3VXQA

H27-14 tcr specific for hla-a24-nef134-10
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
204
structure length
204
Chain Sequence
b'KQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLIQSSQREQTSGRLNASLDKSSGRSTLYIAASQPGDSATYLCAVRMDSSYKLIFGSGTRLLVRPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H27-14 TCR alpha chain
publication title Structure of TCR and antigen complexes at an immunodominant CTL epitope in HIV-1 infection
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 43
structure length 204
sequence length 204
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-09-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vxqA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vxqA02
3LEXA 3PGCB 4S1QL 5LGHL 5ISZE 2R0ZH 1XFPA 3O41B 3LSOA 1BQLH 3A67L 2P46B 1E6JH 3GIZL 5GS0D 5J13C 4OF0A 3BP4A 4L1DA 4Y4HD 5FYKE 3D87B 1OT1A 3DLQR 3QXAB 4DGYH 4TVPE 5FUZL 4FQCH 4JO4H 43CAB 5K9QG 1P7HL 3MLSL 5F88B 3U36A 3L6FB 4D9QE 4ZTPL 1XF4A 1RUPH 1NGZA 5JHDD 2D4DA 2IFFH 4XAKD 1GIGH 5GRJL 3UCRA 1FH5L 4M6NH 4WI2A 4OD3H 4XMLH 3HUJE 4AYFA 5CSZA 4MNGB 1AD0B 2R2HA 5I0DA 5JMRA 1W0WB 3LKSB 3MMEB 5EC1B 2PR4L 5BMFL 3UDWA 1NGYA 5IMOA 5ILTH 5EC2A 1OF2B 1FBIL 2E27H 3WEXA 3O45A 3V0VA 3NCMA 3VDCA 2IQAA 3BZ4A 2VDOL 1MRCL 3RUGE 4WTXA 4NUJA 3JXAA 4KKCD 5EIQA 2LE9A 3BQUC 4CVZB 4YHIB 4LLVA 4PJGE 1JK8A 1XAUA 5LQBL 5E9DE 3UTTD 1MPAH 4ETQA 3T8XB 4G6FD 4R2GC 3U7WL 2DICA 1OAKH 5KZCD 4ZD3L 1QSEA 4KWUA 1KEMH 4JRYB 5TE6L 2BSED 3VXUD 3T2NL 2A74A 1NEZA 3VDAA 3WSQL 4QRTB 4RGMB 2EDJA 2HFGH 4R97B 1Z3GH 4Y4FB 4H1LH 3FRPG 5KSUB 4LIQL 4JDTH 4BSWB 1RZJC 2E3VA 4QTHB 4NQEE 1BQHG 5MI0C 5EU5A 5FM8A 1MWAL 3QDJB 5D96B 4P3CL 1FRGH 3FZUC 1A7BA 4Z0BL 3RZWA 3GI9H 1Y6NR 2VDKL 3MRJB 1MEXH 3LRSA 3X3FL 2VLJA 2VXSH 2MFNA 4DZBB 4LVEA 3U0TB 1WBZB 1TJIL 3BZFA 4WW1B 3RAJH 3RWFA 3WNLA 1SVCP 2APWA 2HFTA 1FGVL 1JHKL 4JY5L 3L7EB 5BRZE 3P2TA 1CLOL 3B8YA 1JWMB 3QIUD 5AWNH 4UAOB 2RFXA 3MNWA 2VQUA 3R4DA 3EFFB 5LJYH 5DR5H 3TV3H 1KB9J 4YXHH 3TM6A 4FABH 3WNOA 2F74B 3FQTB 4JZOB 4YPGA 3NA9H 4YHYC 5KJRH 3OGOE 3L5WA 4H5SA 4Z0XA 2ZJSL 3H0TA 4PJDE 4KXZI 1B4JL 2UZXB 5D2LE 2Z31A 4KV5F 1GC1L 5F1NA 4RGMC 1YEHL 4EI5C 4NGHL 2DD8L 5F1IB 1I7ZA 4LARH 1DBJH 1UWGL 1ZT4B 2BK8A 2YUZA 1XF2A 1W8OA 4OBRA 5INCB 1WWCA 4WWKA 1F8TH 5F72S 4R90L 1RMFL 4OI9A 1FG2B 4NHCL 4AEHH 1BJ1J 4MQ7B 5J3HC 4LSVH 2VR5A 4CW1A 5ACZA 4P2YA 3GZKA 3BUTA 1NGPH 3ARZA 4OLUH 4JQIH 4HFUL 1BBJA 1I85A 5E7BA 2KQNA 3LV3B 3QO1A 3B3IA 2ED8A 3GSRB 1IC5L 3MV9A 4U1GC 5GSVA 1GGIL 2YOCA 5CCKL 1CGVA 2IQ9H 3I50H 1JPTH 3OAUH 4G9FA 4LSTH 3EO9H 5CJXA 3RY5A 4QHKJ 5IWLA 3JWDC 1T7WA 2PKDA 5DJZB 1NCBL 4P2QD 1Q0YL 5DEGA 4L4TA 3TYFA 3WIIL 1MCPH 2YA0A 4W6WB 3WXWH 1RK0A 3GJFB 3QRGL 1QFWI 3DVGA 4AH2B 4K71C 3B9KD 4JO2L 3V4VH 4PJAE 5EU6B 3BP6A 4G43B 4TNWK 15C8L 1FDLL 3NIDF 4YAQA 4FZ8H 2J3SA 1FYTE 3QAZC 2DLIA 4IOFC 1IEBB 2OX5A 3TA3A 4P4RB 3VXMB 5EH1A 2YD5A 3EYSL 2NY3D 4X0KB 4P2RB 2P8PA 3CH8A 1VFBB 2Y7QA 1BZ9A 4P5KB 2NZ9D 4XNXL 3QDGE 5DUPH 4Y5YC 1JV5A 4GUPA 1S7VB 3CPLA 1A7NL 5HGBB 1ZANH 2DKMA 4I2XE 1ITCA 4NYLA 5J9PB 2R1XB 3SDAA 4XXDB 2QADB 4JVWA 4OFVA 2FR4A 1JBJA 3GKZA 2CIKB 1WAAA 4PRIB 1BD2E 2QBWA 4NM4L 1T3FA 1N6QH 3ARFB 5BOZG 3JVGA 3M17A 2O61A 4PV8A 1KCVL 1Q9WA 1A7OL 1SYVA 2DYPA 1FGNL 5HHVH 3SQBA 1FO0B 5JW4M 5IW6A 4RCAA 3S36H 2OTWB 4EXKA 2VDPH 1CE6A 1YNLH 1TVBB 2FL5B 1INEH 4L3EA 4KRPC 3RZCC 1U42A 4WUUB 3U30B 2ESVB 5KSBB 4OCRH 3EHBC 2FJHB 1SVZA 2H32A 3OJDB 2YZ1A 4J6RL 4NKIL 4X9HA 2HVKA 1DBBL 4JREB 1DUZA 3EO1B 3PWJB 4QOKE 2BXYA 3GSNH 1A1MB 5D6CA 4Z78B 3MFGB 1IT9H 1CZ8L 1N0XH 3QQNA 4YGVA 5MEOA 2EC9U 3EOTL 2R0LH 4OI8A 1A4KA 2JJSA 1MIMH 1Y6KR 5E8EB 2G60H 4MA3B 4XCYA 3WJLC 2FH8A 4PRPE 2NW2B 2DL9A 2AJUL 5I8OL 2YD1A 3BW9A 1DQDH 4FQPA 1T89A 1LNUB 3DX7B 4OF7A 3U2SA 2Q6WB 1DVFB 2F58L 1ZLVH 4NQXB 1LO0L 1EGJA 1R3IL 3EBAA 4XP9H 5HYJA 5DQDH 1KOAA 5TF1L 1U3HC 5ICYB 3HRZA 1R24A 2CUMA 4XAWH 5DZLA 2VL5A 1PVHA 1CFBA 4JHAH 1KC5H 3QDMD 4NZRL 1CFSA 4WEUD 4BUGA 4NRYA 3KLDA 2G9HA 4P5MA 5IV2A 1QA9A 5L0QB 1XF3A 3LKNA 4EZMA 5ADOL 4JREC 2X4TA 5IB4B 5E08L 4N1HB 4HW6A 3RWHA 5DA4A 2DJUA 2H9GB 4KRMB 2E9WA 3M45A 3V7MA 4OLYH 5FYLE 2GTZA 3MOBL 5D5ME 3ZT7A 1P84K 1MFEH 2FX9L 1JPFB 2EXWD 4AZ8A 5CD3B 2I5YH 3PUCA 2IAND 3QCTL 3REVB 1BZ7B 4GRMA 2OM5A 5BO1H 2VN4A 3DRQA 1VFMA 3O3DB 4ODWA 3TWCL 1MY7A 4JFEB 4HZLA 3HZYA 4EI5D 4M5YH 5IEHA 2E7BA 2ZSVB 3RVUC 2CKBA 5DRWB 5HGDB 1I75A 1I4FB 1MCWW 3QEHA 4PTTB 1N5YH 4EN3B 2X9WA 3MLTB 3MXVH 5J3HD 4HUUB 4RAVB 2RCSH 2GSGA 4LKCA 4XCNB 5DTFB 2H26B 2BSSA 3QQ3B 1CD9B 3PF2A 2Z0BA 4G3YH 5E2UL 4KKNA 3EIFA 4PRBA 3IDUA 4Q6IA 5I1JH 2J12B 3QH3A 2HKHL 1PDKA 2XN9B 4CN1A 3QXDA 1JTPA 5F6IB 4GBXD 1WFTA 1PZ5A 5DD6B 2XNAB 4L5FH 4DAGH 5E00A 3IXAB 5LCVH 5GISH 3MLUL 1IGML 4PGJA 4ZTOH 3PWUB 2IPKB 3RUGF 4JFXA 5F7DA 1X5GA 2HWZH 2Z93A 1HI6A 3H9HB 3G6JB 5JA9A 1T6WA 1NGQH 1ZHNB 1KIRA 2ITDB 1ZT1B 4O58H 4NQVB 4PP1C 2J4WL 2PUQT 1AGEB 4UINL 2X4RA 3WD5L 2IFGA 2XTJC 1UM6H 3NBNA 4LLYB 2FSEA 2AXHA 4GQPH 4W6XB 1BVKB 5DQ9A 4ZSOB 4TUOA 1HOCA 3VFOB 3FOLA 4RGOH 4OZFH 3P11L 3D3VB 1YMMA 4EN3C 2VLLB 1CI5A 1RIVL 4ONGH 4W81A 1WZLA 3TH2T 