4R8WL

Crystal structure of h7 hemagglutinin from a/anhui/1/2013 in complex with a neutralizing antibody ct149
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
110
structure length
110
Chain Sequence
EVVLTQSPGTLALPPGERATLSCRASHRVGSTYIAWYQQKSGQAPRRLIYGASNRATDIPDRFSGSGSGTDFTLTIRRLEPEDSAVYYCQQFSVSPWTFGQGTRVEIKRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin
publication title A potent broad-spectrum protective human monoclonal antibody crosslinking two haemagglutinin monomers of influenza A virus
pubmed doi rcsb
source organism Influenza a virus (a/anhui/1-balf_rg45/2013(h7n9))
molecule tags Immune system
total genus 21
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2014-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4r8wL00
5I1JL 1PZ5B 3HE6D 4XC1L 2F8VA 3HC0A 3MYZA 4PGBA 1EHLL 3CLFL 4QRRE 4NZDA 3UZEA 4UOW1 4ZUSB 1C5CL 1A1NB 1BIIA 1AXSB 1KB9J 4HHAA 2ZKHH 3DVGA 4U1HB 1KN2L 3QEGL 3WNKA 3P9WB 1DANT 1G1CA 4YZFF 1YQ2A 5ISZB 4LPCA 5BOPA 2EDEA 2FL5A 4LL9A 4XNYL 3SGEI 3LMJL 5I30H 2D9CA 2JJSA 4I2XE 3L3GB 3RGVA 1TQCC 2EYSB 1H3TA 3KYNB 1C5DB 4NN5B 2HKHH 4M3JA 4ZXBA 4FQLH 1RPQA 4NO5B 1G9MC 4KAQL 2IPKA 4LKCA 3NIGF 2J2ZA 3TT1L 5KVEL 3SO3C 3VWJC 4JDZB 3IDXL 1KNOB 3ZKMC 3TIEA 3O3DB 1U95A 3G04A 1S3KH 1T89A 5DJXA 5ESVB 3T0EB 2D03L 3VD7A 4DWHA 4OIIL 3WO4B 1KCUH 4KK6C 5D2LA 1BBDH 5KSUB 1ONQA 5DZOA 4LNVA 1JHLH 4JB9L 1YMHA 3G6DH 3FQTB 4Z7UB 4NP4L 3A6BL 5EUOE 3C09B 4L3EE 4DAGH 4R2GB 4DOHB 1ZS8B 1GHFL 1SY6A 1UWGL 2AJVH 2YD6A 3EO9L 4NKDA 4UB0H 1I9JH 4E0RB 4YGAB 2DB8A 2VR9A 2F53D 1FYTD 2GQHA 4JFXA 4X7CC 5D2NE 2I9TB 4NKMA 2A38A 4RRPA 5GHWH 1FNSL 4IIQB 4OD3L 4OCNC 2YRZA 1DLFH 5CZVH 1EEZA 4UV4H 3G6AB 5B39A 1ZA6B 2X4PA 5FYKL 5FGBC 1XGTB 4PJ9C 4GG6A 4JRXD 3BYYA 2OCFD 1KEGH 4W4NA 5C0CE 2Y6SC 1JPFB 3BKML 4MQXC 3MOQA 1A6PA 3JV0A 1OB1A 2XFXB 3P0GB 4PJBB 2XN9E 1DQQA 5EIQA 2PYED 1MJUH 3V5HB 1IAKA 3LHPL 1ZA3A 3OKOB 4X7TA 4HKJB 1T1ZB 3ARGC 1GSMA 3IKCA 1GL4B 1LD9B 4PJEA 1U8HB 4M9OA 3MNZB 1G7IB 2WBJB 5D6CA 1CGSH 4IRZH 4RWYL 4UT6H 1AC6A 1A9BB 4RSVA 4QHUB 4HGWB 1QYGL 1ZLWK 2RIKA 4ZS6C 3VXMB 1A6UL 5DD6A 2ZWLT 1JN6A 2P8PB 1RJYA 4XBGA 3PDOA 2WK2A 4XXCA 1E4WH 3RX5A 4WTZA 2Y7QB 5LAXB 3V4UL 1AGBA 5CBAA 2CIIB 3UTSA 3IU3A 4M00A 3RWIB 2GJJA 1QA9B 4D94A 2N7BA 1BPVA 4HIEB 3T1FB 4U6XB 4WO4C 2O5YH 4LCIL 4R3SA 2VLJB 2XZAL 3UX9B 4Z7OF 4M43H 1KGCD 4WUKL 5IVXE 1TVBB 4XRCA 3VA6A 1MEXL 5FYJU 5JOPD 5DFWH 3S88H 1OAUH 5J4MA 1N3NA 3MR9B 2HJFA 4AEIL 2C3GA 5DRXA 4AL8H 5BMFL 5HHPA 4NQSB 2OXGA 4AIZA 3WKNA 1EGJA 4OSUL 4XPHL 4QXGH 1MFCH 3TBYB 5IBTL 3MJ6A 5ITBH 4P2RA 3IDIB 1AIFB 3B9EA 2BDNL 1VENA 1KG0A 3M07A 3MLTA 2X42A 1FZOA 5D5MF 2EDBA 3N9GH 4GAGL 4NM4L 1YEEL 4L8SC 3HE6B 3DSFL 4FTVD 5JW4N 2VXSL 4K7PX 1NUNB 3QQ3B 1JK8B 2ENSA 1OAZH 3MGOB 4M8VA 1BFVL 2R23A 2LU7A 3GBNL 5F7MC 1WAAF 1IGMH 1I1CA 2MJWA 2E6QA 2YXMA 4K23H 4PTTA 4WEBH 1FBIH 2GSIA 1MRFL 3QQNA 2MPAH 3TNNB 3TCXA 2H2PC 5FA3B 5IQ7L 2J8HA 2UZYB 3DO7B 3TO4C 3E6FB 3HI6H 1U41A 2APBA 2RGSA 3NH7H 3MRJB 3BPOC 1HH6B 4PTUB 4XGZB 1CU4L 2AJSH 3LQZB 5IESL 2P7TB 3QUXC 5CSZA 4PLJD 4XWOD 4TSAL 4JQVA 4IDJH 3C60C 3S96A 3Q5YA 3NCEB 1TTFA 4GS7B 3HAEH 2IMNA 4BZYA 3BKYL 3U4EA 3RVXD 1NC4A 3MV7E 1FIEA 4G8GA 3NCYS 3F58H 5MEOB 4X4ME 4P5KA 5DF0A 3TZVB 5GRUH 5HJ3A 2JKXA 2HVJB 4MXVF 5F7EH 5KVGH 4JFHE 3ELAT 1CLYH 4XNXL 1N59A 2NY2D 3PG2A 1B2WH 2W0FB 3LKPB 1VEOA 4X80H 5DJ2A 4KKLD 2HKFL 4PJHA 1ACYH 4KJQC 4QF1A 4AMKH 2X2YA 4J12A 5EWIL 3TO2B 2I9LB 2DDQH 1EZVX 2WNGA 4G42B 5K59E 3UO1H 1LP9E 1K3ZA 3K3QA 2EDFA 5E8OB 4DFHA 3UZQA 1MLBB 1B0WA 5EO1B 1FYTB 3CPLB 5TGBA 3QXUA 4MWFB 1UJTA 2DN7A 3O2DL 4RZCA 4Y4FC 3SY0A 4HUVB 1KIUA 1LO0H 4ZG1A 3JZ7A 4MA7H 1VFAB 1JPTH 3RZWA 4DK3A 1FO0A 3QIWD 5TQ0L 3SCMC 3QIUB 4JRXB 1R3JA 2E9WA 4GRLA 3MXWH 2FR4B 1SHMA 1R3KB 3VXRA 4L1HA 1I85C 3IXAA 2VLKD 3NBNA 1BOGA 5CP7B 2BMKB 3ARTA 4JKLA 4L3ED 1FG2B 2X4TA 2PYEB 4PIRF 1CICD 3KJ6H 5DK3A 3O6KH 4R6UA 1D3CA 1U8JA 2MMXA 2GKIA 2NXZD 1Y18A 3OKMA 5F7LB 1ITCA 4ZUTB 5LQBL 3BXNB 2VISB 2VN7A 1X5ZA 4YHNA 3HG1D 4BQ9A 5JPMA 3TA3A 1ULVA 1K8IB 25C8H 3QFJA 5C6TH 2B4CL 2CLVB 1PG7H 3NFSL 2RCSH 3RWGB 3SDYH 1E4XH 2VIRA 3HFMH 1F8TL 4I4WA 1X5XA 5HI3C 3WS6A 2C4XA 2SEBB 1RHFA 3VD4A 2IH3A 3QR2A 2WSKA 3O2WL 4ZD3L 4OI8A 5HGHB 5FHBL 3QXVA 3O6ML 2X4UB 3IGAA 3IAQA 5DT1H 5IHUH 4PJXF 2CKBL 1FORL 4MXWL 5CP3A 1L4IA 3VXTB 1INDH 5L8JB 4LSDA 1JWSA 3QRFM 4HUUB 3RI5F 4OGXL 3VW3L 5ENWB 1WWAX 5E94A 4H0GA 1REIA 2DBJA 4RMVA 3UTQA 3DVFA 2DMKA 2GUOA 2DM3A 3VD9A 2MFNA 3OG6B 3HS0B 3G6JA 2YEZB 1FG9C 3H9SA 2VDOH 4OZGB 1KELH 4OLZL 2ORBL 4WU7A 3BN9C 1LO5B 3UXFA 4RX4D 2AXFB 1VADA 4HV8B 3SDAA 4BKLA 4J1UA 3MV9D 1TZIB 5KSAC 4UAOC 4H25B 3ROLB 1MNUL 4PJDA 2HYMA 4KPHL 5F3HA 2AK4E 4N1EA 1HHHA 1OAXH 3R06B 4LSQH 1FH5L 1YY9D 1YEIH 3RKDC 1MJ8L 1KXQE 4HCRA 1UXWA 4K7PL 5DFVC 3SKJH 1QR1A 1YEGH 3NCYP 5C0RH 1NCBL 2B2XH 4HIXH 4MHHI 3ZL4H 1ZHLA 1UM5L 4FTVB 1ZGLP 2OL3B 3LN5A 1N5AA 2CDGA 5EZJB 2H8PA 1U8MA 2GFBA 4NQDD 1ZLVH 1QKZH 5J13B 3MRHB 1IC4L 1J8HA 4Z7WA 3RY4A 5K9QG 2H41A 4TPRL 5ILTL 4Y5XC 1X4XA 3FFCD 3W11C 4ORZC 3HPJA 1C7TA 3QXTA 4UIKH 4F7EA 4XTRC 5IFAH 2WP3O 3MRCB 1N8ZA 3P4MA 5A3IC 