4R8WL

Crystal structure of h7 hemagglutinin from a/anhui/1/2013 in complex with a neutralizing antibody ct149
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
110
structure length
110
Chain Sequence
EVVLTQSPGTLALPPGERATLSCRASHRVGSTYIAWYQQKSGQAPRRLIYGASNRATDIPDRFSGSGSGTDFTLTIRRLEPEDSAVYYCQQFSVSPWTFGQGTRVEIKRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Hemagglutinin
publication title A potent broad-spectrum protective human monoclonal antibody crosslinking two haemagglutinin monomers of influenza A virus
pubmed doi rcsb
source organism Influenza a virus (a/anhui/1-balf_rg45/2013(h7n9))
total genus 21
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2014-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4r8wL00
4BZ2L 1RZJL 3FJTA 3Q3GB 1P7KA 4KWUA 1QYGL 3H2WA 1OAYL 3AXLB 1JK8A 3VRIB 2R2BA 3MGTA 2FZ3A 5F96H 1N5AB 2BSRB 3PIQA 3GNMH 3C8DA 4N8CL 3MRNA 2IG2H 3U4BL 5INCA 5FA3A 4XBPB 4Z7VB 4OZHB 3JWDC 1E6JL 4JVWA 3BYTA 3VXQA 5EU6E 3WS6A 4YBLC 4KK8D 3MXWL 4M6OH 4ORGB 1YEIL 1J12A 3WL9A 5IVXF 1J18A 2WK2A 3SDYL 4MJ4A 4ETQB 1RJYA 1P7HL 1I8KA 2VRAA 4L8BA 1DDHA 2R2CA 4G9DB 4JQIH 1A6UH 4PB9L 1IAII 4G6JH 4I3SH 5H35B 3QEQD 3T0BA 3KLSA 2HLAB 1F4HA 5C3TA 5C9JB 2EYTB 3IF1B 1S9VB 3RWCA 3QXWA 1NAKL 1NKRA 1D9KA 1OHQA 2LTQB 2PXYD 4O9HH 2FIKB 1KN4H 4I48A 5FYLD 3PQYB 3PDGA 1VGKB 2AERT 3CFBA 1DDHB 1BM3H 4F9PC 2ADFH 4LHUB 4WEUD 4OZ4B 4FN0A 2MSPA 5C0BE 5IMKA 1M6OB 3BYYA 5I30L 5GRJL 3QHTC 4JKPL 4I3GA 3L3JA 1T03H 1MNUL 5D1XA 3F62A 5E0QA 1U8IA 2IAMC 3V7AE 3EZJB 5JHLL 2EC8A 5D7SH 5J3HD 1LP9A 5JO5A 1IGJB 1IGTB 2FJFA 4QEGA 4Y19A 3VWKA 3HR5B 3V4PH 4KKAD 1PD6A 4RGNB 4ZSOB 2QADC 2NW2B 4Q6IA 4M7JH 1DL7L 4ONFH 3QI9D 2AI0H 3TBWB 4FTVB 4TSCL 4FNLH 3VG0L 2IFGA 2CIIB 4PB0L 4JDZA 5IQ9B 4OV5B 2NXZD 4Y5XA 4JJ5A 3RL2A 1DANT 1YPZB 4XXDB 3T0XA 3WKML 3MOAH 5D93B 2W0FB 4K7FB 3P9LA 2EEBA 2WAHA 4PJIE 3WN5B 1D5BB 2P48B 1HCVA 4JVPA 4OCNC 1MWAA 2HTLC 1UZ6E 5BMFL 3IVKA 5E2VH 3S97C 3Q48A 2HA1A 3NA4A 4KDTA 3E8UL 1EXUB 2EC9U 3L3DA 4J3TA 4DOHE 2DD8H 4MJID 3TT1H 3SDXB 1IEBA 5A1AA 1UXWA 3ELAT 1MCWW 1MPAH 1UQSB 3HI5H 4HIEA 1WAAE 4K71B 4JR9L 3PWNA 1XFPA 1MI5A 1RUML 4GRWH 4PJ9C 2P8MA 3SCMC 4JDTL 4P9ML 4GRLD 3V5DB 5L8LB 3BZ4A 1WFOA 1AP2A 5L2KE 4TTGA 4P23C 1YEDA 1YEEL 3MV11 3V6ZA 5HI5D 1I1YA 4E0RA 2A1WL 3GMOB 1YEGH 4P5TB 5FO9B 4I0PA 3TCLA 4G8GE 3VXPA 1D5ZA 1G6VK 4U6VL 4M1CC 1AP2B 8CGTA 3QJHA 2GK2A 4NQXB 1ZHNB 1QRNA 3V6ZB 5T33H 5C07A 5E2UL 1NGXB 1MVUB 4LLWA 4NQEE 4QRPB 3PDOA 4K94C 2YMXH 3MA9H 2DIAA 1XGPB 3H9HB 5DD3L 4UQ2A 2FX7L 3IT8D 3TCLB 4RWYL 4YFLF 4KKNA 1MCEA 3ZE1E 1Z5LA 1UEYA 1BQUA 1JGUL 1EUTA 1QFUH 2CXGA 4WDIA 1KPVA 2R1XB 3GJEB 2YD8A 2X05A 4QOKA 1T1XA 5ITBH 2D9QB 5FYKD 3KG5A 1MAJA 5BVPH 3QUYD 3CFDB 5JDSA 2APWA 5BCAA 2A6KA 1FAKT 1ZLSH 1N4XH 3RNKB 2X4TA 4U1KB 4P3CH 1MREL 3MLZH 1I9EA 4M5ZL 4G6KL 5FUOH 5LCVL 4FXKB 5B4MD 1Q8MA 5KSAA 4F2MB 5JXEC 3SO5A 5LGJA 2J2ZA 4NCDA 3FO0H 3EDDA 2APVA 1F11A 4GMSH 1ED3A 5GS0H 4F57L 3L3GA 4LPXA 4YHNA 4AENB 4IJ3C 1FFQA 1INQB 1S7VA 35C8H 4J4PD 1GC1H 4PRAA 4JCLA 3C5SB 3RVVD 1TXKA 3EYSH 3TO4D 2F15A 4YQXL 5B22A 3T09A 5HGBA 1FO0A 1Q9KA 3U4EA 3OAYK 1G9EA 5SWQB 5KTEH 2AGJL 4P57A 1CICA 4D9LL 5EOCJ 2ARJQ 2OLDA 2A6DB 1C5DA 4MYWB 4MAYB 3KXFD 3EFFA 4O58H 4O4YH 1DCLA 2QKIB 4NQCB 3QHZH 1TETH 5ENWA 3IB4A 1ITCA 2PO6B 15C8H 4PJ8D 4YXKL 1WCQA 1F90L 2Z8WC 3E6HB 4Z0BH 5T1KA 3TN0D 1AQDB 4Z7OF 2QEJA 1BJMA 1W72H 1J8HB 2DQHH 1LMKA 3CVHB 5CZVL 2X4NB 4KZEH 3MGAA 3GSOB 4FQJL 4GW1A 4Z7UE 4P49A 3B83A 2WANA 4YX2L 4HFWB 1MLCB 1MWAL 2DLEA 3P0YL 1QR1A 5E94B 5I1KL 1RPQA 4CNIA 1HYSC 4K8RD 4LOUD 1T89A 2BK8A 3OG4B 4TPRL 1E4WL 4FQCL 4XAWL 5HVGB 4N0CD 1C5BL 1U3JA 3D48R 4LCIH 2IANE 3KPRB 3MO1B 1VEMA 3BW9A 3CFEB 3BIAX 4UMGA 1DEDA 4Y4FD 2RFXA 4NKDB 4RNRA 4FQHA 4R8WH 4DQOL 1FLRH 2ZKHL 3PDDA 1JPTH 2I07B 3QRGL 5HPOA 2GJ6A 3KPSE 3LDBC 3LPFA 4G6FB 4IRJA 1EFQA 4JRXE 3KWWB 5SV4A 3QIBC 4X4ZA 3TC9A 4NZJA 3FQNA 3P11L 3L5IA 4GAJL 5CEZD 2NNAA 5C6PB 4KGLA 1JMXA 5DQDL 5LBSL 1XIWB 5C0AD 1RI8A 3GBNL 4PTUA 2GFBB 1BOGB 4EI5C 1D7FA 1H5BB 2C3XA 4TULL 1A7PL 1KCUH 5K33A 4Z5RA 2P44B 1AGBB 4XNXL 2FJGA 2BOCA 4XNQA 2OTWB 5C0RH 4OZFG 1M7IA 1JHTA 3H0TB 1R0AH 4PRPA 1T0PB 1CL7I 4EDXB 1UYWL 2VABB 4L8SB 1PKOA 4EDWH 3T65B 4CJ1A 3OHXA 3ARFA 3C6SA 4Z5RB 1AQKL 5DVKA 5LXGH 1L6ZA 5TGBB 3FB8A 2CRMA 5BVJB 1CGUA 3BN9C 3EJZC 1JPST 1T7XA 4LGSB 5F72S 4ODHL 3RDTD 3BGMA 1E4XL 4QF1B 3NGBB 3GM0A 5GQBA 5DQJA 1EVUA 4ZUTB 3ULVL 3SQBA 1JFQH 3V6OA 3GRWL 2H8PB 2X1OA 3O2VL 1DBJH 4UIKL 5GRVK 2VR9A 4U1JA 4RZCB 2P5ED 4DFHA 1T0MB 3TVMB 2XXCB 4LSUH 3HRZA 3RX7A 4MZ2A 4PY7B 3CLFH 1ZVHA 1RZ8B 2X4PA 4N0FA 1S78C 1T1WA 1VEPA 2HH0L 1BEYL 5FGSA 4CU6A 2HRPH 2EEAA 5DJXA 4FXGB 5I15L 5FF6A 1C1EL 4OLVH 3MFFA 4W70A 3RGVB 2V2TA 1P4BL 4DZ8B 4O00A 5D7IF 4J3SA 4XPBL 3BH9B 4JPKH 5IF0B 3CSGA 1CXEA 1HQ4B 1NDMB 1NGQH 2P5WD 3T0EC 1ZSDA 2MQCA 3CDGA 3N1FC 1RV6X 2P1YA 2PNDA 43C9B 3EYVA 5KS9E 2ICEB 4P2OB 2A9NL 4XVSH 3VRJB 2R8SL 1OSZA 1YYLL 1A3LH 3HE6A 2H3NB 2YRLA 3DVFA 3GIVB 1FIGL 1IC4H 2NX5B 4ZOAA 3KPNA 3G5ZB 1I7TB 3TIEB 4KQ3H 3ZT5A 5GSRB 2J8HA 1PSKH 3CDGB 1S7XB 2SEBB 4MD4A 3C8HA 3FB5B 4N90D 4UAOC 