3VXQA

H27-14 tcr specific for hla-a24-nef134-10
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
204
structure length
204
Chain Sequence
KQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLIQSSQREQTSGRLNASLDKSSGRSTLYIAASQPGDSATYLCAVRMDSSYKLIFGSGTRLLVRPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H27-14 TCR alpha chain
publication title Structure of TCR and antigen complexes at an immunodominant CTL epitope in HIV-1 infection
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 204
sequence length 204
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-09-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vxqA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vxqA02
2D31B 5M94B 5AG8A 1DL7H 1YC7A 4PJBA 3QG6A 5FHAL 3VW3L 4ZNCD 3RPIB 4JCMA 5DD6B 3E6FB 2Z93B 4LPUA 4XZUB 4YUEH 5TH2A 4OFDA 2BXZA 3VFGH 2XY1A 4HCRL 5TF0A 3HTLX 3F7RA 4DN3H 1UADC 1U8MB 1QVOA 2CDEA 1CICD 3QWOA 1PD6A 4OF6A 1X5KA 5IR1A 5HI5D 3LD8B 1C1EH 4JHWH 2YK1H 2ZCKL 1CXLA 3P4OB 1ZA3A 5CEZH 1OW0A 2JTDA 3G5ZA 5D72H 3ZKMC 4UTAH 5KS9A 3DTXB 4EBQL 1CFVL 4LSDA 1OCWH 1YEHL 3DIFB 1F5WA 1S7XB 5ESAA 1OGAD 3MLZH 3OGOE 4QRRE 2DQUH 2EE3A 4P5TD 1A9EA 4WO4D 2XZAL 5DS8A 4EI5C 5IHLB 1RVFL 4HQQL 1IKFH 1NL0L 4P2OC 3TCLA 4N8CH 4BK5A 2NY1B 1F4WH 2I25N 1XR8B 4LL9A 3PWPB 1QACA 4LF3B 3MJ7B 3PJSA 5C08D 3VG0H 1NGWA 4X6FA 3V0WH 2I9LA 4XBPA 1K8IB 3QZWB 3SO3C 4PJHE 2HP4A 1UA6H 2NLJB 4PY7B 3MRDA 3FJTA 1YEFL 2A83B 4AEHL 5EU4A 4WNQA 1OAKH 1PKQB 4ALAH 3TIEA 2PTUA 2AXHA 4TTDC 4RQQB 1MCOL 3R8QA 1YNKL 4S1RL 3FB8B 1HHJA 3OKOB 4LLYB 3BWUC 1KIQA 4IM8A 2GUOA 1IRAY 4UOJA 4Y5YA 2O61B 1EEZA 5JMRA 1MCIA 5DJDB 5I66B 4JRXA 2PXYB 4NRZA 4KHXH 2I5YL 1CT8A 2YRZA 5C0NC 3LKSB 1LE5B 3SPVA 1E4KC 3S97C 3LMJH 3QYCA 4X6CF 1L9NA 5GHWL 3IFPB 4P3CH 5LAXB 2FJGB 1ZT4B 5I71C 4NJ9L 3VFOB 3NFPA 3JVGC 1QR1B 2F58H 5ISZB 4H0HB 5B8CA 5EBMB 5H8DA 2JB5H 5H94A 4F9LC 3BDYH 1G7LA 4HBQA 3JV4A 4J1UA 4F57L 3HI5L 5AYQA 1BQHG 2A6JA 1XCTB 2CD0A 3S4SG 2X1QA 3I2CH 5HGBA 3ARUA 3TEUA 2GY5A 4QXUL 3ALPA 3A6BL 2EXWD 1HHKA 1NMAH 4OGYH 1FDLL 2AEPL 4HT1L 2XXMB 4RMTA 3MOBH 4CKVX 1DBBL 3I3EA 4YAQA 2PYEB 4P46A 2V17L 2A0LC 4GKOA 5LBSH 5JW4N 3U0TA 4MQTB 5DJZB 4QCIB 3SEPA 3X13A 2WAHA 1FFOB 6FABH 1NH6A 4JHAL 3WHXB 1EO8H 3RDTD 4D2NA 3MO1A 3V7AG 1CE6B 4R8WH 4PRPE 5HHXL 1F6AB 4Z95H 3GSNH 4YE4H 2PW2A 1VFAB 4YHPA 2GSGB 4L8DA 5KSAC 2XOTA 4LVNB 2LU7A 3PHOA 1ND0A 1XGTB 3CFEB 1FVEA 1QLFB 4A6YB 2R2BB 5FGBC 2IBBA 3NGBC 1KXVC 5IHZA 4NBXB 3UEZA 2LE9A 4PV9A 2HFTA 5DMIL 1MJUL 1LQSR 2NZIA 2BZDA 4QRSA 1B0GB 1TFHA 4OKVA 2HG5B 4OLVL 1L6XA 2Y06L 4HXAL 4MDJB 4I77L 3ZKMD 5JOPD 1IM9B 3UTPD 2EYSA 2DTMH 4NP4H 2ZZUT 4J23A 5EWIL 1LO0L 1FHGA 3LKOB 3DMMA 3VMPA 1CXHA 2NY0B 5HYJA 2NXZD 3PHQA 5K9QI 1JGEB 1LP9E 1OPGH 3FQTB 3NAAL 1NLDH 4XXCA 4POUB 4ODWB 4GW1B 2YOCA 3GMRA 2GJ6B 3AAZB 4HUWA 5F1OB 4FZEH 4LSPH 5T1KD 5DVKA 1XF5B 2EDKA 1NKRA 2LABA 2XACC 1TZIA 1TIUA 4H25B 4ZO9A 3IFLH 5ADPH 5IBLC 5D6CB 2KDGA 1QSEB 1QSZA 1OT2A 3QH3A 2R9HC 2XG4A 3GHBL 2PO6C 4M6NH 3IT8D 4TULH 3CJJA 3OKYA 3RUGB 1A7BA 2J4WH 3SKJL 2P47B 3BP7B 3C8DA 2ICWJ 4KV5F 1AQDB 1S78C 5IGXL 4QY8A 4UV4H 2CK0L 1TJHH 3VFVA 1UVQB 2VLME 3BE1L 4UIMB 2D9CA 5HPMA 1ZKAA 1KPRB 2R15A 4RX4D 5HVWA 2CIIA 4PGEB 3VWJB 3L6FB 1T5WA 3KXFE 1M6OB 1KJVB 1ZGLA 1FO0A 1I1AD 5EOTA 2VQ1B 3NIDE 5ID1A 2B0SH 4OZGB 43C9A 2CO6B 1RV6X 4N8VB 1A8JH 5DK2A 3HFMH 4PJIA 4M5ZH 2AK4A 5F3HB 2A0LD 1L0XA 2COQA 4UNVA 4H8WC 4KKLC 4NDMA 3RIAK 1SJXA 2PR4L 5FM4A 4PLOB 1SQ2N 1VPOH 1VEOA 3OJDB 3D6GA 5EOCJ 3MRLA 3FFCA 4KKAC 4QTIH 4LKCB 5J13B 4BZ1H 4PJ8A 4NOBA 3BSZH 2R2EB 4X6DA 5GZOC 3Q2CA 3WKNA 4YR6B 5ERWB 4OLYH 3PGFH 3SJVB 3MOQA 5SWZA 4JB9H 5KSAD 3G6JE 1T4KA 3FO0L 4GMSH 3MXWL 1G9ML 3GHEH 4KRPB 2BVPA 4F7TA 4LPTA 2BSSB 1UH4A 4YDKH 2YZ1A 3WXWL 3H7BA 3NCJH 3QB7C 4TYUA 2PF6A 4KMTH 4OAWB 3H8NA 5I1DA 2EYRB 5KANI 5FHBL 2UVFA 2VSDA 2YMXH 1P7KB 2E6JA 3TO2B 1HHHB 1ZWIB 2A6IB 5FYJD 4YHML 5H35B 3VFUB 4YFDB 4GBXD 3O6ML 5JR1L 4MSWA 2JJWA 3ZDYF 4LCWD 5EU7C 4KK8C 3BXNA 4KQ3L 2NPLX 1HSAB 4HKJA 3TVMB 3O45A 3ELAT 3PDOB 5SWSE 3CMOL 1J0ZA 1KJ2H 1SJVA 5FYLH 2F54D 1F4YL 1N2RB 2NCMA 1U92B 1NCCL 5JUEH 2V5SA 4KKNA 1N6UA 2DJSA 1UM6L 2NXYC 1I4FB 4IMKA 3JZ7A 3PWNA 5D7LA 2E27L 5DYOA 3REVB 1S7RB 1ITCA 5FDWA 4J7RA 1E6OL 1U8HA 2XZQH 2ERJC 3H9YA 2QSCH 3QDMD 4X4MA 2DYPB 3P40A 2R9HD 3LN4A 1S7SA 5DR5L 2PO6D 1UM5H 4NCC2 1DQJB 1TETL 4YHNB 1QLEL 4DKAA 4F7MB 3UMTA 1G7QB 5FEBA 1E6JL 2HLAA 4JFEB 2MJWA 1H8OA 1T2QH 4ZNEA 3NOIA 5HHPB 5DHVB 3BN3B 3HC4L 15C8H 3F6IA 2G9HA 3QXAB 4BFIB 4Q0XL 4GS7C 4ZTOL 5F7DA 3VA2C 2C7UB 5A16B 3P73A 3NFSH 3JWOH 4UZGA 3TC9A 1SEBB 1AHWB 3ULVF 2UWEB 2AJSL 3T0EE 1CVSC 4HDIB 3O2WH 1OGTA 1UWXK 1JZ2A 2QHRH 1Q72L 1IMHC 4OZFH 3ZYZA 4EN3B 5DD0L 3FOMB 3TNMA 1JNLH 3UPAA 1FGVH 4HX1B 4NO0A 2APFA 3H9HA 4H88H 1S7TA 1DQQB 3C87A 5CEYA 1G7JA 1QRNB 4TSBL 5DQJB 1R3IH 3OWEA 4KKLD 2QEJA 3HC3H 4Y1AD 4MQ7B 4UILH 3RX7A 4QRPE 1R6VA 1JV5B 1BPVA 3SY0A 4JFFD 1NDMA 1FCGA 4LLWB 5I19H 5FKPB 4O4YH 4LCUB 2HJKA 5CIPA 3O6FB 4F37F 2VDQL 4K55A 2IH1B 4PJAB 4Y19A 3CVHB 4DUVA 5TQ2H 1K6QH 3KYKH 3SN6N 1UXWA 3DV6B 4DGVL 4OZ4B 1WISA 2IAMA 4M61A 