2ZPKL

Crystal structure of p20.1 fab fragment in complex with its antigen peptide
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
212
structure length
212
Chain Sequence
ETVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPDHLFTGLIVGTNNRVPGVPPRFSGSLIGDKAALTITGAQTEDEAIYFCALWYSNHWVFGGGTKLTVLGQPKSSPSVTLFPPSSEELETNKATLVCTITDFYPGVVTVDWKVDGTPVTQGMETTQPSKQSNNKYMASSYLTLTARAWERHSSYSCQVTHEGHTVEKSLSRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords IgG1-lambda P20.1 Fab (light chain)
publication title Novel affinity tag system using structurally defined antibody-tag interaction: application to single-step protein purification
pubmed doi rcsb
total genus 51
structure length 212
sequence length 212
chains with identical sequence M
ec nomenclature
pdb deposition date 2008-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zpkL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zpkL01
4BFBD 3SGJA 2XG4A 3RJQB 1I9RH 4RWYL 5IVOA 4F2MB 1T20A 2FX7H 3UYPA 1ZLVK 2DAVA 3EUUA 1Q9KB 3U9UA 5J1SC 4JQIL 1T66D 3OB0K 1E6OL 4KKBD 5D96B 4YXHL 5M95B 1S78C 4P3DA 2G2RA 5CZVH 1UT9A 8FABA 2OK0H 5HI5C 1IBGH 4Y7MA 3AS2A 5JUEH 1U3HC 2AV1B 4KZDH 4QOKD 4WFHE 3VJ6B 3UTSD 3OPZL 1A5FH 1XR8B 1HDMB 2F54E 4KK9C 4YC2C 5T5FH 4RIRA 1CD9B 1PJ9A 4U05A 4BQ9A 3BUYA 2VO5A 4R4ND 4BQCA 3S4SA 1MFDL 3IJHB 3DVNB 2CR3A 2QADB 3V4PL 3T2NL 2IALA 5LAXB 5L2JA 3MGAA 3FFCD 5TJWK 3PGCA 4IS6B 4I5BB 4PGBB 3RL2B 3ARDC 3JWOL 5HGAB 1C5BL 2EDQA 4XHJD 2EE2A 1UJ3B 4LCWA 1OAZH 3RVTD 5E8DL 3MXWH 1U95A 4LCIH 1V7ML 4YUEH 3WLWC 3OX8B 1OP5H 1AE6H 5C0CB 4F9PA 1GC1H 3B2UC 3ULVC 4H88L 3W11C 2BSRA 4F15B 2NPLX 4KPHH 2BSED 5T1LA 1E4XI 2EICA 2DQEH 3NCYP 5I1LB 5JIKA 1EV2E 1Z3GL 2NLJB 3JWDC 3ZE0F 3L95B 5C0DB 2VWEC 1F8TL 5EU4B 5IG7A 5IQ7L 5IBLD 5C0NC 2NNAB 2DBLH 4M4RA 2A73B 3OKDA 1MREL 2D0GA 1CWVA 3B9KB 2V7HA 2GJ6E 1NJ9B 4JZOA 2ZPKH 5DC9B 4B50A 2J8UA 4LSDA 3VE0A 1YEIH 2ZCLH 4XMKL 1BVZA 3RHWF 1WISA 3V0WH 2AV1A 4KRMB 1CU4H 2W38A 1S3KL 2PYEB 4MD0A 3FCTA 5L6YH 3R06A 1IC7L 4KJWD 4EEEA 1EHLL 4JB9H 5F6HJ 5HYJD 4JFFD 3D25A 4AK1A 1DQDL 2JK5A 2ZUUA 5AAWA 5F7UA 1GZPA 4XP5L 4MLIA 5E1AB 4LLDB 4AIZA 4NKDA 1ZTXH 2HVJB 3F62A 5E5RB 1LO4H 1YMMB 1IGMH 3EO1A 1CGTA 3SKNB 1E0OB 3GRWH 1OAKL 2NQCA 4CJ1A 3KLAA 3QCTL 5SX4I 3FFDA 4RWHA 1FRGH 3DYMA 4WUUA 1GAFH 4FP8H 3REVB 1YECL 5EFIB 3MV8A 4QHKJ 3C5JA 4BSVB 1TZHA 1OTSD 5C0CA 4AL8H 2IF7A 4NWUH 2X70B 4OSUL 1A7BA 1DUZB 2XOTA 2UWEE 2Q8BH 1OGAB 5FEBA 3EJYC 1ADQH 2UVEA 4MXWL 1GSMA 2OI9B 3SQBA 3MRQA 4F58L 4WHDA 2NLJA 2CIIB 1KN4H 2NW3B 1FN4B 2XTJE 4U6TA 5DK0B 4QXGH 3P73B 5IW1B 3LRSA 3MUJA 1IVLA 3STZB 5D2NB 2OSLA 1MIML 3MRJA 3G5ZB 4LLQB 3WBDA 1INQB 3RZCC 2N4IA 4X6CF 5DJ8A 2OZ4H 1YEFH 2O61B 1YEDA 3ARTA 2GTZA 2Z35B 4HS6B 2HKFL 3LS4H 3RWCB 1RZKL 4KROB 3H9HB 1YY8A 3MLTA 5I74B 4WV1C 5L8LB 1KC5H 5ICZB 3EO9H 4JDTL 4QCIA 4XH2B 1S7RA 2HLFC 5DFVD 5DHYA 5E1AA 2V2TB 4PJCF 3PIQB 4G7VH 2HVJA 5JHDB 1EFXA 3IT8D 4HK3J 3HA0A 1IKNC 3VWJA 3MACL 5KSUA 3HMXL 1FNHA 3V79C 3K8KA 5D72L 3ULVH 3ZDYF 3BEVB 3C6LC 4NGHH 5CJQL 3V6OA 2AGJL 4M00A 4DKAA 1BFOA 1R3KB 4NKOB 3GJFH 4NNYA 2Q8AH 4YX2H 1MJ7L 3WO3B 4BFIA 4O00A 1IQDA 3JWDH 5DJAA 5ALBH 1RD6A 1M7IB 4LPWA 1HKFA 4DAGL 1GHFH 3RNKB 1U8IA 4JJ5A 1F3RB 1A0QL 1FL5A 5K59E 3KPNB 4ZAKB 4QOKE 5DQ9B 5DK0A 3UTSE 1G0DA 1B2WH 4DEPC 3V52L 5MP6H 2X4PB 3JTTB 3Q5OA 1LDPL 3IU4H 1FNAA 3KDMB 4K3EL 4WTZG 5D2NA 2EIEA 1MCRA 2ZCHH 6FABH 4JR9H 1B6UA 4FQLH 2QADD 3QULA 5I8KH 5HGDB 1I7RA 1RZ7L 2PO6C 4KJQD 3REWA 1JWMB 2XZCH 5BVPH 5I75B 2AEPH 4EN3B 3LQMA 2YN5A 1FYHB 3HS0A 2DQJH 2QTEA 3HC3H 5FDYA 1KLUB 1SY6H 3CSGA 1CGUA 4B53A 1FIEA 3WXVH 3NA4A 1GPOH 3L3KB 4JM2F 3N9GH 2DLIA 1HHJB 3PP4L 5TGBB 5C0CD 4M7KL 5M7QA 3DX6B 3VRLF 3SDXA 4G9DA 5DA4A 3JWNC 3RWIA 3S5LA 1OARL 3T3PE 3CU7A 4OT1L 1N59A 1NL0L 4Z0XB 2NZIA 1T2QH 2CIKA 2K7PA 5HHPB 4NDMB 2YUZA 1OTUC 4N0YL 4NKIL 3HG1B 5CP3A 5E8NB 1MIEH 1IM9B 3D1MC 3UMTA 2ERJC 3L3OA 4KK8C 3M45A 5ID0A 1U92B 2RFXB 1CT8A 3ZDXF 3B9KD 1MSPA 4PJEF 5L2KB 4BH7A 3NPSB 4OFPA 5B38G 5C0AA 3RNQA 3VFVA 2D4FA 4LGSB 4FQ1L 4Z7WE 4OZIE 1J11A 1R5IB 3IETB 4X6DF 1M7IA 3PWPB 3MO1A 2P45B 2VDKL 3FMGH 1WF5A 2QQNH 1MVUB 3PDDA 4WU7A 4ZODA 1PY4A 4TSCH 4NNPH 4TOYL 2PCPA 4P2QB 1CR9L 2X4PA 5DQDL 3JTTA 1BZ9B 5J7CC 1RQ5A 2WLZA 4GJTB 5IB2A 3SDAB 3D48R 4Y4KC 4JFFE 4UTAH 1KTDB 4H1LG 3BUTA 2XWBB 3QWOB 4S11A 3GMNB 3MXVH 3DX8B 3BAEH 5CHNB 2CRZA 1UXSA 1MHHB 3O6MH 4XGZB 4R3SB 4PJDE 3DTXB 5IMMB 3AGVA 3RGHA 4LLUA 1VESA 43CAB 2VAAB 5IFAL 5JPMA 1XGYH 4WI6A 1HHJA 1HYRC 4YHIB 2AERT 2EH8L 4K71B 4FRWA 4UDUA 3RA7L 1OGAD 5A43C 4YBLB 5DJ0B 2P8MB 1B0GB 5BQ7B 1CGSH 2X89A 3E6HB 1R3JB 4RBPH 5HHPA 2X7LA 2F19H 4NDMA 4J12A 4MA1C 2JIXB 3HZMB 5E8EB 3U46B 1ACZA 3HG1A 15C8L 1A4JA 1IM9A 4N0UE 3VW3H 5H94B 2QLVB 4UNVA 2R29H 2RFXA 4KMTL 4UILL 1QBML 1JYVA 4AM0B 1MCPL 4BKLA 3KS0H 3GSXB 2WWKO 1DBKL 4FZEL 5JIPA 1NQBA 5AZ2H 5JHLH 4JRXE 4L8BA 3VGEA 1KCUL 3EOAA 2QQLH 2WQRA 1YUHA 3P4NA 1U3JA 3U83A 4U1SB 3LHPL 1ZT7A 1GGYA 4KROD 4XP9L 3LKQB 4FQXA 1FE8L 2AJVH 2Y6SD 1I3GL 4FFZL 3TT1H 4K8RD 1LK2B 1WFOA 2OR9L 4NRYB 2W0LA 2W60A 1CK0H 3QFDB 1KCKA 1A1MB 3Q1SL 3O2VL 1UKTA 5I2IA 1RJLB 3GMNA 4C59B 