5FO7B 3ILQC 5HDQH 4LHJB 1ND0B 4WVRA 1CBVH 5EB9A 2IPKB 3LEYL 1OP5H 3QG7H 3HA0A 3VGHA 4P2QD 5KVMC 4PJBA 4I18B 3TH2T 3GSWB 3QJFA 4TUKL 3V4UH 2VDOH 1GL4B 1F2QA 4OSUH 2JIXD 5BRZB 5I1LB 1WWAX 1S7SA 4KRMB 4MA1C 1FZOA 5DJYB 5CWSB 5SWZE 3KPPB 5E4IA 1TJIL 3TYGH 5D72H 3ARBB 1HHKB 3O11A 3FQUA 3LH2L 4ENED 5EU3B 4JHAH 4UDUA 4HGWB 1IKNA 4P0DA 4Y0GA 1YDPA 2H6PA 3PWLB 2WV3A 2AJ3A 2IFFL 3QPXH 3JZ7A 4ZS7L 2WW8A 4J3UA 2B0SH 4RFNB 2EIZA 4JO4H 3QFJD 3QO1A 4B53A 2HP4A 1HHIA 1P9MA 2ZOKB 3IFLH 5E03A 1JJUA 2VC2H 2F53D 4G8FB 4ZTOH 3LQAC 5IW1B 1TMCB 1XR9A 4GKZB 4Z77A 3IU3B 2OZ4A 1OY3B 3D69B 2DRUA 2HFFB 4JKKA 1V3LA 1HSBA 3EBAA 3T0EE 4MSWA 4Y7MA 4PTTB 5J13B 4WEMB 1ORSB 2EDBA 3C9NB 3THML 4TQEL 1K85A 2PYEA 2BNQE 3IXAB 1VFUA 4BZ1H 3AAZA 1PEZA 1T20A 1LDPH 4ZYKB 1CFQA 1NAMH 1C7TA 2XKNB 5JHDA 3VI3F 1F4WH 2QSCL 4LPTA 3K74B 2DMKA 3VXRB 1KLUA 3TT3L 3RVXD 4Q2ZB 4U3HA 4HXBH 3BRDA 1FZJA 3S96B 5IFHL 1NUGA 4HCRH 4X5WB 2VUYA 3N1QC 2F54E 4PPTA 2XZAL 3QUXC 3CVIL 2XWTB 3JV4A 4GAGH 3W39B 2Y5TB 3F6LA 4LBEB 1DQDH 2YZ8A 3RWIA 1KELH 3RWJA 2ZUQC 1X5XA 5C2UB 2BXZA 2D0HA 3SY0A 3TH4T 12E8H 4NQDB 1KLUB 4JFZH 3VXTB 1U8KB 4Z7VF 3UTPE 3L1OL 2NY4D 4GOSA 2R15A 5GGRA 3SBWC 4P46C 3DI3B 2CKNA 2XRAL 4XVUD 3V0WH 1K4DB 2HMIC 5HVWA 5BOZG 4J7RA 1AE6L 1AKJB 1JNLH 4LU5H 4LLYB 4NC0B 3WIHL 1EZVX 3H9SE 4PJHE 5DJ6B 3SGKA 3O4LB 1CZ8L 2Q86A 4C55A 5ERWA 4MXQC 3CH1B 1IC1A 1DLFL 3ARGA 43CAB 2DQEL 1Q1JL 1QQDA 3RTQD 3H7BB 1Z0MA 2GUOB 5DURB 2XN9B 3MLRL 5DLML 1M7DA 5GGQL 5E5MA 1K4CB 1AGDB 4S1DD 2N7AA 2PTUA 1U36A 5HDOA 3FOLA 3O6MH 1EK3A 3TCXA 3G6DL 3ECBB 4UTAL 1LE5A 2IGFH 3MUHL 5D5MA 3WNPA 2EKJA 3MA7A 3BD3A 4LIQL 4Q74A 4LNRB 4UT9H 3IS0X 4X7TA 1U3HC 1WBZA 4LFHD 1V7ML 1QACA 1UVQA 4LK4A 1K9TA 2VXQL 1KCKA 3ES6A 3HE7A 3UROR 3UTOA 4U1NB 3BWAA 4NP4H 5EPMB 4HS6B 4PV8B 5FV1L 4JFEE 1DBKL 2YD1A 3QUKB 5LGHL 1CGTA 3FQRB 5F44A 5AYQA 1DJSA 2E7LA 3HC3L 4Z7WA 3D3VD 4HJ0D 2V2XB 4HKBB 4MQ7B 4DUXA 4PBXA 2R1YB 1DE4A 4PJ5E 2P8PB 4QTIH 4UINH 1QLRA 1D5IH 5I8KH 2W9EH 1NFDB 3QXDB 5E6IC 5FM4A 5I1HH 4XT1C 3IJYA 3MCLL 2A38A 4U1LA 1CXKA 3HNSH 1MEXH 3LKSB 4I4WB 1CFSB 2NLJA 1WBYB 3VI4E 4WJ5A 5IK3B 1MCRA 4Z7WB 1JF6A 2FR4B 1IC7L 2Z9TA 4PGBA 4PJDE 2W9DL 3TH3T 4CU8A 1BFOB 1QBAA 2YPKB 3HLAB 3IRPX 3FT3A 4BSVB 2VWEC 1RK0A 3FO2B 4W68A 1A1NB 5HVHB 3SDXF 4HG4K 1KCLA 2OSLA 1YEJH 3BQUC 1LEKA 5CEYB 1ZANL 3INUH 5D2NB 4HWUA 5IB1A 1J0ZA 3EO0B 3L3IA 3GUTB 1MCLA 4ZNEA 4N9GA 1RZJC 4OT1H 4RIRA 5CSGA 1JZ2A 1JF1A 3N0PB 2EDWA 2ADIA 5SWSB 1A2YB 1U91A 4LSTH 4APQD 1L9NA 3BPOC 1R6VA 1MIEH 1XF1A 5AEAA 2NY5H 1E28A 4YFLI 5IMLA 4OJFH 3LKNB 3VXSE 1TVDA 1CGYA 5ECJE 2B2XL 3REVA 1FBIL 2Y06H 5DGQA 5BXFA 5FKPB 3FT2A 1KJMB 4B7LA 2VDQH 5DJAA 4YUEL 4BFIA 4U2YA 5LGKA 3IJSA 5I66A 2UWEE 3ZO0A 3VD3A 8FABA 4DKEL 4X99B 1T3FA 1EFXD 1CLYL 5C0FB 4R4ND 1L9MA 3ZSTA 5DWUL 4ZUWB 4NRYB 1I9RH 2ZUYA 1TZGH 1YEKL 4YIQB 4KRLB 1A64A 1RIHL 5DD6A 2XKSA 3QFDA 5EOQL 4YHMH 5C8JB 3JBG7 5GJTH 4LCUB 4XMPL 2VLJE 3MREA 5HYJA 2DDQL 5DC4B 1IKFH 3Q1SH 3MXVH 3DUUA 2VDML 4WWKD 1CD1B 1DFBL 4DN4L 3MRQA 4HXAH 1EJ6A 3DX9B 3ZE2F 2OYPA 5J3HC 5J11B 1NLBH 1AO7D 4LHUG 5FYJD 3VXNA 1NUFA 5GS1C 1OTSD 1QVOA 2EYSA 3FMGL 2VWEE 4MLSA 4KKAC 1IT9L 3GSNL 1LO4L 3RHWK 1HILA 4LLMA 1GSMA 3T8XA 1FG2A 4JFXA 3SGEH 4X6BA 1MCPL 1OTUD 4QT5B 5IHZA 5DI8A 4L1DA 3VXNB 2YWZA 2CRIA 2D31A 2EYSB 4NO5B 2K3TA 1WIOA 3NIDE 4KTEL 3V5HB 3VFTB 5ALCL 5CJBA 1JGVH 5DO2D 5FYLH 4YBQD 2FHCA 3GBLA 1WWCA 4XPAH 3VFNA 4X0KB 3ZHLA 1A1OA 3EO1B 1P84K 2O93L 3SHSA 3H3KA 5F93C 3BKCL 3P4OA 3W0WA 4ZUUB 3MLWH 4X6EA 3MLXL 2JJVA 3KYKL 5C0BB 3KYOB 1E6OH 4W4NA 3F7RA 1CFTB 3KYAA 4JQVA 2O5ZH 1TCRA 3DURB 4OLXH 2D31B 4JDVB 5ACMA 4IRSA 1A6ZA 4LEOA 2VUOA 3QEQE 3DHJA 4M6MH 1LO5B 3WO4C 1OTTD 3U1SH 1BWWA 4KMTH 1J05B 4GRLC 5F89B 4G6ML 3MV8E 1EO5A 5IVZA 4B50A 3UO1H 2PYFB 1AXTL 3IYLW 1A6AB 3RGHA 3KJ4C 5HI5C 4PRIA 1UKTA 5JDJA 3TPKA 1TVHB 1OAZH 3QUZD 1UB5B 5IOPA 3S4SA 1LO0H 1BAFL 3U0PB 5HYQB 3HG1A 4LKCB 5T3ZH 1NCNA 4F37K 2ORBL 3MRBB 4WV1B 4Y4HC 4QYOA 1G9MH 2UVFA 1C16B 5GRVL 5L2JB 4WHTB 4GBXD 3FRUA 4ZPTB 4OCYH 1JPSH 4FMKA 4MVBD 1NCUA 3LAFA 2DQIH 4Z95H 5T1LA 2ZJSH 1GJIA 5F6IB 1GIGL 2XZCH 4ZOEA 3UTSA 4LEXH 3SDCB 1G7QA 2CO6B 4G8IA 4TRPH 4L3EE 2DBJA 1X4YA 3C5ZC 4OZGE 3QH3A 3LRSA 3TFKD 4M1DH 5CUSL 4DZBB 3O6FD 4MHHG 5D1QB 1J0KA 3OPZL 1QG3A 4G5ZH 3L5HA 2A0LC 4E41D 5K9JH 3EYUH 1FL6A 3FFDA 4KHTH 2XACC 4R2GD 5J1AB 3SDDB 5HD8D 3GSQB 1O5DT 1R24B 1NFIA 3D2UB 1R5VA 4HK3N 2X9YA 5DYOB 3WJLA 1BLNA 2E9WA 5B4MC 4M5YL 1BVKA 3OWEA 3NA9L 4L9LC 1KFAH 4MJIE 4H1LH 1TJHL 5E1AA 5B38B 3STZA 3I6GB 1NGZA 4BK5A 4DVRL 4G8GB 1YNKH 2GY5A 5DFVC 3EUUA 4PGDA 4MNQA 5DVNA 4QKXB 1Y6MR 1NANH 1MHEA 5F1IA 1KCVL 1XF4B 5BJTA 4GRWB 3O4OC 3TO4C 4GSDH 4QY8B 4NQEB 2FSEB 4XVJL 4LPVA 1UWGL 4U33A 4ZOBA 1QBLL 2ADGA 3QUMH 5FFLA 5HYSG 2I9TB 2QADB 3OF6D 1U8QA 1H3XA 3RZCB 1OAUH 2X9WA 2C3HA 3PHSA 1IRAY 5E2TH 2NPLX 3EOYG 1BVLA 1U8MA 4F7CA 3TO2B 5HDLA 1B2WL 1E4JA 4PJ8C 4I77L 1FL3B 1RUPL 3DX6B 3BP4B 4YHKH 2CKBH 3PV6B 4D94A 2IPTL 5EORH 2BSSA 5CEXA 4RX4D 4OD2A 5F70A 1MRDL 2YK1L 1MFDL 5L8JB 3X11A 2KBGA 4G7VH 2XOTA 4HK3J 5HBBA 3OKEB 1QRKA 4PRNB 4CMHC 4C56A 2CLVB 3B9VA 4U6HB 3BMWA 4K8RC 