1IMHC 4Y4KB 1DBMH 2D7TL 4F2MA 1EXUB 3FAWA 5L88H 1YN6A 2BERA 1ZHBB 4Y5YA 5MI0C 4NO3A 3CGTA 3ULVD 3AS2A 1N5YH 5L6YH 2HFGL 3QXAA 4N0FB 2AS5M 1JVKA 3PWPA 2BC4B 2ZCHH 2XTJB 1IKFL 5EU6E 4H26B 1UXSB 4PRIA 1E4KA 4AH2A 4ERSH 3AB0C 4HWEL 1MCIA 4KROC 1MREL 4JGMA 4YHMH 3JXAA 1NDGA 1CYGA 3TBTB 3KR3H 1DUYB 3OXSA 5FM5M 5I1HL 3CFIC 3P4OA 3RWCB 1PW3A 3B2UC 3MOAH 4N0CD 1INEL 3MOBL 4JM4H 5I1DB 5E6IA 5I73B 1RIVH 1O0VA 2GAZA 4KJWD 4LPUA 4NHCH 1QACA 3IDYC 2W60A 3Q5TA 3BHBB 4KVNH 4QHKI 3MJ7A 1QSZA 3L6FB 3UTOA 2BJML 3SE9H 3DYMA 3OWEA 1KF9B 1FLRH 1N6UA 2R2EB 4JZJC 5DS8A 3OR6B 5T33L 3VH8A 3KPSE 1PQZA 1O5DT 3PGFH 3I6LE 1IQDB 1JPGA 1EO8H 1RHHA 3EAKA 3VDBA 3KLHD 5KS9B 4KDTA 3EZ8A 1KYOK 3W5NA 4WFHE 3NN8A 1O7VA 2K1MA 3JV4A 3Q3GA 3NIFF 3ARDD 1XCTA 3GZKA 5FO7B 3QIWB 2AJXL 4HFWA 3TO4A 2O61A 5EZOL 4OV5B 4DVBB 3PWJB 3JUYA 5M7QA 5HXMA 1P7QA 3JWNC 4K2UL 3CC5A 1BF8A 1INQB 1JV5B 5FO9B 5JOFB 3HZKA 2DQTL 1CICB 5I8EB 2ARJB 4WGVB 1WITA 1QFHA 4K8RD 1FFPA 2NXZB 3MC0A 3ZYJA 4GW4B 4OB5H 3GSUA 4PY7A 3TWCL 1KCSH 2FB4L 4P5MA 3FOMB 4WVRA 2X9XA 4J3OC 4ZFOA 5ISZE 2V7NA 1G0DA 3HG1B 5IKCA 3QFDA 4HKXA 4DN3H 1WIUA 2J12B 4PLOB 5C0FB 1OD7A 4N5UA 4YXHH 3RPIA 3EYVB 3KNBB 4WUUD 2YD8A 3MRDB 2HTLC 1KB5H 3FO1A 1MVUA 4GMSH 2QR0B 4QRQB 4YHLL 1WT5A 1X9QA 4J4PD 3G5YA 4PG9B 1QRNE 4B7LA 4XAKE 1T1XA 5C0DA 3MRKB 3EZJB 4M5ZH 5C0AD 4YE4H 5HHNA 1AKJD 1H5BB 3VWKB 2B5IC 1JFQL 1LE9A 3RBSA 3GI9L 5IP4A 4YAQA 3V6OE 3QO0B 5AAWA 4PLKC 3N85L 2Y36L 2ZG1A 1P6AB 1Q0YH 3ES6A 4FQXD 4U1MA 1SYVB 3DXAE 1CFQA 5I1LB 4Y7MA 2XQBH 3VXUB 1M7IA 3MLSL 3V8CA 5CFHA 2DM2A 3DECA 3PJSB 2ZG2A 1NCAL 2OQJA 5CJOL 5CSBA 3DETD 3NAAH 3SCMA 2J4WL 4QOKA 2P5EE 3OAUH 4PJXE 1OWRM 1R24A 1BZ9A 4HLZH 3C5SB 3L3KA 4HWBA 2PW2A 3RZCC 1Q72L 3O4OB 3TIDB 5C1MB 2A0LC 5CIPB 1U8PA 1WK0A 3MV8E 2ITDA 4GW1B 3S97C 4R0LC 5EZIL 4OBRA 3H3PL 3NTCL 4G9FA 2KBGA 3RWJB 1JP5A 4TNVF 4ODHH 3KPOA 3JVGA 3MV9B 2HRPL 1DQLH 4NUJA 1X44A 4NM8H 4JQIL 2GJZA 1JNLH 3TN0A 5E4EC 5DJ0B 3BZEB 1YNTA 1M6OB 4RQQA 3FJTA 3B3IB 3QG7L 1MI5A 4YBQD 3BSZH 3DUUB 1WTGT 1J05A 2XZZA 4Z7VA 5DMJB 4ELME 4Y19D 1MJJA 1WF5A 2YKLH 3LPWA 4X4XA 3WEXA 2DWDB 1UH2A 1JI1A 2BVQB 3JWDH 5DTFA 4Y2OA 3LKRA 3TV3H 4LSSL 1MHCB 4LARH 1S7UB 5SX5K 5T3ZE 2ICWA 5T5NF 2A1WL 2VABB 1JRHH 2IAND 3M1BB 4XPAH 3VMNA 3GB7B 5LWYH 1P2CB 3CD4A 3IF1B 4PJAB 4PR5A 1K5NB 4R90L 5IEKB 4CADB 4O2CB 2R2HA 3JWOL 2P24A 5M94B 4HLZG 4OZFB 2A73B 1YY8A 2VL4A 2J1KA 3OZ9L 3MUGA 1T2XA 2V2XB 2WUBH 4M7KL 1F00I 5F9JB 5DRWA 3RA7H 5D2LF 3MA9H 5JIIA 2E5EA 5B38G 1NJ9B 1BX2B 2V7HB 5AZEH 1YECL 2EE2A 1IGCL 2HVKA 4RDQF 3QAZC 3RNKA 3IAPA 5IM7A 1I3GL 4H1LB 1Z9MA 5DD3L 5I19L 3CU7A 1C5BH 4Q0XL 4PJ8C 4F7MA 4HUKB 5H94B 5TDNA 1OW0C 3O3BA 1OL0A 3F6IA 2ZUVA 1TXKA 5IOPB 4KJPC 3S4SG 4KKAC 4UIMB 3MACH 1CVRA 5T1MA 2A6IA 2IALA 2K9UA 4UUJA 4LQFL 2J6EA 1UCTA 5IB1B 4YHOH 1J87A 1EMTH 3RVWC 5D7LD 4JY6B 3Q6GL 5FIEA 1EAPB 4YHPB 2NXYB 1KSRA 4GG6F 5EULV 3TNMB 4JN1H 3QHZL 2VDPH 3V4VL 2QV2A 3O3AB 3T2PA 5JIPA 5MEQB 4MVBC 1DE4A 2JB6A 4RAVB 4QTHA 2GIYA 2X4OB 3SE4C 3CH1B 1PKQA 5JUEH 5GGTA 3CUPA 3WJJC 3EYOA 3BPLB 2GY7B 3O11A 2XKNB 5J8OA 5CEXA 4FA8A 2OI9C 5IJVA 1DQDL 2J7LA 1WZ1L 3CVHB 3GSNA 3FHQA 4DCQB 4ESKA 4PJEF 3A6CH 4F9LA 3RDTC 2GTZB 3ARDB 4OCXH 3F7RA 2D0GA 2ZKHL 5I71B 1HE7A 4WU5B 5BV7H 3T77A 1A1OB 5J6HA 1XIWD 3QG6B 3VXOB 4KRPD 3OXRA 2UYLB 3CK0H 4LPVA 5CJXA 5E08H 1NGQH 2FWOB 4R7DB 2B4CC 1FFQA 4ODXB 4HW6A 1I1AB 5GRJH 3TC9A 3T2NH 3VFMB 4XCFL 4GBXD 1RMFH 4DUXA 1NMBL 4FQLL 5EU3B 2Z31A 3RU8H 4HT1L 3BZ4B 1RULL 2GCYB 1EFXB 5A40E 4PREB 4CW1A 1R5VB 3GMNA 2XI9A 2HTKC 2IPTH 2O5ZH 1B90A 1S3KL 5T1DH 2UVFA 1F58L 4WUUB 1RJLB 4UT7L 5IF0B 1EAJA 1BQLH 1QLRB 1YMMA 3CCHB 4OGAD 1LO4H 4UTBH 1I8KA 5HY9A 4CU8A 4IJ3B 4OF0A 2ZUYA 4YDJB 3G6DL 5C0AB 3F7QA 3UAJC 5IMOB 3MRRA 5AYQA 4FQHA 5GRVL 5EDXA 3LKOA 3PE9A 3QEHB 4DAGL 2C7UA 1RI8A 4CRPA 2DIJA 2PR4H 1I7TA 4FQXB 5DMGD 2AJVL 4ORGB 3QXDA 1I9JL 3X3GL 2AGJL 3AVEA 4QRPE 1GGCL 3R0MA 1KIRA 5A2IH 5GHWL 4OLWH 2QSCH 2OMNA 1AHWC 1KPVA 3QT2A 1DLFL 2R0LH 4LLWB 5CZVL 2APVA 1AGCA 2H2SC 5HPMA 3QDGD 5BVPH 4WV1A 3QNYB 4LAQH 4MXQD 4IRJC 3MYJB 1IVLA 2R9HC 3RWHB 4LASL 5E9DE 5C9JA 4JKWA 1KPRB 3UBXB 3QJFB 3WIIH 3LAFA 4XP6L 3SDCD 1VACA 3F65A 1VPOL 4D9LH 5D1XA 5GGSY 2IG2H 3MRMA 4TTDC 5FCSH 3SQOH 3Q6FA 4LEXH 1SEBB 3X11A 1T6VN 3IU4L 1BEYH 1RK1A 1OD9A 3QUZA 4I0CC 3QRGL 4Y19B 1S9XA 1FAKT 1A5FH 32C2A 2W9EH 4L1DA 1CFSA 2DMBA 4IRZL 2Q7YB 5FOBA 1YJDL 3VRJA 4HGKC 3NFPB 4HFUL 2IANB 3LCYA 4XMKL 4HZAA 2IJ0C 5C6PB 5F44A 3BH8B 5ACZB 3MJ8A 1E4WL 5D1ZB 1LDPH 4BH7B 4ZPVA 2ICWI 1PG7X 1J11A 3IS0X 4M48H 5F7DB 4LDOB 9CGTA 1WJ3A 1BQHB 3CSYA 2BSTB 3MNWA 2BVEA 3VFUB 1JWMA 4PJHF 4MA8H 3OV6A 2OTWB 4HMDA 2M2DA 3BRGC 4C83A 1BD2A 1RAMA 4KI5C 1P4LA 4M43L 1NUFA 1WFNA 2IAMD 3HCVA 4NQTA 3TP4A 1FNGA 3S88L 1OAUL 1JYWA 1XF3B 4JQXC 4KKBC 3QI9D 4GAFB 1OTTC 4APQA 3MCKB 1DBBL 4C55A 4D9QD 4RFOH 4KRNA 3S5LA 4F7TA 3LRGA 2XTLA 1S9VA 3MO1A 3QEQD 4HXBL 1I8MA 1JUFB 4GSDH 5D5MB 3OHXB 3ARED 3EO0A 1LMKA 4HIIA 4Q6YA 1J86A 4DN4H 1MFCL 2JK5A 1CG9A 5ITBL 2C3VB 4LPXA 3REWB 5IV2B 3IFOA 5F1NA 3IXTA 3THMH 3KDMA 1HILA 4PRNB 5F6HJ 5MENA 5TF0A 2X9WA 1QNZL 3QP3A 4OZGE 4XAWL 1NBZB 1SYSA 