4DGIH 5JHDD 4YE4L 4YDKL 5EO1A 2AK4B 1MAML 5ADOH 1K2DA 1QRNB 2Y1VA 4RAUB 3TNMA 3BKJL 5SX5K 2A6DB 3TIEB 2HJFA 2VDMH 3WFEL 4XVJL 4LP4A 5HVHC 1ORQB 5F9WC 1EH9A 2KL6A 4HJ0C 1TVDA 4LLMB 1PG7H 4DN4H 4JG0H 1HEZA 3EOYG 3QEHB 1FFPB 5BQ7A 1EHXA 3FT2B 3TT3H 4EI6B 3BPLC 3MV7B 5IHLB 4ZAKD 2HT2D 3BH9B 4KAQH 5E8EA 2VDPH 4KRNA 3FTGB 4XNZC 3UJJH 5HVWA 4FQCH 2DMCA 3QQ9D 4YWGH 5B8CA 1S9WB 2OMNA 1MJUL 4GRLB 5CWSB 4AM0A 1N4XH 1VGKA 4BA8A 4V2BA 3G5VA 2EYTB 2MWCA 3SGDI 4M1DH 4GAFB 4FQ2L 5I16B 4EN3D 1NCCH 5AWNH 2XYCA 4GAJH 1RULH 3FRPG 4ZUWA 1SHMA 2G60L 2VKXA 3TF7C 5F1IA 3GNML 4U1LB 5H37G 3V8OA 1JYNA 5C0IB 3RVXD 4TVSa 4M6OH 2QSQA 4UT7H 1RJLA 4QF1B 2P5WA 4CVZB 3K2UH 3UYOD 1DBMH 3V5HB 1D5IL 3BE1L 2YZ8A 4LSSL 4Z5RA 3B8SA 3HG1D 2GK0B 4PLKC 1QRNA 1IM9D 1T6WA 3MGOB 3JV6A 4FFVC 5CSZB 2ATPA 5T3ZD 2CXKA 5AUMB 2ZUQC 3AM8A 5L2KD 4QY8B 2CRMA 2AW2A 3NFSH 4P5MA 1LK3L 4PY7B 2V2XA 3KPTA 2DB8A 3T77A 3V95A 5C0RH 4X98A 3PWPD 1NFDB 2LAAA 2XWTB 2UWEF 4M03A 3QPQD 2O5XL 1IAIL 4GRWH 4HXAL 5I1CH 1CD1B 5LQBL 5GS0C 3IDNB 2PYEE 5TE7H 4P2QD 3FTGA 3RAJH 1U8MB 3IDGA 3MRFB 5I8CA 3GHBL 2HRPL 5F3HB 2AJUL 3SDAD 3BWUC 3BPCA 1V5JA 1S9WA 5HHXH 2YUXA 4F7MA 4D9LL 3IFLH 5IM7B 4NHCL 4BH8B 1OOAA 1HE7A 3TN0B 2HTKC 3ZE2E 1UM6L 3HLAB 3HZYB 2EXYD 1MH5A 2RBLA 5CKGA 1YMME 5E00A 3VFNB 2VN4A 3ZKSD 1NLBL 3AXLA 4JAMA 1OTTD 1OVZA 3QHFL 3QUMA 1MVFA 4QRUB 4Y4HA 3MBXH 1U8OB 2Z8SA 3KJ4B 4CRPA 2WW8A 2GJJA 5TH2B 2LU4A 4NHUB 1FZKA 5KVGH 5C0IA 1Q72L 3O2DL 3WD5H 3CDGB 1OGAE 2UZIH 4QF1A 5JXAL 2IG2H 3N85H 5C1MB 3IAGC 2WBWB 3V5HA 1CGXA 5KOMC 1G1CA 2JIXD 4HKXA 1RZJL 1BJMA 3T8XB 1D5BA 1KBGL 1NGPH 4Q6IC 4WGVB 5EZJB 4OKVB 3T0AA 3F8UB 2ZUSA 4FQXC 2ICWI 1UB5B 1FYTB 5KTEL 4JY6A 3MRCA 2H26B 3MRBA 3GMQB 4P5TA 1MRDL 4QY8A 3WXWH 4MJ4A 2Q20A 3OJ2C 4OM0H 3GSVB 1FZMB 1F11A 1FO0L 2XTLA 4OCYH 5FA3A 1IAKA 3T0EC 3K8LA 5GGRY 1MI5A 3QO0A 3WSQH 3OZ9H 4OLWH 1E4WH 4OLYL 1X5ZA 3NAAH 3U36A 2P5EA 5ECJE 1HXMA 1RUQH 3SO5A 5FHAL 1MRFH 3RHWK 5A2JH 2VLLA 3GSRB 3O6FB 3TBSA 5I1JL 2NR6D 5FUCE 4OTXH 5K59F 1QEWA 1MEXL 2ZG1A 1A7QH 4PJHE 4QRTB 3G08B 3VXNA 1GGIH 3LPWA 4H1LB 2B1HL 5GHWL 3EYFB 4CBPA 4BH8A 3CJJA 1CCZA 2AK4D 2IAMA 4TSBL 4CL7A 2VDQH 2WINB 5JHDE 4G6ML 1QRND 5FO7B 3VFNA 1DBJL 4MWFA 1YQVH 3RTQB 2RHEA 4M7ZB 3HI1B 2OJEA 1WZMA 4Y5XB 3U48A 3GO1H 1UM4L 3RU8L 4AEHH 1C7TA 1Q94A 3MRLA 1BD2B 4QRSA 3SEPA 5B8CC 2BFVH 2AEQH 2OL3H 2H2PD 4OUUB 3WNKA 1XF5B 5IEHB 5IOPA 1C8PA 3PDOB 3L3DB 4XCCL 2QQQA 3MV7D 1QSFA 1RJZA 4NC1E 3VWKC 2ESVB 3BKML 5TF1H 1T04B 5C0GA 4MMZC 1X3DA 4MAYA 4GRLD 2BC4A 5GS2H 3UX9B 4PB0H 1ZSDA 1ZHKB 1ULVA 4MDJA 5LGJB 3JV5A 4UU9A 4R8WH 4HKBA 2FR4B 3ZYZA 1JF5A 1F4YH 1TNNA 5GS0H 4GH7B 4OZIF 5EBMB 4Z7WF 3BGMB 4HLJA 4LVNC 1MLCA 3TYFA 5HDQL 4I48A 3OKLB 2SEBA 3O6FA 5TQ2L 4Y4FB 5EOCH 3RI5F 5CSGA 3FRUB 1M7DB 4G6AC 2JJWA 5IKCB 1G7HB 4H0GA 1IEBB 1JF6A 4M1GL 4Y16A 3S3SA 1T1ZA 3KPPB 4EUPA 3DO7B 4CVWA 2IJ0C 3QNZA 1FNSL 2ENYA 2H9GA 5FO7A 3BKCL 5JZ7C 1AHWB 4PJDF 4GRMB 4V1DB 1QZ1A 1EVUA 4A6YH 3QFJB 4HEPG 4P46A 2CKBH 5KOVC 1JN6A 1ODAA 2XKNA 1EBPA 4ETQB 3RY4A 1QFUH 1HH9B 1U2CA 5EPMB 1OSZA 3HNTL 2IBBA 3JV0A 5E2WL 4H20L 3KLHC 2XACC 3V0AC 5J13C 4XBGA 3PWPE 2MQCA 2HLAB 4G6KL 5FV1L 5GSRA 4XP4H 25C8H 5C0BA 2GY7B 2JTDA 1FL6B 4R4FL 4AEIH 4JFZH 4P2QE 5E4EB 4Y4HC 1TVBB 1OSPH 4CADA 3HAEB 5FM8A 1SJHB 2DD8L 4WRLA 3T0DA 1ETZA 3TN0D 1P7QA 2IAMD 4YHPA 5K9KA 1KEGL 4JM2C 1YA5A 5E08H 3T3ME 1ERNA 5C7XH 3ET9F 3C9NB 4Z95H 3EYUH 4PRIB 5ACZB 3KYNB 4N9GA 2B4CL 2VUYA 4ZQKB 4XPTL 2YC1A 2D7OA 1FV1B 5DEZA 2DDQL 1WAAA 4TRPH 4Y4FA 3V4VL 3FN3A 1KPVA 4DGVH 3O11B 2V5TA 4Z77A 3EO0A 4PJ8B 1SVZA 2F74B 4LFHG 3I2CH 3OKEA 1Q38A 2A6KA 3DO7A 3S34H 3L5XH 1KJVA 1SYVA 2DQUH 2GI7A 5HPMA 3UO1L 1S7SA 1FC2D 2R1WB 2IADB 1RJYB 4WU5B 4BZYA 1FYTD 2FZ3A 4GRMA 5BV7C 1FVCA 4B5EA 3UTZB 3WFBL 3MC0A 4LASL 1KNOB 2GW5A 2YKLH 3SDDA 1NFKA 1FZJA 2VZ3A 1INDL 2FX8H 3VGHA 5EPMA 4MXQD 4NYLB 1HINL 1EK3A 5I9QC 3LEYH 2FJHB 3VRJA 4PP2B 3U0TA 3LDBB 5CIPH 4WFFD 1AGFB 1T0NB 1XZ0B 3O6FD 4P9ML 4Z7UB 4ZG1A 5B39A 1N5YH 3LZFH 3OHXB 2H32B 2WUBH 5IV2B 3IS1X 1QP1A 1JGVH 1BQLH 3HAEA 2L4OA 1G6VK 2IBZX 3QB7C 3WLBB 3KYOA 1T7VA 5C86A 1FZOA 1YEGH 3D39B 1XR9B 3BVNA 1BBJA 3G5XA 3HI6H 4PJ9C 1TQCC 1KSRA 2AK4E 1V7NH 3O3DA 5ID1A 3RTQD 4O02H 3C9NA 2M26A 1VPOL 1RZ8A 5CZXD 2BVUA 4PJ7B 2AV7B 4YR6B 4I77H 1QUNA 2HFGH 2XZQH 1KYOK 1BD2D 2H1PL 4Q7DA 1BP3B 5GGUA 1DEDA 1FV1A 4O2CB 2ORBL 3IJYB 4F7TA 5TE6L 1U3ZA 2LTQC 5C2BH 1JI1A 1AD9A 4MDIA 5DUPL 1VSCA 1UKQA 3X3FH 5KVMC 1QQDA 4XT1C 4HG4K 3FQNB 4N90D 1J05A 4LAQH 3MV7E 5T3XD 2ESVD 4WFED 3OAYK 5DURB 5E2JA 4KI5D 1QFWH 3HMXA 4WU5A 5DLMH 4EBQL 4XWGH 1XIWB 4OZGB 1IJ9A 4U1NA 1MY7A 4HAFA 2A0LC 1JGLL 4I4WA 2AK1H 5GRJH 1DQLH 3UJIL 5D7KD 3CXDH 3C8DA 2XY2A 1YYMH 3KPMA 1A9BB 2YPLB 1VGEL 4F7PB 4KMLB 1EX0A 1TXKA 4YNYB 4XVSL 4Z7UA 3CLFH 3U0WL 4Y4FD 4OV5A 3L5WA 5CILH 3JWOC 5D7LB 2BY3A 4ZXBC 3KHQA 3RL1B 3V6FB 3NZHH 1KG0B 5KJRL 3FQRB 1AR2A 3T09A 1NC2A 4JKPH 1RZFH 3TZVA 4EVNB 1N8ZB 3KHOA 4GW5B 1KTLA 4LVEA 4NZTL 3ZE2F 4JO1L 3BGFB 3GSWB 4PG2A 4V1DD 5CGYC 3UDWA 2CK2A 2AV7A 4OV6F 3ALXA 1H8SA 4XXCC 3QFJD 2W9DL 4LCCB 1MY5A 2E6JA 4HPYL 2Y06L 4O2CA 3UTTB 4UV7H 3FOMB 1OW0C 4FTVA 1FNGA 5DJ2B 