3KCWA

Crystal structure of ganoderma fungal immunomodulatory protein, gmi
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
110
structure length
110
Chain Sequence
SDTALIFTLAWNVKQLAFDYTPNWGRGRPSSFIDTVTFPTVLTDKAYTYRVVVSGKDLGVRPSYAVESDGSQKINFLEYNSGYGIADTNTIQVYVIDPDTGNNFIVAQWN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords immunomodulatory protein
publication title Single cysteine replacement at Leu6 increase the potent and thermostability in Ganoderma fungal immunomodulatory proteins
rcsb
source organism Ganoderma microsporum
total genus 27
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2009-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09259 Fve Fungal immunomodulatory protein Fve
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3kcwA00
1OSYA 3F3HA 3KCWA
chains in the Genus database with same CATH superfamily
2K1MA 2CKNA 3D33A 3GXUB 3HC0A 1NMBH 4HXAL 1JWSB 4YSEA 4YSOA 3MODH 1FJ1B 1XCWA 2OR9H 2N1KA 1AE6L 1I75A 5TK4A 4JRWA 5MEOA 5K93A 2MMXA 2ZXCA 1IC4L 2AZAA 4PUBL 3DA0A 1MDAA 4UB0H 1FZMB 3TBTB 5LN8A 1NQBA 2NSQA 3D48R 4P23D 5BS0A 1YDPB 5EZIL 5IVZA 4BA8A 3DGGB 4LFHD 5CUSH 2EDMA 4OLEA 5T3ZE 1AACA 3FTGA 3V10A 4PJDB 2AABL 5I74C 5E03A 3GJFH 3BD4A 4IRSD 2OA9A 4I0CC 5CP7B 2Y36H 5B8CC 3EJUA 2J8UF 6CGTA 3FPYA 1HE8A 3A4FA 4U7KA 2VDPB 5AZEH 2YD6A 3QYNA 1BM3L 2F7QA 4ONGL 3ZMEA 1JDCA 3AT9A 5ICZB 1GS8A 2ZP9A 2AEQH 1WAAF 5E56A 1IAKA 1QPXA 2QPEB 3WKML 4CKVX 2AV1A 1X9QA 4HIPA 4TF4A 4JZJB 4XNXH 1D5ZB 4FJYA 5KSVB 3OHXB 1FAIL 5ALBL 5IFHL 3GZQA 2VC2B 5L2KB 1CGUA 2PYFA 1CK0L 4W81A 1ZY9A 1X5AA 4IIQC 2WTRA 5C0RL 3C60C 5HHXH 1HCYA 1H3PL 3NN8B 1MKFA 4ODXB 3VA2C 3RWEA 1GGYA 4AL8L 1YSOA 3NIDB 4XB3A 4Y5XC 2O61A 1A6VL 4GP8B 4KZ0A 2DJMA 3L1FA 