3UBXG 1RHHB 1HHKA 1NCTA 3H8NA 2EC8A 4WY7H 1EEYA 2VISA 3ROLA 1MAJA 2YPKB 2FLBT 1MFBH 3SDDC 3QNZA 1FFNB 4L3CA 4HUMB 4Y4HA 5I8CA 1MJ7L 2CLRB 3JWDH 4DVRL 3D25B 4FQ2L 4XPBH 4CDGC 1LK2A 2QQNL 2Y06H 4JM2F 3HE7D 1WFUA 4J1UA 2Q8BL 1CT8B 3PXHA 5DRNB 1QBMH 3ZKNC 5K9JL 4FFYH 1CGTA 1UJ3C 5JHDA 1XR9B 1KIUA 2YD3A 3SKOB 1IKFH 5IB5B 3V7AE 4GAJL 1PQZA 3OKLA 2VIRB 1T4KB 4HEPG 4X6EA 4GAGH 1F11A 4X99A 5ISZB 1HHHB 3D2UD 2CKBL 3N1MC 1ND0A 1Y0LB 4H1LG 1VGEH 1JL8A 1UM5H 1AR2A 3V0AC 1X4ZA 3VFNA 2SEBB 4P5TD 4ZDHB 3WFHB 1HDMA 4YHZL 3FHAA 4OIAA 3UTTA 1CDJA 1OOAA 2Z4QB 1CLZH 4J2XA 1CF8L 4DK6A 1NGXB 4N5EC 1ZVSB 3D39D 1KV3A 3VXUA 1KIQA 5I17B 2V2WA 4FQCL 3HUJB 2CDGB 2ZKHH 5C0AE 1IAOB 4PJBE 4N0YL 1T0MA 1NC4B 3CCHA 1GIGL 4M6NL 4OAWB 2IG2H 4HMCA 4OD3L 5C0ND 3GSVB 3ILPA 3MACH 3TVMB 2ICWB 1SYSB 3C09B 4JZNB 4S2SA 4NC2B 3RGVA 1AR1C 3LRHA 1U3HD 2WUBH 4PJGB 5IW1B 3S88H 2Z8SA 2R1WA 1JZ3A 4NKMB 1R3KB 2B7DT 3ZKXB 3EZ8A 3I6LD 4APQB 1EHLH 3V0WH 5EUOE 2V9TA 3QIUA 5EO9B 1KT2B 3GRWA 1MPAL 3MQIA 2ZUQB 3L5IA 5FOJA 2DQTL 4WU5A 5GS0L 5K9OA 1BMGA 2FZ3B 4JFFE 5IMLB 5HSFA 5FUCE 3PIQB 4NQEB 5C08E 3GEWB 4IRSA 1G6RA 4WFHE 2V9RA 5HVFB 4PY8J 2EYRB 1PZUB 2HFGL 1DBAH 1Z3GL 4RFNB 3IXTA 5GRUH 4Y5VB 5DUBB 4X9BA 1NCUA 1NCWH 4FFVC 2IPTH 3GUTB 2UYLA 3O8XA 3DX6A 2EO9A 2X1PA 2DQDH 2Q1EA 2X70B 1GOFA 3KYOB 2GJ6D 3N85H 1U91A 2R1YB 1VFAA 1DBKH 2DBLH 4D0CA 5BRZB 3QQ4A 5FDWB 3PWPE 4HZAA 4ZUTA 1CICB 4ISVB 2BDNL 3DIFB 3TVMC 3IF1A 3WNNA 3C09C 5JNYA 1C16A 1X5JA 1IGIL 3VRLF 2X4SA 4CL7A 3S8WA 3RAJL 4MHHI 5C9KA 1U8LA 2F53D 1DQJB 1MVFA 4OFPA 2MMXA 3NGBB 2RJMA 5CGMA 4I4WA 4JGJA 4PJDB 5CGTA 3RWJA 3MJ9A 4U1IA 3K8MA 1I1AB 3KPOB 5D2LB 1QLFA 2PXYD 5DR5L 3TV3L 4YXHL 4FABL 3OAZH 3HI5H 2WSKA 1JVKA 2ZUQC 5KSVA 3HNSH 1LP9E 3GDBA 4YE4H 5CAYB 3NIFE 4PJFB 3MROA 3B9KA 4PJ5E 1UWXH 2YPLA 3BMVA 4NKDA 3W39B 4RFNC 1S7QB 4Y5VC 1P7QB 4OFDA 1ACYH 4X5XB 1QLRB 3CLEH 3L1OL 3P0GB 1D7FA 3G04A 1F8TL 3EYVA 5J11B 1I3VA 5H37H 3ZDYF 1GZQA 3MLPA 1OQXA 3WCYA 3BDXA 5HHMD 5TDPB 5GZNC 1J05A 4LSVL 1EEZA 4JM2C 3OAZK 4DQOH 1NGPL 4OLUL 4JQIL 3ARBA 3DX9B 4MZ3A 3B83A 3MRIB 4M5ZH 3ZTJG 2D3VA 4IMKC 3GSUB 3UPAA 1A6ZB 5HYQA 3ZKQD 3EYFB 1MI5D 3FN3A 3VXOA 3KPSB 4X4YA 3OAUL 4DGIL 1UWXK 1XH3A 4KK6C 3V52L 4OBSA 5IESH 1SJVA 3NGBC 4P4KC 1HHIA 3GRWL 3SDDD 4PJAB 2GITB 5SX4I 1JWSA 3P30H 1X4YA 5L8LB 1WF5A 1ZA3A 4RNRB 4X7TA 1MCPL 4JKKA 1FYTB 4FQHB 4LRNH 1KUMA 3O3BA 3VFGH 1JN6A 3RI5F 1FNEB 1RJYB 3RHWF 5B8CA 3VD9A 3DGGA 3H3PL 3SN6N 2EKSB 2CH8A 3STLA 4RRPG 2ITCA 3QDGB 4NM8H 2CIIB 5HGAA 4ALAL 4LP5A 5D5MF 3W9DB 2K1MA 1RAMA 1XF5A 1LWRA 5J11C 5EBMA 2GJZA 2HP4A 2R2BA 2CQVA 2F8OA 3LKOB 4WO4C 3ZDZF 1BD2B 4HKZA 3OAYH 1D6EB 5DSCB 3PGFH 1IAIH 3GNMH 5DUPL 2Q7NA 4KK8C 4U1KB 1ZVYA 2H2PC 4P23A 1DQQB 3KLAA 3WNMA 2CO6B 1DANT 3MJ9L 1YQ2A 2DJ4A 3SKJH 4XMKL 1CFVH 4X9IA 5DVMA 5C8JB 2E7LA 3S34H 3VWKC 1N6QL 1MIEH 1VACB 2HTLC 3ARGB 1HQ4A 3HI1A 5DVLA 3U82B 1A1OA 4BUHA 1YECH 4MD4B 2Y9RT 5GIRB 1CFNA 2AVGA 4N0RA 1UGNA 3OAYK 4N90E 4WDIA 1U6AH 3WUWA 2DQFB 3CFDA 2VDPL 3IVKA 1F58H 1TQCC 1JCKA 4QOKB 4OV6F 4F58H 1FVDA 3VFMB 4OCRL 4Z7UE 1H3XA 5D1QD 4FG6C 3SKNA 2JELH 3ELAT 3GMQA 3X11B 2GI7A 3VRIA 1PX4A 1LILA 2DB8A 2GW5A 4XNQA 4IJ3C 2J88H 1QBAA 3WN5B 3VD5A 2EYSA 4LDOB 3BWAA 4PJEF 3IU3A 4PRPB 1EAPA 1H5BB 1IT9L 1N64L 4R6UA 1AY1H 3ALWA 4PUBH 1NAMH 3QSKB 4I0PB 2LV4A 3VGEA 4K7PH 3K46A 3HG1A 1FSKC 2G60L 5EZOH 1NMCB 3OB0H 2BVYA 2IANA 4N9GA 4OLWH 3VJ6A 1JNNL 4N1EA 4Y16B 3X13A 3FCTA 3PE9A 1DQDL 4MJ6B 4ZFFA 1CBVH 2JK5B 4OIIH 1EUUA 2BHUA 3GO1L 4QRUB 1PLGH 5C0RH 5IUSA 3BJLA 3RIFF 1FHGA 1U8QA 1KB5A 5DMGC 3THMH 3T0EC 1MFAL 4WI4A 1MCLA 5B38G 4NBZB 4RIRB 1FIGH 2X5PA 4XAWL 3QWRD 4OCMC 5JORB 2JCCE 3T0DA 4JLRA 5MEPB 1ZGLP 4LMQI 4RZCB 4H26B 4MAYC 5DD3L 1OAZL 4UT6L 3OB0K 3DV6A 4WFED 1R3HA 4LBEB 3TFKC 1S8DB 2UWEE 1ETZA 3OKOB 1KTRL 1KBGL 1D9KB 5F6HI 3WN5C 3D0VA 4Z5RB 4OZFG 3NAAL 1FLRL 3EO0B 4NNYB 3JV4A 1IBGH 4HKBA 1ZLWH 2LTQB 4OLYL 1S3KL 5B3JE 4I3GA 4M6AA 4C56D 3B9EA 1H5BC 1IKNA 4LCCA 5FO8A 4PRHE 1S7XB 1OW0A 2I5YL 5I8EB 3MGOB 3BESR 4W4OA 5F1SA 3MLRL 1YEEL 5BO1L 3CFBB 3IDMB 2W92A 5T1KB 2AJVH 3V6FA 4M9PA 2FBJH 3CSBA 3G6AA 3TIDB 4KUZH 2VJXA 4GKSA 5MHSE 5IB3B 1YEDA 3BP7A 1A3LL 1G9MC 4LLWB 4AQ1B 3OTTA 3O6ML 1JUFA 5L9DH 1FNGB 1EAJA 5H35B 2RCSL 1KNOA 4JM2D 5J56B 2FCBA 1B4RA 3QIBB 4JFOB 5D72L 5FOBA 1ZLWK 1BX2B 1F3JA 4WJ5B 3I2CL 4QHMB 2D31B 2HJKB 3ZKMD 1EMTL 5GSRA 2G75A 1IAKB 4G8IB 4KK6D 2XPGB 2X1OA 4AG4L 1ITBB 5DRXA 4DAGL 4PJIE 4U4BA 3U79A 2YXFA 5LCVL 5GISL 1KGCD 3QNYB 1E28B 4WENB 5DK0A 2PO6D 3N1PC 4L8CB 4FQXB 4G8GE 4C57C 3HE7A 2VABA 3ZMRA 1RY7B 1A6UH 3F5WB 1JPST 1NGQL 1J88A 4X4XB 4F7CA 3O3EA 4O58L 5BV7C 1PFCA 2O5YL 2XV6B 3GIVA 4WNQB 5ABDE 3VH8A 5ALCH 3KYNB 4NWUH 1A14H 1T2JA 4R9HA 1KB5L 3TBWA 3D2UA 3PL6B 2XZAL 3GKWH 4RGOL 3GMOB 3K7UA 5D7KE 2ZUTA 1CR9H 4WO4D 2IAMC 5T1DL 4OD2B 3WMSA 4P5TA 1U8OA 5E8PB 4ONGL 5DFVD 3QIBC 4M1CC 2O5XH 4OF8A 4WY7L 4E41D 4Y2DD 5C09E 4L4VD 4HK0A 4P9MH 1Z9OA 4R7NA 1JRHI 1QP1A 2B8OT 4YHNB 3RDTD 2HT4C 1GGUA 2GCYB 4JFZL 1F13A 1HYRC 1FFOA 2ICCA 1IEAA 2R23B 3BKCH 2J8UA 3HPLA 3IDIB 1ZHLB 4LPVA 1U92B 2HTLD 4JFYB 3WFEH 1A64A 1TVHB 4KJWC 3PHQB 