3VXQA

H27-14 tcr specific for hla-a24-nef134-10
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
204
structure length
204
Chain Sequence
KQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLIQSSQREQTSGRLNASLDKSSGRSTLYIAASQPGDSATYLCAVRMDSSYKLIFGSGTRLLVRPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H27-14 TCR alpha chain
publication title Structure of TCR and antigen complexes at an immunodominant CTL epitope in HIV-1 infection
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 43
structure length 204
sequence length 204
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-09-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vxqA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vxqA02
1L4IA 1MQKL 4HFWB 2V5RA 4PRID 1G7QA 3L3JB 3SDCD 2CK0L 3AU1A 3MRFB 2UZXB 4HXAL 4PJBB 3RWGB 5FIEA 3A6OA 1FIGL 3VI4F 3DI3B 3QZWA 3L5WA 1KCRH 1RULH 3PHQB 4YJZL 4FQCH 1WTLA 5E6ID 1IC5H 5IB2A 4KK6C 4NQCE 3UTSB 2EXWD 4RMWA 1FCCA 1A6WL 4DQOL 1LDPH 1NC2A 3ARFC 4JPIA 4R7DB 1MPAL 4I3RH 3LS5H 4WWID 2VL5A 2AXFB 4MB4A 4OF6A 3KLSA 2H1PH 3ZDYF 1A7BA 3KNBA 5CS7A 2V6HA 3BGAA 4H1LA 3PNWB 4NZJA 4JZJA 5A2IH 4YHKL 3TCXA 3OGCB 4EKXA 2D03L 5IR1A 4CDGC 2D7MA 2XXMB 3PQYD 5FB8A 4P59H 2AI0H 4I77L 3QDGA 4BSVA 1DN0B 3VWJA 5J6GA 5M7QA 3B5TA 3E8UH 4HUUB 4TVPD 5EZJA 3NFSL 1ZT7A 1IM9D 3WIFA 3L5HA 1IKFL 3UJTL 5JLZA 4G6AD 3R4DA 3K81A 5HJ3B 4QCIB 4X6DB 2D0HA 1RUKL 3JVGA 3R06A 4EVNB 2JE8A 3CSPA 3Q6GL 2AJUH 4W4OA 3IETA 3UMTA 1BF2A 4DUVA 2EYSA 4CW1A 4MJ6A 3QDJE 4KRPD 4OM0L 1KLFA 1FRGL 5E6YA 1DVFD 3KPPA 2HTLC 5D7LB 3ZKMD 5EBWA 3RVUC 4YH6A 1FC2D 5GJTH 3FO1B 4YBQC 2YPLA 3NZ8B 5C3TA 2B0SH 5FYKL 3JWOH 3DURA 2VDPH 3D18B 2EDFA 1OW0C 1NCWH 3SE9L 1NCBH 5KSVA 2WZPD 2OK0H 3PG2A 1AJ7L 1BJ8A 1YEIL 4BQ6A 3ZTNH 4KZEH 2FR4A 2AJXH 4WTZA 3W0WB 5EWIH 1FLTX 3RY6A 3UC0L 3QUXC 4M6ML 1WEJL 4IIQB 1DDHB 4HCRL 4MNHA 1FG2A 3PL6B 5IV2A 3WS6C 2Q86B 5C0BA 1J05B 3MV9A 3MRNB 1RZ8A 5IBUB 5HVWA 1GC1C 1F2XK 4P9MH 2NW3B 1G1YA 3B43A 4YGVB 1AKJA 3MLUL 3UX9B 1NUDA 1N6VA 4JZNA 1VEPA 5JW4M 1IL1A 1NLDH 5CIPA 4NFBA 5GS2D 1FFNB 1V7ML 5IIEB 3MGTB 3H6JA 2EDRA 4R90L 2MPAL 1EEZA 4MZ2A 2CLRB 5HYJB 2DDQH 4JFFB 5FV1L 5I30L 4PRHD 4RZCA 1OAKL 4J4PC 1I9JH 5KW9L 3I50H 5DK0B 3MOBL 3VXUB 3FB5B 2A73A 4K8RD 2QLVB 3CMOH 4P5MA 3MZGB 5B3JE 1VA9A 5GGTL 3WN5B 4MJIB 3WL9B 5HGDB 4X6BA 4U7SA 3A0OA 2ZSVB 5C8JA 1N0XH 1ED3B 3Q6FA 2CK2A 1TZIA 4P2CG 2AJYL 1MRCH 2ARJQ 4J1UB 4M5ZH 1RURH 2ZCKL 1MNUH 3C6LA 4AT6B 3MO1A 2EDBA 4MMZC 1AXSB 1K5NA 2ZUSA 1NDMA 1JV5A 1G9MH 4XNXH 2WUCL 3X17A 4BZ2L 1U8OB 2CO6B 3O8XD 5L9DL 5C0CE 1I8LA 4RQQA 4DZ8A 3PGFH 5E5UB 1EO7A 1R24A 1A6AB 3SDXE 3WHXA 4QTHA 2K9UA 4H0GA 3HAEH 4NQCB 4NN6C 3S36L 4WW2A 3IDJA 3FQTA 3V8OA 1FO0L 5D2LF 1Q9WB 3MPCA 3VA6A 3TN0B 3MXVL 3JWNC 4O5LH 2VLJE 2VWEC 4A6YH 3QXDA 2YBRA 1FSKC 5CGYD 1MOEA 3G08A 5DD6B 3AMKA 1MRFL 3LEXA 3QIBA 2JIXB 6FABL 4PJDE 1GHFL 5IKCB 4TULH 1G7LB 4X9HA 3AM8A 3VXOB 1BBJA 2E9WA 1HHGA 1G6RA 4NRZB 4MD0A 4OIAA 3U30C 2EXYC 3WUZA 2Y6SC 4Y19E 4KMTL 4P5TC 1CZ8H 2B4CH 2DQTH 4QXWA 3BKCL 4HUWB 3S35H 4U1JB 3GUTB 3VFMB 3WIIH 2EDXA 4JZOA 5I1JH 1FO0B 2GY7B 1YEHH 5C0IB 5JNYB 4GBXC 5GRVL 4DGVH 4JFPB 3R8QA 4PP1D 3WDHA 3ARDC 4JQIH 4ODHH 4RDQG 5D1ZB 1Z9SA 2VXSL 1BVZA 5KN5A 2ZPKH 3ARFB 1RI8A 3ESUF 3VH8G 3QDJB 4HBQA 4JO2L 5K9OA 4FQLH 2VWEE 3O3BB 5IGXH 4GRWF 2HH0H 3E0GA 2VTFA 2QHLA 5D1QC 4OZFG 5H8DA 1MCOH 1JZ2A 5I2IA 1OARH 3FFCD 3OF6D 4HLJA 3ARRA 1JZ7A 3KGRA 4JPWH 4I2XA 1DBMH 1RZIB 4L8BB 4PTUB 4QT5B 4LNRB 3J8F7 4LCUA 1MFAL 2DQUH 4X7DC 1QKZL 1QRNE 1T1ZA 5F1OB 1NQBA 3LKSA 3ARBC 4ZS6D 1KOAA 2XQBH 5IFAL 3HI5L 1LHZA 1OGAD 1C8PA 1VADB 2AP2A 1I8KA 4OKVB 1QBBA 4U1SB 2W0LA 4PRNA 1XCQA 1BVKA 5E8NB 4PY7A 5GS1C 4BJLA 1FVCB 2XIDA 5C09A 1AGCA 5INDA 3DX9A 4E41A 1JNJA 4XAWH 5ICYB 5IVOA 4QRUB 4XP6H 5TQ0L 1PD6A 3FO0L 1NLBH 2CJUL 4LDEB 1MF2H 3VDAA 4I0KA 2P24A 2I60H 1T6VN 4N8PA 4XP1L 5ICXA 4UT7H 4RAVB 5FAAA 1GC1L 3IU3B 2VLKE 4O4YL 4OLVH 3VG9C 4OF5A 5D71H 1N26A 3D9AH 1CK0H 1E6JL 1HQ4A 3CJJA 4YUEL 4I9WD 3DSFL 4O2FB 1I3GL 1A7RL 2J8UF 3UO1L 4K2UL 2MKWA 2G2RB 5EU4B 1MHEA 4L4TD 2HWZL 3KYMA 5MEND 1C7TA 2RFXB 4WHCA 4YFDB 5EULV 3VXRD 1AO7D 1U8IA 1UYWL 2P5WA 4TTDC 1ACZA 3P4MA 4FNLH 2HMID 3MYZA 3GHBL 2MHAB 3JV4B 4HGMA 3GM0A 1W72A 4YBHA 1V3MA 2A0LD 3L6FB 3QUXB 5HGAB 4D2NA 4QNPF 1IGCL 3EJZC 2HFEA 2FB4L 1KBGH 1JN6A 5DGRA 4Z5RB 1IC7L 1CE1H 5JORB 1JPFA 3CLFL 3O3AA 3S3SA 2X05A 1J18A 1EFXD 1EPFA 2MQ0A 3UDWA 3T8XA 3NIGF 2BFVL 3MRBB 1T80A 4UZGA 4GG6E 5H94B 2NX5D 3PE9A 1K4DA 4C4KT 2OL3H 2QEJA 2Z31A 1TTGA 3QXVA 4QRTA 1H15A 2XRAH 3V52L 2F54B 4X98A 4GXUN 3V4UH 1Q0YH 3O11B 5J1SC 5C08D 4PJCA 5T5FH 5C0CB 1FGNL 1DEEB 1Q72L 3MUJA 1KTKE 3SDXB 2AXGA 4ZPVA 5EUOA 3TPUA 4PGCB 3BRFA 3NCEB 1IGYA 3PGCA 5CJOL 2VLJB 1R0AH 1YEFL 3D2UD 2B5IC 4Y16D 4OT1H 5K93A 1QFWI 3OB8A 4PJ5D 2NXYC 3MNWA 4HUVB 1U92A 5GRZA 4PJDB 4H25B 4HKBA 1QLEL 4MXWL 4P2OD 4U1HA 1CFQB 1YYLH 1PKOA 1YEGL 3SDAA 5BVJB 4OZIE 1CWVA 3FAXA 2MMXA 4Y19B 4NNPL 4QRRE 4JQVC 2VLME 15C8H 2XXCB 4N1CA 5K9JH 5IBLD 4HC1H 1YEJL 4KPHL 1TPXC 2GITB 2G60L 2GSIA 2PXYC 3HR5A 2N1KA 3HZVB 4F7MB 3RL2B 2V2WB 3V5DB 3V6BR 3MTRA 