4YDIL 1JWMA 1MI5B 5K9KB 1OW0C 3GBMH 3PP3K 3CFBB 4AQOA 5IJVB 2B5IC 3QXVA 2GEEA 4OCYL 2APTA 2IPTL 1KTRL 4HSQA 4XP6L 1G6RH 1LK2B 4C4KO 1RJLA 2OTWB 1T7XA 3BQUA 1L0YA 1RJZB 4LMQE 1OARL 3TN0B 1SM3H 1GVIA 3VXNB 1N5YH 1U95A 3RWGA 1MQKL 3RVWD 5C6PB 1FVDB 3C6SB 4CMMB 3MNWA 4NQSB 2UZIL 3VGHA 5GS1A 3K8KA 1PLGH 4N1CA 3RIFF 3C8KB 3T4AA 1WZ1H 1RJYA 4NO5A 5HYQB 4HUVA 1MRDH 1BQSA 4LU5L 4RIRB 2YPKA 3INUH 5TDOB 3TJHD 5HDQH 5DJYB 1CGSL 3GMMB 4GG8B 4TNVK 3U7WL 4PRHA 1YMMD 2NXYD 3PQYE 3CXDL 1FL6A 4JQXA 4GRWE 4QNPE 1RZ8B 4OBRA 4QT5A 4I9WE 3BEWB 1G1CA 3NMEA 4Y5YC 1R5WB 5INDB 3QI9D 2YS4A 5GPRA 2XQBH 1N64H 1EHXA 1A47A 4CVZB 4ZXBA 2DWDA 3O8XA 4LCYA 4X7CC 3FB6A 3IDNB 3SGDI 2GSIB 1KPVA 4ODXB 4GRLB 4PJXF 4Y4HD 3WN5A 3LS4L 4M7KH 3FQUA 2VKXA 3AGVA 1XR9B 4KAQL 4WI2A 3NPSC 1NSNH 1GAFL 2FEEL 4I8DA 5B8CC 3Q5OA 4LRIA 2Q7NA 1HXYB 1JPTH 5L0QB 4Y8AA 4AJ0A 2EIEA 3MROA 5LGKA 3MLRH 4L8SC 5FCSH 2XWTA 4FQXB 3BWAB 3BO8B 4XNMB 1KJMA 2HN7A 2CRMA 3H3PH 1VFUA 4TUKL 4MHHI 4M4PA 4APQA 1UB5B 1I85C 1DBAL 5FDYA 5GRYA 2WWMC 2H9GA 3P2TA 5C07E 1KTKE 1AKJD 3HAEB 2IQAB 5F7NC 1WBZB 2MOVA 1IGJA 3OAUH 2EDTA 3AU1A 3HG1D 4X9BA 1FNAA 1HK6A 4Y4FD 5JTWA 2BVEA 4PREA 3U2SB 1F3DJ 4YHKH 4XPGH 1C7TA 4LCIH 4XT1C 2J8UE 1EBPA 1A5FL 2YD6A 3EO9H 4L29A 3GSVA 1S9VB 4ODVH 5GS2D 2B1AH 3C5SA 3Q1SL 5IFJA 4X6BB 3C6LC 5BS0B 3QRGH 1ORQA 5FYKD 3B8YA 3CC5B 5IOPA 5IHUH 1B2WL 5GS0D 2ICCA 5ITFB 3KS0H 2AW2A 4AIOA 3KLHC 2LAAA 1J05B 5B22A 3QFJB 3UTQA 4X4XA 2EH8H 3MNVB 5DJXA 5IQ9B 3KPRD 5C0IB 3QHFL 5MERA 5ID0B 5J89A 1NAMA 5KOMC 4JDZB 5DFTA 3WD5H 2BVOA 1QBAA 1HH9A 3QBTB 4EUPG 3OBAA 4G8IB 1CG9A 3IKKA 1FG2B 3U1SL 3X3FH 1G7HA 1FNFA 1MH5B 1YYML 1BHGA 4NOFA 4DGIH 1SJHA 1ED3B 5L7XH 3DMMC 2VSCA 2QTEA 4TRPH 4Z5RB 1VKXA 2FECL 2YBRA 4GAJH 4E42A 4QRQB 2Y36L 3BIBX 2VXSL 1CFTA 2YWZA 1P4LB 2BRQA 4WV1B 3TBTA 3TT1H 1J8HD 4XXCC 3B9KA 4PJ5E 1ZMYA 3EZ8A 3MA7A 1CGWA 1F00I 3ECBB 3UTZA 3QUMH 3DSFH 1YPZE 1I8IA 1N3NB 1L7IL 3VFGL 1NFDF 3CUPB 3H3KA 4NN5B 4ZO8A 4JREB 1NEZA 1BLNB 3HS0A 2R1WB 3O41A 3QIBA 4I2XB 4NKMA 5DEGA 4DVBB 1FLRL 4B7LA 1HNFA 4TSAH 4GG6F 4X6DF 1MWAH 4G6JH 4H20H 2W38A 4XBEH 4MCYA 1YDPB 1R3KB 4I0CC 4V1DB 1ADQH 5AZ2H 1HINL 5J12C 5MENB 1II4E 4A2MA 4PJHA 4HGWB 3OXRB 4JRXD 3TNNB 3RWJB 3HCVB 5J1SC 2VMFA 1Z9OA 2F74B 3MLYH 2EIBA 3QCUH 2A6KB 1UB6B 1IKFL 3KPOB 1Z5LA 1WF5A 2HKFH 4JPIB 4C55A 5B38A 4Q97A 1UT9A 2ZNXA 1MREL 4RGMB 2EDQA 3P4NA 1FH5L 1NMCC 1HOCB 3VG0L 2BHZA 1WWWX 4GXVL 5GJSH 1AO7E 2CIKB 3T65A 3RTQB 3M17B 3SGJA 4K3JH 2VQUA 3WLBB 5TGBB 3NCFB 1UA6L 1FE8L 4JM2D 2V7NB 3I02A 1OAKL 3D0LB 3D5OF 3NIGF 3QCVL 3ZMRA 5IK3B 4YZFF 1DN0A 3QIWA 3W0WE 5E4IA 3UROR 2WWMD 5GSRB 3FT2B 4JFHD 4P46D 3ARRA 2BHUA 4PYHA 3RL2A 3CH8A 1A4KB 3OKKB 1X3DA 2Y5TA 2J6EH 4C54A 1MUJA 1TTUA 4QOKB 4FFVD 5DRNA 3HUJB 4JE4B 1ZK9A 1JYNA 1B4JH 2CDFB 3ARDB 2OYPA 3LMJL 1QP1A 4G6FD 2FL5A 4P9HL 4P3CL 5HHQA 3FONA 1GJIA 3W82A 3MCKB 4HZAA 1QFWI 2HT2C 2D4DA 4X8JA 1LNUA 1J1OL 1S8DA 3V0AC 3VXRB 2P7TA 3BFOA 5IB4B 3ARBA 3K2UH 5LJYH 3IDYB 4PLJC 1BBJB 4OGYL 1BF8A 1RZJL 3I6GB 2CRYA 2LAGB 3C60B 1JPFB 4AG4L 4PRPA 4F7CA 2DLTA 5TQ0H 3RFZC 3T4YA 3REWB 5ALBL 4PP2A 4ZYKB 4NKDA 5LBSL 1NGYB 4D8PB 5F72S 4KXZI 4FQIH 2ZOLA 3DMMD 4Q7DA 5F7HA 1A6AA 4ZUUB 5HYJD 1NAKH 4E9LA 3A0OA 1KEML 3V6FA 6FABL 1FL3B 4U1SA 3TZVB 2ED9A 4S1SL 2GK2A 1EO8L 2PETA 3RY5A 1A6ZA 1JHTA 1I7TB 2ENSA 3QXDA 4XWOC 1CBVH 4PJ7F 3OG4B 4X7EC 5ENWB 5C0AD 7FABH 1J86A 2J7LA 3QEUA 1HQRA 4KTEH 2DQGH 4IMKC 5DEFB 5A2KH 1JBJA 3DX7A 2YKLH 2BRRH 3IB4A 2DIJA 3BUYB 4YBLC 3FRUB 3FZUD 1DUZB 4UB0L 1NDGB 2QQQA 1K8DB 2UZXB 2FCBA 2ICWI 3VFRA 3MUJA 4YPJA 1FFNA 1T7YA 5TFSL 1VADA 1J1PL 1T5XB 2DTML 4L4VE 4NP4L 4BM7A 2NMSA 5EO9A 3FO9B 1V7NL 3W9EA 2HFGL 5ISZE 5HDOA 3SE4A 4P99A 4S2SA 1KXTB 4AT6B 1J1XH 1RY7B 4ZOCA 5LWYH 1OPGL 2D0GA 1SYVA 4U3XA 3IS0X 1RK1A 3BVNB 1I3VA 2BJML 2Q20A 4LSQH 1EMTH 3BEVA 5GJTH 1NGPH 5HGAB 3BT2H 4JG1H 4N8PA 4FZEL 2NY2B 1KTLB 4MD5B 4U2ZA 4EKXA 1ZS8B 1A7NL 1CU4H 1AIFA 4PJEB 4X5WA 5C7XL 4OQTA 3FQWB 2GKIA 3BJ91 3IFLL 5ADPL 2EDBA 2FGWH 2L7UA 5JHDE 4HS8H 4D0DB 3BPNC 1F90H 3OKNB 2AK4D 3GK8L 4LLDA 1MNUL 5EUOB 2ED7A 1E28A 4OFIA 5IB3A 1ULVA 3E2HB 5I9QC 1NLBH 4TULL 2AJZB 4HGMA 5D1ZB 5ICZB 1ZVSA 1FORL 4UQ3A 3LDBB 2J4WL 4N8VG 4NQCA 4HZLB 4F7PA 3FFCD 1MCRA 3JTSB 3TBSB 3ZE1E 1EO5A 1VEMA 5CMAA 5ANMB 4PJ8D 1ETZB 5HHMD 5D5MF 1ZHNA 2PTTB 1GPOH 5HY9B 1EEYA 4K2UH 1YEDA 5SWZD 3KWWA 2YC1B 2IAMC 1J5OH 3IU4H 3X11A 4HJJH 4BELD 1OTSC 4ODHH 3Q3GB 3MLXH 1KCRL 4OUUB 4K7FA 4ELMF 1HHGA 2VLRB 4RGNC 3VJ6A 2OJEA 5I1CH 3QJHB 5FO7A 4PLJD 4BQ8A 3BQUC 4L4JA 1X44A 2YR3A 1I3RA 5F3BB 4BSWA 3NH7H 1FN4B 2V7HA 2OXHA 4B53A 4PJFF 1C5DB 2I26N 3D39B 2ATKA 3G6JA 2M2DA 1CK0H 1IGFH 1LO4H 1VPOL 2D4FA 2HLFC 1WBXB 2XRAL 4YQXH 1IZKA 5GS1C 4G80A 3LPFA 3AUVA 4QTIL 3QO0A 4M1CD 4ZMAT 1IGCH 3H42L 43CAB 4CU8A 4F2MB 3BSZL 3I75A 3KJ4C 3VMOA 2Q76A 3QDGB 3UTTE 1QPPA 2DTSA 4OLYL 2NY6D 3PGFL 5F1NA 3AREB 1T04B 3KPQA 5D2LF 4LSVL 3GHEL 5D7LD 4KJQD 1OWWA 1KNOB 2H8PB 1T1XA 1EAPB 1QSVA 4YIQA 1R5VA 4KMTL 5SV4A 2SEBB 2GW5A 3H3BC 1Q9LB 4ZXBC 4P48A 3ME0A 4RMVA 5I1HH 2NY7H 4M9OA 5DC0A 1FJ1A 5F9AC 5JPNB 1KENH 1TZGH 4XVTH 3RVXC 3KPSD 