4R8WL

Crystal structure of h7 hemagglutinin from a/anhui/1/2013 in complex with a neutralizing antibody ct149
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
110
structure length
110
Chain Sequence
EVVLTQSPGTLALPPGERATLSCRASHRVGSTYIAWYQQKSGQAPRRLIYGASNRATDIPDRFSGSGSGTDFTLTIRRLEPEDSAVYYCQQFSVSPWTFGQGTRVEIKRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A potent broad-spectrum protective human monoclonal antibody crosslinking two haemagglutinin monomers of influenza A virus
pubmed doi rcsb
source organism Influenza a virus (a/anhui/1-balf_rg45/2013(h7n9))
molecule tags Immune system
molecule keywords Hemagglutinin
total genus 21
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2014-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4r8wL00
4NO3B 4P9ML 2I27N 1MAKA 1CL7I 1AGCA 3LQZB 1RJLB 4AEFA 1A02N 3VFWB 4MWFA 5DJZA 1YY9D 4NWUL 1FORH 2ESVE 3WKNA 2ZSWB 1DR9A 4DVBB 5C2BH 1GHFH 2A6KA 4K3DL 2OTUB 4WI5A 5B3NA 1F6LL 5KVEL 3P0VL 3WIHL 5JHDD 4MD4A 4OAWA 5FV2A 3NIDF 5I6XB 1MCEA 5FA3A 1ORQB 4GW4A 3OB0H 4KDWA 4ORZC 2HG5A 5FFLA 3EFDL 3MLVL 1NFIA 2DIAA 2Y1VA 3DIFA 3L1OH 5L88H 1AP2A 1J8HB 1GPOH 4LDEB 5D7JC 5DUPH 4AM0B 5DJXA 3Q6FB 4PJ7F 3RKDC 3ABZA 3SDDD 3IT8D 4Z7NF 32C2B 4LSRH 1F90H 5EZIH 1AQDB 4PUBL 3NOIA 1BHGA 3BISA 3E6HA 5F96L 4GH7B 1RZKC 3GSUB 3DXAA 1KIRA 4G6FD 4UV4H 4GJTB 3LCYA 1R0AL 1T1YB 5E08L 4KPHH 1MHCA 2F54D 1N8ZB 2WQRA 2X4UB 3LN5B 5E2VL 5C07B 1ZSDB 3BDXA 2VISB 3VH8B 5IB4B 3EHBD 4I77L 1DBBL 1NDGA 1NLDH 1T20B 5E08H 4XVTH 1JYVA 2Z35A 3I84A 4WEBL 4D0DB 3BPCB 2O5ZH 3U83A 3MLXL 4LRNH 2XTJD 3GSVB 4CU8A 2R9HD 3IFNH 5CEZD 1B3JA 1G7QB 2AJUH 4HJ0C 4X5WB 2IANE 4DN3L 4P5KB 1LMKA 2PXYD 4NM8H 2UZXB 5DRWB 5E6ZA 3MV7B 4JHBA 4R4NC 4X6FB 3ROOA 2XPGB 4CDHA 4JFDE 4G8GB 1E4WH 2P5EB 1FLRH 4MA8L 4M03A 4U49A 3TJEH 2NTFA 3L3DA 5AG9A 2A74B 1SBSH 3HZKA 1TVBB 1MFAL 3H7BB 3MUZ1 5EOQL 5I1IH 5IBTH 1JNLL 2DIBA 2F5BH 4X8JA 1AGDA 4WTZG 3GKZA 1XGQA 4TVPE 3FT4A 5SWSA 1AR2A 1FL3B 3V0WH 2CO7B 1KCVL 1KTDB 5T1MB 3JWNC 2P8MA 4JVPA 3HI1B 5D6DA 4XPBH 1KJ3L 4U1SB 4HFUL 4ZS6C 4KDTA 3STLA 2NY6B 3EDDA 4TTDD 1JNNL 3QHZH 4JRXE 2XKNB 4XPHH 2V2TB 3W0WD 1LDSA 4BZ1L 4OM0L 4PJCE 4FQQA 4OQTH 3IU3B 2IPKB 3QDJA 3AXLA 3C60D 4UB0L 5HPOA 4HIJA 3BGMB 2Z0BA 2HN7A 5D7SL 4Y2OA 2IBZX 3QHZL 1CDIA 3RFZC 2YMXL 3U4AA 2YUVA 1MQKH 1WBXA 4LLUB 1A7PL 2CXKA 2DIJA 1HQ4A 4ZXBD 5HHNA 2D7NA 1F97A 5F9WC 3E2HB 5T33H 1FZKB 3GI9L 2R4RH 1RZ8B 5DURD 4IMKA 3QDJE 1Q9LA 1UEMA 4HIIB 1SBSL 1U3YA 1S7VA 1LWRA 5IVZB 4WFGE 5A43C 3ULVL 3IJSB 2ZUQC 4Y5YC 3QCVH 4K9EH 4GW1B 3B2VH 4OZHE 1PYWB 4NO3A 1AGBA 5E2UH 4HLJA 2HLFC 2FR4B 1Q9WA 2YC1B 4QEGA 1AHWB 1L0QA 1X5JA 1U8NB 2AJUL 3ULVF 5IVZA 4XWOD 1INDH 1C5BL 3ZT5A 2Z8WC 4HIIA 5DSCA 5F7EL 2IAMC 2A9NH 2BMKA 5FAAA 4MX7A 5ERWB 3I50L 5TF1H 5IB3B 1F02I 3MLYH 2VLRB 5DC4B 1A1MB 1QKZH 3RZCB 4XVTL 2ADJB 5TDPA 1TZGL 3DX9A 5JMOC 4LLUA 2BSSA 3FB8A 2VZSA 4FFZL 4NNXA 1J8HD 1KCLA 3CSBA 3O6FD 1PDKA 4TVPH 1FLTX 1N7MH 1XIWC 1Q72H 1A3LH 1DDHB 4LDOB 5K9QG 2Q3ZA 5KTEL 4PJ5D 2FO1A 1AC6A 3NVQA 2BK8A 3UEZA 3DNKA 5I8KH 4Y5XB 2HJKB 2ARJB 4HQQL 5EZIL 5TFSL 3FONA 1ETZA 2BX5A 3O8XD 1IKNC 1X5GA 5SX5K 2G75A 3T4YA 5FK9B 3OAYK 5IMKA 3N1PC 4KMTH 1Q0YL 4ZUVA 4YEEA 3P4MB 2Q87A 3V52L 1AGBB 2YKLH 1PFCA 4K3JH 4CN4A 3KPRB 1OP3K 3T0EA 3CMOL 2A74A 3HZKB 5DJYA 1CLOH 5F71A 4RMWA 5DHVH 4XGZA 3VFGH 4ALAL 3L3GA 3QWOA 2MQ0A 2UZIH 43CAA 1NDMA 1EFQA 5TE7L 1S5IL 3NH7H 4DN4L 1HXMA 3UYPA 2JCCA 3H3PH 5K9OB 2P8PA 5D7KE 2YA2A 5DMJB 2AP2A 4PJFB 3GBLA 4CL7A 5EZOL 3CX2A 2IC2A 3ZYIA 1FNGA 4R97C 4RGMC 4TUOB 1TIUA 5A2IH 3T77A 4K7PX 1J1PH 1P7KA 4FA8A 3UYRL 2ARJQ 2DN7A 4F9PC 5IVOA 2XIDA 1ZVSB 4N9OB 2DBJA 2FD6L 5FCUH 3B5HA 4LSSL 5EZJA 1F11B 1W8OA 1KFAH 3QDJB 5HI5C 4H8WH 4XP6L 1UYWH 3IFPA 4IOFC 3WFZA 3PL6C 1LEIB 4YBHA 1NDGB 1YMME 5IR1B 4P46A 5D96C 1ZSDA 3HI6H 4JHAL 3WIFB 2R69L 3MGTA 1YY8B 4Z18A 4H20H 5GZNC 5J56B 2VZVA 3FJTA 1NAML 1KUMA 2IANB 1MCDA 4X80L 3RWIB 4M4PA 4OZ4B 1BVZA 4LVNC 35C8H 3RWCB 5LJYH 1VFAB 2EEDA 2J4WL 4P2RE 4DJMA 4BKLB 3PG2A 3MUGA 5TE7H 4ZTPL 5L2KB 2HG5B 2VDRL 3TIDB 3SDYH 1AXIB 4G8GA 4WFEE 3F65A 2YXMA 1KIQB 4GXVH 3D3VA 5I0ZA 1T5XA 5EDXA 5ICXA 4BZYA 1AI1L 2H2PD 1QFPA 4GAGH 3S96A 4FQ1L 4G9FD 8FABA 5ADOL 4Z78B 4NZTL 3VFMA 3TCLB 4J12A 4KTEL 2YRLA 1FPTH 1J86A 3PWLA 5L6YL 4Z8FH 1SJVA 1N0XH 3QQNA 5AZ2L 4P9HL 4JKLA 4X0KA 3N1QC 5FGBA 4JFDB 3RIFF 1NSNL 2L4OA 4G9FB 4R6UA 5E00A 2B1AL 3C08H 1SJXA 4QCIB 5ILTL 3RWEA 2WQ8A 4OIIL 1MJUH 1AHWA 4X5XA 5GGQL 3VGEA 3P40A 4GKSA 1DL7H 1R3KB 4JJHA 4ERSL 1FJ1A 2ICWA 3LQAH 1Q94A 2OL3A 3O6KL 4Z5RB 3FO2A 3OSKA 3G6JE 1P84J 3OAUL 5IG7A 1KN4L 2EIZA 3FB5B 5I1LB 1ZA6A 3O45B 1BECA 4X9BA 5D1ZD 3PWNB 2IAMA 5JOEA 1FC1A 4NM4L 3TPUB 3MRNB 4UDUB 4HZLA 4GRWF 3QNYA 4W4NA 2R1YB 1CF8H 4MMZC 4RDQG 4Y5XC 4O00A 2Y06H 4YDVB 2EYTB 4HMCA 5JW5B 4K3GA 2GYSA 3DIFB 2HYMA 1NGPL 1I9RH 2CKBH 1OHQA 1LO4H 4OGAD 2FX9H 3ECBA 1N64H 2XQYK 2M2DA 4PJAB 3JV4B 2XG5A 2BNQA 1YA5A 4HS6B 4X9GA 4XNXL 4K3HA 5MERB 1HWGB 4KI1A 4OCRH 3IU3A 2AQ1A 1BQHB 3PXHA 4P2OC 1YC7A 2A6IB 1I85A 2JIXB 4UNTA 1WUNT 3ZT6A 5HYEA 1CTNA 1ES0A 2D2OA 4O2FA 1AGCB 5L8KB 3I6LD 4F7CA 1JPSL 3EO0B 