1O5DT 3RWDB 1NMCC 2V7NB 1X44A 5C86A 4H0HB 4X7SH 1U0QA 1C5DB 1MLBB 4ZYKB 1CN4A 4ODUB 3O9WC 4U6HA 5JIKA 3IDNA 4NN6B 3KR3H 4X8JA 1KCVH 4KI1A 3FFDB 4OCRH 1R3IL 4S1DC 5C3LD 3DUSB 2GSGB 4P3CL 1VACB 2H32H 5IJVB 1MUJA 4QRQA 1U8JA 1SM3H 2DL9A 2GCYA 3V0VB 3DMMA 4Y4KA 3WD5H 4IRZH 2L4OA 3DXAA 2JELL 4XB8A 3SKNB 3U2SA 3DETC 4NQDE 3I6GB 1Z6JT 1FNEA 2FYYB 3OJ2C 4YHLH 1OAUH 3C5JA 1AQDB 4XWOD 1F90H 2IFFL 3GMOA 2DQFA 4NRYB 5J6HA 5JZ7D 3MV7D 5GRVK 4BA8A 1FPTL 2QJDA 2CXGA 5L2KE 5BCAA 2NLJA 3U30B 4JJHA 4L4VD 4JN1L 4G80B 3HG1A 2EKSB 1QRNB 3QJHB 2L7JA 3ULVF 3QO1A 1QSVA 4F15C 3ZKND 2PR4H 4N0CD 3NH7H 2DIAA 3L3DB 2HYMA 1OAXH 3SOBH 4JM4L 2GTZB 1AP2A 4PS4L 1TLKA 2AJZB 1WBYB 2QR0A 4S0SD 2VITA 2R56H 2FO4A 5AZEH 4EDWH 1NBVL 5J89A 1T2QL 3OJMB 1LO0L 4DVBB 1Q8MA 1U8HB 1UEMA 2BMKB 2HLAB 1XGTA 3VD7A 2BRQA 2PO6D 4ODXB 1ETZA 1NCCL 3BP7B 3MRQB 2C3HA 1CICC 3O2WH 4ZS7L 3SY0B 1MJUH 2H2SC 4XVJL 4HS3B 2ZP0T 2VLKB 1LD9B 1YN7A 1N5AA 2FZ3A 4I0PD 1DTUA 3LN4A 1REIA 2CIKA 2W60B 2HVKB 4XHJC 1NEZG 5IMOA 4YPGA 5JA8B 1QA9B 5J1AA 5SX4H 4JG0H 3TFKC 4F7PB 5JR1L 1RJZB 2XI9A 1JI1A 4DFHA 4O51B 2Q87A 1JMZA 1BQSA 1FNGA 4UQ3B 5CWSA 2R9HD 2FJHB 3VFSA 4C56E 1C12A 3ARBB 3P11L 5KG9A 2D7TH 3BXNB 3IJYB 1AHWA 3RJDA 4WUKL 5TFSL 3TIEA 3UTSD 1UEYA 1FZJA 4LP5A 1K85A 4PTTB 5DFVC 5FYKU 2N56A 5HGHB 1I1AA 4JO1H 2ITDA 2IFGA 4PJ7A 2W0FA 2X1PA 3EO0B 3P30L 4W4NA 1JPTL 2GTWB 4GG6B 5C0FB 4Y1AA 2J5LB 4M1DL 1HH6B 3O6KH 4IRSA 5FFLA 4DTGH 4KDTA 2D4FA 4J6RL 3HZYA 2QSCH 1MI5D 3QEQA 4LCCC 1YDPB 4YDKH 2PYEE 1IGJB 1Y18A 4LLAA 4PJ9A 4X4XB 4YAQA 4HDIB 4TNWF 4PR5B 4OZGA 4G43A 1I7RA 3D85B 3MUZ1 3GM8A 3P0YH 2W65A 1TJGL 3WFCH 1IEHA 3ESVF 2VZ3A 1KJVB 2P8MB 2VQUA 1CL7L 2VDOL 2CR6A 4HCRA 2JB6A 5J56B 2F9BT 4Z7NF 4OCMC 4F2MA 3QQNA 4K3HA 2VISA 3MJ7B 4D0DB 3QUMA 1BAFL 1YN6A 5I15H 3KPSE 4HPOL 1R5WB 4OZIB 1UM4L 5JIHA 5EBMA 1T0NA 1I9IL 2AQ2A 1QO3B 4M7JH 3EYOA 4OLEA 4U6VL 3TVMA 4QRRB 1NAMH 3QFDB 5D7LD 1ZSDA 5ILTL 4XNZB 5E2JA 5DHVB 3RVWD 1X5YA 4AYFA 5MEPA 1FFPA 4JFQA 1QRKA 3CVHL 5TH2A 1BIIB 3MV8A 1WZKA 4S1RL 2ZUVA 1U95A 4YNYA 1F13A 1BD2D 4WO4A 3LEYL 3EW3B 4MNQE 4K7PX 3H7BA 3W0WD 1EO8L 2X2YA 2OSLA 2A77L 1L6XA 1N7ML 4U7KA 3VMPA 3L7EA 1XF2B 5DYOB 4M1CC 2NNAA 1DANT 1T89A 4R96B 5DQ9A 1IBGL 5CEYA 2B5IB 2E27L 4LHUA 4X80L 3L3IB 4NQDB 4O02H 2MFNA 2NXYB 1J11A 2ZCHH 4OCXL 2F58L 4NQSA 4O58L 4OCYH 3BDXA 1T0MA 1AI1H 3IRZA 4ODTH 5I76A 1CBVL 2FWOA 4X4ZA 5L2KB 2Y4SA 5I73B 3BP6B 3F7QA 3QIWC 5FYKD 4LL9A 5SV3A 1FYTE 2PW1B 2NMSA 3CVHB 5IF0A 4ZFGH 5SX5K 4AG4H 1FJ1B 1P9MA 3SQOH 5IEHA 5FM5O 3CCHB 1E4KC 1ZAGA 4QWWD 3CC5A 5DRNB 1RY7B 1TPXB 2B20A 2PXYB 4JFFD 4MA8H 1F4XH 3UBXA 3AAZA 4JHWL 5E24E 1NMCB 1LVEA 3BPCA 4HKJA 1I3RA 2UUDK 2EDOA 4YHOH 3VXUD 1JWSB 1TETH 4FG6D 5CLWA 1N5YL 1RZJC 1URLA 3O9WB 2E7CA 3EYFA 4OUUA 1QFHA 3MJ9H 2ZUWA 3LS4L 4F33A 1NUGA 3SKOA 1KJMB 2HFFB 1S7RA 3LN9A 1CF8L 4G8GA 3LQAL 2PN5A 3T3PF 5HVFB 4N1EA 2IPKB 3WFZA 3AMLA 3HC4H 2CDEA 5JHDE 1BF8A 5IVZB 1XF4B 3U0WL 3VI4E 3ZKSD 3B9VA 1X5ZA 3P9LA 5TE6L 2FGWH 3Q3GB 2YS4A 2DKUA 4X4YB 4XP5L 5I17A 2K7PA 1A7OL 3UAJC 2N7BA 5CBEA 2DLIA 2DYPA 4EQ2A 1EJ6A 4J3SA 4YK4B 1EGJL 4XAKE 4HIJB 1BWWA 2RCSH 4OZ4B 4F15B 3ZDYE 4C56B 4F8QA 2NY3C 4RFEA 4P23C 2YD4A 5E94A 2VDQH 4LSUH 4S1SL 3IJHA 3TN0D 1CXEA 1JFQH 5L6YL 1KNOA 2W91A 4J3VA 2VXTH 4XVUC 5L88L 4X9IA 4LASH 4NKDB 3D1MC 3GI9H 3PDOA 4KZDL 1EJOL 3IKCB 4KJYB 5DR5H 1ZKAA 3PWLA 1F11A 3DVNB 2NY0C 3JV6A 2JIXD 3MREB 1MCFA 1A1OA 4OFDA 4FQIH 1O0VA 4RWYH 5E8DL 4UT9L 1VEOA 4PJIA 1TTFA 1QLRA 3WCYA 2V7HB 1ZTXH 1F4AA 4X5XB 5DJDB 1TJHL 3FAWA 3QZWG 3GSVB 2D9CA 5IJKA 2UVFA 1AGFA 2BY0A 5FHAL 3BGMA 3TF7C 1JWMB 1U3HB 3VRJB 1E4WH 3OR7A 1UJTA 3B9KB 1OW0A 3S5LA 1VFUA 4NO0A 5FHBH 4M43L 1FV1A 1GAFH 5EU6A 5DWUH 5AD0B 4Q0XL 3KPSB 5D1ZD 3C08L 5E2VH 4H1LG 1T66C 3ARFD 5ICZB 2VO5A 1P4BH 3QDJD 4BSWA 2ZG1A 1KSRA 3MCKB 1MCJA 4BQCA 3WS6A 4Y8DC 3N9GL 5JXEC 1MIMH 1QR1A 1NL0H 2AV7B 4ZMAT 2DQIL 2QQLL 4RDQF 1CFBA 2C26A 1LEIB 2AJ3B 3U7AA 3DVFA 1J0ZA 2R2CA 4ODSH 4G3YH 1VB9A 1SY6H 2AABL 3MGAA 4LCCB 4Q2ZA 5F89B 2VE6B 3RGVD 4RIRA 4HIIA 5DMKA 5KVEH 3DGGA 4MNQB 3OR6B 2R23B 1IEAA 3CFBB 3QUYC 4KJWC 3BVNA 3CSGA 1IAKB 5FUCC 3QQ4A 3C60C 1S3KH 1EAPB 1WZ1L 4R7NB 4Z7QF 4G6KL 3VXPA 4YX2L 3VD4A 3QWOB 4NO3A 4Z6AT 1F3JB 3GMRB 1QBLL 2ARJB 3HFMH 5I1LB 1INDL 2DM7A 3TO4D 5IG7A 3SGEI 1K2DB 1KG0B 5DUPH 3TBYA 1ADQL 3D3VA 1FYTB 2Y23A 2IAMC 2UZIH 3P4OB 5IWLC 3HI1A 4MQTB 4P49A 3RVUD 1RVFL 4X4ME 2DQEL 1N64H 5F3HA 2EEBA 4WTZG 5JQ6L 1F4WH 4QXTA 3CH1B 4S11A 5DJ6A 4FQQB 1N2RB 4XPFH 1ZHLA 5LCVL 3D0VB 2HLFD 5I1CL 2BK8A 5BO1H 3IDIA 2CMRH 4K94C 2I07A 1MLCB 3IXTA 1ZGLB 3HHRB 4K3DH 4GJTB 4Y2DA 3TT3H 1T4KB 2H8PA 3BP4A 2Z9TA 4HJGB 1VPOL 1U3JA 3PWUB 5HGBB 1DBKH 4OGXH 2DWDB 1F8TH 1I7ZB 1RZJL 2DWEA 1PG7H 1MELA 1XR9B 4HJ0C 5MEOB 1MJ7H 4LEOA 3LMJL 4D8PB 4FP8H 1P1ZB 3KAAA 4QHNB 4E0RB 2IADA 3GSNH 1UH4A 1OAQH 4CMMA 5CEZE 4ZUUB 1U93A 1KUMA 2HT2C 2Z8SA 3UZEA 2OYPA 3WMSA 2F54D 3OJDA 5D2LE 4ODVL 5A2FA 5LGJA 1RJLB 2FEDD 1R3LA 1ZGLM 4U1IB 2YOCA 3DHJA 4UUJA 1YMHB 1L9NA 1AGBB 5E2TL 5CJQL 4OUOA 4OFIA 4P5TA 2V2XB 1FQ9C 4J4PD 4C4KO 4IRJC 5MERB 2VZVA 2X9YA 3UTTE 5ID1B 1P2CA 4LGRB 5B22A 1KTDB 