2EDKA 3D34A 4KXBA 3ZZLA 4LLWB 2OYLA 4JO1H 3KPPA 2EIMB 5D4JA 4ZPVA 5F89B 4ERSL 1QSVA 3E0GA 5IQ9B 4UM9A 2XU9A 3A4EA 4WWKB 1BVLB 3RWFA 3TF4A 4XPAH 3VXNA 3MCG1 4TV3A 3X12B 5CN1A 3FFCD 1CR9H 1PIFA 5T33L 2X40A 3NJHA 5ANMB 2H26B 1NIEA 2B77A 3MRKB 1V55B 1OSYA 1G6RH 1ZEAH 3EYQD 3FQUB 4ZX4A 3VQ2C 5DHVA 4F5CE 3WEBA 2HP4A 4L4VA 4M9OA 1A1OB 1T5XA 2RACA 1LQSR 2Z0UA 4MRBA 5E5MB 3BPCB 5GGRA 4B3EA 1NDMB 1YEEH 2C7UA 3EUUA 3LNGA 2NW2A 4RSVA 3H2WA 1UXWA 1EFXD 1BX2A 3CN1A 5DQ9B 1TZGL 4MDJB 4HAKA 1HHGA 2WSDA 4ABQA 1G7HA 2R4RL 3ULUL 4PGEB 4OB5H 3AJ7A 4HPYL 1JYWA 1QFWL 4M7LT 2VSMB 2JKRM 4S1QH 4KJPD 4Y9CA 2OTWB 4OCXL 3S35X 1SXCA 2WOYA 2X4SA 3LKQA 1FCGA 4IBLT 3QI9D 2A2QT 4JM2B 3QIWD 4ZMLA 5ESAB 1J5IA 2IH9A 1U91A 5B1JC 5C08D 5I8KH 1NBYB 4I77H 2HB0A 3RAJL 4HWEL 3CLFH 2YZ1A 2APXA 3VX1A 1EV2E 1L6XA 2QSQA 3VJ6A 2FNWA 4QOKA 2C3WA 1H19A 5I2IA 3N04A 4WI0A 1CE6B 2V33A 3K6SB 4PJ5A 5FM5O 5PCYA 4JCMA 1MCJA 3FOMA 2BS9A 5IKCA 5INDA 5JYMA 5K33A 2JKTM 5DF0A 1A0QH 1U95B 3GMOA 2F1BA 1O9ZA 4OCRL 1QO3B 2I32A 1PZAA 4HUWB 1HQ4A 3D0VB 4GT0A 4O00A 4RAUB 5DQDH 3QCVH 2D3VA 3HB3C 3KZ8A 3VFVA 3IWVA 4P46B 3ROLA 4FMVA 4ZUTA 3LS4H 2E9WA 3G6JE 5I6MA 4PVBA 1JZHA 1KTJA 1P1VA 3AXIA 4RFEA 3RZCB 5I1CL 1JN6A 4A6YA 4TVPD 4OZIF 3LV3A 1CO1A 5AYUL 1B4TA 1GZQB 4ETYA 4F2EA 1J86A 4LAJH 1ZPUA 3PHQB 1NLDL 1RIVH 2B7DT 3ZE1B 1UKTA 2EDHA 2I07B 4PV9B 4BZ2L 3AU0A 2DQDL 4Y2DA 1AO7D 4KHXH 1ZA3B 5T3XE 4GQZA 2YA1A 4LVHC 3WY1A 5JW4R 3UZQA 1G84A 4XN2A 2CCLA 4FG6C 4P9HH 3AY4C 2QPSA 3BUIA 1LE9B 3TLRA 3QPQD 3KJ6H 3SHSA 2AXFB 5AAPA 2X12A 2W0FA 3VRIA 1U30A 3PIQB 3NZ8A 4O4YL 4RMTA 3U46B 3QNZA 2FL5A 4H0HB 4TKWA 4OUUB 1LNUB 3L4WA 3CN3A 4XPFH 4IK7A 5F88A 1P69B 4PJ6A 4DP1X 3QUMB 4N0YH 3T6VA 1A3QA 4BFBD 3QDGA 1PTZA 1KGXA 4L29B 