3RZWA 5ADOL 1BAFL 1GOHA 5IF0B 3CCHA 1FYTD 4DJMA 1QFWM 1UC6A 1MQ8A 5T3ZD 4LRIC 1RZIA 4M7LT 1JWUA 5EZJA 2C3GA 4U3HA 4Z7WE 4QYOB 4EZMA 5BZDB 3MQIA 3KG5A 1DE4B 4GKZA 2VB5A 4OZGE 1G1YA 5A3ID 1HKLL 2JCCE 4Z7OF 4OZIA 3FT3A 3D0VA 2EDXA 3UTOA 5DRWA 2JJTA 1BD2B 4WTWA 3V79C 4TVSa 1LDPL 3SDXB 2NY4C 4U1NA 1MEXH 3MCLL 4NO0D 5FO9B 3UXFA 3IETB 5EBWA 4ZUSA 1E27B 1ZA6B 3AM8A 5EU3A 3B43A 2X4UB 4D0BA 1B0RB 1CDIA 1I7ZA 1UM5L 5I17B 1FVCA 4N9OB 1SMOA 1X5HA 3GSNB 3O2DL 5EFIA 2OZ4A 4X9HA 2ZCHH 5F9WB 3T0EA 5IEKA 1GOGA 4Z7VE 2HRLA 4HFUL 4XP4H 1B6DA 3TH2T 4I0PC 4K8RC 1IQDA 4HWBA 4K23L 3RY6C 5TJWK 1FAKT 3ARVA 4ZFOA 2IAMD 3RZCA 4HKZA 1NC2A 4Q9QH 1OTSD 3JWOL 4OT1L 3VDAA 4G9DB 4QRPA 3SCMA 5JPMA 4ODUB 2H6PB 2EDFA 3O2WL 4F15C 2ZG1A 4WW1A 1XGUB 3PV7A 4YHOH 5DJ2A 1FGVL 3O4LB 2EIDA 5D71H 4N5EC 3ULUC 1DQLL 3GJEB 1U6AH 4QGTA 4HV8B 4ODSH 2HKHL 4H88L 3ULSA 1K4CA 3GGWA 4MLIA 2XKSA 3MBEA 1R3IL 2IJ0C 5HHOA 1XIWA 3NA4A 4PLNC 5BV7C 4KROB 3B9KC 1A2YA 2FR4A 1HIMH 4JKMA 2IPKA 4OF3A 3VXMB 1Y18A 3GDBA 3NCEB 4R9HA 1S7QA 5C09E 5I16A 4WWKB 3V4VL 4Z7NE 3B5HA 5FA3B 5TPWH 5I19L 4XP5L 3TM6A 1IEBB 3GRWA 2ZSVA 1BWMA 1P4BH 3QIBC 4JPWL 4ACPA 1EZVY 3B9AA 4CL7A 4PRHD 3NBNA 1MCNA 4Z78A 5EULV 1IJ9A 3PWUB 3GBML 5IEHB 2H3NA 1PX3A 3C2AL 4NNYA 3L7EB 2F53E 3OSKA 3GB7A 3MV8A 1MLCA 3V6BR 1QFHA 5DMKB 3T0VA 1G6RL 4Z0XB 3O8XD 4FNLL 1F11A 4GQPH 4M6AA 5I76B 4AM0A 4DZ8A 3D9AL 4NSKA 2BNQA 4R7DA 5FOBB 2EC9T 3N9GL 4GLRH 3VFNA 3SDAA 1RUKL 5C0FA 1SM3L 4JFQA 1ZTXH 1BVKB 1N5YL 4PJCF 1KV3A 4GFTB 1AGCA 1P84J 4NQEB 1IC4L 1H8SA 1I9RH 5EOQH 3WFDH 3QPQC 2LTQB 4G8GE 4JJ5A 4G7VL 3DV4A 1HDMA 1MRDL 2J8HA 3T09A 3INUL 2HJFB 4UBDC 5HDQL 5IMOB 4ORZC 3KGRA 4XCNB 4LLQA 1FZJA 1T20A 3K8LA 2HTKD 1YEJH 5A2LH 4APQD 4N9GA 5C0JB 2NYYC 5FYJH 3TO4D 4L8BA 3GMNA 5DJ0A 2WIMA 3KYOB 4NUJB 1YN6A 5IB2B 1P2CB 2NY4D 3ROOA 1JRHL 1B88A 2XQBL 3GSXA 1N64L 2E7HA 1JL8A 3NZ8A 2EIZA 3T2NH 1Q0XH 4MA1C 4TUOB 3DVNA 3IYLW 5DJ6B 1JTOA 2VR5A 1YQ2A 4M6ML 4OZHE 4R3SB 3LS5H 1U8OB 3GNMH 3JTTB 4OF8A 1P5UA 2GJZB 3BPCB 4HIJB 3R4DA 5E6IA 1L9MA 3EKCA 2Q8BL 5E5MB 3S6CA 2A2QT 3OB8A 3FQXB 4P2QB 3QEHB 4MNQB 1JPTL 3TLRA 2DQEH 4WUUA 1DQML 1JTTA 1JN6A 2FHBA 4B5EA 1ZHKA 2C3HA 3X12B 4ZUVB 1URLA 2ICEB 1X4XA 5D7JB 3MLTA 3BH9A 3V5DA 3ZL4H 5DHYA 3KDMB 2BSRB 2J8UA 4CU6A 1UACH 4M6OL 3T2PA 3X14B 2H32H 2Z92B 5TF1H 2VLKB 2ENYA 1V8HA 2GTZA 4Y8DC 5DEZA 3ULUD 3QQNA 4N5ED 4ZFGL 3SGDH 1DCLA 3OAUL 2EE2A 3V5KB 2BNRB 3BGMA 3RAJL 3FQRB 3ZE0E 4JFDB 4EIGB 3FB5A 3B9KD 3CNKA 4PG2A 1VDGA 4HPYH 3L3IB 2JIXB 4NCC1 1XH3A 3QRGL 2B1HH 2E6QA 2C3WA 3OR7B 3EOBA 5F96L 4HS6B 5CD3A 5E4EB 5E70A 5FO8B 1MJ8L 4K3HA 3VRLF 5IHUL 3HA0A 1UQSA 3QWQB 4JFOA 4HS3A 4NQVA 4ZDHB 4R0LB 4OI8A 1KN2H 2R69H 3QIBD 5FB8B 5C1MB 2CQVA 2HH0H 4S0SD 4PJGA 3L3DB 2Q8AH 4ETQB 3S88H 5D1XA 1U3HB 2IQ9H 3W2DH 3QP3A 4Y16A 5IMKA 1G9EA 4RFOH 3IRPX 1C5BH 1P7QB 1X5ZA 3L5IA 2CLRA 5BRZB 1BFOB 2OTUB 1OAXL 2CLZB 1KG0B 4HBCH 5DF0A 3SE4C 3MJ9L 4LOUC 4JR9H 4GAJL 1FSKC 4R97B 3QJFB 1JNNL 2CKBB 2VIRA 3IJHB 1CFNB 2CLVA 3BPOC 3SE9L 3NZHH 2WBJB 3QUML 1MLBA 3QPQD 5E8OA 1XGRB 1D5ZB 4MB4A 5E8PB 1OAQH 4QEGA 2OP4L 1RZFH 4KZDL 4ZPTA 3E6HB 1RFDH 1MPAH 4M8QA 4MB3A 3QIWD 3HZVA 1JUFA 4TSAL 4NM4H 3EGSB 4UAOB 4G6MH 1MWAL 1TZHB 4G6JL 4H20L 5I0DA 5K33A 5IHBA 1MY7A 2H45A 1UZ8B 3WEXB 3MV7B 1ADQL 5I1LB 5AZ2L 4POYA 1S9YA 3U4AA 1G7PB 1IC7H 2ZSWB 2AXGA 3TBYB 2P8PA 1XGPB 3HRZA 5I74B 4NFCA 2BOBB 4BH7A 3TYGL 5J11C 3R06A 1HQ4A 4XB8A 1WCBB 3CSBA 5CLTA 2ZG2A 3QCUL 5E2JA 5I6XB 3ORJA 3HE7B 3L7FA 4RNRB 4HF5H 3TBWB 4FFWD 2HKFL 4MA7H 1IILE 4DK3A 1SBBA 1CFSA 2BNUB 4EEEA 4FFZH 5AD0A 1KB5L 4XMPH 2H26B 4RBPK 2F8OA 5GJSL 4YNYB 2D31A 2JF1A 2ZCLL 1OAYH 4L9LB 5ICXB 3DX9B 4IBLT 2EDRA 3MGTB 3RPIA 3WUWG 5DD6A 3E6FA 4U7MA 4P23B 3ARBD 1MIML 1KYOK 3TGXA 2Z93A 5K9JL 4XZUA 4WY7H 5JDJA 4AMKL 1F2QA 4EOWL 3L3JB 1P84K 4NZTH 4HUKB 4PRPD 5C0DB 3HHRB 1XCQB 3L95B 2RB8A 5DVNA 3UO1L 4NJAL 3V4PH 5EBLB 2H2PC 1AY1L 1EHLH 3P4OA 3RWEA 1OT1A 3LHPL 1T3FB 1JHLH 4YGVB 3N50A 4QHMB 4RISH 5HI3D 3DTXA 2XKUA 4C57C 3IF1B 1B4JL 1WITA 3DIFA 4ZAKC 3S7GA 1R0AH 1S7XA 3VGAC 1WWBX 2WZPD 3BIKB 1UJTA 4FMKA 1T66C 2VXTH 1MJ7H 5JORB 2YUXA 4MQSB 3BHBB 1CGXA 1A14H 1A7OH 3RVUD 2BSED 5T33H 3C5ZB 1XR8A 3PWPA 3DXAB 3MJ7A 1I9JL 4CVXA 1FNSL 1CLOL 1VACB 2GQHA 3QZWA 4JFPA 4P5KB 4JKKA 2FB4L 4RZCB 2NLJA 4PY7A 2IANE 2PW1A 3HI1B 2A83A 3P0YL 5TQ0L 1FC1A 2VDOL 1PKQA 2VE6B 5GS2H 4I3RH 5JA9A 1K5NA 5FYKH 4KU1A 4Y7MA 3FB8A 1A3LL 2WLZA 3OKOA 4LOUD 2VERN 1JHKH 4NQDE 3O6KH 3FFDB 1KLUA 3GBLA 5GS0H 3DO7A 2O61A 1INQB 2XWBB 4ORGB 5I66A 4WTZA 5GXBB 3D87B 2YXFA 1QFWH 1TENA 4LHUD 2V6HA 4MD4B 3LKSA 4M3KB 3AS2A 4ZS7H 4KTEL 1KN4H 2DQGL 2JJTC 1BFVL 2WWKT 3IFPA 4L4VA 5LAXA 2WMPA 2NW3B 2FJGA 1T0NB 1ZT4A 2BRRL 5JW4R 1UYWH 3VFOA 3RVVD 4MXVE 4KRNA 1IAMA 1NC4B 4NC1E 8FABB 5ISZA 1A7PH 3D48R 1EPFA 1W0VA 5EPMB 2VLMD 5AAWA 2ZJSH 5HSFA 3AM8C 5IROA 4RRPG 4P4KB 1LEIB 3VMNA 3STBA 4KXZH 4QOKE 1H3TA 1UWXH 3NN8B 3DNKA 3JWNC 4Z7UB 4C56B 4ZFFB 3DLQR 4ZPVA 1XF3B 5GISH 3G5VB 4F3FB 1QNZH 4NQCD 3T0EC 1UCBH 3C5JA 5EB9A 1YUHB 5FGSA 4W4OA 1AGBB 4QCIA 5LWYL 3ZKND 3TP4A 2E3VA 3WHE1 3EYSH 4QKXB 3RZCC 4LSQL 1EMTL 3WHXA 5GJTL 