5DS8A 4LHQB 4X9FA 4Y19A 1XH3A 5T1KA 4LDLB 3T0BA 2KZ1B 1ZVYA 2VXVH 1NFDE 3GHEH 4HUNB 4J3XA 4JG1L 5BV7H 4KU1A 1IILE 4JFXB 2BK8A 5KW9L 1KJMB 4Z8FH 1RIVH 1A7RH 3GI8L 4LBEB 3DX7A 3SO3B 1AXTH 4YDIH 4I0PC 4NM4H 5EU6A 4EDWH 4K3JL 1Z9OA 2Q6WA 1W8NA 5FYLD 1NBZB 4Y2OA 5FO8A 4XPGH 1UVQB 4P59L 5E2TH 3CD4A 5DJDA 2AVGA 4PRID 4RRPG 5IB1A 2NY6C 4PR5A 1KFAH 3SGKC 4EI5B 1WIUA 5CBAB 3TCXA 2R23B 3VCLA 2R4SL 4F7PA 1IAMA 4ONOA 3DVGB 1ZGLP 1GJIA 1A22B 3F7VA 2I07A 4L29B 2V17L 2QQKH 3BOVA 2Y5EA 4PJ8D 3FQRA 5DO2D 2MHAB 1E27A 3FQTB 3ILPB 4PJHF 1JZ7A 4M48H 1KCLA 1EXUB 3QP3A 4EVNA 2WWKT 4RWYH 3NA9H 1A3RL 2DLGA 3BN9D 4U31A 4I18A 4X7FC 1WBXB 1J10A 1T1YB 3CFEB 4UUJB 3DGGB 4GMSL 3ZYJA 3DSFL 1FYTE 3MROB 3F5WA 2VISB 5BOPA 3V4UH 5FECA 4ZOBA 1SBSL 3WIFA 3UTTA 5FV2A 4OIIH 2AEIT 3FOMA 3EZ8A 3VFRB 4HAGA 3NFPB 5DJ2A 1NCUA 3RP1A 4OKDA 1A7PH 2XTJC 1J8KA 5DHVH 4TSAL 3QNXA 4PB9L 3RX8A 3EGSA 2VC2L 4WFFE 1CXEA 5HHVL 3QT2A 1ZGLB 4FG6C 3QUYC 4MNGB 3QQ3A 4TN9A 3MUGA 4QLRA 4NPYB 5EU3B 4XP1L 1K8IA 4JDZA 3D39D 4H0IA 1MFDH 3CAFA 1OQXA 1NKOA 1SJEA 3T2NH 1JPTH 1UVQA 2P7TB 3NCBB 3MFFB 4ZS7L 3QCVL 1FQ9C 3ZTJH 4FQHA 3JWOH 4QTIL 5E8DH 1BD2E 3QUKB 4KRPC 1YMHB 5DJZB 2AJSH 2Y4SA 2VZ1A 1BVKB 4HW6A 5T1KD 4K94L 1MJ8H 3AS3A 3FHQA 3QO1B 4PJXB 2DQDL 5A2FA 4YGVA 3CH8A 3HCVB 1FL3A 3BP5B 3IFNH 4JDVB 2LVEA 4OLXL 4RMTA 2DLHA 4N90E 5DURD 3GBNH 3QIWB 2ESVE 4O5LH 3QCUH 1T1YA 3NABL 1XIWD 3DGGA 3OXRA 5TQ0L 2QSCL 1JWSA 5CBEA 2IH3B 3DYPA 2Q76B 1B0WA 4JFOA 2VERN 1IL1A 4QXUH 4ZFOB 2KKQA 2FX9H 3ARGA 3CFDB 4NWTL 5D7KE 1B0RA 3O8XB 2YPLD 2BCKB 5D7IB 5KAQG 2FEEL 5DEFB 1S3KH 4BSWA 5IT2L 4RGNB 4R4NC 1L4IA 3F6IA 4PG2C 4PJAB 3KPRA 5C3TA 4OCXH 1EHLH 2UUDH 5BW7A 5D7LD 3FQXB 1X4YA 2G9HB 4NPYA 5CP7B 1HZHL 4Z7NE 5EU3A 3CDYA 2YPKB 2FEDD 3QPXL 4K3HA 5EBLA 1TETL 4J3UA 5IWLA 2ADIA 2K9UA 4KJPC 2HG5B 3GM8A 2O5ZH 4LQFL 4PRPE 3VXRA 1IZJA 2E6PA 2YOCA 3VU2A 3WJJC 3UZVB 2E8ZA 1TPXC 3I3DA 4UT6H 1OAKH 4XHJC 5D70H 1C12A 1I8KA 2F58L 3U7YL 3T3MF 1G0XA 3QCTH 1P1ZB 4IRZL 5D8JL 3O4LA 2NY7L 3BP4B 1S7QA 2ZJSH 3GJEB 4V1DE 2IPUK 4WI9A 3C08H 4OI9A 2FBJH 3UTTD 4X80H 3PV7A 3QFJE 4UQ2A 1SEBB 4WFGD 3EYSL 2ATKB 4JREC 12E8L 1BVKA 2AKRB 2OBGA 1QFWM 4FXKB 2CDEB 4MXWH 1E4JA 1KLGA 2DMBA 3TBVB 3HCVA 3JUYA 1NMAL 4JN1L 4M62L 4Q9QH 3I9GL 1QR1B 3QIWA 2QEJA 4PGDB 1IMHC 3GIVA 4APQB 3P11H 3I6KB 2OP4L 3MBEC 4L4VA 1GYAA 1FNEA 1JTPA 3H9SB 3AMKA 1XCQA 1DANT 5F7HA 4HWZB 3U2SA 3HRPA 4OGAC 4NZDA 4U6YA 1M05A 3CFDA 4N9OB 4NO2A 4JQXA 3SY0B 4EI5D 1Z9MA 1PZUB 4PRIE 4KJWC 4NUJB 1YDPB 3OF6D 1YNTB 3AMLA 5IESH 3L9RA 4WI4A 3TBYB 1P5VA 2NZ9D 4LEOB 1CFSB 1MFEL 3FO2A 1OB1B 2NY3B 1N5AA 1VADB 5IVXA 3Q6GH 4MHHG 4OZHA 2CJUH 4TUOB 4XCYA 2R4RL 2VR5A 1MCSA 2E9BA 2DQHL 5DD3L 5CAYB 3I50H 4HH9A 1T6VN 4JFQB 3QUZC 4GQPH 4XNQA 2Y25A 3WHXA 4EDXB 4F3FA 1DLFL 4KTYA 4O2EA 1LO5A 2P8PA 4ZFGL 2RJMA 1R5WB 3MNWB 1DFBL 2AJYH 1JBJA 2GEEA 5D72H 3L3HB 1KIQB 5IMLB 1IAOA 3LN4B 3WFDL 4CDGC 4ISVB 4QRRB 3QQ4A 1MJ7H 1U8LB 3N1MC 3BDYL 3UC0L 5E94B 5GGSY 2MCPL 3DV6B 2FHBA 5EO0B 3O2DA 4POUB 1ZVSA 4XNXL 1WC7A 1T1WB 1JHKH 5I15L 1T83A 1ZHLA 4PJFE 3VXSB 5I1DA 2FJFA 2HTLC 3GKWL 1U6AL 1O0VA 4JY5H 1PD6A 3JVGA 3VFGH 4Y1AB 1NSNH 1J8HA 2B1AH 5IP4A 1LDPH 3O3BB 1JK8A 1YEJL 1RUAH 3I6KA 3T2QA 2NCMA 1EO5A 3QZWA 4C4KO 2EDHA 1EEZA 5HPOA 1IGTB 4GLRI 1FO0A 2ARJQ 1G7QB 1FAIH 1QLFB 2PW1B 1K85A 1HHKB 4KKLC 2NTSP 2HA1A 4Q9RH 4PJ7E 4TUJA 1YNTA 3CFCL 3IFPB 1TZIA 2EIBA 4WI3A 1PEWA 3CIQA 1H3WM 1OB1A 3H42L 4JZJB 1VADA 4I8DA 4JCLA 2H3NA 3QDJB 4TUOA 1F3DH 1OARH 2DOCA 4KTDL 4RISH 1DANU 1NCTA 4YHKL 3C09C 2JJTC 5ISZA 5LXGL 4G9FB 4NKIH 3QIWD 5FCUH 4X4ME 5HYSB 4PRDB 5I71C 5IEKB 3MNWA 3TYGH 1MCEA 4YXKH 3WS3A 1ZHBB 1W72L 4L4VD 1IGIL 4OZGE 4GQ9L 3VXUB 1R3IH 2Z8WC 1A6TA 4K3DL 3CVHH 4ISVA 1AFVL 1G9NH 1U8LA 1CFNA 4FQ1H 3CFKB 4HHAA 5EO0A 5I1GH 1DTUA 5H2BA 1T1WA 3O8XD 4M6MH 4GT7A 5FF6A 4ONFL 2VDNH 4G7YH 5FM5O 3MR9A 1NFDF 2YPLE 4RGND 3TPUA 4QGYA 5GGVL 1Z6JT 3ARFB 2JCCB 4OF7A 5FXCH 4TOYH 4F57H 4JE4B 5ILTH 1NUNB 1R0AH 4JFEB 4NJAH 5JA9A 3CSYB 4RFNC 1H3TA 2QADC 5D7LE 2VLJB 3SOBL 2FIRT 4UMGA 2BRQA 3TJHD 3VDAA 2BHYA 1KIPB 4PTTB 2DIJA 4R0LA 3OAZK 2BVEA 3K80A 2A77H 3LEVH 4M1CD 4D0BA 1G7QA 2A2QT 5E6YA 2PW1A 4LAJH 1Z9LA 1HHKA 1EJ6A 2X2YA 3E2HB 2X4TB 3KPSB 5ANMB 3C8KA 1ZLUK 5DRNB 4LRNL 1Y6KR 3FB5A 3MRGA 5B4MD 5HGHB 5LKNA 4F15C 1IGJB 3LD8B 3UTQB 3O2WL 4I13B 1J5OL 4NBZB 3STLB 3SQOL 3T0XA 2ED7A 4NZUH 1F6FB 3I6GB 4L9LC 2J7LA 4L4TB 2BVOB 1T7YA 1BFVH 3BQUB 1QNZH 3B9KC 5HYSA 5IEKA 4OFKA 4PY8I 2AXGB 4APQD 1NUDA 1YN6A 3VXUA 3UJTL 4LCUB 3T0VA 3ZE1E 4M7LH 3ULSB 4MA8L 5GS1A 1KCUH 1RUKL 2A9ML 4PS4L 2R2BB 3CFKA 1FLRL 2YRLA 4HS3B 1MUJB 2HVKA 4NRXA 1FE8H 1IKFL 4JHAH 4LCYA 4B7IA 5DJXA 4W6XB 1X5FA 1T5XB 1I3GH 1TCRB 3VXMB 1YPZA 2NY3D 4FQIL 4FFZH 1IQWL 3VD5A 2GUOA 1FG2A 1D6VH 4IMLA 5KSBB 4H26A 4LIQL 4OM1L 2PXYB 2NXZC 2F53B 3BT2L 1BIIB 5B21A 3I02B 4LHUG 4YDKH 2NXYB 5DRXB 4GW4B 2L7UA 2VL5A 4XAKD 4OD2A 3L6FA 1T83C 3BKJH 5MENE 2M8XA 1BQUA 4YHZL 4HDIA 1TLKA 3ORJA 4JZNB 1RZJC 4LPVA 1A7OL 1EEQA 3WFEH 4XVJH 1G7JB 2IH1A 4QRRD 3MOAH 1YEHH 4XRCB 3D5OF 4CN1A 1H8NA 4F9LA 3IU3B 5EA0H 3NCFB 2OI9C 2DMKA 3DHMA 1RK1A 1NFIA 3RIAF 3STLA 4X7TB 3LAFA 3X3GL 