4MS6A 1PF3A 1FO0L 1LWHA 1JCKA 4BHUA 5DI8B 2CDGA 2HT4D 2ZCKH 1LO0L 2C9XA 1C16A 3VFSA 1JUFA 1CXFA 4JJOA 3P9WB 1TPXB 4PP2B 4ZFGH 1JZJA 4JDVA 2CRMA 4LGPB 2HT3D 2H2SD 4HGWA 4QRQB 5HVHB 4FQ1H 4ZAKC 3FJTA 2G5BA 2Z7ZA 4MJID 4HS8H 5DUJA 5GIRA 3J27A 5E2VH 3CQFA 3ESUF 3W2DL 4BM7A 4DGVH 3T1WA 4MLIA 4JKMA 5EC2A 3HKFA 1P2CA 4Q7DA 3V0DA 3SDXE 4FHKA 4PY8J 4CILA 3HBQA 2BIHA 2IADA 2G3MA 3ULVL 4CVZB 4HUUB 4X7CC 4WGKA 3KWTA 4P3DA 1WHPA 4KTDH 4AKPA 1I7UB 1ULVA 4D2NA 3WEXA 4KUCF 4ANWA 2NX5B 2VITB 4IRJD 2EE0A 2IPTH 4DKEL 1DP0A 1L9TA 1OSPH 3OC8A 2HMIC 1BD2D 1BVKA 3MMEA 4JPKL 1WO2A 1T80A 2WSKA 3UJJL 4GRWF 1CL7L 3WNKA 5HYJD 2AK4D 3QIUA 4OLVH 1BOYA 1TTRA 2GTWA 2L0DA 3MHZA 4MAUL 5AW7B 5ILTH 2Q76B 1RZ7H 4Y16A 2EILB 1WK0A 5ERWB 3X3GH 4YFDB 4DKTA 2E46A 3U7AA 1XFPA 3EBGA 4LU5L 1BGXH 2QV2A 2AKRA 1HKLL 1YMMD 4APQC 1ZHNA 4YWGL 3UTPE 5EIVA 2MKLC 2DIJA 2TAAA 1PD6A 2E4TA 4F15B 1HHIA 3BZ4A 1CF8H 1C5BL 1QPPA 5JZ7C 4QRPA 4OGYH 3F00A 2FX8L 3CUPA 3MLYH 4C56B 4NLHA 2J56A 3RBSA 5J6SA 2CG9X 5AQ0A 2PF6A 2VH5L 3RDJA 1NKRA 3SJVA 1V8HA 5BOJA 4ZUUB 1CI3M 3BKYL 4UANA 1FLRL 1VA9A 3C5ZA 5D2NA 3KLAA 5EBWB 3V6OA 2CBPA 2VOTA 2CLVA 3E8UH 3MGOA 1A6WL 4KI5D 3BVUA 5DGQA 1KTBA 3KYMA 4B7IA 1R3HA 3NCEB 5EB9A 5KVDL 4DGUA 5JQHC 1FF5A 2CUHA 4FNSA 4UDUB 1V05A 3EFDH 1DQMH 3LQMA 5GPRA 1ZLSL 2PCPB 3ZR5A 2ZAIA 2JVUA 1S7UB 1FORH 2DOCA 4NIKB 2NCEA 2MCPL 4AQAA 1BDYA 5T1JA 2AXGA 2Z35A 1UT1A 1GTFA 5G5DB 1RFDH 5DUML 2F53A 3TN0D 3DXAE 3N44F 3VNZA 1D2PA 5EEYA 4DUWA 1AP2A 5E6IB 3L1OH 2V9TA 2ZUVA 3PNRB 4PRHE 2ESVD 1EH9A 3QDME 5IQOA 3WIIL 3PWLA 5GS0H 3DJRA 5JIIA 4XWOD 1XGTA 2RMNA 1JTTA 5F7EH 1PGRB 1CDYA 4MSWA 1S4IA 2XIDA 4E9VA 5SWQA 4WUKH 5INCB 4JPSA 5FYJE 4QY8A 4NQEE 5A6LA 1G9NL 3BVNB 1HI6A 5FFLA 1HOCA 5HYEA 5JR1H 1J18A 