5C9JB 2D7OA 4FQHB 3RHWK 3D2UB 4JG1L 5C0CB 3SCMC 4OCNC 1R24B 1CE6A 4HKXB 3MUHL 3MRKB 2FO1A 5D7IF 5IFAL 4DVRL 3HB3C 2X9XA 3MRJB 2OXGA 4L3AA 5L9DH 5FUCE 4JM2F 1XGTA 2W91A 3CFEA 4BKLB 1QLFA 4A6YA 2R2BA 5F1IB 3VH8G 3EO1B 3EJZD 4CDHA 2X9WA 3PP3H 2NTFB 2VH5H 3MBEC 4RCAA 3TA3C 5F7EL 1EV2E 1NMBL 1NLBL 1FFPB 4PJ9B 3QEQB 1EVUA 1B0GA 4MDJA 1UM4H 3FTGB 1IM9A 4WI9A 4CGTA 4ZQKB 1G84A 4KUCD 4CN4A 4G6AC 1CTOA 4X7TA 1F4HA 1GPOL 3KLDA 3LKOA 1T66D 1Z2KA 2ZOKA 2NY5C 4ERSH 4O51A 5T3XE 2BDNH 1J5OL 3IU4L 1ZV5A 4HJJL 2EKSB 1JGEA 3RWHB 3SDYH 3TWCH 2X1WL 3FQTA 5EG6C 1JYWA 3AS1A 4I4WA 4ODHL 3BDBA 3AS3A 5F7LB 3CDCA 4ODWA 4GW1A 1K2DB 4HIEB 1HKFA 2GJ6A 5A43C 3AAZA 5HGGS 3KR3H 3CX5K 1ZVYA 4EDXA 5SWSD 5I1CL 1XF5A 5EOCH 1JVKA 2WK2A 2XI9A 4H25A 4GG6B 5IB1B 3NH7L 5D6CA 4ETYA 3LSOA 1Z9SA 4JFXB 3FCTA 5C6TH 3SDDA 1JGLH 4DQOH 4NZUL 1DVFD 1UZ6F 4YQXL 4HUNB 4R6UA 3LEXB 1IEAB 4AEIH 3O2DA 3RUGA 2NY3B 1A4JB 1AD9B 3NFNA 5DO2D 3BP7A 3VD5A 2J3SA 1FNEA 4KH2A 1LEKB 1Y6NR 1E4WH 1UVQA 1N5AB 4UIMA 1DLHB 2R4RH 4ZTPH 1IGTB 3S9DB 1KPRA 5D93B 4MLSA 5EUOE 3VWJA 4PGEA 2CR3A 1M6OA 1KJVA 1GGBH 5HDLA 2VTFA 5T3XL 2VQ1A 4LRNH 3KPLB 4OCXH 3IVKA 1I9IL 4OD1L 5IP4A 5I1KH 1X5AA 4U6TA 1IFHL 4CMHB 4OZGA 5ANME 3H0TB 3LQMA 4N8VA 3T0ED 3ALWA 4NKIH 3E8UL 4I18B 1M7IB 3JBG7 3BPLB 2P8MB 2WSKA 5JQHC 5KTEH 3BD4A 1E4XL 1LO2H 3CMGA 1X5XA 2D03H 3OJDA 3QCTH 3U36B 3LKNA 1MF2H 1NC2D 4LKCA 3SE8H 3WLWC 2W9DH 1N8ZB 4QRPD 3SCMD 4FA8A 3S5LB 1KCKA 1MAMH 5FYJU 2FX8H 5ERWA 4YR6A 1V3LA 5HHVH 3HB3D 1FPTL 1MEXL 4YC2B 2HRPH 1PZ5B 1TVHA 2Z8WC 5CWSB 3CFIC 4G9FB 4OF7A 1A6TB 3BP5B 3IFOB 4N0UB 2Y9RT 5TE4L 1XIWD 4WW2F 4FQ2H 5EZLA 1YC8A 4OAWA 1QUNA 4PUBL 5CEXB 2EYRA 2ID5A 4WFHD 3UCRA 4X7DC 4NZJA 3QDJB 4PG2C 2LVCA 1P7KA 3TO2A 3KPMB 2A6IA 2ZCHL 1NCNA 5H35A 1ZVHA 3VFUA 4MA8H 4L8CB 4AEFA 3F7QA 3L9RB 4LNRB 4OSUH 4LVHC 4IDLA 1DANT 1OM3H 4WHDA 4XAKE 1JPSH 4PV8B 4L5FH 4GAGH 4IRJB 3ARFB 5DJAB 2DD8H 3K80A 5FGCB 2VAAA 3LQAC 4ZFZB 3ARSA 3Q48A 1BVLA 5D1XC 1HSAA 4Y16C 3PDOA 1YYLH 4PRIE 5JW4Q 1JGVL 5FOJA 4PRNB 5SWQB 2QADC 1FZKB 4HMEA 4WEUD 1N2RA 2I60L 3CFCL 5DFVD 3RX8A 1U92A 4LVEA 2VXQH 5D71L 3GI9L 5HYIA 1U6AL 4ODSL 3FOLA 3REVA 2BNQD 1ZHLA 1S7RA 3D3VB 5EUKB 3DGGA 1MCDA 3SDAD 4DOHB 2DLGA 1CICB 4OLXL 2N56A 1JNHB 3PQYD 4UI2A 4CU7A 2DYPA 2EDNA 2R0LH 1HIML 5DT1L 4I9WD 5CUSL 4X6CE 1F8TL 2YHGA 4GW4B 3VWKC 4YHNA 1CDJA 3BP6B 3DX6B 4P9HC 3PV6A 4Q58C 5FYJE 7CGTA 3MJ8B 4F7MA 2ARWA 2N7AA 1G7QA 2O5ZH 1A7QH 1TJGH 3C9NB 4Y5XB 1RZ7H 3G5XB 4JFEA 4P5TB 4WO4B 2FLBT 5CJXA 2HFEB 5HI4D 4D0CB 1CF8L 3UBXG 1DN2A 12E8L 5HHPA 1BX2A 4R26L 5DHVA 2CSPA 2DQHL 4WEBL 4BFIA 3B5GA 3QXAA 3IJYB 1CLYH 2C7UA 2JK5B 5A16A 5C08B 3GMPA 2Q6WB 4R2GC 5BVJB 3EUUA 1RUMH 2F54E 1SEBA 5H37H 3VI4F 4HDIA 3P4LA 4PTUB 4EN3A 3FOMA 3N06B 1ZEAH 4DTGH 3MLPA 4HX1A 3WMSA 1FNGB 1ZTXL 1LEGA 5E6ID 4UIKL 5C07D 1DQQA 3GIZL 2AXJA 5CGTA 1QRNA 5CBAA 3M1BB 5I1JL 3QDME 4Y4KA 1W72L 1OAUH 3UJIL 1BZ7B 4GUPA 5DHXB 5EOQL 4ZSOE 4MQ7A 1KGCE 4WUUD 5C8JB 3UZQA 4XWGH 4UQ2A 4TQEH 4MAYD 1WIUA 3W9DB 5D5MB 1MCFA 3FKUS 4HWZA 1OWRM 3WLWD 4KRMB 4LCUA 1YEJL 3I3BA 3O6FA 2FJFB 3CVIH 2IH1A 4PJAA 5FYJL 3DI3B 3CZFB 1UWEL 5KBNC 3GBNL 3T0XA 5DZLA 1YY9C 2LU3A 3DV6A 1GGTA 3LD8C 4OCMC 4AYFA 5KSUA 3BKML 4YPGB 3QPXH 5K9KA 5T3ZH 4ELMB 5F6HJ 1AGEB 3CFBA 3DVIA 1C16A 2WINA 1NCDH 1Q0XL 3BZ4A 3C2SA 1M7DA 2VC2L 5GRZA 4Q9RL 3LS5L 1QFUL 2FBJH 3GNML 4WGVB 2OTWA 3MJ9A 3D69B 2FEEI 1TITA 3ZSSA 1RJZA 1T21B 4PJFB 5LGHH 4YEEA 3R8BB 3TN0A 4LMQI 2NY1C 4YXHH 1AXSB 1U42A 2AABH 3VXNA 5CJQH 3U83A 5KSBF 5ITBL 1UKTA 1UXSB 5F9OH 3ZKQD 1MFBH 1ONQB 3C6SA 5D1XD 4NQSA 4CMMA 2D7TH 3ZL4L 4Y16D 3M45A 5HYQA 4YXLL 1D5MB 1A6UH 4RIRA 1Z0MA 5TF1L 3Q6GH 4XVSL 5DJYA 5CP3A 4I48A 3GMMA 3K4ZA 4HWEL 5GGQL 2CPCA 2V2XB 4GG8A 4NO2B 3I50H 4MNGB 4XMLH 3WFBL 2DLFL 3VFPB 5D1QA 1ZANH 1RZ8A 1GZPB 1WICA 3BEWA 5EIQA 4NQEE 1OQOA 2FHCA 5INDA 1EFXD 2G60L 1KEGL 3GMQB 4KV5E 2O5XL 4NM8L 3RU8L 3VXOA 4CVZA 3STZB 5DUPH 2PXYC 1RU9H 4HPYL 2VNCA 5ESQA 1CXKA 2X4QB 3IDNA 4JQIH 4YHZH 2B1HL 4KI5F 4ODXA 2ADJB 4GRLA 2VLJE 2ATPA 4R7NA 4M7ZB 3N85L 1CI5A 2P48B 2CH8A 4Q6IB 3S88L 5IROC 1HXYA 4MNHB 3W2DL 2NXZB 2UUDK 4K7PX 4FZ8L 5GGTL 4OZFG 4FQXA 4H8WL 3BO8A 4YDLB 4XNMA 2R1XB 2AJ3B 4DCQB 1AO7D 3OKEB 4IHOB 1UB5A 3QUXB 4HBCL 2JJSA 5T1KB 2IEPA 2FECI 2N7BA 4PGZA 4E0RB 3PNWB 5JXAH 5MEPB 2AJVL 5I8KH 4W4OC 5JO5B 3W0WD 3HAEA 4NRYB 1WBZA 2C4FT 5C86A 3IDUA 1Q9KB 1F4AA 4M62H 5ICYB 3HPJB 4KK5D 3ZDZF 4RDQG 3U2SA 3T8XB 2FWOB 4XP9H 3T77B 3GKWH 4DKEH 4HKBB 3RI5F 2X10A 1X4ZA 5F88B 4X6BA 5IW1B 3IDIB 5BS0A 4R4BB 4QTHB 1RZFL 5GRUL 1FL5B 3B9VA 5GGUB 1JPST 4M9PA 4LVNC 5L88L 3IAGC 1MPAL 3KS0J 4NM4L 4PGCA 1T22B 5ITFA 5KN5B 1NCAH 1NGXB 4NWUH 1J05A 5L2JB 1Q1JL 1YY9D 3MNVA 5IQ9A 5C0IA 5KVGL 3OMZA 5ID0A 1AJ7H 1WAAF 4NHUB 3WFHB 4JDZA 2Z8VC 4G8IA 1I1AB 1H0DB 2NR6D 1FG2A 1ZLVK 3V95A 4HH9B 2OX5A 4P0DA 3ZDYE 3AS0A 1FZMB 4BSVB 1S5HB 4Z5RA 3WIIH 3WS3B 1MCLA 4M5YL 2NY0C 4B0MM 3G08B 4OB5H 3B2UC 4XMPL 2NY1D 1F97A 3IDJA 4N1HB 3PWPD 2BC4B 4U0RB 3WKMH 1Q0YL 2ZCKH 3RWCB 3U9PH 3AVEA 3ECBA 1I7UA 2YD8A 4PJBE 3RGVB 3SBWC 1ZLWK 4XB7A 4PGJA 4HUUB 5DVOA 4HK3N 1N3NA 1WEJH 4GH7B 4EBQH 