1K3ZA

X-ray crystal structure of the ikbb/nf-kb p65 homodimer complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
130
structure length
130
Chain Sequence
TAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Transcription factor p65
publication title X-ray crystal structure of an IkappaBbeta x NF-kappaB p65 homodimer complex.
pubmed doi rcsb
source organism Mus musculus
total genus 29
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16179 RHD_dimer Rel homology dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1k3zA00
2A9ML 3TN0B 3D25B 1YEIH 1O5DT 3KXFE 1UWEH 1NEZB 3WMSA 3IDGB 1KB5A 1MCQA 4WUUB 3FFCD 5K93A 1EHAA 2VLME 1CF8L 3MLTA 4Q74A 3AM8C 4YEFA 4I77H 1INEH 2LV4A 3TPKA 1EBPA 1AKJA 4XNXH 3HI1B 1FIGH 2H1PH 4PJCB 1IILE 3L95B 4HHAA 1DCLA 1BD2A 1IGFH 1MCFA 4K3EH 5D8JL 3GB7A 4EN3C 1XIWB 3V52L 1H9VA 4FTVA 2PUQT 3WJLA 4QRSA 4WWKD 1I1AA 4A2LA 1A6ZA 3NZ8B 3TO4D 1M05A 1HXYA 5IBLD 4NBXB 3V4VH 5IB2B 4NN5C 5EA0L 3FO9B 4MGXA 3EYSL 3EYVA 4X6EB 1FIEA 5C0DA 5BVPL 3QNYB 4H8WC 1VPOL 3OX8A 3Q6GL 1HNFA 4FQLH 1ZA6B 4XCFH 3AAZA 4FQXA 2X7LA 5ETUB 4Z7NF 2NYYD 2OMBA 1E4XH 3GJFH 4ZFGH 1BGXL 2XWTB 3FONB 2BHUA 3FQUB 2Y9RT 2D0GA 2V5MA 3EOTL 1IAOB 1VDGA 4PJGA 1RZFL 3GSNA 2NX5D 3V4UH 3OG4B 4X83A 5INCA 3UYRL 3DBXA 4FQ2L 3IVKA 2AEWA 3WIHL 4M7ZC 3H9SB 1ZVHA 3H7BB 3GSOA 1T4KA 5SWQB 3ULVL 4YHPA 3TF7C 3CSYB 4Z76A 2EO9A 2JJSA 2ATKA 5CUSL 4PS4L 5L88L 2VWEE 2XRAL 5EORH 3DXAA 2CRIA 4Q6IA 3VCLB 2I60H 5FA3B 1TETL 1MCBA 3D85A 1ODAA 4JY5L 1PKQA 4PP1C 5CINH 2XZAH 3LMJH 3V0VB 5I76A 3E8UL 1JFQH 4HJJH 5ANMB 3T0VA 3MZGB 4XVTL 2OQJB 2FX7H 1U8OB 4WIQA 2DM7A 4BZYA 5JIPA 4XAKD 3UTQB 4J23A 1P9MC 3ESVF 4O4YH 5GGVY 4WY7L 1DLFH 3SBWA 2VXVL 3BZ4A 3HCVA 4XNYH 2MFNA 5D96C 3TEUA 3ECBB 2C3GA 1NDMB 3DV6A 3MV9A 4HPYH 2ICCA 2VDOH 5D93C 4XXCA 4Y4HC 3WN5B 1RZ8B 2GT9B 3NIFE 1OT1A 4X6CE 4GAGL 4X80H 3EYOA 4K7PH 3WFDL 2XZZA 2J8HA 4Q9RH 1JF1A 3EO9H 3RTQB 4H8WL 5J3HD 1HSAA 1OF2A 1FL3A 4UAOB 2X89D 1D5BB 4OI8A 4DZ8B 1AC0A 1JGLH 4QOKB 1CFVL 4FMFA 3QUYD 1FVEB 4A2MA 5T1MA 2W65B 5DK2B 3GO1L 1DBJH 1XGQA 3B9KC 5MP6H 2F15A 4WEBH 4NQDB 4PJAB 4XMLL 4OLZH 1IC4H 4XCNB 4CW1A 3V0WL 2DQGH 3X3FH 1FH5L 3T65B 4PJHB 3SY0A 3RWDA 3FOLA 4QRRB 5F88B 5CMAA 4K23L 1NFDF 3LVEA 4TSCL 1A47A 3MUZ1 2EXYC 5KVDL 1MIML 4W68A 2CMRH 3P0YL 2CIIB 4MD0A 1R3HA 5J13C 1AHWA 1EEZA 2PTVA 4FFVD 1YEIL 2GAZA 2IWGA 1UWEL 1NFDA 5F9JB 2R9HD 3RWIA 5F6IC 4ODBD 3T8XA 1J0HA 1XF4B 5ENWB 3PXJA 4I77L 1INEL 4MNQE 3ZDZE 2XN9A 3PV6B 1P7KA 1FIGL 5DQJB 1SVCP 2VLKD 3T3PF 4K3EL 1CQYA 1Q9OA 5CP7A 3VGDA 3OB8A 5FEBA 3OHXB 1XCTA 2VABB 2VL5B 4KROC 5FOBB 3UPCA 3FJTA 4NO2A 4F37F 4ODTH 4JPVH 3V4VL 4N0YH 4XB7A 1CIUA 4PJ8D 5I1IH 3PWNA 2YR3A 2YKLH 1RY7B 5K33A 1DL7H 5BQ7A 1YUHB 2M2DA 4FQLL 3PWUB 1CWVA 4XCFL 3K7UA 3LPWA 4TUKH 1WBYB 1SYSB 4R97C 3BN9D 3CPLA 3HC4H 1AGCB 1E4XL 4GAJL 4ZFGL 1A1MB 3CFBB 5E2JA 3MRKA 1M6OB 2FIRT 4F37K 2HT4C 5JW3H 4MJ4A 1PW3A 4FFYH 4HKJA 3V4UL 3TA3C 3TH2T 3GMLB 3MUGA 4PLKC 1MQKH 3VXSD 2PXYA 3WFHB 1NBVH 2W0FB 4Y16A 2ZUSA 3I6KB 3IRPX 4MJIB 5CJXA 4XP4H 5HHOA 1UH3A 3MO1B 5GRJH 2AJVH 4F7CA 1S9YA 5EORL 3BFOA 3MV8D 4BK5A 1AQDA 2VE6A 2X4PA 1E6JH 3PNWA 4P48A 2I60L 2IH3B 2DWDA 5E2TH 2N56A 3IDIA 4GRWE 4OB5H 4QTHB 1T2JA 4U6HA 1RD6A 3OTTA 4U4BA 3MC0A 5CINL 1EZVY 2XZAL 1KXQE 3VXMB 4QNPE 4TTDD 5D7KE 2F54E 4HJJL 5TGBB 1MJJA 2FX7L 5IROC 5IEHA 3CX5K 4UINH 3HPLA 1X3DA 1N64H 1IGCH 4ZO9A 4O4YL 4EZMA 5JOPD 4PTTA 1U91B 1JPST 3C60C 1DLFL 2VMFA 1IM3B 1IEAA 1FQ9C 5F7HA 2WQRA 4XNYL 3LN4A 1JNJA 3CVHB 2EIBA 2BNQA 4HPYL 2VDOL 3OV6A 3VXUA 4MAYD 3UO1H 4AY0A 5E99H 3VFGH 4QRPB 2O61A 2EDOA 4ELKA 3LEVH 4X80L 3PUCA 3DURA 3EO9L 5EPMB 4LCCA 3MLYL 4R6UA 3L5WB 3O9WA 5ACZB 4P23B 2ZOKB 4JFEB 3JV4A 3MBEB 5SX5K 1MIEH 4X4YB 5GZNC 4UUJA 1N3NB 3H42H 1JRHH 4Y2DB 1JI2A 4HC1H 5JQ6L 4WEBL 2VZ3A 2ZWLT 1DDHB 4OLZL 3STZB 2DQGL 3X3FL 4ZXBA 2W92A 3B6SB 3TVMA 1P5UA 3RVTC 1T83C 3BZEB 1OSZB 1FV1A 2CMRL 2PW2B 5FFLA 3P3YA 1S7SB 4WWKC 3WS3A 3S96B 1IGIH 3DHMA 2X42A 5C09E 2OJZH 2UWEE 2H2PC 1NCUA 4WRLA 3TO4C 4I0KA 5IBLC 4JM2D 4TNWK 3KPOA 3RZWA 3P0VL 5IHUH 2NCMA 3L5JA 3L3GB 4HZLA 1SM3H 4IRSB 3SJVA 2ORBH 5KOMC 5DRWA 4R2GB 2DYPB 2NYYC 2GJJA 1MQ8A 1QSEA 3ULVE 3LV3A 3QQ3B 4UB0H 4X9IA 4FZ8H 4PRIB 4ODTL 2X4OB 3BQUB 3UBXB 1KEGH 3U4EA 4JPVL 4P2QA 1JBJA 4N0YL 4MNGE 5IK3B 4GAYA 1Q72H 3GBNL 4N8CL 4YIQA 2YKLL 1DL7L 1BOYA 4KK8D 4M43L 1F97A 3PJSB 4GS7B 4TUKL 3R0NA 1INQB 1OAYH 3ARFD 4MVBD 3KYOB 3HC4L 2X6MA 4PG9A 4WU5A 1MCCA 4ZOEA 5EG6C 5DK0B 1OVZA 4PJXF 4Q7DA 5JDSB 5BRZD 4FFYL 5DUBB 2AABH 2FJFB 5LVEA 4LLQB 1NBVL 4PJ7B 3LN5A 5HXMA 2EO1A 4PJXA 5C71A 2CKBB 1Z5LA 2CRMA 1ZANH 5F7MC 4U1NB 2CK2A 3QDHA 4XP4L 2AJVL 3TPUA 1P84J 1E6JL 3D87B 4NRXA 2AJ3B 4HUNB 5E2TL 1ZHLA 1AXIB 5FGRA 2EDEA 4OB5L 4GKOA 4OZ4A 1HYSD 5KVEH 1OTSD 3D9AH 2P5EA 4KUZH 2ARJB 3QIUD 4LKCB 4XNMB 3GMQB 1U8NA 1G7JA 1RUQL 1W0YT 4LHUA 4OZGE 4UINL 3RWHB 3WNMA 3FT2B 4L4TE 2D9QB 4MDJB 2WSKA 2X40A 1U92B 4P3WA 5J3HC 1JWMB 2AI0H 5JMRA 4C56E 4WJ5B 4YNYA 4I5BA 3QUYC 3HFMH 4Z7WE 1T04A 5DD3H 3KYNA 3VFGL 5C7XH 1JZ2A 4OGYH 4PGCA 5EU4A 2X70B 4ZOCA 4RGNB 5HGAA 1T2QL 1I9JH 4I18B 