2J1YA 4DEPC 2XXCB 3CHQA 5A43C 3BVVA 3ZL4L 4B3VA 2F5AH 1RMFL 4U1NA 4F7EB 25C8L 3HE7C 2ICEC 4Y9FA 4WTQA 1BIIB 3WN5C 1PG7W 3NFSH 1NCBH 1LHZA 2IFGA 1RJYB 1U8LA 1E4XH 5FOBA 4AQOA 2X6VA 4QMEA 2MQCA 1EZVX 2V2XA 5D71L 2H41A 1Q9KA 5F9JA 3L1GA 1JGEA 5ICYA 4BQCA 1FIGL 2WYIA 5F93C 3I6LD 2YUVA 4KO9A 2WXFA 4AQ1C 2HKAA 4JO2L 3U6RB 2BRRL 4DPBX 1WEJH 1RZKH 4N0FA 4O2EB 1K4CA 3L4TA 3I6GB 1DCLA 3IMBA 2F19H 2XV6B 3OJ2C 3ENEA 3GSVA 4WNQB 5DRZA 5EWIL 2VDPL 3QXDB 2P52A 3VFGH 1LMIA 5C0IA 3NJLA 3BE1H 3WXWL 1XF5A 5D1QD 2P5PA 5B1BB 3R8QA 3F8UB 3US9A 4S1DC 4ZW7A 3U7WL 3QRGH 3KPSD 2JJSC 2Z4QB 3T0WA 1GGTA 1YYMH 2AP2A 4G42A 5BV7B 2BH0A 1D6VH 2AK1H 5ICXB 3BP7A 5CFHA 4QYOA 1EAPB 3MNWA 4MLSA 1X7QB 1MXDA 3SGJA 5D6CA 4BFIA 4QRRB 3VXQB 1AIFB 1GRWA 5H37H 4XXCC 3UMNA 4U3CA 2BIMA 1E0OB 1KULA 1KTDB 4TRPL 5EEVA 1PL3A 5A3ID 3TNMA 4P2CG 4NQXB 1QSEB 2P9RA 3F7PC 1U6AH 4P04A 4JY4A 3A6BL 4FFZH 3WELA 2HVKB 4TNWK 1KTCA 5KN5B 3I9AA 4AYFB 3TS8A 3WKQA 2WJ7A 5D7IE 2VL5B 5I15H 1A9EB 3UROR 1WC7A 2PKDA 2NY3B 1HZLA 4FI6A 2I24N 4F57L 1G9EA 4XX5A 3DWTA 4X6FB 3ZW3A 5DWPA 4OIFA 2WBJB 3VB8A 1NEZA 2FWUA 3UXFA 3JWNE 3S88H 2IG2L 2C4FT 1I9EA 1NCGA 4OZFG 3VFWA 1KIUB 2BOCB 2HWZL 2PN5A 4UAOB 3TFKC 5LDUA 5EEXA 3AREB 4Z95L 4YR6B 4M61A 4FA6A 2DQEL 4WCYL 4XC1H 3HS0B 4OLUH 1RUKL 2YMXH 1YA5A 1R5WA 5IBLC 4U6YB 4V11A 1ZLWH 1BAFL 1ZD6A 1Q9WB 2KDYA 1CE1L 2F74A 3BEVB 4Q2ZA 4QHUA 1DJXA 4YK4C 3O2WL 4DVRH 3UIYA 4HIEB 2DTSA 3QDJB 3HMXA 4PP1C 4XGZB 3U82B 3WKNA 4D9RD 3QZLA 4HAGA 4BFFA 2FEDC 4EKJA 1D9KC 2P47B 2COQA 3GJFB 4OIBA 4F8QA 4FQCH 4QXTA 4TTDC 4TSAL 4PJGB 1N7ML 2X4QA 1B2WH 4AM0Q 5D7LD 2VDMH 3CC5B 4K5NA 1F41A 1OCRB 3BUTA 1NCIA 3S5LG 1W0WA 2CKBB 3GIVB 4IKLA 5J9PB 4MKTA 3O2VL 3OB8A 4NN6B 1KTRL 1WD8A 4H1LG 3RX9A 1XEUA 