4NZTL 4UU9B 3PL6B 5CJBA 3VXPA 1BLNA 3VE0B 3AXLA 4LPYA 2XZAH 4HD9A 1CXEA 2R0KH 1I3UA 4HQQH 1NL0H 3SDDC 5AZEH 1GGYA 1TDQA 1YDPA 1EIBA 3V8OA 4H1LA 3BOVA 1JHLL 1RQ5A 4V1DA 4RISL 1DFBL 1KC5H 4ENEC 4JKPH 2D7NA 3P77B 1XFPA 4JM4L 3DRQB 3OXRA 4HGWA 3TNNA 3RWJA 2A1WL 4WHTB 3HCVA 3QA3A 1NAMH 1MJ7L 2F74A 3QDHA 3TF7C 5MP6H 3EOYG 4XHJD 1YEFH 1UB6A 1R3LB 3KPOA 3OJ2C 4GBXB 4L4VD 4JPIA 1MRCL 3MPCA 2HTLC 4K9EC 5TDPB 2X2YA 3VWJC 5ISZD 1MCOH 1HOCA 3STLB 4NQDA 3ULUH 2W0LA 3IDMB 4YDVB 4CW1B 3RTQA 3M17A 3OXSB 3WLBA 5TGBA 2Q7YB 1ZT1B 2V7NA 2DL2A 3WIHA 5BV7H 3D0LA 2I5YH 5F7FA 2D3VA 1NANI 4P2YA 5KJRH 2J2ZA 3W11C 2AI0H 3X17A 1IAOB 2ADIA 5GSRA 3FT2A 2PUQT 5GHWH 3VFTB 1C08B 5E6YA 1JHKL 4NJ9H 5D9SB 1OP3K 4MJIB 3UPRB 2AKRB 3B3IB 3OKKA 3HNSL 1SVCP 3IU3A 1T0MA 2BFVL 1QFWL 1S7UB 4A2LA 3ILPB 3HI5H 4QOKA 1I8LA 3HUJA 1UJ3A 2EECA 5CZVL 5J13C 5T5FH 2CDFA 3ARDA 1JWSB 5HHNB 4I3GA 4WFEE 3U4EA 2FIKB 4OD2B 4LSSL 2ESVE 3HMXA 1B0WA 1FCCA 3P9MB 3MCKA 2DBLH 1A7PL 3U0PB 2VLLB 1GC1C 1DBBH 2XV6B 4KRPC 2V17H 5EN2B 1U58B 5EZIH 3VXRA 1KULA 1KLGB 4LBEB 1JGDB 2VWEC 1NBQA 5M95B 1I1YB 4JHAH 1NFIB 4G3YH 3I6GA 1BQHB 3C60A 1JPFA 2OR7A 3S4SB 1UCBL 1VGKB 3REWA 1S9XA 2HJLB 4ZYKA 2UWEF 3RVTD 4JFHE 3KNBA 2E8YA 1U8IB 5C0GB 5KG9A 3DXAE 2NY0D 4ZUUA 1E0OB 4LGPB 3TVMC 3MREB 2GIYA 1FL3A 1XF4B 5K9OA 5E2TH 3THMH 2VISB 4Y1AB 2D0FA 2FX7H 1I7TA 5DMIH 2AEQL 1PYWB 2GJ6D 3OAYK 4R4ND 4U1HB 1V3MA 1CLCA 4OV6F 1F2XK 4OLVH 2Y06H 1EH9A 4UUJB 4HXAH 4JFFB 1R3HB 2Z8SA 1JNJA 3DO3A 4DAGH 1Z0NA 2D9QB 5DEFA 2WANA 4GXUM 4TSCH 2XT1B 3UTTD 1RZGA 3DVGB 2VH5L 1BP3B 1LO0H 3BUYA 2C4FU 3FRUA 4Z18A 3V52H 5F9JB 1CWVA 3BKJL 1DUZA 3F7YB 3QSKB 3SDDD 1NDGA 1ORSB 4J4PD 4PJXE 2GTWB 3NAAH 1UM4L 2XIDA 4ENED 3OZ9H 2XZCL 1T5XA 1P7HL 4RMUA 3VD4A 1DSFL 3FO9A 1NBYB 5I1AB 4ERSL 5CJXC 1NCWH 1IBGH 1MCCA 2BDNL 2IFFL 2P1YA 1WBYB 3QNZB 5HYJE 1BF2A 3SDYL 3UBXI 5I15L 4DGYH 2EH7L 2EDHA 4MVBD 3KVQA 3BVNA 1UKSA 4KKBC 3RJQB 3KR3L 5HGAA 1BVZA 1AHWC 1O7SA 1KTLA 3I9GL 4X80L 4EN3C 4OI7A 3V6ZB 1LP9F 2YN3A 4OBSA 4ESKA 3QQ9D 1HWGB 4D0DA 4EI5A 3OKNA 1HCFX 1YMMB 2NXYB 4P2OA 2R23B 4DQOL 5EUOA 4LKXB 2AJZA 4LCCB 3EZJB 3ARZA 4B50A 3QI9B 2DQDL 3LEYL 1R3JB 2DQCL 5BXFB 3FL7A 32C2B 3WJLA 4HZLA 3JTSA 3TBSA 2AJUL 2UYLB 1XF1A 5ANMA 2OLDA 1E4WL 1ETZA 3O6FC 4RWHA 2IPUK 1JPGB 5IMMB 3KPTA 4YK4B 3CU7A 2PTTA 3MGAA 4Y4HB 1DDHB 5HY9A 3UAJC 4PBVC 2PKDA 2YC1A 4G5ZH 4NHCH 3SE3A 1BZ9B 3RX5A 4Q9BA 4KRPD 4BQ6A 4MA3B 2FSEA 3Q3GA 3EW3B 1BEYL 1A1OB 2PR4H 4OUUA 5IM7B 5I1KL 5GGRB 3S5LG 3LB6C 3LQZB 1DBKH 4OCSL 1KLFA 4PYGA 1AQKH 1T1ZB 4PBWD 2IALB 5L8KB 2B8OT 5DFWH 3ESUF 4NKIL 1E4KA 4OGAC 5F3BA 3TN0C 1HEZA 3NIDF 1FN4A 3LKQB 1D5XA 1FZOB 1MJJB 4MXWL 4JY6B 1C5DA 1QQDB 3D39A 4OQTH 4S1DC 5SX5K 1TPXB 3MXWH 1CLZH 4KKCC 4KPHL 4F9LA 3HG1B 3QCTL 1NFKA 4Y4FB 1NFDE 1OSZB 2ADGB 3WXWH 4E41E 5FV1L 2W9DL 43CAA 5E03A 4F2MA 4M3JA 1D9KB 4JDVB 5FHBH 3QDGA 5C09D 4GG6E 4X6DE 5HHVL 4WJ5A 2G75B 3LKPB 2YD9A 1PKOA 4YHMH 3AREA 1T04A 3O6MH 4PD4J 5TH2B 2AEIT 3F12A 5JR1H 4U1GB 1KNOA 3EOAA 1EAPA 5LKNA 3JUYA 1QVOB 1PQZB 3H9SB 3O3UN 5F44A 3QWOB 4FQ2L 4XNZB 4KQ3H 3KPRB 3U30B 4E5XB 2DQFB 1EBAA 5F7WC 4RWYH 3QUZD 2BY0A 2YD2A 1KPUB 5JPNA 5B39A 1F42A 1FO0L 3D1MC 4NBYB 4GRLC 4RAUA 5M7QA 1F4YH 2EKJA 5ESAB 4L5FL 3K8MA 5IF0A 3WFCH 5L8LB 2DD8L 2F9BT 4JFED 4WVRA 3VXUB 3WJJC 2RAMA 3CLEL 4JRWA 4KK6D 2E27H 4WWID 5L0QC 3OKMB 4S10A 2GAZB 1YYLL 5FK9B 1DE4A 3NIGE 3NCYS 4URTB 1J8HB 4FQXC 5GSVB 1QSFB 4YZFE 4KKBD 4X6CA 1NGWB 5DR5H 1OSPL 5I73B 4G8GD 1YNLL 4XBPB 5I8EB 1MHPH 4YH6A 2JJSC 4TNWK 4UDUB 4CVWA 2DQIH 1BD2A 1QLEH 2Z35A 4EN3D 1NQBA 3LKRB 4MYWB 4WNQB 5EU6E 3HNVL 1E27A 1ZA6A 3WDJA 2R0LL 4JVWA 4OFYD 4GRMB 4Y4KD 1PG7W 4O02L 5I17A 3ZDXF 2GUOB 4ZTOH 1X5IA 1U8JA 4G8EB 1JI1A 2P44B 2O5ZL 1TJGL 4L4TB 2ICWB 2X70B 2AJSH 4YBQD 4JGJA 3MGOB 5J1TC 3EFDH 4ONFH 3O6FD 4RBPH 5ETUA 3U0WH 5T3ZE 4G9FE 4K7PH 2YUZA 2BVQB 3UAJD 2P45B 5F6HI 4WI7A 3VD9A 2X4OB 4WDIB 4IRSB 1UKQA 4TSBH 3EDDA 4V2CB 2C5DC 3QDJE 4ZSOA 1HI6A 1RUML 2VDRH 2YN5A 4G9DA 4J1UB 1PZUB 3C8HA 1D6EB 5IKCA 2A6JB 4N0CD 2YEZB 3LB6D 2LU4A 4JM2B 3C08H 5IJKA 1ZEAL 3NACL 4DTGL 3O4LA 3GJEA 1TQBB 4M93B 5FGCE 4HV8A 2WW8A 4ONHA 4OGAD 1MY5A 2IG2L 1YJDC 4YAQB 3K1KC 1DUYB 3TN0D 1OAUL 4P46B 4WV1C 3MV9B 4B7IA 1WZKA 4PJ7E 4MQXC 1IAIM 4PTTA 3VXMA 3G6AA 4JZJB 4XWGL 3X13B 4KKCD 4YDIH 1IAKB 2V5MA 4WWKA 4GW5B 2W9EL 5HJ3B 1YNTB 1C8PA 4GQ9L 4OCYH 2IPTH 4YGAB 4FS0A 4NN5C 2BXYA 4JREC 3RNQB 3EDEA 1DLFL 4Y19E 1ZLSL 1JRHI 2JJUA 4OCLC 2OZ4H 1IM3A 1OARH 2QSQA 3FRPA 2P5WB 5E1AB 2B4CC 5D1QD 1ND0B 5GGTA 3PWUA 5T3ZL 5CJ5A 5IEHA 5IWLA 3OL2A 4KGJA 3L7EA 1N0LA 4J3XA 4M43H 1MQKH 1F6FB 3G6DL 5I2IB 4JO3L 2FBJL 4Z0XA 3FN0H 4RGNE 3IGAB 5I76A 4OKVB 4LU5H 5FOBA 1WJ3A 4KQ4H 2P46B 4AL8H 4QWWC 1CGSH 3SDCB 3U7WH 4RGMC 1EEQA 3MJGX 3TESA 1OVZA 3CXDH 5F9OL 4NQEA 2DF3A 4W6XB 2R2CA 3RTQC 1U2HA 4WI4A 1AD0A 3QHZL 5KANG 4GKNB 3ARGD 1A6UL 2E7MA 4FQXD 2HJFA 3WBDA 5IMOA 5FM5O 2XZZA 1EUUA 4K07A 2VLJA 5C0AB 5C0RL 1EK3A 2XA3A 4XMLL 4S1QL 1Q9OA 1T2JA 5J06A 1ZANL 3KYOA 4ZG1A 4H26A 4NUJA 5CP7B 2OL3B 3MZTA 1P2CA 4KAQH 4LARL 1GAFH 3GRWH 5HPOA 2OK0L 5GGVH 2ZUXA 3LPGA 3R0MA 3T2QA 4F33B 3BRFA 