3N9GL 1PYWB 5T3ZH 1QFOA 4U1NA 3B9KA 4IM8A 3SBWC 3STZB 3TM6A 5BRZD 1DTUA 2PXYC 3KPRE 5B8CC 4LCWE 4W6XB 3CFKA 4Y1AA 4ZDHA 3ARBC 1OAZL 5E2VH 5GRXG 1IGML 5HDBE 4NQCA 4K23L 4QHMB 3VGBA 3L3IB 2ILLA 2MPAL 1T80A 1HQ4A 1S7QA 5GS1A 3F5WA 5HHOD 3PQYD 4YJZL 1G0XA 3VGAC 3TT3H 3NH7L 4PRHA 2FX9H 3HMXH 3ZSTA 3AM8A 2AJSL 3BIKB 4UDUB 1Q9LA 1UWEH 4LSVL 4GBXB 5IGXH 3MBED 1BFTA 1N6QL 3I02B 2FSEA 3IJHA 2OL3L 5IBUB 4BH8A 3U0TB 1U93B 2CGRH 4F15B 4L8CA 1NBYA 4JZOB 3NGBC 4DEPC 1R0AH 5GRUL 3S98A 2MOVA 3MMEA 3LS4H 5F7EL 5KVGL 3AAZB 4KMLB 1CLYL 1C12B 1HSAA 3EGSB 5E5MB 3ULUF 3C6LD 4X80L 3E8UH 2JCCE 1PSKH 2O5XL 3ECBA 4L3CB 3T0EC 1ACYL 3T08A 3KPNA 2XTJE 5JNYB 4Z0BH 3G6JF 4TSBH 4OQTL 3WO4C 1OARL 1F4YL 1MH5B 2MKLC 3VRLF 4NWTL 2AJUH 4OZIE 3U9UB 4NPYA 4I0PA 3ALXA 1D5BB 2R1XB 1LE5B 3IKKA 2FLRT 3D18A 4QHNB 3C09C 3MJ9A 2Q87A 4ALAL 1NAMB 3Q2CA 3LRSB 1QFWM 4PJDF 4QTIH 5CEZE 3BUYA 4MAYD 1AD9A 4Y16B 5C0BE 3WNLA 5IVOA 3FQUB 5FYJE 1BREA 2P8MB 5DI8B 1JF5A 1H8SA 2W59A 2UWEE 1L9MA 4MA7L 4NZJA 1C8PA 1JPTL 4I0KA 1RUML 3QDGB 3PWLA 1IEHA 4BZ2H 2XZQL 4P2RE 4HUXA 3U9PH 3GO1H 4N8VG 4I48A 2DBLL 1Q9KA 1PEWA 4QRUA 1DL7H 5JLZB 4P2OD 5IROC 5KS9E 2X41A 1NLDH 4Z7WF 3DARA 1GIGL 1PBYA 1G9NL 5I1AB 2YUWA 2BVOA 5TH2A 2VZ3A 5DJAA 5HHXL 1WWBX 3JWOC 5I18L 3O6KL 2EKSB 4RFEA 1D5ZB 1MUJB 2QQLH 4LAJH 2QSQA 2ZOLB 4LVEA 3LDBC 4OBSA 4HJGB 3ESUF 4HS8L 2HFFA 2PF6A 1I9RH 2LE9A 5FO8B 3MRIA 5SWQA 2DI9A 2VLLB 4Z6AT 4N90D 3WNOA 1BMGA 2M1KA 1K6QH 5B3JE 3FQXA 4D0DB 1H8NA 3OG4B 1ZK9A 2WBJC 3MRQA 1E4XL 4PY8J 2C1OB 1V7ML 3RNQB 5I6XB 2ZPKH 5JO5B 5EU7C 2EYRB 2LV4A 3QCTH 1NL0L 4FFYH 5DRZB 2PYFB 1CXEA 2NNAB 4KK8C 2HLFC 1LEIA 1EEQA 5L9DH 5DT1L 3TEUA 3RRQA 4Z8FL 5AZ2H 4E5XB 1G7HA 3RVVC 2XNAB 3O8XB 4QKXB 1Z9SA 3I3BA 2Q6WA 2HWZL 1XZ0B 4Y5VA 3ARZA 1INDL 5HYSB 1GGIL 4HS3A 1XCQB 3VDCA 3RVTD 4G43A 4U4BA 2DYPB 3HHRB 2IAMB 5J6GA 3KPQA 1FIGH 3L3DA 1PG7W 4UBDD 5IEHB 1W72H 4B7IA 3ISWA 3QI9B 1KC5H 5HI5D 4BJLA 4XNMA 2VDOL 4OT1L 4HUWB 4M6AA 4ZMAT 1J7VR 4LSTH 3ZDXE 1KELL 2YPKB 3QEQB 4L4VB 3LKQB 5T1KB 4LSRL 3ZKNC 5SWZE 1JZ4A 5BVJA 5GQBA 4HD9A 2XPGA 3AREB 5FK9B 3R8BB 4CVUA 3RGVD 3VXUE 5CUSH 4OTXL 4YIQA 3GGWB 1KT2B 1A4KA 5BS0A 2NR6D 1KENL 5DHVB 1CS6A 1Z9LA 4ZXBD 3PHOB 3MNVB 4YHZH 1BJMA 4S1QL 4MDIB 2X7LA 1AQDA 2IBGA 1XGPA 4FQ2L 4LDEB 1S9WA 1WIOA 1YEIL 4I18A 4I8DA 3S35L 5DR5H 3C08H 2ZP0T 5HYJB 5BO1H 3ARYA 5C0RL 1T83C 3FQWA 2VXUL 2BRRH 5BRZB 3BGFB 4HIXL 2Z8VC 1GPOH 3ZL4L 3EO1B 2ATKB 3IFNL 3MLYL 5I8OH 1ZVSA 3BE1H 4UQ3A 5I17A 1R6VA 2JB5L 4X6EA 3CXDH 3HE6C 1P5VA 5B22A 1T21B 3WHXB 4OM1H 3TJEH 1M05B 2ZOKB 2CKNA 1U0QA 4UIKL 4FZEH 2LVEA 4GXUM 5D8JH 5HHOB 4RMTA 2H9GA 1VERA 1MCJA 4W68A 4G8FA 1PLGH 5L88L 2AERT 1JNHB 3LKNA 3OKNB 2PW1B 3VD3A 1F4XH 3MBEB 1M7DB 5FB8B 2Q8AH 3C8KB 4PJCA 4QEGA 1V3KA 4ERSL 1RK0A 3PWNA 3X3FH 5C0IA 3GSQB 2X40A 3GI8H 1MWAH 5JTWA 3U4BH 3IETA 2Y9RT 4LRIA 3H0TB 2W65A 3PABB 4D0BA 5E95B 4KJYB 2AJYH 1MPAL 1RIVL 2EYTB 3RTQB 3C6LB 1MCBA 1XF1A 4KVNL 4JRYA 1MQKH 4F37F 4XVUD 1ZLUK 3OAYK 3ULVL 4WW2B 4WI5A 5GGUA 1KJ2A 1L7IH 3SE9L 4Q7DA 3BI9X 5T5NG 3VCLA 5IR1A 1YQVH 3FT2B 3GMPA 1FLRL 3CMGA 4QLRA 3VRIA 1U6AH 4JDTH 1UB5A 3G9AB 5L7XH 3GMLA 5ALCH 2A9MH 4FQIH 1EO8L 5E5RB 4MAYB 3CFEB 1UCBH 5F7UA 1YEDA 4I77L 1AY1H 2QLVB 3FB5B 2M8XA 3FT4A 2ADIA 1CGWA 4Z7VF 4TUJB 1RZIA 4PS4H 5LXGL 4RDQG 3UTSD 4OJFH 5D71L 3X13A 2HFTA 5BXFA 3DROA 3IAGC 1SJVA 4UZGA 2ESVB 3L5WB 1Y0LB 2A6JB 4JREC 4X6DB 4NNPH 2CIKB 2J5LB 1YJDC 1BLNA 1R5IA 4MNQA 1AXTH 3MREB 4RNRA 1Q94B 5F3BB 3FB7A 2ID5A 2V2TA 5HDQH 4F7CB 5I66A 1ZWIA 3MGTA 4YPGA 1N64H 1P5UA 1OHQA 4ZFZA 4OB5L 1JZ6A 1NFKA 4LHUG 3CVHL 4XXDA 4U49A 3MXVH 3SDXE 5E03A 1RJZA 5B39G 4LP5A 4OV6F 3S7GA 4RGND 3W9DA 2R0WH 4DN3L 4LNRB 1NQBA 15C8L 4DGYH 1II4E 1LK2A 4WW1B 4GMSL 2AV1A 3AXLA 3B2VH 4HK0B 4P2RD 4G8EA 4YDVB 5D7IE 4JKPH 4P57A 3GSWB 1S7XB 4EBQL 1TMCB 2CXKA 3DOSA 3GMRB 5DVNA 4K8RL 4OFKA 3HMWH 4J3SA 4PRIE 3GSXB 3O9WB 1EO7A 5CEZH 2GY5A 1I8LA 4OZ4A 1KBGL 1PAMA 3HC0B 2D9QB 5FYJH 4JY4A 1DP0A 1ITBB 1Q1JL 2FX8L 1M7XA 1Y6MR 1U2HA 5TDPA 3ZKXB 4HHAB 5FYLD 3NAAL 4WFGE 4IS6A 1IE5A 3OAUL 2CDFA 3QWOA 3N1FC 4LDLB 3SKNA 3CDGA 2AQ3A 4KV5E 5J57B 3VFVA 3RL1B 1IKNC 2FL5B 3PNWA 2W0PA 4ISVA 4JFEE 4XVJH 1RY7B 1ZOXA 5J1SC 2Y5EA 2VAAA 3EYSL 3IJSA 4X8JA 1TZGH 2CPCA 4HH9A 4YBLC 2HT2D 4WY7H 1NC4D 2OBGA 5CINL 4G8GD 2KPNA 3BSZL 1U95B 2DQHL 4F58L 3G04B 3O6FA 5DJXB 5TDOA 3CSBA 3RL2A 1LQSR 3OKEA 1A4JA 3OKKA 4LARL 5D2LB 1CT8A 1ONQB 5FV1L 2D3VA 3KVQA 4IOFD 5LWYL 1YMHB 4YBHA 2C3HA 2VDKH 2H1PH 1FAIH 3VI4F 1A02N 3G9VA 1BF2A 4FXKA 4NKDB 4WHDA 2MCG1 4LKXB 1FN4A 4G6JL 2DICA 4JFXB 1TENA 2X4SA 2Y07H 3EOBA 4OI9A 5DEFA 1DDHB 1E6OH 3FT3A 1H15B 1CXFA 1S9YB 4KQ3L 4WDIA 1C5BL 2YD1A 4MLSA 3D85A 4XWOC 4R4BA 2X4PB 5HVHB 4GG6B 1ORSA 4RFNB 2YZ1A 4LVNB 1UVQA 5CZXD 3HNTL 4GRLD 4CMHB 3LSOA 8FABA 3VXRD 4BZ1H 1HINH 1CWVA 1UKSA 5I1EL 3I6KA 1C16A 4E42A 3V7MA 2OM5A 3JV5A 1CLZH 2X1XR 5HGAA 4TN9A 4YHOL 2AEIT 1IAKB 2NY2C 4LLDA 1ZA3B 5I73C 4FFVD 4KUZL 4W6YB 1D6VH 1UZ6F 2ZUSA 3L3JA 4KKLC 4EDXB 5EU4A 3IKCB 2WQRA 4PJEB 1QFUL 1MCPH 2FEDD 5EIVA 3TVMA 2W38A 3MZTA 4XH2A 5D6CB 3STLB 1HKLL 3TA3D 4MB3A 5JUEL 4ZAKA 3QFJD 1BZ7A 1NMAH 