4XNYH 3O6FB 5J6HA 1FP5A 4XVUC 5A3IC 2A6JA 2VWEE 4U1JA 4YNYA 4MD0B 2W65A 4NFCA 5FYJD 1MUJA 3KNBA 1MLBB 3VWJC 1QUNA 2AERT 2MKLC 2DKSA 3IJHB 1BEYH 1WWBX 2FEEL 1NAKH 4YDIH 3N50A 3QDHA 5IFJB 1KCSH 1Q9KB 4LCIH 4FHBD 4HGMA 2OMBA 3KPNA 3UMTA 3PL6C 4ZAKB 4LEOA 3U83A 2EKJA 2CKNA 2VLME 1G0XA 5CHNA 4JPWL 3PNWA 4LFHD 2GHWB 1AKJB 2VMFA 4G8FB 1CLZL 4NUGH 1ERNA 5C0AB 4MD5B 3FRUA 1VPOL 4PJBB 2VTFA 4OKDA 1TXKA 4MNHB 1CG9A 4OZGE 1S9VA 2Q87A 1G7QA 3V8CA 1S7TA 3GHBH 5GJTH 1XMWA 1UXSB 4MA7H 5FXCH 2BSRA 5T3ZE 5IHUH 1ZVHA 4TPRH 3UYPA 1ZMYA 1LD9A 1NL0H 5AG8A 3QXVA 2GJ6A 4LQFH 2IG2L 1NBYB 3KR3H 2VLRD 5DMGD 3MACL 1AE6H 3T0ED 1MQKL 2NX5D 4HJGA 2HN7A 5EUOB 3S88L 5GZOD 1P9MC 4HF5H 3TO4B 5JOFB 2CLZA 5CP7B 5EU4A 5C0CA 3PWLB 5BXFA 3H9SB 3SDCC 5DJCB 1B0WA 1DN2A 3D85B 4X5WB 2ZOKB 4GQ9L 1MJUL 5C08B 1EHLL 4YBQC 4AIOA 5H37G 3AXLB 4PS4H 3OKDB 1RJZA 5DC0A 3ULSA 1XR8A 3BPCA 3S37H 3FB6A 3EKCA 2PXYA 3T3PE 3C5ZD 3HPJB 4KPHL 4I18B 5SWZE 2EEBA 3GSQA 4KHTL 3DX8B 1HHJA 4PG9A 1FG9C 3BKYL 5C9JB 5CBAB 1JE6A 4OZHE 5I19H 1LO2H 1FFRA 1X5FA 5C0BD 1QFHA 2FX8H 3EFDL 1V7MH 2B4CL 3PWPB 1BP3B 5FA4B 3NCFB 4POYA 2ZSWB 1J7VR 1G7MB 3A6CL 4BFIA 1Z9SA 1AO7B 5HDBE 2CXKA 2A6KB 4D0BB 1DBKL 2ARJQ 4NO5A 2DBLL 3ECBB 4GLRH 4Y8DC 5E8DH 5MEQB 4DVBB 1ZSDB 4S1RL 3DO7A 4QRQB 4ZS7H 5DJAA 2NY4B 4K2UL 4QY8B 1ZHBB 3K81A 3DHJA 1FIEA 3NFSH 3K8KA 3EDJA 3MRCA 2PYED 5E2TL 3RWEA 1N5AA 4Y5XB 3CUPA 4GAFB 3TO4C 3SJVB 3WKMH 1LP9B 3CXHK 3LS4H 4EDXB 4L8BA 1WGOA 1U8KA 3BEVA 4XH2A 3D9AH 4PJ5B 1HQRA 1S5IH 1M1SA 1AXSA 5C70A 1FVCA 4RISH 5D7JB 2QHRH 3KYMA 5JOPD 5L8JB 3BN3B 5MENE 1NDGB 4Y19D 5HXMA 2NY7H 1BIIA 4MAUL 3ULVE 4LASL 1AQDB 1A2YB 4NKOB 5B39G 3BT2H 1QQDA 3TC9A 4G7YH 1ACYL 5CZXC 2DJSA 2ADGB 1FQ9C 3T65B 4RSVA 4GKNB 4RFOH 4ZOEA 4I5BA 3MRPA 2YSSB 3MFFB 1HN1A 3X3GH 1UKQA 4WFFE 1G9MH 2V7NB 3QIWB 4E42A 1DBML 1LEIA 4M3KB 2IAMD 4M5ZL 1I3RB 4GRWF 3A6BL 1OD9A 3MNZA 3I9GH 4JFHE 4LAQL 2H2SC 4NZUH 2ZUYA 2NW3B 2ED7A 3C5JB 1AP2B 3EOYG 1KCUL 4AQOA 4BH8B 5IESL 5L88L 2FD6H 4LCYA 1C7SA 3UPRB 2XZZA 5FYLH 3RNKB 2JCCF 5EULV 4HKXA 1ONQB 3CZJA 3Q5TA 1QFWL 3LIZH 4LRNL 1CFQB 1QD0A 5FA3B 3VFGL 4JCMA 3BRDA 1W0YT 4CN6A 4Y1AA 4O9HH 1YMHB 1ZA6B 4LSRH 1KACB 5A3ID 1TCRB 2DL2A 3RI5K 5I18H 5HI5D 3VXRA 1R5VA 4YX2L 5I73B 5BV7H 3RHWK 3KPPA 3LN4A 4NM8L 5DHVH 1CDUA 1NEUA 4OQTA 5D1QA 1AHWC 1FL6A 2FYYA 1IQDB 5DGRA 3D69A 3BWUC 3PGFL 1IAIL 3QIWC 1JPGB 2FJFB 3NIGF 5TH2B 3K4ZA 3MRMA 1N59B 5D70H 1S78D 2KH2B 2HT2D 5DEFB 4ZS6C 3W0WA 5KVGL 1W0VA 1PG7H 3S96A 2XI9A 3Q6GH 1KTDA 4HG4K 4LKXA 3PABB 5KBNC 4JFDB 3HLAA 5JUEL 1KIPB 1MIEL 4TSAL 4M93C 1WTGT 1MFNA 2BCKA 3RVVC 4KI5F 1U95A 3NCBB 5T3XD 4Z7UB 1K5NB 1VEMA 3N9GH 5LKNA 4WW2A 2BNRB 1DANU 2I24N 2MCPH 1DUYA 4F3FB 4PJIF 4K55A 1F58L 5D1ZC 3TN0D 4PGZA 1QSFE 2AJZB 1P4IH 5JLZB 1R3LA 4F58L 4HIIA 3OL2A 4NRXA 4OFIA 2VOTA 1G1YA 1GGCH 4JANB 1KJ2B 4HS3A 4PRDA 5KSAD 3GBNL 3WHE0 1AD9A 4XI5C 5F7WC 1N6UA 4JFPA 1J5OH 2J88L 3SDCD 3OKEA 3MYZA 3H9ZA 1FZMB 4YDVA 5DJ0A 1CLYL 3TYGL 5C0FB 4NQUA 3QHFL 3IDJB 2N7AA 5I1KL 5K9KA 1BFOB 5DS8A 4NPYA 5GGVL 2R8SL 1NAML 4GG6A 3ULUE 4BFGA 2VDNH 4C56A 2JTDA 1KPVA 2EIZA 1F42A 5EZOL 2OK0L 1Y6MR 4RMSA 4WIQA 3TBVA 3QUZB 1H3VA 1CBVL 2DMCA 4ONOA 1YPZA 5FKPB 2EE2A 4YEEA 3RWGA 1P84J 5IMMB 4JG0H 2X4NB 1CXKA 4KTYA 3VXQB 2HVJA 4G8EB 5ANMA 4P2OB 4WI3A 2DQJL 2EE9A 5IJVB 2HA1A 5D8JL 2UWEB 1J1OH 4MXVE 1FIGL 3RIFK 5KN5B 4XC3L 2XOTA 3WJJC 2R29L 2ED9A 1K8IA 4OQTL 2ATPB 4KDTA 2VDLH 5EPMA 4JE4B 4ZFZA 1DLHA 1G1CA 3MRQA 5D2NA 3MBEB 3E3QC 1IM9B 5IVZA 5DK3A 2GAZB 4L3AA 1N2RB 5D7SH 3WS3A 2YRZA 4PJHE 4X6CF 1NBZB 4KZDH 3CVIH 1OGAE 2P5EE 4OCYL 4P57B 4XBGB 3CSYA 3GSWB 3K0WA 5HPMA 1DP0A 3EYOA 1FFPA 3CDFA 2PO6A 3P3YA 1RJLB 3MODL 1BQUA 1WCBB 4AIZB 3AGVA 3P77A 4B7IA 3LS5H 3MRFA 5JTWA 4D94A 3P4NA 1VEOA 1F90H 1SQ2N 4DGVH 1LEGB 3WS6C 3I6GA 3GHEL 4NQTA 1DDHB 1NUFA 2QR0A 5DJ8A 4KROB 1OWWA 1UYWH 4P2OC 1PEWA 3VGFA 4Z7QE 3VXSA 3IFOB 1PD6A 4CMMB 4IDJH 5CEXA 3AB0B 4GW1A 5CBEA 2F54D 5MERA 1JZ5A 1BOGA 1UZ8B 2NY6B 1OM3H 4E41A 3B2VL 2DM4A 3GMRA 4Y2DA 4OV5A 4LIQE 3GMMA 3RDTA 3I02A 2R0WL 1I7RA 4AJ0A 3IFNH 4OB5H 3MRNB 4Y4FD 5IFAL 5F7HA 1EO5A 3VXTA 2XXCB 2VLKD 3UYRH 4UT7H 1T1WA 3L9RA 2HG5A 5IFHH 1YN6A 2BNQE 2ZUVA 1Z6JT 5DRZA 3CDYA 1T04A 3D48R 3M8OL 1MCEA 1VFOA 1RZGA 2BZDA 4J12A 4YFLF 1REIA 1DLFH 4JN1H 5ALCL 4NWUL 5J12C 4NN7B 2ICWI 3VXNB 4DZ8A 4GRLC 4RA0C 2OP4H 4OZHF 5CD5C 2X4OA 3QFDB 3LPFA 5DK2A 4RAUA 5C09B 5F21B 5GJSH 3HAEB 1CR9L 2CRIA 4KI5C 4PJCA 2BX5A 3U9UB 2ARJB 4KROC 2K9UA 3DWTA 4XP6H 1CL7I 4PGDA 3K3QA 4Z7VA 2OSLB 4TSBH 4UDUA 5HDBF 4FMKA 2GQHA 4EI6B 3DETD 2HKFL 5A16A 3B9DA 3ILQD 3QT2A 1NJ9B 3P0VH 4JQXA 1A6WH 2BVPA 2A1WL 3RVTD 1FL3A 3BD5A 2AK4E 2OR8A 2AJYH 3FO9B 3NPZB 2W9DL 1I8KA 5ESAB 2BOBA 4QCIB 3IDNB 3H7BB 4G6MH 4LCWE 3WFEL 3F7VB 3MCG1 4UB0H 4XNYL 5KS9A 1SJEB 3MRKA 5TDNA 4ZYKB 4LFHG 4NNXB 1EXUB 1I8LC 3LPGA 1OB1B 4IRJB 3QCUH 4X6BB 1AI1H 1OPGH 2W38A 1HNGA 2VLRA 2APXA 1U3ZA 5IVXE 2NX5A 2PW2B 1JYXA 5D1ZD 5DEZA 4G7VL 3RA7H 3QG7L 1S9XB 4X7FC 3EYQC 5FK9B 2KBGA 3QDAA 5E1AA 4NN7C 3ZE1E 4HS6B 4PLKC 5EU3A 3ARQA 3BGMB 3J7HA 2Q8AL 4POZD 3BKMH 2FHBA 2P5WB 1O5DT 4X6DA 1YN7B 4OZGB 