1VCAA 4PUBL 3VXSD 2Z31B 5JIHA 1EFQA 3BIKB 4YEFA 3AAZB 3CC5A 4Y1AD 3U9PL 1G7MB 2E7CA 5I30H 2RB8A 1REIA 2B5IC 1G7PB 1FVEA 4PGZA 4MNGE 4KI5F 1SEQL 4GS7C 4LRIA 3PWUB 4P4RA 5C3LD 1XEDA 4P4KB 4Y88A 2ZSWA 5FKPB 3VFPA 2R2BA 4LOUD 1BBDH 4KUZL 3B9DA 2YD2A 5I74C 1MUJA 3DBXB 5FUCC 3MLUL 4YZFE 4K8RC 1ZLUH 3PJSA 2XA3A 2G60H 4X6FA 3VXMA 5E99H 3QDJD 3UZEA 2APTA 2FO1A 3UBXG 3MLXH 2ZOLB 5KSBA 1NMBL 3N1FC 4PYHA 5C9JB 4JY4A 1XF3A 4IRSA 4WNQA 5E6IB 2PKDA 1FJ1B 1S7WB 4PJXE 4Z7NF 4XPBH 5D1XB 3BZEA 1XT5A 3NN8A 5F7LB 4XVTH 4G9FD 4JPKL 3ECBB 4XNUL 3EKCA 2DJUA 4JHZA 3NGBC 2P49B 1S9VA 5DJ6B 2VZVA 3UYRH 3JUZA 3T1WA 4HPOL 2RCSL 4JZNA 3VXUD 2C3WA 3IKCB 4PV8B 1RHHA 5I0DA 2EZ0C 1Q9WB 3QSKB 1X5LA 4IOSD 4YDJA 4PRBB 1AC0A 3EDKA 3BYTA 4PRHA 4NC1C 4CAGA 3O3EA 5DT1L 3BIKA 3OBAA 5CD5C 2P48B 1NEZG 1EEYA 3GGWB 4XPAH 4WIQA 3FO0L 5D7IE 3D9AH 3ARFD 5L88L 4XCNB 5J3HC 2I9TB 4EIGB 4RGNE 2W65B 5L7XL 1J0IA 4M8QB 5CLTA 5JNYB 1VDGA 4LL9A 4PJAE 1I4FB 3BIBX 2VLJD 4KXZH 4LU5L 3Q5TA 4CW1A 3UROR 1JNHB 2EDEA 4D9LH 1J1XL 1F3JB 2YZ1A 5HGBA 4ZYKA 5I75C 3GUTA 2FBOJ 3B3IA 4H5SB 3MLSH 3TNNA 1FFOB 4WI5A 2AJ3A 4NM8H 3P9MA 1ACYL 2A9NL 2W0FA 4U0QB 1F90H 4UTBL 3QXTA 1RIUH 4G3YH 3BMWA 5FOJA 4Z76A 1Q72H 4RMQA 1HQRB 1I9RL 5GZND 2DWEB 1UH3A 1S9YB 5IMOB 1JWUB 2Y5TB 2EIZB 5D1XA 1MFNA 3UCRA 4L4TD 5DMIH 5ETUA 3BQUD 4GBXA 3HB3D 1ZLSH 5FFLA 1WBZA 1KBGH 1K8DA 5EBGA 2QKIB 5DJ6A 3PABB 3NPSC 1U3YA 3C60B 5GSVB 2IANA 1MRDH 4M7LT 3TIDA 4PV8A 3H9SE 3MZTA 5CLWA 2OK0L 2BP3A 5DQJB 1FO0H 1WTLA 1ZA6A 1AR1D 3ES6A 5KVEH 3LEXB 4PRBA 1NMCB 4KZDL 2X4SA 5CJXA 1JHTA 5FK9B 5CJBA 5H35B 2XNAB 1EHNA 4OGZA 3VXMD 4PJFF 1F00I 1J0KA 1WWCA 3WNNA 1MEXH 5IFJB 5EORL 3RWDA 4PV9B 1YY9D 4JO3L 2PXYD 1B4RA 3KYMA 2F53D 1JNHA 4HSQA 1FORH 5DUBA 4F9LC 5I66B 1PW3A 3LKSB 2NXYD 4G8IB 4OF6A 5LBSL 4TSBH 4H5SA 4K8RH 3UTOA 1OTTC 4L4JA 1I1CA 3W2DH 4WTZA 3QA3A 3TA3B 4QHNB 1LE5A 1KXTB 1PKQA 2Z93B 3MXWL 4LCIL 4OZ4A 2CGRH 4XAKE 4YUEL 2DBJA 3Q6FA 3WIHH 1UM4H 4K71C 3G6JA 1GC1L 3WKNA 4PJ7F 2EC8A 2VLKE 3QEQB 1T0MB 1H3PH 4P2OB 4TPRH 4QRRE 4JO4H 1HQRA 4KPHL 2DQEL 3QJFB 4LRIC 1AO7A 2YD4A 4X6EB 4D9RD 3L7EB 1KJ2B 2Y5TA 1UEMA 2B20A 4CMHC 4M6AA 3VXSE 2OTPA 5DC4B 2IQAB 2I27N 4E5XB 3MNZB 2VQ1A 4MJIB 4Y1AE 3K7UA 4HKZB 3DRQA 1K4CA 2AJXH 2ZPKL 2WUCH 5D5MA 5IBUG 3WFZA 4Q97A 4OZGF 4LGPB 1PVHA 2VIRA 2R0LL 3LQAC 2ZCLL 3LEXA 1JRHL 4R9HA 5HHOA 3EDJA 4GKZB 4IRSC 3V0WL 1QLEL 1A64A 5ADPH 3P77B 5F7KC 4UI2A 5L6YL 2NR6C 5HDQH 3FQWB 1O7VA 4M02A 5B38A 3WE6B 2VLMD 4WI2A 4OGXH 5TQ2H 5KANG 1C16A 3DI2B 3QDJE 4ZUUA 3RRQA 2EDKA 1ZTXL 4M1GH 1LO4L 5E6ID 2CSPA 5D1XD 2F8OA 5CJ8A 3BWAB 4G8IA 4LHUB 3GMPB 3VA2C 1UWGH 2HKHH 1GAFL 4FP8L 3G5YB 4G9FE 4KGJA 2ARJA 3QHZH 1KCRH 3TA3A 2WP3O 4HJGA 4AL8L 1JFQH 1N6UA 4NWUL 3H0TA 1DZBA 3DURA 4F33A 4LDEB 4F7CA 4RDQG 1EPFA 1HQ4A 1T0MA 3A6BH 1ADQL 2YD5A 5F7YC 5K9OB 5DEGB 1FC1A 3VH8G 2BSTB 4QXGL 5C09B 1T1XB 4KQ3H 3IF1B 1QO3B 5DYOB 2JCCE 4GRLC 5F7DA 3R8BB 5F93C 3OXSA 4J7RA 43C9A 2CO7B 3K1DA 1FIGH 4JFEE 2OZ4L 5JDSB 1YEFL 2Q7NA 3WNPA 2VLJE 4HIIA 4UOW0 2R1YB 5FGSA 4R7NA 1QRKA 3VGDA 1WICA 32C2B 3VGGA 3ZE1F 3LS4L 3ZDZE 1BQHG 2Q7YA 1A9EB 1DQJB 3P77A 5TDOA 2VDLH 2DM2A 1KC5L 1CL7H 1MWAB 3EO9L 3KPSE 4PJIB 2E7BA 3FQWA 4HIHA 1B4JH 4GBXC 4XPTH 5DRZA 3OG6B 1I1YB 3CDCA 4OLZL 7CGTA 5F88A 2DDQH 2E9JA 4G8EB 4L8CA 4O51B 3N50A 4YBQD 1AGDB 3ZHDA 4MD4A 2F9BT 3EOTH 1N3NA 1RV6X 3CH1A 4KY1H 3FB8B 4U1MB 3W82A 3H2WA 4Y5YA 2CKNA 3B8YA 3C5SB 4NQXA 4ODUB 1X6LA 5CJXC 5K33A 4L4TE 3IDMB 4M5YH 1DN2A 4OFVA 5TDPB 3C60D 2Q8AL 5AD0A 5EZLA 2PR4L 3MJ8B 2ZUTA 4KDTC 3MOQA 4U6XA 4XTRD 3JWDL 2EDLA 2VTFA 5ALBL 3EYVB 5FOBB 2B39A 4M5ZH 5J11B 2XT1B 4UB0H 1GHFL 5C08B 1F4XH 1NBYA 5K9OA 3GSNB 2R0WL 3P4MA 1T1XA 5MP6L 3IU4L 4ZO9A 5BS0B 2YA2A 1XF4B 4DK3A 5F7FA 2VDRH 1NGZA 4ZS6D 1HWGB 2ZCHL 6FABL 1J12A 2VN7A 5IROA 1CTNA 4FQLL 1CYGA 3LQAH 4WW2A 5JDSA 3D18B 5I8KL 4J1UB 4CN4A 3IDYC 3OL2A 4U1GC 5T1MB 5ENWB 2R9HD 1YNLH 2R1YA 2XZCL 5BVPL 3SCMC 4O4YH 2AEPL 2BERA 1S9KC 1JYXA 3TA3D 2DQJL 4XZUB 3MJ9L 4OLUH 1SY6L 4NUGH 1GPOL 3N9GL 1CE6A 3HE6B 3T4YB 5SWQB 2E9WA 2X40A 2NMSA 5DMGD 4YZFF 1RY7B 1UB6B 1I1YA 3OKKA 3QEGH 1JGEB 3QEQD 2VITA 3I6LD 4EXPX 2C7UB 3CPLB 3GB7B 4NNXB 3RIFF 3L7FB 5J4MA 1T2QL 3I84A 4RNRA 3CGTA 3BPOB 4Z78A 2DWDB 2PTTB 2W9EH 2DF3A 4C4KT 4YHNA 3MMEB 3VXTB 4D9RE 1MIEL 3MODH 1H0DB 3MA7A 4PJXF 4YK4B 1QHPA 4ODUA 4MJID 2IPTH 4YFLI 5DDHA 3IDMA 5EC1A 5TDPA 1SYSB 3G6AB 2XZZA 4EBQH 1JZ6A 1PEZA 1WFNA 3SE4A 4E41B 4MXVE 1RPQA 5HI3D 4ZUSB 4MXQC 4XI5D 4IJ3B 1NC4A 3AU1B 4DUVA 2BY1A 3UJIH 3VFTB 3DYOA 2QQNL 1QSZA 5CS7A 2FJGB 4TSCL 5CMAB 2HN7B 3D2UB 3T65B 2FYYB 4OZFB 4MJ6A 1ZLWH 2D31A 4UBDC 1NCBL 1TJHH 4QYOA 3TWCH 3FO9B 5D7IF 3JSSA 2VLME 3X12B 2B8OT 3PL6B 3ZTJG 3MXVL 4PJAF 1I1AA 5EU5A 5KJRH 1MCCA 1U93B 5D9SA 4U1KA 4ZSOB 4LHUD 5F6IB 3FONB 3U82B 3TP4A 4Y5XC 3L5IA 1HCFX 3JTSB 2ARWA 1LEGA 4JO1H 4I0CC 1DUYB 1URLA 1XGYL 3DV4B 4HIEB 2QBWA 2W9DH 2WBJA 2WWMD 4R97C 2NTFB 3LH2H 5E2VL 2X4UB 2ICCA 4ACPA 5IB4A 1FPTH 5JW3L 3WMSA 4U3XA 2ZWLT 4IIQA 2F19L 4TNVF 1CN4A 1P4BL 1G6RB 5TDNA 1LILA 5EC2B 2DWDA 4MNHB 1BLNB 5C09D 5BMFH 3ALWA 1N6QH 3VXTA 2X44D 1FNLA 3VW3L 1J7VR 1E4KC 3LKRB 4MVBC 1RFDL 2D7NA 