4MDJB 4FA8A 5J0BA 3VMOA 2EO1A 4L3EA 4RGNE 4LQ1A 2VLJD 2B39A 1YA5A 1QSEE 4GBXA 1V7NL 5DD5H 5E8OB 3GKWH 3PXJA 3FMGH 1HHJA 4D94A 2FO1A 3NCFB 3WNOA 5BS0A 2I9LB 3SDCA 5ALBH 5F9AC 2Y7QA 4ZTOL 2GJ6E 2WINA 1BFVL 4QHKJ 1IMHC 4ZQKA 3MLRL 3PWNA 4HX1B 2CLZB 5LKNA 4ETQB 1DSFH 2ESVA 5B8CA 5D1QA 5LAXB 5KSAB 3UJIH 4OV5B 3CGTA 3OAZK 4RBPK 2E6PA 3MACH 3T2PA 1J8HA 3TM6A 4DKEL 2IQ9L 3FRUB 4HLZG 2NY6B 4UB0L 3NCYP 4YR6A 1P7KB 4JRXD 4KQ4H 3KLDA 3DX6A 4XNQB 1X5GA 3IDXH 1A3LL 3FONA 4WFHE 1JRHI 1OSPH 2BVEA 4XWGH 5IMMA 1Y0LA 4Z95L 4PP2B 4GKOA 1KJ3L 2O5YH 4GRWE 4XTRC 4P23B 4DOHE 2BHZA 4K23L 4PGJA 4RAUA 1JYVA 1YUHB 3GI8H 5F7DA 5DUBB 2DTML 3WO3B 3B8SA 4LCIL 5GS1A 1UENA 1OAYH 4HPYH 3ARQA 3FO9B 3MUY1 1UWXK 3RPKA 2NY0B 3CZFB 1IM9A 1S9YB 3FRPA 4QXUL 2HG5B 1RIUL 1LO3L 2OJEA 1INQA 3O3EB 3T65B 4NOFA 2OX5A 4CN4A 2YEZA 4CVZA 1CD1B 1QRND 1AR2A 2F5BL 5IFHL 1QFOA 1TJIH 2VLRE 5LG1A 3GIZL 4OI9A 1MEXH 4JHAH 4PGDB 1FBIH 3QPQD 1QHOA 3N85L 4LP4A 4E5XA 1AY1L 4UINL 4ONGH 1KB5A 4H1LH 1G7PA 3RVXC 1H5BA 3C5SB 5ADPH 1NCDL 1WAAA 3WNLA 3ROOB 3BZDA 4IHOB 2YUVA 5D2NC 2E9BA 2A74B 3X3FH 5K59F 5GIRA 4P2YA 3QXTA 4Z7UA 2J8UE 4X6CA 1HYSC 3ZT6A 2VLKD 5HI3C 3CPLA 5IESL 2XY1A 1G84A 2ICWA 1BX2B 1UKQA 3FN3A 2W9EL 4ZOCA 5CEZL 1A6VL 5F88B 4PBXA 3O4LD 3JWOC 1I7TA 1PX3A 4U1LA 4QNPE 2D3VA 5GSRA 1MHHB 1AR1C 2BSTA 1CLOH 4JDVA 1UWGL 5DD3H 5MHSE 3RU8L 1PQZB 1WVZA 2Q76A 1MH5A 1XF3B 5EPMB 4XCCL 3CXDH 1EZVY 4LSTH 4ZNCD 1ZLWK 3TCLB 4UDUA 3NIGE 3QUYB 1N6UA 4CADB 1ZHBA 4MJ5A 3FCTA 3FQRA 2QADD 4J23A 4F9LA 1M6OB 4K94L 3FHQA 1U6AL 4WENB 3OX8A 3MLYL 1Z3GH 4OCSL 4RSVA 5I19H 2A6IB 2R2BB 1R3HB 5D2NE 1J0IA 1HH9A 1MIEL 2F53E 3BEVA 3GSWB 5I1HH 3W11D 2FD6H 4HWEL 3UTZA 4PRHA 3O4OC 5CILL 5JHLL 5ADOH 2F74A 4NUGH 3JTTB 5D2LB 5H35B 2IAMB 3BHBB 5DJ2B 4BKLA 3ZSSA 4OLUH 1JVKA 2IGFH 2R8SH 1A7NH 4FABH 2AJVH 1S5HA 4MD4A 3GNML 3ULUH 1ONQA 4RMQA 3V7MA 1P7QB 3LPWA 4FFWC 3IDYC 3UTTB 3O6LL 3D85D 1ZLVK 3ZDZF 1I9RH 5KBNC 4RGNB 3RNKA 1RUML 3PUCA 1QSEB 4B5EA 3FQUA 3U7WH 3EJZD 3OKLA 3ULVC 1QNZH 4L3CB 4M61B 1D5ZB 3CFJB 5C0AB 2HRPH 2ADIB 4RRPA 5CHNA 3O8XA 2E7BA 1RIHH 1ZT1A 5J13B 4D3CH 2O5XL 3NA9H 35C8H 4QRRD 3LCYA 2VLMD 4Y0GA 3FT3B 1D5IL 1TVHA 1OQXA 1CTOA 1CFTA 3W81A 3B2VL 1G9MC 1T21A 2XN9E 5EIIA 8FABB 4RFOH 4TOYL 1J1XL 1T7XA 3LN5B 1A9BB 3U4EB 3W9EB 2X4TA 3BMWA 5K9KB 1EEYB 4FFZH 4GRWB 4ZTPL 1RULL 4DOHB 4GW1A 4Y89A 4F7CA 1RFDL 2P48B 1IC5L 4G6JH 4BYHA 3R0NA 1RUPH 3HN3A 1B9ZA 2X4QB 3ZT7A 3WBDA 5GGVY 4WV1C 4MDIB 4NQDD 1NC4B 5GZOD 5F9JB 2NXYD 3GIVA 4JLRA 4Z76A 1N3NB 3X3GH 5HHQA 3WJLA 3ULVE 1DL7L 3F5WA 1YNLL 1IC1A 1CICA 1QFUH 5J06A 2MNUA 3STLA 2X4SA 4ZSOE 4EI5C 5L2KD 1DLHB 4OKDA 5C0RL 2G75A 1Z2KA 2YSSB 5KVFL 5EZOH 4J3OC 3AB0C 4UV7H 2FDBP 3H8NA 4YDLC 5DVOA 2B4CC 3DV4B 2VR4A 2VLRB 5HHVL 2WLZA 4GMSH 4U6YB 2PXYD 5DSCA 3IVKB 2UYLA 3E8UL 2G5RA 3SE4C 1SYVA 1KJ2H 2XKNB 1LO2H 3BN9D 4AY0A 3SE3C 4E42A 5B39B 2PCPB 5DEGA 5CCKL 3O9WD 1MVUA 3HS0A 3FFCA 1G6RH 1B6UA 2Z0BA 5JPMB 3SGKA 1HKFA 3ORJA 4L3AA 2J8UB 2AJUL 4GLRH 2Q7YA 3G6JF 3I3DA 5DUMH 2GFBB 4XC1H 3SGDH 4LVNC 4R4FH 4AMKH 4ZUWB 3MCG1 2D31B 4N8CH 3FOMB 3THMH 3QISA 3O3DB 5T3XE 1JZ4A 3D39E 1OGAA 1YQVL 1M4KA 4JE4B 5GJTL 5IB4B 4XXDB 7FABL 4NNXB 2VUYA 2B0SL 2P7TB 5AZ2H 3JWOL 5ERWB 2VDPL 5HYQB 1NCWL 3BJLA 3D69B 1NCBL 5FO9A 3LOWA 4P57B 1I1YA 1TCRA 1IGMH 4YGAB 4KZEL 5DJZB 4FZ8L 5DTFA 3TH3T 4DW2H 1J1OL 1TNMA 4LDOB 3QNYA 5C2BH 3S34H 2YN3A 3LRHA 5EC2A 5D2NB 2F53B 1YPZF 4JRYE 4PJEF 3EDFA 3IDMA 1RZ7L 3QRGH 1AIFA 5IQ9B 3BPNB 4P9ML 1M7DB 4L9LC 4L4TA 2O26U 5IB5B 1EHLL 5MENA 4KXZI 3CLEL 2O61B 4H5SA 3VXRA 5CBAB 3TO2B 4MA3A 1JL8A 4Z8FL 5DS8B 3GSXB 1NLDL 1ZVHA 2NYYC 1X4XA 3LB6C 1KCUL 4Z7NE 1A02N 1CS6A 4QF1B 1CGXA 1DBJH 1YECL 1U3HD 1ZT4A 4AM0B 4EDXA 3C5ZD 2DDQL 3B9KD 4Z0BH 3OB0H 5D70L 4TSBH 1GGUA 2I9TB 1F42A 2C1PA 4XMLL 1EFXA 3MRLB 3BRGC 4JJ5A 5DHYA 5CZVH 4OFVA 5HHPB 3CMOL 3EOAA 3KPSD 4UNVA 5DFVD 1WZLA 3CXHJ 4QO1A 1W0VB 4IDJL 4M4RA 3BIKA 1JNLH 2WW8A 3ULVL 4LKXB 3X14A 1OF2A 1LEKB 5EOQH 4HS8H 4ZAKC 5IQ7H 3O4OB 1MY7A 3U82B 1KIPA 5ACZB 2XN9B 4M5ZL 1DQLH 4XCNB 5J11C 5KSUA 4U0QB 1X5JA 5FYJH 3QIWA 3B2UD 3JUYA 3MXWH 4JPKH 1G9ML 4XNXL 1MCNA 4MNQD 2Z4QB 1BQHB 1E4KA 1DLFH 2VZUA 2VZOA 4L8DA 5IW3A 3IDYB 4P2OA 3EO9L 3H9SE 3BRDA 3REVB 4Q6IA 3T0EC 2B7DT 4ORGB 1S8DB 3FHAA 1IAOB 5KVGL 2J6EH 3BH8B 3LKPB 3G04B 4X7TA 3LIZL 4JVWA 3VRLF 1T1YA 5FUZL 4X9GA 4F8TA 2Z92B 5HGGS 4ZSOB 4UI2A 1QLFA 2VC2L 3QEGH 3STZB 4B7LA 12E8H 1FYTD 1HWGB 4TULL 2IANA 5I16B 3EKCA 2V17L 5T3XL 2W1NA 3WHE1 4M7ZC 1CFNA 4PB9L 3A67L 4IS6B 1QQDB 3ES6A 4LFHG 2NR6D 1CZ8L 1FL6A 2B4CL 2DQTL 3T3PE 4I48A 1MFBL 3S37X 3S35L 4QRSB 4K3GA 2PYFB 3HAEB 1H3XA 4LMQE 5I66B 4LHUG 1A6UL 3A6CH 4CVXA 2Y06H 1HDMB 1RV6X 2BC4A 3MRMB 4Y5VB 1T7VA 5HHNA 2ZG2A 4WV1B 4OJFL 1RPQA 43CAA 1W0WB 5SWSE 1P4IH 3KPLB 4JFED 1WC7B 2VERN 1X5KA 4JHBA 3D39B 5E08H 1MCOL 4FQ2H 1UB6B 1HI6B 5CINH 2HKFH 3UBXG 3SJVE 4PREB 5DVLA 1WITA 4YDLB 3HE6D 4ZNEA 2ITCA 1UB5B 3BKYH 3CX5K 2PO6A 4OCWL 1CTNA 4YEEA 3FOLA 4NO5A 5ISZE 2DQUL 3KYAA 1JK8B 2R1WA 1I85C 1ND0A 2WP3T 4OF7A 3IF1B 3TYGL 1BVLA 4I0PA 3FN9A 2V9RA 2XQBL 1F6AB 2FECL 1HSAB 1NFDA 4JRYB 3DTXA 3SKUD 5DRZB 