2XYCA 3C60D 3IDMB 1CGXA 3GMMA 5D9SA 5J9PA 4NWUH 4GLRI 5FYKE 1MIMH 1MHHA 3K8MA 4G9FB 1IQDB 4N0CC 5MEOA 4KFZC 4PJ9B 4YFDB 1WFUA 2DBLH 4JG1H 3UJTL 3WMSA 5E5UB 4LRNL 4GUPB 3D9AL 4NRZA 3QDJB 2R0ZL 4AT6B 4Z76B 2A6IB 1G7JB 5D2LA 3WFHB 2Y07L 3G6JA 1RULH 4HDIA 4DKFH 5C08B 2LU7A 3Q6FA 1JNHB 2OJZH 1OM3H 3AM8A 4XPHH 5HJ3B 2XPGB 4S1QH 1IFHH 5CSBA 2LE9A 2EZ0D 2E9JA 4XVTH 3GSUB 2MCPH 1LK3L 5HHOD 4ZO8A 1BF2A 1SEBA 2IPUG 2UZIH 5HPMB 3TA3C 1S9WA 5DMGC 3FL7A 32C2B 4PY8I 1EIBA 4HJGA 2DICA 2MMXA 4Z7UB 1WZMA 1W72A 3JXAA 3QIUB 2VN7A 4PYGA 1BGXH 1FVCA 3QNZA 5IW6A 1DTUA 3KXFE 4DCQB 3NACH 2DQUL 5T5NF 2J8UA 4NT6B 2R56H 3FB7B 2ZNXA 3RIAK 2AEQH 3CZJA 3PWPB 3FFCD 2EC9T 3G08B 4NRXA 4UBDD 5SX5K 4FG6D 1FE8H 4MQXC 3U0TA 2IANB 2B4CH 4QCIB 4U0RC 4QRSB 1D6EB 4ODTH 4IOFD 4X7FC 1G7IB 4CADB 1WGOA 2AJZB 2J4WH 3O3EA 1S7TA 3SE9H 3MNWA 1IL1A 3DJ9A 2AXFB 1JGLL 4MJ5A 3SJVA 3RWGB 2ZPKH 3CGTA 5EZJA 3SPVA 3KPSB 2NTFA 3DXAA 3KR3H 2DIBA 4DWHA 4FP8H 3P0VH 3CMOH 4GG8B 3DRTB 4M62L 3M8OL 2BVUA 2DJ4A 4OM0H 3FTGA 3KPMB 3F5WA 2BDNL 1VFMA 2NXYD 5T3XL 4IHOB 1A3RH 2JTDA 2WUBH 5IB5B 1Q9WA 5J6GB 2ZOLB 4P2RA 3U7YL 2IPUK 3JV5A 3ULVC 4JFPA 3IS1X 3QQ9C 4X83A 5DJ0B 5B8CA 1QFWL 1KB9K 4HZLA 1H0DA 1MQKH 1RUAL 1NBVL 1OLZA 1G9NH 3CFCL 1SHMA 4ZAKA 3GO1L 2V5RA 4RFOL 1X9QA 4FQXD 1C08B 3HI6H 3CNKA 4JM2D 4NKOB 5I74B 1J9CT 1T04B 3HFMH 5F7MC 4OD3L 3N1MC 4QRTA 4JFPB 5C0AE 3OB8A 4ZUSB 3EDKA 7FABL 5B8CB 3P73B 5I8OH 1FFNB 1P4IH 4M7ZC 1ZLWK 4Y2DA 2PW2A 4R97C 5ANME 1BD2B 1P1ZA 4B0MM 1HWHB 1M71A 5FM8A 2G60L 2OL3H 4OQTH 1NMCC 5FHBL 1LGVA 5CINH 3U7WH 3LKPB 3RY6A 4AM0A 1Q72H 1AC6A 1KB5B 1GGCL 1G7PB 3L3KB 4WHYH 2MWCA 4OGAD 1T0NA 3P30L 5DQ9A 5IB2A 2X1QA 4PRHD 3ARDA 2VDNH 1T21B 2K1MA 4QHUB 1MCDA 3VH8A 3PHQA 1XCQB 1EEYB 1U95A 4TVPL 3RWHA 4N68A 3T3ME 1I7RA 4Y5YB 4JANA 5AAMA 3W2DL 5I1IL 4KV5E 3QIBB 4KQ4L 3QHFH 3V6FB 5DQ9B 3UJJL 5FO8B 3JWDH 3BXNB 5D70H 4ENEC 4GQPH 3FN9A 5I1GH 1PEWA 3U0WL 3UYOD 3BT2L 1WLHA 3MCG1 4JFQB 2GCYA 3CK0L 1NC4D 3B9KD 4X4XB 3NCJH 4GKSA 1I3RA 4DJMA 3ULVE 3X13B 4Y1AA 3QT2A 5GHWL 5JXAL 3OR6A 2HWZH 4GQ9H 5E6YA 3K1KC 1QSFD 4XP4L 3FZUD 4Q7DA 1ZA3B 3FCTB 3T4AA 4XXCA 5FB8B 3C08H 5F8RC 1AHWC 4YHPA 1RMFL 2P5WE 3D39D 4LLDA 5D5MF 2BNUB 3MLYL 2Q76B 3KYMA 5GXBB 4ZO7A 2X4OB 2H9GA 1YA5A 1FJ1B 1YN6A 3CFIC 1A9BA 3VXOA 1NFDF 2Z31A 1RK1B 2B20A 2NCMA 4U31A 1PX4A 3U9UB 2ATKA 2HN7B 4Z7WF 3LEVL 4HWZA 3FAWA 3I02B 4MCYA 5J1SC 4JVUA 1Y0LA 1VSCA 1S8DA 3GJFB 1DUYA 5EBWB 3HUJE 3QPQD 1FQ9C 2GY7B 2QQLL 3STBA 4X4YA 5KW9L 2CMRL 4OM1H 5DDHA 2YRPA 1I1FA 2BMKA 1CFNA 3VFVA 1F6FB 4P2QE 5EU7C 1FRGL 1B0GB 3GK8L 5E1HB 1CR9H 1I9IL 3NTCL 1RQ5A 4AH2A 1P7QA 1QSZA 1RFDL 4RA3A 3PP3H 1CLZL 1ZHBA 1FYTB 4ODSH 2NY6B 3WE6B 4JEGB 1KEML 1DN0B 1KJ2H 3BVNB 4YDVB 5DJZB 5DDHB 1MCSA 5IB3A 3MZTA 2AEPL 1T83A 4ELMA 4J2XA 1NJ9A 4UV4L 1JPGA 2VAAB 2A74B 1ORQA 5F1NA 1TENA 2NYYC 2BNQB 1AJ7L 3NH7L 2XT1B 4Y8DC 1S9YB 4JFFA 3X3GL 4XP9H 4D9RD 4PJGB 3PHOA 3QFJE 1EMTH 1A7OH 2YR3A 4R0LA 1W0YT 4MA3A 1W0VB 2ED7A 1I3GL 2DQGH 2A9ML 4NKMA 1PKQA 4S1DC 4MCZA 2OTUB 5HYSA 3MRLA 2F54B 4LRIA 7CGTA 1CTNA 3IXTB 3MRFA 3DX7A 1CD8A 3HR6A 3MJ6A 2DQCH 3CCHA 3ZYJA 3D18B 4BYHA 4HCRA 2CDFA 3DV6B 3ULUF 1DBBH 2VXSH 3MBEC 1NAMB 4O2EA 1PZ5B 3PWVB 1GOFA 4QXWA 4NNPL 3BPNC 4WENB 3ARSA 1A0QH 1A7RL 1J1PL 1ZMYA 3EYQD 1QSVA 3S36H 3FB6B 4HH9A 3RWFB 4WO4A 1D9KD 2DQTL 5T1DH 2YC1B 4HPYL 1KBGH 1BZ7B 5CJQH 1KCSH 4OV6F 4K94H 4MJ6A 2V2WB 3U9PL 2GSGA 4Z78B 3O3BA 4PJHB 5LQBH 3LZFH 5EU7E 1OWRM 2OR9H 3L5XL 1C12A 1LK2B 1UA6L 4P5MB 1I1RA 2A6JA 4QRUB 3B2UD 5D1XD 4OCWH 1X5FA 4NZRL 3L3OB 1ZLVK 3CXHK 3KLHD 1FC2D 2Q1EA 2OMBA 4Y19D 3FONA 3VWKD 4PLJC 1IM3B 1TFHA 1ZKAA 2OP4H 1MCHA 1UWEH 2VQTA 4GG6A 4MAUH 2WBJA 2IBGA 1UACH 4RBPH 3S88H 4JB9L 2HYMA 1H8OA 5JORA 1I9JH 1ZA6A 4IBLT 4O2CA 3IFPB 2DWEA 4XC3L 3C8KA 4U6XA 4WUUA 4Q9QH 2LAAA 4JPWL 4HWBH 2F58H 1QEWB 3LS4L 4R4FL 5CBAA 4GXUM 4APQC 2VE6A 2GJJA 3N85L 3EYOA 1CQKA 4ISVB 2ITCB 1YECL 4V1DE 1QHOA 5C9KA 2PUQT 4JY6A 3TYFB 1KIRB 5AZ2L 4L3CB 1OGAE 1DLHA 4MB5A 2ZUQB 5JLZA 4FABH 1BQHG 3HC4H 3OKLA 3S37H 4L8DB 4P5TD 1L4IA 3CDCA 1EHLH 1MI5D 5CJXA 2YZ1A 2X4RA 1JRHL 1ZTXH 4P46B 5TF1L 3MROA 1CK0H 4PREB 5C7XH 2VLLB 2AK4A 4M7KL 5IESL 2YA0A 1M1SA 2PKDA 2RAMA 2IADA 4ONGL 1IAOB 3R1GH 3P4NA 4PGCB 4WWKC 3TZVA 4ELKB 1BJ1J 4NN6B 3MUGA 4FZ8H 1RIVH 3Q0HA 2BNRB 5IT2H 1OSPL 1QOKA 4OZIB 1M4KA 1A1MA 1YEHL 4LVNB 4ZD3H 5I75B 4P4KB 3VE0B 5C07D 4NKQB 1R3IL 3CPLB 3WFEH 1ZXQA 1OTSC 4X9GA 3I6KB 3FO9A 3GI9H 4N0UB 4P48A 3O6LL 1QKZH 1SM3H 1CQYA 2QQKH 4OGYH 1VADB 4XP1H 4IS6A 3QNYB 4YDJA 4M6NH 4NQSA 1U92A 4N5UA 5JNYA 1P2CB 4QOKD 2V17H 5FEBA 1OWWA 1MCIA 1G6RB 4XGZB 1XGUB 4EZMA 1UFUA 3NABH 4GRWF 5TQ0H 1OOAA 3WS3A 2UWEB 1CXFA 2ZG1A 5IKCB 3HAEG 1JUFB 3HZYB 1CT8B 3QXAB 1FZKA 5DO2C 1CGVA 3MBXH 4M93B 2X44D 3QQ3A 4JZOA 4EJ1C 2AEWA 2ESVA 4JN2B 3B5GA 5HGDA 4C4KO 1KTLA 4N5ED 1MHPH 1GXEA 4WFHD 5KSAD 4RMQA 4S1SH 4N8PA 3RRQA 4JFOA 4NUGL 3LQMA 5IVXE 1B4RA 3TWCL 3U2SB 1TQCB 1WT5A 2Q8BL 1XGTB 4ODWA 5E8OB 2BCKB 3CVHL 2R29L 2WUCH 1R3LB 5IROA 1A7NH 4MAYD 1BX2B 4JO2H 5HHPA 4G43B 2VLRA 1FVEA 2PO6D 5DD0L 3HHRB 3ARWA 4PJEA 1L7IL 5EA0L 1RJLB 5JQ6H 1U93B 3V5KB 5E6ZA 1J8HD 