6CA 1G6RA 2P24A 4Z76A 2HN7A 4KK8C 1T89C 2Z8WC 5F88A 3RY6C 5I1JH 5CZVL 2BHZA 1I9RH 2Q7YB 4HFWA 5BRZA 3MJ8B 3S37H 3F12A 4EI5C 1EUUA 4PLOB 3VRIB 5CP3H 2DLFH 1X5JA 3FB6B 2IQ9L 3BAEH 1G6VK 3PP4L 1U3HC 3G08B 1WIUA 3VD7A 3V6BR 2PXYD 4X4ME 4NUGH 4HUVB 4P2OA 2G5RA 2HVKB 3DARA 3CFCL 1FL3B 1DN0B 5JXEC 3MCLH 4YO0A 2CR3A 3QA3A 2Q1EA 3G6DL 5GJTL 5FO7B 1TETH 2BK8A 4GRWE 3QRGL 1MY7A 5DR5L 2O61A 2X40A 3HZMB 1JI2A 1CU4H 1FZJB 1KIQA 5CFHA 2CSPA 5C08E 1R3KB 4O2FB 3RVXC 2CKBB 2FJGA 4QRRA 4AM0B 2VDLL 1QBML 1IGCH 2CO6B 3QUMB 3FT4A 2Z92B 4YXHH 1B4JL 1BM3L 3EHBD 3GIVA 4U7SA 3RDTA 2NY6C 4TVPL 3P4LA 2WV3A 2PR4L 2HJLA 5D72L 1L4IA 1UCTA 1YJDH 3SDXE 3TA3C 1A7NL 3HN3A 1FSKB 3ES6B 4AEFA 5C8JB 1OY3B 5JTWA 3O2DH 1Q0XH 1QBLH 1CF8L 4RGMC 4ZFFA 1LWRA 3KXFE 5C08D 4KUCF 4OZHB 2DI7A 3CH8A 5DMJB 2CQVA 1HHKB 1PKQE 1RSFA 4YEFA 3A6OA 1S7WA 1OGAE 5HDLA 4OLZH 4PJIA 2YMXH 1J0KA 4JQIL 1QBBA 2JJVA 3VXSE 4AMKH 4TYUA 2H32B 3U36B 2B39A 4UTAL 1EUTA 5CIPA 1QLRA 2AK4B 4QHUA 5DI8B 1RUML 4UT7L 1YPZE 2DLIA 2AJUH 4XB7A 1E0OB 1FO0B 2FGZA 3KXFD 2JJTA 4M1GL 5ELIA 2BERA 5T33L 3FTGB 1T1ZB 3PHQB 5BS0E 2I5YL 3MJ8A 1OGAD 2DLEA 2JIXD 3QXAB 3IDXH 4RX4A 2EECA 3U0TB 2DBLH 3VXSD 3B9KD 1VPOH 1TTGA 1BX2B 3FB6A 3G08A 3LKSB 3MV11 5D6DC 3BRGC 3H3BC 4NQCB 4OFDA 3LY6A 2VDNH 3VG0L 5HI3C 1YEEH 1T03L 4HUVA 4Z7VE 4PJFB 3SE4A 2HVKA 1FL3A 3QDJE 1L6XA 2XN9B 1DN0A 1UQSB 4URTB 3T1WA 1BQHB 4OUOA 1CDJA 3AMKA 5BS0D 1S78D 3Q5YA 4G9FE 3D39E 4JFQB 2JTDA 2AJVH 5FO7A 5TFSL 5L7XH 4R8WL 3HZMA 4W4OA 1FZJA 4CUCA 3HR6A 2E9WA 2W91A 1R3KA 4O2FA 2CKBA 3ARGD 2QBWA 1LNUB 1A7QH 4FFVC 5CJQH 3GO1H 1JNLH 3PWUB 2Z92A 4X8JB 4IDJL 3QDJD 1CDCA 4C57C 4DUWA 1OD7A 4G9FD 1WBYB 2HJKA 5IFAL 1BQHG 3ES6A 3F6IA 5C8JA 4XVUD 3TM6A 4Q6IB 2VQ1B 4OZHA 4LCUB 1A7OL 5FAAA 4DTGH 4Z95L 1HHKA 3K2UL 1RUQL 4YXKH 2YA0A 3ILQD 3DURB 2VIRA 2K3TA 2H32A 2IF7A 1MLCB 3VFMB 2F58H 4NKDB 2R0KH 1DQML 1NGPL 3VFRB 5DI8A 1BD2A 5MP6L 3SOBH 2AQ1A 1J1PL 3L3IB 4UT9L 4YH6A 3KNBB 3FN3A 4PGZA 2QADB 5EIIB 1FO0A 1MCOH 1ONQB 2IG2H 3D3VB 3B8YA 3Q6FB 4XPBH 4HEPG 3FTGA 4YPGB 3RZCB 5F72S 1T1ZA 3OL2A 3NGBB 4QOKE 1SBSH 4GAGL 1GZPB 5FIEA 3QXAA 2B4CH 3PIQB 3RU8H 4ZXBD 4C55A 5BXFB 4JAMB 1V7ML 5FGRA 4XMKL 3VWJD 3SJVE 5FF6A 1DFBH 3CVHL 5FYLL 2W9EH 2ICWI 4EQ3A 3I9GL 4PJFA 2BFVH 2XA3A 1JV5B 3L5WA 1UQSA 1XF2A 1MH5B 4M7ZC 4DK3A 3QWQB 4WY7L 4QOKD 1P1ZB 2O5ZL 4JFQA 4HWBH 5E2UH 5KZCD 1MWAB 4Z0BH 5EOCH 3V4UL 4JKWA 1RUAH 2FX7L 4N90E 2VDRH 1MEXL 3SJVD 4TTDC 5I18L 4NKIH 1HIML 3S4SB 1T7XA 1KTKE 2DTML 3PXJA 3GSNL 1LNUA 4FQ2L 2AI0H 4NN7B 2F53A 1U8QA 1NC4D 2NY4D 4X8JA 1MI5B 3HZYB 5DD3L 3MLVH 4U2ZA 1NCCL 1WBYA 2D2OA 5GRYA 2B2XL 1JI1A 4UV4L 5T1MB 4Q6IA 5GISL 1BF8A 3EJYC 5CEZH 3QG7L 3V8OA 4LCUA 4YQXL 3HKFA 3VMOA 4OZGF 4G8GE 2ZCLH 4HK3J 1CL7H 3S4SG 5C71A 4R6UA 4BKLB 4X9GA 5FGBC 2MQCA 4MZ2A 5GGSY 3DURA 3KLAB 5FV1L 3V9FA 3FAXA 4WNQB 1MLCA 3VFMA 3NACH 2NTSP 4PJ9D 3VFRA 3S35X 4NHCL 1IEBB 4J3SA 3L3IA 4XP4H 1MAKA 4PJEB 3KNBA 1M7DA 4LHUB 3TN0B 3W2DL 4XP5H 3C87A 1ONQA 1HHHB 3D3VA 1NGWA 4N8CH 1G7PB 3Q6FA 4G43B 2AV1B 3RZCA 4YPGA 1IAMA 4G8GD 5TF0A 2Z35B 4ETYA 3L9RB 1D5BB 2CMRH 5H37G 4N8PA 4XVJH 1GZPA 3QXDA 4UILL 3PIQA 2JB5H 2PKDA 2V17H 4X6CB 1EZVY 3NFNA 3SQOH 1AIFB 3LB6D 3RHWK 3RIAK 4CJ0A 2NY3C 2BY0A 4NQTA 5FYJE 3F7RA 5K9JL 3FQXB 1JHLH 2JF1A 4OF5A 5GGUB 1NLBL 4LHUG 1MH5A 3M8OL 5HHOE 3ZDZE 3ZL4L 1YEKL 1P1ZA 2BSSB 3ULUL 1CT8B 4HWNA 1MWAA 3UJIL 3NBNA 4MS8D 4JFFA 4M7LH 3ZT5A 2CRYA 2HVJB 1MNUH 1HXMB 4JRYB 1MHCB 2XZAL 1M6OB 3HC3L 4PLJD 2FATL 3W5MA 3HZYA 5TF1L 5E00B 2OI9B 3QNZB 5HHOD 2VDKH 1WQVT 3QIBB 5ECJE 3QQ3B 5KJRH 3UJJL 3RQ3A 4WJ5B 5T1MA 3I6GB 3MV7E 3PJSB 4NQDE 3RUGB 1KG0B 5BV7L 3CDYA 5GS0L 3OF6A 4BKLA 2LAGB 3DRQB 4I1NB 2D3VA 4JVPA 3VFPB 3VI4E 1KIPB 4H1LH 3KLAA 3SGKA 3MRDB 5CP7B 4WNQA 2R1XA 4CVXB 4XCEA 5F3HB 4U0RC 4HLZH 1GOHA 1IEBA 3MLSL 2O5YL 5KOMC 4PJEA 5KSBB 1X6LA 4JKMA 4LHUA 5TQ2H 3TN0A 4FA8A 4PJIF 2RB8A 1HHHA 5KTEL 1G7PA 1FYTB 1QFUH 4G43A 2AV1A 1SYSB 1S7UB 2Z35A 2VKWA 3ZE2F 3L9RA 