1WV7T 5LXGL 1MWAA 2GQHA 3JTSA 4RA0C 4L29B 4RCAA 1OD7A 4XP6L 1UQSB 5GRXG 1MCCA 1KN4H 3BPOC 2F19H 4OLVL 4UU9A 1HSBA 3T2NL 2XZQH 5KSAD 3WDIA 1KLUA 1BFOB 3QNXA 3UAJD 1TQBB 3D9AL 4NSKA 3GJEB 3WS3A 3GMMB 1T04B 1FG9C 3OKDA 4R7DA 2NY6D 1ORQB 4RISH 4QKXB 4EIZC 3IDGA 3BZFB 2UWEA 3MRJB 2B1AL 5C0DA 1Q9KA 1UWEH 3QG7H 4R0LC 3FQWA 4P23D 4HWBA 4CNIB 4WW2F 1T20A 4HBCH 2EYRA 1XMWA 1ORSB 3MQIA 3C60A 5JMRA 1MI5A 3QJFA 5GRUH 5E8EA 1BOGB 1JCKA 4N5EC 3TNNA 4KK8D 2WIIB 3D0LA 4L9LB 5BRZA 3RIAF 4JFOB 5FKAA 3TA3B 5EU7C 4Y5YC 2OL3L 1IILE 5HJ3A 1KIQA 1MCPH 5IK3B 1UCBL 3UJJL 4MZ3A 5AAMA 4Z7QE 3V4UL 3W2DH 3RRQA 3CSYA 4HUMB 1JHTA 5CKAA 1UM6H 1HWHB 3CNKA 1JP5A 4NBZB 5F1NA 3H9SB 5L8KB 1HXMB 3G5VA 3VJ6A 3U9UB 4RGMC 1BQLH 3PP4H 2XZCL 1AGDB 5EOTB 1DP0A 1T83C 1ZVSA 2WNGA 3BSZH 3HE7A 1S7UB 3MA9H 3ROLB 4OFKA 3NZ8A 5DF0A 3RKDD 4L8CB 4G9FD 2OBGA 3PDGA 1FAIH 5JXED 1YYLL 1BD2A 4KVNL 2OL3B 5CP7B 2A6DB 2A9NH 4ZAKB 4OBSA 5I0ZA 3GMNB 4LVOC 4K9EH 1DBAH 4XP4L 2HFGH 4NZDA 3BKJL 1LO5A 1BPVA 3LKOA 3EAKA 3GMPA 5JDSA 5J11B 1IQWL 4HC1L 5CGMA 1DE4B 1KCSL 3BGFC 2FJFB 4AQ1B 3CXHK 4YDJA 5D5MA 1KEGH 3PV6A 4PUBH 3I3BA 2VJXA 5DRXA 4X7SL 5DC0A 3QUYD 4ONHB 3S4SB 1KTRL 2Z35A 1AGEB 5I1GH 3VFVA 2VH5H 4IRJA 4N9GA 3MUGB 1T5WB 3L3KA 1INEH 3T4AA 5C6TL 1WBXB 3TZVC 1KLGB 2A6JA 4QHUB 1SM3L 4A2MA 5E1AA 3PWVA 5C07E 3WD5L 4IRZL 1CFSA 2V5MA 4YHLL 1JF5A 1ZXQA 2VDRL 3U0PB 2ADGB 4V1DE 1HOCB 4P5KB 4PJXA 4PLNC 3SJVB 1XIWB 5CD3A 2IAMD 2HVJB 3IAQA 4G5ZL 5HD8D 2I26N 4NPYB 4P4RB 3T1FA 4M7ZB 1RUAH 3WN5A 5ISZB 2EE3A 4NIKB 1XR8A 3RWEB 1JWUA 4MB5A 5GGQH 1XF5A 3FZUC 5DLML 3UTTD 4A2LA 4TNWK 4UOJA 3KS0J 4GRLD 4GFTB 4OGZA 1U8QA 3LRSB 4RGND 3BD3A 2R56L 1D5XB 2X4OB 4EDWL 2HKHH 2OQJB 2H32B 5DEFB 3S35X 1CL7I 2YZ8A 4O9HL 3V79C 2R15A 1FNSH 2X4RA 1Q0XH 3PXHA 5C0AD 4XMKL 3O2WL 4JHZA 1MJUL 2LAGB 3MRIA 4PBWD 1X7QA 5F96H 1OT2A 1A4KA 5ESVA 2E6QA 3UXFA 2VLLB 4Q6YA 3VGBA 3BDYH 1FC1A 4NKMB 3DUUB 3U36A 5GS0H 2CUHA 2R69L 3HC0B 4I3GA 1S9WB 2HJLB 3MBEB 5F1IB 3OXRA 3MRDA 5CZXC 2H9GA 4ONOA 3VW3H 3IB4A 4DVRH 2VYRE 3PWJB 3EOBA 4PJCF 4XH2A 4Q97A 5KVDH 2Q7NA 4WFHD 1G9EA 1GOGA 5BVPH 4KUCD 2MTPA 4P46C 4W70A 1D7FA 5EUOF 3QWRA 4JO4H 1G7LA 5C9JA 1XCTB 3VH8B 5EOCL 4G8IA 3HPLA 2R1XA 2VIRB 3GJFB 4R8WH 2HJFA 5D72H 4N0RA 1B0WA 5EU3B 4HGWA 2XG5A 3BE1H 4OZFB 1NC4D 3N1MC 3U4BH 1LE5A 4KY1H 2FGZA 2NPLX 4NQEE 4BZ1H 1JGUH 1TZHB 5T3ZD 1CE6A 1YNTA 3NCJH 3BPOB 4WFFE 4ZUSA 4DTGL 1YY8A 1A9EB 4UILH 4BFIA 2ORBL 2VLRD 1X6LA 2OMBA 2QSCL 5F9DC 2R4RL 5K59E 3R8BB 3ILQD 5FA3A 3Q5TA 4GAYB 3L7FB 4WWKD 2VABA 4UTBH 1XGQA 3KYNA 4NKIL 3TJEL 5GSVB 1IGTA 4R0LB 3X12B 2MCPH 1VGKB 5J9PB 1EBAA 5FO7B 4QRPE 5I18H 1A6TB 2JJTC 3HZMB 3H3PH 3FRPG 1CR9H 4QT5A 4ONFH 4LNRA 5CKGA 2EEDA 4NKOB 2VDMH 4PJAA 3RGVA 3PHOA 3KXFE 3EFDH 5DMGC 2Y5TB 4AJ0A 3BO8B 1NFIA 5DK2B 1N6QH 4TPRH 1NAML 2IBGA 4UIMA 5ENWB 3QO0B 2UZYB 3DV6B 4XPGL 4N0FB 4FQXB 3OHXA 5MHSD 5TJWK 3WE6B 2MJWA 3DRQB 3RP1A 3L9RA 2GUOB 4R4BB 5D1XC 2VAAB 3ZE0F 1FZMA 4PY8J 2GK0B 4AQOA 1B2WH 2W59A 3TO4A 4HH9A 1RZFH 4O00A 1X4YA 3FB7A 1KTLB 3C2SA 1S9XA 2ZCLH 1FL3B 4RGMB 3C8KA 1GRWA 4LVEA 3E2HC 2BSRB 1ZHNA 4IOFC 2F53D 4FRWA 3GRWH 5C07B 5F72S 1MHCA 3T0BA 1W8NA 1D9KD 1FNAA 4M00A 5LBSH 3LH2L 3KYKH 1F58L 1I4FA 4KQ3H 1QVOA 1OP3H 1I8IA 3KYOA 1ZK9A 5BZDB 3G9VA 1Q94B 2ZCHL 3V7AE 1ODAA 1NAMB 5DJ0A 5ID0A 2CKBL 4FZEH 3ZDZE 5ELIA 3BDBA 4D9RD 1KPVA 1Q38A 1KYOJ 2NY7H 5E5MB 4LCWA 4LVOB 4ALAL 2CRZA 3QXAB 4OM1L 2IQAA 3SQOL 2XWTA 4JDZA 3SBWC 4AEIH 4Z5RA 3MRGB 4WTXA 4NNYB 2FSEB 4MX7A 1DANU 1AQKH 3BGFB 4MA8L 1JBJA 4Y4FC 3B5GA 4Z18A 1A2YB 3VFRA 5JW3L 4TNVF 2AEQH 4OGYH 4YHOL 1HXYA 2DQDH 5T1LA 1H3UA 1CQYA 4MB3A 3MJ9L 3EYSH 5SWZE 5EH1A 2F54A 4K7PH 4JVUA 3BISA 3TZVB 4A6YA 4M6OL 2ATPB 3NCCB 4GKZB 5ECJE 3WFDL 1PFCA 3CDGA 4PJ7F 4UQ2B 1LE9A 3P4NA 2CKBB 4N5UA 5IROC 3KPMB 3PHSA 1ZWIA 5I8OL 3CUPB 3CU1A 5F70A 1C16B 4KDVA 2XN9D 3W39B 2FGWL 4HK0A 3M1BB 4EI5A 1JF1B 2ZOLB 5TF1L 4PV8A 3ARXA 4ZO9A 1RJYB 3RVVC 3VFWB 3GJFK 4WDIB 3HMXH 2YKLH 5IHZA 5T1KA 4JFXA 4H25A 3MSPA 2RCSL 5ALCL 4ZDHB 4DGIH 4FFWD 1NAKH 2Y72A 4OZGF 2CIIB 5TDPB 2AK4E 1FN4A 1UXSA 1BM3H 1VFAB 1OP5H 3ARGD 4P2RA 2YA0A 4LSUL 4O2EB 3SE3A 3UTPE 4FMKA 3KPNA 3U0TB 4RRPG 1ZLSL 3L1OH 2B2XH 2HT3D 2NY4B 5IFJA 2X4UB 2QL1A 3ULVD 3AREC 2VXTL 3GI9L 4ZPTB 4NQEB 1FFOA 3PP3H 2BNQA 3QYCA 5DR5L 3VXNA 4ZOBA 5KJRH 4JRXA 4QYOB 4IJ3C 4FQIL 3VFPB 4MQXD 5DMIH 4URTB 5IW6B 3NGBB 3UYRH 3VD3A 4CAGA 1F4HA 4MWFA 1FZOB 4XVSH 4J2XA 4W6XB 3G6JE 4U33A 3T09A 3SCMC 2VZ1A 4JO3H 5IW1B 1E4WL 3BH9B 1JPSH 4HXBL 3BMVA 2O5ZH 3NN8A 2OP4H 4GUPB 3MLWH 5F9OH 2YC1B 1CQKA 3EFFB 3V4PH 4HZLA 4P4KD 4QRPB 5T1MB 4QY8B 1GAFL 3F7PC 4LLMB 5E99H 2O93L 3RPIA 4X5WA 2OZ4H 2DIBA 4GKNB 5E2VL 1E27B 4JG1L 1GZQB 3P77A 4H8WC 1KULA 2MQ3A 3KXFB 1P4BL 1XZ0A 5FECB 1NEZB 2X4PB 2BY2A 3WFHB 1B3JA 1MIML 2ADJA 1NL0L 1PKQA 5T3XD 3D39D 5EA0L 1DFBH 3FQNA 3GSRB 1S7QB 3CH8A 4GW4B 5TQ2L 4HWZA 1KN2H 4ODSL 4D9LH 4L9DA 4G3YL 1CLCA 1P53A 3D25B 1SY6L 4HHAA 1YPZE 5EC1B 4ODXA 3HI6H 4PJEE 5KVEL 5INCB 3NZHL 2FHFA 4JZJC 3ILPA 4TVPH 3IJSA 3QUZA 3I02B 1JZ8A 5CJBA 3VXTB 3VFUA 1WFOA 3QQ3A 4NT6A 1S3KL 3MROA 2B1HL 4MSWB 5DDHA 3O4LA 3GBMH 