3MR9B 4KHTL 5DUPL 3QH3B 1RU9L 5IB5B 1QFPA 1I8LC 3PDDA 3MCG1 5DJ6A 3ARDC 3LN9A 3OB0K 2ZUVA 4GRWF 4QNPF 4R3SA 5HYSA 4JQVA 1U8OA 2K7PA 1QD0A 2D7PA 3BPCA 5JW4M 1NBVL 4HIJA 2AK1L 4TUKH 4BYHA 5C0BB 1JYVA 1DBAH 5E5MA 3FQXA 4QY8B 3QEHA 3VFVB 4JPKL 4ELME 4X99A 2C1OB 4DFIA 2EDJA 3MLVH 1JFQH 3N1PC 3X12A 4ZUVA 1T5WB 3O9WD 2QKIB 3IDYC 2BSRA 1EEUA 2Q3AA 4X7SH 3MLUH 3ZT5A 3X14A 1NBZA 3C60C 3CSGA 5EOTB 2Z92A 4J3UA 3DSNA 2E8ZA 2JB6A 2VLKA 4O5LH 4HFWA 3KYNB 5ID1B 1G9NC 4QLRA 3Q1SH 1BGXH 5I8KL 2DAVA 1I1RA 43C9B 4HAGA 4L1DA 4PJEF 3PHSA 1DQTA 1U91A 4WW2B 4HIIB 1B2WH 2BNRA 3MRFB 5DSCA 3FQRA 2AGJH 3TZVC 4KWUA 4JFDA 4MZ3A 4NDMB 4MQXD 4L3EB 4XNXH 3LRGA 3TT3H 3L3IA 2JIXA 1NUFA 3WO4B 4F8TA 5D2LE 2Y4SA 2X4TA 3FFCB 3OR7A 1AGFB 5FO8A 4HS6A 3U1SH 3QQ4B 4PJ8B 1K9TA 3GMLB 4IDJH 2DS4A 4ZDHA 2Z31D 1DJSA 4R0LA 2E5EA 5CBEA 5FB8A 1QBLH 2I07B 2G5BB 1JK8B 1EVTC 4ETQA 4JKLA 5SWZB 1U3HA 3DGCR 2XN9B 2VXSH 3HZKB 2R8SL 2BVPB 3DUHA 1P7QA 5DRZB 2FATH 4W4NA 1AR2A 1BFOA 1U9KA 2OTUA 1T83A 5I1DB 2CLZA 4XP1L 1KG0A 4EUPB 1HYSD 3MSPA 2IAND 1L7IH 3WIIL 3ULUE 4OB5L 2RIKA 3QJFA 5JA8B 2CKBA 3IJHA 4KK9C 4QWWD 1CFNA 4RFNB 2X4RA 1FLRH 3UDWA 4Z7OE 1VESA 4Z6AT 3JWDL 3WKML 3GZKA 3ROLA 3U9PL 4U1MB 4NQDD 2NY2C 1FIEA 1XGRA 1D5ZA 3GM8A 3O45B 4XVJL 2AQ1A 1WEJL 1HINH 5E0QA 2HAZA 5E8PA 4ONOA 5CINH 2MCG1 4P4RA 1AC0A 2NY6B 4NUGH 3EGSA 5D96B 1MIEH 2R0KL 1TZHA 4WI5A 5FCUL 1CGUA 5CD5D 3WNKA 3BZEB 4U1KB 3PWNB 5AZEL 3C09B 2OMBA 1UZ8A 5DLMH 5DURB 3E2HC 4U3CA 3MV7A 1MREH 5F93C 4XH2B 5D1ZC 1KC5L 3SOBH 1I8KB 1FH5H 4HH8A 4K8RL 2ZSWA 4JKPL 5E2UH 1XGPA 3LDBC 1U8NB 4GXVH 5DMGC 3WJLC 2BOBA 3LQAH 4QOKD 2EYTB 1NAML 5KW9L 3O3BB 1FE8H 4LVOB 5MP6L 3GJFK 3HE7A 4FQJH 4RNRA 4H5SB 4MCZB 2E7LC 3QCVH 3KPSB 3CSPA 4R96B 1N4XH 2QQNL 2BNUA 1LHZA 1FYTB 2HLAB 3SE3C 1LD9B 2H26A 1ZLUK 3ULUL 4YNYA 5DVMA 3VXRD 1T03H 1OD9A 4L9LA 5ICXA 3DX9A 5E8EA 1SBSL 1LDSA 3MGTA 3MRGA 5GRVL 4XX1G 1P4IH 4JVPA 4P23A 5BV7L 2FEDC 3P73B 1VERA 2VYRE 1JZ4A 5KJRL 1W0WB 3L3JA 1ZSDA 5C0DA 2AI0L 1XCQA 2ESVA 3L95A 4TOYL 4U6YA 1OGTB 4P9HH 5KVFL 1Z9MA 5EBLA 1J0JA 5E5UB 3VGEA 4NO0B 1GCFA 3SDXF 2E9BA 1J1OH 4TVPE 4QHMA 5B3NA 2YD3A 3L5HA 3LV3B 5EORH 3WL9B 3IF1A 4ISVB 4L8SA 5T5FL 2D2OA 3BIKA 3H7LA 1W0YT 4MHHG 2C3VA 5JORA 1RZJH 2C3XA 3BHBA 2BCKA 1I85A 4AG4H 3AREC 2DBLL 5KSBB 1P69B 2KZWA 4K94C 1BJ1J 1BM3L 5KZCD 5ALBH 2HJKB 2VZSA 3C5ZA 2IBGA 5EZIL 4N0YL 2IGFL 3U6RB 1NANH 3OF6D 3DXAA 1P9MA 3RA7L 5T3XD 5CS7A 5IBUG 2NQCA 4RA0C 1EX0A 2M1KA 2VR4A 4Y2DD 4XNYH 1KEMH 4M61B 2BY3A 4RZCA 4G3YL 4S1SH 1I9EA 4PRBB 4D9QE 2BOCB 2VDKL 4PJCE 2VE6A 2W0FB 3C6LA 2F5BL 1RJLB 3MUY1 4EQ2A 4Z76B 5I30L 5F89B 3ZTNL 5HVHB 4U05A 3FFDA 4GKSB 1INQA 5E2TL 2XWBA 4LAQL 4ORGA 3THML 2YWYA 2FX7L 1U95B 3RWGB 4PJXA 4UB0H 1W8OA 1H3GA 4MD4A 1DBJH 2DLHA 2NY2D 4TVPL 3S36X 1FLTX 4DAGL 2NW3A 5TFSH 1T0NA 1J1PH 4TSCL 5C3LD 1NC4A 2XKNB 1OP9A 8FABA 1V7NH 3ZYOA 4MJIE 2HFGH 4PP1C 3BGFB 5C9KA 3B5TA 4EI5D 3V52L 4C83B 2L7JA 1AC6A 4P2OD 1N6VA 5AG9A 4P4KA 1LEIA 2A73B 2ZNWA 4QT5B 5AYUH 3NN8A 4C56A 3OZ9L 1I1FB 4XNUL 3MUGB 2BJMH 5IIEB 1QG3A 1XF3A 4OJFH 3G5VA 4OF5A 4Y5VB 5F9WC 3TFKC 2EZ0C 2PTVA 3O8XB 4LCYB 2O26U 1A7NH 1YUHA 1NCWL 1IBGL 3T1FA 5C7XH 3RNKB 3UJTH 3WN5B 5EO0B 3FQUB 4O00A 4DGYL 4TTDD 4M1DL 3GK8H 3NA9L 3SKNB 4BA8A 3LZFH 1MNUH 3BKYL 5E08L 3D2UA 3U82B 5C0CA 1I7RB 2OTPA 3FQNA 5DI8B 1R24A 4HKXA 3MROB 1KACB 3MRKA 4U0QB 3QEGL 1FORH 3EYVB 3IAPA 5IJKC 1J87A 2FEDD 5T5NG 1WQVT 1RPQA 4OIBA 3HPLA 4XGZB 5C0ND 3GSQB 1S9WB 4APQB 5F1IA 2QSVA 3TO4B 2NTFA 4U1JB 4KGLA 4RAHA 4UOW0 3N0PB 1T7WA 1MHCA 1INDL 4X0KB 3LPWA 4KROC 5AAMA 3L3KB 4I3SH 4PJ9A 3QEQA 1BOYA 2B2XL 3AU1B 2F5AL 4WWKC 3VRLE 1VHPA 2R2HB 1KCRH 3FTGA 4LLVB 4NQCE 4PREB 5C0EB 1AFVL 4NKQB 4JFYB 3PDGA 4ZQKA 5INCB 3V7AE 3QDGD 5DK0A 4LFHD 3P4MB 3V9FA 2IMMA 3ARED 3V7MA 4G5ZL 2ITCB 4NHCL 4JFZL 4P3WA 4XAKD 2EKSA 2R0WH 3PWLB 5IOPB 3HZYB 3ZE1F 3HC0A 1CGVA 1BIIB 3I3DA 5IWLC 2EDLA 4OTXL 1K2DA 4HIEA 1YEKH 3UTQB 5HTSA 2GYSA 4RA3A 3GI8L 3HE6B 1NCBL 1DBKL 1NFDA 1UENA 2XRAH 4JANA 4E41A 1AQKL 4PRID 1JMXA 3FN9A 2R56L 2CRIA 1IC5H 3H42H 1WZMA 1KIUA 1TJIH 4GG6A 2OBGA 5IB1A 4X4YA 3CDGB 1BECA 4JFXA 1E4XI 2BP3A 4LPXA 1PG7X 2FO4A 2ZUWA 3GSWA 4OQTL 5CGMA 4OV5B 4GMTH 4LSVH 1CLZL 1JCKA 4E42B 4CAGA 1IEAA 2LTQC 1TCMA 2HYMA 4HHAB 4M02A 5HDBF 1NUGA 4IS6A 4BFGA 1AD9A 35C8L 5KSVB 1BOGB 2ZUYA 4PGDB 5D2NB 5DXWA 1ODAA 2RFXB 1LEKA 3UC0L 3TJEL 3DRTA 4P9ML 2GJJA 1N5AA 1DLHA 1I8IB 4CVUA 2Y7QB 3OV6A 2UUDH 3HLAA 4QRRB 5ADOH 1BAFH 1NEZB 2IFGA 2OR8A 3ZZ1A 3HS0B 5DEGB 3MRPA 2QLVB 3KPLA 5A2JH 5D7SH 1A64A 4W6YB 4RWYL 4WU5A 3DYPA 1H3PL 3O4OB 4BFBD 3HZMB 2LFGA 1ZHBB 1TXKA 4JQVC 3O11B 5F1KC 1HKLH 2X09A 4J12A 2YD7A 3WFCL 5DZOA 3SGKA 4I18A 1M7IA 1JZ5A 2P8MA 4JJHA 5EU6A 4PLKC 1LDPH 1KOAA 5IBLD 1XAUA 3MCLH 4KJPC 3RL1A 5D7JC 1F4XH 3P4NB 4RGOL 4LAJH 2RJMA 1YY8A 2LVEA 4FHBD 4ZO6A 1KGCD 3T65B 1JMZA 1MHPL 3U4BL 3G9AB 1EJ6A 4OZIE 2DQIL 1WFNA 2X1PA 4Z7WF 3O2DH 4LSTH 1IL1A 3Q6FB 3I02B 4WU7B 1S78D 3O4LD 3VU2A 1J0YA 5CWSA 3A67H 1DN0B 4HFUH 3QIWB 2JCCF 4G9FA 1QBMH 1A6TA 4JRYE 3BP5A 3IFOA 1ZLVH 3VFMB 4YFLF 5LG1A 4K23H 3VRJB 5CEXA 3RL2B 4K9EH 1O5DT 1REIA 3QDJA 