5JR1L 1WSST 3LRGA 5T3XL 2APBA 4X6CA 5D1QA 3IF1A 3RA7H 4NNYB 1EZVX 5EOCJ 1AIFA 2EIEA 4G9DB 5GRJL 3LD8C 12E8H 3LPFA 3ULUD 2XQBL 3FQXA 3MCKB 2LU4A 4LCIL 3QIWB 5B4MC 5GGUA 1MF2L 3DPBA 4Z8FL 4D8PB 2EDRA 3MOAH 1H3GA 5HVHB 2BSSA 3I3DA 5IROC 1XH3B 3D18A 5C86A 5EU4B 3SDAC 2VSDA 5LCVH 2HVJA 2UZIL 4M6MH 1HXMA 5D70H 5A3ID 5DJYB 1UCBL 1RUKL 1JYXA 2E6PA 1FORL 5DJ8B 1DQDL 5E00A 3QNZA 4LHJB 5F1NB 1OAZH 4HXBH 1F02I 5AZ2H 4Z7OE 4WJ5A 2GK0B 4FQXA 4OM0L 3IDUA 2OCFD 4FFWC 3I6GA 3QRFM 3PJSA 4OZFH 3NCYP 2FL5B 2FHCA 1GIGL 2FD6H 4FQ1L 2OL3L 1LEGA 5CS7A 1T0MB 4NRXB 3VFPA 1A5FH 3MRDA 5CP7A 4QWWD 4EDWH 2HKFH 3ZKXC 4CVXA 5F3HA 4OZHF 3MRIB 4NOFA 1JNNH 2MKWA 4LBEB 2DN7A 3BPLB 5KSBA 1N5AB 1RU9H 5I1JL 2ITCB 1I9RL 5T3XD 5JQ6L 1IBGH 2A74A 3RGHA 1FYTA 5E8EA 3S37L 1ORQB 1SYSA 1S7UA 4FHBD 3U0PB 5EULV 2DLFL 4DUXA 5DT1H 5F7EH 5J11B 1BEYH 3D5OF 4LVHC 2A6IB 3MA7B 4NNYA 4HKXA 2GW5A 4G9DA 2LVCA 3QCVH 1UVQB 3ZKMC 3MCLL 4KDTC 1NBZB 2C9AA 2I25N 1UH3A 3MCKA 5KSVB 3SDYL 5IEHB 2M1KA 4JG1L 5EUOE 2EIDA 1TETL 2QQNH 4LDOB 5I6XC 5FV2A 3WO4B 1DBKL 5INDB 1IZJA 1HDMB 4JM2B 3V5DB 4YHZL 4RGOH 3EJZC 4ZS6D 4JPKH 3GK8L 5EU4A 3M45A 4PJFF 5FKPB 1F6AA 1IGCL 4BH8B 4YXHL 3WMSA 4IRSD 1BQLH 1FFNB 3QXWA 3FONA 4U6YB 2YUWA 3O41A 3AM8A 1YJDL 5DJ8A 5D1XB 1B0WA 5C9JB 4X6DB 3O2DL 1Q0XL 1QBLL 3BP5B 4F9LC 3KR3L 1BVZA 3U30C 4HX1B 2WM0A 4J23A 5IJKC 3E2HB 4CMHB 3J8F7 4OLZL 2FL5A 2YMXL 1A3LH 4M48H 1F45A 3WXWH 4O9HH 3TPKA 2C1OB 1JPSH 1T0MA 1AE6H 3GHEH 2AJSL 4MA1B 3H9SB 2XNAB 5MEQB 4X4ZA 2W59A 4OD2B 3MRIA 4LBEA 1A6VH 1QRNE 1DDHB 4MJID 1N5AA 3MRPB 4FTVE 4NYLB 2ITCA 3ZLQC 2D9CA 2XZQL 5C0CB 2I07A 1FNSH 2M8XA 4YK4C 1O7VA 2XV6B 1BOGB 1ZANH 5JW4M 1F4YH 4JFXB 3DOSA 1VPOL 1MFCL 4ELME 2A6IA 3AFLA 2VDNL 2F74B 3DX7B 1UVQA 3CFDB 3CXDH 4CJ1A 1QRND 1AXTH 1T66C 1I3RB 4FTVD 1NBZA 3NH7L 4QRTB 5KSVA 3MROB 2V2WB 5IEHA 2GJ6E 2K7PA 2DM7A 1E4WL 2AJVL 3VGAB 3MRNB 5IT2L 3BZ4B 2YS4A 4YDJB 3V0AC 5JHDA 5I17B 1WFNA 2EKJA 4M62H 4ENED 1XF4A 4J3VA 4RGNB 5INDA 3V5DA 1KB5L 1X5XA 3LRSB 4LVOC 3R4DA 5FKPA 1WITA 4BH8A 3HE6A 5EBWB 1HINH 4Y89A 1FFNA 4U6YA 1S7XB 2E27H 5C2BH 4HDIB 4X6DA 3REWA 3BP5A 2V6HA 1NLDH 4HX1A 3VWKB 2VKXA 1A7PH 5C0BB 1L9MA 4PJCA 1XMWA 4DTGL 2QSCH 1BLNA 4BQBA 4UINH 4HFUH 1YNLH 4YXKL 4G8EB 4OLVH 4HWZB 2W9LA 2JJTC 3P0YH 2F58L 4GKOA 4MZ3A 1EEYA 1RURH 3SOBL 1E6JH 1N0LA 4ONFL 4PRDB 4Z7QE 2WMPA 2XNAA 5B38A 4XHJD 4GXUM 2X05A 5IESH 2I26N 4Z7UB 3O6KH 2OBGA 2IG2L 1DDHA 2KKQA 4XPBL 4NYLA 2P5EB 4OQ1A 3DYPA 5C0CA 3MJ7B 4PJHE 4CVZB 4I0PB 1SBSL 4HJ0D 3HUJB 4IBLT 5IBLD 2B4CL 3RU8L 3WO3B 3ZHKA 4WUUE 1BOGA 3QUYB 3SE4C 1EMTL 1UFUA 4LPYA 4FQQA 4PJEF 5F7LB 2DICA 3FRPG 2F74A 3DX7A 4GLRH 5ERWB 4QXTA 3PL6D 4I3SH 2BFVL 3CFDA 4XNYH 3P9MB 4L8SB 1I3RA 2BCKB 3F5WB 5GS2H 4QRTA 3MROA 1D9KB 3IXTA 2V2WA 4G6AD 3HNTH 1T4KA 4JREB 1MAMH 4X7DC 4HWBL 3MRNA 4X6CF 1S9KC 1JWSA 2MQ3A 3INUH 3BZ4A 3P40A 5H8DA 5I74C 4WUUD 5EOCL 4YHYB 3ARBB 1RUAL 1HE7A 5I17A 5IFHL 3HFML 1MCWW 4P5KB 2A83B 1X5GA 3CZFA 4NKIL 3LRSA 3SE3A 5HHME 4KGJA 5DSCB 2AI0L 5EBWA 3VGBA 5C09E 4NZDA 3CGTA 3MLVL 3QDAA 2FJFA 3DTXB 2PXYB 3MGOA 3MV9E 1S7XA 5ESQB 4JDVB 3T1FB 4JJHA 4PP2B 1ED3B 4N0FB 1OP3H 4HDIA 3TJHD 4N5EC 5E1HB 3QXTA 3VWKA 5F96H 5C0BA 5CEZL 1A4KB 5DJCB 4Y2DC 2L7JA 2GUOB 2X41A 5INCB 5BMFH 7CGTA 3BIKB 4G6MH 3Q1SH 2EDNA 4MLSA 2CJUL 1S8DB 5C09D 1F2QA 2YZ1A 3KPQB 5C0GB 4HWZA 2VXTH 1N6VA 1LO4L 2N1KA 3V7AG 2BHYA 1ACYL 4EN3C 4GKNB 1MCJA 4HW6A 4PRDA 1CQKA 1JTTA 4R97C 1R5IA 3E8UL 4XP5L 4Z7UA 2BSED 4FQIL 4AL8L 4N8CL 1RULH 5EG6C 2P5EA 1FDLH 3VXNB 4GRWB 4NFBA 4Y5YA 3ZTNL 1KELH 3BGAA 4CVZA 2CMRL 4WI3A 3SDCA 3WDJA 3HUJA 3LRHA 5C08B 2Q20A 2V17L 3T2QA 3QUYA 3S7GA 3OGOE 4IMLB 2QHRL 3SQOL 4R4BA 5EC2B 1N26A 1J5OH 1HHGB 5KSBF 3TYGH 1V3LA 3E6FB 4NIKB 1JHLL 3P9MA 4L8SA 4XGZB 3F5WA 3UTTA 4HK0A 4YDKH 4XXDB 1FE8L 2FJHB 2A38A 5CEXB 3KXFB 1J05B 3ARBA 2GI7A 2NY5L 4M7LL 2P49B 4P5KA 1PKQB 3OWEA 2A83A 5EN2B 2D9QB 2C1PB 2JJUA 3D85D 5A16B 1K6QH 1MNUL 4PJ8D 2R1WB 1OGAB 3CSBA 5IVXE 2JIXB 3C8HA 