5C86A 3PJSB 5K59E 4K9EC 1KJVA 3DRTB 4M7LL 1X5AA 4GFTB 1N4XL 3C5ZA 1A1NA 1KENH 5BVPL 5D9SB 3ARYA 1EJOH 4BJLA 3PDDA 4JPVH 1IARB 4JO1H 3O9WC 3UC0H 1OTTD 4YEFA 5C0BA 4ENED 3DV4A 4S0TD 5IHUL 4U7SA 4U1HB 4ZUSA 5IR1A 1F4AA 3HC3H 4HQQL 4TPRL 4P48A 3TBSB 5EZLA 5DMKA 3T08A 1DQLL 1A7RH 1D5ZB 2CR3A 5TPWH 3FQXB 4PGBB 1ZLSH 3VXMD 2Z8RA 4X8XA 4OCXL 1IGFL 5FYJL 3AU1A 4P2RD 4DN4H 5J1AA 4I0CC 5GRYA 4HF5L 4E0RA 3TZVC 3B8SA 4I48B 3DECA 4NQDE 1Q1JH 4PP2B 2R4RL 3O4OB 3LKRB 2PYEA 3G5YA 1JGEB 1E4KA 3QQ9D 1I7TA 2EDNA 3JSSA 4PJ7A 4PYGA 5SWZB 3O3UN 1IC7L 2LAAA 2V7HB 3R8BB 1JTTA 4LOUC 3G6DL 4K23H 4PBWD 5I1AA 5FHBH 1YUHA 4TRPL 1IL1B 3FMGH 3S37L 4PRID 3QWQB 5IHBA 2AEIT 3S7GA 1V3KA 1N8ZA 1TZGL 3BXNB 3L5XH 2XKNB 1WWWX 1ZT7B 4FTVD 4HV8A 3ARFD 3C8DA 1CXHA 2OJEB 4QXUH 4Y19A 5I19L 4DKAA 4Z7WF 1HCVA 3NACL 5J7CC 2BRRH 5CMAB 5ACLA 3CMOL 4LGRB 3N06B 2FX8L 1WT5A 3FT3A 3GSXB 4FQIL 3QPQC 2J2ZA 1SBBA 3BHBA 3ARTA 4F9LA 1Z5LA 1Z9LA 3ARWA 1OCWH 2OL3B 3MC0A 4WUUD 5FECB 4N9OB 1UH3A 1AJ7H 3S5LB 4IIQC 4O02H 4OF6A 3DROB 4BQCA 3DVNB 4ODTL 3RTQD 1GXEA 4JHBA 3UX9B 3HE6C 1I9EA 5CS7A 2P1YA 4DUXA 4UI2A 5IBLD 3ZHKA 3GBLA 1J0JA 4J3OC 3SOBH 3O4OC 2R56L 3I3DA 1U41A 1YJDC 4H8WC 2X4PB 3D9AL 1D5MB 3U0PA 1PYWB 3HB3C 3VMPA 4RFEA 1FAIH 2QHRL 3I6KA 3VFUB 2LU4A 5D6DC 3C8KA 4HJJL 1MFDL 4TQEH 5ICXB 3U7YH 4GSDH 3UZQA 5CIPB 2HFEB 4GRWH 3BT2L 1FYHB 1ZK9A 2FO4A 1GAFH 5DJDA 3CVHB 3SCMB 5TDOA 5IBUG 1T5WB 2CJUH 3RGHA 3PV6A 3BH9A 4F15C 2C1PA 2Z92B 5IQ7H 1AXTH 4LLDB 3X3GL 4TTDC 5CD5D 2VXVH 1NFDA 4CDHA 1BGXH 1C5BH 1PW3A 1E4WL 1TFHA 1YNTB 3QEQE 4JM4L 5J1TC 4A6YH 4I9WE 2WINA 4KI5D 1WAAE 3VFVA 3KPQA 4PGCB 4BKLB 1U8HB 2NR6C 5I8KH 3LEVH 4NZUL 2ICEA 2ZNWA 4KK9C 4CADA 4L9LA 4G9DB 4OCSH 4XC1H 4E9LA 5F9OL 3MV8D 3OWEA 3SDXF 3VE0B 3ULVC 2NTSP 2L4OA 1WFOA 4EOWH 2NY2B 4NKQB 1CIUA 3VXPA 4KKAD 3SGDH 3BUYB 3MUZ1 1J0YA 3LIZL 2VC2L 3DHMA 3FFCE 2DQUH 4PJ8C 3IAGC 4Z7NF 3KPLA 4QTIL 1A9EA 4U0RC 2EH7L 1JNHA 4L3EE 4KMLB 4XPHH 5DJYA 4DW2H 4NJAH 3DTXA 3Q3GA 3UJTH 2AK1H 5DT1H 5CUSH 3P40A 3ZL4H 2DDQH 3QA3B 3LB6C 4KJYA 1J8HA 2H8PB 4URTB 3SKMB 5KTEH 5EOTB 3CAFA 1FZOB 4JFQA 4PLKD 5KSAA 2QL1A 3EJZC 1GSMA 3TIEB 4LGPB 4EXPX 4JB9H 1JTOA 2XN9D 2JJTC 5GS1C 1IGJA 4GOSA 2Y36L 2MKWA 2AJ3A 5INDA 3EOBB 3FQRB 5E8OB 3TCLB 1PG7L 4U7MA 1A6TB 3Q6GL 2E7HA 3MYJA 1LEKB 3VRJB 2PYFB 4RMVA 5BJTA 5HYIA 5JO5A 4LU5L 3F7RA 4Z7QF 2APFA 4ZUVB 3IKCA 2NY2C 5CJQL 3O9WD 3FJTA 3FONB 3WFZA 3RWIA 5FDYA 5I1LA 2QKIA 1QSFB 1IGCH 5DO2C 5FKAA 4ZUWB 2FB4H 3P73A 4ONHB 5DFTA 3BN9C 3N9GL 1W2KT 4PR5A 1LGVA 1T1XA 1A3RH 2GK0A 5I9QC 4LNVA 1U9KA 2B39A 3U48A 4XWOC 1UG9A 3O2DH 3FQNB 2BJMH 4PRAB 3D3VD 1GGCL 3L3DB 3T4YA 3PGCA 3QUKB 2IBBA 3O41A 3K4AA 4XVTL 1A5FH 5F9WC 5F44A 5GS2D 1G7HB 3VG0H 3ME0A 4XVJL 1X5IA 3HS0B 1WVZA 1UH4A 3FOMB 5BW7C 1NFIB 3MOQA 4ODBD 5HYEA 1LE5B 4YZFE 5JPMB 2W9EH 4WHYH 5A2FA 4K9EH 1OWRM 4AENB 2JB6B 43CAA 4EKXA 3O0RL 4NO2A 4XB7A 4JHWL 2YWYA 1E4XH 5F88A 5SWQB 3H9YA 4BZ2H 1CD1B 4X80H 3L6FA 1RUAL 4DOHE 4NBYB 2J7LA 4I3RH 4YXKH 2IADB 3VI3E 4K3GA 3ZDXF 1NPUA 1DEEB 4MNGA 1AD0A 1X5ZA 2CK0H 4HSQA 4JJ5A 5T3XL 1CDBA 1W0WA 3KHQA 3LKSA 1OLZA 3MMEA 5EC1A 4LVNB 4HIXH 2Q86B 1OF2A 1KJ3H 1J1OL 1RQ5A 2XZQL 5GGSY 3CFJB 2RBLA 4PJHB 5BS0E 4WUKH 2VDLL 1OGAB 1S7WB 2P5EB 4KVNH 2P44B 5HHOE 2GUOB 4BSVB 1ZXQA 4CVZA 4Z8FH 4WV1B 3OV6A 6FABH 1T1YB 3T8XA 5C3TA 5GS2H 3V6OE 2FIKB 2OTUB 4JRYA 4QRPB 5D7SL 4EUPB 5BQ7B 5MP6H 4UTBL 1MAMH 4FRWA 4QRTA 3SE9L 3OR6B 1MVUB 3ZE1F 4JCLA 5EORH 4Y4FA 1C12B 5IG7B 2DWEB 4HDIB 3BD4A 1M6OB 4RGNC 1JFQL 3EOAB 4Z9KB 1CTNA 4P49A 2N1KA 5KSUA 4BSWA 4BYHA 1MF2H 4KKBC 4QTHA 1NC4D 5FCUL 2HMIC 2DLGA 1T7YA 3QDJA 3VW3H 3P9WB 4QWWC 1RU9H 1YMME 4PJXE 5KVDL 4HH9B 1F90L 3MRJA 2GT9B 3AC0A 1BFVL 5JW4R 3MO1B 2XWTB 3DMMB 2VXQH 2BVOB 4DZBA 4C58B 1WBZA 4M7ZB 1UYWL 4QYOB 3FQUB 4APQD 4Q2ZB 3CK0H 2A6IB 3L7EA 1EHAA 1JWMA 1JZ6A 1MWAB 1CXLA 3MRGB 3EFFA 3OXRB 4N0UE 3VGGA 3QRFM 2CGRL 3FTGB 1MRFH 3FQTA 4JZOA 1YJDH 3T2PA 3B6SB 2BNQB 4ZXBC 4H8WH 3C60B 1J87A 2ZPKH 2EEDA 3IFNL 3EYUL 1MHCB 5DUMH 1GGYA 3DXAD 5JHDE 4XAKE 2EIBA 3ISWA 5IJKA 4HBQA 1LDPH 5C2BL 3WDHA 5IGXH 1CK0L 1ZT4A 2NXYB 5INCA 1NBQA 1F3RB 3S35L 3NH7H 4GKZA 1FG2A 4NO0B 4JN1L 4MQ7A 1QR1B 3ZYIA 4PJ9C 3JV5A 1YNKH 2OP4L 1BFSA 2VXUL 3LV3A 1GHFH 4YIQB 5GJSL 4Z18A 3GSRA 1M7IB 5JQ6H 1SY6A 1P1ZB 5E2JA 3L3GB 3PWVB 4MLSA 3BPNC 4XP6L 3WFDH 3VXUE 3E6FA 4RMUA 2CRYA 2IF7A 4UILL 2AK4B 1I1AD 4TSBL 4HPYL 2KZ1B 1QRKA 3EJJX 2ADIB 1JRHL 2B1AH 2GTWB 4LCWB 4MA1B 4D0DB 1WZMA 1TTFA 3P0VL 2X40A 4G6AC 3TT1H 5IMOB 2LAGB 4JPKH 4OZ4B 3GJFA 4PTUB 4AH2A 3KS0J 3ULVH 1UFUA 3O45B 1LHZA 2AJYL 3IRPX 5DJXB 3IU4L 2HTKD 3GMPB 5EU6A 5IVXB 1P7QD 4UB0L 4G43A 3F58H 3CFCH 3VMOA 2GYSA 4PD4K 2EE3A 3QG6B 3T2QA 1S7UB 1IEBA 5D1XD 3VI4F 4P4RA 4PB9L 4HT1L 1BQHB 3VXMA 3QCUL 1AI1L 1YY8B 4M4PA 1JHLL 3CDCA 5FCSH 4X0KA 4P2RA 4K3EL 2HFFB 1U8MB 3S4SG 1YEKH 5EZJB 1VFBA 1CXEA 3SQOL 4HBCL 4IMLB 4P5KA 3SO3B 1S7VA 4Q74A 4KZEH 2AABH 5HGBA 4GW5B 3KPSD 1A22B 1AGCB 4MNQB 1GC1C 2LQRA 5J9PA 2R1XA 4XXDA 5EU5B 2YUXA 1WIOA 2CIKA 1Q0XH 4PRIA 2BY3A 5C07B 4J3WA 5DVNA 2ERJB 1KENL 5E6IB 4HWBH 2AV7B 4LPTA 4ZNCD 3C6LB 4P46D 3ARFA 1EJOL 4MA1C 