3KCWA

Crystal structure of ganoderma fungal immunomodulatory protein, gmi
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
110
structure length
110
Chain Sequence
SDTALIFTLAWNVKQLAFDYTPNWGRGRPSSFIDTVTFPTVLTDKAYTYRVVVSGKDLGVRPSYAVESDGSQKINFLEYNSGYGIADTNTIQVYVIDPDTGNNFIVAQWN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Single cysteine replacement at Leu6 increase the potent and thermostability in Ganoderma fungal immunomodulatory proteins
rcsb
source organism Ganoderma microsporum
molecule tags Immune system
molecule keywords immunomodulatory protein
total genus 27
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2009-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09259 Fve Fungal immunomodulatory protein Fve
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3kcwA00
3KCWA 3F3HA 1OSYA
chains in the Genus database with same CATH superfamily
4E41E 3FQXA 5KYXB 1LEGB 2Z7YA 5AAMA 2QVIA 2Q7YB 4DVRH 1EFXA 1ZV2A 4GEIA 2F8IA 1CD8A 5BJTA 4TPRL 4KITB 4FFZH 5LQBH 2DQHH 2ZUSA 4WHYH 1J48A 5D2NC 4Z3JA 1J18A 3TOPA 2PMZA 1I31A 1H3PH 1BIHA 5LN8A 2RGSA 3VMOA 4U1KB 1U8PA 3CLWA 3ECUA 1MRDH 5F8RC 4JFXB 1K8DA 5LNDA 4KX8A 4NZFA 1OF2B 4N0YL 4RIRA 3OHMB 3DIDA 4PBWD 4HCRH 2BNUA 2OMTA 3BAJA 3F00A 4WENB 4DCQB 4WI4A 4PIRF 5DEJA 3DI3B 4F2MB 3RPIB 1USQA 1FL6B 2H3NB 5JW3L 3CTTA 1U8OB 2Z4TA 3IMSA 2V4LA 4FI7A 4JO1L 5JHAA 1F2QA 1HHGA 2BP0B 1NDMB 4NO5A 3D33A 2G3XA 2FJSA 5DS8A 1HYSD 3I85A 1JWUB 3PWUB 1JD7A 3MREB 4ZPVA 5I16A 1S9WB 3PQYA 4G70B 2AGJL 3BEWA 1NKGA 3WNJA 5DI8A 2FD6L 4LCWB 2K4AA 3UCRA 1YY9C 1T4WA 3EJJX 4L9DA 5E8NB 1R47A 3WNMA 3ULUE 3GHEL 4K71B 2I27N 4L37A 4QXTB 5I1KH 1SMAA 1WEJH 4H0IA 1A9VA 3AXLA 4DTGL 1DSFL 1M53A 4V1DD 3THML 1XGRA 4ECNA 1NFDB 3EO1A 4F7MB 2ZWSA 4WU5A 1Q9KB 2GBUA 3BVDB 2BSED 3AM8A 4YE0A 4DO6A 1G1CA 2VZTA 2WN2A 2UZIH 1WFIA 4OLWL 5CKGA 3QHZH 4LSVH 3BMVA 4HEPG 2HFGL 4G71B 1HNFA 4LPXA 1V7ML 1FO0H 2ZKYA 4Z7OE 3RB5A 3TV3L 4QF1A 4HJTA 4I85A 2ZCKL 4C58B 1PG7L 3MJ6A 1GZQB 2WYTA 2NY5C 3ES6B 1MIML 5EF3A 5I6LA 1MCWM 2E7DA 4MCYB 3BUDA 2OXGB 3SB3A 3QIUA 1NM4A 2XPGB 2Z0UA 3UADA 5ICXA 4S0TD 3SO3C 2QLVB 3QHTC 2XFXB 3UG3A 3L5WA 1KIQA 3KCPA 3QPQC 1UD5A 1P4LB 1A7RL 4IRJC 3OLDA 5E8NA 3KGTA 2E7HA 3QA3A 4NRYB 1J8HA 3TVMA 4ADIA 1FN4B 1R3KB 5EOQH 1MI5E 2D0FA 3CUPA 3HLAB 1L9PA 3IXTA 1T2QL 2FH8A 1W6LA 5E2TH 4J3OD 4TVUA 1J0JA 4DZBA 2WJ7A 1I4FB 1S7UB 4XB8A 3WTYA 3HTLX 1TJMA 2PP9A 1D5XA 1RJYA 1ZEAH 2CLZB 5F0PB 4RMRA 4EDWL 5J0BA 2WKOA 3BIKA 5FO9A 4K8RD 2F54E 4PV8B 1QHPA 3NIDB 4FTVB 5D71H 3AACA 1CGXA 1XTLA 3I02B 4JFED 4F20A 5FO9B 1M3JA 4LLDB 1JZ8A 2FWLB 2WIIB 2WAHA 3BX7C 3H53A 4Z7VF 3A0OA 5HY9A 1AS6A 1ZLSH 2EP6A 3VI3B 3Q8BA 2XN9A 2OMYA 4BFIA 3O41B 2IAMA 3MJ8B 3TZVA 5T3ZE 1IAMA 4NM4H 3HPLB 1KJMB 1IQWL 1HE7A 2QBWA 1E27B 5K39A 5HHXH 1T6BX 1XEUA 4Q9RL 2OX5B 4EZKA 4PGDB 25C8L 4BKTC 4I4WA 1IGYB 1S2EA 3OL2A 1KCSH 3ASNB 3OC8A 5DYFA 2P49B 1KIRB 4KVCL 3VD0A 4IIQC 1O6SA 5C08E 3MNWB 1PJ9A 3GHEH 4KWUA 3WUWA 4HIIA 2CM5A 2VAJA 3QJXA 4JVWA 4Z7NB 2Q0ZX 2VLJD 2WO2B 2YD9A 4ZAKC 3UBXI 2I60L 3G5XA 5FECB 5IVNA 4WFEE 1FA4A 3M1CA 2X4NB 5B8CC 2C1PA 1F4HA 2APSA 2Z91B 4KO5A 3TBWA 1FNEB 3ARED 4N2KA 4N0RA 2GT9B 4RGND 2WXFA 3UTSD 4TL4A 1MCOL 5AYQA 3G5VA 1JTOA 1KTDB 2AJZB 1NCJA 2BSTA 2DQGL 1MVYA 3D7PA 3LB6D 3MO1B 3QUZB 1OP5K 5B1JA 1CYXA 2DWDA 2QPFA 2XXGA 1P0SE 4KDTA 4KI5E 2FO4B 3F7PC 3H6AA 5HHQB 2CK0L 1IEHA 4PJBF 1YEDA 1IQDA 4B9JA 1VFAA 4K94H 4XMZA 1I8LC 5BMFH 1CT8A 9CGTA 2OL3B 4L3EE 3ZE1B 1QLRB 1SEQH 2F53D 2BIOA 2PO6B 1AP2B 3B3IA 4GW5A 2BNQE 3CFJA 1ZLVH 2A7BA 3GQFA 1SLXA 1ROCA 4LLWA 4OZIA 5IB1A 4HJJL 2VM9A 1G7JB 4OLXL 1MELA 2J12B 4BUGA 1AGBA 3H85A 3QJVB 4LSUH 2WCPA 4D9LH 5FHBH 3MRMA 5K9QI 3LZRA 3MLYH 3CLEL 3GHBH 4W6WB 3LRLA 3ILPA 4GIPD 4NN6B 4QAMB 4M1GH 2CDEA 2OMBA 4BSJA 1O9ZA 2DWTA 1U8CA 3BN9C 4Q2ZB 4FADA 2DWXA 3ARVA 3I6LD 3LHPH 1JIBA 1B9ZA 2F8OA 1NFIB 2KS0A 1RZQA 1SJHA 4LOEA 4RSVA 4YHMH 3QW9A 1NGYA 1IAII 2VDKL 3D3VD 35C8L 1EEYB 1UOLA 5DWPA 1TU2A 3MXWH 4XP9L 1JFQL 3BVXA 3VAEA 5BRZA 4GW4B 1KNOB 2W0PA 5ABZA 3S3SA 5AVRB 4WK0B 1XF4A 3ILQC 3TCTA 4KTDL 1LDSA 3L5HA 2OCFD 4KBPA 1JMXA 1MREL 1Z66A 1T2QH 2APTA 5F9WC 4J39A 4M03A 3TPKA 4MS8D 4AG4H 3X2QB 1MOEA 1P5VA 3RB7A 2NY5H 3HZVA 2X6VA 1XQ4A 5A6MA 3QISA 1L0YA 5CEXB 2N1KA 4HXAL 5CZXC 5C08D 1DJGA 5BV7H 2WXIA 3QEGL 5I1LB 4AMWA 2NTSP 1KBWA 3L2MA 4XBPB 5DZNA 1HIML 3GKZA 2ZCLL 1KBVA 1TYEB 3ZTEA 4NRZB 3FT3B 3VUAA 3QUYD 4IRJA 4FFZL 4DERA 5HGAB 1PDKA 1FFOB 1ZLSL 3I6KA 4NKOA 3VQLA 2NY0C 3VRIB 2Z7UA 4MJID 2ZYRA 1T5XA 2ISDA 1QLEB 4Z9KB 2P28B 2P5WD 4YHKL 2Z35B 3QDGB 5IVOA 2IFGA 5FYKE 4Q9QL 1LE9A 4TUKL 1SM3H 1M9WA 2J72A 3CSTA 2QSCL 4XC3L 4M1CC 1U33A 4HK3N 3MCLH 2A73B 5I8EA 1OALA 1TQBC 2E9GA 3TN0A 1BFVL 5IROA 3MLRL 2G3NA 5K9JH 3GDCA 2W9LA 3BAKA 1D9KB 2J8UA 2VLRD 1TVHA 4ODTH 5AVZB 4JFFA 3KHQA 1FYTD 2EKJA 2HLAB 2DYPA 3FB5A 4D8PA 2NW2A 4JB9L 1WUZA 2YA0A 3ATEA 3P4MB 3D5OF 3KL3A 4KOBA 1KELL 4L4VE 5DVPA 1FFTB 3L13A 5KBDA 4LP8A 2O93L 2HFEA 1D5IL 3NRPA 1H8SA 1BECA 1Q9OA 3BLPX 1C08B 1AGDB 2X4SA 5IUSA 4Y4HC 1G9MC 1S7RA 4I88A 4L9LB 3LIZA 3OAWA 4HC1H 1R46A 5HTSA 4KZCA 2VJ0A 2Q6WA 1LXMA 2J8HA 1GSKA 