1Q94A 3TO4C 1O5DT 1AQKH 5E70A 3WS6A 3IGAB 3BKCH 3HI5H 3GFUA 3VXSB 3B9KB 3HR5B 1FPTH 1B88A 1TJHL 3LEYH 5T5FL 5I76B 4GRMB 3DTXA 3GMNA 3FB5B 5ESQA 4JDVA 4NC1C 5KJRL 4PP2A 4UMGA 4N0FA 2MFNA 4JJ5B 2BZDA 3UZEA 1ZGLB 3MREB 4OSUH 2ZUUA 1YMME 1CXLA 5JUEL 1JZ6A 1DN2A 1T6VN 5BS0B 5DJCA 1HOCA 3H2WA 1CK0H 2IANE 4M00A 2HMIC 5INCA 3BIKA 1M05A 1I9IL 4QCIB 1D5ZB 1OTTD 1S8DA 3L3KB 2E7CA 3WNNA 5J4MA 2IH1B 3KPQA 3ARGB 1IKNA 5C0GA 3ULVF 2YUXA 1UWXK 3AREC 2YD5A 1DBJL 4Z7VB 5E2JA 4WEMB 3RZCC 1MHHB 4QYOB 3QDJB 3MRFB 2AXFB 1MJ8H 3QBTB 5TQ2L 1QFHA 4YAQA 4OFVA 4G9FB 1QFUL 3D39B 4W81A 3VXNA 2J6EA 3DIFB 2IAND 4AEEA 4UT6H 1DEEB 1AO7A 1ZHBB 5C08A 3RKDC 1NUDA 5HSFA 4IMLA 1OF2B 3RA7L 5EC2A 3QEQD 5K93A 1P4IL 1WF5A 2C4FT 3ARZA 1HHGA 4K3EH 2EIZA 4FFYL 12E8L 1IEAB 1CXEA 3E6FA 3SDXA 3IFLH 1IC7L 5IWLC 5DVMA 2H41A 4XGZA 3WN5B 3MOAL 4UBDD 4XXDA 5FO8B 1RIHH 4UIMA 3KXFA 1J05A 4NN7C 5L0QC 1PD6A 1PKQA 5EN2A 2C1PA 5LCVL 1DLHA 5DJAB 3DHMA 5A16A 5D70L 2OTPA 4LSRH 2VZ3A 4ONOA 3L3DB 1A22B 4ZXBB 1JZ5A 5ESAA 3IGAA 3VXSA 3BD3A 3HR5A 4N9OB 3UP1A 3VWJB 5I76A 1GPOH 4GRMA 4BSJA 1YPZA 1V3MA 3FB5A 1U8IB 2E7LA 1T21A 2VXVH 1RUPH 5CILH 5AZ2L 4JM2F 1J12A 4L8BB 2IPKB 4BFEA 3MREA 3O6FD 5JW3H 5ABDE 5BS0A 4QEGA 4KTEH 4QOKB 4D3CH 1FZKB 4POYA 5EU7C 2FD6L 3RL2A 4QCIA 1LD9B 1HCVA 5KVGL 3L3KA 4R96B 3JUZA 3SJVB 2IH1A 5EOQH 4X6DF 1IVLA 3SCMD 3ARGA 3TN0C 2HKFL 4JO1H 2P8LB 4PJCF 1A21A 1MHHA 2NY4B 1NC4B 1JNNL 4QYOA 3DBXB 2VO5A 1RU9L 2AXFA 3QCTH 1KCLA 5IJVB 4NBYB 1CFSB 5E56A 5D1QC 2VLLA 5DJ0B 3D39A 1MIMH 1WC7B 5E5UB 3BRDA 3DIFA 1DEEA 5DT1L 5F7WC 5EBGA 2X09A 5F7EL 5FM5O 1BEYL 3AXLB 1ZHBA 3C09B 4MAUH 1DANU 2V5RA 1OF2A 1PYWA 4D9LL 1BIIA 5IP4A 4U6XB 5FUCE 3GJFK 2ZG1A 1NAML 4WRLA 3BYTA 4D0CB 1CFTB 1I4FB 4XVSH 1KC5L 4RDQF 3C9NB 4PJ9B 4P49A 5I9QC 1N59B 3WN5A 2QQNL 4UOW0 1MFDL 4PJDE 1FLRL 4BK4A 3OG6B 3U9UB 4EUPB 2V7NB 3K0WA 1FCCA 4G8GB 5DJAA 3OAYH 3TV3L 1AGBB 1OL0A 5MHSD 3L3DA 4ZXBA 4LPCA 3DX6B 1R3LB 5HXMA 4LLDB 3VWJA 4FQXC 1CICD 4HBCH 4CVUA 3OKLB 2G2RA 1CIUA 2R0ZH 1U8IA 4DKFL 2DM4A 2ADIB 3PWPE 1PGRB 4P23D 2IPKA 4RMTA 3RBGA 4LLUB 1VERA 3A6CH 3MLYH 3UCRA 3DSFL 4OIAA 4QOKA 1PAMA 3OX8B 1R0AH 4OBSA 1FZKA 1OSPH 1KEMH 3B6SB 1CR9H 4O9HL 5ICXB 4R96A 1AE6L 3C08H 3GHEL 5EFIB 3RNKB 4M43L 3NFPA 2P8LA 4OLYH 3QHFH 1SEBB 3PWPD 1NC4A 4N1EA 1A6VL 3DBXA 3KJ4C 3RHWF 3RIAF 2ZUQB 4TRPL 1A4JB 3BKYH 1OVZA 3PG2A 5HHOB 4NDMB 3FO2B 5A2KH 5IJVA 3ECBB 1CFSA 3OAUL 1C08A 5D1ZC 3MLRH 1WC7A 5FEBA 4HS6B 1ZANL 1ULVA 5SV4A 2V7HB 4X7SH 2UWEE 3U0WH 3G5YB 4HMCA 3QQNA 5DC9B 4Y5XB 4H20H 1XGYH 4Z7UF 2YA1A 3ARFC 4LEXH 4Y19D 4D0CA 3T77B 3ET9F 1AXTL 4LGSB 3AGVA 1I4FA 5I16B 4QTIL 5EO1A 5I2IB 3HUJF 5E5MB 1N59A 5DURD 3X11B 1A6PA 3PP3H 2ESVE 4M62L 4YC2C 5AAWA 1FGNH 4IRJD 3U9UA 4EUPA 2V7NA 5JW5A 4MQ7B 5BZWB 4G8GA 3BN9C 4OQTL 4Q9RH 1AGBA 4RCAA 1ZTXH 3BP7B 4X80L 3TCLB 3VMPA 3DX6A 1R3LA 3U2SB 2X10A 4LLDA 3LDBC 4P57B 4JGJA 2R69L 3OKLA 3U7AA 3LS5H 1L0QA 1PG7H 1NLDL 2ADIA 4U1MB 1XEDA 2ESVD 3UTZB 1A7PL 5D7JD 3OZ9H 4Y2OA 2QEJA 4A6YB 1G9NC 2QSCL 1U36A 5EPMB 2R2EB 7FABH 3HNVH 5SX5H 5IBTL 4HFUL 1NEZB 1YNLL 3BPOC 3IAQA 3W9DB 3OX8A 1MCLA 4OLVL 1MJ7H 3CUPB 5AYUL 3B6SA 3U9PH 2MMXA 2WINB 5I8KL 2AJZB 1IM3B 5ICXA 5ENWB 5JW4Q 2KBGA 4PS4H 1E6JL 1L9NA 3O4OB 3UTSE 3U7WH 3RNKA 1OAXH 1X9QA 1IGMH 4KK8D 5HVFB 1Z9MA 1QKZL 1SEBA 2ED9A 4KK6C 2LV4A 1KT2B 5HHOA 3S8WA 3FO2A 4I18A 3ECBA 1XR8B 4EI5D 1A1NB 1GJIA 4K94H 5ESVA 4HS6A 2BVQB 4FQCL 5IFJB 2D7OA 1U3HD 2V7HA 1YEIL 1ES0B 2MSPA 2MPAL 3HMXL 3UTSD 4OGAD 2HG5B 5HDOA 4Y5XA 5FB8B 1LO0L 5CINL 1UADC 4JDTH 5JXED 3T77A 4XNYL 4GRWF 3IDGB 4XP1L 5I16A 4NRYA 3EYUH 1JYNA 4XWGL 4GW4B 5F9WB 3FFCE 1MAML 5E1AB 4MD0A 2ZZUT 3INUL 3X11A 1FLTX 3GSOA 4K7PY 4RAUB 3HE6C 4DZ8B 1VFMA 3MV7A 1AGEB 3MLTB 4NQDA 3K1DA 5ILTH 1CS6A 3C2AL 4QRUB 4HPYL 1C5DB 4MQ7A 4NSKB 4L29B 3SDXF 4K9EC 2NY6D 5FM8A 3BP7A 2CH8A 3CX5J 4K3JL 2NW3B 3TA3D 4ORZC 1TIUA 1F3JB 4Y1AE 3FFCD 4P57A 5HGHB 5F8QC 2KQMA 1Y6NR 5DQJB 4S2SB 2FH8A 4U1MA 4KZEH 2VZSA 3QEHB 