5IIEA 4TSAH 4RRPG 3S34L 1CICD 3M07A 4M4RA 2X2YA 2BC4B 3V7AG 4WHYG 5F88B 1HH6A 3PL6C 2HVJB 3GM8A 4AEFA 4GBXC 1EHAA 3IDJB 3RY5A 4KTYA 3H3BC 5T1KD 3O3AA 1N5YH 3QQ4B 2GITA 1AO7E 5FYJE 1C5CH 2YBRA 2YPVL 5D1ZA 1ZV5A 5C0GB 5TDNA 4KDWA 4MDIB 3ZMRA 4FQLL 1HH6B 4RMSA 5DD1L 2MNUA 4ZFGL 2VH5L 2ICWA 5F3HA 5DJ2B 1G7HB 4ZXBA 4NGHH 1T1YB 2VDRH 3DMMA 3QEQB 2FWOA 5D2LF 4ODXA 1ZT7A 4R2GC 2HJLB 1X5JA 1SMAA 4G8EB 4YWGH 3VXUA 3WIFB 2XTLA 2PXYB 3BHBB 1A5FL 1KEGL 5C0CA 5HGGS 2RHEA 1WIPA 4DEPC 5SX4H 5I9QC 4CN4A 3HNTL 3C09B 3QIWC 2C3VA 1U8OA 4IRJD 4EUPB 3H7LA 4UUJA 4H20H 1WZ1H 1CLOL 4JPIA 2DQDH 3QO0B 4JKLA 1OCWH 1UM6L 4HT1L 3CZFB 3FAXA 3IDIB 2FHFA 2GTZA 2ZUTA 3MJ8B 5EOCL 3F7VA 3HB3D 3UTZB 4NZUH 5IR1A 1MFAL 1HINL 1F6LL 4UQ3B 4UNUA 2IALB 2GT9B 2JF1A 1UM4H 3C2SA 1BF8A 1IZJA 4C54A 2CDEA 3QI9B 4JKWA 2FBJH 1LNUB 5EU5A 4M8QB 5DUML 1LQSR 1N6UA 5IWLA 2V7NA 4O5LH 4KC3B 1PG7L 4W81A 3BP5A 2NXZB 3U36A 3TBVA 2GTZB 4HJJL 2G5BB 4I2XA 4JREC 5EZIL 3ABZA 1IGML 4DN3L 3ARFD 1QUNA 3HS0A 3NZHH 3BKML 3BZFB 3RUGB 1RURH 4YK4B 1RIUL 2CJUH 3SKOA 2VXTH 3MCKB 4MJIB 2JE8A 3C60C 4HBCL 3QDMB 2V7HA 4H0IA 4CN6A 3HNVL 3X3FH 4E41E 2X09A 3LQAH 1JZ3A 5MENB 4ZOCA 4Y4KA 2XFXA 4GRLB 2EXWD 2XWBA 4HHAA 2HT2D 3A6BH 3OXRA 1DP0A 2R69H 2RCSH 4IRZH 1MY7A 1FNGA 3KJ4B 2X1PA 2CLRB 3WSQL 4QHLA 4X8JB 3WCYA 4ERSH 5FCUL 1GPOL 4K3EH 2DLHA 4KKCC 1UJ3B 1R5WA 3RWEA 1GRWA 4TOYL 3WHXA 1UKSA 2CPCA 4H1LB 5ADPL 1OW0C 3QUMA 1KOAA 2E9IA 3VFGL 4PGEA 4BELD 5CZXC 3RL1A 2NX5D 4OF6A 3RJQB 4OGZA 2C1OB 5IEHA 3FT4B 3AB0C 4XCFH 4HUUA 5LAXA 3AY4C 4LPYA 2R9HD 1RZKH 2QR0B 1G0YR 2Q7YA 4XNUH 5AUMB 4PV9A 3HE6D 4LVOC 4KK6D 4PJFB 1I7UB 1CI5A 3QEUB 1YYML 2NTSP 2R4RH 3G5YB 3GMQA 4QGTA 1CLCA 1MCFA 1R3JB 3DTXA 3O8XA 3EKCA 2A73A 3QUYB 6FABH 4S2SA 4MXVF 1RUQH 2CKBB 3PJSB 2Q7YB 1CU4H 3T77A 1P4LB 3ARBD 2BRQA 5D7KE 1WZKA 4R26L 5CD3A 2Y1VA 4NSKB 4XNZB 2YPLA 1HNFA 4HS8L 1KNOA 3VA2C 4Z7OE 4XMKH 2VIRB 4Y16A 5TFSH 2VLKA 5JPMA 1PDKA 4HWEL 2NY1D 5CHNB 4L9LB 3STLB 3MYZA 1TPXC 4AMKH 1P53A 1MJJB 1N6VA 3O8XB 4XCNB 1MCNA 3MRPA 3P4LA 2PN5A 3QCTH 4F58H 2LV4A 1GH7A 4D2NA 4HIXL 3L7FB 5GGTL 1XT5A 3HMXH 3KLAB 2GAZB 4QXTA 3ZDZF 3TO4B 3E2HB 3OKMB 1QFOA 2NY7L 3EOTH 2FGWL 2X40A 4EEEA 4IMLA 4QWWD 3RA7H 1MCWM 1BQHA 3RBSA 2J88H 3UEZA 4X98A 1MUJB 1SBSL 1JGDA 5TE7H 3SOBL 5DZLA 3KXFB 5GGVY 4LCWA 3VXMB 3RWDA 3PP4L 5A3ID 5ID1A 3RPIA 5AYUH 1PBYA 3HN3A 1BMGA 4JZJA 5EUOA 1DQMH 4YR6B 5JR1L 4HV8B 3MRIA 1T22A 3OKDB 3TN0B 5HVFB 5HHOE 5E8NB 5I1CH 1JWMB 2O26U 1FNHA 1SBBA 1SYVA 5BO1L 2PYED 3AROA 4X98B 3MOBL 3QEHA 5TDOB 1QPXA 3R06A 3B9DA 4D8PA 1PAMA 4NDMA 4X6FB 5IMOA 5JHDD 4XP6L 1HYRC 2BSTA 2R2EA 2QHLA 5FECA 4AL8L 3PG2A 4YDLC 3MRIB 3IGAA 2YUXA 2DOCA 2I5YH 4Q0XL 1KN2L 1ZLUH 3FFCE 4MD0B 3LN9A 4OGAC 2X9XA 4ZUVB 2H26B 1CG9A 3VGAC 4L4VA 1IEAA 4JY5H 3BP6B 3W11D 4HIIA 2ZCHL 3MRGB 4AIZA 5A40E 2ATPA 5IV2B 4HS3A 2NY3B 4M6AA 4Y4FB 2O5YH 4PJGF 1AKJD 5E9DE 3LD8B 5EU6A 5C6TL 4ZQKB 2HG5B 5FECB 3FRPG 4YDKL 1HOCA 1LEGA 4ELMF 1T5WA 3HAEA 2A77L 5J12B 5MEQB 1EJOL 5FUZH 3CLEL 2DQFB 3BIKB 2I9LB 4BZ2H 1RZJH 3UTTA 1I75A 1UKQA 1VFBB 4NOFA 1H15B 1KLGB 1QYGH 4BH7A 1OAYH 3BRGC 4KTDL 2WBWB 5C0AB 4BSWB 3T1FA 3RKDD 1GZQB 1R3HB 1HOCB 1T7YA 3U4BH 3TBTA 1INDL 3V95A 3ARGD 5ANMB 4J1UB 1E6JH 4IEFB 4WI4A 3WLBA 1WF5A 5C6WH 2GHWB 1ZOXA 3I75A 4NYLA 1HXYA 3BJ91 3MXWH 2O5XL 1FL5B 4MD5A 1JWUB 1YEIH 1AGFB 3T2NH 1F3JB 3SDYH 1LILA 5EWIL 3FKUS 3G5XA 1ZGLM 4PGZA 5DUBA 3GHEL 2OL3A 1KCRL 4OQTA 5JIPA 1KACB 5EULV 1SEQL 3DLQR 4UILL 5D7IE 5IBLD 1PX3A 3OJ2C 4PB9H 1HZHL 3MACL 4ZFOA 5BV7L 4HPOH 2EEDA 4CKVX 1II4E 3RDTB 1NBZA 1HI6B 1NAKH 4OKDA 3HE7D 1A6VL 2ZUWA 3C6LC 4MXWL 5GS2H 1YMHA 3B3IB 2DWDB 2DKUA 1ZEAL 5HHXL 3VGFA 3QPQC 1OF2B 1MCKA 2Z92B 4NFDA 2P5EB 2WP3O 4PRHE 4TNVK 5I30H 2WMPA 5GRJH 4H26A 4JKPH 1F2XK 2YEZA 5EIIB 1MNUH 3GMPB 4PJIA 3B5HA 4XCEB 3QWOA 1FN4A 3IDXL 5JHLH 2FO4B 4H0GA 3QQNA 4NPYA 5DRZA 2BHZA 5I1AA 1X44A 2P5WB 1WAAA 1DL7H 1B9ZA 1XH3A 4NQTA 3SGJC 4XP5L 4TSCH 3DROA 5KSUB 3VG0H 1H3PL 4PB0H 3OG6B 3VJ6B 4N8VB 5L2KA 1OB1B 4FFYL 1EEUA 5GGSA 3WKMH 3WV0A 1IJ9A 1YN7A 1VGEL 3BWUC 2XZQL 4Z0XB 4CRPA 3O6KH 5EZLB 4RFEA 4PG9A 3CSPA 3KNBA 5GGUB 1ZT1A 4HKXA 1JYVA 4F9PA 1SJEA 3MJ9L 5J8OA 3GMLA 1VA9A 3N06B 3KDMA 1RZIA 3E8UH 3HUJB 1GOGA 4HH8A 3U48A 3IKCB 3W81A 3BZEB 3JSSA 4JGUA 5DEFB 1T80A 1ZHKA 3KPQB 1UCBL 2IAMA 4JR9H 3PXJA 3JTSA 5D7LA 5DTFA 1RUMH 1WCBB 4XH2A 1ZT1B 1JWSA 1NGYB 4GJTB 2I25N 5B39B 3MLUL 4NHCL 4JDTH 2JIXB 4P9MH 1QO3A 4OZIF 1DUZB 4MMXC 1TIUA 3MRJA 3T0AA 3GJFK 1GGIL 1YEEH 3KPOA 3ULUD 5IB4A 3VI3E 2A1WH 2XI9A 4F7MA 2EH8L 3A67L 1R5IA 2ZG2A 1KJ2A 3DRQA 4YO0B 5IBUB 5E8EB 4D0BB 4XBGB 4PRBA 3BD5A 4U6VH 4RGNC 5HYJD 1ZVSB 1U8JA 1S7RB 1A6TB 3OJMB 3B2UC 1GZPB 5DGRA 5D1XC 2F53B 1F4AA 5E2UH 4M6OL 3P4MA 4W6YB 5ABDE 4L1HA 1WTGT 4WFGD 3M17B 5DD3H 1AGEB 2FX7H 1WWBX 4RWYH 4Z7VE 4OZHE 5BS0B 3G6AB 5D93C 1RHHB 2R2HA 1JGUH 1UH2A 3WN5C 1TNMA 4CW1B 1FGNL 4G6JL 3RI5K 3SCMA 3PWUA 4IOIA 4NOBA 4M43H 2YD5A 5BQ7A 1QFPA 2IMMA 2XICA 4P23A 2YA2A 2COQA 1GOHA 3L3HA 4Y5XC 3Q2CA 1FFOA 3CFJB 4OCLC 4C4KT 5I17B 4G6KH 5KN5B 3MNVA 5LCVH 2E6JA 1FIEA 3GMRB 5TDPA 3MRKA 4NBZB 1TCMA 4YPGB 4F57H 1PLGL 3D25A 