2A0LD 4R90H 4LSTH 3I85A 2G60H 4Y0GA 5IG7B 3NCBB 3GMOB 1HIMH 1F3RB 5E8PA 4JQXC 1MIEL 3WXVL 2P5WD 1WVZA 3O4OC 3P4MB 3H42L 1JRHL 4MXQD 2MCG1 4AYFA 2OR9H 4FFVC 4HC1L 1FNGB 1KOAA 3SOBH 2GFBA 2DQUH 5E5MB 3QRFM 4YHML 4B41A 4S1DD 5DJ2B 5MI0C 4MQXD 3FTGB 4RNRB 4LPTA 5E8EB 1X6NA 3IS1X 5F1NB 1T1XA 2OYPA 2ARJQ 1EK3A 1WK0A 1A6UH 5C3LD 1EAPB 2O5YH 1IGIL 4G6FB 2H8PA 4JZJA 4P5TD 5IWLA 2OJZL 4Y1AE 3MRPB 2P43B 4K3DH 3P73A 5KJRH 1A9EB 4M61B 4PGBB 1U58A 3ZHDA 1UB6A 4OTXH 4KDTC 3BH9B 4WW2A 4PJ8C 3PWVA 4HUUB 3VW3H 3OXRA 1SM3L 5ELIA 4K9EH 4X9BA 5HGBA 3VH8B 2HMIC 2ORBL 5I71B 3BN9C 3NN8B 4ZMAT 1TTGA 2SEBA 3WNKA 1CE6B 5J1TC 3S35H 4UB0L 4FZ8L 2DJSA 1FVCA 3OGCB 3KPLA 2DMBA 2L0DA 1EUTA 2OX5A 2JCCE 4JRYD 3LSOA 1AP2A 1Q72L 4LRNH 5I9QB 3ULUH 5GRVL 5JPNB 1T0MA 3KG5A 3SGDI 4LVHB 2NY4D 5FDYA 1OAYL 1MOEA 3QZWA 4X9HA 2AV7B 1IGYA 2QHRH 3QEHB 3TNMB 1L9MA 2HWZH 3NPZB 4P49A 1RJYA 2EDKA 4AG4L 1H5BA 3O11B 4MQ7A 5HHQB 2AABL 1HHIA 5E2WH 1EHNA 1KG0B 2P8PA 2VXQH 5T33H 1QKZH 2CLZB 1PG7H 4ZSOB 3LQAH 5FECA 2HJLA 5MENA 5D2LB 1ZANL 4TTDC 1U3ZA 2YPKB 3V6OC 3PQYD 4DCQB 5DZNA 5EBGA 4MJ2A 4UV4H 5JO5A 4H1LB 1IGTA 2LU3A 2QQNH 2BSSB 1AGFB 2JK5A 2MQ3A 1TDQA 4HULB 3BHBA 1P4LA 4FQHA 5HHVH 4MAYC 5KVEL 2PO6B 5EC1A 1N59B 4KUZL 4K9EC 2CDGA 5A2FA 5ISZE 2X4TB 3LKQA 3WLBA 3KJ6H 1VACB 4NNPH 3U7AA 4JDVA 2DQTH 3V7AE 4UTBH 1A7RH 3HMXH 3DO3A 1U8LB 1Z6JT 5I75C 4HWNA 2AI0L 1LO4L 1DVFD 1CIDA 1PSKH 2P44B 4Z7UF 3SE4A 1KB9K 3HFML 3T04D 1LO0H 5DD3L 4LSDA 5C7XL 4RMUA 5IQ7H 4OGYL 1KC5H 4JFFA 3UC0L 4AM0B 2DBLL 3IKKA 4HKBB 1I9JL 5F7WC 4KJQD 4Z7UA 2OK0L 2Z35A 4R90L 4LSTL 3HC0B 3GI9H 1Q94B 1F02I 2G60L 2ITDA 5I8OH 1HIML 3E1F1 1IE5A 4YXLH 5BOZG 1KGCE 4JQVA 4JHZA 4UZGA 4HUVA 5B38A 5FKPB 1NC4A 1ZS8B 1FN4A 3QUMA 5E94B 2OR9L 1VGEH 5FDWB 5LGJA 3ARUA 2DQUL 4JM2C 2CJUH 1EO8H 1J8HD 3BP5A 5F72S 3MCLH 4TUOA 4RMWA 3F7PC 3LKOA 1C16B 3S37X 3BT2H 3CJJA 1A6UL 1RI8A 5I74C 3D3VA 3D2UD 3MRGA 3RBSA 3O4LE 5HVWA 1ZHNA 2O5YL 5J9PA 2RHEA 1ZLVK 4NUGH 4WGWB 3FO0H 3C8KB 1TTUA 5KJRL 4HLZH 4MA8H 5T1DH 3WV0A 3H9HA 4IRJB 2YA2A 3LOWA 1WJ3A 4OF0A 4OTXL 3VDBA 1I7UB 3QDJD 3VW3L 4HH8A 1OPGL 1UT9A 3OJVC 5DSCA 4K9EL 3QG7H 1NPUA 4RA0C 3SE9H 5D5ME 4KK8C 1KPVB 3VGFA 1EEYA 3ARFC 4MVBC 4Y88A 4PJ7F 4CMMA 5GZOD 4ZPTB 5DUMH 4HGWB 4RQQA 5C0JA 3FFCE 2VZ1A 2WBJD 1K8IB 3RX8A 1QFWI 1CG9B 4F57H 5GGSA 4ELME 3X14B 1WICA 2VZUA 4WV1B 4JKWA 2NZIA 2WNGA 1OAXH 4LRNL 5E6IA 4H20H 43C9A 4I9WE 3QYCA 5ITFA 4M1CD 1Z2KA 5T5FH 4YX2H 3PGDB 2GTWB 5IFHL 1VB9A 2Q6WB 2QHRL 3DRTA 6FABH 5I8EB 5KSBA 3CH1A 4BSWA 3J7HA 3F6LA 3QT2A 4PRBA 4R8WH 1HYSC 2VXQL 5T33L 4Z6AT 1PG7L 3LQAL 1OTSC 1FZJB 4CVZB 5I8KH 1KYOJ 4F33A 3QIUC 4ZYKA 3FKUS 3OSKA 5I66A 3Q48A 2F53E 1MRFH 2ENYA 3CCHB 4ZS6D 3BGFC 4UV4L 1YJDH 4U0RC 2NX5E 5B8CB 4Z5RA 2QQNL 1QSFA 1T21A 3QWOA 1OWRM 3OBAA 2K7QA 5HHVL 5CD5C 4GKNB 5BV7H 2EEDA 3BEWA 5I1CL 1ZLUH 1E4KC 3BKMH 3IDMB 3KJ6L 3MRMA 2DL2A 1R6VA 1I1RA 1RUPH 2EICA 2DQTL 4LMQI 4UTBL 3MJ9A 1IGJA 1A7RL 1JNLH 4PJFB 4HGMA 3GSVB 4YQXH 2BRQA 3MA7B 3OXSB 5I73C 1PSKL 2NY1B 5D7IF 3C8DA 4BH7A 4S1SL 1LO0L 1GOFA 4MXQC 3MOAL 1GGBH 3I75A 3OJMB 4ZAKD 3HC3H 1UCTA 5IQ7L 2Z8SA 4XAKE 4FNLH 2VDQH 4WO4C 4R7DB 4CGTA 5D7IA 4UBDD 4YAQA 4PRAB 3WYRA 1MJUL 3GI9L 4S1DC 3RUGF 4Q58C 5I8OL 3HE6B 3LKRA 1A21A 2HTKD 4MQXC 3Q6FB 1S5IL 4YXLL 3JV6B 4OZFA 4I3RH 1X5ZA 2VAAA 1QFOA 3B9VA 4PLJD 1YNLH 5TDPB 4ESKA 1UACL 5HYSA 2K1MA 3OKKB 1H3XA 3RUGA 2YD5A 3C2SA 5I1AA 3T2PA 4FTVE 4K8RC 1MWAA 1UENA 1VGEL 4P5TC 4OF8A 5D2NA 4NHUA 1IMHC 1EO8L 4Y4KD 4NQSB 3KWWA 2BY0A 1BVZA 3ILPA 1NGPL 3BVNA 4NOBA 4LHQB 4U7SA 1YJDC 2Q20A 5KSUA 4RFEA 3RL1B 3ULSB 4NZTL 3BT2L 4XP5H 4QCIA 3QULA 5F7YC 4JB9H 3FO2B 1MRDH 1TLKA 1LEKB 2E9IA 2BNUA 3UTOA 4EQ2A 1DBKH 1WWBX 5BV7C 4M7JH 2NY0D 3FO0L 4V1DB 5EO9A 3JTSA 4MA8L 5T1DL 4HUXA 8FABB 2VLJB 2WZPD 4RA3A 4JLRB 4RIRA 1N6QH 1M71A 3CFJB 1K4CA 3QO0B 3DX9A 2H45A 3QG7L 3SE9L 5GISH 3LEXB 1OARH 1RVFH 2M1KA 3QAZB 1SJEB 4HK3J 4HZAA 3T0XA 2FEDD 5HGDB 5DLMH 4HFWB 4ZS7H 1FGVL 2COQA 3N1FC 4FQ1H 3IFOB 4DKFH 1UH2A 4LPYA 3MV7B 2E5EA 1ZT4A 3HAEA 2VLKE 3REWB 4NBYB 4JKPH 5EZLA 5CIPB 3CAFA 1OAXL 4L4VB 1FO0L 4RGOH 4MLSA 2WUCL 4H20L 3RBGA 3U0TA 5MEPA 1PKQE 4FHBD 3PWLB 5C08B 1BBJB 4YX2L 3V79C 1SJHB 2CUIA 3MJ8B 1TVHB 2IPUG 1GGCH 1UQSB 5DJ0A 3DLQR 3VXNB 3D6GA 2BC4A 2VAJA 4HQQH 1JNNH 4Y5VC 3VFUB 1IL1B 5EO1A 2GJ6A 4XX1G 2M26A 4OM1L 4IRZH 3SDXB 5IUSA 5IF0A 4KRNA 1I1FB 3MV9E 4JFXB 3DV4B 3UJIL 3VFMB 1CLYH 3NCJH 2DKUA 4EVNB 2GSIA 1MRFL 2AGJH 2DTMH 3IDYB 2C1OB 1YJDL 1U8JB 4M93B 2OSLA 4EUPA 1S9WB 4OFYA 3VXSE 2BVTA 4N0UA 2GK0B 4LF3B 3PL6B 1YDPB 1ZV5A 1DVFC 2I25N 3T3MF 1PEZA 4NQEB 1T20B 1MY5A 4XNQA 32C2B 5BV7L 1M4KA 1MELA 2R1WB 1IEBA 1ED3A 3SKUD 1BQHG 1JP5A 3BKML 3MRNA 1B2WH 1S9VA 4QRQB 2YRLA 4M8VA 3U7YH 5AG8A 2DN7A 2BVEA 1RUPL 1A64A 2NW2B 2QKIB 3HE7A 1JNLL 4JKLA 3HUJF 2AK1H 5DJZA 5FGCE 4MD4B 1EJOH 4YQXL 2YEZA 4OQTH 3EJYD 1FG9C 1GGBL 4UQ2B 3V6OE 3DUUA 2HFGH 2VDQL 5CGMA 1RQ5A 1V3KA 5JOPE 3P30H 5BS0E 1TQBB 2YMXH 3MLRH 1BLNA 1KACB 1F6AA 5DJ6B 4RAUA 4I3RL 4NN5B 1OTTD 4BZ1L 1SBBA 4FXGB 1CS6A 4LSQL 2UUDK 2QADD 4M6OH 3X13B 2PTTA 4HCRH 3MRCA 1LP9F 1PD6A 3QQ9D 3BKJH 