3QUMB 4JPVL 4NP4H 1V5JA 4JO1L 3UC0L 1EFXB 4WHCA 3UDWC 4E5XB 1WAAF 2CDFB 2P4AB 1MH5B 4W70A 3V9FA 1FO0A 3ZTNL 4LHUG 4NQDB 5HDLA 5TPWL 4OLXL 2OTWA 4BQ8A 1T03H 1TVBA 2FL5A 3UTQB 4WUUA 5E56A 4DN4L 4HUWB 2ESVA 3ZT6A 5I71B 5KSBA 5D7LD 2CLVA 2VNCA 1IE5A 2FJHA 1F00I 3OJDA 3GBMH 5ID1B 1XIWB 3K74B 2NY1B 3EO1A 3PWJA 2C3XA 3QUYB 4K23L 5A2IH 5FHBL 1A1MA 1RUQH 4HFWA 4ETYA 4Z78A 3QXTA 4P2QE 4HCRA 2GY5A 3ETBF 4FZEH 5LAXB 2DWDB 4XTRD 4LL9A 3ARXA 1K4DB 5E8EA 4QXGL 2QQKL 5CKAA 3CXHJ 4YHMH 4MA3A 1VERA 2C3WA 3ARGD 4XPGH 5GGTA 1CU4L 2NW2A 4P99A 3OR7A 4RGND 2HLAA 1LNUA 3MRHA 3DX7A 4ORZC 2Q6WA 1DVFA 3D18B 4JN2B 4D8PB 5CEZD 4NQXA 1EHXA 2AQ2A 2HMID 3G9AB 2AJSH 4V1DD 3QNXB 2AGJH 2DMKA 5ICYA 4UBDC 1AJ7L 2ZCKL 2XZCL 4PLJC 4QO1A 5HDQL 1Q38A 1Q8MA 1AGFB 1P4LB 3ARDB 1TNNA 4MJ5B 4OJFL 5I71C 2ZZUT 2C5DC 3FT2B 3MLXH 1SJXA 5DWUH 3HCVA 3QFJD 3SOBL 4OKVB 4CN4A 4ODUB 1YY9C 5IB4A 3QI9D 2NY1C 4DFIA 3RL1B 5DGQA 2H9GA 2OLDA 4ZOBA 4I0PD 1SBSL 4OM0H 4OD1L 4WWKC 3MBXH 5DJ6B 1C5DB 1JPFA 5CD3A 3B4NA 2DF3A 3REVA 1C1EL 1BZ7A 2WM0A 2EZ0C 1WZ1L 5HGGS 1YEIL 3T0WA 1O0VA 3O3DA 3RWDB 3U7YL 4JFEA 4QNPF 5JIIA 1I85C 2ZSVA 2OJZL 3MCLL 3KXFD 5I76B 3WIFB 5CEZH 3QEQB 5DRWA 4S1QH 3DUUA 3GB7B 1I4FA 1ED3B 1JNLH 3LQZB 1NKRA 1HIML 4PTTA 2PNDA 5CJXC 4EN3A 1S7RB 3MLTA 4HWZB 4HUUA 4RAVA 5HYSG 4WI5A 4PJ9D 4HMEA 4XCNA 5DTFA 2W60B 4U0QB 2VXVL 2Y5TB 3QQ3A 4N0FA 3QJHB 1UACL 4LSSL 5E0QA 4A6YL 5SV4A 4PGEB 4X8JB 3IFPB 4FN0A 5FUZH 4NT6B 5EBGA 5D93B 5I8KL 2XN9A 1XGUB 1D9KD 3MLSH 2PN5A 1R5WB 2H3NB 2FECI 3FFCB 3ZYOA 5DD6A 4MX7B 2XNAA 4M1GH 4HCRL 2D4FA 2HRLA 3DNKA 1HKFA 2ZG2A 2VZUA 1KPRB 3MV7B 1FH5H 4G6AD 4BFBD 3TA3C 4EIZC 3PWUA 2VRAA 2IPKA 3W5MA 1MCDA 1S5HB 2PR4H 5GGTL 3H9HA 3G6JA 2DQUL 2HVKB 4OLEA 1ZHNA 2ITDA 5E24E 1ZT1A 4NQVA 4HG4J 1M05A 1MJ8H 1VDGA 1AGEA 2W9LA 1FVEA 3BISA 5IQ9B 2VDOH 1MRCH 4LLYA 4DW2L 4NJAL 3EW3B 1F6AB 4F7TB 3QDME 1BVKA 2NPLX 4ZSOA 5CUSL 3SDAC 3ZL4L 2DDQL 3VFOA 2FATL 2Y07H 1UWEH 3D3VA 3U7WH 3MGAA 2VLLA 4ZD3H 2D7OA 2DS4A 4XT1C 2JB5H 3KWWB 4X9GA 2NY0C 3T2NH 3V4PL 25C8L 1RHHA 3FB5B 3WSQH 1KLUB 3JVGC 1KN2H 2V5YA 4JB9L 1KSRA 2YPKA 1YYLL 32C2B 2XWBB 1FFNA 1ZKAA 2FNBA 2CLRA 3T0AA 2VZ1A 3D25A 3KJ4C 3NVQA 1R24B 4P3CH 4FQXD 2G5BB 4Z0BH 5HVGB 1CT8A 4XNZC 5DRNA 1KELL 2X1XR 3CZFB 2J6EA 1KG0B 1RZ7H 5DYOB 1XR9A 1XF3B 3SKOA 1TJIH 5IB5A 4OIBA 2VIRA 1T4KA 1FGVH 4ZOCA 5TE7L 4ZO7A 1Y0LA 2K7PA 3Q2CA 1NBVL 3VGHA 1YC7A 4AY0A 5I16B 1OSPL 2SEBA 3BDBA 4OT1L 2O93L 3WFHA 2DQGL 1PAMA 3HHRB 4Z7OE 2ZJSH 3LOWA 1ZLUH 1B4JH 4Q6YA 2Z4QA 4XCEB 1T89C 5EFIB 1GH7A 3L3JB 2YUVA 1GC1H 1OTUD 3BZEB 1YEHH 1FZKB 1NGXA 5EOCL 1ZVSA 2DD8H 2F9BT 2FWOB 3OGCB 1UWGH 4PG2A 3HN3A 4EVNB 1XGQB 4U33A 1X7QB 1EV2E 1DJSA 1RMFH 4R90H 4LKCB 1QLEL 2CDGA 4NHCH 3WFBH 1RUML 3F6IA 4F9PA 1IAOA 3O6FD 1YQVH 1MHPH 2VLJD 3NCYP 4FP8H 2WP3T 1NC4A 5ICZB 4Q6IB 5CEYB 4OAWA 2HYMA 1IC5H 5BS0B 3IRZA 1GGIH 3GSVA 3TVMA 5C6WH 2ICWA 5CCKH 1SYSA 5DD1H 4JZNA 4ODVL 5HHOB 1ZLUK 1LO3L 4P59H 4PJGA 5IW1A 4UBDD 1MCSA 1BAFL 1II4E 1R3KA 1PKOA 5JW3L 2JJWA 4APQA 4ZAKD 2VZOA 3HI6H 4WUKL 4WHTB 4KVNL 1Q0YH 3WIIH 3QRGH 5EO9A 6FABL 1KT2A 1AKJD 2Z31D 3UBXB 2P8LA 1Q94B 2E7MA 5CGYC 5F97E 5KG9B 2BVEA 1OP3H 1CDCA 2FZ3A 5C2UB 3QP3A 5IMLA 3LHPH 1EX0A 2DBJA 3PIQA 4NQEA 2P43B 4OFYD 4FFWC 2ZUSA 3IDYB 3QUXB 1MAML 4N8CL 4WWKD 1EZVX 1HOCB 2EYRA 2C4XA 2MHAB 3FOLB 5IKCA 3DXAA 2XKUA 5DUBA 4PJXB 3EYSH 3GUTA 2P7TB 5AG9A 4QRRB 3E0GA 1I9RL 3KYOA 3PQYE 4Z95L 2OYPA 2W91A 2EH8H 3EZJB 4QT5B 1NC2D 2BMKB 1JF6A 2R1YA 4XNXH 3MV9D 4HIEB 3ES6B 5D7IF 5A2JH 4Q6IC 5BRZA 1RU9L 5FDWA 1A7NH 1TPXC 4Y4HB 5I8CB 5IHLB 4G9FD 1CICA 3GGWB 4ISVA 3DIFA 1OP3K 4N0UB 2YN3A 3TGXA 2ADFH 1V7NL 3H9SD 4H1LB 4NM4H 5DZOA 3D85D 5JZ7C 1DQJA 2AAVA 4NOFA 1DL7H 4LVOB 1K9TA 4WFHD 3BEWB 4PJDA 3D39E 2BOCB 3DPBA 1I1AA 3KPOA 5D2LA 1A7OH 3ZHDA 2VQTA 4H8WL 5I1CL 4ORGB 5E4IA 4X4ZA 4MJ2A 4YDLC 1V3JA 4JQVA 3V95A 3TA3D 5DUML 1PJ9A 4L8DB 4PJFA 4U3XA 3W39A 1LDPL 3QZWG 1U8PB 1B90A 1S7QA 1P7QA 3WDJA 2AQ3A 4X5XA 1QLRA 4B53A 3T1WA 1AO7D 4J6RH 4NKIH 4N8VG 5D1XA 1DBBH 1UB6A 3CFEB 4N68A 4G6FB 3L3OB 5FM4A 5KZCB 3QO0B 5TDPA 5GS0C 3I6LE 2NY4D 4I77L 4YDJA 3SDAD 3NFPB 4Y4HC 2B5IB 3DX9A 3TT3H 1GHFL 3LN5B 3MRIA 1HZHH 3EOTH 3GSUA 5HJ3B 1JIBA 1A6ZA 3SJVD 5JQ6L 1XZ0B 2NY0D 3EYFA 4XCFL 2ADJB 1J18A 1CL7L 3KPSA 4MS8D 3C87A 4J7RA 3CSPA 4LF3B 4PJ5D 5I8OH 3K2UH 4PJAA 2B1AL 2GITA 5DFWH 2IH3B 5D7JD 4S2SB 5CJOL 2F58H 4RNRA 4JPKL 1UM4L 2W0KA 4P46A 4WU7B 1R3IH 1FYTA 4MWFB 1HINH 2GJ6E 2X4QA 4OZIA 1VB9A 1XF1A 1K4CB 1FNEA 1RJYA 3TPUA 1GPOL 1GGTA 3IS1X 3MJ8A 2EKSA 1RV6X 3QDGA 2CIIA 5JW5A 4PLNC 3W9DA 2F53E 3OJVC 3S36X 5D7LA 3LKOA 1YEKL 1BD2A 2AEQL 1D6EA 5DSCA 1GVIA 5DA0B 3MOBH 4KZEL 1HILB 3TNNB 4U1KA 1UENA 3H3KA 2NXZB 5CWSA 1DQQA 3WHE1 5EU7C 2D7TH 3UPCA 1Q0XL 4J3TA 3TWCH 4UZGA 4JEGB 1VFAB 4GS7C 4D0CB 4QHLB 4R8WH 5C8JA 1U58B 1ORQB 3DI3B 3MUY1 4ZUTB 5HTSA 3UTSE 5KANI 3O3AB 1VACA 1K85A 3ARGA 5HYJD 3RGVC 3MOAL 3L95A 4BK4A 5FEBA 4MD4A 5GIRA 1GZPB 43C9B 4F7EB 5HHME 2JKXA 2AJXL 4EEEA 4F33B 1F6FB 4V1DA 2DQFA 2H32H 4XNMB 2ZUUA 3QIUC 4QOKA 2X10A 4LAJH 2BVQB 2HKHH 1RPQA 2XRAL 4LLMB 1P4BL 3VFMA 4P2QB 1MI5E 1FNSL 3X11A 2X44D 