2YUWA 5C1MB 4KJYA 1IAIM 1TTGA 3DGCR 3MPCA 4G3YH 1Q94B 4JRYA 4P5TC 4OCRL 1BFTA 2X4QA 4IRSD 5ICYA 4PJEF 5LG1A 3MYJB 4YQXH 1TVBB 2NY4B 1NL0L 1NUDA 2VJXA 1IC5L 2EDLA 4YNYB 4AEHH 4S0SD 2VITA 3BUYA 3D25B 4D9LH 5I76A 2FX9H 2CDGB 4PRID 5ITFB 4RGMB 2AW2A 1DEEA 3HG1D 2X4QB 4RGNE 4ZSOE 5C0JA 5ESQA 4YXKH 3DIFA 2AABL 1F90H 4KKBD 4XNMB 4Z7QF 4MNGA 3DVNB 5CZVH 3RTQB 2BJML 5T1LD 5JXEA 3C5JB 4FQJH 4LSPL 5E2VL 5F9JA 3BEVB 5IEKA 3QYCA 1U8LB 5F6HJ 4YX2H 3AGVA 2X70A 1MWAH 3UTSD 1GHFH 4JRXA 5L8KB 3G04B 4HWBA 5I1KH 1B0WA 3SDDD 4OLYL 3HI5L 4ALAH 3V79C 5DA4A 2NY2D 4ZFFA 4TPRH 1E4WH 5HHNB 4FQCH 2DM2A 4XAWH 3UPCA 1JYXA 2EKSB 1C5BH 1ZT4B 4PRDB 4HIJB 3SDXE 3GSVA 1CXIA 3TIDB 4KKLC 4EI6A 3MV7A 4JFYA 1GGUA 3BPNB 1D5MA 3EDFA 4AIOA 2FJHB 3DBXB 3GMNB 4DQOH 3UMTA 2ZKHH 3OAUH 4X5XA 4PJ7B 4PD4K 2E27L 3OX8B 2QV2A 1HH9A 3VFWB 4DTGL 1YEGL 3D3VB 4N5EC 3FO1B 3WIIL 4F3FB 4HKJB 4R7NA 4V2BA 3ROLA 2EYRB 5E2WL 1QA9A 3P11H 3I50H 4EI6B 2OQJB 3NAAL 4GAJH 3MJGX 2FATL 3RZCD 4L4TA 5EO1B 3DHMA 4MNQD 4MAYC 5HI3D 4HKZB 4TVSa 4YHLL 1MI5E 2HT3D 5DQDH 2YMXL 4YC2B 5I1DA 2PO6C 4S10A 2X6MA 1KIUA 5CSZB 4MDJA 4TULH 3GSRB 1G1YA 1A7PH 4XNXH 3KVQA 3FRPA 4QRPE 3ILPB 1MQ8A 1LHZA 2BVQB 3TPUB 4E5XB 5ITBL 3FN0L 1J7VR 3GSXB 4FFVC 4L29A 1UYWH 3HCVB 5MEPB 1XCTA 3UJIL 1C7SA 1U8PB 4RMRA 5JW5B 5DRWA 1X5ZA 4JGMA 5CJ8A 5EN2B 3LRGA 4JFDA 2WINB 5SV3A 2B39A 1SJHB 4YXHL 5C07E 2C1PB 1T2XA 1QBBA 5DK0B 3WJJC 3CAFA 3ZE2E 4ODHH 3FO0L 1KXVC 1E4XH 4EQ2A 2R23A 3L5WB 4HMEA 1XF5A 5DS8B 3GRWH 2DMCA 3O2VH 1CE1L 4UIKH 5KS9A 3I6LE 5EIVA 5C08D 2GKIA 1A4JA 3HRPA 4EI5A 4F80A 4GFTB 4X6DB 1LWRA 4NKIH 3LQZB 5GS0D 4FQQB 2AKRB 1X4ZA 1IGYA 5D96B 1EFXB 1HHGA 3I9GL 4LKXA 1BEYH 5KTEL 2HVKA 4EN3B 5JPNB 2EXYC 5I15H 2DM3A 1B88A 1IM9A 4ZO6A 3QDGB 1C1EH 1A7BA 1AD9B 1XIWC 2IBZY 4PJFF 1WTLA 1AD0A 4K3JL 4HGKC 1H5BC 1MAKA 3H3PL 4C57C 4BQ8A 4DGIL 4XPBH 1HQRA 3QZWG 3BGAA 1DQQB 1ETZB 1XGRA 1PFCA 2YXMA 5IM7B 4U1HB 5DK2B 1UWXK 1HDMA 4KZEL 1KT2B 3EYFA 5E8PB 1IBGL 5FAAA 1LE9B 3NFSL 4NQCE 3VMNA 2A9NH 3MLTB 4WW2B 3B6SB 3VDBA 2R8SH 1YYLH 4H8WL 4L8SC 3VDCA 3IDYB 1LD9A 4WU7B 2VL5A 2IH1B 3J7HA 5SWZA 4OB5L 4EUPG 3DO7A 1J8HE 1KLFA 2AK1L 3VW3L 3KPLA 1P69B 5DJ8A 1Z9MA 1DBML 3NGBC 5EO0A 5DHYA 3KJ6L 1K5NB 5CMAA 2GYSA 1CGSH 5F9WB 1FLRL 4XZUB 1JPTL 3LN5A 1KXTB 3QWRA 3ARFC 2VQUA 4IM8A 4NC1C 4TUKH 5HGHB 2YHGA 3KPRE 3MLVH 2HFTA 5CGTA 5CGYC 5E70A 3DYMA 3SJVD 1TITA 3T0EA 3DXAD 4QHMA 5DHVH 3U6RB 5IVNA 1UC6A 9CGTA 2WIIB 3LH2H 2G75B 4RWHA 5DVOA 4JM4H 1PW3A 1VACB 4BJLA 2CLZA 2PTTB 3RGVC 3V6BR 1YNTB 2HT2C 2VAJA 2IFFH 3K81A 4ZS7H 1CGWA 3OTTA 3DYOA 4P2RD 2R0LL 4R6UA 5CILH 1G7LB 1PGRB 1RZ7L 1N64H 3C87A 3IJHB 3QUZB 5CGMA 1DSFL 5EFIA 5IGXL 5EUOF 2VTFA 2HLFD 1KB5L 4JY4A 1INEH 1J1OL 1NDGA 5ICZA 2ZG3A 4NJ9L 4ZAKD 4GW5A 3THMH 4TQEH 2BX5A 5CP7B 2M2DA 2Z8RA 3O41B 4XPTL 3IU4L 1F00I 2Z35B 4U1SB 1BIIB 1N2RA 2QSCH 4PJCB 4BFBD 4UNTA 4Y2DD 2CD0A 3OQ3B 3TBYB 5JIHA 1JFQL 3TT3H 3O6FB 3Q5OA 3AMLA 1FNSL 2MKWA 2CK0H 4GAYA 5IFHH 1O7VA 1SYSA 1QLFA 3H9SA 2WZPD 2Q3ZA 5L6YL 2XZAH 4E41B 3CVIH 1RZFL 4TUOB 1S9XB 2AQ3A 3VGEA 5I19L 2QQNH 3ARBC 1FVDA 2J3SA 5DRNA 4NC1E 3ARDD 4KK9D 3IDNA 3NPSB 1OAXL 5I8CB 5ACZA 3L1OH 1OP9A 4U3CA 4RFNC 3R4DA 3S36X 4HUVA 2OBGA 3MRMB 1AE6H 5DFTA 4P3DA 2AXGB 4KAQL 4F7EB 2EDYA 3MRCA 1CZ8H 4WW1A 3FQWA 1J86A 1IKNC 4WFFE 3VCLA 1DLFH 3MJ7B 1ZK9A 1IC4L 2DQEH 2J1KA 5JQHC 1Q1JH 4Y1AD 4JFEA 3TEUA 2ID5A 3S35X 1FCGA 5JIIA 3LKRB 3HMWL 3VWJA 5MI0C 5DD5L 1MJ8H 2H32B 3QUXA 1KPUA 5DLMH 4Y5VB 5HY9A 1J88A 5IVOA 5GGQH 5EUKB 4PJ5A 5F7DA 3DNKA 3WNMA 3L95B 1L7TH 3BESR 3LOWA 2NX5E 5IG7B 5I6XB 5AZEL 5KSVB 1TZIB 3WLWD 4UTAH 3G6DH 3JUZA 2P8LB 4U1IA 2W07A 3O45B 3WDHA 5EC2A 4LIQH 2VDOL 2ZNWA 3Q6GL 3V4UL 2H2SD 4U1GB 4D0DA 3SBWA 2VXQH 3UDWC 1ONQB 2Z31D 1JYNA 4PJDA 4CMMB 4NNXA 2MFNA 2EDTA 5ETUA 3T04D 2CH8A 3DGGB 5H94B 1DBKH 2JCCB 1N0XL 3C60B 5LGHH 1QTYT 3ARUA 2J8OA 4BFEA 3HC3H 3RNQB 5M7QA 1FYTD 1QNZL 1PYWB 4MX7A 3TNMB 1X3DA 2GSIA 1JGEA 4LQFL 3VFSB 3WFCL 2P24A 5GRZA 3OZ9L 1HHJB 3PGDB 5JZ7D 1HEZA 5I0ZA 4NN5B 5I2IB 3MCLH 4LCYA 2I26N 3HMXA 5ETUB 3S37X 3SKNB 3F6IA 2FYYB 1S5HB 4PLNC 2DTML 5HHQB 5D6DC 1R3KA 2Z93A 4QRQB 2WWKO 1UADC 1P7QD 3BO8A 2G9HB 1IC7H 2NZ9C 3VXSA 2W9DH 1NBYA 5DR5L 5B3JF 1JGEB 1B0RB 1U3HA 3AS0A 5HHOB 4RSVA 1XR8B 4KVCL 5DUPL 1ZANH 3WHE0 2BVOA 4U7MA 3RVUC 1KF9B 5DZNA 1ZWIB 2FIRT 2VL4A 4LPWA 2ZWLT 25C8L 1A4KA 1I7ZB 4OI7A 5HYEA 3MRDB 4QTHB 5MHSE 4HMDA 4WI6A 5DJDA 3OAYH 1CDBA 2VLJA 4Z7NF 2O61B 2A83B 4GAGL 3O2DA 5E6IA 2PCPB 3VXRE 4G80A 2F19L 1B6UA 5ESVB 4M48L 5IBLC 2DI9A 1A9EB 3PGCB 3GGWA 4OLUL 12E8L 1A4KB 3RU8L 2UZXB 1KIPB 5F1KC 4P9HC 3D85A 1JE6A 4DKEH 1YUHB 3LMJL 1CLYH 4NQDE 4X7EC 5CJOL 5DWUH 5HHMD 3U46A 4BUGA 5KVGL 5EOTB 3WKNA 3BQUA 1DN2A 1YEKH 4GKOA 4WO4D 3WUWG 5GRWA 5EOQH 3QA3A 5TH2A 4XMPH 4D3CL 1ZGLA 2RJMA 1DQJB 2NXYB 2DDQH 3UBXA 3BPLB 2JJSC 3DVGB 2EIEA 2VDMH 4NQVB 4D0CB 1I85C 5ALBL 4DN4H 5AD0B 5HVHC 3AU1A 5K9KB 1I8IA 1ULVA 3GKWL 4WNQB 3VGGA 3RAJL 2R1WB 3O4LE 3L9RA 3NCYS 5D2NC 3EW3B 5J4MA 1S7QA 2Y7QB 3FMGH 1DZBA 5L7XL 1IT9H 3GSNH 4HUXB 4FQXB 1LO4H 3UBXB 1I4FB 2B1AL 4JM2B 2AV7A 3ULSB 2BVPA 4POZC 3JWOC 1LEIA 2IGFL 4HQQL 3RVTC 