2AVGA 3VXMD 1DQDL 2Y5TB 4AH2B 3KPMA 4OT1H 1Y0LB 1NGQH 4L8CA 1ROWA 3DBXB 1JF5A 5DZNA 5E4EC 2FNBA 2BVTA 3EFDL 4RDQF 4ONFL 3OPZH 3U0WL 4PV8A 2P8LA 4NN7B 5DJAA 2FL5B 4R0LC 1T1YB 4AY0A 4K7PL 3MTRA 1DQLH 3NIFF 4ZFZA 1VFOA 2HKHH 1U3HC 1CGYA 1ZLWH 1SJEA 4QHKI 3T3PE 4Z7VF 3OTTA 4NZDA 4PJ7A 1WWAX 2VDRL 4PRNA 5SWQA 1DBMH 2A77L 2AJXH 4HPOL 3K74B 2CDGB 2YPLB 1L7TH 3C08L 4GLRI 1T83C 3ARWA 3V4VH 2CUMA 3ARBB 4KKAD 4XP5H 4I1NB 2HT3C 2V2TA 5GRJH 3VXUE 5ABDE 3A6CH 4PRPB 2VDNL 3D3VA 2ZUSA 2A6DB 4JZOB 5EUKA 2XTJE 5GZOD 4PP2B 3QG7L 1JZ6A 1JZ8A 3FHAA 3K1DA 4JPWH 1NEUA 1JNHA 5HHOE 3UDWC 2MNUA 3TH3T 4F37K 2ZOLB 1QSFE 4WFHE 4NQED 2WBJC 4GW4A 4HLZH 3BP6A 3ZYIA 3DX6A 2ZG3A 3C2AH 5HGHB 4HIXH 4U1SB 4M1GL 4TPRH 5EZOH 3B6SA 3QXUA 4GSDL 1MFDL 3QXDB 1OB1B 1QZ1A 3RGHA 3C9NA 4Y5XA 4FNLH 4LLUA 4P5TA 4WO4A 3V4UL 2VLJD 2OZ4L 4UAOC 4LDOB 4JGUA 4D0CA 3D9AH 3CFDA 3N9GH 4QGYA 1IGML 3RBGA 1RUKH 5J4MA 1RIHL 5CGYC 4HUMB 1KIRB 3ULVC 4KK8D 2Q6WA 4M43L 3O3EB 3U7AA 5BVJA 3WNLA 4HWBL 5I74C 3MMEB 4WENB 3TYFB 1IC4H 5D8JL 3MV8E 2FIRT 3FN0L 4ZFOL 1LP9B 4G7VH 4L4TE 4PTUA 1D3CA 5I6XC 1QYGH 1QHPA 3HE7C 3WHE0 3GUTB 1OP3H 4KQ4L 2BNQE 4FXGB 4AL8L 1FNGA 4J3SA 4PB0L 1YEEH 3RIFK 2DMCA 2F19L 1A21A 2MQ0A 1KCSH 3M1BA 2H1PL 1BZ7A 3GMOB 1A7RL 5DGQA 4PLKD 5DTFB 4S2SB 3BD3A 5C8JA 1G0XA 4L9LC 5D7IE 1JRHH 4Z0BH 3QDAA 4FQLH 5T1LA 3SKMB 3D25B 3WNNA 4P23C 4K7PY 5D5MA 3VXSE 3WUZA 4LHUB 3BEVB 4NNXB 1EHAA 1B90A 2IADA 2FJFA 1EJOH 4M6MH 3QAZB 1I1CA 4WI3A 1AIFB 4LLMB 3MV9E 4X5LA 1Q94B 1JF1B 1KUMA 3GRWL 5GGVL 2Q8BH 1NCUA 1A3RH 3R1GL 2GFBB 4WFGE 1GL4B 2NY5L 4ELMA 1TQCB 1AGEA 1DQMH 1CL7L 4JFDD 1MCPH 3KXFB 5DHVH 2OI9C 3W81A 3D69A 3EHBC 4WHYH 2JIXD 1EFQA 4M6OH 5LXGH 4P2RE 2NX5E 4Z7UF 1T21A 4PJFA 5CMAB 4UINH 4UTBH 1FNHA 1AXSA 4EVNB 3C5ZC 1L6ZA 1MHEB 1D6VL 1UXSA 4OZHF 1P9MC 2KQNA 3MLVL 1JFQL 3OAYH 4WUUE 4ZFGH 1BQUA 1UWGL 1YEDB 2ZKHL 1ONQA 3DURB 3O81A 3OX8B 1U3HD 2X05A 1WTLA 3X11B 3RAJH 2XQYK 5B4MC 4X7SL 1M71B 5JIPA 3MLUL 3AB0B 1A1NB 5E8NA 3K4DA 1D5MA 4NKOB 4O5LL 5D2LA 4KZEL 1BGXL 1MCKA 3VJ6B 4MNGA 4XNQB 2PN5A 5FO7B 1A22B 1UZ6E 3VFPA 4AK1A 4DEPB 4MJ5A 5F96H 5ILTL 4DFHA 1GZPA 1MJ8H 1IZJA 2DI8A 4EXPX 2YD4A 1L4IA 2HWZL 4I0PA 3PABB 2AGJL 4BSWB 4TTGA 3CH1A 3GMQA 2V7HB 3RY6A 4EDWL 1U41A 2EDEA 2ATKB 3STZA 4XNXL 2K3TA 3TT3L 2VZ1A 2X4QA 3NTCL 2ADJA 4LP5A 3L3OB 1U2CA 1OAXH 4IDJL 5BO1L 2Q76B 1KCVL 2ZUQB 1QBLL 1A6PA 4Q6IA 5L8JB 3MJ9H 3ARYA 4MNHA 3DPBA 4H0IA 5H37G 4PJGE 2BSTB 1JNNH 3CGTA 2VZOA 5I8CB 4P4KC 5HBBA 1XZ0A 5CGYD 3ULVD 2R1XA 2AJ3A 2QV2A 2FATL 3SE9H 3OKEA 5GGSA 4IHOA 1G7MB 1M05B 3PWVA 4LK4A 3P30L 5I1IL 3QUXA 2DMBA 5GGVY 5SWSB 5T1KA 1PSKL 3MNZB 5C0BE 4E0RA 3BUTA 3PNWA 3IDXL 5CJ8A 5MEPA 1DEEB 3DECA 3GKZA 4XXDB 4YDJB 3HE7D 4KUZH 2OP4H 2UY7A 1L0QA 3RWDB 4YWGH 5JO5A 3VDBA 4KZDH 4NRYA 2PCPA 5CILH 4FRWA 1QO3B 5IVXF 1Q9KA 4J3VA 5ICYA 3HPJA 2FWOA 4PB9H 1DVFB 3T77A 1JWUB 3UJJH 3S36H 3TBVA 5CZXC 5DQ9B 1HYRC 5F88A 5IW1A 3IDIA 5CINL 4R4BA 4QTHA 3ZO0A 3AMKA 1FL5A 2QSTA 5GGUA 3TYGH 1TTGA 3TH4T 4WFED 4NC0B 4NUGL 1MIEL 2CK2A 4IIQB 5KN5A 5DRWB 1NGXA 2ESVD 3KPPA 3GSUA 4ZUWB 5L2JA 2XG5A 1I3GH 5DLML 4BK4A 3L5JA 1MCWW 3SOBL 1KB5H 3LIZH 3WFHA 1CD8A 1CDCA 4PJ9C 5E2UL 5EBWB 4ZUSB 1I1AA 1H0DA 5EU3B 3LQAL 5L6YH 2ZCLH 1FBIL 4HH9A 1FZMA 4FQJL 4FOMA 1MIMH 4NT6A 4PPTA 5D70L 5K9JH 5SX5H 5EFIB 4BSVA 4AMKH 4LHQB 4EOWH 1N4XL 4FG6C 3N1GC 2K1MA 1F3JB 3C5ZD 4HC1L 3UO1H 4NJAH 1U3JA 1T03L 3CFKB 2JJVA 2BC4A 1EXUB 2YUWA 3MRMB 2EXYC 3DXAD 4N5UA 5IW6B 2Q87A 3RWCA 1AY1H 2FD6H 4XC3L 1P4IL 3HAEH 3RGVA 1U8QA 3LHPH 1TLKA 1A6WL 4HUUA 5B4MD 2X4SA 3ES6B 3WNOA 4QRPB 4BQCA 2DM4A 4UU9A 5JPMB 4MXQC 4W81A 3PL6A 1S9KC 4GOSA 3WUWB 1IGYA 3C6LD 3WDHA 5ACLA 1SY6A 5K59F 2MWCA 3SKUD 4AIZA 4AQ1B 4YX2L 3KLHD 5EORL 1XIWB 1I9JH 2NY3C 3ARTA 4QXGL 1J18A 1FNSH 1CLOH 4P3DB 3RKPA 3DRQA 5IT2H 3MRNB 4WHTA 3PXJA 2FB4H 5I16B 3KYMA 3P0YH 4PJCA 1R3LA 2VDOH 1YN7B 3WIFB 1HNGA 2QJDA 5D93C 5TDPA 1SVZA 3PWPE 3STLA 5KOVC 3VI4E 3BN9C 3VGGA 1A3LH 4YDVA 1OQXA 1U8KB 4XNYL 4X98B 5DJ8B 1BJMA 4P4KD 1QA9B 4X7FC 2Q7YA 1F02I 5CSBA 4CMHC 1NUNB 2H3NB 5E8DH 4C56D 2XXCB 3GB7B 2J88H 4KDTA 1PKQE 1PG7H 3QXWA 5F7MC 3FB7A 1IAOA 5I0ZA 3SGKC 4I18C 1YMHB 3UTSB 1BFVH 1C08A 3BPLC 4DZ8B 3CPLB 1BQLL 4NSKB 5D9SA 4R7DB 4MJIA 3UPRA 3GO1L 2AKRA 3B3IA 4XI5C 3VFNB 3SDAB 4OGZA 5C0FB 4L3CB 3PQYB 4HJ0C 1RUPL 1S7UA 3VGFA 4GRWB 5E95B 4QXTB 1A6VL 4JN2B 2B4CH 3D2UD 1DBJL 1JWSA 2V5TA 5DGRA 5HHNA 3F7VB 4H1LH 2FIKA 4OD2A 3F6LA 1Y6MR 4MWFB 3DV4B 4C59B 1EGJA 1K4DB 4YC2C 3U0PA 4XCFL 1YEGL 4QHUB 4N9GB 5EN2A 3TPUB 1U58A 1IQWH 5DJ0B 5JNYB 4PGBB 4XHQA 5DD1H 1YN6B 1JGDA 5AYUL 2CRZA 1MFCH 4PJ9D 1NFIA 3AROA 4OJFL 4YLQT 4PRDB 1BQHA 4O58L 4X9IA 3S4SA 1V7ML 4IOIA 2R4SH 1VGKA 5IV2B 4RAVA 1MVUB 2HJLA 3NCBB 1ZOXA 2PYEE 1N6QL 5BVPH 4IRJC 3ARFC 4DVRH 5IFAH 3UJTL 5B3JE 4QRTB 3QULA 4PY8J 2IBZX 5E6IB 1RZKL 3BW9B 2YA0A 5C07B 3MREA 1N0XL 3LZFL 5IMLB 4FXKA 5F7EH 3WS6A 4GT7A 1NMBH 2VISA 2V5RA 3F58L 1PYWA 1NCTA 1JN6B 4Z7QF 4PIRF 3F8UB 2IF7A 3DYMA 4MAYB 4UUJA 1R3HA 4HULB 4E41D 3BH9B 3V5DB 5EC2A 3CFJA 3J8F7 3HN3A 1UH2A 4XBGB 3DVGA 1CICC 2J12B 2GTZB 4JPVL 5F9JA 4I3SL 3AC0A 3HMXH 5HI5C 