2H2SD 2V5RA 3OJMB 1AQDB 3RBSA 3RBGA 3C6SB 3DMMC 1P4LA 5JHLL 1CXLA 3MRHB 3C5ZB 1U41A 1ZV5A 4K07A 5BRZB 1IGYB 4U1HB 2QQLL 5IIEA 3AU1A 2Y7QA 2M2DA 5E5UB 5F72S 4P59H 1A47A 3MLRH 4OCMC 4MJ5A 2AJVL 5IB3A 3DRTB 4Y5YC 1NDMB 3T65A 5D1ZA 3MRMB 1T4KA 3TT1L 3IGAA 1F02I 1CK0L 4M6NH 2E8YA 3FO9A 3T4AB 3B43A 2VZOA 3L3JA 4TNWF 1AIFB 4OAWB 3RWJA 4DGIL 2V17H 4KC3B 4JVPA 4RMRA 5INCA 5EG6C 1A3LH 1IAII 5ADOL 2N7BA 4M9OA 3QUXB 1PSKH 1AHWC 2WBKA 1A3RH 1ZAGA 4PBXA 3NH7H 1UWEH 3JTSA 1EMTH 4X4YA 1C08A 4MQSB 4Z6AT 1QBLH 1KCSH 5HYQB 3GMRB 3DETC 1JI2A 4GKNB 5D7SL 1LE9B 5KVDL 1SBSH 2GCYB 1PFCA 1PG7L 4JG0L 4ESKA 4PTUA 4JFPB 1XFPA 5IROC 4O9HH 5C08D 1VKXB 3BZ4A 4R2GB 3MYJB 4MD5B 3TT3L 2D7TH 3FN9A 4OLVH 3PG2A 1DE4B 3RUGA 1VHPA 4LMQI 5EB9A 4KAQL 1BLNA 2VDPL 2Q3ZA 2Z92B 3UJJL 1BAFL 4FQCL 5BS0D 1T3FA 4ZDHA 4O2FA 1HHHB 2E9IA 1N4XL 5L0QC 4XHQA 4XP1H 4HCRH 1A7NH 4M1DL 4N0CD 4U1HA 3IVKB 3F65A 2VLRA 5AWNL 4GAJL 4R96B 2NX5E 1OT2A 1RULL 1SJVA 3KPOB 4G80B 4HX1B 4N8VG 2XV6B 5KS9B 3X13A 2BY2A 3BFOA 4H1LH 3HE6D 3DRTA 1BQSA 4RAVA 4OF5A 4QHLA 3FB6B 4FZ8H 3AY4C 4FMFA 2D7MA 5JR1H 4M6OL 1OGTB 4PPTA 4PJ8C 5DO2C 1HK6A 1JF1B 1ORSA 3QEQE 4OAWA 4UT7L 3WFHB 4C56E 3HUJA 5C71A 3I6LE 3O45B 1KT2B 1QD0A 1Y6MR 3LSOB 3O0RH 4KHTH 4YQXH 3BN9C 2DQDH 3CFBB 2X1XR 3CZFA 3QUXA 4OLXH 4M3JA 4LLVB 1HYSD 4ZFFA 2ZOKB 2H6PB 1D6EB 1P53A 4MJIE 3L3IA 3WUWA 3LN9A 3NABH 4NRZA 4KVCH 3RVUD 3NFSL 4LVOB 4E41D 2QSCH 4KGLA 1LNUB 5C0RL 2GCYA 5I1AA 1PYWB 3HR5A 2D3VA 1EAPB 4PGCA 1ZT1B 5MENA 3LDBC 4P3CH 1I1AC 4Y5VB 4X5WB 1P9MA 3H9ZA 4XCEB 5I1CL 1T21B 2HP4A 3BW9B 4NWTH 1DE4A 1WBYB 3D2UD 2B2XH 4NQEA 1ES0B 3V5DA 5KSVB 2D0FA 3U4EB 4NOBA 3VXPB 5TE7L 4HUVB 1BGXH 1CLYL 3RGVB 3ARVA 4F7EA 5IT2H 5LG1A 2AXJA 2D0HA 4NO3B 5DD6A 3PL6D 5HHXL 3SKOB 1HHHA 3EBAA 3IFLL 3FJTA 2JCCF 1FBIH 1P4IH 4J8RB 1U58B 3L5JA 1KPRA 5BZWA 4HC1H 2GYSA 2IPUG 3VFWB 5HYEA 3OKNB 4R96A 2WK2A 3GDBA 4IIQC 4G80A 5HJ3B 5JOFA 4ODSL 1H9VA 3ZL4L 1DSFL 3MBXL 1JZ2A 2O93L 2F58H 3SDCA 3U7YH 5D8JH 1HH6A 4YHOH 4ZNEE 2HT4D 3WYRA 1JPFB 4CVXB 4FNLH 4FQJH 3PV6B 4DVRH 4PRNB 1AQKH 1U8NB 4PG9B 4KK5D 1JF1A 2UZIL 3EYSH 4MQ7A 1IC4H 2DIAA 3Q3GA 4HS8H 4JLRA 2VE6B 1NGPL 5C09E 2J6EA 1XIWC 3BP7A 5CEZE 2X4OB 4M62H 1MHCA 1JMZA 2H6PA 3VXOB 3DECA 4S0TD 4B0MM 4D8PB 3WXWL 2HFFB 1YC7A 3SPVB 3C5ZD 1ZS8B 4OCYL 1MLBA 5BRZD 1NAMB 4L8DA 3SBWA 4YXLL 3OZ9L 1EAPA 4OLWL 5IVZA 1ZT1A 1YC8A 5MEQB 4GG8B 1A6ZA 4F37K 4XXDB 1P7HL 1WBYA 5BJTB 1Z2KA 4NSKA 3U4EA 3VXPA 5IJVB 2AS5M 5SWZA 4OTXL 3MUY1 2ICES 3BZFA 4I2XA 4PJIE 1KYOJ 2ADJA 1A7QL 4P23A 2Y23A 3DIFA 5CCKL 2FEDC 3ZT5A 3O4OC 1QSEA 1KIUA 3M1BA 1B9ZA 2YUVA 3PXHA 3ZMRA 3CVIH 5D1QA 3PHOB 4EOWH 2JJSA 5IW6B 5KSBF 3QUXD 4HG4J 5H37H 5IR1B 2GFBB 4X9HA 1DLFH 4OCSH 3GO1L 4G6FB 2K1MA 2R0ZL 5KN5B 2UYLA 4LCCC 2VSCA 4ZFGH 2A74B 4JCMA 2ZG2A 1VA9A 2A38A 4RA3A 5K9QI 3E1F1 3QAZB 5FUOL 4PJ5B 4U3CA 2BFVL 2AEQL 2Z9TA 2OL3L 4PRNA 3TO4A 2CO6B 1U91A 4HZLA 3UC0H 2MCPH 4R2GD 2GITA 4K7PY 4NQED 5C08E 3HC0B 3NTCL 3DUUA 4ZTPH 5E7BA 1NGWB 1U8KA 1QA9A 3LPGA 5I15H 2BOCB 2AJZA 1CFQA 3O3UN 5KVFL 3FZUD 5T1DL 5BS0E 2W92A 3S4SG 4NIKB 5HHMB 4PB0L 3CSPA 2HFFA 5J6HA 4KTEH 2XI9A 4WHYG 4MQXC 1JUFB 3P9LA 3VRIB 3D69A 1ZS8A 4XNMA 5FA4B 5DK2B 4M61A 1F4YL 1AGBA 5I76A 5GS0L 1A4KB 4MXVF 2H32H 3OJDB 3DGCR 2EC9T 1I75A 1RIHL 2FWOB 2VXQL 4R90H 5IQ9B 3LQZB 2XN9B 3ARBA 3BISA 1TVHB 2CLRB 1KENL 4NO5B 5KSAA 3L1OH 3CFCH 1H3VA 2JLLA 4WY7H 1R24B 3SKMA 4PJBB 2UZYB 3FQUB 3MGTA 2ICWB 3H42H 4WCYH 4X4ZA 5ALCH 1MHPH 2D7PA 3QWQB 1ZEAH 4MX7B 2IWGA 5ITBL 3E6FB 5IB5B 3TBWA 1J0YA 3M07A 4HUWA 5J57B 1CICB 5I8OH 4KTDH 4MAUH 4AENA 4LF3A 5C0JB 1F6LL 4HGWB 4S2SB 5EZIL 5JPNA 5ICXB 4A6YL 1JGDB 1P69B 3UPAA 2DI9A 2CKBL 1W72H 2MOVA 2E7LA 4RMWA 4I3RL 2DL9A 4GQ9H 4DCQB 4E41E 2GHWB 4HK0A 1BF2A 4D94A 3P4OB 4XP4L 1HCVA 5CGTA 1KIRB 4U0RB 3TV3H 1BF8A 1G0YR 3RGVD 3B9AA 1U0QA 4AEIL 2ITDA 1HHIA 3MLWH 1OSPL 1X7QB 2EYSA 4R6UA 2BMKB 5IHZB 3ROOB 2CDGB 1JUFA 5H8DA 5E08L 5C92A 4K3GA 5C7XL 4ZSOE 2CLZB 3OJDA 2XWJA 4Z95L 3EYUL 2ICWJ 2QSTA 1F2XK 1KB5B 2MPAH 5I8EA 5FHBH 2XN9A 3FT3B 4MNQB 4C83A 1EDQA 2BNQB 4TRPL 4MJ2A 1R24A 3OKYA 5E8OA 3TO4D 2C3VA 2X4QA 3Q48A 3LKPA 4FXGB 1FSKB 2I5YL 5DMJB 4RRPA 1BWMA 1PQZB 3SQOH 1F6AB 1L9NA 1XGPB 4PJGA 5D71H 3S34L 2YBRB 4P2RB 2DQUL 4NCC2 2VR9A 3B5HA 3GRWA 3NMEA 3WFCH 4ZUVB 1Q9OA 2BDNH 2EC9U 2WNGA 1NGYB 4YGAB 2EDYA 3VI4E 1S8DA 3PQYB 4NCC1 3F7YB 1P2CA 3W0WA 4P23C 4FABL 2FX8L 2E3VA 5BRZE 2OMBA 1GGUA 3LEYL 1ADQA 3FKUS 3O8XC 1FNFA 5EUKB 5C0FB 2A9MH 4FHBD 3S35L 5D1QC 4RGNC 4RX4A 1DQQA 1LO0H 3PWJA 2AXHA 2H8PA 3CLEH 1N5YL 3LZFL 1DLHB 1GOHA 5I73B 1JGVL 2VABA 1DBBL 1BQLL 5C07A 1GOGA 1X7QA 3H8NA 3DROB 4QKXB 2GAZA 5A16B 3ZHLA 1DN0A 5IHZA 3ROOA 4OJFH 3QIUC 2CDGA 1JV5B 2OZ4A 1FLTX 5BVJA 2ZUVA 1U3HA 3OKMB 2CLVB 3QEUA 1V7NL 1HOCB 1IARB 2NY4C 3D3VB 4O02L 1K5NA 3JXAA 4N8PA 3D0LB 4G6FD 4I77L 2A1WH 1HIML 5FYKD 1P7KB 1J88A 4JANA 2HFGL 2XZQL 5DMKA 5B4MC 3FT3A 4PJ5D 1U8QA 4PGEA 4YHZH 5JO5B 1JNNH 1VFBB 2FIKB 2R56H 3QXDA 5C2BL 3CXHK 1I3RA 2Y9RT 3OR7B 3HZVA 3X3FL 1FDLH 4K9EH 3W9DB 1PQZA 1F6AA 6CGTA 5JORB 3ARDA 4LAQL 4PUBH 5D93B 4X7CC 1Y18B 2BOBA 4G8GB 1QFWL 3B9VA 5DLML 1CXHA 2A6IB 4OCNC 4XWGL 4LSPH 