5C0EA 1MHCA 5D7IB 2WBJD 3VMOA 1V3MA 3QZWA 1MCPH 1KPRA 3MV8A 3SGEI 1A02N 4OTXL 3TNNA 1IILE 3UPRA 3NPZB 2VISB 3ZDYF 4WUUD 3DX8A 4KTEH 5ALCH 2Y6SD 5TPWL 4M9OA 4YGVB 1FNFA 5I18L 3MGOA 3MRRA 2X10A 5BZWB 1CD0A 4QTIL 3W9EA 3BKCH 1D5IL 4IMKC 3DI2B 5CIPH 1VFAA 1WC7B 3MLXH 2RBLA 3KYKH 3D0VA 5KAQG 1JIBA 1S3KL 4M61A 4MWFA 1UH3A 4PGJA 3MODL 4RISL 5D5ME 2C4XA 3HNSL 4HWNA 1FSKB 5GS1A 4G6MH 3WFZA 1NFDE 3SKMA 3O9WA 5DSCB 1EPFA 1OQOA 2ADJB 4L3EA 5K93A 1WBXB 1AXTH 2D9CA 4OZGA 3ULUC 2AK4D 2BNRD 2DL2A 4BH8A 4K9EC 4PBVC 4PR5A 4NO3B 3QG6A 5J11C 4Z7WE 1GAFL 1AGCA 3B9KB 1SY6L 2ORBH 2F74A 4GKNA 5AG8A 1G6RL 3O9WB 2NZIA 3PABA 2X4SA 1G84A 1QSFB 3WEXB 5D2NE 5KSBA 4RQQB 4HLJA 1GIGH 4OAWB 5KVEL 5ESAA 1MIEL 1S7WA 1K8IA 4PJ7F 4L8CA 1X5YA 2M8XA 4ZTPL 3O3UN 3D39B 2WWMC 5CUSH 1BBJA 4PJAA 3O2DL 3OPZH 1FNEA 1YC8A 4WU5A 4OZFH 3RBGA 3DUSA 2MPAH 2VDQL 2FX8L 4NBYB 4ZDHA 4WGVB 3F8UB 4NHUA 4ONOA 2VZUA 5C0IA 3V0VB 5EBLB 2IC2A 1BBDL 3RVWD 1T5XA 2FH6A 2A2QT 4I5BA 3D5OF 4M5YH 3LKOA 1WVZA 4Y4HA 3NCCB 4LVHB 1CF8L 3NA9H 2ESVD 3UZEA 1TJHH 1V8HA 2BHUA 2AS5M 1OL0A 4U6YA 4DVRH 3JV6A 1YY9D 3VGBA 4HXAL 2GK0B 1G0XA 1NANI 5C09A 3H9YA 4R4BB 5HHVH 1UZ8B 5GIRB 4WV1C 4I3RL 3SKJL 3C5ZA 5GISH 4XVJH 3ULUE 2VLRD 1UWGH 4NFCA 5JW3L 1KGCD 5F6IC 2VXUL 2PW1A 1P7KB 3SDCC 4YHIA 2VMFA 3MV01 1N59A 5K59F 1JK8B 3NZ8A 2PR4L 2R2BB 3MGTB 2FZ3B 4I77H 3ZZ1A 4MB3A 5HYJE 1RUPH 1URLA 3PIQB 3SDAA 4F9LA 2IPTH 3MRNB 4X6DF 5D1QC 4QHKI 5INCB 3O2WL 1MRDH 5FYLL 1MRFL 1HHHA 5FA3B 1EO8L 4HULB 2YK1H 4WFGE 4ODUA 3VXQB 4QO1A 2GTWA 3OR7A 5D1ZD 3WL9B 3SDDC 2C7UA 1XZ0A 3VFRA 3WD5L 1CDJA 1H3WM 2VXVL 5E4EC 1RJYB 5F7FA 4CVUA 3HI1A 1I8KB 4M6ML 1P5VA 4L8BB 2VZSA 4XTRD 4OI9A 3UJTH 3DMMD 4NM4H 3D9AH 4WW2F 2R0ZH 1WEJL 3HPLA 3RWCB 2Y07H 3VXUD 4S11A 1D9KB 2ITDA 2EIBA 4I48B 1AR1C 2OJEA 3VFOA 4URTB 4H25A 4LFHG 4PJ8A 4YXLL 3CFBB 3NCYP 3K46A 2BOBA 1BP3B 3CC5A 1GGYA 5I1EL 1IGIL 4LASL 4P4RA 5IMKB 3RZCC 4G6AD 2N7BA 3L3JB 2JB6A 4LHQB 5D1XB 4WTWA 3N1PC 5T3ZD 1U8IB 2OJEB 4E9LA 5JW4M 1BJ8A 1J0HA 1LP9B 3QULA 5JO5B 2FJFB 3F12A 4Y19B 1Q9OA 3VWKB 3OB0K 4PRIE 4LARH 2GJZA 4O02L 1T66C 1T4KA 4LPUA 4Q6IB 2DQUH 3HG1E 5B21A 1A3QA 2MHAA 5DMKA 2YN5A 5FKAA 1T6VN 2JJWA 4C83A 4WI8A 3L6FA 4JDZB 1EVTC 5EZOL 4Y5XB 4AZ8A 3QDMD 4JJ5B 3RL2B 1V7NL 3S3SA 1UXSA 4H88H 4JZNA 4YFEA 1UM5L 3P9LB 4BZYA 5E00A 2ZSVA 1KIQA 5MEND 1AIFA 1KFAL 1MWAB 5T1MA 3OKNA 5ACLA 4RBPK 3IVKB 3OXSA 3O0RL 4R7DA 3L3DB 1IEBB 1UXWB 4UOJA 3M8OH 3WFBH 3TA3A 4HIEB 3TLRA 4A6YA 4G42A 2EIDA 3PWNB 4HUNB 5T3XH 1MI5B 5GS0C 2P8MB 4Y4KD 3DSFL 3D0LA 3U7YH 4LL9A 3EOAA 3BZ4B 3EGSA 2N1KA 4CDHA 1CS6A 1YEDB 4GRWE 5FOJA 4PJCF 1I1YB 1QFWH 2AP2A 4E0RB 2VDLL 3L5JA 5FYKL 1RUAH 1NBVH 4JHBA 4K3HA 4RDQG 3ARRA 3CFCH 1IEHA 3GO1H 4I0PB 4RFOH 2J6EL 3G5VA 3QIUC 3BDYL 4A2LA 3VXPB 1KC5H 1D5ZB 3WUWA 4MNQE 1ERNA 4OD3H 1Y6NR 5ID0A 1IAIL 1XF3A 3QJHB 4FFWC 4LLUA 3REWA 4I0CC 4UT7L 7FABH 1QRNB 5CD5C 5KJRH 5C07B 4FQ2L 4G7VL 4LLWB 3PDOB 1NUNB 4O51A 2FB4L 4DKAA 3FQTA 3I2CL 3WXWL 3IDUA 2G60H 4UQ2B 4TSBH 5HXMA 5D7JA 1QFWM 5FHBH 1Z5LB 3F7PC 4WDIB 1KJVA 3EDEA 1KPVB 4H8WC 1GGCH 2DLIA 4OGXL 3P77A 4QOKB 1T1XB 2E8YA 2HFGL 3O8XD 2AV1A 4WGWB 3GRWA 2VZOA 5JDSB 5D8JL 4B7IA 4UU9A 4CVXA 2A6KB 4G9FE 2JELL 2X4TB 3IAQA 1D3CA 5D7JB 4TVPH 3ROOA 2YPLD 3GIZH 1KG0A 3AREA 3QDJE 4HF5L 5K9QG 2VLKD 5M95B 2ZCKH 5KSAB 1OM3L 2JJTC 2W65A 5I1IH 3LVEA 4KQ4H 5LGJB 2XNAA 1TLKA 1F11B 1ED3B 2MCPL 3SE8L 3PF2A 3L3GB 5C08E 4YHNB 3B2VL 3U0WH 2WM0A 3BT2H 1QSEA 3CK0H 2VDPL 3VXMD 1S7VB 4PRAB 1REIA 2XWJA 3QBTB 5BW7C 4CL7A 5DHXB 5I74C 5JXAH 2HJKA 5HGBB 3IDGA 1FO0B 1Q9KB 4XP4H 4K8RL 3U4EB 3LV3A 3CSYA 5FXCH 1VB9A 4I8DA 2OK0L 4P57B 1CICB 5B8CC 3IETA 2JCCF 2R56L 3I85A 2QQQA 1C5DB 3EFFB 2BHYA 4LCWD 2X42A 4LLQA 3MLYH 3WHE1 5ENWB 4P2QA 3AMKA 1ES0A 1JTTA 4XCCL 3W82A 2JLLA 2WQ8A 4ODTL 1Y6KR 5T1KB 1HNGA 4AQOA 5A2KH 3PWPE 1BZQK 4YAQA 4GW1B 4Y2DC 1PQZA 5KVFL 1FFPA 1A6PA 2NY3D 3WFDL 5F7LB 4N0RA 1QR1B 4O2FA 4CNIB 2FO1A 4UTBL 4CN1A 5CEZL 2RR3A 3PWJA 2QQLH 5JIKA 3V4VL 5KW9H 4Y5YC 1Z2KA 2CMRH 3ZTJG 5DHVA 4A6YL 3QFJA 5A2JH 1FRGH 3BW9B 4L4VD 4GXVL 3GK8H 4ESKA 1EAJA 1I9IH 3NTCH 2RFXB 4RNRB 1RFDH 4OKVA 4FQHB 4XHJC 4LLVA 1CLZH 1AHWA 3NVQA 2BRRL 5IQ7L 1MQKL 3SJVE 2CGRH 1KEMH 3QR2A 2GJ6B 2ZUUA 2UYLA 4IRJB 2Z91A 4KY1L 1ACYL 3OL2A 1S7UA 2AEPH 1OP3H 3FQNB 1V3KA 4N1HB 3UTTD 4UV4H 3MV9A 4ZFZA 3LCYA 3NH7H 3BMVA 2NNAB 4UV7L 2H2PC 1W0WA 3X3GH 3LPGA 2OCFD 4PTUB 4P2RE 1U3ZA 3WDIA 4OFDA 5BZDA 1J5OL 1K2DA 3IFOA 2AJYL 4OUUA 5C0DA 4NQUA 4FQIL 1I3GH 2FJGB 2BOCB 4AYFA 1N26A 4XNQB 2A9MH 5I8EA 4ONHA 1BD2E 1Q9LA 3C2AL 1M7IB 1JHTB 3QCVL 4PRPB 3DSNA 4F8QA 2XG4A 1CIUA 2Z4QA 2J5LB 3WLWC 3ZE0F 1IAKA 1FAIH 2XA8H 3X12A 2BFVL 3MUY1 2LVCA 3X14A 4XCYA 3OHXB 1UGNA 5IW3A 4WUKH 3ARFB 3OGOE 3C6SB 4MNHA 2Z31C 1G7MA 3FB8B 4NNPH 1A7RH 1J1PH 2VOTA 3BGMB 3PNWA 5IJVA 2PF6A 2DQTH 5DQJB 2MQ0A 4HPYH 5JOFA 4JM2F 4J6RL 2NY6C 3JTTA 4EOWL 4U1JB 3U9PH 3L7EA 4J8RA 4TNWF 4P5KA 1DVFA 2DLTA 2GQHA 4R96A 3L5XH 1I8MA 4X80L 4OIAA 3WYRA 1UA6H 3HRZB 3WIHA 2VERN 5IHUL 1E4KC 2X4PB 4N0FB 1T1WB 2Q20A 3CU7A 4R90H 5FOBA 2XTJD 5DJXB 3LN4A 4NZRH 2EE2A 4V1DA 5GRYA 5FF6B 3C08L 3BH8A 3MFFB 4HC1A 5EC1A 