3S98A 1G1CA 3QDGE 4HC1H 4UB0H 5EWIL 5EPMA 2R2EA 3BDYH 3Q1SL 1NEZA 1A9EB 1NKRA 3W9DA 2Q3ZA 4QF1A 4XBEH 3RGVC 2IPUG 1YPZF 5CD3B 4HIIB 3CUPA 3HMWL 2VAJA 4GOSA 2XTLA 3OR7A 3RBSA 4D0BA 1LO5B 3MGAA 2AJZA 1IM3A 5ENWA 3U4EA 2PNDA 4AJ0A 4Y1AD 1LK3H 4IRSB 3QWRA 5CKAA 1NSNL 5L9DH 4MDJB 5EUOB 4ZTPL 1RULL 3QDGD 1KT2A 3JZ7A 3UDWA 5F9OL 1XR8A 3H9ZA 1A1NA 5DUML 3QFJD 5T1KD 2BVQA 5ITFA 2H9GB 1QR4A 4Z7VF 5FYLE 4PJGE 3PV7A 1J5OL 5J12C 5HI3D 5L2JB 5C0JB 1LE9B 2VC2H 1SVCP 3F7QA 3T0BA 3OKYA 3CH1B 5GRVL 4DK6A 3IDGA 5GZOC 3QUXC 4YHMH 4YDKL 2OLDA 3HTLX 2IWGA 4YHOH 1QACA 4NKMB 3L1OH 4GW4A 3D69B 4RGNC 1KOAA 3SE3C 1MCQA 5LGHH 2VL5B 4DZ8A 4K7PX 5B3NA 4P3CL 1HYSC 1AGEA 2CKBH 4MXWH 3MLTA 3V79C 1BAFL 2JB6B 3BPCA 4FFVD 4ZS7H 1AQKL 1C5DA 4F37K 3QUMH 4NSKA 1C5BH 4L29A 3HI5L 1U2CA 4O00A 5KN5B 1FPTL 4N0UE 2Y07H 3LEYL 4RQQB 3EYVB 2NW3A 1F3JA 4IMKC 5BVPL 4KRPC 4RAHA 4UU9B 4ODSH 2XWTB 3A6BH 5HGHA 3FQRB 5J13C 4P3DB 1QRNB 1CD0A 1BBDL 5DQJA 4FTVB 2YWZA 2PYEE 3QEHA 1WIOA 5LQBH 1CK0L 3GJFB 3L5XH 3ROLA 4M9OA 1J0YA 4JFYA 1A9EA 5ACMA 4MDIB 3JBG7 4ELMB 2APFA 1B4RA 5CD3A 4LEOB 4TUJB 4LMQE 2YD1A 1CE1H 1LO5A 1EHLL 5IKCA 2Y9RT 4NM4H 4IRSA 4Y5YC 1I85A 1I9JH 5T3ZE 3SDCC 2XOTA 1MJ8L 3PABA 3IS1X 2PYED 2VITB 5EUOA 3K4ZA 4XC1L 1WWAX 4P5MB 4MXQC 2FDBP 4KZDH 5IVNA 3AB0C 3V6ZA 1CLOH 5KBNC 3WDHA 2L7UA 2XPGA 4LVNC 5LJYH 1NBYB 4HHAB 1BZ7B 2G75B 1VFBB 1RK1A 2CKNA 5GRUH 4NBZB 1LE9A 2C4XA 4DEPC 5T3ZD 2XXCB 3IFLL 4YHYC 1IT9L 1UGNA 3ARBC 1J8HD 4M93C 4RZCB 3NPSC 1R3HB 2W0LA 1YY8A 4GXVL 3GRWA 1FL6A 3H3PL 4NKMA 3D69A 4WW2B 3SEPA 1UG9A 1RI8A 5J0BA 4XXCC 2AABH 5EZIH 1INQB 4TTDD 1J87A 2XIDA 4TSCH 4D9RD 1GGYA 4BQCA 4LSRL 5JIIA 5IB1A 2JB6A 1G7JB 4HUXB 2YPLE 1LP9A 5KN5A 4K07A 2NY0C 4RQQA 1GPOL 3EYVA 5DJXB 5GJSH 5HYJD 4QRSB 1JF5A 4CBPA 3ESVF 4LSUL 1C5CH 1DTUA 3ISWA 2XWTA 5CILL 2NLJB 3PL6B 3FQRA 2CO7B 4CVWA 4P3DA 2R4RH 3MZGB 4PB0L 4FTVA 3D0VB 3EJYD 1IGJB 1ZA3B 1DJSA 4PJHB 1YEHH 3VH8G 1FNLA 1II4E 3BPNC 3TH2T 1LE5B 5CSGA 3GJFA 2A6JB 2ZOLA 4RNRB 2YD7A 4WUUB 4I13B 4MDIA 2J8UE 4ELMA 1SBBA 2P8PB 4NUJB 5EOQL 3EO9H 4TULL 4TUJA 5IG7B 4GLRI 3UO1H 1W0YT 3T0XA 1EAPB 4IM8A 4HK3N 4GH7B 5J1TC 4EZMA 3UPRB 2GJ6A 5KSAA 1MIML 2VITA 4XNMB 5AWNL 3MR9B 1HQ4B 1NCBH 4M6NL 4P5MA 1S7TA 2CDGB 4JCLA 4JFHD 2FSEB 4ZMAT 4WO4C 4MAUL 1NBYA 1BZ7A 3W9EB 1VFBA 3UPCA 2NY3D 5C09B 3BJLA 4Y5VC 3O3BB 1P9MC 4CN1A 4Q58C 3ZDZF 3D87B 3OTTA 1INEH 1UKSA 1J1OH 1R3HA 3MLZH 1I8LA 3QZWB 1N3NA 5DQ9B 1UWGH 4KHXH 5SV3A 4WW2A 3RTQA 4LLYA 3V4PH 5JPNA 3VMNA 1P53A 4LIQL 3FT2A 3THMH 3IFPB 5B22A 4FZ8H 1NGQH 3KYOA 2WZPD 4P2YA 5C6PB 4PJ7E 1JRHH 5JORB 1U95A 2AXGB 1G7JA 1A2YB 5SWZE 1HWHB 1QFWH 4HUXA 3GBNL 1HH9B 5ID0B 3MUGB 2QR0B 2Y25A 3TFKC 4DVRH 4QRSA 2R0ZL 4P59H 4EVNB 5TGBB 1BOYA 3U7YL 5CJOL 4XCYA 1S7SB 5E95B 5DFTA 2XKSA 3D0VA 1IGJA 4JRWA 1ZA3A 1MCEA 4PJHA 3TVMA 5H37H 3VI4F 1R0AL 1LE5A 4J3XA 3EGSB 1W72B 5SWZD 2A6JA 5I30H 4WUUA 4K71C 1KEML 3VXTB 1CR9L 5JXAH 1HHJA 3MPCA 1NEUA 1MQKH 2A77L 3D85B 1KXVC 2P8PA 4NUJA 3C08L 1JGDB 2DRUA 4F33B 4EI6B 1FJ1B 4OLYL 5IG7A 1E4JA 2AVGA 3WKNA 1RJZB 2AJYH 1KJ2B 2XKUA 1JPFB 3GMRB 4X9HA 2R2HB 2ZP0T 4LGRB 4ZO7A 3BYYA 1MCKA 3FQNB 4HZLB 4JHZA 3CLFH 4XNMA 4C56E 3REVB 3CAFA 1HQ4A 3MR9A 3WIHA 1N2RB 3QP3A 3MBED 4KQ4L 2C3WA 4X7SL 5GZNC 1WBZB 2FSEA 1G0XA 3U0WL 4LVEA 5IVXB 2VR5A 1KNOA 1BP3B 1XGYL 3CJJA 3WN5C 3ARDA 4LEXL 3QIUB 4QHLA 3AMLA 3O3BA 2A1WL 5B4MD 1HSBB 1URLA 3MV9A 3RWIB 1LO3H 2X1XR 1CWVA 4C56D 3QZWA 2FBOJ 1AP2B 2DDQH 5DQ9A 4ZUSB 2ORBL 1YEFH 1YMMB 3B2UC 4JQXA 1FGNL 3IFPA 4NPYB 5TE4H 3SDAD 1EO8H 2OJZH 1EEQA 2IANB 1ZGLM 1KYOJ 4V2BA 3LEVH 3TF7C 1KACB 5JORA 4Q9RL 1ZTXL 4CL7A 4G42B 4MWFA 3SO3B 1HH9A 5ID0A 3QPXL 4KROC 4OGYL 2QR0A 4RMRA 3QEQB 1KJVB 4Z7OF 1FAIH 1XT5A 5FHAH 3QH3B 4ELKB 4EVNA 5TGBA 1LEKB 2EDOA 1S7SA 1XF5B 4M7JL 3OZ9L 4FFWD 3EDEA 3NMEA 1JHTB 5I73C 2HKHL 7FABL 1QNZL 5D96B 1Z9SA 5HHXL 1MJ7L 1AGFB 3EGSA 4Y4KC 3VXTA 2FIRT 3F7VB 3MACH 3U9PL 4XPGH 5A1AA 3BIAX 1IGYA 1Q8MA 4HIEB 2OTWB 4PS4L 1JGDA 1UWEH 