3QUYA 1G9NC 2X6MA 3P0VH 1T1WA 2NCMA 2PN5A 5DD6B 1JN6B 3UPRB 5DUBA 1RJYB 1ZT1A 3PDOB 2FJHA 4GXUN 4GAJH 4XBGB 1IQWH 1NCNA 3BISA 3A6CL 4X6CE 1AGBB 5CBAB 1JPSL 3U46A 5H35A 1I75A 3UTSB 4M62H 3UTTB 3TESA 4OAWA 4LSUH 2EIBA 4U1KA 2J88H 4RGMB 3QIWC 1CBVL 3CK0L 5EBGA 3UYOD 4R3SB 1NGQL 4PGDB 1MI5E 4M1GH 3P77A 5F89A 2OZ4L 5GRJL 1A14L 3T2NL 1WVZA 4O51A 4MNHA 3ULUD 1F3JB 4M93B 1N3NB 2JF1A 1XF4B 2EO9A 4PJ9D 1CICC 1S7VA 2VN4A 4YO0A 3H9SD 5HHPB 2NY5H 5F9WB 4AIZB 2OK0L 4MNGA 4RGNB 4N0RA 2IPTL 4GLRH 4PRPD 1FNHA 2O5ZL 1IRAY 2V5SA 5T1DL 3MGAA 4OLVH 1A1MA 4PPTA 4PG2A 2VWEE 1EA9C 1BQLL 3SDAD 1RIUL 3VXSA 1HI6A 3NIDE 2DQDL 4XVTH 4OZHA 4ZFGL 4GKZA 4JPWH 3GJEA 3GIVB 5MEPA 3QHFL 1KG0B 4R7NB 5JHDE 1FZOB 3O4LE 2CXGA 2PR4L 3HZYA 4Z7QF 4K3JH 3DI3B 4MJIA 2Z8RA 4ZQKA 3CXHK 2AKRA 4HIHA 4LPWA 2R23B 4QRSB 1KB9K 1J8HD 2PETA 4I9WE 1UACH 1TETL 3L5XL 4N9OB 4PTTB 4M1CD 3GMMA 1EO5A 4LCUA 4U1JB 2GSIB 4WEMB 1CD8A 1RUAH 3WSQH 2D4DA 4M8QA 4GOSA 4AIXA 4LAQL 1A6AB 3P0YL 2APWA 2P48B 4JANA 7CGTA 4LLVB 4UQ2A 5ADOL 2P5WD 3TFKD 4ODUA 1S9KC 4HCRH 1XF5B 3DI2B 3PF2A 4XP9H 5CSZB 3WIIL 3HNSL 4P5TA 3PWPD 4D9LL 5KSBF 4OF8A 4PJGA 3P40A 3SQOL 3UTZB 4R97B 3FONA 1C1EL 4BK5A 5TE6L 1NC4B 4G8GB 3QUMB 1X6NA 4W70A 1JNNH 5CLTA 5ID1A 1LEKB 3K0WA 5HJ3B 4EOWL 1FFOA 5HSFA 2NW3A 4URTB 2W9EL 5CCKH 5E6ID 4YC2B 5DJ2B 2P49B 5I76B 4PJHB 4QF1B 5C08E 4RMSA 4MD0A 2RJMA 5DO2D 3WNNA 5FFLA 2E7LC 5KW9L 1LDPL 2Z4QA 1UB6B 3SOBH 4WFFE 1T1YA 4UDTA 3OAZH 1XGYH 4NDMB 1CTOA 4ODSH 3TCLA 5TGBB 1JGEA 1BP3B 3PHQA 4P3CH 4JFFE 4RZCB 3SY0B 3INUH 1CQYA 5C07E 3ULVC 4ODWA 1KLUB 5C6WH 4W4OA 1FO0B 2H2PD 4U1IA 4B0MM 1OAKL 3TO4D 5I2IA 1WBYA 4GRLB 2DF3A 5FECA 4QNPF 3UJTL 5C3TA 5EUKA 1IGTA 2VRAA 5FOJA 3VXRB 4RFOL 3IXAB 3PIQA 1BOGB 4CNIB 1RIHL 1P7QD 4IHOA 4GSDL 1AR2A 5JXAL 2X4TB 4N0CC 5L0QC 4UT9L 1OGAD 1V5JA 4EJ1C 1MCOH 4OFIA 3D0VA 1HXYA 1FYHB 4JM2A 4KJWC 4E41A 4PRAA 1U8JB 3VWJB 4PJFB 3H7BA 5GGRY 1Y18B 2P47B 3OKMB 4ENED 3RWEA 3QULA 1MAML 4NT6A 3VFPA 4NUGH 5DWUL 4YHKH 5JPMB 3TA3B 1QLFA 12E8H 1KJMA 4L4VE 2CD0A 5EO0A 3QFJB 4JPKH 1SEQH 1LHZA 1TCRB 2DQUH 4RA3A 2VIRB 4I4WB 1UZ6E 1A3RH 2HN7A 3HAEA 4JAMA 4X0KA 2IH3B 4TULL 5IK3B 2BY0A 5J89A 3G5ZA 3BQUA 2JJTC 3PL6A 3RUGA 1HH9A 2YUVA 2E7HA 2CR6A 5HYJE 1QP1A 3B83A 3WLWD 2VH5H 4Y0GA 3UTPE 1N7MH 1WBZA 4Z95H 2CLZA 4V1DB 1JWSB 3TT3L 2ZJSH 4ACPA 4CN6A 2R56H 2VXQH 1FDLH 5E94B 1FZKA 1MRDH 4DTGH 2GJ6A 1UWEL 4JPVH 2GUOB 1D5IH 4UV7L 2EDTA 3GMOB 1AXIB 1QPPA 3SCMD 4NFDA 4QOKD 4PJ9B 4FABL 1ZLVK 4JFDA 5EG6C 3H9SB 1TNMA 2CGRL 4K8RC 5AG8A 3A0OA 3W81A 4NYLA 1HHKA 1R0AL 3QNXA 1QBBA 4QRRA 2LFGA 4PRPB 4WU7B 3V6FA 1PJ9A 5EOCJ 4G9FD 1AGDA 3MLPA 4XPBH 5IJKA 3PV6A 1FL6A 2CSPA 3C5JA 3SDAB 3SJVE 4BKLB 4BYHA 5KVFL 2CUHA 4PJDB 2DQEL 2XZCL 5F3HB 4N68A 5F8RC 1MHHB 2BOCA 4TSBL 3TN0D 2DQIH 1HHHB 5SX4H 1IC5H 4J4PC 4I2XA 4Z78B 2NW2A 2UV3A 1UXWB 2AJUL 1QR1B 4NJ9H 1OT2A 4S2SB 2A77H 1LK3H 1D5XA 3H3KA 1KIPA 3PHSA 1A9EB 1ZHLB 4ZPTA 3LN5B 1N5AB 3P9MA 4QTIL 2H8PB 1U8MB 2GFBB 3CFDB 1JIBA 2P42B 2GK2A 1NGWB 1J8HB 3FMGH 1IEAA 4Z7WB 3I9GL 1PY4A 5TF1L 1I7RA 3TGXA 1NFDE 3HPJB 4O02L 2WW8A 4YWGL 2IQ9H 1DEEA 3FO9A 3AGVA 4P4KA 3R4DA 4BZ2L 3S8WA 4EUPB 4M3KB 3SGDH 1YYLH 3GO1L 4C56E 2P5WB 2IEPA 1YN6B 3R0NA 2DQJL 3D3VE 4NO3B 1OQXA 3QXAB 4MD5A 5D7KD 1NLDL 1DLHB 1ZHNA 5EUOA 4KVCL 4B41A 1RZFL 3PWPB 4GAYA 2VUYA 4M6NL 1T0MA 4JHWH 3WD5L 4AH2B 3DVNA 5FYKU 2XA3A 4YEFA 3BESR 2B1AH 1NDGB 5AUMA 4EN3A 3WXWL 3OXSB 1I9RL 5D2NA 1FVEA 2DLFL 2NLJB 3P4OB 2ESVE 4ZUVB 4X6DE 2ERJB 5FUZL 3NOIA 5F21B 4YBQC 4I9WD 3LIZH 4X5XB 1FPTH 1K6QL 4RIRA 2W60B 5TPWH 4PJCF 1B6DA 3MJ7B 3PDDA 3IJYA 1MAJA 2QHRH 4NJAH 2EDLA 1CQKA 2FYYA 4GRWB 1IL1A 4IMKC 4TVSa 5C0CA 3QCTL 4PRDA 4HLJA 1SVCP 4FFYL 5BQ7A 3FRPA 5DS8B 4X7SL 5L9DL 4B5EA 2JTDA 5EFIB 2XN9A 3FZUC 1JNJA 1PQZB 4KZDL 4HIJA 5AZ2L 1ZANL 1RHHB 4OFPA 3GSOA 2D0HA 4HULB 1AE6L 1HQRA 4X4ZA 2VDQH 2GTWA 4D3CL 3PGCB 4KZEH 3GKWL 3NN8B 4D9RE 3ZE2E 1FSKC 3JV4B 3Q3GB 1XCTB 1RVFH 4NO2A 2EC9U 5E2UH 1NC2A 3TO4B 1KC5L 1F4HA 3QIBA 3U2SA 3BD3A 1NAMH 5CEYA 1F42A 2VDLH 1CCZA 4ELKB 1PDKA 1P7QB 3QWRA 3HZKB 1CZ8H 5DJ8B 5B4MD 1OGAB 2MCPL 3VXQA 5CUSL 3BUTA 2V5RA 1UZ8B 3VFWB 1FFPB 4YHZL 4J2XA 5GGVH 4PY7B 2Z31D 5HHMB 1TJGL 1H3VA 4P5MB 4U3CA 2BFVH 4ZFOB 2CLRA 3O2VH 2V7NB 2YPLE 4XB7A 3U7AA 2QEJA 2H6PA 5IKCB 3QFDB 3ZDZF 4HKXB 2XV6B 3ORJA 5IVXA 2YD7A 1QD0A 4Y4HA 1TJHH 4KY1H 1ZMYA 3FO1B 1GPOL 2W1NA 1YMMD 4X7DC 5D7JA 3AY4C 3MLUL 4JDVA 3TPUB 4U2ZA 4XPFL 1UH4A 3EFDL 3EHBD 3G5YB 3DMMA 5TE7H 3FN0H 4M7JH 3ZTNL 5DD0H 3WIFA 4P9MH 1A6WL 4M7LH 5F1IB 4G5ZH 1L0YA 4DKFH 5MERA 3GBMH 3FQNA 5CS7A 1JGLH 3KG5A 3ES6B 5HGDA 1XIWC 1CFQB 1EVTC 3D0LA 4DGIL 3IDGB 4KRPC 1Z2KA 1M7IB 4NN7C 4S1DD 4L29A 1P4IL 3MPCA 2F8XC 4OCMC 1F4XL 2OQJB 4JFOA 3T0WA 3M8OH 3SCMB 2BXZA 2OJZL 4QOKB 2Q8AL 1R24B 4TUKH 3D2UA 1HKFA 4WI6A 2PW2B 2A6DA 2I07A 1VGKB 4NQEB 4GBXC 2X9YA 1MRCH 5HYEA 5KBNC 4LGRB 2HH0H 2E8ZA 2V5MA 3GI8L 4JKKA 1MHPL 3VMOA 2EXYD 3CDYA 5IB3A 1OAQH 4UOJA 4G9FB 1XF2A 1YNLL 1K9TA 3QQ4B 3QCVH 1KIQB 3ZTJH 4IEFB 5SWSB 3ARRA 3DBXA 4Q6IA 3KPOB 2X4RB 4A2MA 1QHPA 5D1XD 2OR7A 4NUJB 1MQKL 1RQ5A 3FCTB 4OGAC 5FCUL 1YNTB 1IT9H 2DS4A 4OF5A 2J8UB 