3VMNA 1CFNB 3HRPA 3VH8G 3ZE0E 4L4TB 5IMOA 1YQVL 5KVFH 2OZ4A 3MA7B 5GGSB 1D5ZA 2HFFB 2ZG3A 3KPLA 5CUSL 3FQUB 3UTZA 2XPGA 4MVBC 2IPTL 3DSFL 1J0KA 4LGSB 4R96A 1OGTB 4HUNB 3WIIH 5L8LB 1I1YA 5HGAB 2VABA 1F4XH 3QRGH 2FLRT 2I9TA 1KJMA 2R0LH 5GGVH 3OR7A 4KHTH 3L7FA 3A0OA 3TT1L 5BO1H 1HQRA 4IMLA 1D7FA 3L9RB 2ZUXA 1D5IH 2IG2L 3EYOA 2AK4B 2H32B 5DD6A 1KV3A 2R15A 3V6OA 1XGRB 4G8EA 3TJHC 5GS2H 3QNZB 1ZEAL 1QLFB 5LCVL 1KB5H 4HV8B 1QFUL 1PQZA 2Z4QA 1K85A 5T1LA 1DUYB 4I9WD 1B0RB 2X4UA 2WBJD 2DM3A 2X7LA 2R29H 1PZUB 5DO2C 3I9GL 5I76A 3A6CH 2AJVL 5IBUG 1YJDC 3ILPA 4QGTA 1DSFL 2AJYH 1WCQA 2YUXA 3EDJA 4FG6D 2C3XA 1CLZH 5JW3L 4YQXL 2DQEL 3GSOB 3MLPA 1BAFH 1OVZA 4ODVL 2DLEA 4HPOL 5TQ2L 3QDMD 1IM3A 3KPMA 1S9VB 1ZLUK 2Y25A 2YHGA 1DE4A 1OM3L 2CDGB 2V7HB 4HUWA 4CMMA 3H42H 1DBJH 5FA3B 3OG4B 3HC3L 3PIQA 1T3FB 2VE6B 3UX9B 4MLSA 3BWAA 1U8PA 3PJSA 2KPNA 3CFEB 4IDLA 5LXGL 4JM4H 4M00A 4EN3C 3LOWA 2JJUA 5IIEB 5CEYB 3LKSA 3NFPB 1IMHC 3KYMA 3UO1L 3FQWB 4JY4A 3LQZA 1B9ZA 5SWQA 5TF1L 5B38B 3LPFA 5AG8A 3CFDB 2PW1B 5F96H 2IMNA 4KKBD 5BOZG 3TN0B 1G9ML 1I8MB 3QXDA 1IGIL 1GPOL 3VCLA 1GZPB 2D03H 1FG9C 5GRVK 3SOBH 3CGTA 3UTOA 2FECI 4E0RA 5B38A 1RZFH 3I3EA 4EZMA 3LIZL 2WINA 3W11C 4RFEB 4HXBH 4X6DB 4YWGH 4LKXB 3SE9L 2XNAA 1ITBB 2BC4A 3BYYA 1BEYL 2R4RL 4ZUUA 4NQSB 4PJDF 5KG9A 1BIIB 2DQIL 3ARDC 3DO7B 4OZGA 3T65B 1SEQH 1QZ1A 1NEZA 4L3EA 3LEXB 3RIAK 5ACLA 1S3KH 4WFFE 2OMNA 1QR4A 1VEMA 5ADPL 2X4TA 5A2LH 1I9JH 5F3BB 2DYPB 4I5BA 4CVUA 5D7SH 1N59B 1OTTD 4OTXL 5IVXE 5IFHL 4WI3A 4UB0H 3O4OC 1ADQA 1G7HB 1XF4B 1Z0MA 2CIKB 5HDQL 4IJ3C 4XXCC 5HHVL 3C9NB 1CGVA 1T0NA 4S2SA 2P42B 3MOBL 4I4WB 5T1KB 4GMSL 3ILPB 5B21A 5EWIL 5DQ9A 4OLUL 4YHOH 1S7WA 3HFMH 4ZFOA 3FMGL 4KKBC 3WUZA 1UM4L 1ACZA 1I1AD 4YZFF 5KSAD 3WO4B 4JQVC 1JFQL 2CKNA 5GHWL 2YD4A 2YSSA 4KUZH 3V0WL 1PY4A 4KTDL 1D9KB 1HILA 3H0TB 4YFLI 5ANMB 4LNRB 4U6YB 3AY4C 4C59B 3MFFB 1WBYB 4G6JH 1TZHA 1DFBH 1CXEA 4P2OB 4K7PY 1LEKA 1L0YA 3QA3B 4KHTL 3MBEA 5HHOB 4PJEB 1C12B 1RI8A 4L3CA 3PNWB 4P57B 1XGUB 3KYNB 4YH6A 2AJSH 3QWRD 3BAEH 4WTZA 3IDMB 4HUVA 3CFKB 3NAAH 3TNNB 4QXTB 1HILB 3FN0L 1BVKA 5D5MF 1EVTC 4LAJH 3BIAX 3G9VA 4WO4B 5CUSH 1W72H 1YUHB 1X6NA 5EIVA 1QSVA 4LRNL 5KSBF 1F4YH 4QXGH 2D0GA 3G04B 1G7PA 3IXAB 3GMMB 3S35H 4LLWA 2XYCA 1HKLL 3GMOB 1BM3L 3QUMA 3EJJX 3WJJC 4I77H 2WUBH 15C8L 3O6FA 2HJLB 3W39A 3EO0A 5JHDB 4DVRH 1NMAL 1BIHA 1RZGA 1T83A 1SYVA 4CVZA 3GRWL 2E3VA 4LCCB 3P73B 2OI9C 1GRWA 1EHLH 4PIRF 3VXNA 1H5BC 1F90L 2ZUSA 3QIUB 4QRPA 5FF6B 4AL8L 4PY8J 2W0PA 3T4AA 3HC4H 3IDIA 1HYSC 4EIZC 1OQXA 4OGYL 5I74C 2AQ3A 2XZQL 1RJZB 3O4LE 3QXAA 3SKUD 2XA8L 3SBWA 4M5ZH 4OI8A 3MV9E 2R2HA 4JY5L 3T09A 3DUSB 2P5WA 2ITCA 1U95A 2IFGA 1F3DJ 5DR5L 4PGCB 3NIGE 5EUOF 5GZND 5H94A 1J7VR 3MRIB 3UO1H 2ADIB 3BSZL 1S9KC 1J0ZA 1YQ2A 3OB0K 1EIBA 5INDA 4NC1C 3DVNA 2WM0A 1KEGL 1GZPA 4A2MA 3T2NL 1B0RA 2DQUH 4I48B 1CT8A 4YAQA 4LSDA 2XWJA 3ELAT 3MRJB 3N06B 2VTFA 3BGFC 1CE1L 3BPNC 3KNBB 2ITDB 3RAJL 1IKFH 3S4SB 1XGPB 2GITB 3QUZB 5FECB 5ILTH 5K93A 4HS3B 1XGRA 1G6RB 2EDJA 2AK4A 3BH9B 3NCYP 1S9WA 1OP3H 2F53A 5T5FL 4PR5A 5GSVA 1N5AB 1H15A 4YBLB 4HJJL 4GG6B 5GGRA 1XF2A 3GHBH 1WF5A 2B7DT 3DXAD 1KOAA 5C08D 1RIHL 2X1XR 2E6QA 5DTFB 1EBPA 4OF7A 5DK3A 4WHYG 4F15C 2HKFH 3VXSD 2VUOA 1MH5B 4PJ7A 4KDTC 3SGDH 4FTVD 3KPPB 5IB1B 1BQLL 4NGHL 5GJSL 1HHHB 4GAYA 4X98B 3X13A 2CGRL 5K59E 4RNRA 1EJ6A 4RGNB 4OCMC 3OKKA 4UT6L 3VA6A 4TSBH 2P5EE 1U8HB 2VLJE 2YK1L 5HPMA 2AQ2A 3FFCD 4M6MH 4WNQA 2X1OA 3MLUH 1HEZB 1CFNA 3OKYA 4PJAE 5JHDA 3TBVA 1DBML 1TENA 2IANA 1PVHA 3MRMB 4UOW1 4M1GH 5DDHA 4H20L 2HFGL 3BPOB 1YY8A 2JJTA 3KWWA 3ZDZF 1ZA3B 2R69H 2AK1H 2QKIA 5F88B 2DLGA 1YUHA 4X6CB 1JZ2A 1ZS8A 2PO6C 1HNGA 5B3JE 1NKRA 5I18H 5EBMA 4UV7H 3KYOA 1EEUA 1Z9SA 1EEZB 1NCCL 3U0PB 3WFBL 4NN6B 2CUIA 1F11A 1CCZA 2DRUA 1F58H 4JN2B 1IBGL 3HMXH 1C5DB 4JM2F 4NWTH 3AU1A 1ZVSA 4MJ6A 1OW0C 3QXWA 4NKOA 4PD4J 1BZ9A 1MRDH 4OSUL 3QA3A 3UTQB 5HGAA 5C07E 1JPFB 4FQIH 2I25N 4MXVE 4NJ9L 5DYOA 5LGKA 4MAYC 1H5BB 5FYKH 5BRZA 5T5NF 1B4RA 1N5YH 1HHIA 3D2UA 3VGAC 2VYRE 1S5IH 1MFCL 1ZHKA 5C0CA 5EUOA 1GZQA 5T3XD 1J8HE 3MRLA 4Z5RA 5J0BA 3MJ9L 4UU9B 3CSPA 1QRNB 2BVPB 4NZUL 3L5XL 4HIXL 4JY5H 5B39B 1K6QL 5T3XL 1EFXD 5ALCL 2X41A 5INCA 5GGTL 1CXFA 4JGJA 1EBAA 1KPRB 3HB3D 4MAYA 3VRLF 5C0BD 3REVA 3MJ9H 3OKEA 2B5IC 2MSPA 3PWLB 1HZHH 3PV7A 4NKIH 4KK9C 1JGVL 4XCFH 5I8EB 1WAAE 5EG6C 1Q9KB 4Z78A 3QXVA 3S96B 2L7UA 4RFNC 1AY1L 1IILE 1FP5A 3FAXA 4OZHA 4C83A 2Q7YB 2WUBL 4YDLB 2XNAB 5I75B 3VXRD 3C08L 3QJHB 3V0AC 4LVOB 2BVUA 2VR4A 3KPQB 4OZFA 3SGEI 2HLAB 5HVHB 4PBVC 1FRGH 2VXUL 4E5XB 5DRXA 1WFUA 1DUZB 4RWHA 1EO5A 1V7NL 1S8DA 1TCMA 2BY3A 4NHUB 4P2QA 1CICD 2RQ8A 3G5XB 2C1PB 3LH2L 4R90H 3DXAE 3BZFB 1C16B 4V2CB 4X7TB 1MUJB 1U8IB 4GSDH 1U8NA 3VRIA 3BFOA 4L8BA 2R23A 2DQJH 3UDWC 3D9AH 2QV2A 3WHXA 1JGUL 3EFFA 3MLUL 1IFHL 4J23A 1BWMA 1OGAD 4KXZI 4PJCF 3SDCD 2IH3A 1FV1A 1CIUA 4RSVA 1CXIA 3VI4F 1T66D 3QDMB 4M6ML 1J8KA 5DLMH 2XI9A 4L9LC 3VFVB 4JFED 1RZ8A 2WLZA 1EERB 3BWUC 3GMLA 1OAUH 1QQDA 2XA3A 4ZYKB 3MRQA 4OGXL 4KK8C 5CGTA 3RDTB 1U58B 1RIHH 1ZT4B 3FMGH 1L7IH 1HWHB 4ODXB 5FUCC 1S9VA 2HJFA 2WNGA 3Q48A 3AMKA 1MNUH 