4F33A 1G6RL 1OAXL 4EI6A 5DJ6B 2LABA 3QISA 1CGVA 2DQUL 4KKBC 2F5BH 4O4YH 3PGCA 3RWJB 3CD4A 4U4BA 1RJZA 3ZSTA 4JN2A 4TVSa 43C9A 1KJ2A 1PQZB 4DKEL 1JPFA 4PJ5A 1RFDH 4J3UA 4JHAH 4YHKH 3WD5H 5FGSA 3GMRA 2R2HA 3QXVA 1ZLUK 5CJXC 4WTXA 2CXKA 2ZJSH 4P9HL 4Z77A 4ZOEA 3FQNA 4HZLA 3REVA 4K94L 4OTXH 1RZ8B 2IAMB 1I1YB 1N2RA 1ZEAH 3O6FB 4KI1A 3FQUA 4OB5H 4JLRB 4WTZA 5DD0H 5IHBA 5F6IB 4MAYC 4KVNL 2B7DT 5LVEA 1N4XH 4KJYB 4FQPA 5IVXA 1U8JB 4Z7WE 3MRBB 5D2LA 3Q3GB 4OZ4B 3ZKMD 3GSUB 5EUOF 4JDTL 3QIUA 2YK1L 1XAUA 2YXFA 4S1DC 5DEFA 5JPMB 3SCMB 1VFUA 3EYUL 3V4VL 1HSBA 3I6LE 1T80A 1IAOA 4I5BB 1AP2A 1JPTH 3NCEB 2N7BA 2P4AB 2WIIB 4Q9QH 3NAAL 5HGDB 2AEQL 3Q48A 4ZUSA 3BH8B 1YMMA 5EBLA 3NIDE 2G9HB 4LLVB 3EJZD 4TSBH 2VLKE 5EU5B 4NPYA 3SKNA 4QHMB 2IANA 5SX4I 4MQSB 2ZG3A 4G42A 1EEZB 5JIPA 5FECB 4WHYH 3NA4A 1FFQA 1KJVA 2BC4B 5BRZE 3MUY1 3I6LD 3QH3A 4ELKA 3ULVH 4KI5E 1DQLL 5HD8C 1JYVA 5FYKL 1LEKA 2RCSL 2XTJE 2XWJB 3PQYE 4KZEL 1V7NH 2AEPL 2Z31A 4LSVH 1JHTA 4EIZC 1ZLVH 4UB0L 3MNWA 1AH1A 1VGEL 3ALXA 3BDYL 2P1YA 4M6OH 3D0LB 1U42A 3LKQB 4MGXA 5E9DE 1BPVA 1TJGH 3HCVB 3F7VA 1T20B 2P47B 1MCSA 2DQIL 5BRZD 4HIEA 2OTWA 3P9WB 4I18C 2C7UB 2UVFA 4RMWA 3SDDC 1AGDB 3BDXA 4Q97A 2J12B 3PQYD 1PQZA 3EYQC 3MNVB 2DIBA 1CICB 1XFPA 4GQ9H 2FR4B 1PW3A 1T1XA 4ELMF 5E9DD 1N5YL 1VCAA 1RZ8A 2IAMA 3CFIC 4P23B 3O2WH 3O6FA 5F44A 4WV1B 4JLRA 4HG4J 1N8ZB 4KJYA 2NX5E 2VC2L 1U8JA 4LARH 1MFNA 4DAGH 2J8OA 4OZ4A 4TQEH 2ZSWA 1T66D 3GSUA 1KBGH 3FRUB 4LRNL 2LVEA 5HHQB 5JPMA 3SCMA 1FRGH 4YHML 4YHOL 3C8DA 3JWOH 4K23H 2I9LB 5KVEH 2DIJA 3PWPB 4I5BA 2ERJB 3DV6B 3HAEG 3WXVL 4JKPL 1MQ8A 2CKBL 4MXWL 2G9HA 4LLVA 4BFBD 3SKJH 5EZLB 3N0PB 3VA2C 3T2PA 5EU5A 4ZS7L 3CPLA 1HK6A 2NX5D 2XFXA 4QHMA 1KJ3L 3QUML 1C5BL 1IC1A 4PREB 3DVFA 4IJ3B 1VADB 5DD1H 5DVNA 3G9VA 4RA3A 3T4YB 3V0WH 4WW2F 5D7LE 4F7CB 5FECA 4C4KT 4ODSL 1A6ZB 4F58L 1CLYH 2QQQA 1OAUL 3GJEB 4UI2A 5CEZE 5FHBL 5E4EC 4J3TA 2XWJA 5CBEA 2HA1A 1NANH 4UDUB 5E94B 4NFCA 3IYLW 4XC3H 1IFHH 1E28B 1XCQB 1S5IH 3NOIA 3NZHL 5LQBL 3L5XL 4N0RA 3GGWB 4QTHB 3D0LA 3LKQA 3R06B 3HCVA 1YZZA 4PG2A 1ACZA 2D0HA 4IRJB 3C6LA 4Z7QF 4JB9H 4P5TC 4UDTB 3BGMB 3UDWC 1DE4A 2C7UA 1I9JL 1AGDA 1PG7X 1FO0L 4RX4D 4N0CC 1FL5B 4PJHF 4ZQKA 1JZ4A 5HI5C 5MENE 3MNVA 4RWYH 4LSPL 3FFDB 2EEDA 4KZDL 2FR4A 5FOBB 2VLME 4PJDA 4OKVB 1T1WB 3LMJH 1CLOL 2FECI 2ESVB 2A73B 4N8VB 5F1OB 5D7JB 4P23A 1EVTC 4JHWH 2YD8A 2ZWLT 4WV1A 3FCTB 5GRUL 1N8ZA 1ADQH 5F93C 5J3HC 3IFNH 1H9VA 5F9WC 3FMGL 4A2LA 3RWCB 5EORH 2FHBA 3FRUA 5MEND 3FT3A 5HHQA 4NOBA 1KPVB 2VLMD 3GMLA 1S5HB 2H26A 2EDBA 5J6HB 3O9WA 2I9LA 3PWPA 4GUPB 3WJJC 4OCWL 4JY4B 4BYHA 3VGDA 2AABL 5EZIL 4DGYL 4YHIB 1AY1H 2WWKT 3DV6A 1IZKA 4B50A 4N8VG 1DQTA 1RPQA 1UJ3B 5HJ3B 5EZLA 4EI5B 2OK0L 3I3EA 1PBYA 1EJOL 1BD2E 3DJ9A 1TCRA 1A3RH 1SY6H 1U3HB 2DIAA 3GBLA 5DMYA 3T4YA 2WWKO 5F97E 3UTSB 3GIZL 3H9HA 5IW1B 4F7CA 2VJXA 1W0VB 3LKOA 1A6ZA 1OGTB 3AS0A 4N5ED 2W9DH 2R4RL 5JLZB 1EGJH 3RVWC 4UDUA 2ILLA 5E94A 1G84A 1YEHL 1QP1A 2ADFH 4Y2DD 1E28A 1XCQA 2YHGA 1BD2D 1MRDH 4XP9H 3GGWA 4QTHA 2V2TB 4PRIA 3R06A 2UWEA 1I85C 3WLWC 2Q76B 3HNSL 4RRPA 4NT6B 2CGRH 3FJTA 2ED7A 4EN3D 15C8L 1JZ7A 1P5VA 4JVUA 3UO1L 4V1DA 3QHZH 5F9AC 3O11A 2NY6B 4XVTL 2FGWH 4NBXB 1T22B 5ETUA 3TA3B 2X7LA 3LVEA 1JUFB 1FL5A 1AKJD 5JO5B 5DGRA 5HHVH 4KJPC 2ZUYA 1BVKB 5EZOH 3V6FB 3FFCB 4I0CC 5J1AB 2WAHA 1NCBL 3FFDA 4RGMB 4U6TA 5FOBA 3SBWC 4JPIB 1FNHA 2VLRE 3DVGB 2F53E 2A73A 4N8VA 5D7JA 2PN5A 1PY4A 4GS7B 1ITBB 1YEGH 3IETB 5GGSB 4QHKJ 4NQVB 4YFDB 3LKPB 4QRQB 5J57B 4HMEA 1INEL 4Y4FC 2J7LA 1J1OL 1N0XH 4Y1AB 2P44B 2A9NH 1UWGL 4KHXL 2OJEB 4NC1E 4OLUL 4S1QL 4WEUD 4GO6B 1MWAL 2VLRD 3V4PL 5J6HA 4GUPA 3NCJH 2F53D 5IVXF 4JY4A 3EOBB 4AIXA 5ACLA 3QDGB 4FZ8L 5BVJA 4LOUC 1NGQL 3OJMB 1CGTA 2Q7NA 1UJ3A 4EI5A 1JRHL 3ARYA 3TO4D 4M61A 4NCDA 1CQYA 1A14H 1NBVH 5T1KB 2Y36H 1U8PB 2YPVL 3EDFA 4LPVA 1BGXL 3WIIL 4FQHB 5GGTA 5IBUB 3UTSA 4CAGA 4P59L 5DHXB 3FKUS 5IW1A 3RKPA 4C58B 1HKLH 3BP4A 1W0VA 2VE6B 3C2SA 1UEYA 3CK0L 