3QUZD 3U83A 1V3MA 3I3DA 1H3PH 3VFOA 2Z92B 5DTFB 3BEWA 1KTKE 3LKRB 3BDBA 5F1OB 2FGZA 1NCCH 4TVPE 4HDIB 4A2LA 2NY4D 1FE8L 3S9DB 2ICWB 1VGEH 5DMGC 1N4XH 3MV7A 4PR5B 3UZVB 3WDJA 1AY1L 1U58A 4X4MA 3I6GA 2R2HB 3BVNA 4YQXL 5IQ9A 1MELA 2P24B 4HG4K 2A9NH 4K3DH 1T2QH 2AW2A 1JHKH 3A67L 4GMTH 3MUGB 1RURH 4PS4L 4MCZA 1YPZE 3FKUS 1CF8L 3K74B 5DRWB 3QJHA 2YD2A 4QGTA 4POZC 4S0TD 1KB5A 3ZTJG 4O58H 4MXQC 4QO1A 3RNKB 1N6VA 4M61A 2OJEA 1ZT4A 4P3DA 1AXTL 4JCLA 3F7VA 3IDMA 3UCRA 1BD2D 4HJJH 1WFOA 5KOVC 3LY6A 3SDCC 4F7MB 1E4XI 1LP9A 1ETZB 5GGSA 3U1SL 5TDNB 1XGQA 3UTTE 3V6OC 3O3BB 4APQD 2VDMH 5BJTA 2ED8A 1KN4L 1VFBB 3AS0A 3B9DA 4WNQA 4X6FA 5T1MB 3H8NA 3T3ME 2A6IB 2IALB 4UUJB 4NBXB 1WC7A 4JO1L 1H0DA 4JFPA 5IB2A 2XKSA 4QYOA 4KDWA 5AWNL 5AG9A 4JKPL 3EJZD 1DE4B 5MEND 2JB6B 4U1GC 4QTHB 3REVA 3TBWA 1W2KT 3CUPB 4K7FA 3EYOB 3HMWL 5B38A 5CEXB 5GS0D 5EIIA 3B9KD 5CEZL 1KFAL 3X17A 2CO6B 2YN5A 5CGMA 3MRPA 2IBZY 1MCSA 5GRYA 3GSNB 3FB8A 4DW2H 4Y1AD 1FLTX 4Y5XB 1EGJL 2BHZA 4QHLA 5KN5A 5C09E 3MX0A 1K2DB 4NQCD 3LEYH 2YA2A 4HPOL 3R1GL 2MHAA 3S4SA 1IC7H 3VJ6A 5MI0B 4HF5H 3ZHKA 5ALBL 1F13A 4PRHD 1TQBC 4XP1L 2MSPA 3C5ZA 4XWGH 2DTMH 1YN7A 3AREC 4O4YH 1ES0A 3F62A 2Z31B 5IMLA 4N0YL 3WN5A 4KK9C 1WUNT 1RZJH 4CW1B 4WY7L 3GMNB 4KJPD 2Q3AA 1L7TL 1SJEA 3X14A 1BVKA 1JGDA 5FYLL 3IDJA 4MMZC 4BSVA 4PRBA 4XCYA 4XMLH 3V0AC 3IDYB 3SEPA 4AEHH 1QR4A 3GRWA 1YMMB 3JBG7 3KYOA 4JJ5A 5E2WH 3DRTA 4NQVB 5J12B 1QSFE 1I8KB 4IMKA 4N8CL 2L0DA 4MSWA 1K4DA 5EOQH 1T7VA 2H1PL 2NY7L 3MRRB 4JZJB 4FQHB 3S6CA 3LKOB 4I0PD 2V17H 4OUUB 1P4BH 4C58B 1VCAA 2R8SL 2YXFA 4PGEA 1NCDH 3L7EA 4QCIA 3MBXH 3CZFA 2YPVH 4LOUD 5T3XD 4ZNCD 4DVRH 5GGVY 4OZHF 2AK4A 5A43C 4UINL 1KIRB 2KZWA 4V2CB 3RDTD 1MIML 4R96B 1KPVB 4Y2DA 5EO9A 1HK6A 3L5HA 2VE6B 1AGCB 5DQ9A 5FGCE 5HPMB 2GSGA 4M1DL 3MBEC 4WV1B 2AABH 3QHTC 5ICZA 5JQ6L 4YK4C 5C9JB 3HKFA 4QHKJ 1H3UA 3GM0A 1UENA 4HZLA 3D39E 4GT7A 5IVZB 4KFZC 1F4AA 4BZ1L 1VSCA 5I74C 4RISH 1VACB 3F7YA 5D1XB 4KHXH 1K4CA 1CLZL 3MRMB 4AK1A 4NRZB 4OLXH 3CX2A 4NZUH 2IQAA 3MODL 3X11B 3GHBL 2QSVA 5ITFA 1RK1B 4M6OH 1QEWA 1AQKH 1HHIA 1CFSB 1DVFA 1FO0L 1T5XA 3K1DA 5IW1B 5FOBB 2NY4B 5EU6A 3VRJB 1F6AB 4LMQE 1LEGB 4Q97A 2B1HL 4PJGF 1FVCA 2DD8L 2EDKA 3KPPA 4MA1C 1NMAL 5CJQH 3P0VL 3PP4L 2QL1A 1IGFH 2AEPL 1S7TA 3OJDB 4Q9RH 3MJ8B 1RUKH 1BWWA 1SBSL 2B5IB 2PO6A 2ZNWA 4MAYC 4ZPVB 5C7XH 1AI1H 4JO2L 1MHEB 1CLCA 4X7EC 5GS2H 5CILH 3GIZL 1YEJH 2OSLA 4BQCA 4CDGC 1JWMB 2J88L 5DVLA 3DHJA 1V05A 1F97A 1FFNA 1QQDA 1AGFA 2AJZA 2Q76A 4MCYA 4XZUA 4C83B 4M1GL 1BD2B 1P4LB 3HCVB 3FQRA 4P2OC 2H2SD 4JRWA 2XKUA 1EJOH 5EZLA 3RZCB 4PBVC 3TYFB 3KPSA 4KGJA 2FO4A 5E8PA 4APQB 5IB4B 4X8XA 3LQAH 4WENB 3S5LB 3ET9F 4F7TB 5C8JA 1I8MB 1S9VB 3MO1B 1VEPA 4V1DE 1KTLB 4I5BA 4BFGA 3EO0B 4HIIB 2G2RA 5B3NA 3LZFL 4TTDD 5SV4A 2EDJA 2JK5B 3P4LA 5BS0D 5E4EB 1CG9B 4N9GA 4HWUA 3Q1SH 1QBAA 4JGJA 4G7YH 2Z35A 2VZ1A 3VXNA 3IFOB 5F1NB 3IXTB 1S5HA 3VI3F 3MRFA 2VZSA 3ULUL 4TVPH 4OM0H 1SYSB 4PJIE 4XC3H 2R69H 3T8XB 4U1NB 3B9KB 4PUBH 3NABL 4K3JL 4JM2F 3T65A 3W2DL 4U1HA 2OR9H 5FA4B 4Y1AB 3T04D 4ZDHB 4G80A 5ISZA 1B88A 2V5TA 3RY6C 3EYUL 2GYSA 3RVTC 4UNUA 1UACL 4NQCB 2BNRE 5KSBB 3CFJB 1QG3A 2HT4D 3ARWA 4HKZA 1HQ4B 3ZKXC 4DZ8A 3K4ZA 5F7KC 1S7QB 3RWFA 5GS1B 3CIQA 1YA5A 3QAZB 5D72H 3DX8A 4M5YH 1QRNA 4HCRL 4GXVH 5FGRA 3I50H 4K9EL 1Q9LB 2JJSC 1V3LA 2EEAA 1SMOA 1KNOA 3RUGF 3VFTA 4MGXA 3RGVC 4Q9QL 3O3DA 3MTRA 2FSEB 1ADQA 1JRHI 3V6OA 3VFGH 1U3HA 1MFDH 4BH8B 1VFUA 4ZXBC 1NBYB 1QLEH 3DXAA 4I3SH 3D69A 4JO3H 4LVOB 4L5FL 3ZDYF 5H37H 1NDMA 3WJLA 5BW7A 5ERWB 1NSNL 2R0ZH 4Z7UA 2AI0H 3NACH 1BIHA 3ECBB 1T89C 5L2JA 4JRYD 1DZBA 2VDNH 3MV8A 4U6HA 4LSPL 5DGQA 1L0XA 3RAJH 1RUQH 1TCMA 4YDKH 4NPYB 4I0PB 1CR9H 5EBWA 2D2OA 3SE8L 2R4SL 3QEUA 1AO7B 4IIQA 1NBVL 1XGYL 4NBZB 1P7KA 1RZ8A 3KPLB 3U6RA 3QDHA 5DQDH 3QZWB 4MAUH 5HPOA 2H3NA 5C2BH 3BUYB 1AD9B 2EDXA 3HR5A 5EOTA 3RDTB 5JR1L 5DZLA 1UKQA 4AENA 4P3CL 1MCEA 4JJHA 1ZA6A 3INUL 3FFDA 3JSSA 4ELMA 3S3PA 4GRWE 2ADFL 3EOTH 4N5EC 5FKAB 2BRQA 4XMPL 1QZ1A 2WIIB 3L1OL 3NA4A 3PWLB 2N4IA 1OP3H 3S3JA 4KKCD 5H37G 4HAFA 4PJBA 3SN6N 4I48B 3LV3A 4KWUA 2RQ8A 1M4KA 4QRUB 2XA8H 3V5HA 5FM8A 3OKOA 4HC1H 3G5VA 4RFNC 5GPRA 1EEYA 4LVNC 4HKJA 4MNQD 1A8JH 2BVOB 1BECA 5TH2B 4FZ8L 2FNBA 5DJAB 1R5WA 1G7IA 1OSPL 1JPST 2CKBB 2BHYA 3V4PL 2ZSWB 4ZNEE 2EDHA 1D6EA 2DIAA 4HGWA 4XVUC 1NCWL 2Q3ZA 5IIEA 5SWQB 3SE3A 3M17A 2VQUA 5EUOF 5LG1A 3HMXA 4YHIA 3MCLH 4IRSA 2P44B 1SEQL 4QXWA 4FMKA 3ZE0E 2Y7QA 2AQ1A 2KZ1B 1I9IH 4DZBA 4O9HH 5LGKA 4F8QA 1ROWA 1L6ZA 3KXFE 4BSJA 1LEIB 4XXCC 5GISH 4N8VA 1LNUB 3NCJH 1QBLH 1G7HB 4MQ7B 2Q6WB 2VH5L 4NC2B 3JUZA 4H8WH 2Q8BL 4ZFOL 4Z95L 4PJ5E 4HS3B 4HWZA 4G3YH 2ZJSL 3BPCB 4LHJB 4G43B 4R8WH 4RGMC 3MR9A 1JTOA 3QSKB 1I7ZA 2XOTA 3L3DB 2F58L 1D5IL 4L9LA 5DEGA 1BWMA 2FATH 3SPVB 4EXPX 1DN0A 4XNMB 1XFPA 5KVDL 3MUJA 1BM3H 2OR8A 1AIFA 2XPGB 3NA9H 3TYGL 5F9WC 2E27L 3WLBA 2E9JA 4YIQB 1A4KB 5BS0B 2NQCA 4RGNC 3WKMH 1HSBA 5FDWA 3OQ3B 5I0DA 2X7LB 1AQDB 2DQIL 4S1RH 1S9WB 4NQEE 5DJ6B 3ALPA 4I18B 5IMKA 1A22B 5ETUA 1IEBA 2WBKA 1VHPA 1NEZG 4XPGH 2F54E 5KANG 3QQ3A 3O6FD 2WUCH 2AXGB 5DC9B 1LK3L 2Y06H 3BX7C 3MGOA 4HWBL 1G9MH 