2JIXB 2UVEA 3BIKA 1IQDA 5M7QA 3N1QC 3QJFB 1IFHH 4MWFB 2NY6D 3REVA 1LP9A 3G08A 4XP5L 1P6FA 5EO0B 4BYHA 3KPSD 4JB9L 1FNHA 1MRDL 5GZOC 4U1JB 1DBKL 4RWYH 2WBJC 4M7JL 2BSTA 1BHGA 3STLB 4MLIA 4XC1H 5KS9F 4C4KO 1UCBL 5CD3B 4J3OC 1JPTH 2QJDA 3GJEA 4S1QH 5DVLA 1D9KD 1N6QL 4OLVH 3O6FC 3RNQA 4X9FA 1MI5D 5DD1L 5KS9A 2ADFH 2IALA 4YEEA 1NGQH 3BDXA 4M6NH 1UXSA 1FFRA 1OARL 1RVFL 2FR4A 3MOBH 4M1CC 4Y89A 5C0AB 3OR7A 2OI9C 4LSUH 2FB4H 2UZXB 5JHDD 2YN5A 4KVNH 1KIPB 5DLML 5D6CA 1G6RB 4FQ1L 5T3XD 3QXVA 4MD5A 4DKFL 2ZSWA 2E7BA 5L0QC 2ZKHH 3NCEB 5JHLL 1OAUH 3G6JB 4E0RB 1J10A 4JKPL 4YDVA 3OR6A 1P7QB 2VKXA 1G0DA 3NFPB 4P46B 1ZWIA 4JREC 1FZKA 2GUOA 3CX5J 4ZS6C 3CH8A 1GGCL 4OQ1A 5GRUH 4HQQL 4BUHA 1JNNL 1EHLH 3ZKMD 1FBIH 5I1HH 5DRXA 5CWSA 1XAUA 2VDNH 3EO1A 4IRZL 1YN6B 5EOCJ 1NGZB 1MY7A 3KHOA 1EFXA 1TCRA 4ONHA 3VXUE 1CLYL 2P42B 3NCJL 3QWRA 3VWJD 1WC7A 3RHWK 3OQ3B 3U2SA 1GZPA 2AGJL 3B9KB 3LQZB 2DTML 2ESVB 2FX8H 1ZHKA 3BUYB 5BRZE 2VLRD 4PJBA 4MXWH 3TWCH 4OLEA 5HY9A 1ZVSA 3CFIC 3O8XD 4HJGB 3GSUB 1NAMA 3VRJA 4BFGA 4NKOA 4O9HH 4Q6YA 4EDXA 4N1EA 43CAB 1DQQB 3IFPB 3ZKQD 3QEGH 4ZAKC 5HHXH 1U3JA 3SPVB 2HT2D 3K1DA 1B2WL 4Z7VE 5ESVB 1T2XA 1VCAA 2H32A 4UBDC 5T1KD 3U7YL 1QO3A 2OTWA 4DVRH 1R3KB 5KANG 1W8NA 5IVZB 5IFJB 5BVJA 1NANI 2HTKC 2VRAA 2KPNA 4W4OC 4D0CA 1BIIB 1TPXB 3D0LB 4UDUA 4ZO6A 5CCKH 1EJOL 4PLJC 4OGZA 4ZFFA 2XKUA 4NZUH 1XF3A 4OQTL 2QHLA 1C12B 4OFIA 1VADB 4OI9A 5DC9B 4PRHD 4JRXD 3RDTA 2HFGL 1OQOA 4LLYA 3DVNB 3HNTH 4Y4KC 1VFBB 3ALPA 2YMXL 3MLRL 3QH3A 3S36L 5F89B 1HILA 1TFHA 5BW7C 4OIBA 3MLSH 1MNUH 1OM3H 5LJYH 3OKDB 4N68A 4WUKH 5B3JF 3SJVE 3ISWA 2VUOA 1P2CA 4M6OL 1E6OH 5IW6A 2NY0C 2ICEA 2E7LA 4KPHH 4RSVA 4HCRL 4LLDA 1S9KC 3BKJL 4NRYB 5IMLB 3C5ZD 4JZOA 3VFSB 1MLCB 3BEVA 1XH3B 2P5WE 4PJIF 3TA3B 1IFHL 3KYMB 4QRUA 4O2FB 4L8DA 5E9DA 1A14H 4TTGA 4MHHI 2CDEB 2Y06H 3BIBX 2D7QA 4JVPA 1KLFA 2FEDC 4PJIA 3HB3D 4JN2B 4LEXH 1NQBA 5F1KC 4XC1L 2J8OA 3WNNA 4KAQH 3A6CH 5DJYB 1FVDB 3SGJA 1OL0A 3Q5OA 3MJ7A 3C6LB 3QFJD 2A2QT 1JPSH 1BD2D 4QXTA 2ADFL 5HVFB 1NGQL 4M6NL 2G2RA 2Y5TA 5IB4A 3JTTA 3MOBL 3SDXF 5I17A 4LSUL 2FB4L 3WL9B 4O2EB 4JAMB 4KVNL 2VDRL 1DEDA 1G7MA 2GSGB 4OIIH 4JFPB 3OAYK 5CILH 2B2XH 3FFDB 1YMMA 5DT1H 5CS7A 1OAUL 3VG9B 1A2YA 1X5HA 5KZCD 2CDFB 2R1XA 3MRBB 4UNVA 3OKNB 5GGQH 4Y4FD 3QA3B 2PYFB 4M1DH 2AXFB 2HFEB 4P5MA 2FL5A 4TQEH 4KGLA 4ZUSB 5GGRB 1CDUA 5D1XA 3C2AH 3RZCD 4NP4H 1GC1H 2ITCA 1GH7A 3LD8C 4K07A 2DJ4A 4UOW1 3W0WD 4P2RD 5GRUL 4JRYE 1EHLL 1ZT1A 1A7OH 1FBIL 4XPHH 5L8LB 1UVQA 5ALBH 4XB8A 5KVGH 2VDNL 4YHIB 3BP7B 4U1SA 2FIKA 1A4JB 3VFWA 5CBEB 5HYEA 1OGTA 1U95A 3GMMB 4O02H 1H15A 1A6PA 2FX8L 5C0BA 4XH2B 4XCYB 4MXWL 3TWCL 1UADC 4LEOB 1T7YA 1Q9KB 1V3JA 3SGKA 5C07D 4PRDA 4O9HL 1PZ5A 2P24B 3D85D 3ZYIA 2YS4A 3V4PH 3EJYC 1N8ZA 3QEGL 4NZJA 5ESQA 4K71B 3PQYE 3F12A 1AR1D 4N1HB 1SYVB 1GCFA 4NN7C 1TZGH 4NWUL 5B3NA 1J0ZA 3BD3A 5K59E 5CCKL 3DMMB 4KKNA 2B39A 5EN2B 2X4UA 2MHAA 4NZUL 1FZOA 1M7IA 1NKOA 4AENA 5ICYB 1NLBH 2J3SA 5JA8B 2QADC 1T5WB 2Q7YA 1RMFH 2IANB 1EGJA 3NOIA 1CFQA 3QDMD 3CMGA 3QQ9C 2J1KA 4XP1H 1UWGH 3PP4H 5JLZB 2R0KH 4HWZB 2BJMH 2IEPA 4UNTA 3ARGB 3MLSL 2NY6C 1MNUL 3T1FA 3BO8A 1KCSH 2UZYB 4WUKL 4NKMB 2DRUA 2UV3A 1FL6A 1MCEA 1VFUA 5I16B 1E6OL 2X10A 4ZNCD 4G80A 3BMVA 5DC4B 3KHQA 3OB0H 3WNLA 1R3LB 3MRQB 4EOWL 4Y5XA 3VRIA 5KOVC 1D9KC 1D5MA 2V7HA 5IB3A 2ZUQB 4HV8A 2AW2A 3T2OA 1N6VA 3HNSL 4C83A 4NO5B 4D2NA 4KJYB 2FWOB 1NFIA 5TF1H 1J86A 4L29A 1C5BH 5ALCH 5F9OH 4NDMA 2Y06L 4JRWA 3F7YA 4URTB 1XCQB 5DR5L 3W9DA 5DJXA 4X5WA 3PIQA 1RZGA 1A6TA 3MNWB 2YPLD 4KAQL 1J8HE 3A6CL 4D0BB 1N4XH 3ZDYF 2OL3H 5IIEB 2RGSA 2XN9D 5HDBF 5C0CB 2R39A 2GI7A 5DYOB 4DTGH 1LK2A 5EUOA 1JPSL 1S7QA 2BVQB 1R3JB 1AGDB 3TBVA 2IFFH 4L8CA 4KK6C 1R0AH 3AXLB 4HIEA 3ARDA 1R5IA 5DMIL 1J7VR 1MCWM 2NXYD 4OIIL 4XTRD 5CILL 2B2XL 3O3UN 2BDNH 2H3NB 1QSZA 3ZKMC 4XHJD 5H94B 1NMAL 3MACH 4IMLA 2R1YB 1IAII 3NA9H 2I9TA 1EAJA 4NOFA 5GGQL 3ARED 1QLFB 4M1DL 3LKNB 4TQEL 4Z78B 1O7VA 2X1OA 2DLHA 3FT3A 4FG6D 5FUZH 1QRNA 3VWJC 3C2AL 4C4KT 4NP4L 5K9KB 3Q3GB 4GMTH 4DQOH 4Q2ZA 4JJ5B 2XTJB 2ID5A 1A7OL 3MLWH 2EIZA 2OR8A 5ALBL 1VERA 4LKXB 3O8XC 4GFTB 1WFOA 4HS8H 4KGJA 1JPFA 4Y5YB 4YXHH 5KVGL 3RGVB 1KB5H 1MEXH 3FO9A 4GAFB 4H25A 2HT2C 4RMQA 4CNIB 5D7LD 3QNYA 3MNVA 4JFFE 4O02L 4LQFH 4DZBB 2EC9U 3HI5H 5MEQA 2VISB 5A2LH 1ZA6A 5J12C 3DROB 4PJ5A 2FEEL 1ZKAA 4MJ5A 1YYML 3HZYB 4GRLA 1S7XA 3L5XH 1DJSA 1A7QH 1ORSB 3MR9B 1B4JH 4AEIL 1I8KA 5T3XL 3CD4A 2XICA 3F58H 5C0IA 4D9RD 2V5RA 3NZHH 1RIUH 4OZHE 3VA6A 3WIFA 1TZGL 5CSZA 1CGYA 3V5HB 3E2HC 3ZL4H 4CU7A 4PV9A 1C8PA 4PJ8B 3FN3A 2EIEA 4LVNC 4HWEH 5DFVD 2AJYH 4Y19D 3VCLA 2KBGA 2OTUB 4O5LH 1RMFL 4ODXA 5E5RB 3SE8H 1BVKB 4OAWB 3CDCA 3MMEB 1DEEB 2DD8L 3SCMD 3C5ZC 1UWGL 3PP4L 3O9WD 2R0KL 2OQJA 2AK4A 1G7LA 3L3IB 2BJML 4PRPE 3TN0D 2FX9L 5FYJD 2JE8A 3PWJA 2DMKA 1KCSL 4WUUD 2X09A 5IR1B 1K5NA 1UZ6E 3U1SH 3LEYH 5FO7A 3HB3C 4V2BA 3E6HB 3ECBA 4EBQL 3QRGH 1HINH 1KXVC 1XF5B 4N9OB 3MBXH 4LGSB 3IKCB 4S10A 3MV8B 1RZ8A 1JPGA 4U1IB 3TESA 1UJ3C 4D9LH 2Z8RA 4ZFZB 1MAKA 3T77A 1BOGB 1JN6A 1PY4A 2XFXB 4IEFB 5DUPH 1I85C 4P4RB 5ALCL 5F9OL 2NLJB 5DURB 