3MUHL 1JIBA 3EJJX 5JXEA 2X42A 5JLZA 4RIRA 4ODWB 1KPRB 2NY2D 2ZKHH 2HMID 5C3LD 3TO2A 5H35A 1YN7B 4KK5C 5I30L 1MIEH 2V2TA 1DUYB 1R5WA 3C5SB 2VXUL 4PJGB 5ALCH 5ID1A 1FFRA 1MLBB 4U2YA 2Q76A 2I60L 3ARED 2BNRE 5IBUG 5KSAC 3N1MC 3RZCD 5MEOA 5DD6A 1CGWA 2AJYL 4JFEE 5JNYB 1KEGH 3B2VH 3KJ6H 3TA3A 2CRIA 2FWOB 1JUFA 4UOW1 4E42A 2I24N 4JFFE 3HS0B 1BVKA 3V6FA 3FFCA 5J1AA 1DQJA 1CLZH 1A6AB 4PYHA 1J9CT 4JPIA 3CMOH 2P7TB 5IMMA 3DVGA 1MVUB 3RKDD 1NCAL 1P7HL 2FX8L 1WTLA 4FABH 2IFFH 1A1OB 5EZJB 4MD4B 1MCBA 3IETA 3Q5TA 4H8WC 1UB5B 4PRPE 1T7ZA 5I1AB 4N0UB 4JFED 3AUVA 4NQVA 3RTQC 3LKPA 3I50H 3MGTB 3E1F1 1TQCC 4F37F 5DHVH 4LDEB 2MJWA 4JFFD 4WFFE 4R2GC 4N1HB 4Y1AA 1BJMA 2DDQL 3O2VH 4KJQC 2OJEA 1Z2KA 1YEFL 3EOBA 2PYEB 2IQ9H 3WCYA 5TE4L 2OJZL 1YN6A 3QDGA 1F6LL 3CIQA 5F7HA 3LEVL 4WGWB 4PRPD 4K7FB 3G5XB 5T1KA 3M1BB 1U8PA 3CFCH 3P30L 4I3RL 4KMTH 1K85A 4ZNEA 4WFFD 3I2CL 1BF2A 1NMAH 4MJ6B 2VNCA 3P77B 4G6AC 4POZC 3TVMC 3CSGA 5DJDB 2FB4L 3S5LA 4HAFA 2IADB 4Z7NF 4M7ZB 1J8HB 2M2DA 1DEDA 4KUZH 4ODWA 1KPRA 2W38A 2VDLH 2X4TB 3BRFA 2AQ3A 5JDJA 1BM3H 1DUYA 3MACL 2APXA 4XPGL 4TVPH 5JA9A 5D72H 4EEEA 4JZOB 5HPMB 4PJGA 3VDBA 5DZLA 3TN0D 1UWEL 3L7EB 1KPUB 1RY7B 2J2ZA 3RWDB 4KQ3H 1OPGL 2F5BL 5IB3B 1CF8H 5LAXB 1K4CB 1RFDL 5JNYA 2YXMA 3ZE1E 3V5KB 1FV1B 2FWOA 5D1QD 2ZJSL 1NH6A 4RSVA 2VN4A 4OTXL 5IMOB 3ZDYE 1A6AA 1NAKH 3ARDC 1ZA6B 4WFHD 2P7TA 4JQIH 1MVUA 5DD0L 1TZIB 1X5HA 1I1RA 1A1OA 1N4XL 1ZSDB 4MD4A 5EZJA 2MOVA 2OSLB 1F5WA 1JNJA 1X5LA 4S1RH 4WWKB 5FCSH 2YPLB 1UB5A 1VGKB 4K2UH 2NY7H 4LFHD 5I1AA 1VACB 4N0UA 1J0HA 3H0TB 4XX1G 4M1GH 3MGTA 4JQXC 5BJTA 4PJDF 2I5YH 2EE2A 3JWDH 3MLXH 5F7KC 2N56A 5DEZA 3OKMA 2X44D 4H26A 4TOYH 2PYEA 1WZMA 4N9GB 3BUYA 3C6SB 4U6VH 4O51B 4NNPH 4OD3H 1NBQA 3VG0H 4MD5B 2J8UB 4M3KB 1T03H 3G5XA 4NO0B 3M1BA 3G9AB 1BZ9B 4HKBB 4P9ML 4FQXD 5BOZG 2ICWJ 1U6AH 4JQVC 5EIVA 4NWTL 4JANB 4MJ6A 3ULVL 3ROOB 2NY3B 4M02A 1MCHA 3P77A 4JGUA 4DJMA 4R8WH 1G9MC 1V7NL 2IADA 3OB0H 5A2JH 4LSVL 1CN4A 4GT7A 2HRLA 3FN0L 1CTOA 3IKKA 1MCWM 4M6OL 1VKXB 3MXVH 2X4TA 1N6UA 1TJGL 3X12B 5EOTB 5ALBL 1GVIA 1CXKA 4IDJH 1V5JA 4LQFH 4ODUA 5KOVC 4JZOA 3JTTB 5HPMA 4CMMB 1KPUA 3RWDA 4YNYB 5D7KE 4G7VL 5IVOA 5IB3A 1Y18A 1E4XL 2ZUSA 5LAXA 3V5KA 1FV1A 4W6WB 3OKNB 4GQ9L 3FB8A 5D1ZD 2UWEF 3K2UH 4OAWB 1U8LB 1OB1B 5IMOA 4LDLB 1AQDB 3TH3T 2X1OA 3O2WL 3C60C 1REIA 3QIUC 2GTWB 4FFZH 4ERSL 1TZIA 4PJ7B 3SGJA 1XGTA 3VXRE 1JRHI 2B1HL 2OSLA 5MP6H 4LARL 1X5KA 4XI5C 5SWZB 3ARFD 5D7KD 4DAGL 4WWKA 1DR9A 1Q9KB 4JO2L 2YPLA 4TQEL 4UT9H 1KBGL 1P7KB 1VACA 3H0TA 4PV8B 1EBPA 4U0RB 1DL7H 3JWOL 4HWUA 4K23L 4LF3A 5TH2B 3LH2H 4TNVK 5HGBB 4LAJH 4GAGH 2W0PA 5DJZA 4XH2A 4X5XB 3O4LE 1U41A 4HJGB 2R4SL 4KAQH 3G6JE 3SKJL 4HT1L 3VXRD 3O8XA 4HH9B 3C6SA 3SKMB 3BN9D 4O51A 2VMFA 3CVHH 3WFHB 3HRZB 4LASL 1CTNA 2MHAB 1WZLA 2AAVA 3MBEB 4BZ2H 1PDKA 4BZYA 2J8UA 5DD1L 1GGCH 3I9GH 3MRCB 1GZQB 4NO0A 1T5XA 2DQFB 4ZFGL 1PZ5B 3V0WL 1BZ9A 4HKBA 3OKDA 4QRPA 2Z31C 2AV7B 1I1AA 3LD8B 3GBMH 3ROOA 1Z9OA 3L5HA 4NHUB 4X0KB 3ZYIA 2EC9T 3V4UH 4XC3L 1IFHL 1H5BB 1MEXH 4C56B 5E24E 1HNFA 1Y6MR 1VKXA 2DTMH 2A6KB 1IQDB 3GSNH 3X12A 4G8IB 5EOTA 2ZSVB 4U1LA 2CK2A 4MQXD 5DD3H 3SDAB 1TITA 3PWLB 3JTTA 4CMMA 3S3SA 1M4KA 1F4AA 5TE6H 3EO0B 5BO1H 1NCCH 3UC0H 1C1EH 4YNYA 1Q9LB 4KK6D 5HYSB 1X5IA 5JHDE 2IAMC 4UV4H 2DQCL 4RWYL 4BQ8A 2R56L 3OKNA 4U1KA 4YQXH 4OAWA 5J9PB 5A2LH 1U8LA 3LMJL 1QRKA 2DS4A 5FOJA 1ZGLP 1AQDA 1RZKH 1KV3A 3CDFA 4YLQT 2GTWA 2X1QA 1TMCB 4PJ7A 1FYHB 1ADQL 4X6BB 3MLUL 3IFNL 5I1GH 4NHCH 1OTSC 1Q9KA 1RJCA 5JHDD 1ZV5A 1P7KA 4K8RC 4PGBB 4PV8A 1BWWA 3EZJB 3ZKXB 5E7BA 4F7EB 2WBJB 5JMRA 2WBKA 1IC4H 5TH2A 4MCZB 3HE6D 3QB7C 4R7NB 1T5WB 3QULA 5HGBA 4KV5E 3DO7B 1AY1L 4UILH 5HDQL 1GAFL 2ARWA 3AS3A 3IVKA 4EOWH 4V2CB 1YECL 4HH9A 3T0AA 2SEBB 3SKMA 4X7TB 3WFHA 3HRZA 2R39A 4XRCB 2MHAA 1MHEB 1OAQH 3MBEA 3MRCA 4PBWD 2VTFA 3HG1E 2DQFA 2YN5A 1PZ5A 3WNLA 1IM9A 5ADPL 1IARB 5GS1B 4PRBB 1AR1C 2AV7A 1KUMA 3MBXL 3RP1A 1FVDB 2FX9L 3PWNB 1YEKH 4NHUA 