5LQBL 5D7JB 3ISWA 1RJZA 1CD9B 1GSMA 1U58B 2J88L 3HFML 3PIQB 2M26A 1M1SA 3U6RB 5I8CB 2WP3O 5DUPL 4PV9B 1JPGB 2NZ9C 4NM4H 4KHTH 4KTDH 3ZZ1A 1KB5H 3RZCA 3JVGC 5DVMA 2BVPA 3IJYA 1OQOA 4W4OC 1T22B 3OKKA 2AEIT 4YHZL 1F4WL 1Q1JH 2JB5H 4MMXC 4H26A 1JNNL 1FVEB 5D1XB 3PABB 3I9GH 4J8RB 1IGIH 2GTWA 4WW1B 2AKRB 4HJJL 5BO1L 3BYTA 4OFYD 4X99B 5SWZB 2RR3A 5FGBA 4LCYA 5DQJA 3TT3L 4HUKB 3T0EA 4LHJB 3O2VL 2R4SL 2CRMA 4OGXL 1QFWM 2ZUQC 1PG7L 3QDGE 1G0XA 1MJ7L 1KB9J 5DD1H 2AK1H 4PR5A 3U4AA 3TA3D 4PJIF 1S7XA 5FYLE 1U8NB 1A1NA 4QHKI 1KPUA 3K1KC 3OPZL 2NYYD 1TZGL 5CJ5A 4EIGB 3ULUC 3LB6D 5GS2H 3BP5A 3SKMA 1R6VA 1HYRC 5D9SA 1QEWB 3VRLE 1J5OH 2AK4B 3WFEH 5H2BB 4J3XA 5FM8A 1B0GA 2BVUA 2APTA 3EBAA 4GW5B 2IALA 1IC4H 4NYLA 2G9HB 1MFCL 1KYOK 2D4DA 3A6BH 1HHHB 4K8RH 1SVZA 4LF3B 5DI8B 3RWJB 2YPLE 1H3PH 1NGXA 1SJXA 1CGTA 3IU4H 2E9JA 4NN5B 1P5UA 1WZMA 4WJ5B 3W9DB 1NDGA 4UIKH 4RX4A 4ZAKD 5HTSA 3VGFA 3MMEA 4NJAH 3RJQB 2Q8AL 4P3DA 1UKSA 1DSFL 2YRPA 1HQRA 1FZKB 4GG8A 3MRRB 3UJIL 2HTKD 4Y88A 3VRIB 2BOCB 3AS3A 3G6JB 5D93C 1MCDA 3MRKB 2WANA 5I1EH 3MODH 5E00B 4PD4J 5C0BE 1WK0A 1H8NA 1JTTA 2VMFA 1PVHA 3MV9E 3RA7H 3IDXL 2R2EB 1UKTA 1OSPL 2ICEB 2YUXA 1YYML 2SEBB 3MLXH 1ZLUK 3F7YB 1JZ3A 3U9PH 4ODWB 1LEGB 1D5MA 3BQUC 3TIDB 3L95A 1H9VA 1TXKA 3GI8L 4KVCH 2OJZL 1BLNB 1PYWB 2J3SA 2LABA 3AREB 3PJSA 3QSKB 1I8LC 4WCYH 5JOEA 3QIUB 4H8WL 1HHKA 4XBPA 3IFPA 4G8EA 2VDNL 4WW2C 4N8VA 3GSOA 4WGWB 2XZAH 4IJ3B 3SJVD 1XIWD 4UBDC 1OVZA 4RNRB 5I1AA 4YIQB 2BY3A 2NTFB 1YPZB 1X5HA 2X7LA 5ISZD 4PJEB 3ZTJH 3IFNL 2FCBA 4KK5D 3E6HB 4LLUB 3F6IA 2OI9C 3MNZA 1TJIL 1NKRA 1NBYB 3QIBC 2IPKA 1O7VA 4KJPC 3LSOB 1FBIL 2EDJA 3O6FA 3SCMB 5DD0L 3AM8C 4ONGL 4CBPA 5A16A 4E9LA 1YY9C 4S1QH 1YMMA 5DJXA 3VFTA 2GT9A 5C0GA 4KRMB 4H20H 1SJVA 5KTEH 5M95B 1LO4H 3X3FL 4HG4K 2DAVA 3FTGA 1G7QB 5MP6L 3AU1B 1KIUA 4L5FH 3TT1L 2CDGA 2GEEA 2UY6A 3QZWB 3L5WB 3WFBH 3BWUC 2P47B 5I0DA 3UZVB 2R1YA 3M17A 2R0WH 5IB2B 3TYFA 3VWKC 3MBED 1I3UA 1F3DJ 4JN2A 1JI2A 2Z8RA 3QCTL 2CXKA 2ZUUA 1NC2B 2PTTA 4JPIB 5E8PA 1X6NA 1CLOL 3FB8A 2VL5B 4ZFFA 4KMQA 5EO0A 3KNBB 4DCQA 3KLAA 3CXDL 4H1LB 4JZJB 5L8LB 3ECBA 4JKKA 4YXHH 3JXAA 3RQ3A 5IR1B 5DJ8A 1K8DA 4OLXL 4OLWH 3V4VH 5FB8B 3E6FA 3QDGB 4BSVB 3VWJB 1RQ5A 5J6GB 3MCLH 1Z3GL 5HI4C 5EZLA 5I19L 5EZJB 2VZTA 1JGLH 3TH2T 25C8H 3TLRA 3C5ZA 1ZT7B 2OXHA 4PB0H 2FD6L 3ELAT 4NHCL 1FL5A 4YHMH 3WIFB 2EZ0C 3GB7B 2VXUH 1T7YA 1LDSA 2X44D 3NVQA 1ERNA 1XEDA 5JLZB 2VKXA 3T0WA 4NUGL 1B0RA 4TRPL 4U2YA 5CGTA 3MBXL 1D3CA 3R06B 2R0ZL 1JZ5A 2IGFL 2YR3A 1LK3H 1A7NL 2A1WH 2FATH 2YHGA 3IETB 2APXA 2EYSB 4CW1B 4Z9KB 3HTLX 4MJ6B 1CU4H 1W8OA 2X70A 1S7VA 4X6EA 2X10A 1I9RL 3KPPB 4KKLC 2YD6A 5TF0A 1X3DA 5EBWB 3V6OA 1I1FA 4H88H 1AD0A 3C09C 3TBSA 1MCIA 2YPLB 3U7WL 2P42B 1QNZL 3DURB 2DL2A 4UOW1 5E9DA 3SPVA 1T0PB 1WIPA 5DJYA 5KSVB 4I2XE 2HRPL 1K4CA 4YWGL 4UV4L 3RX7A 4S0TD 4LRIC 2FR4B 1RIHL 1UGNA 3BW9A 3G5ZB 3SKJH 2GHWB 3NA9L 35C8L 1ZA3A 5CUSL 1PG7X 3VGAC 4FQXD 4MNHB 2IBZY 4U3HA 3NIFF 1HHIA 4RFOL 4WY7L 7CGTA 5IV2B 2A6KA 3EYVA 1VEMA 5C0BB 1V3LA 3MV9B 1LILA 4PJFA 5EUKA 3OXSA 1RZ8B 3GMRA 5C09E 2BVTA 4YE4H 3QPXH 2FX8H 3D5OF 4FFZL 3MC0A 3UDWC 1AKJB 5KSBA 2DQJL 1Z0NA 3QDMA 4M62H 4PJ8C 3CMGA 5FUOH 4E41E 4JKPH 1JHKL 1HE7A 2Z31C 4JZNB 1IL1B 4G6JL 5CIPB 1WAAF 4NKQB 3MJ9A 1RUPL 4FQ1H 4LK4A 5HBBA 4UTAH 5C07D 1EEZB 5DC9B 3B5HA 4YFLI 3ZL4L 4Z7UF 3X3GL 4RZCB 2M2DA 1NMBH 4X6CF 1U8KA 1BEYH 2FIKA 4F7EA 1I1CA 2DI9A 3OV6A 3RDTD 1FDLH 3ZE2F 2P5WE 1ZGLA 3V6FA 1GOFA 2A73B 4OQTH 4P5MB 5EZOL 5IBUG 5FOBB 1BJ1H 3C8HA 4HUXA 1RIVH 3IFOA 1CXIA 3QCUL 3HNSL 4I18A 1D6EA 4PRPA 5HGBA 4X6BB 5D6CA 4D0CA 1JPST 1X5AA 1J87A 4GMSL 3CDCA 4OLYH 4Y4HC 3BUYA 4NWUH 3SDAC 5D93B 5C8JB 4G7YH 2WWKT 3FT2A 2JF1A 1IAMA 3Q6FB 1KJ2L 1LO2L 1TZIB 2CLVA 2AGJH 2FHBA 2VXQH 5I74C 1ROWA 4JFEA 1FGVH 3C6LB 4P46A 1WT5A 3MO1B 1K5NB 1G6RL 3T08A 5HYIA 1NDMB 1JV5B 1R3KA 4M03A 1J10A 3I6KA 3HE6A 1J0KA 4PGBA 4AL8H 4IEFB 4PJCE 3DPBA 4RQQB 4DZ8B 4Z77A 4YHYB 4ZXBD 1R24B 3F7RA 4XC1L 1ZANL 4R4FL 3WHXB 4QTHB 1Z9MA 5I1IH 3THML 4WW2B 3WNKA 3IDJB 5EUOE 3FQTB 4X6FA 5JPNA 5EFIB 1OLZA 2OCFD 4RMSA 4RGOH 3DMMC 4Y4KC 3RWFA 3QXDB 2YBRB 4IMLA 5D7KE 1JRHH 1FNLA 3G08B 3LEXB 3IYLW 3QIBB 3FZUD 4GKSA 4Z7WA 2OR9H 4PRBA 4WIQA 1WISA 4DW2L 3WEXA 1HHGB 2CLZA 1G6RB 4F37F 4MD0B 3S96A 5CZKA 2NY4D 1MCWW 2AEPH 3JWDL 1I8MA 1Q9LA 3F58H 2QHRH 3AS1A 4WFFD 1K6QH 1MAKA 5IEKA 2EDLA 1NUNB 1CI5A 2PTUA 1UZ8A 1LK2A 3T0VA 4UAOC 4XPBH 4LOUC 1YUHA 5KN5B 4XPTH 5GHWH 2KDGA 1GIGH 2D0GA 4OB5L 1DBJL 5GISH 3DLQR 5K9OB 1CG9A 3NFPA 3HCVA 32C2A 3DXAE 3P9MA 1CFVL 5EBGA 2H41A 3CDFA 1L7TL 2R2HB 4TSBL 5CSZA 1YNKH 5DVNA 5I2IB 3RVTC 4QHMA 3VD5A 5CZVL 5F7FA 5IBTL 1H3WM 4QOKA 1A14H 4I2XB 1PAMA 3DOSA 3HUJA 5DGQA 3GBNH 3KXFD 4LCUB 4Y7MA 3HG1E 4XC3H 3RTQC 2COQA 3ZE0E 3EDKA 1E4XL 1T1ZB 3LKRA 2XFXA 2XPGA 2D9QB 2CD0A 3LKSB 1RK1A 5EOQL 2P1YA 4HS8L 1AHWC 5IQ7L 1WCQA 1DQMH 1SBBA 5A2KH 5DJAA 3HPJA 1I8KB 3RI5F 4M5YH 1I1AC 1XCQB 4U1MA 2DQHH 3REWA 1BVKB 5JOFA 4PY7B 5C09B 1MQKH 1AGCB 3L3OA 3MXWL 5INDB 2CK0H 3DX9B 3N06B 2I24N 4M48L 4E41B 4BQBA 3B6SA 5HSFA 4G9FA 4BQ9A 4OI7A 2P24B 4QTIH 2WBKA 5ICXB 4NZTH 2P4AB 1HNFA 