2CO6B 3F7VB 1A3QA 1UXWA 4QOKA 2AV1A 1N4XL 2OL3L 4CVXB 5KSBE 5HHNB 2J8UB 1AXTH 4POYA 2F58H 4Y4FC 4R0LC 4N8VG 2OZ4A 5HDOA 4G8IB 4NKDB 2IFFL 3P4OB 4MAYB 1M7DA 4APQB 1Y6MR 4QRRA 3RZCC 1CD8A 1AO7A 4YDLC 5EU6A 1J11A 3BX7C 1P4IH 2BDNL 2W1NA 4KUCF 4HIIB 2ADJB 4FQPA 1HQ4A 5H37H 5J1SC 3MACL 1EVUA 4NUJA 3NA9L 1QRKA 4DGIH 4RRPG 1DBMH 3MRHB 5I75B 1JZ6A 1XF4A 3U0PA 2C3WA 5CGYD 4YC2B 3PV6A 5FUZL 3D39A 3WCYA 1FL5B 4GMTL 5A40E 4IS6B 1NL0H 4YHZH 3OHXA 4WFGD 2VL5A 3X3GH 5FOBA 3TYGH 3VXTA 1XZ0B 4WHTB 3WFBL 4HS8L 5GGSY 4AH2A 1CL7H 4YXHL 1ZAGA 1CGVA 1G9MC 3RQ3A 3IXAB 2CIKB 1UM5H 4PR5B 1KB5L 1MEXL 3LPFA 2ICWB 3G5XA 1AR1C 3DI2B 4LQFL 2FGZA 5F1IB 1RIHH 3PWUA 1WBXB 1V3MA 3AGVA 1X5AA 1AGCA 3I02B 1CFTA 1PY9A 2MQCA 2W9EH 3L5XL 3CFBA 5IJVB 5DJ8A 1M6OA 1QNZH 5KVFH 1VFAB 3ES6A 4BFIB 1FLRL 1B4JL 4UDTA 1XGPA 4X4MA 2WW8A 5GSVB 3BGMA 3F58L 2H26B 3RTQD 3WFHA 5GS1A 3NZHL 3QG6B 1RIUL 3DRQB 1K2DB 1RFDH 1R3IH 3NGBC 5EBWA 3TZVA 4L3EA 3ZL4L 4TOYH 2X4NA 4E41E 5EBMB 1KJ3H 1P4BH 4HWEL 4NQDD 4G3YH 2AJYL 1LWRA 2PCPA 1RUMH 4LK4A 4I2XA 5D6DC 4BH8B 3V95A 2IH3A 4CVUA 4G9FA 1P5VA 3PXHA 3SE8L 4MXVE 2CR6A 2DQFA 4QT5B 4J4PD 4XCEB 5CFHA 3IXTA 3Q0HA 1RZJH 2WIIA 4RFNC 2YSSB 4MB3A 5C86A 5D9SB 1RJZB 4P57A 1LO2H 1A1OB 3ILQD 2O93L 3CUPA 3U1SL 2DLIA 5SWZB 3LEYL 4JG0H 2G75B 3HNVH 5D1ZD 3QNZB 1KJ2A 3QRGL 4MDIB 3D0VA 5LKNA 3RJDA 3MBXL 2X1WL 4PJDE 3DARA 3HPJB 1L7IH 5K9OA 1H0DA 1JWSB 1FNFA 2FO4B 4HK0B 4NFBA 5EOCH 4HDIB 3KNBB 5DUPL 4JFZH 5ACZA 4LSPH 4NQCA 3FCTB 3VDCA 2J2ZA 5CEZD 2NXYC 4HAFA 2LAGB 4P3DB 4XTRC 5FUCE 2EE6A 1A8JH 2XWJA 3IETB 4PJEF 5E08H 4Y2DA 4ERSH 5DVKA 4XHJC 4U0RB 4G42B 3VD3A 4F2MA 2F58L 3HTLX 4DK6A 3AREC 3STZA 5B22A 5IV2A 5M94B 1VKXB 2B1AH 1QSVA 2A73B 3OKEB 4LASH 4E5XA 4NM8H 5L2KA 3V5KA 1PX3A 3FQWB 4U1KB 2DLTA 2GK2A 4J3TA 3OWEA 5FYKD 3ZE2F 1P4IL 3DNKA 3MREB 4MB5A 4ODSH 5FYJH 5GRVK 1MHHA 5E00A 3QDGD 4LLWB 4WI3A 4HJ0D 4N0UE 4ZDHB 4DGIL 1DBML 1LEIB 3FB6A 4MJID 3ZKSD 1RZJC 1U36A 1AJ7H 4R26L 3G9VA 3L3GA 3VFTA 2X1PA 5T3XE 4XPAH 3S4SB 4GG6B 5IJKC 2ADGB 3O6KL 1NL0L 4PV8A 5E8NB 3X3GL 3TYGL 1A02N 4I0PB 4PTUA 3VXMD 1RZIA 1CL7L 4NM4H 1X5KA 1YY8B 1Y0LB 4LLMA 1ZGLB 5C8JA 1HWGB 4M6MH 1FC2D 2IAMB 3PGCA 4NQVB 3VGHA 2DJUA 4NYLA 1RIHL 5JR1H 4XAWH 5BJTB 3PJSA 4U6XA 3GMRB 4I3GA 4N9GB 4Q9CA 2W9EL 4YLQT 5BO1H 3QFDB 3G5YA 4Z8FH 1N2RB 4QRPD 3J8F7 1QNZL 5KVFL 1EMTH 2NY3B 3NIGE 1Q9WA 2UVFA 5DFVC 5IVXE 4TVSa 5K9QG 4KV5E 3GKWH 3SQOH 4LLQA 4P23D 1JK8A 4OV5B 4JFED 5BV7B 3MBED 2CKBA 3SE3C 3SCMC 4OLYH 4AEFA 3O2DA 1RFDL 1R3IL 3P77A 3BYYA 3TN0C 4TOYL 3V6FB 1MCWW 3WS6A 3V6ZB 5C0RH 1KJ3L 1CFBA 3ZE1F 2Y72A 2CRZA 4X7TA 1RUML 4IM8A 4L8SB 1I7TB 3BJLA 2NY4B 2CLRB 4PREA 3U36B 4O51B 2A74B 1OW0A 4LKCA 4XNMA 3GMQA 5F96H 5EFIB 1WCBA 1RZJL 3S3PA 1QEWA 2C4XA 3RWJB 4N5UA 1LO2L 5TQ0H 1YEKH 1MCJA 3EFDH 4PY7B 3K0WA 4JG0L 3VI4E 4K3JH 1N5YH 1DQJA 1QHPA 2R56H 4QY8B 5IMOB 3ARPA 4IRSD 1ONQB 3WO3B 1L7IL 3B2VL 4Y5VB 2X70A 3PDGA 4R2GD 2DYPD 3CFKB 3JZ7A 2AS5M 2ZUXA 4HBCH 4RDQG 4XP6H 4X99A 5J56B 5EOCL 3SDDA 3NFNB 3BZFB 4PRID 5IG7A 1A3LH 4AL8H 5J89A 4JFZL 3BQUD 6CGTA 1QBMH 1U8QB 5I6XB 4F7MB 1DQMH 4I48B 3MFFB 2FD6H 1HWHB 3P4MA 5E08L 1B88A 5DRZB 3L7EB 4ERSL 2BNRA 1FNGA 4I4WB 1BZ9A 3CVIH 4JY6A 4BUGA 4TUJB 3MCKB 4PJ9B 3L7FA 5T1LB 2CLVB 1XGRB 3RI5K 1DVFB 2B1AL 5CGYC 4NO3B 3FTGA 2VIRA 4I13B 4LASL 4ENED 4RNRA 3CZFB 3T0EA 3GBLA 4NM8L 4U1LA 5E8EA 3PP3H 3UXFA 1I3UA 1NLDH 2PW1A 5FYJL 4X6FA 2ARWA 3QFJE 2QQKH 4PJBE 3X11B 4KY1L 1F3DJ 4LQ1A 3MRPA 5ERWA 3VXOB 4U05A 4M61A 1X44A 3MXVH 3PHOB 4MZ3A 5F21B 4DUVA 4X4XB 4X6DE 4WFED 5TH2A 4JHBA 2P45B 3MXWH 2W60A 4XPAL 1KBGH 1ZVYA 4PYHA 2AXGB 2IPKB 4AIOA 3BW9A 4MJ6B 1MVUB 3N1PC 5E24E 1U8IB 4DEPB 2Z31A 1CDJA 3NCYS 3WN5C 5EZIL 4NM4L 1CDIA 4OCMC 5C6PB 3LDBB 5CEZH 4C54A 5DC0A 3QEQA 3VWKB 3TBYB 1WIUA 3WHXA 1JZ4A 3D2UB 1N26A 3RTQC 1AI1H 2V9TA 3W0WE 4P2RE 4HX1B 4X6BB 4UAOC 5JR1L 4XAWL 1YPZA 3BIAX 4YDJA 2OXGA 4HH9A 1QSFD 2YA1A 1JF6A 2E9JA 2HN7B 1ZMYA 5BO1L 4Z8FL 1KTLA 4ODUB 4YZFE 3DI3B 2CGRH 3QDJB 3H0TB 3BPCB 3KXFA 5J7CC 1EMTL 1J1PL 1YN7B 2Y5EA 3M45A 4JCLA 4RGND 2HVKA 1NSNH 3O11A 3P4LA 4OCSL 5FYKH 5HHQA 3GKWL 3SQOL 4Z0XB 4J3UA 3T1WA 2CLZA 3TBTA 2WBJB 3TBSB 3S5LG 4WI4A 4J4PC 1MCPH 4X7FC 2L7JA 1VESA 4DCQA 4DN4H 4CN6A 1WZ1H 5C0RL 2D7OA 2E6JA 4BQ9A 3ILQC 3GMPB 1EUUA 2CO7B 1KUMA 5D1ZC 5KSAA 3SDCB 3BKCL 3H3KA 1T5XB 3ZTNL 4OZIB 1NANH 2C5DC 1Y18A 1F4YH 4KI5C 4IMKC 3O3EB 4YHOL 5F96L 5L0QB 2ATPB 4OLUH 2AKRB 1ZXQA 1EO7A 2IMMA 2X4SA 4MCYB 1BQHA 1MJ8H 4ZD3H 4ETQA 5TQ0L 5F7DA 3D69B 1W8OA 4K7FB 3QDME 4K3JL 1N5YL 5JW4M 5CP3H 5AWNH 2R56L 3W9EA 3U30C 3GNML 3GSXA 3NCCB 1C1EH 1MH5B 5GSRB 2X9WA 4PGDA 4AM0A 5LGHH 1U3HD 5CEXB 4HBCL 3BH8A 2DB8A 4XP6L 2E6PA 1T03H 1Q94A 1AY1H 4PLOB 1CK0H 1R5WB 4M8QB 4AL8L 5SWSB 3K8MA 1RUAH 3CZJA 1UZ8A 1JHKL 1XF2B 1QBML 5DMGD 1DLHB 1DQML 5BZDA 2FD6L 1BBDH 1JGUL 5IHLB 4GQPH 4HJ0C 4HLZG 5DA4A 3OKLA 5C3TA 1E28B 3ARBB 3BUTA 4M7LT 1KJMA 4ZUUB 1A5FH 4GBXB 3MRJB 2PN5A 1Z9LA 5CJOH 1TJHH 1MCSA 1C5DA 1FNAA 1NLDL 1HOCA 5C0BE 3IDNB 2QSCH 4K3GA 1Z9SA 1H3VA 1JV5A 4X6CF 1WTLA 4V2CB 3F62A 4M3KB 3QUMH 5IQ9B 5IMMB 5D7JA 4HWUA 4J1UB 3MXVL 