3GMQB 3ULUH 3PDGA 3B9VA 2F9BT 4HUUB 4A6YH 5KSUA 2Q87A 2H2SC 2ADFL 3C6LC 1H5BA 5I6XB 5CP3A 4C56A 2X4SA 3FB7A 5FUCC 2A6KA 3RGVD 3UTPE 1IQDA 3CSYB 2RIKA 5IROA 4G8IA 2ZSVA 3HG1D 4O2CA 2AJXL 2CUMA 5IB4B 5TF1H 4HIJB 3SDAA 1I7UB 3PWLA 2HJFA 4OF6A 5C0CD 5LGKA 2R0LL 4PGCB 3Q2CA 3WLBB 3EO0A 2FGWL 2EXWC 3L6FB 3FO1A 1Q9LA 4MB4A 3T08A 2J3SA 1EEUA 3O0RH 4X9IA 5HYSA 2XY1A 3S34H 1AXSB 5E8NA 5EZOL 1NC2A 3DV4B 3UYOD 4Z6AT 3U30B 5CMAB 3SE8H 1GRWA 5ADOL 4PJGF 2Q8AH 5J9PA 1XGQB 3UTPD 1J1XL 5BV7H 2D7TH 1IAIM 5HVWA 4OJFL 2DL9A 2VABB 4NJ9L 1RZJH 1FG2A 1U91B 1MFBL 2UY6A 5I19L 2D0FA 2HN7B 2XA8L 3VD3A 3O9WC 1SEQH 3MLSH 2O5YH 3EOYG 4PB9L 4JPWL 1N0XL 4PGBA 5KS9E 2X70B 5GZOD 3QUXD 3O2DA 5BRZB 1QVOA 4UNTA 1U8NB 4F7EA 2WBJA 2E7MA 1ZHLA 2EICA 5A40E 4MCZA 3NCJL 3PQYB 4R7NA 2BSRB 4OF8A 3ARTA 2E3VA 5T3XH 4IJ3C 1HYSD 4YK4B 4CU6A 4XCNB 4G80B 5E9DB 3V0VA 2SEBA 1NBVL 4X7TA 1HQRB 4G6JL 4MYWB 4XRCA 4EQ2A 2Y36L 1MHEA 2VDQH 2FEEL 1UM6L 2XQBH 3CFEA 1UXWB 1OW0C 3QA3B 3BX7C 4KRPD 3MUJA 1MF2H 2X4RB 5GS1A 4JO4H 1HKLL 2IJ0C 5L2KE 2O61B 1A0QL 2LFGA 4Q0XH 2FYYB 1E4XI 2HP4A 3GMQA 2D4FA 1J0ZA 5DWUH 2QSVA 2W07A 3B9EA 5IB5B 4HUUA 3TJEL 2ZKHL 5I8OL 2MWCA 2EDJA 5CLTA 2UZIH 4ZAKC 1MIEL 5H94A 3GIVB 1RUKH 4KK9C 4BZ1L 35C8H 1FORH 4CN4A 3EFFB 2F5AH 2NX5B 3WKML 3UTTE 5L2KD 4Z7WA 5JW4R 3WLBA 3WEXB 4TUKH 1X5YA 3SDCD 4XMLL 4ZFFB 1KEGL 1FH5H 2EDYA 4CU7A 2EYSB 1AXSA 3X14B 4UQ2B 4MXQD 4F9LA 3DV4A 1CLZL 2FHFA 3HC4H 5CMAA 1GIGH 5IJKA 1XGQA 2BY2A 1CLCA 4FQ1H 2VXQL 2OL3H 4I48B 4QHKI 2VLKA 1OLLA 3UTTD 1NCWH 3WHXB 2C3GA 5BW7A 5DEGA 1UKTA 3I50L 3SO5A 3ARBD 5D7LB 2DQDH 2X70A 2UV3A 2AW2A 3GRWH 1U8NA 1P4LB 3O2VL 2DQJL 1UJ3C 1KCKA 4WCYH 4YR6B 2OXGA 3PQYA 1NANI 2BSRA 5ICYA 4JM4H 3T04D 4HGWB 4XCNA 3UX9B 4G80A 1JZ2A 1WT5A 5E9DA 5EA0H 4OGAC 4JFOB 3G04A 4WU7B 1HQRA 1S9YB 4KMTL 2NY0D 2YUZA 1NMAL 2WK2A 3SDYH 1UXWA 4HGMA 4JG1H 3KHOA 3BWAA 2X4RA 1OWWA 2AXJA 2FYYA 3HE7C 1AO7E 5MENB 1DBKH 1DBAH 4KUZL 5IB5A 2J8UF 4YHZH 5CSZB 1JFQL 3GK8H 5I74B 1MCPH 3GJFH 2B8OT 3MRKB 5EH1A 3VU2A 3S36X 2YRPA 1HWGB 1JVKA 5BQ7B 3GUTB 3QJHB 1K5NA 5IVZB 3EFFA 5E99H 1QSZA 5D7IE 4N5UA 2HJKB 1WLHA 2NX5A 4KQ3L 5I1IH 1WWBX 3KR3H 3WEXA 1RMFL 1AO7D 4PGEB 3E6HB 4JKLA 1KENL 4L9LA 5DHYB 1NDMA 2EYSA 3X14A 4FXLA 4UQ2A 2W65B 3IJHA 1MRFL 4GS7C 32C2B 1B90A 1NAKL 3W39A 3ZYZA 3KPRE 5F21B 4WO4D 3GMMB 2VIRB 3T65B 4ZNCD 4Y2DB 4I48A 2BY1A 1A47A 1JHKL 3GSXB 1BD2B 4ZOBA 4S1RL 2AJSH 3AAZB 4YDLC 3KVQA 3WHXA 4K2UL 2NY7L 3MRQB 2FRGP 4FS0A 4KVCL 5HYEA 4NN5C 1IJ9A 4KU1A 5D7LA 4EN3B 1OQXA 2XZQH 4K3GA 1FP5A 5EO9A 3DRTB 1P4LA 3MODL 4R97B 4F3FA 3JWDL 3KPRD 3MLXL 3ZZ1A 3C5JB 3NPZB 4YR6A 4PJ7F 1AKJB 1MFCH 2DQTL 4TOYL 5EUKB 1ZHKA 5FF6B 4U6VL 4HGWA 3BZFA 3UZVB 4OD3L 4NNPL 1MVFA 5DFWH 1JF1B 1MRCH 4H1LB 4NP4H 3B5GA 4JFOA 3X3FH 4WU7A 2C3HA 4NZJA 1S9YA 3L5WB 1XIWB 4OFKA 2FZ3B 1XF2B 3P0VH 3TFKD 1U6AL 1WZ1L 4EXPX 3NH7H 1JTOA 1E4WH 3H3KA 2BP3A 3R1GH 5IT2H 1KLUB 1HH6B 3ZHLA 5MENA 3IU4H 2NCMA 3KPMB 5IM7B 3AY4A 1OP3K 1KB5H 1PG7W 3MXVL 5CSZA 2VLRB 3LQZB 1EVUA 5J8OA 2F53B 3MRKA 4GRLB 1U8QB 1AI1L 5GGQL 4G8FB 3WUWA 4LQFL 5DA4A 5BQ7A 3BOVA 3GUTA 3QJHA 3DUHA 5IVZA 2YRLA 3TO4B 3B43A 3D39D 3ELAT 2VXSL 4NQEE 1UT9A 4MCYB 3VFWB 5HDBE 1GHFL 4DN4H 1AFVL 2XZZA 4OZIE 2VZTA 4ZDHB 4PGEA 1BFVL 3E6HA 5DHYA 3F58H 5C3TA 4U1SA 2W65A 4AH2A 32C2A 1F11B 5CUSL 4GAYA 5GZND 3V6OC 3MRMB 3GMMA 4X98B 1EFXB 4NQUA 3T65A 4FFZL 3V95A 3S97C 2NY2B 1KJMB 4XAKE 4Y2DA 4LPUA 5CEYA 4GBXB 3GSXA 4KKAC 3VXME 1IQWH 4ONFH 3AAZA 1BREA 3D2UB 3T3ME 1M7DB 1E27A 5HI4C 2FEEI 3LIZH 1V05A 3MRQA 3N1PC 3AREB 1NGWB 3DWTA 1DL7L 4EN3A 1F2XK 4O02L 3LH2L 3DRTA 4CADB 3QXDB 2NY1C 3B2UD 4HKJB 3C5JA 2HAZA 1AKJA 3MJ9H 1H3UA 3NFNB 4KAQL 1EMTH 5EUKA 5FA4A 3VXMD 1JF1A 1KF9B 4BZ2L 1H0DB 4U3XA 4H1LA 5FDWA 1GGCL 2Y4SA 4KROD 4M5ZL 4P2CG 1XIWA 2BNRB 2FZ3A 2EE6A 3S6CA 1JPGA 3GBML 1CZ8H 3T0EC 4JFEB 1RJLB 5CHNB 3WHE0 1KLUA 1DSFH 1HH6A 5GRZA 4JFFB 5IFHH 3HFMH 2VR9A 3KPMA 5IM7A 4LCYA 5T1LA 1HSAB 5F89A 4Y4KD 1SYVA 2VLRA 1W72H 