2V2TB 2IF7A 5ICXA 2ICES 1OGAA 5MERA 4EBQH 3F7YA 3MBEA 1MCBA 3S5LG 4YLQT 4JB9H 1ZSDB 2APTA 4W6XB 3EYVB 1Y18A 5DEGA 1KYOK 4XC3H 4OIIL 2QSQA 1OSZB 1EEZA 4G7YL 4Y1AE 3HE6B 4WY7L 5L2KD 4JPWH 2EH7L 3ZDZE 3LS4H 3QP3A 3VFMA 3KPNB 2OXGA 4K7PY 3N85H 5FA4A 3BN3B 5EO9A 3FOMA 3BIBX 1YECH 1IQWL 4QHNA 3ZLQC 2ERJB 4MD4B 4DUVA 5C70A 1LO3L 1CFVL 4GW4A 4KU1A 1CDYA 1MLBA 4MJ2A 4QGYA 1FP5A 1TJGL 5D7LD 4PJBB 3QJFB 2NY1B 2NW3A 1JRHH 4U0QB 3VD7A 1K8DA 1JV5A 1S7SB 1FZOB 2BVTA 1JBJA 4PLKC 5IESH 1FYTE 3P9MA 4BK4A 4EXPX 3O11B 4RMVA 4L5FL 1CL7L 1F4YH 3FQUB 3OKKA 5FDWA 1UT9A 1T2QL 2EO1A 4UDUB 2W1NA 4KXZH 4J3XA 5BS0D 1YDPB 2H6PB 3FQXA 5KSBF 4WI9A 2G5RA 3QNXA 4CDGC 1UH4A 5HI4C 2AJ3B 1JPFA 4TYUA 5E08L 2EIZB 1OSPH 3SEPA 3QO1B 1HHIB 4FZEL 2APFA 2DQGL 3SN6N 5MI0B 1N6QL 4PJGE 1R3IH 5INDA 1XR9B 4PJAF 3RIFF 4Z77B 1KTDA 4PP2A 2D0FA 3QDAA 2ZSWA 3NFNA 4X7CC 5GS3A 5IVXA 1HSBB 3O6LH 4ELME 2DQCL 5J6HA 4MSWB 5H37H 1SMOA 2W60A 3O3DA 1QFHA 1DBBL 2PYEB 5FK9A 2C3GA 3AAZB 4KH2A 3BKYL 3T3PF 1T20B 1CFQB 5JHDB 2Y6SC 3BKJL 5F6HI 4BKLA 2I60L 4NNYA 2D2OA 3LKQA 4LCCA 4IOSD 1FZJB 2C9AA 4WWKA 4NUGH 3E1F1 4FQ1L 3EOBA 3ARQA 2OR9L 4M1CD 3JV4B 3TWCH 2Q8BH 4U1MA 2R29H 3LIZL 3RWIB 1AO7A 3RWJB 4OCWL 4LVEA 5SX5H 3SY0B 1HIML 2Z8SA 4JRYD 4DAGH 5DD0H 2D7PA 5D6CA 1CE6A 4NN6C 5D4QA 5GGRB 3VFPA 1L7IH 4RAUA 4X7DC 2Y36L 5EA0H 3GB7A 1ZLUK 1WITA 2BVYA 3SGDH 4HC1L 3S34H 4LVNC 5I75C 1NEZG 4P4KC 3GFUA 1TTFA 1I9JL 3GSNA 1PJ9A 3MMEA 2R0KL 2Q6WA 4HX1A 5E24E 2Q86B 5ERWB 2APBA 3A6OA 3ARGB 1FV1A 1KXQE 3I3EA 5A16A 2CRZA 1QQDB 3P2TA 5KVDL 2YPVH 5JXED 1M7DB 4E42A 4FQLH 5DJCA 5E5MB 5FYKU 4JRXD 5DD1H 4ZFGH 3SE4C 2VH5H 4LSDA 3FOLB 3VFUA 4XC1H 5CJ5A 4M93C 4JQXA 1LE5B 5L9DL 4B5EA 4FABL 5ISZA 5CIPA 5D5MB 4K7PL 3GBML 3MA7B 2ZZUT 4WHCA 4X7TB 1WBZB 4F8TA 2B8OT 5IHLB 1UVQB 1ZTXL 4WUUE 3VG9B 1TQCC 3ES6B 3HE7B 3MV7D 3ZTNL 1A5FH 1ZLWH 3BWAB 1KEGH 1LP9F 4P2YA 1N7MH 4UIMA 2YWYA 2FEEI 1W8NA 3PL6A 3NOIA 4DW2H 4M8VA 3HNTH 1JF5A 5SX4I 4GBXA 1NC2A 4MQSB 1DE4B 1NCBH 1YY9C 1JN6A 1QLRB 5CCKL 5L88L 1OAKL 4CJ0A 1CLOH 1IMHC 4JLRA 1N8ZA 5IT2L 1WT5C 2X7LA 2IQAA 3TBSA 5IFAL 2X1XR 3IJYB 4ZD3L 4L4TD 4HT1H 4OCXL 4U1LB 1P6FA 3WFEL 4K55A 2NLJB 5EOCH 4RAVA 4WJ5B 3DV4A 3WO3B 1S9KC 1ROWA 4GRMA 3LSOA 1MFAH 1HINH 2AK4E 2BNRE 1HYSD 4PGBB 1MFCL 2VQ1A 2YD4A 2YKLH 4OZIE 4XP1L 4K3DL 4OLZL 3FT3B 1G0DA 1RK0B 4KK8C 3CUPA 1RJZA 5DUMH 1MH5A 1DQLL 2V17L 3ZL4H 2OSLB 1LEKB 4N0UE 3OGCA 4GS7B 5IB1B 1U41A 3L3IB 4HJJH 3V8CA 4OZFA 3ZDXF 4KRNA 3QEGH 4N9GB 4RIRB 2I24N 1MRCL 1IGMH 1JF1B 4DN3H 4JFDD 2ADIB 3W9DA 1U91B 3BKMH 1TZHA 4WRLA 1T1ZA 1BZ9A 3QIWA 2Y9RT 5KANI 1RIUH 2EDXA 4OLWL 1E28B 2FBOJ 2PXYC 1NMBL 5IMLB 4HIHA 2C26A 4HBCH 3E6FA 4EN3D 1W8OA 3REVB 4NO0A 3HC0A 3MRHA 3QDGD 1A7NL 4HK0A 1CVSC 4XTRC 5BXFB 4EVNA 3FT2B 1OQXA 2D7TL 3C09C 5FYJL 1KJ3L 5DJAB 4NWTL 1CVRA 4HUMB 4BFIB 3IJSB 5I66B 8FABB 4LP4A 1T3FB 3OJDA 4N9OB 4M02A 3WSQH 2FGZA 5FCUH 5I71B 4RGOH 2ESVE 5E95B 1IM9D 3LB6D 4TOYH 5DD6B 3QFDB 1FCCA 3VFGH 3MREB 3VD4A 5HYJB 4KVNL 4TUJA 3DVIA 4G6AC 3DUUB 3QI9C 4F7TA 3MRQB 4UZGA 1C5CL 1A14L 3BAEL 1K6QL 2W0KA 3BP7A 4KGJA 3ZHDA 1G9MC 2VLRE 5H2BA 1HKFA 1VERA 2NXZC 4X7SL 5I73C 1XF2A 2WIMA 4LAQH 4PJEE 5SWZD 3ARVA 1QVOB 3BISA 3MNZA 1HILB 1OPGL 1QBMH 1YYMH 4LLMB 4WI3A 5ADOL 2VO5A 3HZKA 5IBTH 1YMMA 2DYPA 4YK4C 2DL9A 3T8XB 1FG2B 4JFXB 3T08A 3HPJA 5IWLC 5EBMA 3F58L 4X6BB 1HSAA 1BFVL 2EDDA 1IGCH 3S5LA 5IHZB 5DI8B 1BIHA 4CBPA 5GSVA 1OVZA 5EH1A 1V3JA 2AJVL 1J0JA 4F7PA 4Z7QE 2FEEL 4HS8H 3QWRD 4HWEH 3VFNB 2FLBT 1U8HA 1A1OB 2GIYA 2G2RA 4NZTH 5FYLE 3P4OB 3W0WB 3T0ED 2ICCA 5TQ2L 4X6EB 3HTLX 4ZS6D 3K2MC 5I16A 1Z9OA 3AY4A 1RUKH 2HFEA 2OS7A 1I1AA 1TCRB 1UJ3C 2E7CA 1CDCA 4M9PA 4IRSB 1A6ZB 4LEOB 5K9OB 2NY7H 2DTSA 3VXUE 2FGWH 4H5SA 2IH3A 4U2ZA 5IVZB 1QD0A 3RP1A 1SBSH 4PRIB 1FZMA 3SOBH 4R3SA 2J12B 5IMMA 2B5IC 1VKXA 1F6AA 3FFCA 5IOPB 3PP4H 3S4SB 3UTQA 4X6CA 3HG1B 1XGQA 1HXMA 3ILQD 4XRCA 5JR1H 4QYOB 5T3ZE 4CVZA 2QJDA 1NKOA 5E9DA 2CIKA 3FRUB 4HG4J 3KPTA 3BSZH 5BO1H 2D7NA 3NZHL 3WBDA 5T1LB 3MOBH 5F21B 3BEWA 2IWGA 2DN7A 5HGAA 1RURL 2ZCLL 3QUYC 3T4YA 3UTSB 1G7QB 5IUSA 4G8IB 1NQBA 4XP6H 4X4ME 1ZLVH 4XNZC 2JK5A 3QH3B 3LRSB 5E4EB 2NY2B 3RUGE 4Q0XH 1MCOH 3BPCA 1KN2H 5GRUL 3CX5J 2OTPA 5KG9A 1FDLL 3H9SD 1EAPA 3O8XC 1JYWA 3QDME 2R4SL 4I2XE 2ZCHH 1FL6B 1YEFL 3FFDB 4LDLB 3ARYA 4NUJA 2JB5H 5C6TH 3EO9L 4J4PC 3K4AA 5MENE 2FH8A 1NFIB 3RVVC 1R5VB 1ZHLA 4U7KA 1BLNB 4YDKH 2HKHL 3E2HC 1BVKB 2A77H 2VNCA 1EJOH 3CLEH 1V5JA 5E1AB 1N3NA 3UBXI 3STZB 2OR8A 1NGZB 5H37G 4PGDB 3P3YA 2W38A 4QRRA 1J87A 4MNQB 2KZ1B 1QPPA 3ALPA 1MHEB 5F1IB 5BJTB 3ALWA 4NM8L 4LDOB 4DK3A 4NO2A 1INDH 3TN0C 1AY1L 1NGWA 3G9VA 4GT7A 3ZKMD 4JFED 2ADGB 2O5XH 4UDTA 2FL5A 1U8QB 3VWJD 3QUXD 4MQTB 4PRHA 6FABL 2Y5EA 1BVLB 4PJFE 3GHEH 1U8MB 4F7CB 1KCRH 5FGRA 4PJXA 1YY8A 1SEQH 1NEZA 4OCMC 2Y4SA 5EU4A 4LOUC 1NGWB 2BSSB 5CEXB 4U05A 1HZHH 5BV7H 4OD2B 3UAJD 3X11B 4DVBA 1AFVL 5IFJA 1A6VH 2B4CC 2HJFA 2NY3C 2HRLA 4MXWH 4Y4FC 3QCTL 4OFYA 4F58L 3LD8C 1NC4A 4C56B 4N1EA 2QHRL 3GMMB 5D9SB 5HHXH 1P84J 5J9PB 4GMTL 5F9OL 1JNNL 1MHHB 5MEOB 5J12C 2EDFA 1RSFA 4ZPVA 1C8PA 1RVFL 4NRZB 2J88L 3MR9A 2DLFL 2YPLE 3IDXH 