2XIDA 1CGTA 2DKSA 4KJWD 4OJFH 3S4SG 4YJZL 4NQXB 1T7ZA 2AJXH 3MXWL 5AEAA 2ZCKH 4QF1A 5DTFB 4OSUH 2CUMA 1EXUB 4YFLF 4Z77B 1KBGL 1HE7A 4ZPTA 1CR9H 5LCVH 2PO6D 2GJ6D 1FGNH 2GCYA 4RAVA 1CG9A 5GJSL 4KQ3L 2ZUYA 2D31B 4GRMA 5CEZL 1XGYH 3QB7C 5DWUH 2E7MA 1AI1L 4P23C 3MBEC 4HWBA 1X4XA 2R15A 3FQRA 4OFYD 2GTWA 3NVQA 2GTZA 3GM8A 3AB0C 4KTDH 2CGRL 5GRZA 3ZDZF 1J0JA 5GGUA 1ZLUK 1NSNL 2EDLA 1GXEA 5FYKL 5D7LE 4IDJH 3FQXB 5CHNB 2AEQH 4MNQA 3WJJA 3TCLA 1MLBB 4LCWB 3QI9A 3GSQA 1CICA 4P2OB 1ADQA 4WU7B 3HE7D 4I8DA 5K9JH 4XBPB 5DF0A 1WZ1L 4FQQB 3UTTB 3ARQA 4AJ0A 5L7XH 5B8CA 4ZO7A 1XGTA 4BFEA 3FT4B 5ID0A 3HS0A 3GMNB 4EI6B 1H3PH 4KMTL 1CXIA 2DBJA 1A6VH 4F7TA 1IM9D 1F4YL 4IRSC 4OLUL 4R2GC 1KFAL 3GSWB 2NTFA 1SQ2N 5EUOE 1MJ8L 5IVNA 2HFFA 4ZD3L 1GGIH 3NBNA 1HHJB 3BQUC 5DQ9B 3T08A 1SY6H 4IRJD 4PJFA 3FZUD 3OXSA 4D3CH 3CVHL 1BREA 5AWNL 2BSED 4LRIA 4ISVB 3M17B 5EOTB 5GS2D 1C1EL 4QHNA 4G9DA 2WWKO 3ROOB 5F6HJ 5LGHL 2MJWA 3BN3B 4WUUE 1T03L 3HA0A 3RY6A 1AY1L 1JGEB 4L9LB 1CK0L 3UCRA 1VGKB 3Q6FA 4GRWF 3SEPA 2R0ZH 5TDPA 1WAAE 4PJCE 4QNPF 3RWFB 5DD6A 2V2WA 3OKKA 1BBDL 4HD9A 3GUTB 2PF6A 5FYLH 2EZ0C 4HPOL 3GIVB 3HRZB 2F54A 3FRUB 4OUOA 1Z0NA 4JANB 4R7NB 1A5FL 4N0FB 3QIBA 4GLRI 3B5TA 5CBAB 5CJOL 1D6VH 4LSVH 5CSBA 1TJHL 4OV6F 2BP3A 2DLEA 1QA9B 3ULSA 2XKNB 5TDOA 3N1GC 1WT5C 4XXDB 2QSCL 1GGUA 1LO5A 4NN7B 3I84A 4U1HA 3SDYL 2YN3A 2I24N 3VXRD 3BKYH 8FABA 4MAUH 5ITBH 1U2HA 4OJFL 4DGYL 3BXNA 2QADB 3O81A 3EOYG 2AJXL 3QEUA 5CJBA 2ZCKL 3LEXA 2DQJH 3EIFA 3V0AC 5TFSH 4JO4H 3EJZC 1IAIH 3RNKA 1KTDB 3H9SE 4JFOB 1BMGA 5J11C 1CR9L 4KU1A 5LCVL 1OQXA 4HFWA 1FGNL 1DBBH 3L3DA 1NGYB 4QYOB 4OCLC 2HRPH 4RGNC 2E8YA 3LN9A 4I18C 3KPQA 2N7AA 1XGYL 4PBVC 4G8FB 2R2HA 3UTZA 4L4VA 3KPSB 5DWUL 1I7RB 1I9IH 4F7PB 4QTIH 3QQ4B 1CYGA 3HG1D 3EDDA 4ORGB 2EKJA 2UWEF 4QHMB 3IJHB 1CXLA 1ZSDA 3QUZA 3BWAB 5ANME 4KTDL 1D9KB 1D3CA 1TVHA 1CN4A 1EEQA 1MI5B 4R4BB 5GXBB 3EFFB 4HIJB 5HGHB 4Y2OA 3D18A 2UWEA 3VFUA 1XR8B 3PWPB 1JUFA 3QIWD 3AC0A 4LLVB 2KKQA 2Y25A 4IDJL 3U9PH 2AEQL 5JHDB 2R4SH 1FJ1B 1U6AL 4GW1B 3M1BB 1FCCA 1I1FA 3CC5B 4JFXA 3VFMA 3S88H 3ULVF 3EYFA 1BQLH 4EVNA 1LEGA 1AIFA 4MYWB 2C1OA 4LNRA 3WKMH 4H1LH 4ODWB 4KJPD 5L7XL 2Q86B 1OTUC 5DI8A 1S9WA 3V5DB 4LARL 1NBZB 4LF3A 3RDTD 4P9MH 1YDPA 2YWYA 4MNGA 2VLLB 1H3PL 4NQEA 5I1KH 1T20A 1A6VL 4QOKE 4X98B 1K8DB 5E56A 5JXAH 1DR9A 2CRYA 4M7KH 5I71C 5FK9B 2DI7A 4JN1H 1U3HC 2C7UB 4G8GB 4JZNB 4NQDE 4PJAE 4JGMA 1GGIL 4V1DD 3AM8A 3T2QA 1UB5B 1MCOH 1SY6L 4PJHE 2MQ0A 4UU9B 5DMGC 4QRRE 1AD0B 4D3CL 3VWJB 4HIHB 3RIFK 3UROR 2Q76A 3CXDH 1Z0MA 4EN3A 5KG9A 3ARZA 5BXFA 2VLRB 3TT3H 1LD9B 1YNTA 2VITB 3EYQD 2QEJA 5EZJB 3AS3A 1MHCB 3UPRB 4JPIB 4B7IA 2R0ZL 5FM5M 5A16B 4KI5E 4FXGA 4LP4A 1OAKH 5T1KB 2VSCA 4OZGF 1PQZB 1KT2A 4OCNC 3BPOC 1BEYH 4L5FH 3X13A 1X5LA 1OSPH 4OCXH 3KJ4B 4OZGA 4KJWC 5ECJE 2JB6B 5CEZE 4L4TA 1QQDB 2UUDH 4PY8I 4Z7WF 1D6VL 1KN4L 3QJFA 4PRHB 4JRXB 1D5ZB 2Z92B 3B83A 2VDLH 5ADPH 4XPTH 4ZPVA 3AVEA 3WE6B 2PO6C 4Z7WA 4NWTH 4M1GH 3STLA 1WFUA 3E2HB 4O00A 1BFOB 3BKYL 5CD3A 3M07A 1D5XA 3X12B 4O2CB 2A9NH 4FN0A 5ITBL 4LVNB 1LK3H 1JNHB 2EYRA 2WINA 3WFCH 1LE5A 1TZHA 1S5HB 1FFOB 5GS2H 1HNGA 1FYTD 2DQJL 3PL6D 5EZOH 2ILLA 2ZG3A 5TFSL 4JO4L 3CU1A 3DX7B 3VFOB 4R4ND 2A6IA 1QR1B 2XXMB 3C5ZB 1D6EB 4D0DB 1DBBL 4MJIE 1PG7X 3FHQA 2HRPL 4HKZB 1P9MA 1V5JA 2WQ8A 2X05A 3NFPA 1I9IL 1ZLWK 4S0SD 4QTIL 5T5NG 5A1AA 2IFGA 2PYED 1KB5B 1KCVH 3O3DA 1QZ1A 4LFHD 1AGBA 1U9KA 3MLTB 3VRLE 4M5ZH 3VXME 5I30H 4PLNC 1LDPH 1T89C 4Y4HA 1MFAL 1BD2B 4Y1AA 2FH8A 5IB5A 3GB7B 5JORA 3GJFA 2PKDA 3SQBA 1CDBA 4P9HH 4QRSB 4UT9H 3U9PL 2XZCH 1YN6A 2R4SL 1I1AB 1IAKB 2F5AH 3NABH 1ZGLM 2MTPA 1A6ZB 5HSFA 1FFNB 1M05B 1HXYB 3S88L 1PYWA 3UTSD 1BQLL 1T7XA 4QRPE 3RAJL 3SO5A 2FJGB 3LQZA 2ESVA 3EYVB 3WKML 2JCCF 2LVEA 5C0DB 4N1CA 4R0LB 2DQIH 3BP6B 1OP5K 3AAZB 4IRJC 4FQXB 1OD9A 2X7LB 3FZUC 4P9ML 2YD9A 4JFEE 2RQ8A 2JCCA 2JKXA 3G6AB 3RZCB 2JIXD 3CLFH 3U7WH 43CAA 3DX6A 5I1KL 5JW5B 4YDLB 2W9DH 5GPRA 2C3VA 3CDYA 5JXAL 5J6GA 1XFPA 3KGRA 4M7KL 4YPJA 3SPVA 4PJGB 3GSNB 3I3EA 4JN1L 1F3DH 2VZOA 5INCB 3IU3A 3U46B 3MGAA 3IVKB 1HKLL 2QV2A 1MCOL 3H7LA 5H35B 1YEGH 3GSOB 1T4KB 4YPGB 5KAQF 4YHPB 2EYSA 4WV1C 3CFCH 4Z76B 2ATKB 1HHGB 4W6YB 3TT3L 2NXZB 3DXAB 4Q6IB 5C0AD 4F9LC 3IYLW 4WTZG 5ID1B 5C07B 2RBLA 4AT6B 1LHZA 1VFBA 3KR3H 3D85B 3ZHKA 4I3SL 5I1EH 3JUYA 5I76B 1CGSH 4PGZA 2ED8A 3OKDA 4P9HC 1WUNT 2VH5H 1OAKL 4P46D 5FGBC 4L8BB 1F8TH 1RZ7L 1HHHA 4L5FL 3HCVB 5ISZA 4PRIE 1OSPL 4OCXL 1QBAA 3IGAA 1BPVA 2R2EA 3DV6B 3RY5A 2OMNA 1MLCA 3MZTA 3CIQA 3ET9F 3TA3A 2KL6A 1V8HA 5D7SH 4JDZA 4O2FA 3MRDA 4EXKA 2VDLL 5ADPL 4XPTL 3FB7B 3EYOB 1G1CA 4KXZI 2XG4A 5FOJA 1Q0YH 3QNXB 4G43A 4M1GL 1HSAB 4NWTL 1OGAD 1FL3B 4JDTH 5EULV 4LSRH 1IC5H 3VJ6A 1Q8MA 1XT5A 4MZ2A 1FVDA 1A6WH 2DAVA 1LK3L 5FO8A 1PBYA 4M5YL 4XWOD 1XGQB 3HRPA 1MSPA 3UTPD 1RJLB 1G7HB 4LLUB 5EZOL 4PJ7E 2W0PA 4NRZA 4N8VA 4AEEA 3QUKB 1ACZA 3RWEA 1I8MB 3RWDB 3FOLB 4JFPA 4NO0D 4FXLA 1U93A 5IROA 3WDHA 3FFDA 4RFNB 5CMAB 2PTUA 1ERNA 3ORJA 4RMSA 4BKLB 3PHSA 5CIPH 3QIWC 2ZZUT 2CDFA 1PJ9A 5TE7H 4MD0B 1R3HB 3C60A 1OLLA 1AHWB 1EEZB 3HE6C 3T4AA 2GAZB 2DM3A 