5SWSE 4ZTOH 1IAOA 1EUUA 3DTXB 1MFEH 4UQ3B 5IFHL 2QKIA 4PB9H 5DRNA 2IWGA 5CHNA 1DFBL 5C0ND 3IFLL 2HLFD 1YDPA 2J8UE 5HYQA 5IVXF 1HZHL 1HH6A 4ZTPL 3KYAA 3T2OA 2IQ9L 4H0IA 4PTUA 3IVKA 3MUZ1 1JI2A 4HXAL 3FB6A 1F3RB 1A7PL 2GITA 1YYLL 5IBLD 3MA7A 3LKNB 4QXUH 1Q9OB 4OLYH 2LQRA 2DM7A 4MJ2A 3OAYH 3PXHA 3HC3H 1FNEA 2YC1A 1YEFH 4CVWA 2VLRE 4HEPG 3TZVA 1WCBA 2HVJA 4PJCB 1RK0B 1SBBA 1OY3B 3D85D 2WANA 4NKIL 3HPLA 4JQVC 1I3UA 3LB6D 1ZSDB 3CH8A 2F19L 2W0FA 6FABH 5GJTH 4R97C 4QRPA 2HT2C 3IETB 1QFPA 2X70A 3F6LA 3OKDB 1ZGLA 3TO2A 3OJMB 1S5IL 5JW4R 1FPTL 2AQ2A 4XT1C 4X4YA 4NZRH 4G9DB 1KLFA 4JRYB 3UP1A 1Z5LA 1W72A 3VFRA 5GGUB 1U8QA 5E9DA 2QSTA 3HRZA 4IOFC 5L2KE 4PP1D 2EZ0D 4X99B 3VCLB 1HHGA 4OCYH 2DQFB 3TVMD 5K9JH 2DOCA 4JHBA 1KYOJ 1KJVA 4YNYB 1HCVA 4K94L 1EIBA 1UB5B 2PXYB 4ZAKD 5B8CB 3GMLB 4Z18A 3ARBB 3QUYD 5ANME 5FEBA 4OCWL 2VQ1A 1YEDB 1KACB 4EQ2A 3KPMB 5C3LD 3RY6A 3BH9B 2ADIB 3QIUA 2VERN 1CDUA 2DLTA 43CAA 3FRUB 2J6EL 1WZMA 3QNZA 1F4WL 1T20A 1VEMA 1OTSD 5E2UL 2DL2A 1A6ZA 1NKRA 5BXFB 3DROB 1EZVY 2XG4A 3VGAB 2ZCLL 5D9SB 1OCWL 1UQSA 2DM4A 3VG0H 4F8TA 3U7WH 1BLNB 1R5IB 5CZXC 4MNQB 4GRLC 4RNRB 1OTUD 2V2TB 5GGTL 1CZ8L 1HDMA 3GEWB 3E2HB 4C57C 1ZWIB 3MGTB 5I66B 3NZHH 4ZFZB 5JW5B 3NGBB 4DEPB 3GSNL 4EUPH 1K8IA 4FFVC 2BFVL 4HQQH 1I7UB 3K46A 4J6RH 4XXDB 3WFZA 3GK8L 3HB3D 3SKOA 4JZNA 1BGXL 1RJZB 1RZGA 3W9DB 4AG4H 2WMPA 2FEDC 1T04A 3LD8C 3RHWK 5DD1H 5K59F 1TJHL 4KY1L 5HGHA 2BSED 1LK2B 1LP9F 2WINA 3TA3C 4HPYH 2BY3A 2AV1B 1L6XA 2WQ8A 3W0WE 3AXLB 4K3GA 2X4UA 3ME0A 3VXSD 5MHSD 3RQ3A 5I8KL 5TE7L 3FN0L 1EJ6A 4NKQB 1HIML 5J11C 3G08B 3WS6C 2BSSA 4P57B 3QWQB 4AT6A 1OAYH 5LCVH 1MWAA 4M7LL 3VXTA 3LS5L 5DMYA 4G5ZL 4HUUA 4DKFL 2AXHA 3GBML 1SMAA 2FH6A 1JGLL 4G6ML 4XP4H 4YPJA 4O5LL 3HRPA 1QSEE 2E9BA 4JY4B 2VXTL 4MJID 3RIFK 1TNNA 5DYOA 4GRWH 3HS0A 4M02A 2AEWA 1A0QH 5TDPB 2YEZA 4OZGA 5FYKE 4NKOA 3BAEH 4LHUA 3QWOB 2NX5E 1A7QH 2H32H 3HNVH 3SKNB 2NZIA 3CDGB 3PWVA 3CZJA 5I1IH 3VFVB 3ULUC 3WS3A 4FP8L 3PNWB 2AXFA 3KPRA 4ISVB 3V0VA 4LLMA 5JQHC 2HH0L 4LCWA 2A74B 3ROLA 3OB0H 4I3RH 3O6LH 5A2LH 3QDJB 3R06A 2VXVL 3IJSB 4KMTL 4X8JB 1KTDB 4YDLB 2PNDA 4NRXB 4P5TD 4NC1C 3LDBB 4MZ2A 4YX2L 1JWUA 1CDCA 3SDAC 1B4JH 4S1SL 5B21A 5ICYA 3MRLA 2I60H 4TSCH 1G0YR 5TDOB 3RL2B 1EHNA 1IM9B 3OKEB 1A4JB 3OKKB 4FQQA 1CT8B 4K9EC 1I9EA 3J7HA 3S34H 4JFZH 1VGEL 3D25A 3OPZL 3ZSSA 1EHAA 5KJRH 1N4XL 4PJ7E 1M1SA 4LBEA 5DD5H 2P1YA 4Y4KA 4QRTB 1ZVYA 1ZHBA 4GMTL 4FXKB 4M1CC 3MLZL 4N0FA 3UDWA 2OTUA 4BQ8A 3UPCA 1F90L 2JCCA 1FN4B 4H26A 4L4TB 2X4SB 5K9KA 2IFFL 3FT3B 3W39A 3TFKC 1U8NB 4HUNB 3B5TA 3TBTA 4OZIA 4WDIB 4Y5YC 1DUYA 4YDIH 4OD1L 1XH3A 3D85B 2C3WA 1QO3A 3E3QC 5H2BA 2R2BB 5I1DA 4HBCL 1ORSB 1ED3B 1E4KC 2HJKA 2VTFA 2Z93B 1WZLA 3LSOB 8FABB 1E28A 5C0BA 2C26A 2YK1H 5IMMB 3I6KB 1C16B 2XWTB 4E42B 2I5YH 2UWEA 5LBSH 2ERJC 5HGAB 5ADPH 5E6IC 1LO3L 4JM2D 1UT9A 4E41D 3L3JB 2APTA 5EU4B 3ZE1E 4K55A 3QYCA 1IQDA 5DO2C 3TVMB 3VE0A 3ZT5A 5KS9A 4XH2B 4TYUA 1Z0NA 4ZAKB 2WIMA 2OS7A 1XR8A 3E6HA 4JE4B 4LRNH 1BZ7B 4K3EL 1GCFA 2K7PA 1J1XH 3I2CL 4JFQA 5FO7A 5IWLC 3P11L 1ZT1B 4MB4A 3UYPA 4KDTC 4DVBA 3BQUD 2VB5A 3U46B 5H35B 1WV7T 3PL6D 3LEYL 2BVYA 1S78D 4FXLA 4OAWB 1INQA 4U1KB 5JOFA 2G60L 1AD0B 3AMLA 1UH3A 4HF5L 1T7YA 5L8KB 3TH4T 1FV1A 3P77B 4S10A 4GW4A 1YEHH 5E8NB 1PVHA 4W81A 4XWGL 4NZTH 2GJ6D 4O51B 4Q58C 5GS0L 4X6BA 4MNHB 4YXLH 2XRAH 1NFIB 4O4YL 3PDGA 5CMAA 2HG5A 2CR3A 1S7VB 4JFDD 4YO0B 3S37H 3W9EA 5GGRA 1CDBA 2DLHA 1G7QA 4ENEC 5DMKA 1A6VH 4F7PA 1CL7H 5JOEA 4QRRD 2DJSA 5CKAA 1IAIL 1Q8MA 2A83A 4O00A 4PG9A 4XMLL 1DBAL 4S11A 4AEHL 4LCCC 2JIXD 4X7FC 3VWKA 3DV6A 3VXSB 5E2WL 1RUPH 1HI6B 4GKZB 3OX8A 5MEPB 1DBKL 4FG6C 1WT5C 5I1JH 1OSZA 4XC1H 5F6HI 1G6RH 1SYVA 5SWZA 3U0PA 2FD6H 3U79A 5I1LA 5I16A 5IW6B 1BVLA 3AS1A 1EHLH 3CLFH 3VXUA 2XG5A 4ZODA 1P4BL 3KJ4B 2YMXL 3HZYB 4Z7NE 3PJSA 1NCDL 4XPTL 5JIHA 3CMOL 3MBXL 3QEGH 2JJWA 4DVRL 4MJIB 3WLWC 2F53B 2AKRB 4HIHB 1E4JA 1V7NH 1CIUA 1GAFL 4U31A 2PKDA 4OFYA 3RX8A 5CZKA 5E1AA 3GMMB 1MAKA 3HAEG 4GW1A 4LCUB 3ZT6A 4LLYB 4JREB 3EKCA 4Z0XB 1AC0A 2VITA 2AABL 4P4KD 5F70A 4JANB 4UQ2B 1U36A 4ODUB 3L95B 2CK0L 4BSWB 1P9MA 3TT1H 4A6YH 3T0BA 3WFHA 3OAZK 1BHGA 4RISL 3B3IA 4P5TB 3UJJL 2CRZA 2KKQA 1QBML 3MJ9L 4Y8AA 3DUUA 4PJGB 5T3XL 2ADJA 2Y72A 4OLXL 5HDLA 3FONB 4NZUL 2IGFL 4FQJH 2D03H 3JVGC 5DLML 4CN1A 2BNQE 4FHBD 5GSVA 4OIIH 5ID1B 3GSVA 4EN3D 4M6OL 3NPSB 4ZSOB 1FFOB 1S7UA 3TN0C 1XGRA 1IZKA 1S7WA 3M1BA 3MLXH 4JB9H 1P2CA 2F74B 1K8DB 5FF6A 1K5NA 4YFLF 1BAFH 2Z91A 4O2CA 5D7SH 4NP4H 3A6BH 1CFBA 2A73A 4GQ9L 5CJQL 1IGFL 1GHFH 2OTPA 4MD0B 1UWGH 5F9JA 2Z4QB 5C0CD 1NJ9A 5C7XL 1J5OH 1AI1L 1BX2A 4UDTB 5I15L 4JY5H 4OD3H 4Z7UF 2XN9D 3K7UA 1PFCA 2VDRL 5JPNA 1GXEA 3TCLB 3WCYA 3NFNA 3TBVA 1JGEB 3PHQB 5EBMB 4G6FD 5FYKH 3BRFA 5J3HD 4C4KO 5E99L 3MLRH 4ETQB 1EJOL 3BKMH 4U1IB 1ZLSL 1NC2D 3FOLA 2HT3D 3BKCH 4RCAA 1X5FA 3QIBD 3BGMA 1RZKL 5FECB 4RAUB 4K94C 1YYML 1RJCA 5DVKA 5EUKB 4WWKA 3PIQB 4JY6A 1A3LL 3BP6A 4IHOB 2B0SL 3WIHH 4ELMF 3QWRD 1TZHB 4YBLB 3TNMA 2ZUUA 3TPKA 3D0VB 1HXYB 4JM2B 4E41B 4PRAB 2FO1A 2H26A 3C8DA 3Q1SL 3H7BB 2CDEA 3CH1A 4RWYH 5DUMH 2F5BL 4PJBF 2HAZA 2YRLA 3RWEB 