3UIYA 1OWWA 3JSSA 3VI4E 1CXFA 3QJHB 4I1NB 4LVNB 1KLGB 4Y1AD 2YQ2A 1Z0NA 2VQTA 1QFWI 4P9MH 1HU8A 2CHZA 1BQKA 3UG4A 3FU7A 3V0WL 2QLYA 4LHQB 1BZ7B 1XGPB 5I5IA 4LU5H 3MJ9L 2XPGA 4PJ8A 3PGCB 1P53A 5LVEA 4GB9A 3WIHH 2WWKO 3QI9D 3CFCL 4JCWA 2NQDA 2WTRA 1OGSA 3ROLA 1CLVA 1JI1A 4K07A 4PV8A 2KZWA 1PCSA 1XXFC 2ZX8A 5MENE 1I8MB 5GGQH 3AU1B 1INEL 3IFPA 4FOMA 4AKQA 1TSRA 2ZKWA 2PTTA 2N3JA 2AK4D 5SWSE 3LS4H 1N67A 1J9QA 4F91B 5LWYL 1UXSB 1M1XB 4PLJC 3VH8G 4BK5C 3PQYD 2IDTA 3CN4A 3EH1A 3SPCA 3CZJA 3P77B 3HI6H 1VEOA 2Q8BH 4JHWH 4DGYH 2R59A 3WJLA 2CXGA 1JNHB 4XPFH 4AMKH 1FC2D 1DQDH 5KYWB 1OHZA 2X2HA 1KIPB 3MRKB 1S7WB 3V4PL 3KJ4C 3KPOA 4HWBL 3FRPB 3MDJA 2TAAA 3IJHB 4FFTA 2W8CA 1P1ZB 3DROB 5K9JL 1FFQA 1ZGLB 3ROLB 2FSEA 3NMEA 3SCMA 2GT9A 3CFMA 3SE8L 1NOLA 4OLZL 1CFVH 1DTUA 1FPTL 4HUCA 4WTZA 1WD9A 3QP3A 5LNEA 3MBWB 3DARA 5CBEB 3VXTA 4AIZA 4G82A 4GQ9H 5FA3B 4MJJA 1XCXA 5CBEA 4QRRB 4YC2C 1A6AB 5IV2A 3C2SA 1PAMA 3UGXA 4GW4A 5I2IB 4P2QE 4DP5X 4U1SA 1M2VB 1HXMA 5I17B 3AAZA 1TZHB 2FK9A 2YRBA 1MI5B 3EF7A 3IF1B 1Q1PA 4PRAB 3L95A 4YDJB 4CILA 4LRIA 4PLOB 5I0DA 3N04A 4JDEA 5KYYB 4HD5A 3HZMB 2OYMA 4FZEH 1WUNT 3HC4L 3RUGF 4M48L 2QADB 1FH5L 4UTCA 5ANMB 1NAKH 1P9MC 2FCBA 4FQXA 1XGQA 2IGLA 3V0FA 2E46A 2FO8A 5GGSY 1DBAH 3VI3F 1SN5A 1F6AB 4TXVB 3LQAH 4PD4K 3REWA 4FDWA 5D2LE 4E68A 1D5IH 4XMLH 4XNXL 3TJEH 3IPFA 3IJYB 5GGRB 1Q9LB 2QQNL 2OMNA 4L1SA 3OBAA 2PWEA 2XN9E 1A6ZB 4JGMA 4XVUC 2CK2A 4Y1AA 4OT1L 4P48A 3KYMA 4F57L 4URKA 4TYUA 3FNKA 4IBWA 5E03A 1KNOA 4FXGA 5F44A 3RWGB 3BWAA 3MBXL 4QWWD 3F62A 1WA1X 1KPRA 2VQ1B 1F6LL 1RVFH 4JANA 3DURB 1UD8A 5L6YL 3RGVB 1ZE3H 3OJ2C 1UH3A 3NCCB 3OWRA 3RL1B 3S36X 1OO2A 2VDOL 1NEUA 3RDTD 4N25A 2ZICA 3O0LA 3L48A 4FABL 4YXLH 3GM0A 4KHXH 5CEXA 3GMNB 3V7AE 3NIGB 1XF1A 3T5WA 1U8QA 5B22A 4ZFOL 1KDJA 4J8RB 1QSZA 4R97B 3B4NA 2ED9A 2DWEB 2ZCHH 4H0GA 1NC4A 2DQMA 4ETQA 2DLFH 1O7DE 5M95B 2HUEA 1NSNL 2K70A 3JV4A 3OAUH 2Q86A 1BQLH 1PG7X 2WGXA 2VQUA 2PO6C 1BF2A 3QXTA 1A66A 1FC1A 2L7QA 5AVXB 5GISL 1KB9J 1QSED 3HR6A 5C3TA 1T2XA 2A4CA 2ZQKA 4B5ZA 1IM9D 1JBJA 4HSQA 2E6JA 1MRDL 5TE6H 1YC8A 3U2SA 1KYOJ 4AWJC 5C97A 4GXFA 2A74B 2EDKA 2Q2EB 4IBTA 3O8XA 3ECVA 1X4ZA 2YLHA 4X6EB 1D9KA 5DEGB 5DS8B 4X6DE 2EUVA 4NQEB 4PYGA 4WWKA 4PCSA 4YHOL 5D5MF 5I8KL 3WTXA 5DZLA 2Z93A 1UM6L 5HJDA 3BWZA 2BCKA 4W9KC 4MD5B 4AQ8A 5JQ6L 2X44D 2ITCA 1ET5A 4H25B 1HHHB 3DX1A 4RMVA 3X13A 5E8EB 3MLVH 5BZWA 3S36L 4YVUA 1FVEA 1L7IL 4HIIB 1U21A 2DF3A 3MTXA 5FFGA 3WJLC 2NXYC 1R3IH 2P48B 2ZWLT 2H2SD 1S9VA 4XX5A 3ZHNA 5I6NA 5FECA 1CYWA 3R06B 2PTTB 1PCXA 4G9DA 4JRXE 3GEWB 4UI2A 5EOCL 4N90D 1RMFL 2CLRB 4JFDE 1QATA 2AV1B 5JPMA 5GRYA 4XC1H 1CD0A 1N8ZB 1OV8A 1E4XH 3VH8A 1IMHC 4F57H 5EO0A 3FUMA 1KGCE 2X28A 3GWJA 3L08A 1QSVA 5IVXF 2IOMA 1ADWA 4ALAL 5KVMC 2UYLB 1OE3A 4ZX4A 4KRNA 4QHKJ 1LL1A 2FHBA 2Z3FA 3D85A 1KCRL 5DVOA 2VXQH 5DQ9B 3VI3A 1Q72H 5PAZA 4ODVL 3L5JA 4I2XA 3FXIC 3NJMA 4P04A 3VG0L 1RZFL 3MNWA 2XOTA 5L0QC 1HCVA 3UBXB 1AGBB 4ODHH 4U4IA 4I4WB 5BO0D 1F1DA 5KBLA 2WXOA 1FAIH 1WWWX 4WAFA 4KKZA 2XA8L 1SY6H 3WS6A 5BOPA 4A1RA 2PCPB 1U92A 1JWSA 1RZJC 1GHFH 4YBLC 2NYYD 5I0ZA 4M7JH 4PUBH 5IKCB 3VXOA 1RAMA 5DC2A 2CKBH 4Z3GA 3MV11 5JORA 1A4KA 5BZXA 3WAJA 2DEXX 1EEUA 3KWXA 1RU9L 3QXVA 2DEWX 2Y5EA 5GGVH 5D1XB 3TA3B 4H4NA 5F7UA 3CIQA 4DGWC 2B1HH 1N0XL 3STLA 2I32A 3AY4C 4M62L 1SXCA 1CZ8L 4QHMB 4JNXA 3D85B 4LPYA 3W81A 2X9ZA 1G7MB 1GC1L 2BINA 4FXKB 1ROWA 2K0RA 2FSEB 5C0JA 1XGZA 1K5WA 2XWXA 2W9DH 4WW2B 2JWYA 2OM5A 3CFIC 5C09B 4GQPH 4K94L 1XX9C 3WY4A 5GGUB 4F9LA 5DUPL 5D93B 3RVXC 1IT9L 4I18A 1UD6A 4JHWL 2AQSA 3BH9A 3KH3A 1VGKA 3ZE1F 1JPSL 3WGVB 3TWYA 4NPJA 4LVHC 2ZX6A 5EU6B 3UAJD 5TGBB 1JWSB 5E5LA 3TBWB 1RZIA 1FL5B 1U8KA 4QKXB 2D7MA 3U9UA 1OY3B 4IOSD 4FERA 3QUGA 4NO5B 3QZWA 4P2QB 3DK0A 3R1GH 4LNRA 1VESA 3S34H 3M7OA 3PNWA 4JZJB 1S9YB 4H8UA 4XCFL 1UHVA 3PCYA 4G80A 4Z5RA 1IAOA 3Q5YA 3WL9A 3OGCA 3ZU8A 3EOAB 4H13C 1L7TH 4KXZH 1YQ2A 1KCRH 5T1JA 5AZ2L 3CSYA 1FZJB 2XHNA 4GQ9L 1IC0A 3G04A 2XQBH 1D5XB 1RJYB 2OFQA 2WPGA 1CE6B 1QEWA 3I84A 4O58H 4C56B 5J7CC 5FWQA 3NCBB 2QKSA 1DDTA 4JO2H 4NKIH 1HKLL 3ZBMA 2JKRM 1XIWB 4Y5YB 2I26N 3NCYP 5L9DL 3P1VA 2VIRB 1IBHA 3QPQD 4XP1H 2B39A 3KPRB 4X9IA 3PDGA 5JHLA 4NYLA 5J1AB 1XGTB 3D87B 5CJ5A 1A47A 2ZP0T 4P5RA 4G8FB 4TUOA 3BZDA 2EC9T 1I3RB 2Y36H 3QJZA 5L0QB 1U8KB 3L16A 1JXFA 2YPLB 3PF2A 2EC9U 4GUPB 2ZUQB 3DBXB 3FSWA 4LEEA 2EABA 2ROXA 2XG4A 5D7IF 3WE6A 1FJ1B 1DBKL 1AXSB 1PLAA 4B95C 4AYGA 3F85A 1AHKA 2WBJC 4QR7A 4LF3B 2Y07H 2DYRB 3X14B 5TJWK 2ATKB 2NYKA 3F7VB 4QTIH 5D7SH 3ZXAC 1ZTXL 2DDQL 2ZOLA 2FJGB 3CHSA 3C08H 3C60D 1U8JB 4ODHL 8FABA 1B4JH 4BFKA 5H37H 5DO2C 1C5BL 5B1KA 2VDPL 5DJXB 1QRNE 4KKQA 4N0CC 35C8H 4OF5A 1J8SA 1R24B 1WFTA 3OGOE 3WN5B 2IG2L 4HZ1A 2VLMD 5D7EA 3BKCL 3PWLB 2HCZX 1IT9H 3D09A 4G1MB 1L5GA 2ZF8A 4XMUA 1E7VA 2RQEA 4RGMC 5DEFA 4J6IA 4NJ9H 4GXUN 2LOEA 3R8QA 2OL3L 3UDWC 5J1TC 1FFOA 1FNSL 3RA7L 4YDKL 4QJ3B 2YXMA 2UZIL 3QDJE 1K6QL 5F21B 1V5JA 2EZ0C 1WITA 4YAQA 2G3ZA 1AC0A 2WXLA 1CIUA 2XZQH 4LEOA 2HG5B 3L6FB 5T3ZH 4YZFE 5I15H 3WAKA 5A3ID 1NLDL 1X7TA 3JTTB 4X4XB 2PWHA 5DEZA 4JQVC 2O6PA 4FFVC 1E4XI 1NGWA 4E9RA 3NJIA 5CXPA 2FQEA 