5A2LH 4B0MM 4KDTC 3W82A 1H8SA 4N9OB 5JMOC 3GHEL 1U8PA 3QEHA 2X40A 1P84K 4XNMA 2ZKHL 5D7JD 3ALXA 2FECI 1HQ4B 4PJ9C 5EO1A 4LARL 2JJSA 4X0KA 5EU5A 4OAWA 5TDNA 1MHEB 2OTUB 3EHBD 3KYMB 4Y5XA 5FGCE 1W2KT 4OGAC 3GSNA 1U8IB 3QEGL 2P5WB 4ZODA 12E8L 1Z9OA 4LLWA 5DMGD 4KK9D 3P4MB 4YHKH 1SMOA 3R1GL 3HC3H 3GSUB 1U36A 4GRMA 1W72B 2D03H 4N1HB 3MFFA 1TCMA 2HFEB 1JN6B 3VGAB 3AVEA 4I77H 4MAYD 2ED9A 1T1WA 1A21A 4W6WB 5EIVA 1TVBA 4NWTL 2CQVA 1MJ8H 2BX5A 5D1XD 4BSJA 3QXWA 1JPFB 3VXQA 3O3AB 5GGRY 4PJ7E 4G42A 3GBLA 3NFSH 4N90E 3T8XB 4CU6A 2F15A 4R3SA 1IKFH 3UJTH 1CGSL 5D96C 4Y1AE 5F93C 2Z31B 1NSNH 3A6CL 5SWZD 1HILA 4QRTB 1H15B 2Y06L 4X98B 1P4LB 3N1PC 3Q6GH 4PJCB 4WGVB 4P2QD 3QEQE 1FHGA 3RX5A 3BZEA 4WO4C 4CU8A 3MLVH 2AXGB 3INUH 4ZPVB 1P4IL 1RZKC 5EUOB 4GRLA 4OZGE 3TPUB 3C6SA 1IGYB 3RIAK 2J4WL 5E08L 3NAAL 3QI9D 3RHWF 3PGCB 1HNGA 1T89C 5CINL 4XPHL 4BH7A 5FYKH 1IZJA 3MNWB 3BKYL 1U92B 4HKBB 5C0AA 2AK4D 5FDWA 1V3KA 3KLHD 1AJ7H 4U1HB 3SDAB 4U3XA 4M9PA 1HEZA 4KJQD 4IBLT 4LVHC 1IAIL 2BVOA 5I74B 4DFIA 4XCFL 3U79A 3O45A 2LAAA 4LMQI 1WEJH 5KVMC 1P9MC 2WBJD 4FFYH 1CIDA 4WU5A 2EDDA 4HIEA 4XCEA 2GSIB 1Z9LA 3HR5B 3Q1SH 5GS0C 3TBVA 2X6MA 3MV8E 1JGDA 1KN4L 1V5JA 3MRCA 4MCZA 2F19L 4U6HB 3KWWB 4XBGA 3IDNB 4X8JB 1J0YA 3MLPA 4WHYG 3EJYD 1MUJB 4QRQB 4R90H 1DJSA 1U8JB 2GCYB 3DMMB 3OKYA 4Y4KB 5FF6A 3DXAB 3U2SB 1S7TA 1FNEB 5DURD 1SBSL 3EYQD 2LTQB 3C5JB 2GJJA 3GMOB 2HJKB 2DQFB 5J6HB 5DRWA 3MOBH 4J3UA 2NXZC 5CSGA 1F6LL 1DLHA 4KUZL 1RMFL 2VN7A 3HB3C 2H26A 4HBCL 2NLJB 2BVQA 2HAZA 2AV1A 3HG1B 3WXWH 3ARED 1EMTH 2ICCA 5I1KH 1U91B 5E5RB 3QO1B 5GRUL 2WQRA 1KACB 4HEME 3HR6A 4QLRA 3S7GA 3QIUD 1PZ5A 2YN5A 3W5MA 4WWKA 4XVTH 4YDIH 5C9KA 1AP2B 4ZO6A 2QR0B 2VITB 2AJYH 2FO4B 2QKIA 2ZCKH 1DUZA 1IAIM 5B4MD 2BSSA 1XGTB 4UAOB 4XNUH 1T3FA 1ETZB 5JPMA 4BK4A 2WUCH 4MAUL 4B53A 4G8GE 1S78C 1YN7B 1N5AB 3DUHA 2FZ3B 3LN4B 2KL6A 3S36H 2CIKB 4HULB 1BQLL 4R4ND 3MLSL 4YPGB 5IMOB 1FO0H 1H0DA 1J12A 3GK8L 3WKNA 3O3DA 5IJKC 1PY4A 4TQEH 2FBJL 3HMWH 1RK0A 5TE4H 3MA9L 5FGRA 1FNGB 4AENA 3O2DA 1XGYH 5FGCB 5CWSB 4OI8A 2C3VA 4KXZH 3VFSB 1FAIL 6FABH 2PW2A 3WKMH 1D5BA 1IGFL 1C12B 3GDBA 1AHWB 2A9NL 1FZJB 2HFGL 1NC2D 1I1AB 2IH3A 4KKBD 2ITDB 4BK5A 3OKMA 2IPUG 3TPKA 1C5CH 4PJ7B 5SX4I 1I3VA 1D9KA 3BKCH 3QUML 2W0FB 2C5DC 4XI5D 5F3BA 1KEGL 5DJCA 1EV2E 4PLJC 4ZG1A 4GAJH 4Y1AB 4LSSL 5E2UH 4IRSB 3TJHC 3AS0A 4PJIE 3RWCA 4LSVL 2BXYA 3HZYB 3QDGD 1INEL 1NFDF 3QEQB 4EI6A 3VWJD 3KJ6H 1ACYL 1Y18B 2VXSH 3PGDA 2DIJA 4PJ9B 4BM7A 1MRDH 2R0KH 4NUJA 3N1GC 4WEBH 4YAQB 3BI9X 4JO2H 1OTUD 3DNKA 2BNUA 1OPGH 4KKAC 4M4PA 4OZGB 1G9NH 3LKNA 4WTWA 4G43B 5GGSY 1I7RB 5FYLD 1QSZA 3P9WB 3EDJA 2W65B 2NZ9D 4JY6A 4JFZL 2YD1A 1EO5A 3VXMA 1XAUA 1RZKL 2JB6B 3MRHA 4F2MB 3WXVH 2VISB 5EU6E 1RUAL 2APWA 3BWAA 3QUMB 1A5FL 3X11A 5EIQA 1YN6B 4KI5C 1MFAH 2KH2B 5F7YC 1QKZH 5EBMB 1T0NB 2F5AH 5GGQL 4AH2A 5HPOA 2UWEF 3CFCL 3EYOB 2WMPA 2XQYK 1YQ2A 3TVMB 2WWMC 1ZSDB 4EN3A 1CDYA 1TIUA 2YPLD 5IOPA 2HKHL 1NBZA 5JW5A 5MEPB 1FFPB 4JFQB 5I8EA 1FNSL 2NY1D 3BQUA 3EGSB 4KGJA 3MV8B 4JVPA 3SDDD 3E1F1 4YNYB 1U95B 4K3EL 5F96L 4JPVL 1TENA 4WO4B 1Z0MA 4IMKC 3IFLL 1M7IA 4TSCL 3H7BB 3LV3A 3F7VA 4MJ4A 4O4YH 2OSLB 4Y2DC 3ARGA 3L7EB 1SEQL 4NHUA 1UM5H 2NNAB 5DQ9B 5AG8A 1E6JH 5CEYB 3VW3L 4MS8D 4YUEH 4LHUB 3DSFH 1I3GH 5HHME 1A7RH 2P8PB 4JM2D 3UO1H 4U1KA 3PV7A 4HT1H 1AKJD 2HWZH 1KJ2A 4NQSB 1UYWH 1KFAH 3HLAA 1HINH 1T0MB 3DARA 1CDJA 5C6WH 5I76B 1MFEH 2FWOB 1OP9A 3GHBH 4JO4L 3TV3L 3D3VE 1II4E 3I75A 5F21B 5IB3A 5IF0B 2X4NB 4R8WL 5C0NC 5IEHB 1VKXA 1IC7H 3ZMRA 2IC2A 3CC5B 2H2PD 2QQQA 3BE1L 2UVEA 3AXLA 1IE5A 3UBXB 3AAZB 3QUKA 3BPCB 3BEWA 4HKJB 1I3RB 3B3IA 2BFVH 4WHYH 1F3RB 3NCJL 4PJGA 4OUUB 3EYFB 3BKML 4P4KA 5K9QG 3VWKA 3SKOB 3G5XA 4XBEH 4TUKL 1KELH 2FNBA 1S7RB 4NOBA 5DFWH 4G8GB 3SDCC 3CX2A 5BZWB 1Q72H 2GJZA 2OLDA 1WFTA 4HKXA 2CDEB 4FS0A 5D5MF 4UTBL 2LQRA 1OCWH 3RAJH 3N0PB 4TNVK 1VGEL 2H6PA 4I5BA 4PY8I 5E6IC 4PYHA 2DM2A 2EE2A 4GQ9H 3C6LD 1A6ZA 5B8CC 5I17B 2OM5A 5CBEB 2EXWC 3I85A 2DYPB 2J12B 2VZSA 4PREA 4LSQL 4N8VG 3ZHKA 4ZFZA 2YPKB 2WWKO 5J3HD 2VDML 4MXWH 1YEGH 3IAGC 2Z8WC 4RFEB 3EZ8A 1N6QL 5E94B 4TPRL 1EXUA 4PJXF 3ULSA 3UZQA 3IJHB 2ICES 1OTTD 2FHCA 4NNPH 1KNOB 4L3EE 3PDOB 1WBZA 3VXSA 1UVQA 3PWLB 4K07A 1F11B 3KPRA 4HMDA 5BS0E 3JV6B 4PRDA 3QIBD 1A1OB 2IWGA 3CFKA 4PJIB 5E0QA 4XCYA 4G6AC 3VE0A 1QLRB 2ZCLL 1M71A 3ME0A 5H37H 1R3IH 5SX5H 2ESVE 1AGFB 5D8JH 4YQXL 3UPAA 3BGMB 3EOTL 3NFNA 4JQXC 1DQJA 2XY2A 1J8HE 3KYKL 2JELH 3OR7B 4KQ3L 3S5LB 1C08A 4AEHL 1VFBA 4NO0B 4LQFL 1H5BC 2YMXH 2IFFH 1FV1B 3ZKMC 4LRIA 5ITBH 2BHYA 1N59A 5EU6B 5IB1A 4Z0XA 1TFHA 5C2UB 1K3IA 3SO5A 4IM8A 4BSWB 5ANMA 3K7UA 5ETUB 2IH1A 3IRPX 1B90A 1QR1B 3RNQA 4CL7A 9CGTA 5AYUH 3MFGB 3LZFL 4PG9B 1T5XA 1GOHA 2AEQL 4JM4H 2VR9A 4OGYL 4PS4H 4OD3L 4PJ8A 4HQQL 4LRNL 1NBVH 4QXGH 2ADFH 2JLLA 2J6EA 3EYSL 3NIFE 4YHIA 4K7PL 4Q2ZB 1MCSA 4ZS7H 4RIRB 4HIIB 5DMKB 3DGGB 2ZUTA 3OKNA 3T77B 3WIHA 1IEAB 3QHFH 2DM4A 3BVNB 1ZA6A 1A47A 4F9LC 3QQ4B 3OG4B 1UJ3A 1KENL 1JUFA 3UPRA 1WAAE 3VXPB 5HHMB 5JR1H 4NO3B 4FXGA 5I9QC 3ROLA 1JNHA 2YKLL 5IG7B 3OQ3B 3SDYL 5FO8A 5HYFA 2BXZA 2YXFA 4PPTA 4Z7UE 3TBYB 