1MCHA 4KKAD 3S35X 1DQJB 43CAB 1MCIA 1EK3A 3SDCB 3X14B 3GUTA 1D6VH 3UPRB 1GGYA 3P30L 4FQXB 4UZGA 3T0WA 4ZQKB 5EOTB 4KH2A 1XIWB 3MJ6A 1IGCH 4HWUA 4GW5B 5JR1L 1JHKH 4N8VG 4M3JA 4UUJB 2ICCA 4ZOAA 4DGVL 4O4YH 4PRID 3O9WB 2F8VA 2NYYD 4LPUA 5HVFB 1X44A 4C4KT 3FHAA 4GKSB 2OSLB 2YEZA 3RGVC 2GFBA 3K4AA 4KI5D 3F6LA 4RAHA 1RUML 1KEGH 1XT5A 5KVGH 1TCRB 1YEKL 4LCWA 3S98A 3SPVA 2VXSH 2PNDA 4Q9RL 2BJML 1OAYL 4EOWL 1K9TA 3C8KA 5CCKL 3L7FB 4UBDD 4NQED 1S7QA 3KS0J 4HLZG 4X6FA 3ROOB 5C0JA 3QZWA 3KXFB 4LLDA 3HA0A 4F7EB 1ZHBB 4NQCA 5CJ5A 3MV8E 2JB6B 1R5IB 5I0DA 2WV3A 4TRPH 3KPLB 4N5ED 3T0ED 4XXDA 5CEXB 1R3IH 1Q9OA 1U36A 4GRMA 3MBXH 3LEYH 3MYJA 3G6JF 1TETL 4R8WH 2F5AH 3I6KA 1EFXB 4WHCA 2UYLA 25C8H 4KJYB 3ZZ1A 1NGZA 1N2RA 4EI5C 3BQUA 3B9AA 2GFBB 5JORA 2I9LA 3O9WA 2W9DL 2XQYG 3HHRB 3OKLA 3U7WH 3L6FA 3VWKC 3IJYA 3RWHB 3GJFA 5MENA 1A6WH 4FQCL 1UB5A 4F37K 3GSUA 4HIEB 5IBLD 1L9NA 4HWEL 3PHQB 3U48A 3E6HB 2X70A 5ENWB 3JTTA 1U93B 4XVSL 4J8RB 4R4ND 4UTAL 4XP9L 4DAGL 1AP2B 3OBAA 3UTTA 4U0RC 4LU5L 4M1DL 2YOCA 2IQAB 2WSKA 2Z31B 3S5LB 1ED3B 3QCVL 4K9EL 1CE6B 3DV6B 4PJGE 4OFPA 4NUGL 3ZDZE 4G6JL 1IQWL 4Z0XA 1V8HA 4HSQA 3IDJA 3H3BC 1UKSA 4FQQB 4JPWH 4QKXB 1CFTB 3T2QA 2N7BA 4ZO6A 4PRBA 3OMZA 5T33L 1CDYA 4RGMB 3C2AH 2FR4A 4P3WA 4F58H 3T3PF 4YHPA 1BMGA 3G6DL 5IKCA 5TPWL 3VFRA 5E03A 4YXLH 3MLRL 1K8DA 3CH1A 3JVGA 3RWEB 3E3QE 4LIQL 4LCYB 4X7TA 2VZ1A 3FT4B 5E8NA 2YD3A 3JTSB 3BZFA 1MAML 1MJ7H 4GMSH 4FOMA 4APQB 4RDQF 1OAXL 1B4JL 4K23H 1MCSA 5CEZH 5D96B 5C6TH 1FFQA 1T89A 1BOGA 4U6VL 3RGHA 3LKNB 5KANG 1K3IA 4L4VA 1CGSL 1KN2H 2XWTB 3AY4A 2DLHA 3MV7A 1KNOA 3LKPB 4KJQD 3DI3B 1QHOA 3UDWA 2X9WA 4C83B 3FN3A 2FEDD 5HHXL 4R4BA 3BXNB 4W6XB 4K55A 4R7NB 5D1QC 1CR9H 1JN6B 3VXUA 3PABA 1P9MA 4CVWA 1LP9B 2X89A 2ZNWA 4LVHC 1FNEA 1VFAA 5BV7C 3BQUC 2DTMH 1CD1A 1E4WL 5KANI 4OZ4A 1JGLL 3VD4A 4F9PA 1S7XB 3LEYL 2ZPKL 4HT1H 1O7SA 3EOBA 3B3IA 3HI1A 4OIAA 9CGTA 2XQBL 3F12B 1A1NB 3UTSB 1KBGH 3P4OA 1QSEB 2D03L 2AEQL 1F3JA 2QSVA 2HT4C 1FHGA 1QRNA 1W2KT 1OAYH 5DA4A 1NJ9B 5CS7A 4PJ7E 4PD4K 4PS4L 5DHVB 2HRPL 1NC4A 4PJBF 4KK6C 2O5ZL 1JYWA 2HT4D 1DBKH 4HHAB 3ARFB 4GS7C 2H1PH 5HXMA 2N4IA 4BFBD 1KN4H 4G3YH 4Z7OF 3CX5K 3IS0X 2BP3A 5IW6A 4XP1L 1T22B 4LEXH 2CRZA 1QRNE 3CMGA 4G43A 1J9CT 3WLBA 1EHNA 2O93L 2GQHA 2OI9B 4XT1C 5DI8A 2HH0H 4LF3A 4P2OD 5FYLD 2NY2C 3K4ZA 1PD6A 2NXZB 5DGRA 5EBMB 4K3EH 5TDOB 3W0WA 4X5LA 4QTIH 4OGZA 1XR8B 1CLYL 4D0BA 4MZ2A 1M4KA 5L7XL 5EO1B 4Z7QE 4ODTL 5E8DH 4D94A 1EA9C 2N1KA 3IYLW 2DMKA 3MRGB 5JUEH 4PJ5A 5DLML 1VEPA 2P43B 1NGZB 4WO4D 1T89C 2R2BB 2GT9B 4DK6A 4XPTL 5C0NC 5T1KD 2C3VB 3TWCL 1JRHL 4NWUH 1P53A 4PV9A 4BFEA 1H9VA 5EC1A 3RZCD 4NCC2 1J8HA 5ALBH 3IU4L 3BXNA 3GK8H 3OF6A 1MWAL 2X05A 4U33A 4YHKL 4CUCA 1TTUA 4TVPD 1ORQA 4WUKH 5GRUL 4Y5YB 1MLBA 4QHNA 1I1AA 1EPFA 2X4QA 4C56D 4KK9D 1OPGL 4GKNA 2D7TL 2K3TA 3LH2H 4O9HH 3PQYE 5DTFA 1BF8A 4RRPA 4Z7VB 3LQMA 4M5YL 4JO3H 3FB7A 4QOKA 4Z95L 4EIGB 1ZGLB 3U30C 1UJTA 4PRAA 4ELMA 3DV4A 5FHAL 3CUPB 1KXVC 2DMCA 4H8WL 3DTXB 1UWGL 3BH9A 3V6OE 4P2YA 4N8CL 2UWEE 2RB8A 2W91A 1JV5B 4FQ2H 1UB6A 2NY1C 5ICYA 4K8RD 3AREA 4LASH 5DJ6B 5F7DA 5KSBB 5FV1L 4XBEH 4NC0B 4QHMA 2FX7L 1X4YA 3H7LA 5C3TA 1B2WH 3MR9A 3R1GL 4ZFGH 3TN0C 3TC9A 4L4TD 4GRLA 3VGFA 2BY1A 4ALAH 3EDEA 2MTPA 3C6LA 1KXQE 2VLJA 4OZGF 4WFGD 5DJXB 5AAMA 3HR5A 2VSCA 3DGGA 4HIXH 1FZJA 2FYYA 4GRWH 4Z77B 3QXTA 3V52H 5IHUH 3KJ4C 2CKBL 3RJQB 1EMTL 2X9XA 1ZANL 4DEPC 3O6FC 1K6QH 3BD4A 4OF0A 3QUKB 1AQKL 4NQXB 3KDMA 1I3RB 1I9EA 1I9RL 1TXKA 4ORGB 1UCBH 3WXWL 2A6JB 4DGYH 3WKML 1RIVH 1CL7H 3MLSL 5DMIH 3NTCL 2X89D 3DROB 5F9JB 5GGVY 2BNUB 3AC0A 3ILQD 3MFGB 5DJ2A 4ZAKC 2VDQH 3PUCA 4N0FB 5HYJB 1A7OL 1A6ZB 1FVEA 2J2ZA 1EUUA 3WL9A 3MV7D 4QRUB 1U8JA 3IAGC 2Z93B 5FUZL 3HLAA 2PO6A 4YPJA 3W5NA 5DEZA 2JELH 3ARGB 1Q1JH 2I60H 5FA4A 3U9PL 4IRJC 1TTGA 4U1IA 2JB6A 5D4QA 2LVEA 3BP6B 4UIMB 4M1GL 5I1KH 3SY0B 3TM6A 3LDBB 3VW3L 3S36X 1QSEE 2FJGA 5IHZB 1RJCA 1XGUA 1S7QB 3MODH 4KJQC 1EGJL 4H25B 2ZSVA 2GJ6A 4KJWD 4AEEA 3WJLC 5M95B 1BBJA 4NRXA 4NQCD 4L29B 4TUJB 1FH5L 4LCWB 4JFFA 1CDBA 1BZ7B 1HHKB 1BQLH 1MF2L 4NGHH 1Q0XH 5GJSH 4EUPH 2YK1H 3KNBA 2NY3C 3CFJB 4FFVD 4OB5L 1KIUA 1QLRA 3BP7A 1GGCH 3VXSE 4DOHE 1CFSB 3ULSA 3VRLE 3FFDA 3MJ7B 2I07B 2EE2A 2W9EL 1MQKL 4UT9L 5DJDA 5MEND 3HE7A 5C09D 4LASL 3KPOB 5MEPB 4LPTA 5BRZD 3S8WA 1MFEL 3NIFE 5DEGB 5E8PB 2C4FT 5I17A 3HKFA 4JDZA 4PGEB 2CJUH 1MRCL 1UEYA 2CIKA 3GRWA 4XNMA 3FO9A 1MPAL 1WCBB 3K2UH 3PDOA 4LP5A 4PB0H 1DVFD 4M7LL 3W0WE 4KZDL 3PP4L 4JE4B 3D85D 4U7KA 2XV6B 4JKPL 2IQ9H 5MHSE 4PJHF 4PJEE 4J3VA 2OL3H 2OP4H 4YHIB 1JZ3A 1KCSL 4P48A 1CS6A 3RGVB 1D9KC 3IDIB 5LBSL 4HULB 5DWUL 3BSZH 2A6KB 4XMKH 1SVZA 5IQ7H 4KZEH 4EDWH 5ESVA 2Z92B 4MHHI 4LKCA 2NXYC 5I66A 1I75A 2F5BL 5JIKA 3ARBC 1ZAGA 1A0QH 3QIWA 5GJTH 3GMNA 1JIBA 4KROD 1OARL 3D3VE 3EO9H 3J8F7 4IDJL 4XPFL 3LSOA 3CDCA 2AEPH 1BJMA 3OJMB 4KMTL 1QLEH 3JWDC 3BZ4A 5JOFA 5F7HA 1U8LA 1CDJA 1I7RA 3MRHA 4NC1E 5LGHH 4M5ZL 1M6OB 3MREA 3U4EB 5GZOC 1MCKA 2XTJE 3GMNB 4NFBA 1X5YA 3GM0A 4RNRB 2YPLD 3KPRD 5C0ND 4GG6F 1HI6A 2IBBA 3SDAC 3B83A 2YR3A 5K9QI 3LN4A 1I8LC 1PGRB 1WBZB 3M8OL 1A5FL 5E4EC 1FFOA 4XCNB 