5TDPA 3VXSA 1PZSA 4WJG3 4E9VA 4ZOCA 4L3ED 5DZOA 5E8OB 4P2OB 5C0FA 4BSWA 3CN0A 4AJ0A 4AEFA 1VZGA 1TJIH 4NGHL 4MQXC 1MHCB 1A6TB 3PG2A 2WLHA 4NX0A 4ZMNA 1QRND 5DZ9A 4A39A 2WQRA 3LV3B 3QUXB 3UAFA 2G0LA 3VFRA 4KHTH 5C86A 3N6YA 2J1XA 4PV9B 3SGKC 2XPZA 1HQRA 1TU2B 4EUPB 4QRPD 3BUYA 5EF1A 3KPLA 3MLRH 3N85L 1I9RL 4G8GA 1IBBA 4QT5A 3NH7H 1WBXB 4E2OA 2XXFA 2YZ1A 4ZUSB 2J5WA 4BFEA 2ITFA 4GAYA 3T0AA 5J6HB 1BD2E 4LQFL 4LARH 4JAMB 3LNIA 1P6AB 5TK2A 3NFSH 3QXUA 1Y07A 1NCOA 1YO4A 1EJOH 4KUCF 3IE9A 2YXFA 2EIEA 1SOXA 3PYCA 1GR7A 3VTMA 2OZ4A 4B60A 1DANT 2NY4C 1EGJA 5C09A 4GOSA 1H5BC 1BPVA 2VH5L 2OR9H 2HTLC 4EQ3A 4Z3FA 4L29B 1UM5L 4LPVA 3P3UA 3DXAA 5BXFA 5IUCA 1EDQA 4JKKA 5JMRA 1E7UA 1KYDA 4ODSL 4UQIM 2XZAL 1DYZA 5C07A 4KFZC 3IFNH 3FBQA 4LHUD 2HVBA 3UMTA 2IG2H 2IDUA 1LO2L 2FATL 3LAFA 4LU5L 5EN2B 5CCHE 3RTLA 2J25A 3JV5A 5ALCL 3W57A 3U30B 3FF8A 3OC5A 1MHEB 4KY1L 3HMXL 2PW1A 5IW6A 4RMSA 3RWDA 2R15A 3PJSA 3CFCH 4UZSA 1AGFA 1KLUA 3NA4A 5CEZE 3HB3B 1P84J 3KYOA 3F2LA 2V2TA 3KXFE 1HXYB 2BSEA 2V17L 1YAZA 5GGSA 5IVZB 2WQXA 3ARXA 3OV6A 4P2RD 5IWLA 1V7NL 3CZFB 1XSKA 3QAZC 4ZT1A 3PWJA 5CM1A 4XH2A 1XCQB 5ETUB 1H3VA 2BY1A 2WZ5A 2XVLA 2I7SA 3ARYA 4GSRA 1WAAF 4BGLA 5E08H 2W0FA 1BZQK 6CGTA 1FF5A 2CU9A 3SKOB 4BKLA 4IBVA 5C0AE 4XPFL 4AMKL 4L8BA 3AREC 1U2HA 4LLYA 2BOBA 4AGMA 2Y7QB 2XV0A 5C3IA 4PJBE 2H1PL 1GGBL 1UT1A 2JCCF 4UIMB 3BAIA 3PDDA 1QFWL 4WHCA 4C59B 2PCFB 1CTMA 3NH7L 5TTRA 1NCDL 5EZJB 2XX1A 3STZA 2A6KA 3O2VH 4PJDB 5C0RH 2KDYA 3OPUA 1Z9OA 4FA6A 5JNYA 1CC3A 1HZHL 1NL0H 5BVPH 1UFUA 3NG5A 4KXCA 1MJ7L 1CDBA 3MRHA 2VISA 4OD2B 2EIZB 4LLMB 1YN6A 3QA3B 4NRYA 4WKXA 3SSGA 2H1LM 1U0QA 3EGXA 3L3OB 3ZT6A 4BRJA 1KG0B 3QDJD 2IADA 5ADOL 1KB9K 4J3WA 3MGAA 4FQCH 2WBWB 1GAFH 3QIBB 3NFNB 4WWPA 5D1ZD 3KVPA 2AV7A 4GO8A 4ATTA 2NY1D 1PG7H 4Q9CA 3F7RA 3FO9B 3QQ4A 3S4SG 3UZEA 1BSIA 4WGWB 1PLGL 3SY0B 4RNRA 1FFRA 4A6YA 1P5UB 3EOBA 3M7FB 3M46A 3RWGA 5JHDA 1EFQA 2DJMA 2PCFA 4PSRA 1IJ9A 4YBHA 2EXSA 2GUYA 4GW1B 5DJCA 5IQ7L 2WNGA 3OJVC 4PJ7E 4LHUB 5ID1B 5IFJA 4I0CC 1VADB 5CFHA 1YEKH 2WYZA 1ZVSA 1U93B 3FH5A 3KLDA 4QTFA 5KWYC 5F7EL 3QG6A 1VFBA 4ZUWB 2KPWA 4W81A 1A6UH 1WS8A 2LU4A 3VB9A 3VQMA 4W9CC 2HT2D 3IDIB 1JZ6A 2HN7A 1LWJA 4M7ZC 1RKRA 5D1ZA 2XZAH 1RULL 3GXDA 4M7KL 5HI5D 3V6OC 5DD1H 5C0NC 4BYHA 1A2YA 3DX0A 1T04B 2Y25A 1MJUL 15C8L 3ARGB 4PWFA 1GS6X 5JUEH 2A5UA 1BWMA 2R8SH 4YDJA 4BFOA 4FX5A 1WBYA 1KELH 4PRHA 3FFDB 2QV2A 4GMSL 4LRNL 3OXRA 3RIAK 2EIJB 1VJSA 2JJSA 2XG5A 4U1LB 3O41A 4Y1AE 4WI0A 3WJJA 3OMIB 4KDWA 5LCVL 1IAIL 4QRAA 4PJFE 1YEDB 5KSUB 4CDGC 4A2EA 5CMAA 3OAUL 4KK5C 5CUSL 1J5OL 3L4XA 3GKWH 1RI8A 1ZVSB 3IJYA 3PRZA 3WFBL 3EOYG 5FOBA 2C9RA 5DD3H 1OE1A 2A9CA 3VWKA 1UB5A 4BWTA 4EI5B 2NY2C 4J3TA 2R0WH 3LNGA 2NY0B 4PJXB 4NQDD 4JKNA 3O6FB 4O9HL 3EGDA 4X5XB 4DZ8A 4FE9A 4FHBD 1XB6A 3MRCA 1KWKA 1HH9A 3QT2A 5IOKA 2HX8A 4JREB 2AEPL 2XZQL 4TNWF 1OAKL 5D2NB 1F4XL 4WJ5B 1AZBA 4HQQH 4Y4HD 3OHXA 3MLYL 2V0AA 4M6OH 4PJ7F 3MRQA 1L6PA 5KYNA 1N2RA 1U8IA 2O30A 3FN3A 1DVFD 4IIQB 5FYKD 4OCNC 4OIFA 3N40F 3UO1L 2DV6A 2OXHA 5DU7A 3BKML 4N6RA 2MNUA 2WIMA 4KY2A 1D7CA 1HHJB 2L4OA 3HG1B 1SJXA 1H9DA 3G6JA 3NN8B 4FS0A 2EH8L 1PY9A 2XN9B 3Q5TA 4ZO7A 1TJHH 4MD4B 3CFJB 3PP4H 3K8MA 3PIQA 3W37A 5KBKA 1YEGH 1ONQB 3VCLB 5L8JB 2W0KA 2V5TA 1PD0A 3UOAB 1FYTE 3OAZK 4H1LH 3UAJA 2QGCA 4HDIA 2XCMC 3PWVB 1KZQA 4DGYL 1ILSA 3DECA 5C2BL 1P7QA 3HRZA 1SBBA 1WK0A 1QSFD 5HVHC 1P4BL 4KTEH 1GC1H 5D1QD 3H0TA 3SDCB 4PRBA 1UACH 2JFCA 3SGEH 3IJ8A 4GKNB 3LKQB 4N5UA 2CMRH 5DCCA 3DX8A 4BD4A 5JHBA 4O4YH 5ECJE 5EIIG 4QMEA 3P11H 1MCSA 2Z91A 2XN0A 5CR8A 4Z18A 1A1MB 5I16B 4MJ6B 1JZIA 5FUOL 2E9JA 5TGBA 3NSCA 2DLEA 4POZC 1XO8A 2GJ6B 4G8EA 5KZCD 2BK8A 3NCMA 2CO2A 1KENH 3FJTA 4P5TA 3ZQXA 4EEEA 4BINA 4NO2A 4OZFG 2XC8A 3BQUA 2N7BA 3ZGHA 1IC4H 1G7MA 1JDCA 3UTTD 1NMAH 5E8PA 2NY1B 1LK2B 4U4BA 5ABAA 1QI5A 4GRLC 2UY7A 4DGIL 4OQTL 1E4WH 4LVOB 4MWFA 2GIYA 3K2MC 2HRLA 1WZ1H 3MA7B 4XBEH 2FZ3A 4JO8A 4Y8DC 2V2WA 3RZWA 1GOHA 2HUHA 1FO0A 4TSCH 4UCFA 5I82A 1YAIA 2Y7SA 3DX9A 2XQBL 1ASPA 2NY6D 3P0VL 4IHBA 1I1YA 2WK2A 4PJ9D 3O11A 3GJFA 4P2QD 1JGLH 2GJ6E 3KLAB 3UTQA 1NCTA 1RZKC 6TAAA 3K71B 1TVDA 3T4AA 1ACXA 4HC1L 4OF3A 5JA8B 2DBLH 3O3DB 2D7OA 3H42H 4XBMA 1Z9SB 4KX7A 4IS6A 4KO9A 3QDME 2ZXBA 4TTDC 5GRVK 4HEPA 5H35B 4BQBA 1KEMH 4UTBH 4Y5XA 2CGYA 1QLEL 3GPEA 5E2VL 5L2KD 4NBXB 2TSAA 5DK2A 2FR4B 2ITCB 4H25A 1UG9A 4XPAL 3V0EA 4MXVF 3HAEB 1XIWD 1CLYH 5IP4A 2F5BH 4XP4L 3EYOB 3FQWB 3CHPA 2OSLB 1I8IA 1ICTA 2Y2TA 5C8JB 2ICCA 2LLLA 3H9SE 4AJWA 1CDUA 2K3TA 2RA1A 1B0IA 3FONB 2VDOH 4AQZA 5LKNA 1FO0L 1KCVL 3NAAL 2BVEA 1FORH 5LLIC 2WBJB 3MV9A 1X7SA 3PGFL 3BZ4B 3CC5B 4FNSA 2GHZA 4EXKA 4MA8H 1ED3B 1XVSA 2H3XC 2J1YA 4P5SA 4LLVB 5EA0H 2HAZA 2LGNA 1XCWA 5DJ8B 4QRTA 3WS3B 5BQ7B 3BD4A 4Z7NF 4GKSB 1C5CL 1RSFA 2K7QA 1VEMA 4OBSA 3H2PA 5D1QA 1YEIL 5D6DC 5DZVA 1T1WB 4PB0H 1MSPA 4JFDD 3N42F 4AYFA 2ZUXA 2D7TH 1YNKL 1YSOA 3L3IB 1XD0A 3NA9L 4Y16C 1L3WA 3D9AH 4FCHA 1FFNB 2VWEC 4GKOA 4NHUB 4NJAH 2C3HA 3EH4B 1FWXA 4NZUL 5GHWL 1LO3H 1T21A 1U2CA 4E41B 2LU3A 2WCSA 4X8GA 2VDRH 4FQLH 1VGKB 4XMKL 1U93A 3QORD 1ECYA 2BY2A 3L7EA 5F3BB 2MCG1 1GY2A 3EUDA 3Q5OA 2EKSA 