3JV0A 5E00B 2OSLB 1ORSA 3VH8B 2HT2D 4KI5E 1GGIL 1QEWB 2GTWA 3DOSA 3EJYC 2NY3D 3IKCB 1IAIL 1NBYA 4Y5XC 5I1AA 2APWA 3BAEH 4P5TC 4WO4C 4BQBA 2KUTA 1A1MB 3K7UA 1LO3H 3VGDA 3EOBB 1WBYA 2R0WL 3QNZA 4CNIA 5AWNH 2DDQL 3PIQB 1KCLA 2VXUL 3N1QC 4JFOB 3TV3H 3ZYJA 5HYFA 4F80A 2R39A 1YEKL 1U8LB 3BN9D 5CAYB 2GJ6E 3NPZB 2MFNA 3LEVL 4NZUH 1WUNT 4UNTA 5J6HA 5IMKB 1X5LA 1K85A 4PJ5B 1IC5L 1IE5A 4ZAKA 2Q86B 4N0FB 3I6KB 3V6ZA 1TJIL 5EIIA 4XWOD 2AQ2A 4BZ2L 1NEZG 1H9VA 5KVEL 2EE9A 1YPZB 3ZDZE 3AY4A 3RRQA 1QSEE 1YMMA 4FFYL 4GMTL 4LKXA 1GIGL 2DQTH 5JW3H 2P49B 3EO0B 5EU6D 4A6YL 3OB0H 4LCCA 4XI5D 4OIAA 3P11L 3QI9A 2AV1B 1EFXB 2FHFA 1R3JA 3D18B 2X5PA 4HJ0D 5T3XH 3RUGE 4P59L 32C2A 1FAIL 2UYLA 1JZ7A 1I9IH 5FXCH 4OD1H 1IFHH 2FDBP 4HMCA 4M8VA 5E8OB 5CCKH 1JPGA 4FABH 1DDHA 1CR9L 2W60B 4F7EB 1WAAE 2DMKA 4OM1L 1J7VR 1BZ9A 1KB9J 3E8UH 3M07A 3JXAA 3ZTJG 4MA3A 1GYAA 4G9FD 3IAQA 5ACMA 3SO5A 1CGTA 1GHFH 2DKSA 2WUBL 1A1OA 5D7SL 5IM7A 1E4XH 3BP4B 5GGRA 2C26A 4MMZC 3LQZA 3L5XL 3CXHK 3QDJD 4UNUA 1T1ZA 1AO7B 2IALA 3QIUB 1VENA 4BH7B 2ZUTA 3R06B 1HQ4B 2EDDA 3VFSB 5GRVK 2YD1A 4U1IB 4NCDA 1P53A 4JY6A 1FPTH 1QQDA 3JWDC 3OJMB 5J1AA 3TPKA 4MAUH 3W0WB 4XC1H 3QNXB 4PJDF 3K4AA 4JRYA 5LCVL 3K3QA 1F4XL 1MAKA 1A0QH 2ADGA 1BZQK 5TE4H 2GY7B 1AE6H 4PUBH 1D9KA 2DB8A 2DM3A 4JDVA 4PG9B 3CU1A 4LSTL 2G75A 3LKPA 2YA2A 5DVLA 2KQMA 3KJ6H 2DKUA 2OMNA 4OLUH 3SJVE 3A67L 3T04D 1QBML 5IQ7H 3D3VD 4Y19D 5EC1B 3KLAB 1PQZA 3H9SA 5ESVB 2EEDA 3KPRA 3MOAL 4K9EL 4E5XA 2DQFA 3IRZA 4Y0GA 2DWEB 2VWEE 3RWEB 1JGVH 5D2NE 1KPUA 1NGQL 3EJYD 3OGCA 4GAFB 2I60H 4M7ZC 2I27N 3CFCH 3OPZL 1RULL 3IXTB 4RGND 3FN3A 2J5LB 2F8XC 2VR9A 2Z4QA 5DC9B 3VXUA 4S11A 3GI9H 3BQUD 4Q6IC 4PR5B 3OKMA 3QUYB 2NXZC 4XMKH 2NTSP 2GAZA 2UV3A 3TA3A 4OLXH 5FK9A 2GI7A 1J8HA 1DBML 5GSVA 1QSFA 4YDLC 4KVCH 2AJXL 2E7CA 4CVXB 5JW5B 2R0ZH 5DT1H 4D9LL 5CUSH 1L7TL 2HLFD 4KI1A 1F8TH 1IT9L 4O2FB 3QUXC 5I8EA 1HXMA 4UDUA 4JFPB 4OI9A 4HEPG 5I75B 2P5EB 5GRJL 3CX2A 4K3EL 3LKRA 2PW1B 3A6CL 1OTUC 2HVJA 5FF6B 2VZUA 1YEIL 3U7YL 2AP2A 1K5NB 4QHNB 2GITA 1CF8H 4GRMA 12E8H 1OY3B 4R26H 1GC1L 4K94H 2DQHH 4U49A 4WEBH 1KLUB 4HIXL 4I5BB 3DO7B 2RR3A 3GJFH 4TPRL 5EZOL 5T1LD 3SHSA 4G8EA 1UG9A 4ZXBD 5FKAB 4L4TA 2ICWA 2X70A 3MGOA 3NABH 1HN1A 4DZBB 1ZLUH 4JFEE 1KFAL 2QL1A 2VDML 1H15A 2VABB 4ELKB 4L4VB 3RVXD 2BVQA 4UIKH 4L9DA 1KYOJ 2X4OA 3GIZH 1DZBA 2WLYA 4IRSA 4WDIA 4D9RD 1W0VB 5I1JH 1W72H 3UJIH 3UBXB 1I1AC 1WWCA 4LHUG 5D7IA 4BFEA 1D6EA 5C70A 1D5IL 2UWEE 1OAZL 2YEZA 3V5HB 4JM2A 3VXSA 1QYGL 4NIKB 4XPTL 1YEEL 2A74A 5CHNA 4ZPVB 4NN6B 5I18L 1KCSL 3MRIB 4BH8B 1DUYA 2A9MH 1UWEH 3C5JB 1JE6A 4F58H 3GBNH 3MV9A 1QRNE 3H6JA 2FX9L 3QT2A 2ITDA 4KDWA 4U0RC 5D4QA 5JHDB 4JLRB 1VGEH 3Q0HA 4Z0BL 4JZJA 3BKMH 4FQLL 1IAKA 3RGVC 3MX0A 1P1ZB 4GW5A 3QHTC 2YPLE 2X7LB 5HJ3A 1YNTA 1YECL 3ZHLA 2VC2H 1VFBB 1EJOL 2W0KA 3RNQA 4Q9RH 3PL6C 1QFUH 3MLSL 1RMFH 3DHJA 4DWHA 4PJAE 4P2RA 2NX5A 4JZNB 1WVZA 2FZ3B 4UMGA 5HVFB 4WFFE 5E1AA 2P5WA 1A3RL 5E99H 5EU5B 1MI5E 5ITBH 4I0PD 4K8RD 1HSBA 1MCPL 3L3GA 4LSUH 5F8QC 3FAWA 4HMDA 5I2IA 1PEWA 1B3JA 3IGAA 1KB9K 3VA6A 5LXGL 4YXLH 2EICA 1RIUH 4GBXC 4UINL 4UTBL 4XVSH 1CD0A 3P0GB 3K81A 3BJLA 3SDCA 5GGQH 4HWEH 3S96A 2OS7A 4X7TB 2EEAA 1IKNC 3BYTA 1XGYL 2ZOKB 5DRXB 3WFBH 2DLFH 4O51B 1EAJA 4U6VH 2IH3A 5CSZB 4MDIB 5DUML 3LRSB 2X89A 1KJ2B 2CKNA 4FTVB 2G60H 1KEGH 1RD6A 4KVNL 4GKNA 1ACYH 4I4WB 2O5XH 2HFFB 4NM8H 4Q2ZB 3RU8H 2VITB 3CDYA 4UOW1 4KDTC 4MX7A 3QUXD 4EDXB 5C0AA 3U9UB 1CD1B 4BSJA 5BJTA 4QHLA 5CP7A 5IFHL 2OL3A 3N85H 3O3DB 1OTUD 3UTTB 3CVHL 4F33A 3LSOB 1M4KA 4MMXC 3FCTB 3MR9A 4AENB 4C4KT 4W68A 1YQVH 4P49A 5IB5A 3SDDB 4FZ8H 2VKWA 5GGTH 2O93L 4YXKL 4H8WH 1KJ3L 4R4FL 4RFEB 4U1LB 1WC7A 4NO3B 1CXFA 1RK0B 2E9WA 4JO1H 3NFNB 5C0BA 3N1FC 5LQBH 1FNEB 3VCLB 3DX8B 4HC1A 5LVEA 4YHYB 4P5MB 3PUCA 1K3ZA 4HJGB 2AJVH 4UV7H 2C1OA 4NYLB 1XT5A 1MCWM 1HHIA 3RBSA 2QKIA 5DD3L 2MQ3A 4Z7WB 3VWKA 2MHAA 1ES0B 2CMRL 1CQKA 4XCEB 3IVKB 4OZFB 3KYNA 2EDWA 4YO0B 3F62A 4ZUTB 2JCCB 4KUZL 3T08A 2GCYB 4UBDD 5GRUH 4YWGL 3IFNL 5L88H 4WW2A 3RIAF 1PAMA 4HIIA 5CILL 3MRFA 2NYYD 5FGRA 1Q1JH 4PB9L 5GQBA 3WS6C 5EA0L 3UJJL 2WUCH 3S36L 2QQLL 5KVGH 4L3EA 2ZPKH 4O2EB 5E7FA 2APBA 3RGVD 4TVPD 5IVNA 3PGCB 2FYYB 3UYRL 2YSSB 5FECA 3LKNB 5BS0E 1AGFA 1S3KL 1CFQB 4TUJA 3QQ4A 1J8KA 4UT9H 3GMLA 1VA9A 2VDLH 3PL6D 2FJHB 1I3GL 2I07A 3CX5J 2G5BA 4JHZA 1JK8A 1S7VB 1OTTC 4Z7VB 4M5YH 3QFJE 2XN9A 3W39B 1MFEL 3LIZL 1TVHB 3BZDA 3HZKA 4CRPA 5T5NF 2XPGA 2CUHA 5DRZA 3VI3F 5L6YL 1R5IB 4LIQH 5MI0B 3MUZ1 4NPYB 1Q0YH 4ODTL 5EZLB 2W65B 1G6RB 1Q38A 3J7HA 1PW3A 3E3QC 4EUPA 3Q5YA 3ISWA 4HG4J 1QPXA 3QR2A 4D9QD 1U8MA 3HR6A 1BFTA 4NNPL 1RI8A 4U1MA 2VAAB 2FD6L 3BD5A 3RVWC 1J0HA 2VAJA 1BVLB 1DFBH 3HRPA 5I1GH 1QKZH 2CR6A 3BH8B 4RMQA 4EJ1C 2ILLA 4JM4H 3TJHC 5C09B 2A1WH 3EDKA 3T2OA 1PBYA 3AY4C 4PJBF 4I2XE 4ZD3L 3ZDXE 3BZEA 4U1KA 1MRCH 3K46A 3FOLB 4XAWL 1BJ1H 4I13B 5SX4I 1ZHLB 4MJID 3DGGB 4LCCC 4XH2A 1I8KA 1Q9WB 4LF3A 3QI9C 4V1DE 3MODL 1U8NA 2AQ3A 5MENE 5IT2L 3BZFB 2ZUUA 1K8IA 2EYTA 3DI2B 3LH2L 1X5GA 3QUZB 3O3BA 1GGCL 2F53B 2BY2A 5FA4B 5MEOB 4YK4C 3PV6B 4Y4HC 4H5SA 1HCVA 4MCZA 5IESH 4OCRL 3KPSA