4GKZA 2PYFA 4LCUA 5AD0A 1NFDB 2WWMD 1T0NA 1KCVL 3TYFA 1NFKA 2WK2A 2YPLB 5DQDH 4RRPA 3RWIB 4P5KB 1CGWA 3T8XB 3FRPG 3JWOH 3G04A 1LDPL 3PDDA 3OAZK 2XN9B 2P8MA 3O4LA 4KJPC 3DVGB 1Q9OB 2APVA 1OAZL 5CP7B 2C3XA 5D5MF 2FATL 4P9HL 1XCTB 3BP7A 1QFHA 4UT9L 2XZCL 4NSKB 2G5BB 1A4JA 4NO2B 3IJSA 3WUWB 1NCCH 1JYXA 3S37H 4XPGH 1GGYA 4HAGA 4ELMF 3ARYA 1YY9D 4YFLI 4RGNE 5HYQB 3FFCA 4XCYA 2H2SD 3P2TA 3AREB 4QXWA 5BQ7B 4LEOA 2VSDA 2Y1VA 2DQIL 4ETYA 5EUKB 4NCDA 4ELMA 3MGOB 1T83A 5IB1B 3CLFL 3T09A 2QQLH 3MRKB 1YQVH 2P8LB 3QAZC 4WWKA 3K3QA 4HKJB 2HH0H 3EYQC 3MUGB 5SX4I 2PXYB 3TO4A 2EKSA 1ETZA 4Z18A 5DJDA 1J0IA 3F7RA 1DBAH 3EDEA 3CFCL 3C6LD 4NKQB 4MSWB 1K6QH 2W59A 5HHOB 5ICYA 2IQAA 4G7VH 4WHYH 5DD5H 5ESAB 4F7CB 1S9YB 4XVJL 1AQDB 2VE6B 2X4PB 3PNWB 4R3SA 1HDMA 1KYOK 2BZDA 4QHUB 2A6KA 2FO1A 2DWDB 4GXUN 4P4KD 3KR3L 4U6HB 2DIBA 5I1EL 2Z8WC 2NX5A 5MERA 1KJVA 1MJJB 1Q1JH 3ARSA 1CGSL 5KSVA 5JW4N 4RCAA 4C59B 1F8TL 3Q5TA 1T22B 4XWGH 1IEAB 3GHBH 2ED7A 1GSMA 3RFZC 3LN4B 4HC1A 3AU1A 4I0CC 3IDYC 1EGJH 2BNQB 5KANI 4M93C 4PRNB 4Y19B 2DI9A 2O5ZH 5D7SL 5HYJD 2O61B 4KJYA 5B4MD 3PL6C 4R4NC 4KMLB 3DURB 4M02A 1J1XL 5IGXH 1Q0YL 1ZOXA 3O9WB 5TE4L 4X4ZA 2RR3A 4JDTL 1IC5L 3JV4B 4KUCD 2F74B 2AXJA 1K3ZA 4UUJB 1A6WL 7FABH 3N06B 4U7KA 1R3JA 5JIKA 2HT3C 1F45A 4XX1E 2BCKA 3RVUD 4ZSOE 4ZXBB 1QBLL 1XF1A 5D2LE 4U1MB 5I8CB 1G6RH 35C8H 3VFPA 4MX7A 1OAQH 4XP9H 5FF6B 2ADIA 2Q7NA 2HKHH 2HVJA 1TQBC 5TE7L 3WS3B 5IT2H 3MLPA 3RWCB 2X89A 5LBSH 3DMMD 1R5VA 4HUWA 4OT1H 5DQDL 3QUYA 1WSST 2P48B 4XVUD 3JWOL 3KPOB 2QR0A 3Q3GA 1YQ2A 2DMCA 4PJGF 2IAND 5FM4A 4YFEA 3EYUH 3SKNA 4JJ5A 4LGPB 3HZKA 4IJ3B 2NPLX 5DRWB 1B4RA 3EDFA 4IBLT 4KZEH 1A6AA 2C4FU 1F4WH 4JQXA 4J8RA 1QSEB 1A0QH 3LV3B 3VGEA 3ARGD 2XQBL 1NGXB 4Q0XH 3MUY1 4LL9A 4TYUA 3U4EB 4P2QB 4XPGL 4CNIA 4L3ED 3QUXD 2IPTH 4GAYB 2NY5H 4YIQB 4DVBA 2VQTA 5D72H 8CGTA 1WV7T 1F5WA 3JUZA 2VLKA 4PG9B 1A7PH 4WU5B 3VA2C 1H3GA 5GGTH 2QBWA 3SKJH 3S36X 2R0LH 1YQVL 1DE4A 1HH6A 1AXSB 2IGFL 3SDAD 3WO4B 3DOSA 1I8IB 1KIRA 4S0TD 2HH0L 5TQ2H 5I1JH 1JF5A 4JO2L 2W07A 1F6LL 3R1GH 5C70A 5C9JA 4PJXB 1Z5LB 1F3JA 4JFDD 1T6WA 4PD4K 3KYKH 1DBAL 4PJ8A 5C0CD 2KZ1B 3EOBA 3C6SB 3IJYB 1K6QL 1JJUA 1IKNC 4G7VL 4P46C 3DYPA 3TPUB 1B6DA 1ZGLP 1EVTC 1DUYB 5LXGH 3GI8H 1BM3H 1ZHLB 4QWWD 1MHPH 3CX2A 4OZ4B 4WI2A 2I07B 3EOAA 2P5EB 1MFCH 1Q1JL 5DEZA 3VXSA 4OD1H 1U8NB 1G7JB 2F8OA 4LHUB 1QOKA 3RRQA 1JHTB 3KVQA 3MRLB 2Z93B 4XWGL 5CEYA 1YEFH 3LQMA 2R23A 5H2BB 1T1ZB 3UDWC 1EGJL 4I5BB 2D03L 1ZA3B 2XTJD 1T04B 1UG9A 3KYNB 1KN2H 2O5ZL 2IMNA 3AS2A 4XWOC 4XPBH 3S34H 2XFXA 2D0HA 4LSSH 3RGVD 2IJ0C 4GUPA 5IGXL 5E8PB 3F7VA 1XMWA 3UPAA 2DL9A 5H37G 3V6OA 2FECL 1AQKH 3KPMA 3IS0X 1H3TA 5HHNA 2RB8A 3FN0H 7FABL 5BS0A 2BVYA 4GG8A 4F7EB 3LS5H 5HTSA 4MCZA 3L6FA 4XCCH 1TPXC 5D1ZB 3BZDA 2DI8A 2WWMC 1W2KT 4NKDA 4XNXL 1W0VA 2H1PL 4MAYA 1IGFL 2ZJSH 4P2CG 1G6RL 2OM5A 5JIHA 4KDVA 1OAQL 4JFQB 5FCUH 5HI5D 4JG1H 2HKHL 1GOGA 1GZQB 2BOCA 3MRHA 1QG3A 4JZJB 5LBSL 3IDJA 1LE9A 1PEWA 3P73B 1HEZB 2ZNXA 1U58B 1GHFH 3U30B 1UB6B 2OZ4H 4JY4B 3HR5A 3JV0A 1YY9C 3EZJB 3PWVB 3OXRB 4IS6A 5IHZB 2DICA 2H2SC 3EYUL 5DD0H 5HGBB 2QTEA 1EV2E 4WHTA 4M7LH 4OFPA 4PJFE 4KZEL 3WUWG 2SEBB 3IXAA 3BD5A 4PR5A 1A0QL 2CXGA 1HCFX 4JM2F 1BECA 3KPLB 3QDGB 1AP2B 3LIZH 3RL2A 4JM2A 1P1ZA 4RMVA 5FB8A 5D72L 2XT1B 3SKMA 1EHXA 1NCDH 3LHPH 4ZUVA 3C6LC 2GW5A 2H41A 1KELH 2XWBB 3DPBA 5GGTL 2K9UA 1IGYB 1II4E 5SV3A 3SKJL 4FABH 1ZT7B 2R0LL 3TO2A 1RJYB 4R96A 5A2KH 2H26A 1H5BB 4EIZC 1T80A 4MQ7B 5TQ2L 5I1JL 3LMJL 1HHIB 4LP5A 3R1GL 1JFQL 3INUH 4P4KC 5DURD 1I3VA 1E4XI 1NJ9B 2EH8H 3EBAA 4HS6A 4W81A 3VG0H 5FECB 3S5LA 4XC3H 5GS0H 5MENB 4X5XA 2FZ3A 3VG9C 3KPRD 3KYKL 5EBMA 3NACH 2FYYA 1FFPA 3HR6A 3IF1B 4L4JA 4UTAH 1ZHBA 5JO5B 1IGTB 1TVBA 3ARFA 3SKOA 4Z9KB 1X5IA 5IESH 5LXGL 3S6CA 4APQD 3GI8L 2NW3B 2JK5B 3TFKD 4V1DE 2VC2H 3RPIB 2Q1EA 3BHBB 4QT5A 1P4LB 1MHPL 3VFNA 3MRRB 4IHOA 2VLJE 2DM2A 5EC1B 5BRZA 4GSDH 3NH7H 4K7PL 2CDGB 2HRLA 1MFCL 4Q9RL 5B3JE 5D9SA 5B4MC 1RSFA 4OD1L 1RJZA 4KKCD 4JFHE 1HSBA 3OKMA 2A38A 4Z7VF 5FAAA 1DANU 4JDVB 2G75A 4XNUH 1JGLL 2A83A 3QNZA 4NN6B 1YEFL 3O2WH 5HHMB 3K4DA 3ZYZA 3AB0B 1U8PA 4NC1C 3ULUD 1DBJL 2E9WA 4Z7OE 4Z7VA 5MP6L 1IC1A 3HPJA 3OJDA 3MV7E 1IC4L 2BXYA 2C26A 2VXTH 1KN2L 4L4VE 4JFFB 2D7NA 4NNYA 4OBRA 4XPBL 3RVUC 1T1WA 3S34L 4Z7UB 2Z35B 4LSSL 5C08E 3QIUA 2ITDB 1NEZG 4K71C 1AQKL 2YZ1A 2JB5H 3RIAF 4HUVB 3FN0L 5C0FA 1NC4B 4EKXA 3ZT7A 1FN4B 3QUMB 3OKYA 2B5IB 3LS5L 5E6ZA 5AYQA 4XCCL 1WWAX 3SDXE 5LGJB 3IRZA 3DMMC 3GGWA 4OCYH 5F3HA 1FCGA 3OKEA 4HF5H 4F8TA 5T3ZH 4UQ3A 2Z31D 3BP5B 3FQWA 4U1KA 1E4KA 4TUOB 5DGQA 3LKOB 1F2QA 4JG1L 1YECH 3ZYOA 3GSRA 4BQBA 1MF2H 1XEDA 2D2OA 3D3VB 5HI3D 3BYTA 3MRGB 2HG5A 3MV01 4YHYC 1V7MH 1LEIA 4UILH 3ARGC 2P5WA 4NQEE 5I1LB 5I1IL 1KIQA 1GHFL 3HMWH 1FO0A 2X4RA 4QHKI 3QUXC 2QQQA 1BX2B 3DTXA 4WO4A 2ADGA 5DSCB 5DD0L 3JXAA 4M6AA 2QSVA 2B7DT 3IDUA 4M7LL 3CSGA 2H9GA 2IF7A 4CMMB 2UY7A 5JW3L 4RQQB 4N90E 5C0JB 1Y0LA 2ZUQC 4XMPH 3ZDXE 1MQKL 2ZUUA 5I15H 5GGSB 4IOFD 3SDAC 1CGXA 5SWZD 4NQVA 4P5TA 3ALXA 1B0RB 5HHPA 1NCBH 2X4QB 1UKTA 3GMRA 43C9B 2APXA 3QFDA 4JFYA 5CAYB 5GRJL 