1IE4A 5DJ0B 4NNXA 2EKSB 4PI0A 1B4RA 1AMXA 2AXJA 3GEFA 3V0IA 5AKRA 1GZHA 3ZVVA 2G9HB 1LK2A 4RFNC 3ELAT 2WPGA 4QRTA 3RU8H 3B2DC 2DM2A 3ARFB 3NJJA 4XPGH 3U0TB 2HFTA 4MMYB 1IVTA 3D2UD 4JAMA 5CBEA 3S34L 3MRDB 5KOMC 3D0LA 1Z0NA 1DEDA 1QZ1A 2G4EA 1AS7A 2EH7H 4JUTA 2DQHH 2VXUH 5SWSA 3MV9E 3IU4L 4IGBC 3DIDA 5C0CE 5I19L 1KIRA 3FQ1A 5FF6B 3WDIA 2BS8A 4AOFA 2YD7A 1YLBB 3FN3A 2I60H 1KJVB 3H6AA 5C0BB 2NY5H 2MNUA 3X1GA 2JIXD 3O6FC 1IAMA 1GMIA 3MRGA 4GO8A 3OF6D 2QR0A 1ETA1 1MW1A 2HKHH 4P2OC 4WW2A 2X4NB 2YAEA 5H4YA 5T1DL 1IM9B 3REVB 1WIOA 4GMSL 2A4CA 2FSEB 2W92A 4AIOA 3AGWA 4WO4B 1G6RB 1NGXB 3CZGA 3TV3L 3C5JB 4P2QD 2CMRH 2UZIL 1OF0A 4NPKA 3RVXC 1OT4A 4UDTA 4YH6A 5LGKA 3JWNC 1NC4B 4JREC 5IM7B 1S9YA 2GBTA 4HALA 1FGVH 1VDGA 4BUQA 2DH2A 3MRQB 4ZSOA 4RFOL 9CGTA 1NFIB 3BZ5A 2DTML 4MQ7A 2OMYA 1AZBA 1KN4H 3VXSE 1PFOA 3EJCA 1NLBL 1DVXA 5MHSE 1EHXA 2E86A 2LTQB 5DWUH 2ZWYA 3O81A 3NRPA 4JFOB 1G0YR 1WS8A 3BD5A 5AKVA 4KXCA 3T8VA 1MRFH 4JFYA 4I4WA 3O0RH 4DCQB 3AS0A 4U1JB 3L4UA 4WFFD 2OMXA 2EC9U 1P4IL 3D12B 5J1SC 4R0LB 1IL1B 1NTDA 1A4KB 1AQHA 3LEVH 2ZOTA 1N2RA 1CB4A 2FQEA 3H2PA 3CN2A 4HOMA 4YL9A 2ICES 3QHFH 2RFXB 3IDGB 3KWWA 3CMGA 4ENED 4MQXC 2FJFB 3D52A 4B97A 4MMZA 3UCQA 5JIHA 1WLHA 1WZLA 2DQJH 4N5ED 4XMPL 4YPGB 5IOPB 5K9QG 2ZYHA 2FEEI 2APWA 2XWTA 4WAFA 1JFQH 3NJIA 4W4NA 2WXJA 5C1MB 4JFXA 1BVOA 3DDGA 1ZLVK 3LCYA 4PREB 3RX5A 1AH1A 1LD9B 2BNUB 3WHE0 1S9KC 5JO5A 2D3NA 3VRLF 1M3JA 2CLZB 4LRIA 3BP5B 2CIKA 2XNAA 2AAAA 3GSQA 2AV7A 2NZ9C 4GOSA 4AZ8A 1O5DT 3K74B 1KB9J 2CDFA 1Q9LA 4AKOA 4XCCL 1QLRA 4DKFL 5EU4B 3ISWA 4R5TA 5GGVH 3JV6B 1OAQL 5F3BA 3WO4C 2UZXB 1NL0H 3UYRL 2J21A 4ZD3H 5ECGA 2DQ6A 1I4FB 2H6PA 1TZHB 1ZGLB 5DMIL 1RZQA 3QUZA 1MFAL 3P30L 1L0YA 3NAAL 4NM4L 3LN5B 4AQEB 1UWGH 