2E27L 3RJDA 2RCSL 2NNCA 2GJZA 3CHOA 3D8MA 5CD3A 5C0BB 5KSAB 3RZCB 1QFPA 2F61A 1P4IL 3DPDA 5T1DL 1BX2B 1J9CT 1WC7A 2A6JA 4ZX6A 4NC1E 3SQBB 5JIPA 4YDIH 4Y5VB 3OPZH 5LHDA 5F8QC 4NUGH 2ZOKB 4RLDA 1AO7D 4CNIB 5F1NB 3ZDYE 1T0NB 4K5OA 3HI5L 4XN1A 4LVHB 4HWBH 3I74A 2ENSA 3SE9H 4NFCA 1OCWL 3CXDL 1E8ZA 1KCLA 1IAIM 3DKHA 1JGDA 3O4LB 4JAMA 4EZMA 3A6BH 3BPLB 1OLZA 2UUDH 1TQCB 5E2VH 1MCDA 3ISWA 5C09D 1MWAH 4PJEB 2Z8WC 1ML0A 1KN4L 5DZPA 2WKGA 1KJ3L 2J3SA 4S0HA 2XWTB 2C34A 1JF5A 5H4YA 4GIAA 5AAMC 4V1DE 1IKFH 5DFAA 5DQJA 4L3CB 4WK2B 4TUOB 3I3BA 5E1QA 3Q8CA 5HGHB 1TENA 1A7QL 1IFRA 2C3WA 3BQUC 1MFEH 1JZ4A 5EIIA 3A6CL 5IEKB 1YCSA 2YUWA 3KPSA 4MJIE 5E2UH 2IIJA 4FKHA 3ZE2E 1FAKT 2DM4A 2QHRL 2J8OA 2WSKA 3VACA 3K8LA 2H32B 3KWWB 2XT1B 3QZLA 4PJIB 1ETJA 4F7PB 2NUPA 4KUCD 3VD1A 1MCWW 1THAA 1FSKB 1LO5B 3LZPA 1R5WA 3BQUB 3FO0L 4F5CA 1Z6JT 5IQOA 5JTWA 2C9QA 3D07A 3CSYB 1J1OH 1BGXL 5F1IB 1NGQL 2DRUA 1YG9A 2IAND 4OCWH 4ZFZA 5M7QA 5DMGD 3DVIA 4G7VL 5HDRA 3C5JA 4LE8A 4YXLL 5BOJA 1LO3L 3H56A 3DIVA 3KYAA 1F8TL 3L4VA 4G3YL 4Z7VE 2CRIA 3GSWB 1A7PH 3H3KA 2YAOA 1FBIL 4YHPA 4L0YA 3QUZD 1DVUA 2BZDA 3K2IA 1OD7A 1KTBA 1E5BA 4ZMOA 1TCMA 4PI2A 1JVOA 2UXTA 4OR1A 2A99A 3TIDA 2JKNA 2F7IA 4XXCC 2YQBA 1W8NA 2JH2A 2AJ3B 2FEEI 5IEHB 4U2YA 1I8AA 5T3XH 5JHDB 2IEPA 3ZK0A 2BDNL 1YNLH 2Y3NA 4NNXA 3DO7A 3FB6B 1R5WB 1QPXA 2TSBA 2BXZA 1GZPA 3B1TA 1DSYA 4MYPA 4ONHA 4RFOL 3U4EB 1R3HA 4K8RC 2VL5A 2YFOA 5CLTA 3DBSA 5IW1B 1JPEA 4LT7A 2EYRB 3IJEB 3QUXC 3GIVB 5FA4B 3AWEA 3PWJB 1J8HB 5FDWB 1LNUB 1XGRB 2J57A 2F6AA 4P5KA 3N44B 1CTOA 5G5DA 1C12B 1EANA 3DV4A 2FL5A 3BCFA 2CR0A 5LGJA 5GRWA 3KYKL 2I7OA 1IQWH 2CJUH 4MJIA 4RNRB 1YQVL 3BAEH 5TQ2H 5AOJA 2HVKB 1WFMA 1PZBA 1XSOA 4A2FA 1CFBA 1WT5A 1XD1A 3FYEB 4J4PC 5AYUL 2N0MA 3PFUA 4WDIA 3A21A 5INCA 5AWNH 5E5MB 1IC1A 3BPLC 3PABA 1BG9A 1QBLH 3IGAB 3P73A 1CQYA 5EU5B 1DLFH 3IDGA 2HRGA 4NQEA 1MPAH 3K46A 1IL1A 3FRUB 4QYOA 1MN4A 3K6FA 2XKNB 1KB5A 1DQLH 2J8UB 2YPVH 4L2YA 5E8OA 4YHYB 5T33H 3SJVB 5C0FB 2XVKA 2WTRB 4XE0A 5CO1A 4GBXD 5HYIA 4HFUH 4KK9D 4W68A 1HCZA 1FN4A 1R3KA 2ID5A 1A4BA 4UYPA 1K3ZA 2H0EA 3OM3B 4FXGC 2W95A 5EHFA 1DBKH 2CIIB 3GYRA 4FQJH 5DURB 3U79A 5AEAA 1MFEL 1B9KA 1A02N 3F6JA 4PJDF 1D5BA 2X1XR 2IFFL 1T66C 4OM0L 1B6DA 1CIDA 1VENA 2O26U 2YD6A 4ORZC 4TVPH 1FBIH 2QHRH 5IQLA 3PREA 4W9JC 3LCYA 2FJHB 4BHUA 4NEHB 1BFOA 2RHEA 4LNVA 2NTFB 1QA9B 3QFJA 5GGSB 5IVZA 2EYTB 4NRXA 2X3BA 3DO4A 4JUTA 2F1EA 4I0KA 4N85A 1WICA 5PCYA 2M8XA 2DLGA 1SXBA 2Z4QB 4FLQA 5GQBA 3QWRD 3S48A 1XR8B 4U3CA 2G5RA 1CFMA 1QABA 1Z3GH 5I73C 1AIZA 3QAZB 4E9YA 1MCEA 3K4AA 2E86A 4Y2DB 5CZRA 3FUKA 5MEPB 1MDAA 1N10A 2C9XA 4AQ1C 5IFJB 3HR5B 4UIKL 3V5HB 2NSXA 1N70A 5EV7A 5GRUL 2CO3A 3NCXA 5KW9L 3MBWA 3OKEA 1NAMA 4L48A 1ETZA 1HK6A 2ADIB 5K9OA 3ZMEA 1I8KA 1E8WA 1PX4A 2J44A 2CIIA 4NM8L 5ES4B 2FD6H 1Y7VA 3HE7B 2XN9D 5C7XH 1IC7L 3VSTA 2DBJA 5EBGA 3PWPD 4FQXD 4DWHA 3F7YA 2YFNA 2AXFB 3OKOA 3AUWB 4A2LA 1LEGA 2EDLA 1HHGB 1TXKA 2RFXA 2MCMA 43C9A 1EAPB 5HJ3A 4AQ8C 3K6OA 2YKKA 1ANUA 1A6UL 2MH4A 2YQ3A 3VE0B 5IHUL 3DOHA 3LQZB 1HAWA 3EO9L 4ZQKA 3GJEA 3IDJB 4RBPH 3MRHB 4OD2A 4FJYA 1FGNH 2OW7A 3KDMB 4HXAH 1AY1L 4JY5L 2JCCA 3IKCA 1NIBA 3HN3A 2NY7L 4NXKA 1ZT1B 3OMNB 4LP5A 3UTTE 3LNFA 5A43C 3B9KD 3QWOB 1BQSA 4IJ3C 3WFCH 2LU5A 3FDWA 3V5KA 5AW2B 2JKLA 4KTYA 4MA1C 2V5RA 3MKGA 3QUYC 3B8YA 1S5HA 5JZ7C 1TZGH 1ZA3B 1OZUA 3QUML 3L17A 4IRSB 3LQAL 1U3HB 3JT0A 5ESQA 1HL5A 3WHE0 2R39A 4WO4D 3G08A 1OGTB 3D4CA 4HV8A 5SWSD 4R0LA 4UOW0 5T1KA 1RZIB 1QFWM 4PS8A 1ZHBB 4Z1PA 1RK1A 3HMWL 3F12B 3ZKNC 2C3GA 4XGZB 1FNEA 1F4WL 4NQED 3CVDA 4YSAA 1UTDA 2FBJH 4KX9A 4PJEE 1RZ8B 4G6AD 2AXHA 3ETBJ 5KSVA 1X5KA 3VQ2C 2DQJL 3QUKB 4XHQA 2JVUA 3PL6A 3PWNB 4KOCA 2CMRL 2OTUB 4DPCX 4MXQC 4ELMF 5DRXB 2K78A 3KE0A 3DMMD 3NCWA 5DGQA 1KYUA 3SPIA 2CA3A 2EXTA 2EYRA 1T6WA 4LGSB 3UJIL 3B2VH 3QQDA 2BS8A 1CG9A 1MFCH 4J4PA 2HTLD 1U8LB 3FMGL 2NXZB 1R4XA 4PD4J 2QDWA 4WLCA 1MIMH 1G5AA 3EG9B 3FQ1A 3KJ6H 4IGBD 5SWSB 5C0GA 5CILL 2Y72A 1KDIA 1YYLL 4ZMZA 5DGRA 1U2YA 3MLSH 4GAJL 1AZUA 4N8UA 3EHBB 1FZKB 1IC4L 3GXPA 2X12A 1MCPL 4LP4A 5GZOD 5MEND 1ZS2A 3U4KA 2D4FA 4M56A 4RGOH 1KBGL 5D5MB 1QRNB 3MRGA 4ZPTB 5DRWB 1L5GB 2JKTM 5I1AB 2WHVA 1DVQA 4UT9H 3TT1L 3HVDA 5AZUA 3BW9B 5K93A 2PR4H 3IRZA 3VWJA 1T0OA 1SQMA 2KUTA 2YZ8A 4DP2X 3QCTH 5BO1H 4HISA 3GMOB 1IB5A 1D5RA 3UP1A 2BVYA 2BP3A 4G1EB 1CGUA 3HZ3A 1C16A 3E8UH 3UBXA 2A6DA 4HPOH 5CJXA 3L4ZA 4M43L 5KN5B 4QI3A 4HIEA 1ACYL 1VFUA 1MFDL 3KXFD 1C12A 3DV4B 5EU3A 3BSZH 3E8VA 1UA7A 4PVNA 1JZGA 3W9DB 3QNXA 4HHAA 4XVUD 3WENA 1LD9B 3UROR 1ODUA 1QO3B 5J3HC 3OZ9H 5KBNC 2OMUA 4PW3A 1NMBL 3S5ZA 5HHMB 2Q3ZA 3GO1H 1YHPA 4OB5L 5AOMA 4A7GA 2Z7WA 3EJUA 4E9WA 4BXSV 2JV6A 2IQ9H 1PLCA 4YE4L 1L9RA 5EOCJ 2O5NA 4IKIA 1CVRA 3SGJC 4HIJA 3TEXA 2WIIA 4PGZA 1ZHNB 2J5LC 3T6WA 5HYJA 3AVEA 1I7RA 3VFGH 4PRIA 4OFDA 2X41A 2XWJA 1ONQA 4UYQA 4XNDA 2VN6A 1TTFA 2GUOA 2NR6D 1E4HA 2X6UA 4JVUA 3D18A 4YFDB 3RVWC 3PAVA 1F58L 1OCZB 3IDXL 3U36B 2QQQA 3F7QA 3OZLA 5KSAC 1E50A 3L6FA 1B0WA 5DYOB 4XNYH 2EVGA 1AQDA 3MRBA 4ZUTB 4QTHA 4KI1A 2WQWA 3MRMB 4GKNA 3BVUA 5IBLC 5EOCH 4HWZA 1X5JA 1IGTB 4HKZA 1Y18A 4P57B 2FIKB 3K6IA 3TLRA 