4N0UE 4HGMA 4NT6B 4D2NA 5HGGS 1T03L 1KJMB 3OR7A 4OM0L 4XC3L 5EO0B 4Y4HD 2V9TA 1KULA 3QISA 3AU1A 3B9AA 4PUBL 3UJIH 3B5GA 4ONOA 5D7JD 1T66D 1MFBL 4JAMB 4X0KB 1A1OA 4PY8I 4KI1A 3BPNC 3DMMD 3WFEH 1R3IL 2KQMA 4X98A 4NOFA 3BQUB 3SDXA 4LCIH 5BZWA 2K3TA 3RUGB 1HH9B 1FVDA 2FWOA 2A6KA 4F9LC 1I1AA 2HJLA 3WHE1 3FRPG 5JHLL 1UWXH 5D72L 5J1AB 4EDWL 4M5YL 4CJ0A 1KEML 5CGYD 5D7IA 4AEIH 4GXVL 3BZ4A 5CJXC 1EFXA 5BZDA 1DN2A 5DC0A 1FZKB 5BMFH 3QBTB 5HVGB 4F37K 1R5VA 2ED7A 4EXKA 3L3HA 2GT9A 1KUMA 5B4MC 2X4QA 4OSUH 3VFGL 3D2UD 3FHAA 1MFDL 1I1RA 4JFDB 3P9LA 2X44D 1RJLA 1QLEL 5E8DH 5D4QA 4NYLB 2Z31C 2AV7A 1S7RB 1IM3A 4QRRB 3V6FB 1RD6A 1CFNA 3OKLA 3DWTA 4PGCA 3DRQB 5HTSA 1AGDB 2JIXB 4J8RA 4KI5E 1FL6B 4YDJA 3NCBB 5LVEA 4LLAA 2NY2B 3C5JB 3FL7A 2DI7A 2AI0L 3BW9B 3NACL 2C1PB 1IGIL 4XHJD 4KTEH 3SKMA 1KPUA 4ODVL 3QEHA 4GAGH 2BOCB 4NM4H 1YEEH 5DK2A 2N7AA 4JFEA 4MYWB 4YUEL 3RAJL 3EHBC 4ORGA 3QDME 2NW2B 5J12C 3DSFH 1P84K 1V8HA 1RUQL 4ZO7A 3OKYA 4JR9L 2NTFA 1BFVH 1KIPB 5DMIL 4ZPTB 4EI5A 4LLWA 3MFFA 5IWLA 4P2QE 1KJ3H 1A7RL 2AEQH 2BOBA 1MRFH 5C2BL 1D9KC 2VZUA 3B43A 3MV7D 5HYIA 5IQ7H 1IEAB 4S1DC 3T4AB 3MYJA 3HUJE 4NWUL 5E56A 4JFHD 3QA3A 4Z5RA 1GGBH 5C0JB 4ZO6A 4G6AC 1FRGL 1CU4H 5E4IA 4P4KB 3QJFA 2Y4SA 4HK3J 4RBPH 5IESH 4TSAH 1K3IA 1KJ2L 1I3VA 2FRGP 5FHAH 4TTGA 1I1FA 1NGXA 3IRPX 4WV1C 3BKYH 5IFJA 4CL7A 1SEBA 4MD5B 2VLKB 2EDWA 5EUOB 2EXYC 2R1YA 4L3EB 4GAYB 1T0MB 1Q0XL 4WCYH 2CK2A 2Y5TA 4Y19A 4R4FH 1X7QA 3DVNB 3DX9A 5CWSB 1N2RA 4XNXH 4PV9A 1BBJA 5D1XC 5AUMB 2V9QA 4MJ6A 4EN3B 2VLME 1Y6KR 1HHJB 2YD4A 2L4OA 5KTEL 4ONGL 1FVEB 1S7SA 1UA6L 5DJCB 5JORA 3QUZC 4LCCA 4PV8B 1WFUA 3V9FA 5ACZA 3MCLL 4RIRB 4HS6A 3L7FB 5D1ZA 1CE1L 3IJYB 4F57H 1I9IL 2NY4C 1EDQA 2BSTA 4O9HL 4WJ5A 5DSCA 4F9PA 4YFEA 5C0CB 3VFSB 4HBQA 3CX5J 2OTWA 1FGVL 3FTGA 2XN9B 3O2DH 5F9OL 2FHFA 5DK0A 3GSOB 1KTRL 4H8WL 3DUHA 3T0EE 1HQRB 4WTXA 1ODAA 4G3YL 4G6FB 1D5MA 1WIPA 4GLRI 4HX1A 3WBDA 5F1SA 2N1KA 2XXMB 5J0BA 2ZCKL 3BT2L 4P9HL 3SGJA 4FMFA 4NO2B 3HI1A 2Q86A 1NC2B 4Z7UE 2FATL 2X1OA 1JUFA 3U2SB 3OHXA 5CEYB 3I75A 4DOHE 2WWKO 3V5DA 1BM3L 2OXHA 1F3DJ 4APQC 1WTLA 3REWA 2HA1A 3NA9L 2DKSA 2R1WA 4X6CA 3VXQB 4H5SA 3C5ZD 3GJFH 1ORQB 3LH2L 4PRNA 4LF3B 1CDIA 1OLZA 2CLRB 3N1MC 4S1RL 2B4CH 3WXVH 1NGZA 1RU9H 2ENYA 3NFSH 2H6PB 4DQOL 1F8TH 1J9CT 1UGNA 7FABH 5MP6L 5IVXB 1WWWX 2RR3A 3EJZC 4Y4HB 4ZD3H 2Y06L 4Z76A 4M7ZB 3HI5L 3QDJE 4ZTOL 5KAQG 4JDVB 4PJBE 5GS0C 3DMMB 3B9KC 1AJ7L 3L3IA 4NQDB 4WFEE 2AVGA 1FORH 3D5OF 4MXWH 3WIFB 3BEVA 4PB9L 4FQCH 5E70A 4JGUA 4AY0A 3OF6A 4OGXH 3FFCB 3FZUD 5MERB 4R26L 3FQNB 4Q74A 5HGDB 3U0WL 5C0EB 3BWAB 4QXUL 2AK4D 1U3YA 4QY8B 5GS1C 2FZ3A 4L29B 3LN4A 3VXME 1U93A 2CJUL 5EU7E 1RZ7L 2FGWH 2QQNL 5JHDA 4Y2DD 3GRWH 2ORBH 3ROOA 3O4LA 3AM8C 5FAAA 1U8OB 3WFCH 4DKDC 2A6DB 2I07B 1C12A 5DFTA 5EC2A 3EGSA 3QCUH 1MCQA 3WUWG 6FABL 4IMLA 4JO4L 4L3CA 4P46A 3QPQD 1XF2B 2OLDA 4L4TE 5L0QB 3C2AL 4LVOC 1P1ZB 3DBXB 1FH5H 4OZGF 5D1QA 4TOYL 4EVNA 1MH5A 1MJ8H 2VLJE 3BGAA 2PTUA 3OBAA 1QFWH 1CFTA 1AP2B 1G7LA 5JZ7D 3GFUA 3GSRB 1CLOL 2BHUA 4QHNA 1NAMA 4FN0A 5DHYB 3VFOB 1CIDA 5K9JL 5FUCC 3BEWB 4Y16A 1X5YA 5HDBF 1DVFD 4I0PC 5IHZA 3KLSA 4NFCA 5EU6D 5ILTH 1T4KA 4ZFFA 4L8DB 2EC8A 1A6TA 1U58B 4LOUC 3I6GB 2EEBA 5IQ9B 2PO6D 2D7TH 3B6SA 2B20A 2FEEI 1J88A 4PP2B 4W6WB 3IDNB 4JPIA 3H42H 1E27A 3QJHB 2ICEA 4YLQT 5I1AA 2B39A 1IKFH 5C08A 1KLGA 1KB5B 4U7MA 3VG0L 4QXTA 3U7WL 4M61B 2OJEB 5I30L 4P3DB 1HYRC 2COQA 1XAUA 2ZOLA 3F7VB 3IDMB 2HP4A 1LGVA 3UYRH 1NUGA 3P2TA 4QT5B 1UJ3A 5I1HH 5FO8A 5J1TC 1LP9B 1INEH 1OF2A 3MOBH 3NZHL 5GGSB 2HKHL 3KPSD 1PX3A 2JCCF 1XGQB 1JJUA 3I6LD 2FJGA 4HQQL 5BJTB 3DX7A 4J6RL 3V5KA 4JFFA 4WNQB 4X6FB 2C1OA 4ZUWA 4AG4L 5C07A 5IG7B 4OZIF 4WFHD 2BJMH 1WC7B 2XACC 1H0DB 3S37X 3QPXH 4QYOB 4IOIA 1KCUL 5T33H 1BBDL 1JHLL 1FC1A 2VQTA 2NZ9D 3O8XA 1RZKC 2DLGA 1AKJB 5LCVL 3HA0A 3O0RH 4C54A 4OIBA 2AAVA 3TBWB 2UWEF 1TPXC 3T4YB 5E6ZA 5B38B 2DYPA 4P23A 5DGRA 5EIIB 4ODBD 4XP4L 1D9KA 1UC6A 3KLDA 3MRPB 1BFOA 2AJXH 4UB0L 1C08B 3FB8B 5F71A 5FGSA 3RHWF 4UNTA 5EZOH 5ISZD 4QHLB 4Y5VC 1ERNA 2YS4A 4BFIA 4JN2A 1F5WA 2J8OA 5KS9F 3FO2A 5JMOC 3BIAX 2LTQC 4PB0H 1B0RA 3BAEL 4L4VA 4UV4L 5T1KA 2YWZA 3VXPB 1A7QL 2ZSVA 2MHAB 3S4SB 3AC0A 3LKSA 2CRYA 3VJ6B 1JTPA 3GGWA 4POZD 2FIRT 3MNVA 1QRND 2DQCH 3ZO0A 1KEGL 4XAKD 3O6LL 3ETBF 1FYTE 3HZVA 2ZUQC 3MQIA 4X9HA 1YN7B 3RIFF 1ES0B 5B3JF 5HYJA 3QQ9D 3WN5B 1MJUL 1U3HD 1BOYA 5I0ZA 3MRNA 3SDDA 3CU1A 3DXAD 4JG0H 3EO1A 1SJEB 4YHLH 5H8DA 5IW3A 1BVKB 1JGDB 2ATKA 2I60L 3X14B 3B5HA 3IDJB 2D7OA 4BSVB 4JRXE 4PRBB 4XCYB 4TSCL 5F96H 4I18C 3E0GA 1CGSL 4LLUA 1GGYA 3SGDI 1CGUA 3KYOB 2P5ED 4UT6L 1JFQH 3DRTB 4RMRA 3S34L 4JFZL 2PYEE 1K4DB 3MV8D 2WWMD 2EH7H 2Y36H 4ZOAA 2RFXB 4UI2A 3VFNA 4KC3B 4ZSOE 4AZ8A 3MLSH 1F3DH 3K1KC 3OKNA 1ZAGA 1ADQH 3RPKA 4PGEB 3SJVA 5JA8B 2HT4C 1NCAH 3L7EB 4QCIB 5CJOH 1M7DA 3CZFB 5FB8A 2J4WH 2AK4B 3C8KA 4XB8A 5F9AC 3EFFB 4NO0A 2O5YL 2FHBA 1FSKB 1S8DB 1Q72H 3ZDXF 3GSQA 4Y2DB 1HNFA 1T2JA 5DQ9B 5E00A 4YDIL 5EZIH 4ETYA 2GSGB 3NTCH 4RA0C 5HI4C 1JF6A 1T0NB 4KJYA 5ID0A 4EKXA 5ICZB 3RTQA 5T3ZD 2HRPH 2FBJH 4WFED 5GZOD 1AFVH 3CVIH 4AL8L 4JQIH 4XCCH 1C7SA 3JTTA 