1HYRC 5TJWK 1NCDL 4H0HB 2EDFA 3LHPL 2AJUH 1KELL 2B4CH 3K2MC 1Y6KR 4FABL 1T1YB 5KSBB 4U6YB 5C0ND 1F90H 2MMXA 3INUL 4G6JH 3JVGC 3VG0L 2G9HA 2DTSA 3TP4A 4XC3L 3V6FA 1N64L 4NKIH 1IGCL 4JRYA 5GS0L 3O3AA 4ZYKB 5MHSD 3K4AA 3OAUH 3V6ZA 3NACL 1YMHA 4NT6A 1MFDH 4UTAL 5E4EC 2A6DA 4X8XA 5CJ5A 4Z5RB 1QSFB 1T21B 3WD5H 5J11B 5F71A 3UO1L 4ZOBA 5E99L 2VC2L 3TNNA 1MPAH 3LEVL 4QGYA 2XTJC 3V6BR 3BEWB 3NH7L 4LHUG 1KPRA 1BJ1H 1KCLA 3BP4B 4QXUH 4Y5YC 3MRMB 5C0AE 3RGVC 3WHE1 4XNUL 1NAKH 4MS8D 4OGAD 1IGJB 3TIEB 1BVLA 3O2WL 1G84A 3PQYA 1KLGA 1QLRB 3L9RA 3CU7A 5K59F 3PP3K 2R9HC 4BH7B 2OR7A 3G6JE 4Y5VA 5E8OB 2VXTL 3EDJA 2BX5A 1RK1B 4I0PD 1G6VK 3DIFB 1G7QB 3BZFA 5D7IB 4YAQB 1BFSA 1U8QA 3LKRB 3T4YA 2B4CC 1CD1A 4ZNEE 1T66D 2IAMD 2VAAB 5HI5C 3LAFA 5DRZA 1X4YA 2JB5L 4WW2F 2AERT 3RUGB 4HFUH 4PB0H 5I1AB 4BQ6A 4JVWA 4KI1A 5IHUL 1XGRA 4OCYL 1DVFA 5D2NB 4NHUB 2AQ3A 2Y36H 2AXHA 2NY3D 1HCVA 3G5VB 2MCPH 3KWWB 3ARVA 3TIDA 4HF5L 1NH6A 3ILPB 2Y7QA 1A9BA 3BVNB 2V2TA 3PDOA 2NY7H 1JRHI 1U3HB 2ESVE 3GIZH 4LIQH 5CLWA 5KSUB 1YECL 1A3RH 3MRIA 3QULB 3UTPE 1KEGL 3VXOA 3ZZ1A 1I7ZB 2BNUB 1V7ML 4CJ0A 4UILL 2F19H 3HZVB 5IHBA 5EO9B 3JTSB 4J3SA 1BFVH 1PDKA 4X4XA 1BFTA 3HMWL 4HUXB 4RIRB 2YWZA 1M71B 3GRWH 1K9TA 1BZ7A 1JMXA 2AXGA 3DX9B 5IW1A 1QFWM 4U31A 1J8HA 5L8JB 4CN1A 3DSFH 4XMPL 1I8LC 4WI5A 1VHPA 2IG2H 2FDBP 1ZT4B 4CBPA 5EZLB 4HX1A 2YRPA 5DJAB 3BPOB 5DDHA 4FQIH 1YEDA 4XRCA 2Q87A 5MEPB 2XQYK 5FV2A 1X6LA 3H0TA 3JV5A 1YN7A 2EDXA 3QXDA 4YHKH 5IBTH 1YNKH 2B4CL 5DZOA 2XQYG 5DJ0B 2BC4B 4RISH 1WBZB 4Z0XA 3M8OH 4APQC 3G5ZB 3O45A 3BRDA 2GJ6B 3D9AL 3TFKC 1U8KA 2WBJA 1F90L 1CZ8H 4G6JL 3ROLA 1S9XB 4PGJA 4OF3A 5IF0B 3QP3A 2XKSA 4NKIL 2RCSH 4YR6A 3OAUL 3O6FA 3O3BB 2GSIB 3A67H 1GRWA 4KKCC 1MFDL 4IOIA 4PJ9D 5EU7C 5T1LD 2OSLB 4YC2C 2X1XR 3WD5L 4OQTA 4OZIA 3UEZA 3DVFA 1X5YA 3ULUC 5I1DA 1MPAL 2YUXA 1CDCA 1X7QA 1IEBB 1ED3B 4QXUL 5EBLA 4ACPA 3MRNB 5B39B 3WBDA 1X5GA 3D69A 5DEFA 3VXPA 1XR9B 5IEKA 1NAKL 2GKIA 2AQ2A 3HE7B 2OS7A 5GGVH 4Q97A 12E8H 2ZP0T 3KDMB 5DJZB 5JA9A 2YEZB 3LQAC 4Y8AA 1MH5A 3SOBL 2FJHB 1C08A 4OZHA 3BPLC 4YHNA 3DO7A 1OB1A 4WVRA 3HUJB 3C09C 5KN5B 1BAFH 3LKSB 1IJ9A 4M8QA 1R5WA 2WP3O 2D7PA 1IM9B 1MAJA 4PB9H 3VE0B 1KPUA 1DQDH 1BLNB 3Q2CA 2XY2A 4RAUB 3VWKD 9CGTA 3QR2A 3KLSA 3T0BA 3WUZA 2HP4A 5IOPA 4K3DL 2CK0H 3W5MA 4HFUL 4PB0L 5HI3C 1DFBH 1UZ6F 3WEXA 2HJKA 3W5NA 2XNAA 4KXZH 4PRPA 3P9LA 4WDIB 3HZMB 2Y36L 2GYSA 3MRCB 3LZFH 4UOW0 4ZAKA 3B8SA 4UT7H 1FNEA 4WNQA 1WIOA 2NY7L 3U0WH 1IQDB 3GIZL 3MLUH 1X4ZA 2HJFA 3REVB 5E0QA 1LP9B 3G08B 3UBXG 4PIRF 3S35L 1A3RL 1T7VA 4W4OA 4NQTA 1HH9B 5IMMA 2I26N 3VGAB 4J1UA 4K55A 2F19L 2XZQH 3C5JA 3OKOA 4FFWD 1BFVL 4WGVB 4IOFC 3ULUL 4NQXA 3QUZD 5BMFH 3DECA 5FA4A 3GRWL 3RNQB 5KSBF 1EXUA 5HGGS 3SDCD 5KS9B 5C09D 1MFNA 2ZOLA 4NC2B 2IALB 2NY2B 4Y4KA 1A7BA 4JHWH 2FR4B 5LGKA 2HWZL 3OR7B 4CKVX 2FGWH 2EC9T 2HKFH 4FRWA 1FC1A 3DSFL 3NAAH 5BW7A 2NR6D 2J88H 2IG2L 5E2WL 2ZSWB 2RAMA 2VZSA 1QKZL 4FQCH 4YDVB 2IANE 3OR6B 5C0NC 1U8MA 4FQIL 3VXRB 1YZZA 4UI2A 1FZKB 3QJHA 1YA5A 2GUOB 4OD3H 3L3KA 4FOMA 3BDYH 3NIDE 3O0RH 3QXAB 4YHKL 5F1SA 5IBTL 1YNKL 3AY4C 3IT8D 4A6YH 4NIKB 2XOTA 1JMZA 4RISL 1TQCB 1E27A 5SWSD 3M8OL 5DRXB 5CWSB 3EO1B 1CZ8L 1NBQA 4L3AA 5F9WC 2A0LC 1TCRB 1F42A 1NC2A 4ONHB 4NNPL 4XBPA 4J7RA 5F93C 1WC7B 3A67L 3U2SB 3HMXL 1ZHKB 1DP0A 2ICWI 4EN3D 1WLHA 3HG1B 3ARBD 3QHTC 4MS8C 4OGAC 2C1PA 4GBXD 5HY9B 1ZVSB 3Q5YA 3VRJB 1KC5L 4EDXB 2P7TB 2JLLA 4DAGH 3GSWA 2CUHA 5C0CE 3QIWB 3P11H 1NKRA 1ADQH 1CT8B 4I0PC 1LQSR 2YD8A 3RU8H 1VFOA 4K94H 4U7MA 2OTWB 1H8SA 4TSAH 4D0CB 5GGVL 2BMKA 12E8L 4UDUB 1T66C 4M48H 2IAMC 4F3FA 1S7WA 2WIMA 4ZFFB 4BA8A 3O41A 1XF3B 3OPZH 1KTRL 2MKWA 2CJUL 2R4RH 1IBGH 4U33A 1R24A 3RDTB 2ZUVA 4WTZA 3MCLL 5C92A 4E41A 4YE4H 2NY3C 4C56D 2GEEA 4PB9L 1JTTA 4MXVF 1FSKB 1L4IA 3R8BB 1JHLH 4G8EA 1OP9A 2YD1A 1HILB 1W72A 4CU6A 1SEBA 2XTJE 4NUGL 4KHXH 4ONGH 2IH1B 3B3IB 3CDFA 1P2CB 2XTLA 3FB5A 5IW6B 4JANA 4OCRH 5CKGA 4R7NA 2ICEB 3VH8G 1U8HA 4LLDB 3LZFL 5JIIA 5JOEA 1A1NB 2EE2A 4UT7L 4JZOB 4L8SC 3U0WL 4PJDF 3BEVB 2NY4C 1JYNA 3MLUL 1SEQH 3HKFA 5DUML 4KTEH 4QRUB 3UJJH 1N5AA 4L8DB 5E9DB 3GK8H 4LCWD 1TITA 3L3HA 3E6FA 3MLVH 4F57L 4P2OD 4PJDA 5DMKB 5F3BA 4GRWH 3S7GA 5JOFA 4PJIB 4DFIA 3SN6N 1NGWA 3I6GA 2XZQL 3UTTD 3MV11 2I27N 2JJTC 3RKDD 4H5SB 5BMFL 3MJ7B 4WW1A 5T5FL 3RWGA 4Y1AD 2HYMA 2YBRA 1PLGH 2G2RB 2Y5TB 4JHWL 6FABL 5I17B 3MRFB 2HKFL 4PD4J 4QYOA 5EC2A 1G7MB 5CKAA 1CU4H 2J88L 4FXKA 4G8FA 4QHLB 3U6RB 1CBVH 2I5YH 1YMMB 4R8WL 3KPSA 4F7PA 1A2YB 4FQCL 3FO1A 1NBYB 2R1XB 5I8KL 5I6XC 4ORGA 4LU5H 2Q8BH 1MUJB 4K2UH 4QHMA 4H1LG 2WV3A 4P5MB 4JKMA 1D9KA 1F4HA 3FRPA 4OD3L 3ARRA 1MI5A 4R4BA 5D1XB 3EFFA 2LAAA 3CSBA 4CADB 2ITCB 1FYTB 1B0GB 1T3FA 4OUUA 1ORQA 4PJ9C 3V52H 3ZTJH 4A6YL 5J0BA 4M9PA 4OFDA 4RX4D 1ZT1B 1UVQB 1FG2B 4Z7QE 1M1SA 1HQRA 4U1SB 2FIKB 4NQUA 4POUB 4KJQC 2APFA 3MV8E 1J0KA 4JO1H 3EYSH 3TBWB 1U95B 1LILA 1H15B 2YHGA 2PYEB 2L7UA 3R06A 4OCWH 2B20A 4EI5D 1SBSH 1V7NH 4PRDB 3HC3L 3UAJD 4FNLL 2VR9A 3WDJA 3EOTH 4H26B 4DAGL 3NIGF 1RZFH 1N8ZB 2BVPB 5ESQB 5B39G 3P11L 1G9EA 2J8UE 3C9NB 1TZIB 4DEPC 4FQ2H 2NNAB 3F12B 