1HYSC 4JRWA 3WN5A 2ORBL 1DSFH 1IGMH 2VXTH 1RUQL 5I74C 4PRPA 1C08B 3QI9A 1H5BA 3O8XC 2W1NA 5LVEA 3C9NB 2I27N 4I0PA 4JFDD 4JZJB 1RZ8B 3NCJL 2NY3B 4CVXB 4CU7A 2D0FA 4YC2C 4YHLH 1EH9A 4NN6C 4XPGL 1MFCH 1EGJH 4Y16A 1WBYB 3RWCB 4MJ6A 1SM3H 2FLRT 4RQQB 35C8L 3QXWA 4XPTL 3TNMB 2BNRD 1A6AB 1QPXA 3P11H 3HMXA 3GJEB 3KXFA 3FO1B 5EIIB 2AJSL 5L7XL 1RIVH 3DOSA 3BGFC 2AGJL 1HHIB 1UADC 4RIRA 2EEAA 4CBPA 5JORA 3MRRB 5MEPA 3V2AR 4RZCA 1S9KC 4KY1L 1MJ7H 4H26A 1JN6B 1A6PA 2BERA 4DVRH 5M95B 4FQ2H 1P53A 3V5HB 4X6FB 4LBEA 5DHXB 2QQNH 3ZLQC 2A83B 3DGGB 3OKOA 3B9KC 5FAAA 3D1MC 3KAAA 1D9KA 5E6YA 5LGJB 4Z5RA 3JV6B 4KAQH 3EO0A 4NNYA 4BFEA 5HGAB 5FYKU 5K9JH 5JDSB 1Y18B 3MBXL 2C3VB 1XF5B 4LCUB 1S7XA 4NHUB 1CDYA 4ZQKA 5I8EA 4GAJH 1UCBH 3QUZD 4JZJC 3CFBA 5J4MA 2CKBH 3IDMA 5T1KA 3G08B 1UJTA 4XZUB 3SE4A 4CVUA 3ARBC 3TIDA 3TP4A 3BQUB 4HWEL 2NZ9C 4HIHB 5CEZL 5IB3A 1QRNB 4UOJA 1RFDH 4LLWA 1JNLL 4R2GB 3OKNB 4YHZH 5D71L 1FNGA 5H35A 12E8L 1FC2D 3RPIB 5HVHB 3Q0HA 1B0RB 1B3JA 4IOIB 3NMEA 1U36A 4HGWA 4JFOA 1W72A 1CF8H 1BX2A 2IMNA 4JDVB 4WJ5A 2GSIB 5BVJB 5IB1B 3SGEH 4QHMA 3W2DH 1NKOA 2HJKA 3HI1B 4K7PY 4DEPB 1IAKA 4G8IA 1J8KA 5MI0B 2XPGA 4QEGA 5B8CC 4M1GL 4N0YH 3VG9C 1CTOA 3IVKB 1BREA 4G5ZH 4JKPL 1E28A 1BF8A 5EB9A 5TE4L 4FQXA 1WITA 3ESUF 3G9VA 1LO4H 3VRIB 3QDMB 2Z8VC 3MPCA 4XNQB 3F5WA 1WEJH 3ARPA 4X4XA 1UKSA 1MJ8L 4WNQA 3F7PC 3OG6B 5SV3A 3KYNA 5GRWA 4MYWB 1RSFA 2OQJA 4P23C 3A6OA 2V17L 4YHYB 2Y07L 3GMOA 2L7JA 1QFUL 1UWEL 3MSPA 1HH9B 2DQTH 3R0MA 4WFEE 5B38B 5GS0H 4OD2A 1BIHA 4NZTH 5E8PA 5D4QA 2JB5L 5HVHC 2E7LC 4Y8AA 5CLTA 5AYQA 1JZ2A 1Q9LB 2JJUA 2NY6D 1KN2L 4JO3H 1OVZA 4EI5B 4BH7B 1T21B 4GG6E 2C3HA 4C56E 1ZS8B 3UJIL 4YHNA 4DEPC 1F4XL 4EQ2A 2GCYA 5GGRB 4FQQA 4H25B 4OZFB 2R23A 2X42A 5CLWA 5ESQA 3IAPA 3IDIA 1ZHLA 1U92A 4JFYA 2QV2A 1NEZG 3RGVD 1TVHA 3PHQA 3O6FA 2WZPD 2BDNH 4U1GB 5DDHB 5CP3A 4Y88A 5I1EL 1RZ7L 1IGIH 1LE9B 1EBPA 2X4UB 1MLBA 4KQ4L 2O5ZL 2J8UF 5TQ2L 4F57L 4UV4H 3IJHA 4GBXB 2XICA 3TEUA 5F70A 1X9QA 2ZCLL 1Q9KA 4PY7B 5JHLL 4J4PD 4XNUH 4AL8H 5JXED 4PY8I 3U6RB 4ZAKA 1HYSD 1W72L 4K71B 4IRSD 2EXWC 1CIDA 4R4ND 3VGBA 1TTGA 1R3JB 5EOCJ 1AKJA 1NMAL 1KGCE 4G8FA 1VADA 5C0AA 4MD5A 4PJBA 3QAZB 3O8XD 2P48B 4MNHA 4OFYA 4PREB 3L1OH 5EN2B 4U2ZA 3WFBL 1UXSA 1E27B 3CFIC 1YQVL 2FHFA 1MHPL 3OF6D 4FP8L 4Y5YB 5K9QI 3CLFL 1NC2A 1E6OL 4IRJD 1NBYA 3MR9B 5DD1L 1KLGB 5EUOA 3ORJA 4P59L 1DQML 4DGIH 3SE8L 4R4BB 3NZHH 4ONFH 5JXAL 2WV3A 3TO4A 3V52H 4F7MB 5JOFA 1IGYB 4GBXC 4FFZH 2Z91B 5CP7A 2EDKA 2IEPA 3PWLA 3GRWH 3F7YA 3H9SA 1K3IA 2P5WD 5DJCA 4Y4KD 3D85A 4L4VE 1IKNC 2ZOKA 3HI6L 4X5WA 5C08A 4LCCC 5FM5O 3LRGA 1OW0C 3OKDA 1G6RH 3O3EB 4B50A 1BHGA 4MXQC 1I9JL 2DLEA 2YPLD 3HPJA 4I18A 1OY3B 3WDIA 3LHPL 3DX8A 3VD7A 3OHXB 1RK1A 1CQKA 2AXGB 3PQYB 2YXMA 2Y72A 5CBAA 3H3PH 3BPOC 4GMTH 4HS8H 3HNVH 1RIUH 1UEMA 4KRPB 3RZCB 5JOEA 5L6YH 3NA4A 4ALAH 4UNUA 5FYJE 3RY4A 3U0WL 3FQWB 2VN7A 5C92A 5FA4A 5B21A 3EDEA 3ARBD 1G7MA 2EH8L 2PW1B 1AO7A 2R4SL 4KKLD 4UU9B 2A6KA 1QEWB 4D0BA 1NH6A 3ECBA 5MEQA 4DVBA 1ZSDA 4FQJH 1CXIA 4QRQA 3TO2B 4QY8A 1DQTA 3D39B 1ZHBA 3FB7B 1VGKB 4WEBH 4Z7VE 5LXGL 5KW9H 1ZEAL 2YD9A 3MJ9H 2ADFL 3BP5A 1HEZB 4GW4B 4XMKH 4D9RD 4Y5XA 4HX1B 2E8ZA 1DL7L 3SJVA 1LP9A 1TQBC 4EDXA 3VFPB 3DSFL 3HE7C 2A6JB 4TUJB 5KVEH 2W65B 3OKYA 4PJ5A 2WBKA 3VRLE 2WQRA 5GGUB 3HRPA 5D7JA 4YWGH 2D03H 4XPFH 3ZTJH 1NDGA 1U3HB 2E8YA 4XP5L 4MDIB 2CRMA 3B5HA 4JDZB 1Q72H 1HNFA 1AQDA 4PRNB 1A2YA 1OAQL 1U2HA 4NKOA 5GRZA 5CKGA 2VLRE 4KK5D 4JAMA 5DMIH 3T0EE 2ADGA 4POUB 5BZWB 2NX5E 4P5TC 2HJLB 3T65A 5F7KC 4GKNA 2DKUA 3LH2H 5B22A 1MRDL 2YSSA 5DI8B 5IVOA 1NDMA 1NANH 3FRUB 4KJQD 4P23D 2XG5A 1J86A 4P2CG 2V7NA 1BF2A 3HZKB 3OQ3B 4PD4J 1N64H 5K33A 3TT3L 4H88L 3O2WL 1I3RA 1HZHL 3ZDYE 2BSRB 2DM3A 4GXUM 2B4CC 2NW3A 1LD9B 1MHHB 1AP2A 4BH8A 3BE1L 1JNNH 2AKRB 3GMNB 5CZKA 4O51B 3K2UL 4TULH 3UPRA 2YC1B 1XCTA 3FT4B 3RNKA 3GO1H 2OS7A 1ONQA 5C0NC 2COQA 1CFQA 3AS0A 5FA3A 1MFAH 2CLZB 1HINL 2OCFD 2N7BA 3BAEL 4X7CC 3SCMD 2F53B 4NJ9L 1ZA6A 2APBA 1M71B 2K3TA 1TCRA 5FGCE 5I1IL 5DD3H 5DMJB 1OAZH 4UT6H 2PYEE 4U6VL 4PJ7E 1WBXB 4G42B 4UMGA 1KBGH 4YGAB 1IQDA 1I8MA 2OR9L 4L8SB 3NAAH 4X83A 1FLRH 5F89B 3KGRA 1S3KH 2FJFA 1UVQB 3MA9L 2HJFB 5TH2A 3UTSB 3HG1D 3HKFA 2EDWA 5JOPE 3MLRH 1JGVL 3ZDZE 1YEEH 4Y19E 2D7TL 2W0FB 4FXKA 4DK3A 2XTJB 4TUKL 4NDMB 2R2EB 3PABA 4LNRB 1ES0B 1M7DA 2B1HL 3WO4B 4R8WL 5HHMB 2KUTA 2Z8WC 4JFDA 1NCCL 3BO8A 3IS0X 1A3LH 2VQ1B 5LBSH 5DXWA 4RX4D 4C54A 3O6MH 1JZ4A 5HHQB 2H41A 5DZNA 1K5NA 4U1NB 1MI5B 2BNRA 3PGDB 4BSJA 5B39B 2DQCH 5D72H 4OM1H 4L8BB 1EHNA 3OPZH 4Q0XL 3WHXB 3JBG7 3I2CH 4P9HL 4F3FA 5A2KH 5DURD 5ERWB 3MRLB 3SDDB 1EMTH 1MCWM 5JLZA 3WFCH 1M4KA 2PXYC 4JANA 1KJ2A 4WW2F 2OZ4A 2ZOLB 4AG4H 1A7PL 2FGWL 5LG1A 3WXVH 3CX5K 1FLTX 4NC1E 1DSFL 2VXTL 1FZMA 4L8SC 1H3PH 4BA8A 1DTUA 3LKPA 5C0FA 1UJ3B 4WGWB 4MXQD 1BFOA 1T5XA 3E6HB 3MRPB 2O5YH 2Q7YB 1RVFH 1B88A 4YHLL 4PJEE 3WO4C 2DN7A 1MFCL 1EGJL 1MY5A 3L5HA 3IDXL 1KB5H 3QUZA 1IQWH 1SM3L 2XZAH 5FKPA 4GG6F 1CVSC 2NY5L 5IMMA 5T1DH 1OP5H 5I1HH 5ITBH 2EDOA 4FQLL 2X4NA 3VXQA 4P2OA 1NAMB 1LO5B 5IJVA 3MNVB 2UWEA 1YPZF 5KN5A 1L7TL 1QKZH 2ATPA 1MCKA 