1IRAY 2FB4L 3AUWB 5KSAD 2CIIA 3CZLA 1MCFA 3OTTA 4DQAA 3KCWA 5TE6H 3QEUB 2HRPH 4RQQB 2AJYL 2BSBA 4Y5YA 2XWCA 1QR1A 5C3TA 4M02A 3DECA 1KB5H 3MLVH 4X8CA 3SDCA 5IHWA 4M5YH 2NYZA 1CLZH 1I8LC 2VR6A 3B3BA 1NCDH 2KLSA 1ASQA 3VWKD 3DX1A 4IU2A 4HV8B 1W80A 3SKJH 1VADB 3HZVA 4PJAB 3M17B 2R7EA 3TYFA 4U6HA 1KOAA 2Y7QA 4Y4HB 1RJZB 1M6OB 4URTB 1AR1C 1JK9B 3GLAA 1UC6A 4R3SB 4WSGA 4RGMB 1YY8B 4DZBB 2YRPA 4WF7A 1J5HA 2BNRB 1GL4B 1PY0A 4IDLA 1UACL 1O6SB 2X2HA 4PGCB 1LEKA 2BY1A 2BINA 4P2YA 1Z3RA 3MJ9H 2CLRB 1CFSB 2EIDA 2K9FB 3B9AA 5AB9A 1I8KA 3DETD 3EXLA 5ABZA 3QXTA 2ZWSA 2B4CC 2IAMC 1R24B 2YSTA 3F65A 2Z8RA 1MI5B 1OSZA 4YLBA 5D5MB 4ZW8A 4YOKA 3SBWC 2HTLD 1UJTA 1Y18A 2I27N 1WH0A 4BZYA 3JBG7 1P4LB 4NNPH 4PTUB 3DK2A 3BOVA 2YQ3A 4HMCA 3DO3A 1BEYL 4I2XA 2CK0H 4NXKA 3UJIL 3ULUE 1NGZA 3N06B 3PL6D 4PEEA 4QTHB 3OBAA 2PW2A 2RALA 2Y3AA 3FUFA 4FNQA 2KC0A 2XN9E 3VI4F 1PZ5B 3QFDA 3FQWA 3IF1B 2RJMA 3B9EA 3WU1A 4ZS7H 3JVGA 4Z5RA 1LDPH 1NUDA 1B0GA 3M1CA 3BVTA 4KUZL 2H3KA 5DR5H 3EYSH 3BCDA 4FKHA 1YNKH 4ABWA 2BHFA 2XZQH 5GRYA 3HBZA 5EN3A 4PJXF 3B3IB 2JK5B 3EBAA 3LKPB 4WSKA 3TV8A 1YG9A 1YPZF 1DVFC 4OM1H 4N8UA 3BRDA 1SYSA 3TIEA 2W1NA 3EYOB 5F1IB 4A37A 3WTXA 5DT1L 3BEWA 3T09A 2HJFB 3IB4A 5D6DC 3NCXA 3BHBA 1KXTA 3MJWA 4L4VD 1J0YA 2CE6A 2FNBA 4XXDB 3MBXL 1QBAA 1QWNA 4ZMZA 5CCJA 3O3AA 4G6AC 3NJXA 4M6AA 2CO7A 3CZFA 1BZEA 5FYKH 3CFUA 1D5MB 5B39G 2LE9A 4P5RA 3GXPA 5KG9A 3V7MA 1I3RB 4Z7OF 2ZWLT 5H2BA 3V7AE 3DX9A 2VSKB 4K3HA 1ZLEA 4XVUD 4M5ZH 4OKVB 3NSJA 5B38B 5I76B 3O9WC 2N7AA 4OD2B 1I8AA 1OTUD 2Y7SA 4UM8A 2VABB 3AG3B 4K73A 1RY7B 1W8OA 3PP3K 4ODTL 4AK2A 3C8KA 5JDSB 4HYTB 1MIEL 3O6MH 4AGPA 3S37H 3O2DA 5HY9A 3GMPA 1NMBL 4PJ5D 2D2OA 2IGTA 1QR4A 4WRLA 5FV2A 4WV1B 3MODL 3OJDA 3OKDA 2OR9L 