5HHMD 3ARBC 3NACL 2G75A 2VKWA 3QDAA 5C0EB 5KSAC 1UACL 2AK1L 5GRJL 3MCKB 1ITCA 3GJFA 3N1PC 3LKNB 1DQLL 3I3EA 3KVQA 1SEQH 1PG7X 4HV8B 3CXDL 1LEKA 5F9JB 1Y0LB 2BNRA 5EUKA 4AT6B 4UDTA 5GRVL 2W07A 2XN9D 4GG6B 5EOTB 4LNRB 5KS9E 2A83A 3HZKB 2NY3C 3CLFL 4HUUA 2ITCA 1DLHA 5INDA 3RZCB 4TQEH 1BECA 5HYJB 2YN3A 3IXAA 3NZHL 1MCNA 5J9PA 2EEDA 5A16A 1UWXH 2E7LC 2XKUA 2BHUA 4JKPL 1RZFL 1NMBH 1GVIA 2NY5L 4RGMB 4BSJA 1CICD 1LP9B 3ESUF 3MOBH 4LQ1A 1T20B 2ZKHH 2BJML 3D3VA 3LS5L 3U9UB 2YHGA 1P7KA 1RVFH 4X99A 4Z7VA 1SY6A 5JO5A 4HPOH 1AGEB 2G2RB 1VFBA 4UV7L 4BM7A 4ZPTA 8FABB 1WEJH 3NCYS 4AIXA 2VXVL 3L5HA 3GHEL 3BD5A 5BV7L 3IAQA 3C6LB 1I1FA 2VZUA 1XGRA 2J1KA 2DKSA 4XC3H 4XP6H 4QRPA 4G8GA 4X8JA 1RIVL 1KB9K 1S78D 4P57A 1A7RL 3BUYB 4DQOL 1AXTL 1H5BA 4YDIL 3S4SB 5JXED 4XWOD 4JKLA 1Q9LA 4GAGH 5CZKA 1OWWA 4EDWL 5C0EA 2D4DA 4TVPD 3MCKA 1MAJA 1LEIA 5JDJA 4NBYB 4XPGL 5TPWH 2MCG1 2IALB 3ARQA 5E2TL 5L2JB 4RGOH 3RDTA 3PGCB 2FGWL 5MI0B 3V6ZA 3QNYA 4DEPB 1ZANH 1BIHA 1KFAL 3QI9A 5HYIA 4L5FH 3I75B 3G04B 4LCWB 4MNQD 1QTYT 3X14A 4JZJC 1ACYH 2A9NH 2BNQD 1U95B 2EKSA 2WAHA 3RZCA 4L3CA 5F89A 2QQKL 3S37L 4JO2L 2BSRB 4YBHA 3QWRA 2PO6B 5EUOA 1I3UA 4PJIF 4M48L 1A6WL 5T1LB 1BVLA 5F71A 4P2RD 3NA9L 1LP9A 2Q1EA 5EO9B 4D0CA 2UVFA 3MV9A 4N68A 2FEEI 4WV1A 3WLWD 5IG7B 2XZAL 5JIIA 2VL4A 3ULVD 1M6OA 5E0QA 3PQYD 3OKDB 1ND0A 3V4UL 4DGYL 3HNSL 2V7HB 1OP3H 4JZOB 1L7IH 1AGEA 4OIIL 1SJXA 1K4DA 1QFOA 3PE9A 2J8UB 2HMIC 5JTWA 1FAKT 1A7PL 3VE0B 1IKNA 2I60H 2XIDA 1D5XA 1HSBB 3VGAC 3P0YH 4GUPB 4YAQA 3C6LA 1UYWH 4MD0B 3FCTB 3J8F7 3R06B 1D7FA 2XRAH 3GSQA 1LO3L 2XFXA 3D25B 5AZEH 4IMKC 2JK5B 4EQ3A 4BJLA 1WFUA 1GZPB 1S5HA 4AIZB 4NKDB 5EORH 4RSVA 4JPVH 4K7FA 4JO3H 5F1KC 1JPTL 4JHWH 3EO1B 3AUVA 1BZ7A 3D3VD 4WW1A 3E2HC 5LBSH 4DUXA 4CMMA 3KLAB 5A2LH 3FFDB 4WUUB 2C1PA 3L3GA 3I75A 3MRDA 3G04A 5FYKE 3MV8B 3C5JB 1TZHB 3LD8C 1QLRA 1A6VL 3SN6N 2BVPA 5EH1A 4YIQA 4PJ5E 2EH7L 3GBML 1SVCP 2AJSL 1TJIH 5JLZA 2PO6A 1MJ8L 2Y36H 4HFUH 2RQ8A 1WITA 5LGHL 2WIIA 2UV3A 2E27H 4UAOB 5BCAA 3MRQB 3IFNL 3ULUD 4G8GD 5EO9A 5F3BA 1G7LA 3GBNL 4O5LL 3LRSB 3QCUL 3R1GL 1MQKH 3GI9H 2F5AL 4ENED 2OSLB 3MRJB 3EJYD 5D7JA 5HHME 5DJ8B 3UZQA 5D2LA 2IGFH 1YEDB 5SV4A 4NT6A 4QXUL 2GQHA 4HIJA 2FX9L 2R1XA 1G7IB 2GTZB 4YH6A 35C8H 3ME0A 3GBLA 1HSBA 2R0LH 1JRHH 4AMKL 4D0DA 4GUPA 5FB8A 1QLEH 4Y89A 2VXTL 1YY8B 3MLTB 3Q2CA 1D9KA 3VD7A 3RZCD 1TMCB 5GISL 4QCIB 4OCXL 3DWTA 2LV4A 1S7RB 4NQDA 4HMDA 2DTMH 1VFMA 2PXYC 4PJBE 5DHYB 5F7WC 2LQRA 4DOHB 3W9EA 5EIIA 2NXYC 1EFXB 1CXIA 5GJSL 3IFOA 2O5ZL 2WQ8A 4MSWA 3VWJB 3AS1A 4UT6L 5D70L 5E9DE 5KSUB 4L3EA 1ZLVH 1IC5H 2ZJSL 2HLFD 1WT5A 1JHLH 3C08L 3HE7A 4ODXA 5E8PA 3OB0H 1KELH 2FBJL 1DVFA 4U2YA 4Y4KA 1JTOA 1BFOB 4NNYB 4X80L 1TITA 3PGDA 3AFLA 4POZD 2UY7A 1H5BC 4BFIB 1IQDB 1RHFA 5ESAA 5DJAB 1EHAA 1UXWA 2Z31C 3TH3T 4M9PA 3FT4A 2FO4A 1Q1JH 1JPSL 1U8IB 3C6LD 3RDTC 4JJ5B 1FL5B 4Q9QL 1CE1H 3PDGA 3QISA 4Q9CA 4NZRL 3CCHA 4ZOEA 3QI9C 1A8JH 4K2UH 4YHMH 1BREA 4ELKB 3P11L 5HDOA 1LDSA 3PWVB 4Q9BA 3BRFA 4H25B 1ZGLM 3EFFA 3VI4F 3AREC 3QULB 4XX1G 1S7VA 4P4KC 4TVPE 3OV6A 1I7RB 3BPLB 3REWB 3BGAA 2QHRL 1G7IA 3DXAA 3MRKA 4XNZB 2LU3A 1TZGH 3VD9A 3HS0B 3VFSA 3FN0L 5IESL 4LCWD 1G9MH 4HD9A 3C2SA 4W4OA 3D87B 4N0FA 4ZPVA 4MNQE 4QXWA 3VD3A 3Q6GL 3SDXB 4S1SL 4G9DB 2CJUL 2PO6D 4J4PC 3RWIB 3S5LB 4OLZH 5J89A 3I50L 5CD3A 1N59B 5T1LD 3ZKMC 3PP3K 2AXFA 2CIKB 3KNBA 3RWEA 3BJLA 3ZTNH 3NCCB 4JVWA 4R4BA 4P2RE 4BFEA 2AJYL 2GTWA 1OWRM 3L3OB 3OAUH 5ID0B 1CT8B 1EZVY 3PQYE 4BH7B 4L8SC 5DJCA 2R2HA 3VFUA 1J87A 5C0AB 3RNQB 2PR4H 3VFVB 4HMCA 1OTUD 1NDGA 4AQOA 2FL5B 1JHKL 3MO1B 4N1EA 4RDQF 4CNIA 4KK8D 1AXSA 2XQBH 4WU7B 2DRUA 4JY5L 1WLHA 3VFGL 1QOKA 1NSNL 2PCPB 2R0WH 4XPHH 2B1AL 4M4PA 3MJ7A 4ELKA 3LPFA 5CUSH 5J56B 1RUAL 1P84K 5IB2B 3PWVA 4H25A 1A2YB 4YJZL 3LB6C 4M3KB 1FH5H 5DSCA 2OM5A 1UXSB 2I9LA 1FAIL 4GSDL 2IFFH 3FFCE 3S35X 4LLUB 4WUUD 3LN5A 4Q9RL 4LVHB 3ILQC 3MJ9H 1CDIA 5E5MB 4OD3L 5GQBA 4Y4KD 3MV8D 5JPMB 5ESQA 3QXAA 2COQA 4ELMA 5KS9F 2OCFD 4C57C 3RKDC 4UDUB 2XXMB 4LHJB 4B41A 3M8OH 5D7JC 1C5DA 4RISL 2X7LB 2RIKA 3C2AH 2G5BB 2X1QA 5FCUL 3ULUE 3CZJA 1A4JB 3U6RA 3TYGL 4YXKL 3C60C 2DJ4A 1CLOH 5F1NA 5DVMA 3UBXA 2YR3A 1D9KC 1NANH 4KHXH 4BKLB 4DJMA 4F8TA 2BHZA 1R3IL 5D6DC 3D6GA 4GFTB 4XTRC 3CVHL 1G9NL 1D5MA 3KR3H 4WWKA 4L8BB 3EOAB 1EJOH 2OL3A 1YJDL 4RFEA 1YUHB 3P4NB 5I1GL 2FL5A 4Q6IB 5D4QA 1ZT7B 4M6ML 3EOBB 3HFMH 2VDNL 4G7YL 4FQXB 3ZO0A 2DYPA 1HN1A 4EZMA 5ACMA 5HD8D 4GG6E 2CUIA 4LLYA 4F57L 3H7LA 4ONHB 5ILTL 4NKMB 1NCBH 2W60B 1AP2A 4NJAL 1WT5C 4YPGA 1R0AL 3HE7C 4OBRA 5HYJE 1DVFC 5I2IB 1TJGH 3QQNA 2R9HC 5ICYA 1A2YA 5DFTA 1T5WA 4MB4A 1EFXD 4JFDA 5SWSA 1NEZA 5EO1B 4Y2DA 3VWJD 2A77L 3LEVL 1K2DB 1DQML 3TNMB 2RR3A 1RZIB 3T08A 3SGEH 2HJFB 2DJSA 5E5MA 3VDBA 2HYMA 4UOJA 4P2OC 3F7QA 4L1DA 3ZLQC 2BY0A 5E2VH 1DJSA 1HILA 4POYA 1N0LA 1CZ8L 3IB4A 4IOFC 5C6TL 1HEZB 3ARPA 5JW3H 4NZUL 4S1QL 2R0KL 1P4BH 5GGRA 4DWHA 4P9HH 2G5BA 1BFVL 2V5MA 1QNZL 1BX2B 3HPLA 3FB7A 4J3SA 3C87A 3NZ8A 5B8CB 4HJ0D 1RFDH 4YDVA 4P49A 5E24E 1MCLA 1T03H 4W4OC 4A6YA 2DLFH 1VGKB 3QDMA 3G5VB 4KKAD 4XI5C 2CKBA 4M7LL 1IEAB 4BZ2H 2E5EA 1I1RA 3CU1A 3VWKB 1RZGA 5DD0L 1LD9A 