2ATKB 3QJFB 2DIJA 3ULUD 4GG8B 1L7IH 2D9QB 4JFZH 4UIKL 5EOQL 5JMOC 3MBEA 1IM9A 1WCQA 8FABB 2GAZA 3OX8B 1N2RA 2AEPL 1T6VN 3DVFA 1NBZA 4KAQL 4P57A 3GSWA 1OP5K 4O4YL 2WBJD 4QHUB 1AXIB 1UCBL 1RJLA 4BQ9A 2ICES 1MHEB 1WCBA 1TZHA 3DVIA 3D69B 4AIZA 2D9CA 4CJ0A 1QBBA 3RVXC 3P9LB 5IROA 1SEQL 3IJSB 5F3BB 1RFDL 1LEGA 4KU1A 1XGRB 1DDHA 1ROWA 4JPWH 1Z9MA 4EIGB 4JKWA 1ZGLB 1B2WL 1U8IB 3Q1SL 5H94B 3IFOA 1KJ2L 1NMBL 1VPOH 4CMMA 3MUGA 2P24B 3W2DL 1IZJA 3N1QC 1PSKH 1FZJB 3HC0B 4O5LL 1UZ8A 2OBGA 2AV1B 2IH1B 4QRPD 3OBAA 5DD0L 4UV7L 3MRNA 3LY6A 4G5ZL 5KOMC 5C7XL 1QHOA 2QSTA 3ZZ1A 3RUGB 4N0CD 4JRXE 3MRBB 4XBPB 1MQKH 1PKQA 1LO4L 3BIBX 3F12B 4KH2A 2AEWA 1WEJL 1T66D 5E9DB 5D1QC 1L0QA 3P4MB 2BSTB 5DJ0B 3D6GA 5GGQL 4GQ9H 1MJUH 4YH6A 3RBGA 3VXNA 3DMMD 4ZFGL 2AXFB 1FC1A 3CH1B 5HI3D 3ROOA 3HC4L 5C09A 3HAEA 2F5BH 3Q5YA 4J4PA 4KPHH 4NZTL 4KJPD 3U9UA 4HPOL 4MSWB 3IKKA 5FGSA 4KHTH 4C4KT 4LVHB 5JXEA 2LVEA 3OG4B 3PHSA 1QHPA 3BKYH 1HXMB 2OSLA 1IVLA 4H0GA 5A2LH 4JO3L 5EZIH 3RWGB 3FO0H 4EI6A 3O4LD 1MNUH 4QHNB 1D3CA 1KTKE 5D7IA 3EFDH 2B4CH 4PJCF 3UBXI 5DJ2A 4NBXB 3C60D 3TCXA 1NJ9A 4IDLA 3G5VB 3SGKA 4Z7VF 3HAEG 1SJHB 4OCLC 2DAVA 5IP4A 3A6CH 2APTA 2QQQA 2D7QA 3AS1A 3B9AA 3FO9A 2Z35B 5ESAA 4JM2B 4QCIA 3IDNA 4MNGE 4S1RH 3F7VA 1SJEA 3KPMB 2NXYD 4K2UH 4P3DB 4ZYKA 3OF6A 4NNXA 1EXUA 1OB1A 2VE6A 1XGTB 3MRQB 4NO0D 5C0CD 4AEFA 2A73B 5E2TH 4IRJA 4X6BA 1A7QH 5FO9B 4W6YB 4UV4L 1HCFX 2XFXB 4XWGH 3K8LA 2I26N 3MLVL 4UUJB 2PW2A 4P4KB 5KS9F 3CSYB 1S9XA 3KHOA 5FK9A 3LMJH 3B5TA 1DZBA 2F54E 3BGMA 5IMKB 4XNUL 1ORSA 3S98A 1BM3H 1TZIB 4AL8L 2P5WA 4Y4KA 1YN7A 3D0LB 4OZGA 2V5MA 3FFDB 2MQCA 3PJSA 2FJGA 3CU1A 2P47B 4KXZH 4MAUH 1AFVH 4LVHC 2V5RA 3LCYA 4LASH 3DRTA 4YFEA 3DJ9A 5IF0B 5D9SA 3LD8C 2VLKE 3RVWC 4X6DF 4K7FB 1PY9A 2HAZA 3INUL 5I1GH 5IB2A 3W11D 1D5BB 4WO4B 4YR6B 1WJ3A 4U1HA 3TBSA 3AM8C 4IBLT 1D5ZA 4UIMB 5MERB 1DBMH 1LK3L 3CGTA 4KDTC 2DI7A 1CGYA 3FQXA 4PGBA 4XXCA 3D5OF 1YEJL 3A6BH 3ZKMC 4L4VB 3E1F1 2P8MB 5FF6B 4LAQH 5D2NC 5E1HB 5ADPH 3NZHL 4ONFL 1KCUH 1IJ9A 4ZO8A 5L88H 4MCZB 4FFZL 4PP2A 3LKRA 3VWKB 1A9BB 1JGEA 2MTPA 4Y89A 5EWIH 2I9LB 3MZTA 2V7HA 1TJHL 4MNQD 3T3MF 4BM7A 5A40E 1A47A 2CUHA 1QPPA 4HUNB 2PO6C 3CDGB 1QFWH 1IL1A 1G6RL 2A0LD 5TGBB 1P69B 5C07D 2XKNA 4ELMA 4PJ7F 1ZT7A 3C6LD 1MREL 2WWKT 2OJEA 4X98B 1PGRB 3HMWH 4I3SL 1TQCB 4GMTL 4HS8L 3HNVL 3L3KB 4K07A 1RIUL 4XBEH 4YX2H 5CMAA 5L6YL 4XX1G 4M1DL 2UVFA 5IK3B 3RFZC 4RBPH 2PETA 4I2XB 3GSXA 5J1SC 4IJ3B 4WTWA 4G6KH 3T0VA 2VUYA 3T1FB 3R06A 4NQCE 2ENYA 3RVXD 5DFVC 5C6PB 2OL3A 5FECA 1RZFL 3S5LA 3ZSTA 4FQJL 4GAYB 2VB5A 2BVPB 4Y2DC 3SE3A 4M8VA 2XTLA 4WEMB 4WGVB 3DROA 5F7EL 3DVNA 4WEBL 5KW9L 4O2EB 3RDTC 5KVGH 1JWUB 2IALB 3VGAC 2NNAB 1FSKB 3IT8D 2VDML 3BSZH 3SPVB 2A9ML 1QYGL 3BKJL 2WIIA 3QUYD 2WUCL 5JUEH 3GI8L 2WK2A 5E4EC 4DN3H 4UT9H 3FAXA 4TSAH 2X4PA 4DKEH 4ODSL 5KVEL 4RBPK 1YEGH 1D5MA 1PYWA 4DFHA 2CD0A 2YK1L 4HHAB 5T3ZL 4Y1AD 9CGTA 4YWGL 5FIEA 3T0EB 2D03L 1X6LA 4XPFL 3VFUA 3ZE2F 3QWOB 3VXRD 1JHTB 1Q72L 3CD4A 4HXAH 5ICXA 3SDYL 4PFEA 5F1OB 5CIPA 1ZE3C 2HFEA 2Q3ZA 3VXME 1OSZB 3C2AL 1CFTB 3CVHA 3SCMA 5LGKA 4MAYB 5DMIL 5JPNA 2CMRL 4P2RE 3GBNH 1GRWA 3LH2L 1FAKT 3LVEA 4OGAD 1I9IL 4UNVA 2Z92A 2WW8A 3WUWG 4LLDA 4WI6A 1CLYH 3TYGH 1YNTA 1WUNT 3W0WD 2EXYC 3QHFH 5I1KH 4JQXC 2JJTA 2W59A 3OZ9H 3FHQA 5GGVH 2R8SH 3E3QE 4PGCA 3PHOB 4BKLA 1U8HA 1UT9A 4ZUSB 1CD0A 6CGTA 4G9DA 2OK0H 4FTVE 1NFDF 2RR3A 4U6YB 1V3LA 4HC1A 4BQBA 3O6KH 4X7EC 4TULL 4ZPVB 3VE0A 4MJIE 4GRWE 2EC9T 5I1DA 5J1AB 3AUVA 5ELIA 3BUYA 3WIHA 4HJ0D 4CMHC 5T1MB 4Q9RL 2A9NH 5HI4D 2W07A 5E99H 3AAZB 3RU8L 2PYEB 2DQJH 5HD8D 4RX4A 3MJGX 1I7TB 5GZOC 5D8JH 4XC3H 4WUUE 1FN4B 2R29H 1HHGB 4OQTH 3UTZA 5ETUA 2AW2A 5D5MB 4HH8A 1QNZH 3QA3A 2OL3L 4XP1L 2H8PA 3SKMA 1T7ZA 5EOTA 1T2QL 1OGTB 3C5ZC 1FZOA 4HEME 4Y19B 2XQBH 4OCYH 1X5LA 4M48L 2VSCA 4IOSD 3CXDL 3FFCD 4Q9CA 3EOBA 3MODH 5BV7B 5DHVB 3RBSA 3FQRA 5E8OA 4Z6AT 3TCLA 1A6TA 2C7UB 3MV7D 1LEKA 2BP3A 3VRJA 1L6XA 2PYFA 3RVWD 3NIGE 3MZGB 4NQSB 4ZUVA 3NFNB 3CC5B 1H15B 5LBSL 3ALXA 5FB8B 2IAMB 1LQSR 3GHEH 4ZUWA 4M3JA 3CFKB 2D0HA 5J6GA 4M61A 1E4KC 2DQCL 3QB7C 1JYNA 1NSNL 4OM1L 3OPZL 1ADQA 1A0QL 1VSCA 1GOGA 5C0GB 4L29B 3BRFA 3QXUA 1T1ZB 1I7UB 5CJ8A 3FQNA 4KI5E 2DM7A 4PRAA 3WFCL 4K94L 5L2KD 3B2VH 2HLFD 2YS4A 3L3DA 1J1XL 1ZTXL 3MGTB 1INQB 1IEHA 2R0WH 1YYML 5HHPB 4AEEA 3WXVL 3VFTB 3MV8E 3BIKA 1G7HA 3UZEA 5IFAH 3VD4A 1H3PL 3HS0A 5E2VL 2Y1VA 4PJEB 3FOMA 1NFIA 4NO3B 3DI2B 1LE5A 5JPMA 1HH6A 1L4IA 3V5KB 4HC1L 3VWJB 3M8OH 5JW4N 3JUYA 4AENA 3KPRE 4ZO6A 1UH2A 4F9LC 2JB6A 2E7CA 2WBJA 1WIUA 1D5XB 1RVFL 4I1NB 5IBTH 4NN5C 5SWQA 3UO1H 3WIHL 1CD1A 3IDGB 1DE4A 1IQWL 3REWB 3O2VL 2PF6A 2IADA 3M1BB 1DEEA 2IGFL 3VXSD 5I1HL 3SY0A 3SKUD 5ITBL 5FGBA 2VUOA 1ZHKB 3GFUA 4Z76B 4YHPB 5TJWK 2Q86A 2VSDA 4DTGH 1RURL 3OKKB 3VH8G 1QKZL 4NC1C 3CFJA 2HKFH 4PJHA 1BOYA 2EO1A 1OGAA 1S7WA 2P5EA 4KGLA 4GXUN 2GUOA 4BSVA 1XGYL 3IFLL 2A1WH 1L7IL 3KPLB 4WV1A 2KQMA 3K4DA 3UZVB 1EO8L 1T1YA 5EBLB 3RY6A 1JNHB 2W9DH 2XA8L 3KS0H 2FIKA 4QRPA 4EUPA 4U6HB 5BQ7A 3DTXB 3EDDA 3L3HB 3G6JE 3RQ3A 4L4JA 3OR6A 1MVUA 3TN0B 1C12A 5HI5C 4HDIA 1M6OA 3WYRA 1A02N 4KUCF 