3K4ZA 4X6CE 4Y4HA 5L2JA 4DGIL 4RMTA 1NAKL 3D3VB 4YBLC 2Q6WA 1RZGA 3P2TA 5D7IA 3FKUS 1WCBA 4JFDA 3P11H 4JANA 4KKLD 3ZE2E 4G9DA 4K8RC 3GMNA 4NQVA 3WUWA 5CFHA 2ZUXA 3DROA 5F3HB 5EO9A 4QXTB 1DQDL 2DD8L 2JKXA 4W81A 3QAZC 1CGUA 4NN7C 5FM4A 4DJMA 3KDMA 4WUUD 5DJ6B 4LLYB 4OD1H 1ZHLB 4PJAF 3LHPH 1PG7W 5KJRL 2P5WD 2R0LH 3IDIB 2QTEA 4M1DH 4WI5A 3IXTB 5CSBA 5DMIL 3ZE1F 5I6XC 3ZDXF 4TUOA 4H0IA 3UEZA 4Y2DB 3DBXA 3UYRL 4LPUA 3C87A 2H8PB 3BP4B 4C58B 5C0EA 1T5WA 2QBWA 3O81A 1JYNA 2DWEB 1CXHA 3DIFA 1N0LA 4LEOB 3O8XC 1FLRH 3SO3C 4R26L 4JO3L 1EEUA 2IADB 4JCMA 1FSKB 5FA4A 4EXPX 1WIOA 4FTVD 4EOWL 4WI7A 4CMMB 2O5ZL 4PRHE 1U93B 5F9OL 4NZRL 1CL7H 2VDOH 2ZNXA 2CUMA 1I9EA 3OJDB 3S3JA 3WLWC 2DLGA 4FXKA 5FDYA 5JW4Q 5LGJB 3MRPA 1R3LB 2YWYA 1DCLA 5DZOA 4OTXH 4Q9QH 4UUJB 3H42H 4PGEA 2Z93A 5CGYC 4WI3A 4P5TB 4XZUA 5IT2L 4HF5H 3ALPA 2EE9A 3QA3B 3LY6A 1XH3A 5FKPA 1P2CB 1DFBL 5ILTH 2RB8A 3HRZA 3QT2A 4L3EB 3WNMA 1XGPA 4GBXB 1S9KC 1KN2L 5D7KD 1I7UB 5L7XL 2IMMA 1HHJB 4D9LL 1X4ZA 2HRLA 4XGZA 5BS0B 3WJLC 3ARDB 3SDCB 2Y7QB 4Q74A 4YXLH 4S1RH 3QEUA 2WINB 3SDAD 3H9ZA 4ZUVA 5E56A 5GXBB 5EORH 4ZQKB 2NW2A 1ZHKA 3DX8A 2ATKA 2W9DH 1P69B 3PWNB 1F4YH 1U3YA 3V2AR 2IF7A 4UMGA 3VFOA 2ESVB 5B8CB 5D1QB 3MBEA 2JJUA 3GBML 5CMAA 1QBML 1J8HB 2H3NA 2E27H 4X80H 5I1DA 1DUYA 3P3YA 3PWJA 4YR6B 2BRRH 3DX6B 2EECA 4JY5L 3FONB 4OCXH 5SWQA 3RTQA 2EH8L 1Y0LB 5IMMB 3C2AL 3EO1A 1S7WA 1X5LA 2DMBA 4JFHD 4NM4L 5HHOA 4KTDL 1KB5L 3FT4A 2YUWA 1XCTA 4NC1C 3SGKC 5DZNA 5F7DB 1BREA 3RL1A 4GMTL 4UNTA 3DXAD 5GS1B 2JB5L 4YO0A 5LJYH 2XWBA 3CFDA 1NGQH 4CDHA 4MCYA 3I9GL 5J1TC 1NGYA 1ITCA 4ZS6C 3MLTA 4OQ1A 4MJ2A 2OJEB 1INQB 5F7EL 4NZUL 1GGYA 1KPRA 4GQPH 3LS4H 4MHHG 3VG9B 2YEZB 4CVZB 2VNCA 2YD7A 1CF8H 3CK0L 5LWYH 3LQAH 2N4IA 3L5XH 4LKCA 1JIBA 4HMCA 3TBTA 3CIQA 4LIQH 4E5XB 5DD1L 1VDGA 3U0WH 1KB5B 2AK1L 1KC5L 4L8SA 1G7PB 2DLFL 1H5BB 4XP5H 5IUSA 1CIUA 1PSKH 1XF1A 3MOAH 3MGOA 3FFCE 5GIRB 4NC1E 3HZMA 1IFHL 4Z7UB 4U1NA 1SHMA 4X6CB 4M6NH 3CPLB 5F7NC 3WFEL 3V0WL 2ICWB 2HMIC 3GGWA 3OKEA 1OGTA 2AJSL 3IXAA 4S1SH 2C1OA 2A0LC 4IOIA 3RVTD 1I7TB 3QO0A 2VAJA 4U1LB 4FQXA 4TVSa 3A6BL 3OAZH 5GSRB 3WE6A 1OGAE 3I3EA 4RBPH 5DC4B 2BSTB 4JDVB 4KZDH 1EJOH 2Q76B 1MH5B 1G1CA 1K3ZA 2W0KA 4M8VA 5HPMA 2DQGH 2EDWA 4UDUB 1JGVL 4UIKL 4MXQD 5A1AA 1OWRM 1DQTA 4MJ5B 3FCTB 5MEQA 4BUGA 3KPOA 5A3ID 1CDIA 1TJHH 3NCBB 1L7IH 3OX8B 3UTQA 5EB9A 3PL6D 1K8IA 1G7JB 1HH9B 4KTEL 3ZYZA 5I1EL 5I75C 3MODL 3ZYIA 4D9QE 5CEXA 4I9WE 2F8XC 3UTZB 4PRHB 4Y1AD 2F74B 4IRSD 1NGWA 4YBLB 4B41A 4M43H 5DA0B 5ESQA 5MENE 3T0DA 3TEUA 3VXRE 1MJJA 1VHPA 4XMPH 3RDTA 1QPXA 4ZD3L 4BKLB 4HAGA 4BFBD 4Q0XH 4KKNA 5IHUL 1A4JA 4PJ9D 4KVCL 1S5HB 2FJGA 4MD4B 3MRGA 2IPTL 5E7BA 1ONQB 3HNVL 3ET9F 3QULA 5HYJD 4HK3N 5HDLA 4P2OC 3N9GH 5JOPD 4MNGA 5GGVH 2QQLH 4Q6IC 3RNKB 2XZAL 4LLDA 2NY5H 3WDJA 1RHHA 1EHNA 2X9XA 1I1RA 2I5YH 4DN3L 4ZUTA 3FQUB 1GCFA 5HVHC 4U6XA 3OKLB 5IBLC 4MJID 3V5KA 2AABH 2CKNA 4GAGH 2VRAA 3O8XB 4WU7A 3QHTC 3LQZA 1ZT1B 1NKOA 4ZXBA 5J57B 3TVMD 4JGMA 3WO4C 1TVHB 4S1QL 1CFTB 3ZHLA 1T21B 5EIIB 3L3HA 5KTEL 4KMLB 3ARPA 4G6KH 3GSQA 1EK3A 1WFNA 1NGPH 2X4TB 3MV8D 5T33L 4WO4D 1UCTA 1NCNA 4LFHD 1ADQH 4PRAA 2D2OA 1ZLWH 4GW1B 4F7CB 1B4JH 5JZ7C 4RMRA 4NO2A 4NQCD 2GAZA 1BZQK 3H9YA 4DKAA 1RVFH 1OT1A 4HV8A 2DQEH 2F8OA 1CDCA 5JQ6H 3MR9A 4LPVA 3GIVB 4Z76B 4JLRB 5HHQB 1ZVYA 1AFVH 1GGIL 3ZKNC 3F5WB 1QSFA 5FXCH 4N0CC 3K2MC 1CICB 1CXFA 3STLB 5LCVH 5I1CH 5FK9A 4JFYA 2X4SB 1A6PA 3N50A 1OAZL 1OSZA 2G75B 3DVGA 5KANG 1HK6A 4S2SA 1U2CA 5IM7A 3TNMB 2IANE 4N0YL 2R39A 2PYEB 1VPOH 3V4VL 4DAGH 1SJEA 2PO6C 1RZJH 4GSDL 5DSCB 43C9A 2UYLB 2ERJC 2XG4A 5DZLA 1JGLL 1SYVB 2A9MH 4DGYL 3KPQB 5IW1A 1SYSA 1ZLVH 4I0PC 4E42B 4YHML 2VXUL 5DEGB 4D0BA 3MA7A 1G0DA 1MVUB 2AERT 3FFCB 3HS0B 4KH2A 4OLZL 4KK6D 4WI2A 4G8GD 4HZAA 2Q7YB 2A1WL 2FATL 3QP3A 4DUXA 2BJMH 1XFPA 3VU2A 1C5BH 4NJ9H 1KT2A 5ACMA 4YDVA 1G6VK 1VENA 5KZCB 1GXEA 1ZOXA 2C7UA 1OGAB 2DYPD 2VSDA 3HB3D 3GRWA 5B38A 4ZOEA 4I0CC 1CDUA 4ZNEE 2JK5A 3PF2A 1I1YB 1SJHA 2HN7A 3QFJA 5DTFB 2MWCA 3MLRH 4XRCA 3QNYB 2V2TA 4BH8A 5EC2B 1A7QH 4Y8AA 1B6DA 1NFDE 1FH5L 3HNTL 4APQA 3QCVL 3AGVA 3IDMB 4UB0H 1AIFB 2P5EA 3IDUA 3QQ9C 4K7FA 2HT4C 5JUEL 4XPAH 1S78D 1A3LH 5FUOL 5MENB 4JKPL 4H5SB 1NPUA 1KJ3H 4MA3B 2VDLH 4G6FB 3U1SL 1BZ7A 2EYTA 2HTLD 3BFOA 3GO1H 4F37K 1XGUA 2Z91A 5F8QC 3AY4A 4UTAL 3VCLA 1N4XH 4YBQD 2DTMH 4MAYA 4LCIH 1EUUA 1ZT4B 3AFLA 2EC9U 4EDXB 1UXWA 4P9HH 1NMBL 1BEYL 1JMXA 1VESA 2UWEE 1KIRA 2YZ1A 4NO0D 2C1PB 1EFXB 4IMKA 5HDQH 3HE7C 4FXLA 2FX7H 4JJ5B 1QFPA 5DHYB 4UDTA 2XWJA 5EU6D 3EOAB 1OB1A 4G6ML 3QUXD 1RIVL 4B7IA 2NZIA 5FUCE 3HMXA 5IFHH 2K7QA 1BBDL 3BIKB 5JHDB 4P2QA 1MI5E 4OLYL 5IVNA 3EDEA 1UT9A 3X14B 1OF2B 1CGVA 3N85H 4G7YL 1AY1H 4UINH 3FQXA 4Q7DA 1R5VA 3I2CL 1KIPB 5EG6C 2AGJL 2VXQL 2RQ8A 2D7PA 3TJHD 1FGVL 1NCDH 3RWIA 5BRZE 1CT8A 1GGBH 3QI9A 4NQXA 3L3GA 3P40A 3QIWB 4KROC 3S8WA 3MJ6A 3NIDF 3RUGA 5C0CD 4LLVA 4AL8L 3X13A 4GOSA 3C9NA 4L8DB 1IJ9A 5IESH 2ZSWA 4P2OB 1KXVC 1IZKA 2W9EH 3PWPA 1E4XI 5CEZH 1A6VH 4Q6IB 3ARUA 1FFRA 4NBXB 5GGUA 2FX9H 1R5IA 3RI5K 5FM5M 2OTWA 3M07A 1CXKA 4HS6A 5HVHB 2ED8A 2YK1L 1N8ZA 2WBJA 4WI8A 