3QG7H 4WW2A 5EB9A 3F7YB 4F33A 1X5GA 2I5YL 4LRIC 3OB8A 1K4CB 5LBSL 1NFDA 4MZ3A 5ADPL 4QXGL 3T09A 1KGCE 2IQAB 4KK9D 1HCFX 5D7LB 2VZVA 4XNQA 3N1GC 5JOPE 4C56A 1RV6X 3D3VA 2A1WH 1Q9WA 1QEWB 1HHIB 4DKAA 4R90H 1DVFB 3FB5A 2JE8A 1A3QA 5EU6B 3JWOH 3P73A 4IRSD 2F5AH 4ZUUA 1FVCB 3CFBB 3OZ9H 3QH3A 4M7KH 5ESAA 2PO6B 8CGTA 5K9OA 2ESVA 4GG8B 4X6DA 2EECA 2CIKA 4KUCF 4X9BA 1PGRB 4WEBL 1FBIL 2OSLB 1XIWB 1NEUA 2JJVA 4Q0XH 4KRPB 4NN7B 1D7FA 1FFNB 4KKCC 4D0CA 1QQDB 1AGFB 3HI6L 2AJZB 4MCYB 4OD2B 4XZUB 3N50A 4P0DA 5LGJA 2DKUA 3KS0J 4FTVE 1W0VB 4NCDA 5DDHA 4YXLL 3KPSB 4NFBA 3K2UH 4IDJL 4M7LT 4RGOH 1LDSA 1UADC 2FO4B 3E2HC 3ILPA 3PWUA 5E8PB 4LQFH 1A7BA 4MX7B 3F58L 5C8JB 3Q6GH 1NKOA 1U42A 4YH6A 1CL7L 4H8WC 2UY7A 3CDFA 4LIQE 2G2RB 3QHZH 3V4VH 4F3FB 1X4YA 3EJYD 2X4NA 3DNKA 1B2WL 1OM3H 3BIBX 2DQGH 1RUPL 2Z35B 4P9HC 3VXNB 3X12A 2K7QA 2WV3A 4AMKL 2HMID 2DMCA 2DDQL 3O9WA 4Y88A 1DQDH 1G6RL 2CMRH 3MRFB 2FD6L 3VMPA 1WZ1H 3C2SA 3CXHJ 1DBJH 3P30H 4KRLB 1Q38A 1N0XH 2ZUWA 3UO1L 3T65B 5F7YC 5HDOA 1JZ2A 4MMXC 1YC7A 1LILA 1MCKA 4G80B 1O7SA 1I8LC 3T3PE 2YPLA 2AP2A 3RL1A 1V7NL 1JHTA 3U30C 1UM6H 3WFBH 3RIAK 1LO0L 3WE6B 4HKZB 4DZ8B 2D31A 3TBSA 3RWFB 2ARJQ 4XCFH 2ICES 1FGNH 3DX8B 1CI5A 1NMBH 1QRNB 3MXWL 4XBPA 3K4DA 5DVOA 4HT1H 1RULH 3FO0H 4A6YL 3SDXF 3RVUD 3SDCB 3W82A 5E7BA 3VFTB 3NMEA 3TZVD 1X5JA 4DUWA 1U3HB 4YDLC 3KJ6L 1F58H 4FQJL 4UT7H 3DXAB 4NHUA 3D69B 2D0FA 4QRPD 2EC9T 5D7IF 1NDMB 5DQJB 2G5RA 5E2TH 3MLXL 5D6DA 3KGRA 1BAFL 1OP3K 2VLKE 5D7SL 2P5EB 4PJXB 3O6FC 4XX1E 1J0IA 25C8L 3V6ZA 5L2JB 2NY1D 5EU5A 5C6TL 2H45A 1PG7L 4TUOB 2RCSL 5GS3A 3SDYL 3HFML 3MV8B 4U6HB 4U1GB 2ATPA 5E9DD 4QGYA 3X3GH 2AGJH 4LKXA 5EBWB 1GGCH 1J5OL 1ZEAH 3QEUB 5C0NC 1DDHA 4JY5L 1P7KB 2DLIA 3BDXA 1H15A 1RZ8B 1S9YA 3HG1E 3U6RB 5IHUL 1SJHB 2H3NB 4PD4J 4KV5F 3HR5B 1TFHA 5EOTB 4MJ5A 5IT2H 4ZO8A 4X5WB 4AENB 5IBLC 2G75A 2Z0BA 3FFDB 3DV4A 3QIUD 1YUHB 4ELMB 4LASH 4U0RC 3AUVA 3MLRL 2KUTA 2ED9A 4XP6H 1I3RB 3BKCL 1VPOH 2YSSB 3V95A 1TQBB 1U9KA 3LV3B 4ZO9A 3NVQA 3LB6C 5EN2A 4GW5B 3G5VB 1EEYB 4MDJB 3IU4H 4YXKH 4EDXA 3DURA 3WIHL 3MJGX 3QRGH 4U1SA 3OJ2C 1R5WB 1MOEA 3OL2A 4U2YA 2DJUA 1YPZA 5BCAA 3STLA 1MY7A 1A64A 5DUML 5GIRB 1YJDH 1LVEA 1D6EB 4HFUH 3IFPB 4XMKH 1OAXL 4XNZB 5GZND 5IIEB 1X5KA 4LSQL 4D8PA 3M17B 3UPRA 2XWBA 5E5UB 2XT1B 4PP1C 2EZ0C 1QVOB 4YHIB 3SKJL 4IRSB 3TVMC 4U6YA 1YEGL 5CJ8A 3DX6A 2B2XL 1H3GA 1DUZA 3UJIL 4ZAKC 3UTTA 4DZBB 3MV9E 3WFEL 3ZLQC 2V2WA 3SHSA 3QUYC 1QKZL 1I4FB 2BCKB 4PGDA 4CVZA 1X5IA 4N8VB 4DK6A 2OX5A 3TLRA 4JHZA 5AAMA 3NPZB 2APXA 1OTSC 5IFAL 1MJ7H 3PQYB 4J3TA 4HWZB 2QJDA 1DBML 5D70H 1JF1A 1A47A 3EYFA 1F3JA 1IAII 1XF4A 1N5YL 5D93C 4NQDE 4N5ED 5L6YL 1I7ZB 1NMCC 3KYMA 1J1OH 1DBBH 5EORH 4PJAE 1OTUC 4L9LB 5DEGB 2ZCHL 4HXBH 4LHUD 3F12A 1CGYA 1U91A 4ONFH 2X89A 3FFCE 4YK4B 1DN0B 4KHTH 5FXCH 5INDA 1JMZA 5E8DL 3KPRD 4YHML 1MF2H 4OKVA 4LCWD 4CN4A 3KR3L 5I74B 2NTSP 4LK4A 4JHAH 5ABDE 3GHEH 3HB3C 1U8LB 3MOAL 3WLBB 3GIVA 5C09A 3ULVE 4JM4L 4F80A 4XCEA 3RFZC 4Z9KB 4R7NA 1QNZH 3KHOA 1HSBB 5DHXB 4NHCL 5FDWB 4KTEL 2VKXA 4XAWH 2D4FA 3MFGB 4PG2C 5HYFA 1JGVH 4HJ0D 1JMXA 3IRZA 3IT8D 4FFWD 4U6TA 5ETUB 5IMKB 1IEBB 4GKSA 3KS0H 4HC1A 4X6CF 3O41A 4MA1B 3K81A 4QRSA 1IAOB 3I84A 5GJSH 3PGFL 1KJ3L 2AEQL 3KJ4C 4U1JA 1Z6JT 2QKIB 5DRNB 1A6AA 5CHNB 4Y4KD 4LLVA 1YDPB 1OGTA 4TRPH 5DJYA 5HYQB 1GGBL 1XF5A 3IVKB 2AJ3A 1SM3H 3FB6B 4LSVH 4P4RA 2GITB 1DQMH 1QSFA 3MA7B 2XTJD 5FHAL 1N6QH 4ZYKB 4YZFE 2OL3H 3UTZA 5GSRB 3KYKH 4CDHA 4P2OB 1FNEB 3QUMA 2YC1B 1CE6A 2UY6A 4N1HB 1LEKA 2WLYA 4WCYL 1WCBB 2VAJA 3ZYOA 4R4FL 3NCMA 3ARFA 3HPLB 3LEVH 4P5TC 1GZQA 5CSGA 5JXEA 5A16A 3MZGB 3ARVA 3NIDF 2YWYA 1NEZA 4QRPB 2O5XH 1KCSL 2N56A 5I76A 3WYRA 3ULSB 2X70B 1WEJH 5CEZD 5HGBA 5HVFB 3NIGE 5DJZA 4LIQH 5DA4A 5C0BD 4LQ1A 1ZGLB 5FYJD 4OQTH 3NPSC 1OARH 1F4YH 4X4YB 4NWTH 4B50A 4YXHL 2NY1B 1UB6A 1Z5LB 4BA8A 1W72B 3VFRB 4F57L 1KB5L 4AEFA 1EFQA 2NY0D 1U8QB 4ALAH 5E9DB 4WI3A 4NDMA 3HRZB 3D39A 4KXZH 3WMSA 1HHGB 4M5ZL 4YE4L 1KJVB 2CO7B 1DQJA 3NCCB 1EV2E 2Z8WC 5FDYA 5I1KH 1KLUA 5E0QA 4WUUE 2VQ1B 5KG9A 1Q0YL 1RUMH 4PGBB 2XQBL 2XZQH 2FHCA 43CAB 2DBLH 1BIIB 4LU5H 3QNZB 1T20B 3H6JA 2YD9A 4LCYA 3DVGB 5C0AE 4CNIA 1A6ZB 1XGUA 4G6KH 1KV3A 1BZQK 1GIGH 1G9NH 4W4OC 2DWEA 1UQSB 4U33A 5HHXH 5I18H 2FJFA 3VWJA 5FKPA 4PJFA 4HS8H 3MRBA 1HDMB 3RGVB 5E8EA 2DJ4A 2LAAA 3LQMA 3D48R 4ODHL 3WO3B 1TITA 4ZXBB 2YA0A 2ITCA 1DQLL 2IPKB 4LKCB 5F72S 3DGCR 4NM8L 1JNLL 4JM2C 1TCRA 3MCG1 1MLCA 1RU9L 1AGEA 4JZNB 3SKOB 3WXVL 1RZGB 1MY5A 7FABL 3TIEB 1V7MH 5DURD 2IH1A 1T04B 2YKLL 1IARB 3ZYIA 5IK3A 2RAMA 3JWDL 1NL0H 4UTAH 1K85A 2WINB 3TV3L 5CD5D 3VWKD 3OB0K 1JRHL 4Z8FH 4XPAL 2BSSB 2HWZH 4FQCL 1HWGB 4AT6B 1MWAB 4OGZA 4V1DA 2PTTA 1GGIH 5SWZD 4M4PA 2E6PA 1T5WA 4HK3N 3VXUD 3BQUC 4Y19E 2Q20A 5DA0B 3PL6C 4UMGA 2WUBL 1S78C 1H3XA 3GMOA 3RA7L 3BO8A 3MA9L 1FHGA 5FGBA 4PJ9A 5DYOB 4NKMB 5AZEL 2IANE 3ZYZA 4LGSB 4R9HA 1NGPH 4OT1H 4P2YA 2FGWL 4OFYD 3HN3A 4NKOB 3L9RA 3GRWL 1EEZB 4LHUB 4LSRH 4PJIA 5JDJA 4PRPA 5AD0A 2X05A 4Z7OE 3WFCL 3PWVB 4OTXH 4R4ND 4H20H 4YR6A 3WS3B 5B39B 2BNUA 3KPRB 1KENH 3QCUL 3V0VB 4LLMB 1AR1C 4LCWB 4FNLH 5JDSA 4XX1G 3ARGA 3C87A 4S1QH