2VDRH 5KSAB 4X6CE 3FO2B 4G7VH 3QG7H 4JY6B 3SDCB 3MLYL 5DF0A 2Q8AH 5KOVC 3ARSA 3BDYL 4XRCB 1UA6L 5HHOD 2AJ3B 4HH9A 4WTZA 2GT9A 3VFSA 1ADQL 3MO1A 2XWTA 4X4ME 3DMMA 4YK4C 1S78C 4L9LC 4ZODA 2QEJA 5E5RB 2BVOA 2HT2C 4QF1B 5H2BB 4M7LH 4QYOA 2OI9C 3FQUA 4Q2ZA 4R26H 1N4XH 3IGAB 2EXYD 2A6IA 5HHNB 5BVPH 1BLNB 5AZ2L 5EBWB 1MWAA 1PSKL 4IHOB 1UQSB 3MRGA 4L9DA 3ULUL 3OXRA 3PWNB 3FTGA 3O4LA 4JRXB 3UROR 2M8XA 3WLBB 2GK0B 2BNQA 3B6SA 3L3IB 2ZCHL 3C60A 3G5XB 4HQQH 3QUXD 2FEEI 4OUOA 1DQLH 3LZFL 1MHCA 3ESVF 4D9LL 4OCXH 1IGFH 5FYJH 2VO5A 4R7DB 3TN0C 3OXSB 2VKXA 2DLTA 4QRRD 4L1HA 1J11A 4KFZC 1R0AL 4YBLC 5KSAC 2R4RH 1N3NB 4NO0A 3HFML 5E8NB 4JFFB 3VDBA 1IC7H 1QR1A 2UY6A 3G6DH 4O2FB 4QXTB 4W4NA 1BQSA 2ENSA 3VFRB 1GGBL 4TRPH 3DUHA 3MX0A 4YIQA 1TZGH 2H6PB 2F5BL 4FMFA 1HWGB 4NO2B 1M7IA 4O2CB 1P1ZA 3ARVA 4KHXL 3L3GA 3PWVA 4ZNEE 5I66B 1S7SB 4F2MB 1MCOH 2AK4A 1C5CL 5FM5M 5EZIL 3NACH 4CU6A 3FO0L 4YBHA 1MNUL 3CMOH 2ADIA 3N1FC 4LCWA 2GTWA 4JJ5B 4D0DA 4FQIH 4MJ4A 4OZ4A 3TBYB 4XPAL 4PTUA 4MMZC 5DJXA 5GS3A 3LKQB 2EDFA 3GMPA 5IVXA 1FNFA 5HGHA 2NZIA 5JIHA 3FRPA 3RP1A 5TQ0L 4ODTH 3QG6A 5SWSE 2F54B 1BECA 1S7UA 2V2XB 5FGRA 4S1DD 1BQHA 3AY4A 1A7QL 1YY8A 1PEZA 4XWGL 2DOCA 3F7QA 2R56H 5ITFB 1BJ8A 2HFFA 2XY1A 1U8MA 3U46B 2WLYA 3TBTA 5EZJA 1VENA 3LMJL 5CZVL 3ARED 4PBVC 3P4OB 4IMLA 1A8JH 4ZUUB 1BM3L 2VLKB 2D7NA 3QHTC 4GW5A 1B0GB 2NMSA 1AGCA 4MNQA 4WCYL 5J89A 3QULB 1AFVL 4HJJH 3V4UL 1MFDH 3S3SA 2HT3D 5C07A 3DXAE 4XMPH 5E6IA 2VYRE 1FFQA 2AV7A 2YMXL 3C6LA 3LAFA 1F4YL 3QUMA 5F9JB 4LEXL 3HZMB 4LLQB 5I1GL 5IM7B 1XCQB 2YEZB 1EFXA 4XP4H 4E5XA 2CDFA 1MH5A 4MZ2A 1WLHA 1YZZA 4LHQB 1AHWB 4GXVL 4HMDA 3WNPA 1HSAB 4LPCA 3KJ6L 4ELKB 4HXBL 3QEGL 4FXLA 4NQDA 1E4WH 1OARL 3C6SB 4JM4H 1T7VA 1EERB 3UTQA 4OLZH 4HUWA 3WL9B 5ADPL 1FORL 4K3JH 1KFAL 1UXWB 2DI8A 5F9OH 5ID1A 1XIWA 1KJMB 2C9AA 2Q76B 5SX4H 5EWIL 3ALPA 4R97C 4Y4FC 4M93B 1YC8A 2NXZD 3QUYA 2IWGA 1KULA 5KSBF 4NSKB 4G80B 2VC2H 1KLFA 4GKZB 3Q5OA 1QVOB 5LAXA 2DWDA 4QTIH 4PJFE 5FHAL 1QO3B 3KVQA 2EH7H 4ZMAT 1LDSA 1A4JB 5D96C 1K4DA 1WICA 2FEDC 5AD0B 2J5LB 3HMWL 5D1ZB 4NQCB 3AMKA 4XBEL 3GSOA 3MLWL 1JPSL 1D5IL 5EO0B 3D18A 2EIDA 4JN2A 4D8PA 2FIRT 4G6KL 4YLQT 3E6FB 2VZVA 1EDQA 2WP3O 4Z7WE 1SEBB 4HUVB 3QNXA 2R9HD 4GMSH 4UAOC 5GRXG 2Q20A 1I1YB 1AGFA 1P4LA 1F3DJ 2Y36H 3ARDA 3DETC 3KPSE 5LWYH 4MJ5A 3WV0A 3JTSB 3N1GC 5T1LB 3B2UC 3VCLB 2VITA 3ILQC 3U1SH 2X89D 3S4SB 3HZVA 3FT2A 5IT2L 2VH5H 4D3CL 2A6DB 3BSZL 5I6XB 2DQIL 3I75B 3RVTC 2GEEA 4S0SD 1T80A 4OKVA 4LU5H 4ODUA 4ZFOB 4PIRF 4UT9L 4DN3L 5IJKC 5CJQH 5IEKB 4DKEL 4UDTB 3RL1A 4NZJA 1YEGL 3I3EA 3KYKL 4OZIE 5DJ6A 1NLDL 1S9YA 1C5DA 1L9NA 3U4EB 5F7YC 1OAYH 3QUML 1T0NB 4HXAL 3RWDA 3STZB 1T83A 2J5LC 2D7PA 1IAII 3RL2A 5CSBA 1J8HD 3EUUA 3T0BA 4Z77B 2FBOJ 5I76A 3WIFA 4POZC 3MREB 3QEQA 5D7LE 3GB7A 1ED3A 3LQZA 4XVTH 2MPAH 1S7RA 4LHUB 2I60L 1JI2A 4HWZA 1U8JB 4XVJH 7FABL 5AAMA 2W60A 4HULB 4FTVB 2Y5TA 5F3HB 3QJHA 1T20B 4MJIB 4GRWB 3OZ9L 3IFPA 4X8JA 4PGEA 2I9TB 2XA3A 4NT6A 5M7QA 1U8NB 3F8UB 4HAGA 4P0DA 3O0RH 1XGUA 3HR5B 1OTTC 4JHWH 5I6XC 1R5WA 2H3NA 2X7LB 3FFCA 3U4BL 4ENEC 4MX7A 4R4FL 5ENWB 5FO7B 1RUAH 3O6KL 4YQXH 3FB8B 1KXVC 2KL6A 1G9NL 1KPRA 3MV7A 1F5WA 4RGNE 1URLA 2JCCB 1JF1B 2KZWA 2DTML 5T3XH 2CLVB 5CEZE 3KDMB 2A9NL 1S5HA 4A6YB 3RTQB 4PYHA 5CILH 5E99L 4DWHA 3QEUB 4V1DE 1GL4B 3T2OA 1EVTC 3I85A 5JQHC 3SDXE 5I30H 3SBWC 1MLCB 1NLBH 5KVFL 3BQUD 2XZQH 3V6ZB 5IQ9A 1OAXL 1KPUB 4HFWB 3QQ9C 1QRND 3Q6FB 5C0EA 2I07B 2CUIA 5BZDB 4A2LA 1F6AA 4R2GD 3G6JF 1P2CB 4F7TA 5JIKA 4Z7NE 1QNZL 1C7TA 1UC6A 2QADC 4PRHB 4CU8A 5L2KA 4RWYL 2DLFL 2L0DA 3QFJE 4DKFH 4ERSH 3KWWA 5TFSH 5T33H 2XQBL 2YBRB 3ARFC 3OR7B 4UTBH 2HLAB 3FB5A 3SE9H 1KLUA 3MRHB 3IYLW 3EGSA 4RMTA 2FHCA 3P9MB 5E5UB 4JY4B 32C2A 4ODXB 1VESA 2XWBA 1F45A 2R0KL 3RNQB 1JFQH 2RAMA 3UJJL 3FZUD 5FCUH 1VKXB 5DHYA 3CX5J 3MA7B 4OTXL 2AI0H 5J12B 1EVUA 2G5BA 2FX7L 4GRLB 3C5SA 4MLIA 4KMQA 2X6MA 5KVDH 3KXFE 3U30C 5EUKB 5E2WL 1BFVH 3CZFA 1EFQA 1KG0A 5F9AC 4YHOL 5DYOA 4XVSL 3RTQC 4YDKH 3HCVB 2PTTB 4JPIB 2VZ3A 5GGSA 3IB4A 4LLUB 5IBLC 1JGUL 1TDQA 4PJIB 3MV8B 1ZLVK 3WNKA 3BZDA 1AC6A 5I16A 4G8GB 3S3PA 2CGRH 2LU7A 3MLZH 4KUCD 4JRYD 3BD3A 5HYSB 4AM0B 3QISA 2IJ0C 4OGYH 1FJ1A 5F7MC 1WK0A 3KPRB 4PV9A 3EYUH 3X12B 1NGWB 4AT6B 1I1FB 4XCEA 1RZJH 1KCRL 5EFIA 3L3JA 3P4LA 3BZEA 1FZKA 3V5DB 1DVFC 5C2BH 3DUUB 4A2MA 1CK0H 2FWOA 2I25N 3OGCA 5JIPA 4EVNA 2M2DA 1XGQA 4U49A 3QDJD 1X7QA 2LABA 3S35H 5IOPB 1HXYB 2FEDD 4JJHA 2YPVL 1J0IA 5IBTL 3UO1L 4N0FB 1Q9OB 2BC4B 1WFNA 5EO1B 1KEGL 5ICZA 4M7JH 1WC7B 2DQEH 2VXUH 5CEYA 3HUJF 3R1GH 4FXGB 5BS0A 1T22B 1HSBA 1JF5A 1WWAX 5HHOA 4BZ1H 1U93B 5L0QC 3S6CA 2DMBA 2VL4A 2KDGA 4UILH 4DTGL 1IGTA 4F37F 2D7MA 5F96L 4HPYH 1PY4A 3WE6B 3V6OA 3ZDXE 1JRHH 3B2UD 4WHTA 3O9WB 1X5XA 1P5VA 4KKAC 4PJGF 3T04D 4M62L 4I13B 1U3YA 3ZSSA 4LSPL 1M05B 4MCYB 2VDQL 1FE8L 3UBXA 1Q94A 4AEIH 1TETL 1FVEB 5KG9A 2BXZA 2QTEA 3IU4H 4X6CB 4IOFD 5AEAA 3QUXA 4YFDB 1J0KA 2MHAA 4PB9H 4HT1H 5CFHA 5H8DA 4OGXH 4PJXA 4KTEH 2YKLL 1AGBB 3TZVB 2Y23A 2VDRL 1JHLH 2P7TA 4YJZL 4QRRA 4K3EH 1I8IB 3T4AB 4MXWH 4QT5A 3UTPD 2BMKA 5ALBH 3SQOH 4HBCH 2XQYK 4HIEA 3ES6A