3TEWA 3KPTA 3FT2B 5JPNA 4GP4B 1HHJB 4OGQC 2W94A 1FG2A 5FK9B 3H4HA 4KMTL 4L3EB 2J3SA 3IFLH 2ALWA 4BK5C 2XX0A 4PJ7F 4X7SH 1MY5A 5CJ8A 4F7MA 2DDQH 2VERN 1T0OA 3SDAB 2BWIA 1XCQB 2JLPA 3T2QA 4ZZKA 5CUSL 5FA4A 1OWWA 2GJ6D 5A2CA 3ZE0B 3KXFA 4N1CA 4XNYL 3N85H 1P6WA 3UTOA 2EUXA 5F21B 1NGYB 3S6CA 1MHHA 1XH3B 3L5JA 4YXLH 3PHOA 3O3DA 4MHHG 5KSUA 5IJKC 2ED9A 2Y36L 5EBGA 5C0JB 4YIQA 3GXIA 3FSVA 5FGCB 3VTAA 1WHOA 4KY1H 5AZEL 5IHBA 4P2RA 3TBVA 3SOTA 5HHVH 2AEQL 4M43H 4HFUH 2EDEA 2PTTB 3CE1A 4M6MH 3F04A 4U1IA 1TTGA 2R1WA 1UVQB 4XNXL 3MV8B 3QEHB 4LPCA 3BD3A 3QXVA 4GI8A 3K2UH 4NPYB 4RISH 3WEAA 4NRZA 4X9IA 1I7TA 4LCCB 3D05A 1DFBH 4JO8A 3TJEH 4LLUA 4Z7UF 2A73A 1P4UA 3DUHA 1H9DA 5BVPH 5A2JH 1XAUA 4YC2B 5DRNA 5HHXL 2N56A 4NQSA 1FLTX 3A6CL 4YSUA 2XG4A 2BDNH 2AGJH 3JYCA 1EDHA 3GUTB 2GW5A 1L0XA 4X9HA 4K7FB 2KPWA 3MXVL 2GC4C 3RIFF 4JO1L 2R51A 3GMQA 4X5PA 4OV6F 1TLKA 3C09C 2Z7WA 4NQUA 3ZXAC 2WSPA 5E7FA 4DP8X 1KPRB 5EU6A 2YR3A 5ID1B 3K71A 2ZSWB 3D3VA 4XPAL 4R7XA 4JKLA 2FUQA 4JJ5A 3VH8B 3MBWB 5F1NA 1U33A 4FP8H 2VLJA 1IM3A 1F4WH 4KZCA 4NYLA 2VO8A 1RUMH 1INQB 5L8KB 2CGYA 3CVDA 5J6HB 4NM8H 1G6RL 1ZEAL 2CO6B 4NLAA 2WZPA 3HN8A 5F7UA 3RGHA 4IJ3C 2A6KB 5K1VA 3PU7A 5F6HJ 1JHKH 1YEEL 3GJEA 4KK8C 4GI9A 3FNKA 2K0RA 4R4BB 2QQKH 3M1BB 3QUXA 2Y6SD 1KC5H 2HVJB 3OZ9L 2NR6D 3RGVC 1JXKA 1U8IA 3TO4C 2N01B 3ZTJG 4NN7B 2NNAB 1MVUB 1T0MA 2EE3A 4I48B 4OB5L 2VAAB 2BMKB 2CA4A 3VSVA 2L7JA 4S1QL 5E5LA 3UJTL 3BSGA 3HJ0A 4Y7MA 1U58A 4FYSA 3PQYB 3U48A 3BT0A 1NCUA 2JTDA 4Y16D 5E4OA 5KW9L 3C6LA 2OR8A 5I8KL 1D3CA 2ICCA 3GHPA 3KCPB 3DKHA 4I77L 1GJUA 1RHHB 4NKMB 3CLFL 3E80A 4PY8I 4NUGH 4OZHF 1FH2A 5T5FH 4PJEB 1GC1C 1PYWA 4GSQA 5F6IB 4MJ6A 1YN7B 1IKNC 1EPFA 1XGRB 4ZUVA 5HGHA 4QRPD 4BCZA 2VO5A 3LEXA 5JHDD 