3FAWA 1H15B 1Y1UA 1UZ6E 3U9UB 1CS6A 3RVUD 5ICZA 5D2NE 2J2ZB 2VN3A 2QGBA 5IHWA 3CDCA 3LZOA 3QFDA 3UYPB 1UJ3A 3I50H 1AD0A 4KQ4L 3PWLA 4PJAB 3C6LB 1CICC 4BZ1L 3U0WH 1CLCA 1PJWA 1I1RA 5IESH 1WZAA 1CDHA 1GGTA 4R2GB 4X99B 4OUOA 1UA6L 2ZNXA 3L5IA 1UCBH 4X8JA 3JWNE 4L0ZA 1YA5A 2W91A 1JNLL 4NN6C 1K8DB 4PCTA 3BZEB 1URZA 4L3EA 1XF3A 5CP3A 1VF5C 1Z5LB 5CCGE 1BREA 3BO8B 2V17H 4YHZL 5E94A 3CX5K 4W9DC 5IVXB 3SDDC 5ALBL 5DUBA 2X0WA 8PAZA 4RQQA 1XGUA 2IOOA 4X0KB 3MLZL 4FXTA 2BIIA 1QBML 3B9EA 3CVHA 3QBTB 2DMCA 4NPYA 3VX1A 4L4TB 4ZX3A 2GCYB 1IGTA 4ZW6A 1IBGH 3WNIA 3IFLH 1NBVH 1I3RA 4E36A 4L4TA 3WIHA 4IBUA 1HH6A 4JPKL 5FX3A 4P59H 1CWVA 1R17A 2JJTA 3HS0C 4KTDH 4QOKB 1KN4H 5BNXD 4U1MB 1IGJB 3EJYD 3ULUC 2WGNB 1RZ8A 1W0VA 3TBVB 4AJVA 1UQSA 2A0LC 1KYFA 3BH8B 3GK8H 3RWEB 4FG6D 5EFIA 1NMCC 3SJVE 5KJRH 2APBA 4L5FE 2KZBA 1Q1JH 4N22A 3G04B 2YIHA 5E9DA 1R3JB 3H4HA 4XNQA 5SX5K 5AKVA 4GS7B 5MHSD 1QLRA 5BCAA 4X8JB 1MFDH 1FNGA 2ZCKH 3IXAB 4FJ6A 4U3SB 4WGVB 2EEFA 4FGMA 1P84K 5DJDB 4BH8A 4LXFA 3W9EA 3MV9B 4OI8A 1NDGB 4JRWA 2G5BB 3Q7JA 5CP7A 1O75A 4K3HA 4HVBA 3NZSA 2XV6B 2YEQA 4JRFA 2VITB 4CADB 2KYIA 3GSUB 2APXA 4G6KL 1UWXK 1FNFA 5I1JH 3TNNB 5B4MD 3SHSA 4FFWC 2X4PA 1U8CB 1SJEA 5AYTA 1U3JA 4X98B 1W72A 1XCTA 2JKIS 5T1MA 4AGLA 2VWEE 3EXLA 4FLRA 3TFKC 2HRHA 4G43B 3PHQA 4QRUB 2WLYA 3IVKB 3QCUH 2D03H 1JG9A 4YC2B 3UZVA 3ZLQC 2Y7MA 3EFOB 3TASA 7FABL 1TETL 4ZSOB 4NUQA 1HZHH 4P2CG 2WBXA 1JE6A 1N59A 5D4IA 1OP9A 3CD4A 1T1YA 3U82B 2KZKA 1OKEA 1U8LA 4G6ML 3SZKC 5E8PB 5I18H 4URTB 5EDXA 1E4KC 1NEPA 4P3CH 3LEYH 1E8YA 4XR8C 5HGBB 3V0VA 3TA3C 3MNVB 2YWZA 1FZKA 5CEZD 1JCVA 1QFUL 2K1MA 3CX5J 3I02A 4B9ZA 4FLHA 3DMMB 4G8AC 5L4FA 3QDMA 1ZKAA 4C57C 3HE6C 4V33A 3L2LA 3C6SA 4YSEA 1W72L 4TQEH 1NMAL 5DHYA 4NN5C 2VXQA 2VXVH 3CH1B 3FQUA 4DEPB 2XQYK 4OCWL 1QA9A 1FPTH 3LD8B 1S9XA 1I7UA 4RMQA 3IVKA 5E99L 1WHPA 4YO0B 4C4UA 1GCYA 1KIUA 2FWSA 1QUNB 3KJ6L 5GJSL 3B3BA 1BZ9A 4QTIL 1PFCA 5D7SL 3EOTH 3B5HA 1G5GA 4MFHA 2DQ6A 4JFHD 5DYOA 1P7HL 3NPZB 4LPCA 5JPMC 1KJ2A 4U05A 4MAZA 4F24A 1E27A 5D9SB 5SV3A 2BSSB 1SEBB 5FHAL 3ZE2B 3ZYZA 3MFGB 3ZDZF 2AJVH 4GRLD 3BZFA 3KPLB 3V4VL 1DLFL 1QASA 5KVDE 1XDTT 3EGDB 3LKPB 3QIWC 4E9XA 1NCAL 3WELA 2QQKL 2WCGA 3BPCB 3EGXB 1SNRA 4PV9A 3QNXB 3DC0A 3Q6GH 4HHAB 4AJYV 2B15A 5DVMA 4N9OB 5DJ2A 1MCFA 3QEQA 1VPOL 3CX2A 2VAAA 1ZK5A 5MI0C 2RFXB 5BZZA 1ZXQA 4HPOL 1Y6MR 4CU6A 5DZJA 1U8HB 2UZYB 3CHRA 4G72B 1UXMA 1UXSA 3DPBB 3L1EA 1WTLA 4AITA 2DYSB 2H0PA 2R69L 2WINA 4YDZA 1CJYA 1FL3B 1G1OA 4HJEA 2MJWA 3DYPA 1JGDB 3X12B 5JXAL 1U6AH 4PB9L 1XGQB 4ZS7L 3NFSL 2J88L 3NSDA 4APXB 3VB8A 5LN4A 2ETWA 2BVUA 3O8XB 3SKUD 3V9CA 5EPMA 5DK0B 3MOBL 4OTXL 2Z31A 4OCLC 4AIXA 3HC3L 4QHLB 1B90A 2OI9B 3V4VA 2GCYA 5CGBA 4EKJA 5E6SB 4L1BA 3MCKB 4JQXA 4U7KA 4ZNEE 3HE7A 3DDGA 3ARFC 3AREB 1RP8A 2A6JB 2J1KA 3SE3C 2ERJC 5K9OB 2NY6B 2YBGA 2R1YB 2NDGA 1U8MB 4NI3A 4APQD 5HHME 3BP4B 3K1DA 3IFNL 4U6HB 2B4CL 4CBPA 3HRPA 1RLWA 3BP6A 1NIDA 4KTGA 1ITBB 3TEZA 1RURH 3EDKA 3MOAL 5GZNA 2WLMA 4O2EB 5T5FA 3NJNA 1R3JA 3O2DH 1XMEB 3MNMA 4YVNA 2ICEA 4F9LC 4D0CA 5GS0D 2JKXA 3MXVH 3HNSH 4ONFH 3FFDA 4W9EC 4MAYA 1E2VA 1CXEA 4ZO6A 4BZ2H 3T8MA 4ENEC 1MCRA 1FVDB 4PVMA 1BA9A 5L7XH 2WOBA 2YPLE 2DLIA 1SFDA 2YKLL 3I2CL 5FXCH 4OJDH 4X50A 5IHZB 4GJTB 1UM4H 3U0WL 4BZ1H 1JPGB 2UZXB 2WAQA 4XAKD 3GHPA 2EIMB 1G1YA 3HUJE 4AC2A 2MHAB 3FTGA 2CNYA 2P8LA 3KPRE 3OD3A 4BK4A 3GI9L 4X9YA 2W94A 4XVTH 4L3FA 2H3NA 1JVKA 4KV5F 1EXUB 1P5UA 1NPJA 5F7DA 3RNKB 4UT7L 2VERA 2RIKA 3DX8B 3FCSB 4H26B 3HUJB 2R56H 1IM3A 2PTVA 3GXNA 2GSMB 3WNOA 1AGEB 2O5XH 3FCSA 4H26A 2Y06L 4LHUA 3BN9D 3FRUA 3MUY1 4KDVA 2W88A 3K8KA 4LMQI 4QYOB 4BELD 1QG3A 2ENPA 4B3EA 1Q94A 1RZGA 4H88H 2DEYX 4AKOA 4PMFA 3H42L 3ZUCA 4QXGH 4EN3B 1YEEH 1FJ1A 2CM6A 3IFLL 5JPNA 1KEGL 2XU9A 5JIQA 1J8HD 4IU2B 4WNJA 2C4FU 3ARSA 3F6LA 1B2WH 4AIOA 2FECL 3K81A 2M26A 4KJPD 3PWPA 1U95A 1UA3A 1OB0A 4X6CE 4WW2C 1X6LA 1D7DA 3O3AA 1JZ5A 3QPKA 1K85A 4FG0A 2YO3A 3S5LB 4XO5A 3WN5A 4WI5A 5HPMB 4UNUA 1MW2A 4GAFB 4DNLA 1CGWA 1JHLL 5ISZB 1EEQA 1F3JB 3BQUD 3X1GA 3KXFB 4M1GL 4I0PB 3ZDZB 1LDPH 1I3VA 3OSKA 4GW1A 2BMKB 4QLWA 1O7VA 4EUPH 3EYQD 4XWOC 3PAZA 1DN0A 1ZVYA 2JELH 1QUPA 3NCEB 5F6HJ 2A6IB 2BRRL 5BMFL 5C0RL 5JZ7D 2PUQT 1GH7A 5JXAH 2MPAL 3LIZL 4U0RB 4BHUI 4IOIA 2XG4B 1FIGL 4GFXA 2JKWA 4PUBL 3VWJB 1TO4A 1TKWB 2CRMA 2YSTA 1JWUA 3ARGC 4XMPH 2R1WA 1BMGA 4XAKE 5F0LB 4TSBL 3RNQA 3VWKB 4OFQA 5C1MB 3HNSL 1CLYL 4PJCE 4EI6A 2WZ0A 3SD2A 5C6TL 1D7BA 3WFEH 1RU9H 2FX9L 1WIOA 1M71B 3BP7B 3EYUL 4N0FB 4N2BA 4S2SA 3UDWA 4ODUB 4WO4A 4IDJH 1EUTA 2OR7A 2PYED 3EHBD 2NXZD 3HMXA 1XGYL 4LSTL 1QW9A 1GOFA 3IRPX 4OJFH 3CCHB 1H5BB 4G6AC 3QK0A 5HYQB 1BFTA 1HSAA 3I75B 2VUYA 1WBYB 2YOAA 4IRZL 4P5MA 1KBBA 4X4MA 2B1OA 4JM2B 3I6GA 1HS6A 1I85A 4NAQA 4RETB 3ARDC 3TVMD 4DP6X 3ULAB 4KXAA 4NN7C 4HUUB 1YEJL 2X0UA 3CSGA 3HA0A 3OZ9L 3V0GA 3S8GB 2DQIH 3VRLF 1GYUA 1MFCL 2BNRD 4OCXH 3ARFA 3ET9F 1XZ0A 4WEMB 1IGCL 5BRPA 1EWHA 4MB4A 3O6ML 4B9IA 2K6ZA 5DQ9A 2R2BA 5F7KC 2UY6B 4FNLH 4J6RH 4ZUWA 2Z31B 5JLZA 3O3EA 4RAVB 4UM9D 4ZK8A 4CU8A 4ZMVA 1FZMB 5ESQB 5IROD 3V4VB 1S7WA 1NC2A 3G9VA 3NRQA 2OMWB 4IRSC 4OZGB 2B1AH 2JTYA 1IGYA 1NCBL 