4Q6IA 1LGVA 5BXFA 3SE8H 3EOBA 4FFYL 2YSSB 4ZUWB 4JHAL 5ERWB 4LCWE 4KZEL 5F1IB 3CX5K 3EHBD 4ONHA 3WKMH 4NKMA 1D6VL 4WTXA 3V0VA 3T0EA 2Z8RA 3JBG7 1NGQL 4P5KA 3DSNA 2P5WB 4HJJH 2C4FT 3IRZA 4U2ZA 4Z5RB 4ODHH 5DJYA 3JV6B 5EULV 1RZIA 1W0WA 2ATPB 4AY0A 5CEYA 4WI8A 5MERB 1QFPA 3MOAL 1YEHL 4P5MB 5C0AD 3S37X 5ITFA 2V2XB 3T77B 5D7SH 3MRRB 4LLAA 1UG9A 5EA0L 4DKEL 4O58H 5KVDH 4UT9L 1M71A 2FGZA 2J8UE 3EJJX 3QIBC 4X98B 2XPGA 3SJVA 4F3FB 1GXEA 1CBVH 3WIIH 5JW4N 2HT3D 2H2SC 5B39G 4K23L 1BX2A 4OBSA 1P6FA 1LHZA 3AC0A 1BAFH 5I30L 3IDGB 5I8CB 5GZOC 1U9KA 4FS0A 3BPCB 3HAEG 4NQCA 4PD4K 4F7MB 4QHMB 1JP5A 5J13B 1MH5B 1IEAA 5E00B 3GMMA 2CD0A 1BBDL 4NFCA 3ROLA 4X6CA 3VWKA 3AXLB 2EE6A 4JAMB 4PREA 3IS0X 3QUMB 2YSSA 5CIPA 4Y4HB 4WUUE 4WHTA 4LPYA 5M94B 5ERWA 1MOEA 2Z8VC 5E99L 1YEKH 1FZKB 5CEXA 5C0CE 1N26A 3MLXL 3MRPA 2X89D 5JW5A 4ODWA 4PJBF 4XPBL 1JGUH 4UQ3A 4WWKC 4XVTL 4HKXB 3WN5C 4PJCA 1D5BB 3UYRL 1F4HA 2CXGA 3QDGA 5GRWA 4OI8A 1VACB 4JY6B 3MRCB 3MRBB 4P5TB 4XBPB 5MERA 3S88L 5HHQB 1F11B 4OFYA 4JRYB 5FA3B 3MRRA 1IAKB 5IGXL 4ZMAT 1MI5B 2OQJA 3QO0B 3MJ6A 3U36B 2P5EB 4M7JH 1HXMB 4FQXD 4Y2DC 3H3PH 4XPAL 2VXUH 3D9AL 2BNUA 2C4FU 5E6ZA 2WZPD 2VLLB 1HSAA 3UAJD 3TBSB 2C1OB 1CLYH 1QEWB 3SDYH 4QHUB 1PZ5A 1S7UA 3VXNB 4MCZA 4QHMA 4N0CC 2EDTA 4FQQA 3VH8A 4DOHE 1WFTA 2IAMB 1UQSA 3MLSL 3B6SA 4PLOB 2NW2A 1OCWH 1UA6H 3K8MA 3TVMC 4NM8L 1I7TB 4MWFB 4PY8J 1QPXA 2YRZA 3HE6C 1X6NA 2OJEB 4G42A 4ODSH 2APXA 3ZL4H 1DSFH 3GSOA 5SX5H 1Q94B 1F90L 1CFTA 4HWUA 3V6OE 3MRLB 1RIUL 4G3YL 4QRSB 4HWBH 5FYJD 1DDHA 4JM2A 1BQHA 5IOPB 1ZA3A 3BPOC 5FDWA 2CUHA 1QSFB 1RMFH 1KN2H 1RJZB 5DMIL 1HKLH 2FECI 1ZLSL 4MMXC 4LKXA 3NCJH 5C0GB 5J0BA 5KG9A 1VACA 4MAYB 4XBPA 5D2NE 1WCBA 2LTQB 2BC4B 1R5VA 3KXFA 5HHQA 1HXYB 4IJ3C 1ZSDB 1R3LB 3ULVF 4MDJB 2GSGA 4UU9B 2PW2A 3BHBA 4HKBB 5FIEA 1FFNA 4JRYA 5CEZH 5KVEL 4PJEA 5IVNA 3VWKD 3S6CA 4YXLH 3WS6C 5DVOA 1YNKH 4X7EC 4QRQA 1MLCB 3B5GA 3TYFB 1M1SA 2YS4A 1S9XA 2J88H 4I48B 2AI0H 4X6DA 1I7UA 2SEBB 2FSEA 2C1OA 3PL6C 3EFDH 3RVVC 1WZKA 4QHUA 5D6CB 3SDXE 2XY1A 4Y16B 4I0KA 5CCKH 1E4XH 1NAKH 3NFNA 3WEXA 1FORL 2J8HA 2P5WD 5F6IC 1T1ZB 2NY0B 4EUPB 3VMOA 3HI5H 2YD8A 4K8RL 3K4DA 3QNZB 3W2DL 2H9GB 1IGCL 5HHNA 1I7TA 3S96A 1WZLA 3SE9L 4YO0A 4G6AD 3RKPA 2CGRL 4ZO7A 1X9QA 3WIHL 2HT4C 2R0ZH 4JGJA 4KJYA 1VERA 4P46B 5I0ZA 4OFYD 5FUOH 1JN6B 1H3PL 1U8JA 2OTWA 2XKNB 4TPRL 4D9QD 5AAMA 4JO4L 5C0AE 2JB6A 1ONQB 4PJ9A 1OSZB 1RU9H 4PBWD 1JL8A 2OJZH 4XBGB 1PAMA 1A6UH 2VAJA 5GSRB 3NTCH 1CI5A 5BOZG 4QNPE 3BO8B 5C0BB 1EERB 4NCDA 3OR6A 4HKJA 5L9DH 3AB0B 2HJKA 5KVFH 4D2NA 3ULUF 4CADB 5T1DH 3C5ZC 2AJXL 2FD6L 3RWGA 4E9LA 1ETZB 1HXYA 2WUCL 1QFHA 3GSNH 1R3LA 4ORGA 1P7QB 4GW1A 4X4XA 1ZHNA 4KK6C 4YHPB 5K9KB 3N1QC 3O9WA 1RJCA 2DQTL 4X9BA 3WUZA 5SX4H 5ADPL 3HMWH 5DHVA 3GZKA 2NYYD 4Y4HD 4N9GB 1RIHH 2ADGA 3STBA 2VXQH 2Q86A 3CMOH 2YC1B 3EJZC 4OGXL 1KENH 2HFEA 4GG6F 1QACA 1KPVB 1KCVH 2IC2A 5D6CA 3J7HA 1OM3L 2VRAA 1JMXA 4Z77B 2DQFA 3EO0B 1CDHA 2F54A 5ITBH 3OKEB 2A6KB 1QHOA 2XXCB 4LSRH 5F8QC 1UWGL 2HKHL 1KJVB 1SYVB 5HPMB 2UZXB 1S7SB 3QHZL 1KCRL 3HG1E 5LGKA 5EN2A 1KJ3H 4OCLC 2EYRA 2FZ3B 4LDOB 5EZIH 4P5TD 1FVCB 1ROWA 1QPPA 4ZXBA 5T3ZE 1JFQL 4ALAH 5GXBB 1A02N 3SDDB 4PYGA 1YZZA 5L2KE 1EGJH 1FZJB 3A6BL 4JRYD 2Z91A 4JFYA 3KPLA 2VH5H 4I3RH 3W39B 4Q0XL 4WEBH 1KULA 1MI5D 5T3ZL 1ONQA 4KMQA 1BZQK 4J3TA 2NY1B 3H7BB 2P5ED 2R2EA 2D9CA 3VRJB 3U0TB 4KQ3L 3KWWA 5F7EH 3BO8A 4XXCA 1DBAL 5B39B 1L6XA 3NCEB 4N5EC 1D5ZA 3IXTA 4URTB 5B3JE 1CG9A 1FIGL 1OW0A 1OAYH 3KYOB 5IF0B 1FZOB 4EIZC 5E1HB 1AJ7H 4OZFH 3BVNB 1BBJB 3G5XB 3V9FA 4W6YB 3K74B 4LPCA 3O3DB 5ID1B 4LKCA 1ED3B 1CFVH 1PY9A 1LQSR 2VDLL 1RZ8B 2GJ6A 1BM3H 2NY5C 4GKSA 1CL7L 1B4JL 3DPBA 4I0PA 5GGUB 4OB5H 4HZAA 1KPUA 2DQGH 2IMMA 2V9TA 4F7TB 3VXQA 5FYJE 1AD9B 2I5YH 1U2HA 1Z0NA 4HMEA 3EOTL 4MDIB 1QSFD 4KY1L 1QQDB 4WO4C 4XMLH 4NBXB 1UZ8A 3MCLH 3SGKA 5HY9A 1J05B 1KV3A 1VEOA 4ZUTA 4HUMB 2B0SH 3MNVA 3RPIA 4M5YL 3ZKND 4M93C 5FM4A 3IDIA 4KRPB 2ZNXA 4MAYD 4ODTH 4LVOC 3PNWA 4XPFH 3LRGA 4NC2B 4U1NB 1G6RH 4I4WB 5MHSD 3P30H 4A2MA 5EOQH 3VG0L 5E9DA 3UPRA 4AG4H 4M5ZL 4FABH 1JE6A 3W39A 3TGXA 4UB0L 1EBAA 2BSSA 1F4XL 1OAQH 1T7XA 1NPUA 3KPMB 5DUMH 4IRJC 3QG6A 3H7BA 4MHHI 3M17A 5TE4H 2J8UF 3RGVC 3S35H 3AS0A 1NLDH 3NCMA 3T1FA 4XVUC 2A0LD 1G1YA 4QXTB 2UWEA 2X9YA 3BKYL 1I85C 2VDRL 1FFQA 5DRWA 1I8IA 4OV5B 4UIMA 3L5WB 4W4NA 3MLYH 3DNKA 1VFOA 4GXVL 3RWFB 3RVWD 4U7MA 1DBBH 4WFHD 4Y16D 3LQAL 3EZJB 4CU6A 5IF0A 1YNLL 1NC2B 2NY0D 3TZVB 5MEPB 4O4YL 1QVOA 2P5WE 3S9DB 1MPAH 3D0VA 3BP6B 1X44A 1KTLB 1AD0A 1ED3A 2YPVH 4OLUL 4NUGL 1HNFA 1DEEA 1QRNE 1L0YA 4U1JB 3QUYA 4X6BA 3LMJL 1HIMH 3BH8A 5J1AA 4P46D 3QEGL 2V2WA 4LSVH 1I9EA 4FTVB 1FNGB 4JN2A 5DS8B 4Y19B 4D9QE 1XH3B 5T1KB 3HRZA 4N8VA 1GGBH 1LO2H 1FCCA 3U0PA 2W9EL 2EDBA 3O9WC 1E6JL 3MODL 2C3GA 3QH3A 4HH8A 2V6HA 5C0BD 1F13A 4U4BA 1ZWIB 5EU7E 2IPTL 2J3SA 3N1GC 3GMLA 3DX7B 1RI8A 4JEGB 4JREB 3NACH 1JPGA 3U7WL 3LV3A 1XGUB 5EU6B 5HVGB 1UACH 4H8WC 1P7QD 2Q6WB 5ESVA 4IDJL 4HWNA 2CH8A 2WMPA 1F45A 4XX1E 5FO8B 5HXMA 5L8KB 3DVIA 5DJDB 2ICEA 1TTGA 5IB1B 4X0KB 4PR5B 1QG3A 3VCLB 4OZIB 5A40E 2EDNA 4HF5H 1TJHL 3TWCL 4QXTA 1PKOA 3CUPB 3F7VB 