1JF1A 1ZWIB 5DD5L 5AZEL 4M48H 3VXMD 2CDGA 2OCFD 1QNZL 3QDHA 1FGNL 4PPTA 3S35L 1LK3L 2FH6A 5FO7A 3EOAA 4PG9B 3A6BL 2BY2A 1OP5H 2EO1A 1VFOA 3PV6B 1ZLWK 1HINL 1A7QH 4M8QB 4O02H 5TPWH 2A6DA 2NYYC 1MEXL 5J11B 3MRPA 4YBLC 3LKQB 5A3IC 4KRPC 2GJ6D 5EBWA 4F7MB 1VESA 1FE8H 3GB7A 1ZHKB 2UWEF 2EYSA 4HT1L 3B43A 1HCFX 3CX5J 2CQVA 3BN9C 1I8IA 3U46B 3VG0H 4YR6B 3CXHK 2D0HA 4G8EB 3D25A 4LARL 1YEGH 1VKXB 3IDYB 3B9KB 1H3TA 2EXWD 2DAVA 2BCKA 1UM4H 1CR9L 3R8QA 2VIRB 4LCUA 5ID1B 1AC0A 2EXWC 1QO3B 1JPFA 5K9KA 4OLEA 3MC0A 4AIOA 2E7LC 1HI6B 4XWOC 5IROA 3EZJB 4HG4K 1S78D 4JN2A 3GSRA 4PJHA 4PRPA 4K2UL 1RUPH 3WFHA 2CDFA 3IS1X 3QIWC 2WINB 1OGTA 5BW7C 3ZDYE 1CGSH 1U91B 2ZP0T 1DVFA 4HKBA 4MB3A 1UA6H 3MNZA 2OR9L 2NY7L 3PGCB 4EUPA 4I9WE 3QG7L 5D7LD 4EN3A 1RUPL 1NMCB 3HLAB 3BUTA 3P11H 1QP1A 1O7VA 3BEVA 2GTZB 3QG6A 1T6VN 4CJ1A 4U3CA 2BVOA 1G7JB 1RVFH 2NX5E 4DCQA 5IROC 1DZBA 5DUBA 3ZE2E 3PP3K 1HK6A 1KYOK 3ZYZA 1J1OL 2D7MA 4YHML 1I1FA 4PJXB 3KPSD 3VG0L 5C3LD 3D3VD 2CO6B 3LIZH 2ADGB 3WNMA 1RZFL 2DLIA 2ID5A 4ZD3H 3SOBL 4HS6A 2FO4B 3V7AE 4HUVB 4Y88A 1A4JB 1E4XI 3LS5L 2ICWI 2BVQB 1U8KB 4AJ0A 1E27B 2P7TA 1PSKL 3F7QA 1BX2A 3RTQC 5CCKH 1C8PA 1MEXH 1D5BA 2C1OB 1FZJB 5IJKA 3AUVA 3OJDA 1FL5B 3GSOA 3NIFF 1WBYA 5AZEH 2ZCHL 4JM2B 5KVGL 4KKAC 4Q9BA 4YGVB 2NZIA 4ONHB 3PWUB 1AKJD 4I18B 1MI5D 5E5UB 2Y72A 4EQ3A 4OCNC 4M48L 1IGYA 4I48A 4POUB 3UC0H 1NPUA 3GHEH 3HC3H 3NCEB 3ARDB 5EU3A 1DBJL 1ZTXH 3T2PA 3P9LA 3IXTB 3QHFH 4OD3H 3HMWH 3TYGH 2QEJA 4QYOB 4WHYH 4R3SB 1B0WA 3UZEA 4X7FC 5E8OB 3FHQA 3VXME 43C9B 2SEBB 4NPYA 1A7RL 1YECL 4PGBA 1D9KD 4NZRH 4IRJA 1Z9OA 1IGJA 4L29A 3QQ9C 4LMQI 3BESR 4KKCC 3PWPB 3A6CL 2X9YA 4G6AC 4H88H 2NX5B 2X4OB 4BH8B 2EH8L 4F9LA 3QEHA 4XCCL 5IHZA 3S3PA 1A4JA 2BDNH 4K71C 3SY0A 2P45B 4FQLL 4MJIB 2IGFH 3PGFH 3CFCH 2B5IB 2D7QA 2X4RB 1ZEAH 3OAYH 1JE6A 1D5MA 3WXVH 3VXNB 4E41E 3F7PC 5GGSA 4JJ5A 3TIDA 4JM2D 2L7JA 5EO0B 4L4TA 5IMOB 5MEQA 4YJZL 1HH9A 4YDIH 1PLGH 2C4FU 5JLZB 1MREH 1J0JA 3C5SB 2R2BA 4NYLB 1LE5B 3WL9B 1FG2A 2VR5A 2B0SH 3BZDA 3BW9B 4FG6C 3BZ4B 5JOFB 3N85L 3PP4H 2P8LA 3U36A 3VCLB 5T3ZH 4NO5A 5MENE 1KENL 2V9QA 2P24A 4HXAH 4OD1H 1OT1A 2AJZB 5JZ7D 1K8IA 4ZOEA 5KS9E 3FFCE 4M7LH 3P30H 3DGCR 4LKCB 4PTUB 3CU1A 3PNWA 3M17B 4N0UE 4P57A 1MJJA 1RULH 3KG5A 1HXYB 4WY7H 5DEFA 4I2XE 4DZ8A 1MIML 3RPKA 1UM6H 3B6SB 4OB5H 4JQXC 3JSSA 4YHZL 5KZCD 1I85C 2FIKA 3FRUB 1X5FA 3QFDA 5GISH 1M7DA 1JGEB 4NRYB 3WD5L 2BCKB 1JHTA 3KJ6L 2VO5A 1NH6A 4KKNA 3RU8L 1LO0H 3UMTA 2DQDH 3QDGA 4R26L 3GMPA 2XTJB 5HYSA 1IC1A 4ZAKD 1H8OA 3QIBC 4ZNEA 5KSBA 2PYFA 2VDLH 3DJ9A 2GI7A 1I4FB 3BDBA 1NANH 5DJDB 2NW2B 4CAGA 1FO0L 2J6EL 3CVIH 1UB6B 2DQJL 1QSEA 4I4WA 3F12A 3W11D 4WUUB 3CXHJ 2RIKA 3ZKSD 3ZLQC 1CFVH 3MXWL 3SGJA 3MNVB 1M7IB 3U9PH 4KRPD 1VCAA 3NIGF 5EUOE 1MY5A 4OLYL 2DWDA 3TCLA 1JF1B 4L4VD 5E6YA 4FXGA 2GJ6B 4JANB 2ICEA 5FUZH 3VFTA 2PXYB 2IPUG 2V5YA 1DDHA 4JQIH 1JMXA 1DANT 3C5ZA 4GBXC 5JHLL 3VXOA 4H1LA 4XNQA 1SM3L 3KYAA 1FFPA 3CVHH 5L2KD 3ALXA 3GGWA 3NFSH 1IQDA 2FGWL 3OL2A 4OGAC 3LKNA 4UOJA 3T3ME 2JCCE 3NTCH 3THMH 2HVJA 5DURB 4LP4A 3BQUD 3DI2B 2BMKB 3SDAD 3RWFB 3GSNB 5J13B 1U8JB 4B5EA 5AUMA 1UGNA 2F54B 4Z7NE 4L5FH 1IAKB 3PHSA 1CXHA 4NKMA 4YHPB 1MCWW 4RIRA 4RMSA 1KTRL 4YK4B 3WFDH 1U8MA 5GZOD 2J4WH 3V4VH 4PJDE 4EDXB 5D7LB 3STBA 2QTEA 2P4AB 2QHRL 3QDGE 1WQVT 4HWBL 3LEVL 4TNVK 1BGXL 1MFCH 4WFHD 4XAWL 4Z7WE 2D9QB 3BYTA 1YPZA 3IDJB 3VD5A 1FBIL 4NQEA 1N5YL 4BH7B 2OJZL 2C3WA 3VJ6A 4NQXA 5LQBL 3BWAB 2CIIA 3JV4A 3PHOB 3U7YL 1RULL 1GL4B 2A73B 3VWKB 3ECBB 4PJAF 2IQAA 5FYKD 1I8KA 3VXMA 1I7TB 5C0FB 5EZLA 1UZ8A 3ROLA 4HHAA 2BFVH 4DZBB 3AS1A 1QBLL 3QUZC 3HI6L 4JHAH 2VLME 2W1NA 1J05A 2R1YA 4M5YH 2EE6A 3TPUA 4POZD 4G8GE 3N85H 3VMPA 3TGXA 1UB5B 3KPRA 1QR1B 3LDBC 3ZKXC 3OGCB 3T0DA 4MJID 3ULSB 2HMID 3SGDI 1ZHNA 4HGKC 4L3ED 3EOBB 4PY7B 4HV8A 2VDMH 4JPKL 3BQUB 2NX5D 3KYKL 2XOTA 1YJDL 1LHZA 5SWSB 4G9FA 5E00B 5TE4H 2X1QA 5J9PB 3L3HA 4DW2H 2VXVL 1F2QA 3EYSH 4TSBL 2EC9T 3MTRA 4MA3B 5DJ8B 1U92B 3V79C 4QRTA 1P84K 2NLJA 5CIPB 4X8XA 3KR3H 4LDLB 2OJEB 3GM8A 2I9TB 1LO2L 1KJ2B 3CVHB 4LLDB 3TZVB 4Q97A 5GRYA 4MNQB 2WZPD 4MDIB 4HJGA 5JMRA 1JBJA 3QIBD 4KHXL 5ITFA 3BIKB 4JY6A 3Q1SH 1D5ZB 2BERA 2HFFA 1G7QA 1AR1D 2D31B 4XBPB 2FGWH 4K3EL 3RP1A 2CRIA 3BDYL 3PWJB 2HLFD 4NQEE 3HMWL 3QHFL 4MNQD 1KGCD 4LSVL 4OD3L 4A6YL 4WUUD 3I85A 3JV5A 3RWIA 3PWVA 5DRZB 1RUQH 2A77L 3ORJA 3CPLA 1YEEH 2ZCLH 4KY1L 3RKDD 2K9UA 3QEUA 1PKQB 4FHBD 5SWZA 3RI5K 4NNPH 4ONGL 5EO1A 3AROA 1NGXA 3S4SG 1DBKL 4NQUA 4PRBB 4ZSOB 4O58H 3F8UB 4S0SD 1UJ3A 5L9DH 3ARGD 1I3UA 1NFDB 2E6JA 5JQHC 5CGYC 3E2HC 4OZIF 1G6RH 1FZKA 4U05A 1AQDA 3VXPB 2AEQH 4LF3B 1CE6A 1E6JL 4RAVB 1SJEB 1XF3A 4YDKL 2HJFB 2EYRB 4UAOC 5E2UL 4D2NA 1T22A 3LS4H 4PY8I 5KS9F 3C60C 3LB6C 3RGVD 2PW2B 1IC5H 3W9EB 2WIIB 4QRRA 5ID0A 4PJ8B 1A6VL 4ELMF 4KMLB 4TSAL 1HHGB 4ODSL 3SE4A 2E8YA 4UINL 5KSUA 3EYQC 3ARBA 1KCUH 1V05A 2EECA 4CMHC 5IT2L 3IJYB 1SJHA 4P2QD 2BOCB 5KOVC 5DO2D 3MRDB 1P9MC 4ZDHB 3ETBF 8CGTA 5EWIH 2YBRA 12E8L 5DD1H 1A8JH 1E6OL 5I15H 1ZLWH 4I3SL 5IW1A 4JZOA 4P46D 4PRIA 1JWSB 2R2CA 2LVCA 3V7AG 1TJIH 2M8XA 1KN2L 5DD3L 3ZTNH 1F4YL 2APVA 2MQCA 4QXGL 5JPNA 