3ALWA 4MNGB 4ODTL 4JRXA 4U6YA 4EUPG 3GMRB 3ML8A 3STBA 2WLIA 4FYSA 4JFDA 4JR9L 3ATDA 1OQXA 4O9HH 2H5UA 1E9QB 3CFKB 4MZRA 5DFVC 4KI5D 5HDLA 3LPWA 1WZLA 4U6XA 3E2HC 5AALA 1F4XH 4Y5VA 1LILA 1PAZA 4DFIA 5CBAB 4LPWA 1U58B 4BWUA 4H44C 2OTUA 1DDHA 1ACYH 4F37F 4ZQKB 3RVTD 3GSXB 2EACA 4C56E 1WFJA 1AMYA 4BQCA 2V8LA 5I5MA 3FCUB 3SKNA 3MV8A 1XSJA 3KLLA 4NN5B 1JPTL 5IMKB 3S0PA 3ESVF 4I2XE 2EVJA 3AMLA 3CZKA 2I9LB 4U49A 1LO5A 1OK8A 1NUGA 1YMMD 1NC2D 1LMIA 1SDDA 2H1XA 3UIZA 4GW5B 1ZTXE 1CLZH 2UVEA 3E6FA 3S88L 3WFEL 1AHWA 4Y8AA 4X80L 5HHNA 1N7ML 5L4IA 1G6RL 3KWTA 4I48A 1F8TH 1EBAA 1KJVA 4JL1A 1AZVA 3LPGA 3AT9A 4DF9A 4GAAA 4LO9A 2GW5A 4TUJB 5GGRY 5IWLC 4YXKH 4NQVA 4Z7UA 3QS2A 1LP9F 3QEUB 4OF6A 3UYRH 4UQAA 5FDYA 3LKSA 4XN8A 3T1FB 5IFAH 2BHUA 4MJ6A 2MTAA 3VXNB 5C9JB 4PTUA 1WFUA 5BV7C 3A4AA 2IMMA 1L3NA 1BV8A 4QHMA 5F6IC 1XF5B 4UT6H 5TE4L 5JIKA 1L0PA 4JPKH 4WY7H 2F53B 2GIMA 3BWUF 1YVLA 4G7RB 3U7YL 4YZFF 4H8WL 4X9BA 4HMDA 3W9EB 4N0UA 2J6EH 3KS0H 1R0AL 4K23L 5D2LB 2VIRA 3ZDYB 1EJFA 3GBLA 2WQ8A 2Y36L 3LHAA 2Y4SA 4QRBA 2AK1L 3LKNB 4IRZH 1OCRB 2KMWA 3E6HB 1MFNA 2XWTA 3VGAB 1KTRL 3I6KB 1Q0EA 4HT1H 5FR3A 2LVCA 2J1ZA 4J3BA 4F7TA 1DJSA 3WXWH 2BP0A 4NWTL 1TJIL 3L4TA 1A3QA 3HI6L 3K71A 2Q8BL 5J1AA 2YA2A 4RA3A 4AYSA 2CPCA 4ZMLA 5HGHA 3D52A 3IAQA 4FI8A 1CBVL 1AXSA 3MRPB 2BVTA 4DJMA 2DQGH 3EYSH 4CC1A 4DQOL 3UFIA 4JZJA 1FFNA 4NHUA 3TPUB 1MDTA 5A1AA 4JPVL 1MHHA 2ZP9A 3LN4B 3NRFA 1FSKC 2VR4A 3T3PB 3CZUB 1CU4L 3MUUA 3M1OA 1IM9A 2B1AL 3T71A 3CFNA 5BOZG 3IU4L 5L88L 5CIPA 5F71A 5CWSB 1S78C 1J88A 1N9PA 4XMVA 1TEFA 3IXAA 1T4KB 5DRNA 3ULSB 2YAQA 2XTSA 1OT4A 4L18A 4BH8B 4BUHA 4OZHB 5EUKB 4HJJH 4ZUVA 2FZ3B 3D2UB 3QI9B 4JFEB 3LKPA 4M00A 5F7MC 5H4ZA 1JTTA 5GS3A 2WVSA 3ZKMC 1A9BB 1YUHA 2OA9A 3B6SA 4FXKC 1ZHKB 4QT5B 4WEBL 3D4YA 3R06A 3NJLA 2WW8A 1I8LA 3APMA 3P4NB 4J3VA 2C3VA 4JFFD 1IFHH 3MODL 1MNUH 4R2GC 4ZAKB 1R5VB 2WQUA 5I8CA 4GRMB 3JTTA 4X4XA 2QSTA 3T9WA 5IBLD 1WEJL 2YPLA 5K1NA 3WD5H 3BN3B 4HKXA 3GB7A 2VXSL 1HQ4A 2X1QA 3BUTA 1QUNA 2B5IC 4NHCH 5F0MB 2OX5A 5IEHA 4HUMB 1HQ4B 3LZFL 4X6EA 3HFFA 1PLBA 3ARBA 3KH4A 1KB3A 2NR6C 4P4KA 3CK0L 3U7WH 4KZDH 5DHDA 2ARWA 4P2AA 1KCVH 2WTOA 3RY4A 4B9YA 2DWYA 4M9PA 2TRYA 4PBVC 5DMJB 3VXTB 3D2UA 4AIZB 5F9JB 2WOYA 2FWUA 2D9CA 1ESOA 2WXKA 1U3HD 2D4DA 3RU8H 4U6HA 3GSXA 1A7OH 2NUPB 4PVBA 3JWNG 4WUUE 3T0BA 3MROA 3QZWG 3MA9L 2X05A 1UKQA 4KH9A 5CS7A 1EFXB 1JPST 4KK8D 1C7TA 5LGKA 1WCBB 4FD0A 3AFLA 4OQTA 4ZODA 3T2OA 4OLVH 3HS9A 2A9AA 3OHXC 2NY7H 1S4IA 4MCNA 2YJLA 3L5XL 4NO3A 1R5IB 4APQA 3EBHA 4IHOB 3NDZE 2ENQA 4JPWH 2B7DT 5IVXE 2BRQA 5EWIL 4JLRA 2AQ1A 2NY3B 4ACTA 1WT5C 4RMWA 1HCYA 4MXWH 5F9WB 3OKKB 1Q4NX 3MUZ1 4FQQA 1YN7B 1EXUA 4N68A 5CSZA 4LAQL 4AEIL 2NNFA 2OYKA 3TBVA 5IMMA 2PPDA 1RPKA 1CYGA 4NFBA 3ATFA 4U33A 3FOLA 4I77L 1IAOB 3TYFA 2QZ5A 1L6XA 3COOA 4Z7WA 4EVNA 3HI1B 3HMWH 2ED8A 2F53A 2IBZX 2Y6SC 5CBAA 4I9WE 1SYSA 4XVSH 3FFCE 4G8EB 3AUVA 1NKRA 2ZUYA 1HILA 4O00A 1QHOA 5DI8B 2AVFA 3A67L 2JKSA 5L88H 4S1RH 2V2XA 4M3HA 5D7LB 2ATPB 1XGUB 3O3UN 2KLSA 1CFNB 3DK2A 3GF8A 4I9XA 4JCMA 5KSAD 4KZEL 3SDXE 3M88A 4HALA 1SYVB 4G7VH 1KV3A 4RISL 2H3KA 4TULL 3KS0J 3CMOL 3MRDB 1LO4H 3FUDA 1MIEL 1F86A 1FAIL 4AGNA 4NIKB 2P24A 1X5MA 2P1YA 2J56A 2Y69B 3BYTA 4GAGH 4YXHL 5D72H 4X6FB 1QACA 3EH2A 1FRGH 4OJCA 2MIZA 5LWYH 1A3LH 4ZOEA 2FX7H 3Q48A 1KY6A 1Q72L 3MMEA 5JHLL 3F5WA 3M6DA 2YD3A 5D5ME 4G9FB 1H3WM 1E0OB 3CIAA 2CPUA 1T20B 2Z31D 3QXAB 4G8GE 4U3SA 4X6DF 6PCYA 5I1DA 2BDNH 1CE1H 3BVWA 2AZAA 3PHOB 3NIDF 3OR7A 4ERSH 3QPXH 1T4KA 1TJGH 4RFEB 4MA8L 3PQYB 4PJCA 2CWRA 2W60A 4D0BA 6FABL 4Z3IA 5MEQB 1EO7A 5F3FA 5I1IL 1OM3L 4ZFGL 1F97A 1HJBC 1N12A 1YEWA 1IBDA 1A1NB 4XCEA 3NJJA 5CJQL 5DJ0B 3I9IA 3RUGB 3I6LE 4S1DC 4JKPL 5I1LA 3LIUA 3MRPA 2ZG1A 1R5VA 2HX9A 5I8CB 3BQVA 1N6QL 4KJQC 4NZTH 3I9GH 4HUNB 4ZDHB 2DQTL 3QR1A 1D2PA 2NZIA 4GINA 4LOFA 3I9AA 1ZANH 4MDIA 1ZSHA 3QUYA 2LLNA 4IRJD 3VVVA 5IHHA 1IILE 5HI3D 1T5WA 4JPQA 4HMCA 4RFOH 1RZKH 3FUEA 1HDMA 5K5YA 2GY5A 5J11B 4YDNA 5A7EA 4PJIE 5CEYA 5JUEL 2X6MA 3OKDA 4R3SA 1OIOA 1HEZB 2KDGA 3DOSA 3E7JA 4V1DB 5FUCE 3QO1A 1HCFX 4HX1B 1ACCA 5IB4A 1DEDA 4G9DB 2Z6FA 5DJZA 5E1IA 2ZKMX 4UNTA 4ZW8A 5D6DA 2WBKA 1JK8A 3DX7B 3ESOA 4PJIF 4WFFE 2OMUB 3T8XA 1BQUA 2EE9A 4I0PD 4QHUA 2AV7B 2NW2B 1A21A 1YEFL 4XVJL 3T8XB 5JYMA 4X7SL 4MYWB 1YY8B 3RWIB 1UXWA 3GJEB 4ZD3H 2YEZB 2XWDA 3VXPA 2G4EA 5AWNL 2F1AA 43CAB 5DQDH 5HI4D 5I8OL 1N19A 2YC1A 4JN2B 4WKZB 1MWAL 3FRPG 5DEFB 3RJQB 5KYWA 1KCUL 5DTFA 4NC2B 5D96B 1JGVL 1I1CA 1OT2A 4DKEL 2AQQA 5AZEL 4YX2H 3T4AB 3S2CA 3VWJD 1ETZB 4LSVL 4RAUB 3P11L 4D9RD 3U36A 3R7RA 1YDPB 3ARUA 3DROA 3RQ3A 1MKFA 1VFBB 3DGCR 4MD5A 4CKQA 5DZAA 4AC4A 4XO3A 3B2MA 1QSFB 3T08A 1F00I 1KN2H 1NAMB 4UIKH 3US9A 4MQSB 3BCDA 2XICA 4MD0A 4F58H 4P2OD 2Z92A 3ZO0A 3NIDE 4ZX5A 2EUXA 4ES9A 1C5BH 2ZNWA 3DYOA 3N43B 4JM2D 1RZPA 5IJKA 3N3EA 5D7KD 5IKCA 1DBMH 4UTAH 4U6XB 2KLRA 2B5IB 1KXTA 1CUOA 3FPYA 3LZFH 5LNGA 2PCYA 1U58A 1TJHL 1W8OA 2HLFD 1AQHA 1G9EA 3B9AA 2CJSA 3EZ8A 2EYTA 4NRXB 1CXHA 1E43A 1EHKB 1TZHA 3FAXA 4R96A 1H15A 4KZDL 2VLKE 4MX7B 5J56B 3E1F1 4IIQA 3ETTA 1JNLH 3QC6X 3CZFA 4PR5A 3GTNA 1ED3A 5E2WL 3D48R 3LH2L 