3QBTB 2I07B 1XGQA 3VI3E 3RWFA 1T2XA 1MHEA 1ZT4A 1E27B 4QOKA 4DZ8A 1EVTC 3UTSA 4R26L 5MEPA 2NY5H 1GH7A 5CFHA 3BP6A 4I18B 3THMH 1OL0A 2BJMH 3LS5H 5AYUH 4U1JA 4BQBA 2NY2B 1X5IA 1EO8H 3K81A 4HT1H 2VR4A 4JKMA 3F5WB 3SDDD 3TFKD 5FECB 3LH2L 4PJDB 3WIFB 4Z9KB 3QUZB 1MCIA 4MB5A 1K6QL 1GGCH 3FFCA 4E42A 1T89A 1FPTL 1ZE3C 3MPCA 2ZUXA 2NY1D 3O3AA 3WJJA 1MI5E 5I6XB 1OP5K 5BMFL 3QNXB 1N6QL 2P5EE 1X5KA 3EGSB 2DI8A 5ELIA 3B9EA 2KQNA 1SMOA 1ZWIA 4UV4H 5FO9A 2XQYG 2V7NA 1DL7H 5GGTH 2F8VA 5EZOH 2CK0H 3QQ3B 4HIXH 4DQOH 1GRWA 3MUGB 3IKKA 1K8IB 1XGUA 4JDZB 1V8HA 2X4NA 1SJEB 3CVHA 4PLJC 3JV4A 2GSIA 2VXSH 3MLRL 2FGWH 2DKMA 5DI8A 1KEMH 4U6HA 4FQHB 4X0KA 3VFMB 1Z5LA 3CFIC 3PWNA 2JJVA 4JRXB 4M6NL 4OZIA 4Z7WA 3MBEA 5F9DC 3HC4H 3CUPA 5FGBC 2GIYA 4KKNA 3S37H 4JO2H 4Q2ZB 1RUPH 1NGXA 3A67H 1A3LL 3SDXF 1A6WH 1H15A 2OTUA 4NKQB 5GGSA 4BK5A 3VD4A 3DX9A 4YGVB 1KTRL 4KI1A 1PSKL 4N0RA 1FL3B 1I8LC 4FA8A 1QSFE 3NIGF 2XICA 2X05A 1MJJA 3NH7L 1UWEL 4HLZH 1EMTL 2DIBA 5HYSG 4JFFA 3PGFH 5HTSA 4LSTL 4KRPD 1QBLL 1KCSL 4JM4H 2XZAH 3OAYH 1X5XA 2X4RB 3CFJA 1OD7A 1IM3A 3OXRB 4F80A 1NEUA 1JYWA 4QWWC 3X11A 3CNKA 2QR0A 1JWSB 5CBEB 1T22A 4DGYH 3HNSH 3SGDH 4PJDA 3D85B 3QUZA 4LEXH 5MHSE 4JFOB 4K55A 1IL1B 4O9HL 5GPRA 1E28B 3C09B 3ARGB 4S1RH 4G8FA 2D7TL 4OLVL 1B0RB 4U0RC 5I71B 2WM0A 2R69H 4BSWB 4OQ1A 4AEFA 1NAMH 2YEZA 3DUSB 4H8WH 4QNPF 3KPRB 1LO3H 2FLBT 5JXEC 4XWOC 1GIGH 4WJ5B 4OI7A 3EYQD 4BQ6A 5K9QG 4HCRL 1NC2D 1A7NL 3MRIA 5EBLB 1MCWW 3TZVD 5F9OH 4JPWH 4N0UA 1QKZH 2ADIB 5AEAA 2YD6A 3VXRB 3WHE0 4MA7H 4XCFL 1Q0XH 5HDBF 2P44B 1HHGA 2RAMA 1C12B 1I8KB 2DM4A 3A6CL 3VFMA 4PRAA 3O4LB 1S7QB 3BPNB 4W70A 3PHQA 4RFNB 4JRXA 4FZ8L 5JR1L 1FSKC 4IHOB 1A6VH 4UQ2B 4FTVD 1BWWA 1O7SA 2BVQA 3BXNA 2EH7H 3GBMH 4KJPD 4Y19D 1MAKA 4Q2ZA 5FYKH 5LGHH 1W0VA 2KH2B 3O0RL 4KHTL 1M7XA 3S3JA 4YQXL 2VZSA 3U4BH 2APVA 4JHBA 3ZKQD 1KLGB 2P43B 4MCYA 2GT9A 1T66C 2DI7A 4KKBC 2EDJA 5C0BE 1A14H 2J5LB 3WNMA 5T3XE 4HUKB 3GSUB 4WFEE 4KQ4H 3T0WA 3R1GH 4KI5E 3GIVB 1P6AB 2F5AH 4KVCL 3P9WB 1QYGL 1T2JA 2EDFA 2X4RA 3HN3A 4L4VB 1BEYL 1FNEB 5EU6D 4FFWD 4F2MA 1XCQB 1CF8H 5T3XL 1NCDH 3D85A 4B7LA 5K9JH 3U2SB 1Q9KA 4P3CL 4L9LB 1C1EL 4X7DC 2L0DA 1E28A 4U6YB 1M05B 3MJGX 2JJTA 3WO4C 4EJ1C 2B2XL 4HBQA 3GJFK 4NO2B 3UBXI 1BGXL 4AMKH 5I73C 3L9RB 3MBED 2VXTH 4IOIB 4FMKA 3DUSA 1NCWH 3FO2B 3Q5YA 1N5AB 4RFOH 2X1OA 3K3QA 5GISH 5IVXB 3E0GA 1WAAE 4OZHB 4PP1D 1FBIL 4OGAD 4WJ5A 4XCYB 1P4IL 5B3JF 1CDUA 1T0PB 4HH9B 4ZNCD 4HC1L 3VJ6A 1XR8A 2HJLB 1T89C 4XNQB 1HDMA 1PBYA 3WHXB 5GJSH 4O2EB 1LO5B 2P8PB 5GGQL 1UGNA 2NY2D 3RVTC 3NIDE 3IJHA 3QDHA 4YHOL 4F8QA 3DVNA 1IAOB 1WTGT 4HQQH 4FNLL 4FQJL 3QUZD 5LAXA 4DVRL 2NXZB 2QJDA 1AQKL 4IHOA 1WUNT 3MA9L 5JQ6L 3B5TA 3QQ4B 4IS6A 2OR8A 4I5BA 5J6GB 4PGBA 4JQVC 3RL2A 3ARRA 3ISWA 1ZVSB 1IC4L 5D93C 5HGAA 1WC7B 3T04D 5I19H 3ULUC 1UJ3A 1G9NC 4HS8L 1ZHLB 5I1DB 1T7WA 2FJFB 1JPSH 3OX8A 1EO7A 1YJDC 3VMPA 5IBLC 4ENEC 1INEH 1J8HB 4NZRH 1F97A 3GSUA 2ZZUT 1CDJA 1JK8B 2ED8A 2N1KA 3QZWB 4NN6B 4YDLC 5I1LA 1EEZB 3OJVC 3L95A 5C0DA 1FO0B 2HTLD 5EU4A 5FYLE 4L9LA 3HKFA 2QHRH 2NNAA 2A73A 3LRHA 3B9KA 5I17B 2B5IB 4TUJB 4JRXD 4TVPH 2N56A 3FN0H 1NJ9A 5FYLL 1TZIB 1NBVL 4IOIA 4GS7B 5DWUH 3SGJC 2H3NB 1OPGL 4NN7B 4S1SH 4RGMC 1MFCL 3CXHJ 1KB5H 4UNTA 3CVIL 2PYEA 3DI3B 2HJLA 4EOWL 4KKLD 3S97C 4V2CB 3F7PC 4DFHA 5ISZB 4OCSL 4PJHB 5GRUH 5IHUL 4LLDA 3WS3B 3KAAA 1OTSC 4POZC 1YMMA 5HBBA 3D85D 1A6TB 3SKNA 1CFNB 1B6DA 5J6GA 3ARGD 4HHAB 1IEHA 5J8OA 4ZTPL 3REVA 5H2BB 5HDLA 3NGBB 4I3SH 5EFIA 4WDIB 5FF6B 4TUKH 4BSVA 3HR6A 5E7FA 3MR9B 1WCQA 3TPUB 4NFDA 4NQVB 2X70A 5J06A 3KPRD 1DUZA 5T5NF 3ZKXC 4Z7UE 1OGAA 2Y72A 1AY1L 3WDHA 4RBPK 4KTEL 2DQCL 2LE9A 3MV01 1F4AA 3ETBF 2CIIA 2NW3A 5MI0C 1FN4A 3LOWA 2MNUA 3D39E 3P73A 3VXRD 5IW1A 1WVZA 4R0LB 1C5CH 3STZA 4D0BB 4GSDH 4R90L 3G5ZA 4LLQA 3O4LD 4KV5E 3C8KB 4EQ2A 1BMGA 5I17A 1INQA 4F9PC 3MRNB 2MQ3A 3FB5B 3L1OL 3MRGB 2ENSA 5I1KL 4OD3H 4WY7L 1CVRA 4DK6A 2O61A 2D7QA 2VMFA 4WCYL 5DFVC 5ALCL 1MHPL 2Z35A 5I1EH 4HS6A 1ZEAL 2IQ9H 4NN5B 4FTVE 3RWCA 4Y19E 3VI3F 1UZ6E 2ZNWA 3H9HA 3S8WA 5I8OL 4MAUL 5ICZA 4YEEA 3KGRA 1OAUH 4XH2A 3ARZA 4PJHA 5D96C 2ZP0T 1MFBL 1KB9J 5FUZH 2V2TA 3PIQA 3WIHA 1DCLA 1YN6B 5JHDA 2KQMA 5F44A 1I8MB 5EU6E 4RMVA 3ULUH 3B2VH 1O5DT 3RPKA 1PG7W 5GS1B 4NFBA 1YJDH 3BEVA 5KANI 3K4ZA 1R3HB 1NBQA 1XGTB 2HVKB 3TV3L 2LAGB 3MUZ1 4WDIA 1R3KA 3MUHL 4NKOA 4NRXB 1MELA 3V7MA 4LCYB 5DJXB 4NQVA 2X41A 3MLWL 4NO0B 3LIZL 1YPZB 1I9IH 2GUOB 1FG2B 4IMLB 4XC1H 3QXWA 4H26B 5AG8A 3RNKA 2PYED 4DTGL 3K1KC 4KJQC 3KPNA 4ZAKA 1KUMA 2DN7A 5DQ9A 4K7PL 3KDMA 2MPAL 1QFWI 1UJ3C 1DQMH 2VL5B 4OD2B 3L6FB 5FHBL 4HK3N 3MRNA 4HDIB 4WTWA 1YMMD 3GIZL 4ERSH 5DF0A 5HGDA 2NXZD 2IH1B 5IHBA 1JWMA 1WIPA 4JJHA 4LSUL 3UTTE 4UAOC 4EN3A 1RK1B 1AI1H 1NFIB 5C6TH 1CZ8H 4WFGE 5D71L 3RWHB 1JPST 1KLUA 5DHXB 4XMPH 4KDWA 2C4XA 4P99A 4ETYA 3L3KA 4RMSA 5E4IA 4S1QH 5TGBA 2R0KH 3WFCL 3CC5B 1V3KA 3DX6A 2BDNL 1J8HD 1RURH 4LSQH 4IBLT 4AZ8A 2V5YA 4Z0XA 1FVEB 4U7SA 5HI4D 1XF1A 4LPTA 1RUMH 4BZ1H 2IBGA 1I8MA 5F70A 4LPXA 2P1YA 4P4RB 4ORZC 5E8NA 5FYKU 2ZSWB 3VFPB 4CMHB 4OIBA 5AG9A 5GS3A 5A3ID 1U92A 4OGYH 5DD0H 1R3HA 1LO0L 1XGTA 2J4WL 5HD8C 5L2KA