4PJCA 4M6OH 2D9CA 2ZUYA 1IGTA 4Z7VA 3MLRH 3B9DA 4HJGB 1IQDB 1SHMA 4NQCB 4P4KC 4QWWD 2NW3A 4XWGH 2ATKA 3MRKB 1L7TH 3U79A 4M62L 2OMBA 5H37G 2IADA 5C08E 4AIZB 4LARH 3GBNL 3ULUD 3P9WB 5L2KA 3ARWA 2XG4A 2EICA 2VLKD 1IQWH 1IGTB 1I7ZA 1NQBA 4X7EC 2XT1B 3EJZD 3ZSSA 3RWCA 2ADFL 5I1HL 3MNVA 1UXWB 3EIFA 3PGFL 1NFDA 3DYOA 3CDGB 4LQ1A 2Y07L 2VLJD 4KUZL 4MA8H 4BQ8A 4MB5A 3QEGH 3C6SB 1C1EL 1ZHNB 2C3GA 4JO2H 4LAQH 1G9MH 4OZFH 5I73C 1U3HC 4ETQB 4M7JH 1UWXH 4LU5H 2R0KH 1ZT1B 4ZUTA 4YDKH 4LHUG 1RHFA 4CW1A 1SY6A 5HYJD 4PJHE 3DVIA 5I16B 3VFOB 4FQXA 3MRLB 4JKWA 4DN3H 1A6WL 1PG7W 1G0DA 3Q6FA 3UP1A 3U7WL 1BJ1J 1X5IA 2VXQH 4YX2H 1W0VA 2C26A 1T0PB 1IL1B 5I1CH 4O58L 1HHIB 2OK0H 1I7TA 2FHCA 3TYGL 4ZFZB 3NACL 3MRRA 1DP0A 1BP3B 1H3GA 1CDCA 5KSAC 1EO8L 3TFKC 3FRUA 3GHEL 1NLBL 5JIIA 4Q0XL 5JOPE 4W6YB 3DMMA 4MD4B 2OK0L 4NFCA 1KJ2A 4QOKD 3O3EB 5J1SC 1FFNB 5KS9A 2NXYD 4QXUL 3TO2B 2O61B 2VDPH 4RQQB 1BLNA 5DHVA 3TBWB 3ULUF 3AXLB 3Q6GL 3C8DA 3JZ7A 1U2HA 4UQ2B 2IFFH 2NQCA 3L1OL 1PG7X 2DJ4A 3ARXA 4P3DA 1GH7A 2QKIB 5CHNB 1QSFD 4XNUH 2FBJL 3NPZB 3TBTB 2ORBH 3RWFA 1LO5B 4FXKB 3P4LA 4ISVA 3NABL 1RZJL 3C60B 4K3DH 2XZZA 1MCNA 2Z91A 3N1GC 1DCLA 1X5XA 5F1KC 1S7RA 1RU9L 4LHJB 4OV6F 4LSUL 4Y5XA 3BH8B 1L9MA 3WDHA 3L5WB 1U8HA 2AV1B 1YYLL 4KK8D 4N1HB 4GRMB 1JTPA 3CD4A 4Y2DD 4F3FA 1KCSH 3M07A 4AH2A 5GGVL 1AJ7H 3RJDA 5TDNB 4OZGE 1D5MB 1KACB 5HY9A 1RUAH 3C5ZD 4NRZA 1PKQE 1KNOB 4Z7VF 2OP4L 5SX4H 2ICEB 4P9MH 1HSBA 3FB8B 4K8RL 1I8KB 3MUY1 2DQCL 4LBEA 5D7JA 1BD2B 1U6AH 3B9KD 1D6VL 3SKOB 4APQA 4N90D 2Q8BL 5DJCA 2BSRB 4JLRA 1N4XH 4YQXH 4K2UH 3IAQA 4HS8H 2ENYA 4UT9H 2DOCA 3TH2T 1NBZB 3ZTJH 5D70L 5EU5B 2Y5TB 3WUWG 3RHWF 4C56E 1T7YA 4XTRD 2APXA 5D71H 4HKZA 5CMAB 3BMVA 2ERJB 4OT1H 1V7MH 5JQ6L 5LQBH 1MF2H 3U0WL 3WE6B 4GG8A 1BBDH 2AXHA 5J57B 1O0VA 3F7VB 4I1NB 1FH5H 4RCAA 2APFA 1ZLSL 3LHPL 3V4UH 3NCBB 5IESH 1MFDH 2IALB 3MXVH 5D7LE 1QFHA 4M7ZB 1B6UA 3F6IA 3UROR 1S78C 3OPZH 3QUMH 4XAKD 5JXAL 2Z31A 4NQDE 2FIKB 1AR1C 4X4YB 3UYOD 1NMBL 2X4NB 1NGQL 1DN2A 1KEMH 1P6FA 1XF5B 4OKDA 1U8QB 2Y06L 1TVHA 4YDJA 5I71B 4H0GA 3EW3B 4RAUB 2K7QA 5FYLH 2QQKL 4KROC 2VXUH 3KYOB 1P7QD 1I3GL 3DSNA 3ARBD 4WI6A 4X7CC 1V7NH 4RBPK 2QADB 1UENA 3L95A 4J1UA 3JV6B 3MRBB 1AHWC 4XC1L 5DD5H 3WFCL 4NN7C 4IEFB 3U36B 1OAQL 1YEJL 2VDOH 4JFZH 3BD3A 4U1LB 3MRMA 2QQNH 4JQIL 3QUXC 2JB5L 3D18A 4LVOC 4NN6C 4AT6B 2F54A 2NW2A 3QP3A 5HHMD 2NR6D 2UZYB 3U1SL 2FDBP 4PGDB 3BHBB 4Y4HB 3D5OF 4YO0A 2HMIC 3O6MH 4HH9A 4JGMA 1Q9OB 1KPUB 4WI8A 4KI5E 1F4WH 3IJHB 4PJDA 1IT9H 4BK4A 3QI9B 4EQ2A 1IAII 3E6FA 4ZAKA 1FZOA 1CK0L 4HF5L 2G5BB 3OZ9L 5EU6E 3VFPA 5C0DB 2VNCA 3QEHB 3QCTH 3NA9L 3ARFC 2PXYA 1VACA 1PY9A 3BVNB 3O3DA 5K9KB 5B8CC 5HYSG 3PL6D 1OY3B 2FX8L 3GMRB 3KAAA 3KPSA 4G42A 1T21A 5J13C 1LQSR 1Z3GL 2CDEB 4LLQA 1XGTB 4NO0D 3R0NA 1D9KA 2FATL 1OB1A 3G08A 4QYOA 2YN5A 2Q86A 4JRYE 2RBLA 4X6BB 1MRDL 4MQ7A 4HWZB 3BKMH 3LKQA 5ITBH 2FZ3A 1N8ZA 1I7UA 1EZVY 1YY9C 4NHCH 1QFWM 5HBBA 4MJ5B 1CWVA 5CSGA 1ZLVK 4ZQKA 4YGVA 5C7XH 4N90E 3GUTB 3QNXB 3JUYA 4LVEA 4RISH 1AO7E 4XPAH 5IEKB 1DJSA 1UZ8B 1ZMYA 2B2XL 3WNLA 3KHOA 4KRMB 1NCTA 4E42B 3NMEA 2A73A 2D7TH 4NRYA 4MA7H 4O9HL 3VWKA 5ADOH 4MJIA 5FOBA 3ARRA 4FABH 5IVNA 3QUML 3RWJA 5D5MA 1NBVL 2ERJC 1TTFA 5HGBB 1KJ2L 4RGOH 5D7IF 1B0GA 3V6OC 4ZUUB 1MFDL 2G60L 5ELIA 2H2SD 5JW4R 2W0FA 2C4XA 1NBVH 3F58H 4ACPA 1IAIH 5T1LD 4E0RB 1JL8A 4PGJA 3C5ZC 3QIWD 3CLFH 3SE3C 4OT1L 3VRIB 4B0MM 1B90A 2LTQC 2HKFL 5D2NE 1P6AB 3GMOA 2G2RB 2CUHA 1LGVA 3FOLA 2YPLB 4K94L 4P4RB 3P9LB 1JZ5A 4BK5A 4DEPB 3ARDA 5EU3B 5HVWA 3SDCC 4FNLL 5IFAH 2H2SC 4G5ZH 4MHHG 3DUUB 2NY1B 5DRXB 4HJJH 2QBWA 4F9LC 3DURA 1HH9B 2LABA 2OQJA 2Q20A 5D6CB 3MZTA 5EO0A 1P69B 3QQ3B 1X5ZA 3WFHB 3TNNA 1QD0A 1ITCA 3GI8L 4KJPD 3X13B 3EGSB 1J0HA 4S11A 4EXKA 2DD8H 2V2XB 4LEOA 2H6PA 4LEXL 4RMQA 3CFEA 3OKNB 4R2GB 3T2OA 2JJWA 1Y18A 1KTKE 4QY8B 4Y19B 1CFBA 3P4NA 4JB9H 4UDTA 2CLVB 2NX5A 1A14L 1DQDL 4GG6E 4HKJB 1JHLL 4KQ4H 1IEBB 4U6YA 4PJEF 4M7LT 5EO9B 4GQ9L 2FX8H 4GRWE 5F7EH 2CR3A 4XNMB 1JWMA 2P44B 2UZIL 1INDL 1KLUB 3FOMA 4IRJB 5D93B 2KUTA 5KVDH 5EBWB 4F7MA 2C9AA 1WC7A 4JQXA 3V5HB 3AS2A 4R3SA 1PSKH 4G8IA 4RMTA 5E2TH 3BUYA 3NCMA 1MHEA 4BA8A 1AGFA 5FO8A 4AIXA 1JWMB 3STZA 4ELKA 5F1NB 5TH2B 1B2WL 3BKJL 5IV2B 1E4KC 5HYIA 1WTLA 5BRZB 2HA1A 4NN5B 5I8KL 1SBBA 3RNQA 2HWZH 1WBZA 4OLVL 3CCHB 4TPRL 3HE6D 5HGHA 3BE1L 2ITCB 1NEUA 4LGPB 3BVNA 3MV9B 1KLGB 5GS3A 3ARZA 3GSRB 1NMAH 3TF7C 1QOKA 4S1RH 5HDLA 4P5TA 3VFPB 4M02A 4PTUA 5B3JF 4W6WB 3MV9A 3MO1A 2QQLH 4LKXA 2AXGB 4HGMA 2W0LA 1TJGH 4FQHA 3ULUC 1B88A 2QQKH 3FQUA 1L0XA 2VSDA 4BSWA 4TSCL 1KC5L 5JXEC 2XWBA 2F74A 5C9JB 2R56H 3FN0H 6FABH 3SDAA 4DCQB 4Z0BL 5GRXG 4JN1H 4P4KD 1G7JA 5FO8B 2GSIB 4N1EA 4MCZB 4LIQE 3HG1D 5EFIA 4IOIA 3B2VL 4JRYB 2PO6D 2R9HC 3S37L 3X17A 3TJEL 4EEEA 1WT5A 4KAQL 3FQWA 1RK0A 5I8OH 3MRBA 4KQ3H 4NUGH 3MNZB 1LK2B 3QFJB 1F4HA 4G6MH 4Y16D 4PG9A 2B1HH 2GK0B 4LSQH 4LHQB 4KU1A 4Y4KC 5EO9A 5BVPH 3GI9H 5E5MB 5E70A 3TCXA 2WUCL 5D71L 2WBKA 3CXDH 4PRPB 4ZOCA 3VFUB 1CGUA 4NM8L 5F6HJ 4F2MB 4P99A 1SVCP 3RL2A 1QFWL 2I5YL 3PL6A 1BJ8A 2OLDA 1QUNA 5E9DB 4PBXA 3S88L 3GIVB 3UXFA 5CD3A 1TZHB 2VLJB 1NAKL 