5EBMB 3EAKA 3P0VH 3IN0A 4ICXA 2FO4A 4UV4H 4HS8H 4M5ZL 4UOZA 1F3RB 3KYOB 4Y4HB 1TSHA 3VD5A 2BFVH 2R2BB 3DJRA 3DX2A 5GRZA 4LLQB 2C1OB 5JHDE 2C9PA 4Q8BA 3O3EB 4RAVA 2CK0H 1N26A 4N2GA 3UACA 2WUBL 3IDYC 4ZMPA 5GS1B 3WEOA 3E3QE 1A6VL 4MA7H 4U1GB 2AITA 5FW8A 4N0CD 5IMMB 1QRNA 4HETA 3L3GB 4U3HA 4XZUA 1ASQA 4PRHD 2WWKT 3LSOB 3LXAA 3FSZA 4JZNA 3BVNB 5F6HI 2A2QT 3BH4A 4ANKA 2PXYA 4MMYB 4HJ0D 5CSGA 2DQCL 2IQAA 1DQIA 1TZIB 2PKDA 4YHNB 3S8FB 5MERA 1JZHA 2VXTL 1GTNA 1FNLA 2VC2H 3SE8H 3QQDB 1JJUA 2BNQB 1P6WA 4EXPX 5I2IA 4S2SB 3ZUNC 4FQ2H 3FQRA 2E7CA 5FV1L 5KS9B 4X5QA 4O02A 4WFHE 3W0WB 3X11B 1GYWA 4MWFB 5G2NA 1XSIA 1L9MA 5BPPA 4WV1C 4BK8A 3RILA 1BJMA 2YUXA 3UJIH 3CFTA 3BXNA 3WEMA 5IW1A 3CHXA 1JK9B 1Z9PA 1OF0A 3QQNA 5L8KB 4XAWL 3L3DA 3RPBA 1GYAA 1EV2E 4PLNC 2O5ZH 5FO2A 1DQJA 1MRFL 4L8SB 1MWAB 1H3PL 1RPQA 3EJZD 3L3DB 3BW9A 2JIXA 4WEUD 3QYCA 4B53A 5HSFA 4MTMA 3AQYA 3WU1A 2V9UA 2HFTA 3KXFA 1AG0A 2R0ZL 4XCYB 2PW2A 1JHTA 1BEYL 3HC4H 3V10A 2VLKA 2VZUA 3O9WA 4G5ZH 3GZKA 4ISVA 1XEDA 3QB7C 2B8OT 1RIUL 5KBMA 4CGTA 2RCSH 4AYDC 4QRSB 1SJEB 2EYSB 2F5BL 4XP4H 5IM7B 1ZD6A 7PAZA 4DH2A 2F7QA 1ETA1 2V7HA 4LCWA 5ID0A 2VR9A 2Q7NA 1BM3H 1UZ8A 5T1DH 3DBXA 4G8IA 3T0DA 4LKCB 5DMIL 1RFDL 3BEVB 2ADFL 2EECA 2IH3B 4J3OG 2EQDA 4X7TB 1M71A 3BP7A 2NCMA 3CHQA 4N0FA 3GUTB 4HKZB 3WY3A 3P4MA 4HKJB 5JQHC 1JUFB 2XA8H 1V3MA 3VFWB 2H2PC 3GT6A 2AI0H 2CLZA 1C5CH 1MCCA 3TL5A 5A2KH 4L4JA 1Q0YL 1E5AA 2I24N 4D3CL 5F9JA 4I3RL 3ZKND 5IB5B 5ESVB 2MQ3A 4PW4A 2D7TL 1XTMA 2X5PA 2ZOKA 2EUWA 1LE5B 1SOSA 5IROC 3U7YH 5IB5A 1EDYA 1NUDA 1ZLVK 2UXFA 2GK0A 2AJSH 5AL8A 4AE0A 4XODA 4YSOA 1R0AH 3MRLB 1WHOA 3T6VA 2AQ3A 5A16B 4B7IA 1KIUB 1H8LA 5K1JA 2R69H 4JFSA 4PRNB 5DHVB 3GMLA 4NM8H 1M6UA 2AEQL 1MCJA 2CE6A 1OP5H 4W9HC 4Y4KA 4YPGB 4JO3H 1JV2A 4ELDA 2CJ3A 1U6AL 1ECZA 3UO1H 4E41A 3HAEG 3BKJH 4TQPA 5LGHH 4QHUB 4CN6A 4W6XB 1NMBH 5I74B 5IG7B 4OZGE 1JWMA 4CSSA 3FQ4A 4TNVK 2QQKH 1A3RL 3EJPA 1KGUA 5B38A 5C0AD 3AJ7A 1R24A 2VLRE 4PJ9B 1EZVX 2J8UF 5FYJH 3VXRD 4K15A 2IXQB 3GSQB 3T4YA 2HMIC 3KR3H 5EC1B 1YMHA 2XBZA 5CCKH 2PTUA 1HYRC 5EF2A 4KUZL 3GS4A 4K8RL 3VNYA 2R0ZH 4X5LA 2N59A 4Y88A 1BBJB 3UTSA 2APWA 1OT1A 3CXHK 5LJYH 1IQDB 1WWBX 3MV9D 3CE1A 4OGYL 1E9OA 2QKIB 3SGEI 2C3XA 3QUMH 4Z77A 2IVFC 4GP5B 1QPPA 4HK0A 5EZLA 1D3CA 3RZCD 3ZDXE 1UA6H 3AWFA 3LJ3A 4PV1C 5TDNB 5TQ0H 1EPFA 3WKPA 2CBTA 1I82A 5I1CL 1WWCA 4FG4A 3HR5A 5DK0A 3IGAA 5EOTA 5EULV 1BIIA 1IFHL 3QCVL 2IGFH 1U3ZA 1IIKA 1S8DA 1XMWA 3PQYE 1G7HA 1DBBL 3DXAB 4QRRE 3F04A 4TNEA 4FQHA 4F7EB 3V7AG 5F89B 3TF4A 2XACC 1PKQA 4J3XA 3KVDD 4ZXBB 3IFPB 3GXFA 4KVCH 3UBGA 4OQ1A 5TH2B 3EH3B 4LVOC 2VR7A 2IPUK 1CF8L 3KWVA 2DI9A 4EKXA 4YBQD 1CTNA 5FGCB 1AVAA 2YSSB 5JXED 5DS1A 2FT8A 2X89D 3F58L 2P8PA 1FNGB 3EW3B 2XZZA 3II3A 1IM9B 1BF8A 3WL9B 1LYQA 3SCMC 2XFGB 1NCNA 4NLHA 1PVHA 1WGOA 4L23A 3VFPB 3RKDD 3ZHKA 4MAUL 4S1SH 4LLQA 2X09A 4F3FA 1EZVY 3L4WA 3F7LA 1JL8A 3H6JA 4G8FA 3D4ZA 4OM1L 1P69B 1CE6A 1QEWB 4JHAH 1RIVL 5I15L 5FKPA 3RY5A 5DC9B 5DFTA 3HG1D 2AMUA 3G5WA 3UGUA 1ITCA 1X7QB 5JR1H 4N0YH 5DMYA 1ACZA 4N3UA 4IRSD 2EE2A 3GNML 5B7MA 4X8XA 1XCQA 5ETUA 5EBLA 3TF7C 5BXFB 4BQ8A 2Y5TA 1A1NA 3E2HB 3ILEA 2HJLA 1SYVA 4Z7OF 3ME0B 1GPOL 1VKXA 3D39A 1CLOH 3H7BB 2Z8SA 4B5EA 4MMZB 4LCYB 1SJHB 5B1BB 4EE2A 3MRNB 4XNZC 3QIBD 1F1GA 1K9TA 3L4UA 2WZAA 4XN5A 3KR3L 3QDJB 5D5MA 1I9RH 3UJTL 4QHNA 3KLAA 3T0EE 4R83A 1NTDA 1I53A 5LAXA 3WXVL 2OMZB 3MLXH 2LVEA 1H3UA 4MA7L 4E0RA 5FA4A 1WF5A 2D73A 1BJ1J 5F1IA 3SDAD 4BZ2A 2W81C 5HVHB 2LAGB 2ZD0A 1T2JA 5FLVA 5AVVB 5B1CA 3SBPA 5I71B 3KBFA 4G6MH 2FX7L 5F9OL 1I1AB 4L1HA 3ARTA 2VH5H 2VZOA 3ESPA 5IBUB 5KANI 3UXFA 1EZUA 2Q86B 2LTQB 4ELMB 4QOKD 1PDKB 2VLME 2DKUA 4N2CA 4P4RA 5IK3B 2HJLB 3N85H 4MHHI 1OAJA 1S9XB 1XXDC 3OJMB 3HKFA 4X98A 1P4BH 1KV7A 4K3DL 2HVJB 4PWKA 4F8LA 1YPZB 2WP3O 3LX9A 2J20A 3LNDA 2EXWC 3L3OC 4R97C 1PF3A 5GJTL 2IDFA 3NQKA 2NZ9D 2HTKD 4O5LH 2HG0A 2X4RB 4BFIB 3LPFA 5JOFA 3VSUA 4LAJH 2AQTA 2F0CA 2DL9A 4GI8A 2PO6D 3DURA 5I18L 5D1QB 2R0KH 4CMHC 4HGWB 2AAVA 5HGBA 4EI5A 3B9KA 1YLBB 1ZANL 3HB3D 3WNNA 5CLWA 4V2BA 4Z0XB 4GRWH 1XH0A 1BVKA 3SE4A 1RIHL 3Q2VA 4XXWA 5DUMH 3GUTA 4XC3H 4LOVA 2R4SH 4JRYE 3QRGH 5IESL 1OCWH 3CXDH 1LO2H 2FATH 4QOKE 3FQYA 1GMEA 4R5TA 1WRFA 4Y2DC 5HHMD 1NCWL 2W59A 3IFOA 2Q1EA 4LLDA 4N87A 1DN2A 1TZGL 3GI8L 4TSAL 5KSAA 3SEPA 1INQA 3PGDA 3QG7H 4LEOB 4AM0B 1NWPA 5ADPL 4OCXL 3SBRA 4U1HB 3MBEC 3S4SB 4MCMA 1S7XA 1AC6A 3X3GH 2GB2A 3VI4B 1RUQL 4B6ZA 2ERJB 1PIFA 4Z7UE 4FCAA 4QWWC 5I9QC 2GITA 3C75A 3BT2H 1F13A 1B6UA 2ADIA 4JZOA 3O0RL 4PJAF 1WZMA 1ZV9A 1KF9B 2V3EA 4QHKI 3RJOA 2MRYA 4HGKC 1DE4B 1OTUC 1ZS8A 3V4VH 2IPKA 2PWFA 2YD8A 4JR9H 3HE6D 1INDH 1DHKA 1XBRA 3KYNA 4P2OA 3EYVB 1QSFA 3LXCA 4KFMA 5EEWA 4OY9A 1FGVH 3BP6B 3OLEA 2PCXA 2C4XA 3CNKA 4DGVL 5A6LA 1MQKH 3HPJA 4OIAA 1J11A 1A1MA 2AK4E 1KN2L 2Y3AA 2ZUUA 2P5WB 1N8OE 3AQDA 4IBSA 4ACPA 5D1XA 3ZTJG 4P49A 3EO0A 2FAUA 4NDMB 1JERA 2HRPL 5TDOB 5JO5A 1PTZA 5KSBE 2YC1B 2H41A 2G75B 3LVTA 5F7LB 3WLBB 3WIFB 5IB2A 2G60H 4L8CB 4XPBL 4W4NA 1QEXA 2V6HA 3I3DA 3R18A 3SDCC 3KPSD 4H8HA 1CFNA 2JJUA 3B7SA 4OLXH 1A8JH 4GKZB 4JFHE 4PG2C 2AAAA 4JY6B 4ODXA 2O6DA 2JJTC 5DJAB 