5D2LB 3G6JB 2LABA 1M05A 3M1BA 1S5IL 4HDIB 4Q97A 4OF3A 2QSVA 3CFKA 3Q6FB 3NFPA 2FD6H 2D3VA 2ENYA 4JAMA 2AEIT 4AIXA 3VXME 4XP5H 1U3HD 2PTVA 5DRXA 1H3PH 4PYHA 2OI9B 1SEBB 3OAZH 3C6LA 4FFYH 1S9WB 4D9QD 4PJBF 4HJGB 1VGEH 2XZQH 1E27A 1W72B 1DR9A 4HFUL 4IIQA 1FVCB 4P2CG 3QNZB 5IW6B 2L4OA 1VESA 1EA9C 2CUIA 4F33A 1T6WA 3NN8A 2X4UA 4PS4L 2XV6B 3OKOA 2P4AB 4LNVA 2VSDA 4JRWA 2P7TA 3RDTC 2J8UB 4WI7A 1MFBL 3Q3GA 5EUOE 5E6ID 4XPGL 3AXLA 4NRXB 3VRIA 3U0TB 1N5AA 2BSRA 2IBBA 2KZWA 3QAZB 3QSKB 2Q3AA 2VDKL 3MLUH 4NHCH 5FGBC 3O3EB 1S7TB 4XBPA 3MNWB 1IL1B 4Z7VA 4OZHA 4MJ5B 3SJVB 5A2FA 3D85D 5EZJB 1TQBB 3SPVB 2NTFB 3DXAB 1GGIH 1T7ZA 3HAEH 3ESVF 4ORGA 3CX2A 5F97E 2ARWA 3SGJA 1T2JA 2EH8H 5TE4H 5F7EL 4IDJL 3A67H 3BQUD 4ETQA 3FTGB 3F5WB 2DQJL 1JMZA 4L4VE 4RAHA 1PY9A 4G9DA 1MY5A 1Q9WB 2F8OA 4PUBL 5CEZE 4P2RB 5H35A 2HLAA 2XTJC 2EECA 5C9JA 2EYTA 3IF1A 3E3QC 3T2NL 1S9VA 4DKDC 3TJHD 4YHOH 4HZLB 1O7SA 1B3JA 2FIKA 1H0DB 4RDQF 3PQYA 4ZAKB 3UTTE 1VGKA 3U83A 4JHWL 5L0QB 2CSPA 1FGNH 2P43B 4LHUA 4OZ4A 4AY0A 1M6OA 4HPOL 5FUCE 1ODAA 4QRTB 1NSNL 3MV8D 3S98A 3ZYZA 4Y2DB 2PW2B 3QCUH 1P1ZB 2VLMD 1M71B 4Q9RL 1IGJA 1IGTA 4ACPA 3HR5A 1J10A 2DI8A 4AM0B 4ZSOA 1IGFL 2NW2A 1FYHB 3TJEH 3A6CL 1KENL 1PLGH 1F42A 5GS2D 1T0NB 5IB2B 1QR4A 1WSST 5FGCE 3TBWA 4FTVA 5JA9A 3ARDB 1B4JL 2P5EE 2CIIA 5IQ9A 4OV5A 4OCRH 4YHZL 3VH8B 3PHQB 3HZVA 4XXDA 1YPZA 1DBAL 1NL0H 3VU2A 1JNJA 2W0FA 1U95B 4K7FA 4L9DA 3CU1A 5E7FA 2UUDK 3RWHB 3ZKXB 3B8SA 3IFNH 1I7RB 1IC5H 3O9WD 1D5BA 4JANB 1J0IA 5D71L 4L3ED 3WN5A 1BQLL 5T5NG 3UXFA 3B9AA 4WI5A 4XX1E 1EXUA 3HKFA 1Q0YL 3SDXA 2GCYB 1EBAA 1BREA 1UQSA 1U6AL 3HZVB 4GKSB 2AABH 2E7MA 1I3RB 5FYJU 4HMCA 3O6KL 4Y1AB 2XTJE 3OR6B 2BJMH 3E3QE 4ZO9A 3V5DA 1L0YA 1HE7A 2LVEA 4LSPH 4X9IA 2OXHA 3T4AB 2XIDA 5KOVC 4OLYH 4YHPB 4NJAL 1ADQL 4LLDB 5C86A 3RVXC 1I3UA 3GMOA 3KYMB 4P5TA 2H9GB 5B3JE 5FO9A 5GPRA 1YN6B 1A9BB 4N90E 1F97A 1WFTA 3VXOB 5IJKC 4OQ1A 1YNLL 2Z31B 2ED8A 4NQXA 1ZHNA 3WXVH 5CS7A 1NGXA 1MVUA 4QRPA 4RMUA 4W4OC 1OLLA 2E27H 5C2BL 2ATKB 3ZSSA 1XGPA 3H9HA 4HWZB 4DTGH 3V52H 4MCYB 1HCFX 1VEOA 3WIIH 5LKNA 1Y0LB 2NY4C 3VRLF 1S8DB 4Y4HD 1DUYB 5E2WH 4X4YB 3TP4A 2C4FU 4HD9A 4XVUC 1MFEH 2R1XA 1I1FB 3GJEA 4Z7NE 2BMKB 3NAAH 1CFNB 2FATH 3VFVB 5D7LE 4YHLH 1XEDA 3CFDA 4RGMC 5C09D 1JL8A 4AH2B 1P7QB 2AQ2A 1ZHBB 3RNKA 5KBNC 4U1KA 3C5ZD 2F53E 4FXKA 3RTQC 3M45A 5IB3B 3UC0L 2AJSL 4F2MA 4ELMB 1KB9J 2LAGB 3FN0H 2EDNA 4LGRB 4M43L 1NJ9B 2A0LD 1JPGB 3EJYD 5BS0E 1ORQB 5F1NB 4MA7H 3UJIH 4AENA 4JFFB 1INQA 3PHOB 3KS0H 3SDAD 3C5SA 4U7SA 4R0LB 4MA3B 3PE9A 3Q5YA 3U82B 4YXHH 1BPVA 3MLSL 1EZVY 3EIFA 2FCBA 1FH5L 4XMLL 2Z0BA 5SWQA 1E4XI 1MJUL 4EKXA 4NKMB 1PKQB 4OD1H 5DFVD 4MCZB 5HYSB 2D0GA 2A6DA 3MRLB 1JTPA 4F15B 1MAML 4MAYA 1MFNA 4G3YL 1CE1H 2QKIA 3MRFB 3DX7B 4NQCA 3CCHB 2PO6A 4HJ0C 4K23L 2CDFB 5DMJB 2F5BH 3E6HA 1AQDA 4O2EB 4LSVH 1J8HA 3CVHA 4CGTA 2X4NA 4AEHL 3I9GH 3GSOA 5DEZA 1HKLL 2FX9L 5HHMB 2X89A 2ILLA 2E6PA 4HFWA 3S35H 4HH9B 1MLCA 3ZDYE 4WO4B 3WNLA 4YC2C 5F8QC 4M1GL 3S7GA 4K3JH 3UZQA 5E94A 3H3PH 4DGIH 4MJ6B 2GSGB 2WBKA 5F7NC 3FHQA 3O3BB 1BFSA 3GI8L 1C12B 1WZLA 3R0NA 4M7LL 1IBGH 5B3NA 3NFSH 4JRYE 2A6JB 3WJJA 3MO1A 3KPRA 3CFEA 4H8WH 1GHFL 4OB5H 4NKDA 4J23A 2UZYB 4JPVL 2V5YA 1F58L 3RQ3A 2AK1H 4ALAL 2I07A 3FONB 3VW3H 1YJDL 5I1JL 4AEIH 4POUB 4GG6B 2WBJB 3KWWA 4U49A 1DBMH 5JORB 1I1CA 3KJ6H 1ZA6B 4O2CB 4LMQI 3S8WA 2DWEB 3C8KB 4MNGE 4U6XB 5M94B 4WUUB 3OAUL 1XIWA 5TE6L 2GFBA 4LQ1A 1BOGA 1JZ8A 2L7UA 5CBAB 5DMIH 1H5BA 4NN7B 2VE6B 4LSSL 3EYOB 2KQMA 1AGBA 1Z3GL 3NCBB 4XPFH 1MVFA 5D96C 2OTWA 3U79A 2H41A 3I50L 4PJ7E 4R4NC 4JY6B 4NFBA 4EN3C 4Z9KB 3H0TA 4Y88A 3D3VE 1SJXA 4EDXA 1DLHB 2VABA 4L8SA 4QXGL 2MCG1 3TA3D 5JLZB 3T65A 1QLEL 5DMGD 3OKLB 2B1HL 2RB8A 1JI1A 4I0PD 3MV7E 4KJPD 2R0LH 2X4RB 3BD4A 5TGBA 3MROB 1RZ7H 5BVJA 3N9GL 2AK4B 4X6CF 4WW2C 2IJ0C 1DSFH 5IGXH 1QRND 3LB6C 4QF1A 1KB5H 3IDYC 1NMAL 2BY3A 1J1OH 2IADB 4ZUTA 4XWGL 1N0LA 2XA3A 3GDBA 2AJXH 2ICWJ 4NJ9H 1MSPA 2H8PA 4MQXD 3TV3L 3P4NB 3TZVB 4RZCA 1J0YA 4HUKB 4L4TE 4KZDL 3MUGB 3RJDA 4XPTH 3IU4H 1LVEA 1T0MA 3TVMA 3PV7A 1OTUC 4PY7A 1A1MB 3E0GA 1RZ8A 4JN1L 1NFKA 2H1PH 3MLPA 2N56A 4FXGA 1A21A 5F9WC 3FO9B 2R0WH 1FGVH 1FNSH 4YBQC 1H3UA 1YQVH 3DPBA 3RGVA 4DZ8A 5D7JD 1QZ1A 2D4FA 4IS6B 4YDJB 5L6YH 3BH9A 1RZFH 4K2UL 4NKIL 5IF0A 4NQSB 1U92B 4KPHL 1HQ4A 1NDMA 5JNYB 4NIKB 5I19H 5K59E 3ULVD 43C9A 2ICEA 1FO0L 4JFDE 4P2OA 3WS3B 3QQ9D 1NCDL 4XBEL 4CAGA 3VRJA 1AI1H 1OTTC 4X6DE 5JMOC 2H3NA 1FZKB 1OAXH 4OCSL 1JHLH 4Y2OA 4KJQD 5TF0A 4JZOB 3QQ3B 4NZDA 2CXKA 3GIVA 2D7MA 4JO1L 4KHXL 2ESVB 2NX5A 5HGDB 3G5ZA 3ARED 1KTLB 1I7TA 3TIEA 5GSRA 2UY7A 4ZS6C 4JFOB 3QDGE 1L0QA 1S7XA 2SEBA 3QUZC 3FB5A 5FO7A 2MTPA 4ODWB 4KAQH 2BXYA 5AWNH 1QSED 4JO3L 1ND0A 4UOW0 4RMWA 2IPKA 4MZ3A 5HHPB 5DC0A 2VLRB 1FVEB 4I18A 5C3LD 3GSWA 2EDEA 1CDHA 4MVBC 2MKLC 4PJEB 1FPTL 5BRZA 3HMWH 5I1LA 5DD5H 5E99H 3GJFH 5IIEB 5DJYA 5CWSA 3KPPA 3T2QA 4PJXF 1EERB 3ARZA 1T7WA 1U2CA 3CXHJ 3PGFL 3QDHA 3ARBA 1HHKA 2DMBA 5AZEH 1J1XL 3EJJX 3TFKC 3O6FC 5EU3A 1CGSL 2BZDA 3GZKA 4HGWA 3VA6A 5CP3H 3UYRH 3Q6GH 3V8OA 3PWLA 3SE3A 3O3AB 3MLVL 3MX0A 2GITB 2FDBP 2FRGP 3NIFF 3S4SG