2NY3D 1A1OB 4KC3B 5E6IC 1I8IB 2BNRE 3QQ3A 3G6AB 1CU4L 1EXUB 2BSTA 5FYJL 5DJAB 3IVKA 3V5KB 2EDRA 3IXTA 3V95A 3EOTH 3V2AR 5ADPH 5GSRA 1DQQB 4X6CF 3U4EA 3U2SB 4O51B 3B2UD 5J1AA 4ZXBC 4PRIE 4Y4FA 1BFOB 3FOLB 4R8WL 4XPBL 2HT2D 4XNYH 5CMAA 3OKOA 4D8PB 4FN0A 5INDB 1T0MB 4OFKA 5DQ9B 3RIFK 1YYLH 2HAZA 5FYKU 2Y7QA 3M1BA 1WZMA 3RX5A 4HUUA 5DD0H 3C9NA 2H32A 1BBJB 4IRJD 5C8JA 4GMTH 4WENB 4AENA 1H3VA 1J5OH 3Q2CA 2KZ1B 5C0BA 5HI3C 3SE3A 4Q6IC 1JYXA 1GAFL 1QYGH 1IGIH 1FFOB 2W38A 3CSGA 4X99A 2VABB 3Q5OA 3QHTC 2VR9A 4XB7A 1NGWB 3IGAA 5D2NC 4W81A 5BZWB 2FB4H 3VGBA 5E0QA 5TDNA 3P2TA 1H3WM 4LNVA 5L9DL 3IFNL 1HH6A 4TNWF 2Y36L 3DX8B 4QRQB 1R6VA 4JFPA 3U6RB 4O4YL 3NCJL 1MCWM 3QAZB 4KKCD 1CQYA 1NLDL 3FKUS 4LLWB 2FZ3B 1ES0B 4HPOH 5TQ2H 5JR1H 1BAFL 3MA9H 1G7IB 1G7MA 4O5LH 1QEWA 3OXSB 4BFIA 1B4JH 1OAXH 4K23L 1OM3H 2J8OA 3CFDA 1UC6A 5JXED 4NT6A 4TQEH 3IFPB 5HJ3B 3ZKXB 5SWQB 4AEIH 4RWYL 3L3IA 3GFUA 1ZT7B 4OJFL 5HHMB 1ONQA 2OS7A 3HPJB 4L3CB 5L8JB 5GIRB 3AAZA 2Y23A 5HHOA 1YNLH 3LRSA 3G5ZA 5DMKA 2WUCH 2DM2A 1VACB 1WWWX 4LSQL 4P2OA 4Q58C 5CJOH 4EN3D 3KR3L 2X1PA 1JZ6A 4GKZA 4PJFA 4GRLB 3LVEA 1CGTA 2ZUWA 3FFCA 3UBXI 1MLCA 3PDOB 5TE4L 5BOPA 4JFDD 1DQLL 1JJUA 3GBNH 2PUQT 1UVQA 5EC2A 4L8CA 2AABH 5J06A 3FO2B 1AGFB 1F5WA 4G9DB 1DLFH 5FB8B 2ZNXA 4PGDA 4YO0B 3ZKMC 3TV3L 1JUFB 4JPIB 1JF5A 4ETQA 4WU5A 2CUMA 1LP9F 5F7MC 3BP7B 2GK2A 4GAJL 5D8JH 5A2KH 1NMCC 5BXFA 1L4IA 4RZCB 3WIIL 1ETZB 4B50A 3QFJE 1CD1B 1E4JA 5IWLC 5I1GH 2X10A 3DROA 1FRGL 1AIFA 4NO0B 2AK4D 1BD2A 3BP5B 4I18C 4FQXC 2FIRT 2AGJH 1LD9B 3IKCB 5HGDA 4K07A 1OD7A 4LSTH 5FUOH 3NZ8A 2DQGL 1FL6B 4NKIL 1GYAA 4XVJH 5D7IB 5EU7E 3BP4B 1HZHL 2I26N 3SKJH 4Y7MA 1I1YB 3G6JA 2EKSA 1I3VA 1Z3GH 1IKNA 3VDBA 4XNXH 2AXFB 3RZCA 1P4BH 3ARGA 3WKMH 4GBXD 3GBML 2XFXB 1X4XA 2EDWA 4U4BA 4H26B 5EOCL 3F7VA 5SWZD 1JMZA 5GXBB 4WU7B 4FS0A 4RBPH 5IUSA 2Q8AH 4PRIB 4EI5D 3EYFB 2A38A 5I71C 3RUGA 3N9GH 2FL5B 2W92A 5EOCH 4WWKC 2DKSA 2R4SL 4GQ9H 2VZ3A 5FGCE 1OSZA 1MRFL 4U6HA 3QAZC 2VH5L 5C0CE 3BPLB 1GSMA 1RFDH 4H5SB 4J4PA 3O3EA 4KK6D 5E9DE 5D5MB 4NCDA 4ELMB 2FHBA 5E6IB 5M7QA 5DQDL 1RQ5A 1HHGA 1MCOH 5DVMA 4XX1E 3PQYB 3FQRB 1RHHA 5FHBH 1XAUA 2PW2A 4HFWA 3W9EA 2AI0H 1QPXA 2DQHH 4HUWB 4MD0B 5BCAA 1CIDA 4NWTL 4WV1A 4NQCE 4JFZL 3IFOA 1J1XH 3HNVH 2WW8A 3MXWH 4N8PA 4LQFH 3O2VH 1NJ9A 4HIEA 3D87B 3CFBB 4PRDA 5D7KD 4KV5F 4JEGB 4HMEA 3HCVA 1N6VA 4WW2F 3MROA 3GJFK 5IG7B 3I3DA 3RY5A 1WFOA 3TVMA 1YN6A 5HI5D 3BIBX 4NQVA 3UTSE 3WS3B 2ZKHL 1HHJB 1ZHLA 3B9VA 5D2NA 1CGYA 4HPYL 2B39A 5LWYH 3HG1E 3TV3H 1JV5A 2VLMD 4YHKH 2NY5L 5A16B 2D7OA 1IAIL 4KJYA 3HUJE 4JFFB 4RGNC 4DTGL 1LP9A 4G42B 4PP1C 4AY0A 1G9NH 1KPVA 2NY0B 2G60H 4XZUA 1MWAA 5CSZA 3H9YA 4BQCA 5J3HD 3FQNA 2UY7A 4XMLH 3T0AA 5AD0B 4MD0A 4NNXB 1R5WA 3H3KA 3TJHD 2XWTA 3IETA 4NUJB 4XPAL 4XP6H 2AEIT 3E8UL 3UPAA 4CDGC 1A1MA 2DJSA 1NUGA 1WISA 5FCUL 5IB3A 3N50A 1MWAB 1C08A 3DYPA 2VLKB 4XBGB 3NPSC 4KVNL 1FO0A 2J6EA 1IC7H 4U6HB 1UM5L 3QULA 1Q9WB 3KHQA 3TYFA 4HK3N 1JPST 1YEDB 2R0WL 5BW7A 2HVKB 1VGEL 4DFIA 3UTSA 1GGBL 4PJBA 5C1MB 4UMGA 1MCOL 1Q8MA 1QSFB 4C55A 2A6IA 2FATH 1XIWA 4G8FA 3T8XB 3MGAA 2J8HA 1PKOA 3S5LG 1SYSB 3QI9D 3WFDL 3MNWA 4LSUH 4JQVA 5MERA 3K0WA 1FNEB 2DKUA 1YNKL 2VC2H 2XTJC 2GCYB 2IGFL 5L2JB 4IOFD 2AJ3B 5F7LB 3K8MA 3N9GL 3ROLB 3VI3E 5GGSY 2NXYB 2O5XH 4CADB 2XZQH 4GW4B 1KSRA 1KG0B 2IFFL 4JDVA 4G9FE 3IKKA 1N0LA 2ATKB 3MRNA 3MRKA 1BVLB 4P5MA 3GSQA 3MNWB 1D6EB 5CGMA 2PTTA 3QUYB 3V0VB 1J5OL 1IEHA 4LMQE 2R1WB 5F8QC 3INUH 3L3OB 2MKLC 4R0LC 3VFWA 5DQJA 4ZTOL 5D7LA 1QFOA 3UTPD 1F13A 2I9LB 2DBLH 4RIRB 3S36L 1RSFA 1R3KA 15C8H 1SEBA 2QR0A 4PJ9D 1OTUC 5IMLA 1J12A 4FQ2L 1NCNA 1TJHH 4NDMB 1IBGH 3NBNA 4Y8DC 4JREC 4XTRC 2VDKH 5F70A 3QDGD 5GGUA 3O8XB 1GGIL 5I18L 1GOHA 3DV4B 4OQ1A 4F7PA 4WHDA 2MHAA 2EDQA 3Q5TA 1RY7B 2FNBA 3IETB 4NUJA 3G6JB 1R3HA 1P7HL 5H2BB 1HSBB 3S88H 4N8VB 1NMBH 1FFPB 2ZZUT 2WIMA 1I9IH 1I1AB 4JZJC 5ECJE 4OD2A 3S5LA 3DVGB 1DFBL 1JPGB 3O11A 1CICB 3FO0H 4NBZB 3F7RA 4LAQL 4YBQD 5HVGB 2E9BA 2BSSB 1KPVB 4XZUB 3GSVA 4C4KO 4L4VB 4IIQC 4OLZH 2DQTL 4DQOL 4LK4A 5C0IB 5J9PA 3QZWG 3BZEB 4Y2DC 2B1HL 1U93A 5K9JH 3B5TA 5DVOA 4U1JB 3T04D 1ZLSH 1JNHB 1NCDL 2Q1EA 2WBJB 4BFIB 1UM6L 2XRAL 2YMXH 5EN2B 4RMVA 4PJBB 3P11L 2OM5A 4ODHL 4HEME 4P46B 3ZE0F 5KVMC 2CKBA 5T5FH 3K46A 4D9RE 5I8CB 4ZO9A 5HHVH 4BZ1H 2MJWA 5F6IC 4OUUB 6FABL 4I0PA 1EFXA 4XPHL 4Z0XB 4OFYA 5CLTA 4J2XA 4OLXL 2FH8A 4QF1B 3O4OB 2Q7NA 2DQCH 3ZHDA 3MYZA 5DVKA 5I1JL 3PHOA 4LCCC 3W9DA 1TMCB 1SEQL 4QF1A 1PLGL 2H1PL 3GMLB 1JNLH 3WDIA 4U1MA 3GO1H 3AU1B 5FM4A 1I1RA 1UWEH 4PLJC 1FGVL 2HWZL 4J8RA 2E7HA 1B6DA 5JO5A 5I16A 2EDNA 5HYFA 3B9EA 1RZJH 4NT6B 1L6XA 3CIQA 2ORBL 4Y19D 1MCPH 4NKMB 2AJZA 3UJTL 3QDAA 1TCRA 4UILL 4ODSH 1JZ7A 1G7IA 4ONFH 3P4OB 3LS4L 1N6QH 1FCCA 1RD6A 4S1DD 2FBJH 3FO1B 3GKWL 5CJ8A 2EXYC 2VDNH 2GHWB 3Q6GH 4GQPH 4LLAA 1XGYH 4JM2C 4JFPB 4JCLA 3U6RA 4GW5A 1R24A 3DX8A 4F37F 1JN6A 1FGNH 1X6LA 3BT2H 3RVWD 3HAEH 4JJ5B 3QJHA 1YNTB 4GLRH 2VDKL 3DHJA 1QHPA 2FRGP 3NZ8B 4OZFG 4WUUE 4KQ4L 1NGWA 1YEEL 2ZCLL 4KY1H 3VRJA 3X12B 3IDGA 1EO8H 3IRPX 3ULUH 4ONGH 2VMFA 3SGJC 4MD5B 1PG7L 1JWUB 3RDTA 3FQRA 3HZVB 3VFSA 