3LQZA 4OCSL 4GRLA 5L0QB 4G8FA 4KDVA 1TJIL 5KVFH 2WIMA 3WDIA 5TE6L 3TO4A 4PRPB 3MMEB 5BO1L 5FYJL 3UC0L 3UAJD 3F7YA 1C1EL 4KKBD 4MCYA 3VFWA 3VXUE 5FM4A 4ZDHA 3UXFA 2WANA 4N90D 1WZKA 1S7QB 3SGJC 1F11A 4WWKC 2CJUH 1RZKL 3MRMA 4KWUA 4MAYD 4Z7WF 4X98A 1EFXA 5JIKA 4ONGH 1PFCA 1GC1L 3LQAC 4FQLH 4TTGA 2R1XB 1KJMA 4F9PC 4XCEB 1LO4H 4GBXA 3N1QC 3ME0A 1A7RL 4WW1B 1ACYH 3TIEB 5I1GL 2OYPA 3UMTA 4M6AA 5I0ZA 3KLSA 4PY7B 3D2UA 4S1DD 5TJWK 4W6XB 3E8UH 4XBGB 4XPTL 3AREA 4FQIH 4AL8H 1MREL 1Z9LA 3EZ8A 2QSTA 3O8XC 3NIDF 5BV7C 5C0FB 5GS0C 1IC4L 3ZTNH 3MA9H 3RI5K 4CADA 1SM3L 3PDOB 4ZYKB 3IAPA 4OZFA 4HKJA 3R8QA 5D1QB 1UM5L 3IF1B 4EOWL 2R8SH 1EBAA 2QHRH 3KYKH 2VUOA 4YGVB 2GJJA 1I1AC 1OAQL 4X6FB 1H0DA 4J4PC 3BE1L 1FC1A 4KI5F 2BNRA 1J0JA 2YD9A 5HD8D 5E2VL 4B0MM 2NXZB 1FE8H 2V5MA 4JFEA 1RJLA 2EDQA 5CHNA 4HS8L 1OAYL 1QQDB 1TTUA 5IWLA 4QNPE 5JZ7C 1ZKAA 4A6YL 2NY5H 5K59E 3D18B 5I9QB 2Z0BA 4OUUB 4TPRL 1KB9J 4HXAL 1ETZA 1U3ZA 2QQKH 1HSAA 5FYJD 1R6VA 1O7SA 4Y16C 5GGRY 2DMKA 1MCFA 1A9BA 1TJHH 3PNWB 5T5FH 4PFEA 4NZUH 3CNKA 4PRPA 3MMEA 2HTLC 3SDDD 1IAKB 3VGHA 2E9BA 1F4WL 1KXQE 2QJDA 1BBJB 3O0RL 1T04B 3CZJA 3EYQD 4U49A 3S34L 4FQXB 3O6ML 2PTTB 4MB5A 5FDYA 5JUEH 4OGXH 4OLEA 2ZNWA 5J06A 1J0IA 3OQ3B 1S7QA 3JV4A 2PO6B 3SE8L 3VD5A 2Q8AL 4PPTA 1RIUL 1OAKH 1I9IH 2D7TL 2ZCKL 3KPSE 1UZ6F 2ZPKL 4JRXE 1LEGB 4NQCE 3KGRA 1RZJL 2IH3B 1A7BA 5C0DB 4ZFOB 1DBML 4WW1A 1DBJH 3TIEA 2XN9E 3CFKB 4GAFB 1HYRC 1SEQL 4PY7A 4B53A 4J12A 3MV7D 2BRRH 2A74B 4FXGB 4PRHA 4XBGA 3S9DB 4NQDD 5E8EB 1QR1B 5C0FA 3KJ4B 2E7BA 3KPSD 4DCQB 4JRXD 3PDOA 3MBEC 4ZYKA 1UXSB 3CFJB 5D1ZB 4P4RB 1D5MB 5TE7H 4HKXB 1P4IH 2XI9A 4YGVA 4QGTA 3O6LL 4FFYH 2VDQL 4X6FA 3KLDA 3OAYK 5IHLB 1FVCB 2QKIB 1IC7H 1W2KT 1GH7A 4JO4L 1H5BC 3ARFB 4HF5L 5FCUH 4Q0XL 3V5HB 5FO9B 1NMBL 3WNOA 4M5YL 3RIFK 3RPIB 1YMHB 1QQDA 5DWUL 5SWQB 4OUUA 5F71A 1F6AB 1U8HB 2BNQA 4TNWK 3ESUF 4ORGB 3QWRD 2F15A 1VB9A 3FOLB 3FONB 35C8L 4YC2B 1AR2A 3O41B 4L8DB 3CX5K 2F5AL 5E0QA 4P5TD 3VXRB 2Q8BL 3PNWA 1FVEA 2BHUA 3FL7A 1A64A 3IJSB 2J5LC 3MJGX 4Z18A 4OM1L 5JHLL 4TUKL 1OM3L 2VQTA 1IAKA 3BZDA 4N0CD 1SJEA 1BBJA 4U1GC 1FH5L 1T04A 5HI5D 4HIXH 5IMKB 3LDBB 2PTTA 3HPLB 2YR3A 3MLPA 3GEWB 3HC4L 2PO6A 3TGXA 3C5ZC 3HAEH 3O4LB 1YJDC 3G6JB 5KVGH 3P4MB 2VN7A 4TNVF 3GKWL 1NCWL 2IH3A 3BPOB 5E08H 5J3HD 4WHYG 4MNGE 5C0DA 2EIBA 4ZFOA 1A3QA 3WFDH 2YEZB 2WBJC 3CFKA 2C3XA 5I71C 2WQ8A 2D7NA 1LQSR 3OBAA 1JGVH 1IGIL 2DQDL 3KWWB 3GRWL 2I07B 4FXGA 4X6EB 5E7FA 1QR1A 3F6LA 2HWZH 4WCYL 3UYPA 5F3BA 4PD4J 3G5ZA 5DZOA 4JM4L 4DCQA 5K9OB 2GKIA 1UXSA 4Y4HC 2EDTA 4G6FB 3VRLE 3CFJA 4YHPA 5D1ZA 4P4RA 1T2JA 4XCCH 1D5MA 1WV7T 4D9LH 3PP3K 5EA0L 5GS1C 1QHPA 1NAMH 3TBTB 4DGIL 2R2BB 3FOMA 5C6TH 4KMQA 1GGIH 1LEIB 1FVCA 1KC5H 2QKIA 4ODVL 3QFDB 4HUMB 2ITDB 3ARFA 4YIQB 2IMMA 1MFDH 4D0DB 2KQNA 3V5HA 5FO9A 5JHDB 3RVWD 1FLRH 3RPIA 1YMHA 2XRAL 4DOHE 1BJ1H 1XF4B 1DBAL 3P9LB 5SWQA 4E0RB 4P4KC 1MCPL 1U8HA 3HE6B 3T0WA 4ORGA 3TV3H 3EDDA 1KN4L 3FOLA 1TVHB 5GS3A 5SX5K 3WLWD 4L8DA 5E99L 4I9WE 5FA3B 3VFVA 3VXRA 3IJSA 2W92A 3J7HA 4Q6YA 5I1IL 3REWB 4DKFH 4NNXB 2LE9A 3K74B 3T4AB 1AD0B 4PJCB 4KJPD 5DMGC 5IMKA 4I2XE 1BLNB 1CGSH 3HPLA 3MV01 4FMKA 3DSFH 2IEPA 3FQWB 2BMKB 5BW7C 4R4FL 4ZUUB 3O4LA 1N6QH 1VFOA 1LP9E 4WI7A 5FKAA 1ZLWH 4I9WD 3G6JA 1VSCA 5DXWA 1QLFB 1EEYB 3P4MA 4MSWB 1CFVL 4DKDC 2FO4B 3WUZA 1R3IL 4M43H 4KI5C 3RGVB 5B38B 1NJ9A 2XTJC 2YEZA 1HN1A 3HG1B 3S35H 4Y4FD 1WWCA 3EO1A 3DLQR 1G7HB 4TRPH 1XGPB 3KWWA 4XNQB 1A8JH 2AK1H 2NYYC 5F6HJ 1PLGL 1X4XA 2HYMA 4X6EA 3L95B 3OAUH 1YEJL 2IALB 1TCMA 1WT5C 1RIVL 3W11C 1G7LB 5K9OA 4LOUD 1F6FB 4FQQB 5KG9A 3VG9C 4G5ZH 2H1PH 1MRCL 5JDSA 4NP4L 3X3FL 4GAJH 2D31B 4QXTB 4UIKH 5CGMA 3TBTA 5B38G 2R2BA 3P0VL 3P4OB 3BEVA 4QTIH 5J12B 1LGVA 2DJ4A 3IXTB 1LEIA 5F7YC 1T4KB 4M1CC 4WUKH 2B4CC 3R1GL 3SGDH 3QFDA 2ITDA 1JWSB 1UACL 1H8NA 4P2QE 2J1KA 4YIQA 4D0DA 4RDQG 3RZWA 3OKEB 5TQ0L 3IU4L 4PRNB 2Z8SA 4XTRC 3QUXB 4KXZI 1TVBB 2PUQT 3CZFB 3RUGE 2X9XA 3P9LA 1W0WA 3GMPA 4E0RA</