4X7TB 5HYSA 4FHBD 4RGOL 4S10A 4QWWC 4HSQA 4I8DA 1UWGH 4HIXL 3RU8H 1T1YB 4JREC 3E3QC 4PRIA 1FNHA 5C70A 1E28A 4XCCH 1QLFB 4XX1G 4TSAH 3OKOA 1IARB 2LU4A 1OD9A 3D3VD 2YWZA 2KQMA 2IANB 2OR9L 4FG6C 1BD2E 4PFEA 2DTSA 2WWMD 2EEAA 3QH3A 4Y19D 1CFNB 3WN5C 4K94H 5E6IA 1U6AH 1BQHG 3ES6B 2PTVA 1GVIA 3MLYH 1RUQH 2OZ4A 2AEPL 2Q8BL 1UFUA 2ZUYA 1FL6B 4TTGA 4KFZC 4I48B 3BYYA 2JTDA 1TNNA 5D5ME 4HWEH 5CILH 5JHLH 5C7XH 1GZPA 1YEDA 4CVXB 2FL5A 2NY3B 2YRLA 2BC4B 1LEGA 5EBLA 1G7HA 4PG2A 4LDLB 1GH7A 5HHNB 2DBLH 3PQYA 3GNMH 43CAB 1MWAL 4PJFF 5GRJH 1S7SA 5KSBF 3O6LH 2ED7A 3S88H 2EH7L 3E3QE 3VFGL 4GRWH 4O2CA 1YNKL 4ZFOA 4QGTA 3TN0C 3H9HB 4PJXE 4ENEC 5ESAA 4EXKA 4LU5L 1T7ZA 2G5BA 1KF9B 2E7MA 2ITCB 2EXYD 2Y6SD 2PO6B 3O6MH 3GBNL 3FOLB 4P5TD 3WNPA 3MV11 3ZSTA 4AZ8A 1J1PH 2ERJB 1NBYA 2R1WB 4JQXA 5CP3A 2ZOKA 3VGHA 1MHPL 1ND0B 2O5XH 3HZKA 3OZ9H 4ACPA 1BVLB 2VUOA 4I0PB 2ARWA 1D5IH 2P8LB 1ZMYA 5T3ZH 3RHWK 1DVFA 1NFDB 3DTXB 4HWBL 4GBXD 2RJMA 4TOYH 1MWAB 5BS0D 3JTSB 1NCTA 3WHE0 3ARDD 3WSQL 4F3FA 3NTCH 2Q20A 5AAWA 2DLEA 4ZTPH 4QTIL 1XGRA 4NZTL 4N0UA 4HW6A 1RFDH 1ULVA 4XNYL 4UU9B 1MREH 5BJTA 1HSBB 3EOYG 4DZBA 2ESVD 5D1QD 1KLUB 1PGRB 3QNXB 3BAEH 1IAII 1RHFA 1WGOA 4NSKB 5D1ZC 3WS3B 3GEWB 1J8HD 3HA0A 3OKDB 4KAQL 3GKZA 3OAYK 4J3WA 4M8QA 5AUMA 3VD9A 3IDGB 1ZS8A 2UWEB 1DL7H 3FB6A 1YNLH 5C0DB 1BGXH 1Q9KB 1FVDA 1Z5LA 2YPVH 2LVEA 1FORH 3FQWB 5GGRA 3HC3L 3JBG7 5C0RH 5KVFH 3ARBD 3M8OH 1NH6A 1T20B 2DM3A 4QHLA 4MD5A 5EZIL 4P99A 2EYRB 3C60B 1NMAL 1MI5B 3QJFB 5HHVH 4JB9L 5E8EB 3RGVC 1MJ8L 5HY9A 4F57H 3O2DH 4ISVA 4G8FA 5BV7H 4JKMA 4X8XA 4AIXA 2X9WA 3TNNB 3D0LB 2QSTA 3QG6A 5BRZB 3GB7A 5FKAB 4Z7WF 1ZEAL 5CCKH 4F7TA 1A64A 1U8MA 1NSNL 3KJ4C 1KIQB 2Y1VA 4ELKA 2QQNL 1T6WA 4XB7A 1PJ9A 4CJ1A 3DX7A 3CSYB 1G9NC 1JHTB 3TO4C 5F1NB 3MLVL 4WVRA 5DEZA 1AD9A 3INUL 4LBEA 1NCAH 5F6IC 3G5VB 3VJ6B 1A3RH 2FLRT 2APBA 3VA2C 3LEVL 4TTDD 1ZVSB 3NPZB 3HE7B 1H3VA 5GRWA 1YQVH 3T3MF 2DQCL 3H0TA 4WNQA 3ZYOA 7FABH 1NEUA 2GJ6B 5FEBA 1M05B 3SDDA 2HLFC 2C4FT 1BD2B 4PJAE 1NGZA 4FZ8H 1J1OH 3G5ZA 2WV3A 3IKKA 3ZE1E 1QOKA 3ZDXE 3S37L 1GGCL 1LO5B 3LKOB 3GMPB 4FFYL 5JDSB 3V5HA 2XV6B 4KROB 4YDJB 5IHBA 1EERB 3HUJF 5D5MB 3Q1SL 1RZ7H 2IBBA 4JM2A 1EVTC 3PV6B 4POZC 4HIHA 1KXQE 5DRXB 1EHLH 3QHZH 3CLEH 1KCRL 2RIKA 4X7FC 2Z35B 4FQCL 1ES0A 3VFVB 4Z8FH 5GJSH 4IRJB 3DHMA 4N9GB 3L3KB 3T4AB 2IEPA 4Z7OF 1E0OB 1KCUH 2FEDC 2A6JB 2DF3A 4C83A 3CX5J 4HWUA 1LDPL 2DLTA 5E1AB 1YECH 3PWVB 4I3RL 1CFSB 2XOTA 3LS5L 4JREB 2YA2A 3WUWG 2H1PL 4NDMA 5D70H 4XMLH 4PJXB 3T4YA 5IMKB 5CD3B 3TWCH 2R29H 5FOBA 5TDOA 2CDFA 3T1FB 3SN6N 4LCWE 1DQQA 3G6AA 4P59L 1XR8B 3WXWL 2AI0L 1G7MA 1EMTL 1Q9OA 3G5YA 4IDJH 3S4SG 5I1KL 1JWUB 3ULVH 1A8JH 3DRTA 3BN3B 1XF5B 4LSDA 3U46A 5BW7C 4XVTL 1U8QB 4YDIL 3GMQA 2BOBA 3MJ8A 2KZ1B 1IKNC 4Z7VA 3OF6A 2X4RB 5IMLA 4S1DD 4XNUL 5D7SH 2F54E 4EUPA 3MRIB 1BFTA 1X7QB 1A4KB 5ESVB 1IM3A 2XT1B 3HRPA 1UZ6F 4OZHA 1JTPA 1QR4A 2CUIA 3DETD 1SEBA 3U36B 3QB7C 4F9PC 3CAFA 4OBRA 2DMCA 3EO9H 1LP9A 3OXRB 3MRDB 2A2QT 1I75A 2H9GB 5E03A 5EFIA 4YHNA 4PLKC 3CD4A 3WLWD 5KVGH 4TQEL 3HMWL 1A1MA 5TE4L 1U8LA 3LIZH 3EOBB 4R97C 4XH2B 4EZMA 1XGYL 4YZFF 5FUZH 4ZOAA 4YHPA 4DK6A 5DXWA 4WI6A 2VC2H 4C56D 2OK0L 3ZTNL 5AEAA 3WKML 5C9JB 2AJXL 4G8IB 5EWIL 3HPLB 3UBXI 2V17H 2R1XB 5T3XH 4P2RE 2HJFB 4PB9H 3A67H 4F58H 3N1QC 4HGWB 4OF3A 3MNVA 1LE5B 1C5CL 1MFBH 1CICD 3QPQC 3IGAA 2H2SD 2BNQE 1ZE3C 2JCCA 2XNAA 4I4WB 4GAJL 1CE6B 1YNTB 2GYSA 4JRXE 5E2UL 4ZUSB 1LGVA 1A6UH 1T1XA 4LLQA 1AO7A 3P73A 2E6JA 1CLZH 1YY8B 1G7IA 1MY5A 5GGSA 2CGRH 4BFIB 2PYED 4XHJD 3Q48A 2W38A 3O41A 3KJ6L 3TFKD 4I3SH 1MRDL 4OJFH 5FA3B 1R3JA 2R0KL 3QNZA 4WEBL 2VABB 1OPGL 3QUZC 1XGQB 3KYNB 1G9NL 2NTSP 1JTOA 1S9VA 1I9JL 3MYJA 1IGTB 2R2HA 4KUCF 3I50L 3QWQB 2E7HA 5JO5B 4ELMA 2NX5A 3K8KA 4JY4A 4NRXA 3WXVL 4J12A 3QRFM 4OCWH 3ARSA 3DI2B 5KS9A 2N7AA 4PJAB 3RGVB 5C08A 3PHOB 5EN2A 1L6ZA 2F5AL 1NFIB 5KZCD 1N0XL 3RZCC 3EZJB 3TYGH 4UIMB 4XHQA 1PKQE 2QADC 2FH6A 1MRCL 2XA8H 1RURL 3OHXB 1MNUL 3KJ4B 5LXGH 3L9RB 1ZGLP 5FOJA 2NCMA 4HKZA 3LKQA 1WLHA 2ZWLT 3D2UA 1FZMB 4Y16A 2YUZA 4ZO7A 3VFNA 2F8VA 4PJ5A 3TO4B 3W11C 4NCDA 4HH9B 2J5LC 3PGFL 5E6ZA 3FB7B 3NOIA 5E4IA 4WHDA 5F6IB 5D6DC 1S9XB 5FGBC 3V9FA 1JHLH 3T2NH 1OOAA 3C8KB 4OQTA 4KDWA 1A7PH 4OD2A 1UM5L 1ZHNB 1LNUA 1MHCB 3O4LE 4O5LL 4D9QD 1JGEB 5HVGB 1FIEA 1I4FB 4HAFA 4A6YL 1QVOB 1I8IB 3KYOB 2B1AH 4HT1L 4WUUA 2OTUA 5E4EC 3WIHH 5C0JA 5DJ0B 5ID0B 1LWRA 1KFAL 1KPVB 1HINL 3OGOE 4G6FD 1MFEL 3GSUA 4LCWB 5IVXA 5TGBA 2DMKA 1BZ9A 2P44B 2IQAB 1OLLA 2HFTA 2XWTB 4JDZB 1NANI 4Z78A 3TBWB 3OL2A 4MX7B 3ARZA 5CJXA 1AXIB 4YEFA 2WK2A 3VFRB 1X9QA 1NJ9A 4NGHH 4BELD 4FTVA 1HXYB 4XNZC 5BXFA 5T1LB 3ARTA 3WIIL 1YC8A 3BZ4A 4PJHA 5I1JL 1YEHL 4QGYA 3MV7A 1UCBH 2VQ1A 4DGVL 4WHTA 3UJJH 1P4LA 3FO2A 4XBEL 1KELL 4M1CD 4A6YB 3T0EE 4JQIL 4ODHL 1V3JA 5JHDD 3CDGB 2ZPKL 3GMLA 4L4VA 1YEKH 1LE9B 3ULUF 3P4NB 1VCAA 3H2WA 1ZWIB 4FQLL 1OCWL 3RAJL 4LAQH 3S6CA 3CFEB 5IGXL 3KPTA 2XZCH 2HH0L 3NCMA 1P7HL 4GQ9L 4HK0B 4NFDA 4EI5B 1OARL 4PV8B 2Y07H 3BD4A 2E7LA 3V6ZA 3QIWD 1D6VH 1PDKA 3AB0B 3SE8H 1JE6A 2PETA 2A83A 5IHZB 5GZOC 4XAKD 4JPWL 1DBML 3K74B 5T1KB 4U31A