2VAJA 2DM4A 4AMKH 2A9ML 1WJ3A 1X4ZA 3INUL 1J87A 3VXUD 3Q1SL 1YPZB 1CLZL 3V6ZB 2R0KL 2VAAA 1A2YB 3NAAL 3HNSH 2F58L 1QSFA 4PG2C 4K7PL 4HEPG 4JFEA 3BD5A 1MCFA 4KDVA 5ISZA 1SEBB 1QLEL 2QR0B 3V5DB 2OYPA 2IAND 3DMMC 2KQNA 4MVBD 1CBVL 3EYFA 4KUCD 2XZCH 2Y07H 2GW5A 4PJ8C 3EHBC 1T1YA 5EC2B 4MDJA 5BJTA 1EEYB 2C1PA 1S9XA 1TVDA 2ESVA 3ZO0A 2ZUTA 1S8DB 1WGOA 5GRJH 1FIEA 5HYQA 3SDDB 3GO1L 2VOTA 5K59F 2WIIA 1XH3A 4WFHE 1QA9B 1U95B 1UCTA 5KBNC 4J4PD 4JO1L 4X7SL 4Z6AT 2NZ9C 4M62H 3A6OA 2D4DA 3SQOH 4OLXH 4UTAH 1IZJA 5BS0A 2ZOLA 2R56L 5E1AB 2P5WD 1TNNA 5DD3H 2MCG1 4JREB 3RNQB 3ZTNL 4PGZA 5BMFL 4MWFB 4RFOH 1A6AB 3ARGC 1NCWL 3KS0H 1FNLA 2AEWA 3TH4T 1ORSA 3BJLA 4QRPD 1NFDF 4C56A 3K3QA 3QG6B 1N2RB 4WU5B 4UI2A 3TA3C 1E28B 2UYLB 1FO0B 5FDWA 4CU7A 4G8IB 1A64A 1N3NA 1PX4A 5D1ZC 4LPXA 4XXDB 5CEXA 4PRHB 1K4DB 2Q6WA 5C0CB 1KIPA 1DVFB 4HKBB 1MIEL 2ICES 1NFDE 4MS8C 4M9OA 1WZKA 4PJ7B 1R5WB 3MCLL 1A6VH 1LEGA 4UNUA 2ZUVA 1IC5L 2B4CH 4NQTA 4I13B 2EDLA 2VL4A 3B5GA 3IDXL 1FN4A 3L3JB 5D93C 1GVIA 1C12A 3MV8A 3U0TA 1X5LA 1P7QA 2X4PA 3UTQA 2LTQB 2VIRA 1S9WB 5FDYA 1EO7A 5J89A 2H26A 4PB9L 2IEPA 1JGDA 1NEZG 5CZXC 1ZT7A 5CJXA 4D0DA 3DRQA 4D0CA 4D8PA 5IB4A 3VH8A 1TJHL 4Y4FB 2YRPA 1MJUL 1AXTH 2YPLE 1ND0B 4FQIL 4TUKH 4JR9L 2HTKC 1DBAL 2JB5H 1T1XA 3I02B 4K9EC 5AZ2H 2X42A 3CFBA 1JTTA 4PRDB 3D69A 4NFDA 1NSNH 1AXTL 3RTQA 5CBEB 5FXCH 3U7AA 1CQKA 3WXWH 5J6GA 4WW2B 5E9DA 2AJVH 5JNYA 3NN8A 3S34L 1D5BB 2C1OA 5SWSD 1IAMA 2R29L 4Z7WF 1ZWIA 4FQ1H 5LG1A 4E9LA 5C0RH 1YN7A 3HAEB 2NY2B 2ZJSL 5JA9A 5DYOB 2APWA 3SCMC 4L3EB 5E5MA 1PAMA 1EHAA 1KB5L 4WJ5A 3DO7A 2ADGA 3WNNA 4R26H 4NP4L 3BP5A 4QHKI 3HS0A 3OPZL 5GGRB 1XF2B 35C8L 1F6AB 4EDWL 1OF2B 4GLRI 3TT3H 1HOCA 5JNYB 4I3RL 4LCCA 5LBSH 2FL5A 4DUVA 2DL9A 3DECA 1KTLB 3QNXA 4IOIB 4X6CA 5T3ZE 1VGEH 2F53D 1MCLA 5JIHA 1RIUL 2SEBA 2QL1A 4NPYB 1IEAA 4FABL 3QRGL 3D69B 3HB3C 3MRJA 1MIMH 3MUJA 3I02A 1P1ZA 3VE0B 1WWAX 4ODUA 2VZOA 5BZDB 4P2QB 2EDKA 3TBVB 3U2SA 1MHPH 1LDPH 2DLFL 1DUZA 2J8UB 4KROB 1KB9K 2Q86B 1ACYH 3RWDA 3FT3A 3OHXB 4MNHA 3UYRH 4H1LG 3E8UH 1LDPL 4ENED 1K5NA 4U1HA 2MPAL 5KZCB 3IB4A 4ZPVA 1GGCL 5HDBE 4OF8A 1WIOA 4WWKA 3RGVA 5ITBL 4J3XA 4X7SH 1A3RL 3QT2A 3N1MC 3BKML 2GAZB 3SQOL 1U8KA 1DVFC 1BGXH 4XAWH 4NQDB 2WAHA 5BQ7B 3ESUF 1HSAB 5F7YC 2A1WH 3L3IB 2V7HA 5GS2D 4YR6A 1MREL 3S9DB 4TN9A 3OKEB 4YDIL 5FF6A 2EYSB 2A0LC 3WYRA 1LK2A 5FGCB 4Y5VB 4Q2ZA 1G6RA 1EGJH 2NY6D 4DKEL 3RDTC 4M7ZC 4ETYA 5FECA 5F9AC 2G9HA 4P9HC 4MJ5A 2V5SA 4N0UA 3T1FB 5I74B 4L5FL 3UTTD 4LSPH 1NCBH 4OLWH 3ZYOA 4PJBE 4UTBL 4HMDA 3O6FB 3C6LC 4GO6B 4JPVH 4JVWA 4C56B 4I0PD 3RNKA 3ARDD 3JBG7 1DEDA 1J1XL 4JVUA 5DHYA 3NFSL 5C86A 4RWYH 2ADIA 3PGCA 4ODWB 3FN9A 2CDEA 4LLQB 4ZOBA 5IEHA 2WBWB 5DD6B 2CLVA 1CD8A 2FWOA 1Q72L 4O5LL 2A9MH 2WANA 4QY8A 4Y19A 2V7NB 2GAZA 2MCPL 1KB9J 4JRWA 5EIIB 5DRNB 2R2HB 5IFJB 3CU7A 1IAIM 1RZ7H 2B1AH 3H9SA 5DQDH 3DOSA 2H8PB 3NCJH 3SE4C 3K4DA 3TA3B 2UY6A 1AGEA 3T0EE 3DO3A 4ZAKB 4F8QA 2W65A 2ZCHH 3QI9A 3W5MA 1MRFH 3SDDA 1H8SA 3IJHA 1I3GH 4PJDB 4IIQA 4JG0L 1ZA3A 3WHE0 3BT2L 5BZDA 1XCQB 1UWXK 1TFHA 1HE7A 1GOGA 2AJSL 1AI1H 5DK2B 3O3UN 3C87A 3G5YA 4PJ9A 5I1EH 5DK0A 2HFEB 2VLLA 5EORL 4P59L 4ZFOB 4ZD3L 2YN3A 3V5DA 3LS5H 1JGLH 4N0UB 3T1FA 3LMJL 4WI7A 5I66B 4OCWL 3KYMB 5I1HH 1C5CL 1X3DA 4I8DA 3ARFD 5M94B 1R3LA 1J1OH 5FO7B 2X4RA 7FABL 5HGBA 1FYTA 4IRSC 3EJYC 4F33A 1HSAA 1NBYB 1FGVH 4WWID 1DQTA 3OJVC 1YN7B 1FSKB 3OQ3B 3HFML 4YHOL 1WICA 4KK5C 4Z77A 1DE4B 3MOBH 4NRZB 1IM3B 1RZKH 3RVWC 2UV3A 3RUGE 3ZE1F 3C09B 3O8XC 4J7RA 3DWTA 4PJGF 1D3CA 3CLEL 3KLDA 3DLQR 3U82B 5A40E 2H3NA 1IJ9A 1NBQA 5DJ0B 4JDZB 4PGEA 1MJ7L 3S4SA 3RAJH 4HFUH 1I9JL 3BH8A 3VFNB 2I5YH 2OR7A 2R8SL 2KL6A 5EULV 2VUYA 2QSTA 3RUGF 4N5UA 4CN6A 1MWAH 4LVHB 5ALBL 3CFJA 3D85B 1I8MA 1JRHH 2XRAH 2Q76A 5DVLA 2BRRL 3GIVA 5CD3B 1ZOXA 5IMMA 1KCUL 3TA3A 4WEMB 3O3DB 2Z9TA 2B20A 1PZ5A 2OZ4H 4L9LA 4MQXC 5IB5B 4LBEB 4LRIA 4PJIA 2DQTH 4EXPX 4M1DH 1YEHL 2RFXA 1CLYH 4TOYL 1F6FB 1RK1B 3LEXA 2R1XB 4KV5E 4TYUA 1LEGB 5BV7L 1U3JA 3BP6A 3L7EA 4R96B 3AB0B 2HRLA 3PIQB 5I1EL 4Y0GA 5TJWK 1YMHB 1AH1A 3UTZB 4W68A 5IEHB 4TQEL 3TLRA 4HH9B 4JAMB 3VXTA 4WW2A 5KTEH 1DANU 4P5TC 1SYVB 4QRUA 4I0PB 2HJLA 3W39B 3WS6A 1IGML 4CW1B 2YWZA 4N0YL 1KCRH 4QHLB 5E2VH 1G7LA 4EN3B 4B41A 4PJ5E 3EO1B 3DX6A 5ICZA 2DBLL 1LNUB 3G04A 1KULA 1X9QA 1QKZL 2BNUA 5BV7B 2XN9A 1YPZF 2CLZB 1U2CA 4R7DA 4WO4A 4P3DB 3I50H 1LO3H 2M26A 2WBJA 4PLOB 5DUPL 1BVKB 2BNRA 4ZUSB 4UQ2A 2AXGA 4JY4B 1HHKA 1BZ7A 1FAKT 3MOAH 2E27L 3UAJC 4PJAA 4IS6B 4M61B 3H8NA 4LCIL 4YDJB 1XF5A 3X3FL 4KHXH 4D9LH 4QXWA 4WWKB 4HKXB 1CG9B 1JPGA 3O11B 4UTBH 2DTML 5J7CC 3BPLC 3P0VH 4OCXL 4BFGA 5JPMA 4ZUWA 1OARH 2VXSL 4JDTH 4KTDH 2R39A 3FT3B 1YEKH 4J3UA 2IAMD 4FZ8H 1K4DA 2Q6WB 2BRRH 3QISA 4F7PB 1JHLH 3HI5H 3O8XA 4ZSOE 4P4RA 2BZDA 3KYKH 4XMKL 2OL3L 5I76B 5IQ7L 4Y1AB 2QQQA 3VWJA 1JWSA 2KKQA 5T1KA 4GS7B 2F8OA 2E8ZA 3AMLA 3CAFA 3KXFD 4K7FA 2R0WH 2DD8L 4HUMB 3HZYA 5BVJB 3GI8H 1AD9A 4P3CH 4OQTL 1UXWA 2JKXA 4RA3A 2DB8A 2W0FB 1S7SA 4O2EB 4PRAB 4HH8A 2P5ED 4AK1A 2JIXA 4I5BB 3L95B 4KGLA 2J7LA 1YMMD 2EZ0D 1B0GB 1S3KL 3AREC 1JWUA 4S0TD 3H9ZA 5F1IB 3O3AA 5ETUA 1CXKA 5BS0B 