3RU8L 1PVHA 4K94L 5C0EB 2C3HA 1YNLL 4UU9A 3LDBC 3UTSB 5IVXA 5ICZA 1AD0A 2ED9A 4GW4A 5JXED 3ULVH 3VWJA 4HIHA 3VWKC 3VD7A 4M48L 5ISZD 1NMCB 1UC6A 2KZWA 5L88H 2X4UB 2MHAB 2VLRA 4LVOB 3OPZL 1LD9A 1KV3A 2R4RL 1IBGL 5D1QD 1IVLA 1TETH 3O8XA 5JW4R 3CMOH 3UPRA 5DHVA 5EU7E 5HPOA 4YE4L 2CKNA 1G7PA 2VQ1A 4Q9QH 4JPIA 3E8UH 3KPPA 2OLDA 3ULUE 3TCXA 4EQ3A 1J5OH 1VA9A 4MNHB 1B90A 1S7UB 5T1KA 3T1FB 4L9DA 3BO8B 4KHXL 4ONGL 1F00I 1KF9B 1FL6B 2ZCHH 2OL3A 2OJEA 5DJCA 4OCRL 3VI4F 1KGCD 1JZ8A 4JHAH 4FFWC 4H0IA 5GIRA 2JB6A 2YC1B 2EDTA 5GISL 3PWPD 2V7NA 3VXQA 3VRIB 4PRHA 1D5ZA 1D5MB 2V7HB 4NPYB 3DGCR 4PBWD 3SDCC 4L1HA 1SEQL 2LU4A 4KTEL 5LG1A 2FNBA 3MSPA 4ZS7L 1NFIB 4J12A 4AK1A 4L29B 4NCC1 3MLVL 1X5JA 2W0KA 2WP3T 2YRZA 3W9DB 3UMTA 1TJGH 2NR6C 3PIQB 4O2CA 1RZGB 1CFVH 1A6TB 1WCQA 1JNHA 5F1OB 4RGOL 3F6IA 1FFOA 1KCUH 1LK2B 3DX8A 2D7TH 4LCYA 5BZWB 5F7LB 1F4XH 1S7QB 3DX7A 4ZG1A 3VFOA 1PLGL 4CUCA 2BRRH 3TBVB 1QR1A 1D6EA 1I1YA 1HXMA 4HIEB 3ARDB 1R5IB 4X7CC 3B5GA 1MFBH 4G8GD 1CU4L 5D70H 3P0YH 5EIQA 2I5YL 4UV7H 3P4NB 4OIAA 3FQTB 4JVUA 4PJBF 4IMLB 2A6JA 2I9TB 1OGAB 5HVHB 4LU5L 2Q8BL 1T7WA 3KPNA 4K2UL 1MCHA 3W2DH 2KQNA 3S98A 4WI8A 1JWUB 1DTUA 3FT3B 3QFJA 4OM0H 1QRNB 1UJ3A 5FUOH 3RVTD 1ZLWH 3OG6B 4OGXH 4X6DF 2DLFH 3RA7H 4KTYA 4W6WB 3ARBC 1GGTA 2WLYA 1J18A 4NGHH 4Q2ZB 1I85A 5SWZE 3B2UD 4I9WD 1GOHA 2H6PB 4GBXC 5L8KB 5DK3A 2EIZB 1IAKA 2I9LA 5JPMA 4X6DA 3MROA 1JPFB 2H2PD 3BSZH 4NO0B 1FFNA 2DWEB 4GMSH 3JWDH 2FJGA 4JO1L 4ONOA 4JO3H 1DQLH 4H25B 4Y4FA 3WFEH 3MNVB 3F5WA 4R0LA 1AGEA 2AK1L 3BP6A 3BJ91 5AZEH 4ZFOA 5MEQB 3F65A 4PG2C 4PJ5B 2ZUWA 4MJ5B 4OCWL 2LE9A 4X5LA 3RPKA 1SBSL 3G6AA 1S7XB 4GRLB 1V7NL 4GAJH 4UIKH 5JW5A 1OWWA 3RZCA 4JCMA 4ORZC 2F53D 4YZFF 3W0WA 1NDGB 4P2RA 1A4KA 1AR2A 5MHSE 4LOUD 1I8KB 1RAMA 1U0QA 3P30L 1OP5H 25C8H 5C0IB 3U46A 1BWWA 1KNOB 2EC8A 2NMSA 5EIIA 5H35A 3WIFB 1HI6B 5CSZB 3FQNA 4YPGA 1BP3B 4PGEA 3AS1A 4YK4B 4PV9B 1UWXH 1HHGA 1SMOA 2BVUA 4OI7A 3O6MH 1WTGT 4XI5D 5ID1A 5C07A 4B5EA 3H9ZA 1UYWH 3CMOL 4AT6A 4UIMA 3HLAA 4ODXB 4D9QD 5GRXG 5IMKA 4Q9QL 1TNNA 3QCUH 4OLWH 2AK4B 1G7LB 3L1OH 4GG6E 1J5OL 4KKBD 3PWJB 4L8BA 4RWYL 3RP1A 2EYTA 2Z91A 3B8YA 1K5NB 5HD8D 4P2OC 5FO7B 5JNYA 1JPTL 2ZCHL 4S1QL 5DVNA 1AKJD 4DUWA 2N7BA 3JWDC 4OLVL 4JHAL 1EIBA 3HHRB 3RKDC 1I4FB 2UYLB 5I2IA 1JPGB 4FTVD 1FZMA 3QDMA 4UOJA 4GQ9H 4N0CD 1I1AD 3FB7A 3T77B 4P4KB 5HDLA 1JN6B 3QO1A 3MLYH 3QNXA 4DW2H 1RIVH 4HS3B 5E1AB 2ZKHL 4CMHB 5MEOA 1TJGL 1UXWB 2AV1B 3DGGB 2DQHH 2JJVA 5D6DA 5JQ6H 4NNXA 1KCUL 1RJLA 3TLRA 1B9ZA 1G7HA 4FQXD 4LLUA 2D7TL 1WFTA 1F4XL 2BRRL 3PHQA 3QUKA 1I8MA 1M7DB 3EZ8A 4C55A 1I3GH 1IEHA 1IAIM 5I1HL 1AO7B 5HYJB 5EU6B 1MFBL 5E7BA 5AUMA 4BKLA 3MNZA 5D70L 4UV7L 4L9LC 4RZCA 1QVOA 1S8DA 5CLTA 4S1RH 1HQ4B 4NUJB 2YPLA 4P5KA 4F15C 3U0PB 1IKFH 4HGKC 4M03A 3W2DL 3P0VH 2E8ZA 5DRNA 4OM0L 2NXZD 5FUOL 3DXAD 4OGXL 4LLAA 3N50A 3D39B 3DVGA 2DLFL 3RA7L 4WTXA 1W0WA 1AD9A 4X0KA 4NGHL 5CGTA 3MCG1 4EI5C 4BSVA 4NSKA 2G5BA 3VXTB 3OAZH 4JJHA 3VI3E 3A6OA 4AH2B 2Q3ZA 5HHXL 3BSZL 3WUWA 3UAJC 2BFVH 3STBA 2LQRA 4GMSL 5A2IH 3ZE0E 3JWDL 5L2JB 1HHKA 4JO3L 4DVRL 1DQLL 1P6AB 5HYQA 3G5XB 4LFHG 3GBNH 4N8CH 3WFEL 3AREA 3QXWA 4U6TA 4QRTA 1HN1A 1OTTC 4M43H 5AZEL 2HMID 5EUKA 2K7PA 3RVVD 3MV9D 3MGOA 4WHYG 5JXEC 2BVOA 1CFTB 4UIKL 5IB1A 4YH6A 5TDNA 5DJ8B 2P8LA 1J0YA 3TV3H 3ES6B 4IIQC 4UDTB 1XGPB 2ENSA 3HNTL 5D1QC 4HG4K 25C8L 3MGTA 4RBPH 1CDGA 1GC1C 3BGMB 5DHYB 4YHYB 1S7RB 5GS1B 3V2AR 1J05B 5HI4D 2GITB 1D5IH 1CFNB 1OM3L 5DMJB 2GJZA 5EBWB 3TZVB 4L3EB 5D7LA 2AEIT 4KVCH 4MSWA 1VFMA 1XGUA 3QUXB 4HMDA 2X4NB 5IJKA 2GHWB 5ESAA 3O6ML 5HPMA 5INDB 2J6EH 3H9YA 4KPHL 2PCPB 3EAKA 4I2XB 5E1HB 4QHUA 3VFRA 1UYWL 4G9FB 5CZXD 5DS8A 1RPQA 2V2XA 3I50H 2DQFB 4LVEA 3IXTB 1Z9OA 3QCUL 4KC3B 1A14L 4OLWL 3SDAB 3U9UB 1EEUA 3L1OL 1RUQH 3OJ2C 3TGXA 2WIIB 4LEXL 5EUOF 4P57B 3IFNH 3CUPB 1T22A 5BS0D 4ZUTA 4JFDB 2D9CA 4FQJH 4K3HA 3B9EA 5JW4Q 1KJ2B 4ZTOH 3D0VB 1CXFA 1DUZA 4PRNA 4Y19A 4GJTB 4KKAD 1HK6A 5K9OB 1H0DB 2YD7A 2WBKA 1S7TB 1T2QH 3C5SA 4GQ9L 1DN0A 3SE3A 3SCMA 4NQCB 3MX0A 4DW2L 1RIVL 5DT1L 3TN0A 3QDJE 3D25A 1CCZA 5J06A 1NEZA 2F74A 3WXVH 3IDGA 2XWJB 1WAAF 4PJCF 4WUUA 4PPTA 5JUEH 1E4JA 2DQHL 5E4EB 1EH9A 4AMKH 2XPGB 4HUKB 4F2MB 3HI1A 4TNWF 3WKNA 4S2SB 1WAAA 4PJCA 4PJEB 3L95A 5IV2B 4YHMH 1GC1L 4U1MA 3S3SA 5I8CA 2J4WH 2AJSH 1XIWA 3AROA 2XI9A 3EKCA 4E5XB 1I3GL 5FF6A 5L2KB 1LMKA 4XPHL 3V5KB 2VOTA 2YK1H 2HLFD 3K4ZA 2PXYD 3NZ8A 3SGDH 4J3WA 1K4DB 3B2UC 1MHHB 5E00B 4S1RL 2WAHA 3RWCA 4U2YA 5IB2A 5DVMA 4Y16D 4X6EA 4OZIE 2BSRB 3FB6B 1IKFL 2ICES 2AVGA 4ONFH 2BERA 5HHOD 5F7NC 3VFTB 5ETUA 2LABA 5IVOA 2XWTA 3FONA 4DOHB 3FQUA 3KJ4C 1H8NA 1C7SA 4PV8B 4DKAA 1IAOA 4RFOH 3V4PL 4PTUB 1RZIB 1SVZA 2DLGA 1NGXA 2BFVL 4EJ1C 4LLMB 4KQ4H 4LOUC 5IM7B 3MLZH 5C8JB 2DQDH 1CGUA 3H9SA 4QKXB 3H7BA 5SWQA 4HXAH 3PGCB 3CSYA 4NYLB 1CLOH 4U6XB 5SWSE 2BNQD 3UJTH 3VXUD 5EU5B 1NLBL 3G5YB 5FA3A 1TMCB 1Q9WB 3TV3L 1AXSA 3GSNH 4XI5C 1I8IA 4AG4H 1PAMA 5HDQH 3V0VA 2IC2A 2FEEI 4XP1L 5ANMA 1KEMH 2WBWB 3WSQH 2RFXB 3ARWA 1JK8B 1U8OA 5LAXB 4P2YA 3UTQA 1D5IL 4H88H 1LNUB 4S11A 3P77B 3C6SA 3IJYA 1JZ7A 4GH7B 4KVCL 4KKBC