4IMLA 3E6FB 3FB8A 4DAGL 2OMTB 3JWNH 1EX0A 3ARDA 3D12B 4NB7A 4N3TA 4MS6A 3V95A 1PZ2A 2Y5TB 4I18B 3TFKD 3ULVC 3SBWC 1GGUA 2BNQD 3J8F7 3IS0X 4E5XG 1RHHA 3IPEA 2ADGB 3D4GA 2N4IA 2JI1A 3S37L 1AS8A 3RX5A 5MENB 1CDCA 4XCNB 1QWHA 1EHLH 5EWIH 3RDJA 2ZSWA 2RJMA 4IM8A 1ZVNA 1A6WH 3QC5X 2EICA 4UAOC 1BVLA 3EBAA 1JSYA 5BJTB 2O5XL 5D6CB 3FCTB 4TUUA 5EB9A 5IJDC 3ALXA 3KDMA 4NAMA 3H9ZA 2BOCA 12E8L 2PABA 3V6OA 2A38A 1EMTL 1RP9A 5L2JB 1Q38A 1NBCA 1JOIA 5B39G 4LFHD 1DJHA 1MHPH 1TQUA 3L3OA 4ZOBA 2CGRH 3GSVA 4PRPB 5D7JB 2VR3A 4X4KA 4R7DB 1GGYA 5EIQA 1IX2A 1RV6X 3VI3E 4KGLA 3Q6FB 1QBLL 1MAKA 3NTCH 1OB1A 3JWNC 3OXSB 3L9EA 4A63A 2Q8AH 3TNMA 2JK5A 3WXWL 1F4AA 5F7DB 3LH2H 2YN3A 4KVPA 1E3XA 4AK2A 1YMME 1OAXH 3L3GA 3JV6B 4QPEA 4XZUB 4Y2OA 2GY7B 3CQFA 2OI9C 1TNNA 4N1CA 4WV1B 4M6OL 2VSMB 2NYZA 1LDPL 2RH0A 2PF6A 2OTWB 4DK5A 3C2AH 4MCZB 2AJVL 1J7VR 1BLNB 2XJLA 4CJ1A 4H40A 1AJ7L 5KJ4A 5DD6A 2WLKA 1SDYA 1BZ7A 2ICES 4NS0A 2BVQB 3DUHA 5DSCB 1NCAH 1I7TA 4UQ3A 4C4BA 1T1YB 4MNHB 1XB3A 3CXHJ 3VTAA 4ZW7A 3QO1B 3M45A 1A7RH 4HX1A 3UJJH 5IB4B 2ROYA 5E4EB 3MUJA 4XNAA 2ZUVA 5D7JA 3RY6A 2R4RL 2VE6A 3IJEA 5CNHA 1T04A 2PP7A 2QFPA 5DJ6A 4PS4H 1I8MA 4ESKA 3KPRD 4P9HH 3GBDA 2BVPA 1UYWH 4ABQA 4TQ8A 3CLFL 3K6NA 4M6NL 3LS5H 4JG0L 3U9WA 1M7IB 2WBJA 5KW9H 3MJ8A 2B59A 1N6UA 1VZIA 2EEXA 4K5LA 3MRGB 4CVZB 1DN0B 3ABLB 2RTTA 4R84A 4K9EL 1M7IA 4FNQA 3NSJA 5IGXL 4PJXE 5A16A 3IAPA 4P2OC 4QRTB 3WS3A 5BUPA 1NINA 4XNZB 5FGCE 4HU2A 2LE9A 2WMPB 4K0OA 5FAAA 3GIZH 3O6FD 1KLGA 2HJKA 1G9NC 2J8UE 3HLKA 5FPIA 4MJ5A 5E2TL 3SPVB 1D6EA 3RA7H 2VO8A 3FHAA 4PGEA 4XNUL 5JQIB 5D1XC 1S9VB 2EZ0D 5SX5H 4B96A 1GGCL 3I50L 4HUWA 1E9QA 2P80A 1BFSA 5AFAA 3WLWD 1AY1H 2IMNA 2WUCL 4OU3A 4UU9A 2AMGA 32C2A 4B0MB 4DT2A 1HI6B 5ANME 1JUFA 3BSGA 4X9HA 4Z7VA 5E56A 3T0EA 2F58H 1EAPA 5HJ3B 4PG2A 3CFEA 1HI6A 4FNRA 4YIQA 5E1AA 2AEOA 2GJPA 3OKNB 4Z7QE 3QQ3B 1BMWA 2IBZY 1PKQE 4P5TC 4EUPA 1I1FA 3B3IB 5FCSH 2JCWA 4Y4FB 1RUMH 5E1GA 4LSPL 5DC0A 2VJ8A 1FFPA 2XWRA 2MOVA 4JQXC 1B0GA 2AJUH 1VFAB 3AAZB 4GRLA 2DBLL 2XV3A 4OZ4A 4F37K 1BBJA 3UTSB 3FUHA 1OWRM 2J4WL 1UB5B 4R4ND 4MMXC 3VWKD 4I3RH 3SGKA 1P1VA 5JW5A 2WV3A 3KYNB 4AV0A 4NKMB 3QJFB 1ZY9A 3SDAA 5CMAB 4YK4B 5MP6L 1WV7T 4LQFH 1KB5L 1WZ1L 3B5GA 1J9RA 1S8DB 2C8NA 4B3VA 4NC0B 5T5FL 5C0IA 2C9SA 1UVQA 5J12C 4LCWD 3WHE1 4AENB 3Q2CA 5HYJD 2VDQL 4MAYC 1T5XB 3S3JA 1FH2A 4Z7UB 4UUJB 5AOLA 1X5LA 4NDMA 4OAWB 4YIQB 5E1AB 5KS9F 4BJLA 4XX1E 3L7FB 5DT1L 5DD3L 5EN2A 2UWEB 3PJNA 2Y2WA 4GAGL 1RUAL 4CNIA 2EDTA 4UTBL 5MERB 4ANWA 4YLCA 1UH4A 2EJ1A 3EBIA 4JFZH 3GRWA 4NGHH 4OZFB 4JKWA 5KZCB 4D2NA 1TQBB 3MXWL 2GAZB 3U0TA 4C4KT 3P77A 3VGAC 3NABL 4F7PA 4F15C 1GL4B 3T77B 1SMOA 2FYYB 3L1OH 1WIUA 3P2BA 2VMDA 1SDDB 1NOAA 2H26B 2G2NA 4ENZA 4LCUA 2Y7NA 3HG1A 1NMCB 4JY4B 2OK0H 4KRPC 3D9AL 2IDCA 2ZJSH 4JFEA 4WI9A 3VGFA 4P23C 2XWEA 3WN6A 3FT3A 5AOKA 2DH3A 3VXRA 5L4JA 3TIEA 3CLEH 1QZNA 3GHBL 3PL6D 1LO4L 4J8RA 4K7PX 3SZ6A 2JELL 4ZZFA 5J9PB 4X4ZA 5HYFA 2HT3D 3RI5K 4NKDA 4HFWA 4FFYH 3TO2B 1ZIBA 3D3VA 1N68A 2P5EE 2OYPA 4OLYL 1JS4A 3SIKA 3NOIA 3SY0A 5JYLA 3PP4L 4P0DA 2WWOA 2HZHA 4OBRA 2HLFC 1D5ZB 1JFQH 3OB0H 1A1OA 3JXAA 5IF0B 3P30H 1ULVA 3FQTB 4XOBA 2CBPA 2H2PD 3GRWL 3K6DA 4XCNA 4U6VH 1V05A 2P5WE 4GMTH 3QVAA 3QFJE 2E47A 2VRAA 3F5WB 3CDZA 3S97C 2CJTA 3N43F 3MJ9A 5T1LA 4PS3A 1UZ6F 4FYRA 5H2BB 1X6NA 4L9LC 3HE6B 1A6PA 2VISB 3LZNA 1JZ3A 3AG2B 5F72S 2H26A 4HHWA 2WLNA 4XWGH 4TLSA 4IQHA 3S37H 3TTSA 4Z7IA 1O5PA 4EMZA 4Z0XA 3QEGH 3U4EA 4NQXA 1AGDA 1C08A 1OSPH 5A2CA 2EIBA 1JZ2A 1GJIA 3UERA 1A6WL 3ARZA 1MJJB 1R34A 2YOCA 4HMEA 4LIQE 4FI6A 5H94B 3RAJL 1ZT7B 1F58H 2VLRB 3AU0A 1EFXD 3IDXH 4G7QB 3TCXA 4LCWE 1S7VA 4NENB 5HHPA 1N6VA 3ARGA 2J1WA 4ZTPL 1I7UB 2BJMH 3AT0A 4KKBD 3FUIA 4QNPF 4AGOA 1FLTX 2Y7QA 1JNHA 3TIDB 2G5UA 2XTJC 2X7LA 5K33A 1JN6B 3MLUL 3QFGA 4OJEH 3RWJA 1WSST 1Y6NR 2V7HB 1FL3A 3E38A 3TH4T 5CGMA 1JXJA 1MW0A 5SX4H 3NDYE 3V4PA 4NO3B 1A7NH 9PCYA 1KCUH 4JFZL 1CXLA 1U4EA 3ZHFA 5KVGH 1G7PB 2GKIA 4LLUA 4PBXA 1G6RA 4G5ZL 2FHCA 2CXKA 3Q6GL 3RGVD 2IALB 3AU1A 5B8CA 1I85C 4OF8A 1R3HB 5DRNB 1R3IL 3ULSA 2DQUL 1DQML 2H1PH 4HGWA 5FM4A 3CK0H 4NQXB 1T7XA 1N5YH 3UTPD 1E5UI 3DX7A 4HWNA 3HG0A 2D0GA 2ZAIA 4F1ZA 1A9BA 1PEZA 4JJOA 4LKXB 3U30C 2HX7A 3WDHA 3D08A 3FUFA 4F93B 3ABKB 4F15B 2DMBA 5DJYA 3EH5B 1DVSA 3QH3A 3V2AR 5LBSH 3GSNB 1AD9B 3D30A 4OLEA 3SDAC 2X4OA 4U1HA 1PPIA 1QBMH 1F90H 2SEBA 2CKBL 2YQGA 4Z78A 4GRLB 1H6UA 2AV1A 4OZ4B 3KGSA 4PGBB 1F41A 4HBQA 1RZJH 1DDHB 5HHOD 4X80H 2FLBT 1VIWA 5DURD 4CSPA 5CAYB 3ZT7A 1OTSD 1JP5A 1NGZB 1DQDL 3VG9B 2DS4A 2QSVA 1S3RA 3BSZA 2VRKA 1BIIB 3WIIL 2BLFA 3P4OA 1IGIH 4PHXA 4KJYA 4Z7VB 1DQKA 1Q1JL 3B9KB 1NAMH 2W9DL 3CPLB 3D25B 5FOBB 2R1XA 2ZOOA 1OPGH 4F8TA 3ATBA 3QWRA 4FZ8L 1E8XA 1GZHC 2CZNA 2EDJA 4KKAD 1FCGA 4PH8A 1VDGA 3MZTA 3ZL4L 5HDQL 4ZQTA 4HIHA 4LBEB 1NLBL 4MHHG 3CDGB 4XXDB 3IGKA 3DV6A 3TYGH 4ANXA 4ZMQA 1JRHI 1GTFA 4UNVA 3QCTL 1WFOA 1NGPH 5AVYB 4RH4A 2DJUA 1KXQA 1N2RB 1U8IB 3DGGA 5IQNA 5HHQA 2CUIA 2C9VA 1S9YA 3BFOA 5G4NA 4JRXD 5I6XB 4JFOA 4R96B 3SYQA 5CFAA 2ARJQ 3NJVA 1NPUA 3GSNH 3J2PA 3WO3B 3RTQD 4AYEC 1SXNA 5CZVH 1ZT1A 5E8DH 4N6QA 4OGXL 2GITB 3SKMB 5DO8A