4K94H 5I15L 4KWUA 1IGFH 3IFLL 3OAZH 2APTA 4PJIF 2IBGA 3RL1A 5FM5M 3SE9H 1T7XA 2DLTA 4RFEA 4JPWL 4OFDA 4BKLA 1A6UH 1J0YA 4KQ3L 5JXEA 3DUUA 5CBEA 1R5VA 3O3BA 4FMFA 1IAOB 3SDDC 2QHRH 4APQD 5I2IA 2H9GA 5JDSB 2VQ1B 3O45A 2PF6A 3FB5A 2KDGA 4PRNA 4LCYA 4ZNEE 4QTHB 5C07D 2NY5H 5B8CB 4JN1L 5EBGA 1F8TH 3MLZL 3QUYC 4OZIA 2HTKD 5ESAB 5CAYB 4KK5D 1FNAA 2BOCA 3QWRA 1E0OB 3BEWA 2EE3A 4PRPD 3MLXH 1QNZH 1SJHB 4DUWA 3A6BH 4RISL 1RUKH 2X2YA 4JFDA 3RWGA 1GGIH 1LK3H 2P46B 1T21B 3D48R 2BNRD 3EJYD 4JM4L 1S9YA 2X4PB 1DBBH 3QUXB 4S1RL 4Z7OE 3HTLX 4NHCL 1QG3A 1T1ZA 3OWEA 2R2EB 4PTTB 1WITA 1G9EA 2P1YA 3UCRA 4MNQE 4B7LA 2LAAA 3MRRB 3NPSB 2IF7A 2AKRA 3RY4A 3WJJA 1TETH 4O2CA 1GXEA 5CJQL 3VRJB 2EYRA 3SKNA 2KQMA 3SGKC 3D3VB 3L3GB 2E7CA 4HG4J 4PRHD 1U92A 1CDGA 3L5JA 4UDUA 5DJYB 1OAZH 5LGHL 2YD5A 3L3HB 1UJ3B 1CDUA 1R24B 2AJXH 4WIQA 3FCTB 3T3MF 1FYTD 3D18B 3L5XH 1Q94B 4HGWA 1INEH 1WIPA 4IOSD 4RMRA 1MVUB 1F42A 3B3IB 1HHJA 1LO2H 5GJTL 1FO0H 2J6EH 4TVSa 1JNHA 5IK3A 2N56A 2VDLL 3MV9D 5F44A 3Q3GA 3S37X 1A0QL 3AM8C 5TDOA 3W0WB 3BRFA 2EDYA 1BJ1H 4JFOA 4Q9QL 3MOQA 3V4PL 5BO1L 1A7NH 3PF2A 1J0IA 3ZDXE 2GSGA 3R4DA 2WWMC 1OSPH 4YHYB 3H9HB 5F1SA 4EI5B 2OBGA 3WD5H 5C0FA 2NCMA 1XCTA 5C0AD 3W9DB 1IC7L 1FVDA 2IPTH 3DSFH 4HX1A 1A4KB 1OQOA 2AGJL 3F7YA 2HT3D 5E56A 1M05B 5LGJB 2MPAH 5SV4A 2IALA 1IL1A 3OB8A 5CZKA 2VLRE 2XICA 1YDPA 2JK5B 5DSCB 3CZFA 3TIEA 1UH3A 5C70A 1TITA 2A0LD 5ISZE 4GAJH 1RZIA 5D8JL 5KW9L 1T4KB 3IRZA 4PY7A 4ZFFA 1NGQH 3U7YH 4HIHB 4N0CC 4R2GD 1WFNA 2J12B 3WIFA 2OJZH 3FQTB 4UUJA 1VSCA 4J1UB 2A83B 2LU4A 1UZ6E 3V6BR 1T03L 3CZFB 3TIEB 3QSKB 4NOFA 1G84A 5KSUB 5I2IB 1DQLH 2WBJC 2HVJB 1IAOA 5HHPA 3KDMB 1CI5A 3DV6A 4AQOA 2ATPA 2X09A 1OWRM 5EU7C 5JQ6H 5HHOE 3SDXB 3VXOB 3H9HA 2MNUA 1T5WB 3FQXB 3BKCH 4FQPA 2B2XH 1NCAH 1YNTA 3K2MC 2H2PC 4AH2B 5F89B 2UVEA 5F1IA 2P49B 2VJXA 2X70B 3F62A 3PQYD 5ENWA 1YNLL 4HS8L 4NSKB 4RMUA 5ANME 4P23B 1OLLA 5DZOA 3QFJD 5I1LA 4K7PH 3QUYD 4PJCB 2F58H 3HNVL 2ESVD 5CKAA 4MMXC 3RKPA 3AREB 3T2NH 3F5WB 4QRRE 3MPCA 1X7QA 2R23B 3MA9L 4JR9H 5EH1A 5FGRA 1VPOL 1MUJA 1U9KA 3MRDA 4JLRB 5C0CD 1ZVYA 1C08B 5HDBF 1QBML 3WUWA 4Z8FL 4X6DE 3QEQD 2PTUA 4WRLA 4L8SC 2B8OT 3ME0A 5F7UA 1JNJA 1M05A 1VGKB 4KTEH 4L4VE 2J5LB 1FFNA 1FVDB 3NCFB 1BD2E 1MLCB 2E6PA 8FABB 5CLWA 1FYTE 5CD5D 5JPMB 1XCTB 4GKZB 4O2CB 4JDVB 5SWZE 2J3SA 3D39A 4PJ8A 5HY9B 3FQXA 3ZTJG 1OT2A 3H9SE 4OZHB 1KYOJ 5C0EB 2X44D 5CIPH 1JP5A 2ZPKH 2PYEB 3B6SA 4MAUH 3QUXA 2IJ0C 3HR6A 1N26A 4AL8H 5TE6L 5J11C 2W9LA 3R1GH 2DWDB 3CH8A 4XHJC 1MIEH 3VFOA 4MX7B 5ERWA 3SKJL 3LKRB 3ARYA 2YD6A 3TNMB 2E9WA 1MVUA 5MENB 5DC9B 5HHXH 5F97E 1OAKL 4HGWB 1WV7T 3V8OA 3L6FB 5MP6L 4Q0XH 4U1GB 4QTHA 1W8NA 5JORB 4U1SA 1OAQH 3CDGA 3CPLB 1LEIA 1JTOA 4N8CH 1UYWL 2BNQD 5I1JH 5FYJH 3IJSA 4UQ3B 3U30B 4RFNB 5KAQG 3O3BB 4RQQA 4YEFA 3PWJA 1YDPB 2JK5A 5KS9B 1CD0A 4JKMA 4F57H 5I9QB 1P7KB 3ZDYF 3P0YL 5C0EA 1ULVA 2AKRB 3EYVB 2XY1A 5DHXB 1VEOA 5CSBA 1FNGB 4PJIE 2R0ZL 4HX1B 3MRQB 5IHLB 4W4OA 1G1CA 4XI5D 3S7GA 4F58L 4ZFZA 4F7EA 3UAJD 4Y1AE 2R1XA 3I6GA 4XI5C 3GNML 1R3HB 4KRLB 4NKOB 1XIWD 1HXYA 5DEFB 4DZ8B 5IBUB 1WZ1L 1UKTA 1KB5B 4XH2A 5A2JH 1NC2B 3MXVL 4F7TA 5E24E 1DLHA 2ICWJ 3ISWA 4NJAL 2XN9E 2VZUA 3D0LB 3WCYA 1KCKA 5CSZB 1YEGL 3ZE1E 3GSNL 3E1F1 4KAQH 4XPTH 4ZPTA 4FP8L 3VA2C 4U1NA 5EB9A 1OD9A 4MB4A 4X9FA 5F88A 5IF0B 4ONOA 1YEIH 1WZ1H 5CGYD 2O26U 3MBEC 43C9A 1E4XH 4PRNB 2OSLA 3GNMH 4XCCH 1L7TL 1JI1A 5BS0E 4P0DA 2H9GB 3OGOE 4W4OC 4BSVB 3LN5A 3OKMA 3NZHH 4QTIL 1I9IL 2ARJA 3SGEH 2VN4A 1UXSB 3FL7A 5BRZE 4GUPB 2Q8BH 1I1CA 4XVSH 1NUFA 4OTXH 2EKSB 4M6AA 1S5HA 4WGWB 1BVLA 4P5MB 2GTWA 1RMFL 1KG0A 2Z31D 3IFOB 1TJIL 4MXQD 3K74B 3RIAF 5D1QD 3O9WC 4AM0A 3W81A 5F6HI 1DTUA 1M71A 1NFIB 1J10A 3O3AB 1RUAL 1RAMA 4BZ2H 2PTVA 5DRWA 2BXZA 5D1XD 1E27A 1J88A 4KKLD 4KPHL 4X5WA 2CIIB 1T1ZB 5FM5O 3FTGB 5F3HA 4OFIA 2V17H 4X4XA 1DEEA 2N7AA 3UTPE 3MJGX 3REVB 5L0QC 4DVBA 3VD3A 5HD8C 1KPRA 4J6RH 4WTWA 4ZODA 3TO4A 3HUJB 4JFFE 4K7FB 1RK0B 5TQ0L 1LNUA 1OSZB 2DM7A 3EFDH 3MLVH 2XQBH 1T7VA 4ZFFB 5ESAA 1I4FA 3H9SD 2VISA 4P59H 4D9LL 5DK0B 5EU6D 5B8CA 4NNYB 4L8BB 3HE6B 1OP5K 4NBYB 1GZQB 4EOWH 2BJMH 5TQ0H 5KN5A 1GHFL 4QT5A 5C09A 1WWBX 1KELL 5ACZB 5LGJA 4OUOA 4P23C 4RRPG 3L7EB 1BM3H 1MJ8H 5D7IA 2FJHB 4EI5A 1JYNA 2P7TB 3H9SB 4OKVB 4MJ6B 1QBAA 1SJEA 3ZMRA 1ONQB 2OJEA 4LLVA 4APQC 2EXYD 5D5ME 4ESKA 5TGBA 5HJ3A 4GBXA 5I8EA 1CU4H 1IM9A 3I9GH 1NAKH 5F1NA 4QRSB 1AO7D 5CWSA 4YXLL 3C2AL 4LLYB 4JG1L 3SE8H 3BKCL 4TOYH 4U0QB 3ARED 3I6KB 1QR1A 5EBLA 5TF0A 3MQIA 3K1DA 5E8EB 3FT2B 4JRXD 3QYCA 4X83A 2NXZD 2NTFB 1AO7B 3OKKB 3SCMD 3LKOA 1Q0XL 3QDGB 1DQML 3NCYS 2Z31C 5K9JL 4FP8H 4HUXA 4QO1A 1UADC 3IGAB 2FBOJ 5MEOB 4XMPL 3JWOC 2GY5A 4GFTB 2A1WL 5DMGD 1MQ8A 1AKJA 3CSYB 3PP3H 3HMXA 3ULVC 4UOW0 3D0VB 4PJEA 4JHWH 5IM7A 2NLJB 3OKNA 4KJPC 4O02L 1KC5H 3WSQL 2EDXA 4D9RD 4TSCH 1PEZA 4MSWB 5I1KL 5E94A 2GY7B 2CRMA 4P2RB 4MXWH 3LPGA 1EEZA 3O0RH 5DGQA 5D6CA 5C0GA 2YEZB 5D1QA 4OZIB 4FTVB 2YD8A 4NBXB 2JJVA 3B8YA 1BOYA 1E6OH 12E8H 1MHPL 4JCMA 4Y4KA 2P8LB 3LZFL 1U8LB 4TPRH 1AY1H 5EOTA 5JW4M 5E4EB 5F7NC 4I18A 4M8QA 1IEAB 2JJSC 4F15B 4PUBH 2GJZA 3HRZA 1BPVA 5KSAA 1GGTA