4HDIB 3K3QA 4CVXA 5I73B 2X4TB 3DARA 4G8FA 4P5TC 2Z92A 3RPIB 4HKXB 2G2NA 1RUAH 5CKGA 4HWZA 5DQDL 3QCVL 2NY2B 2W65B 5HJ3B 3LS4L 5E1GA 1QW8A 4WHCA 2GTQA 2RHEA 2WUCL 2ADGA 3C8DA 3H9SD 4WWPA 4CADA 2VSCA 1D5RA 2NQDA 2ZXBA 4RIRA 4G6FB 1WBZA 4XCEB 1S5HA 5CILL 1RIVL 3PHSA 3O4OB 5GHWH 4HH9A 5LGJB 1PDKA 3OKEB 3BQVA 4UCFA 1N5AA 4KHXL 3BWUC 4PJDE 4YBLB 5CR1A 4NQDD 2HLAB 5GGUB 4P9HL 2EIKB 4PHXA 3HG3A 5CEYB 4IBZA 1XH2A 1UD2A 2SEBB 4JJHA 5CIPA 4OZGF 3P4MB 5IROD 1BWWA 1T1ZB 4HP5A 5DFWH 2A74A 3L2MA 4W93A 2PABA 4B27A 4W9IC 3OR6A 5LCVA 3SZ6A 4U3HA 4Y2OB 5IGXH 1DSWA 4GKSA 1OKEA 5DA0B 4LSRH 3EYFB 4XPFL 2NYYD 4C47A 4R7LA 2X0VA 1F90H 4N0YL 3ASWA 3O3BA 1HOEA 2Z91A 4HU2A 3UZEA 5L2KE 2H8PB 2YRZA 3AGVA 2PR4H 4LEOA 2ZCKL 4KKNA 2ZXWB 2NY1B 3FONA 1PD0A 1YEFH 2K45A 4UINH 2CM5A 4N4YB 4ZFGL 1OCWH 2UY6B 3QPXH 2VRKA 3IFPA 4BZ1A 3TM6A 5DHYB 1UXMA 3NIDE 5TF0A 3CSTA 1FC2D 3D69A 1A2YB 4FQ1L 4HCRA 2ZX8A 4TNVF 4B9KC 1U93B 2XJLA 1RZGA 3CPUA 4HS8L 2WVVA 1ZHKB 1JK8B 1XCTB 2YQBA 5E2VL 2VSDA 5JOPD 5EEUA 4PJFF 3RKDC 4DGVL 4GUPB 1IGFH 3KDMB 5C07B 3CCHA 1DANU 3Q2WA 2QQNH 4HUVB 3DTUB 5DZNA 2E59A 4X9FA 1MWAH 3MBEB 1SQ2N 4WUUB 1JTPA 3FO2B 4KTDL 3WKYA 1NGPH 4HUKB 4EUPA 3SDDC 5A40E 3X1FA 5ANME 5I1DB 4V2BA 2YAOA 3K4ZA 2NUTA 1WG3A 2QKIA 2IPTL 2VDLH 4GRLC 5CHNA 1C5CH 1OSPL 4PRPB 1BLIA 4MA7H 1MG3C 5D7JC 3GXMA 1JGUH 5JXAH 1M7IA 4OLVL 4WGVB 5ILTL 4K9EC 2DYPB 2VN6A 2X28A 3PWPE 4H8UA 2DKSA 1RZ7L 4UT6A 1SY6H 3N1QC 5FHAH 5CD5C 2V3DA 1M71A 1PQZB 5J11C 4H5SB 4OVUA 1BGXL 4F5CA 1OE1A 3QEQD 5IBUG 2XKUA 3MNZA 4N1HB 1MAMH 2VKWA 1C08A 5I0DA 1IAIH 2UYLA 3US1A 4WWID 2ADJA 2MJWA 1CI5A 1CF8L 5AW8B 4OGYL 1ANUA 5MEOB 1YEHL 4RCAA 5E2JA 3LPWA 3MLYL 4A7GF 2C3XA 1MCBA 5CGTA 4HCIA 4Z7IA 5BS0B 4ADIA 3N50A 3RDTA 4RDQG 1B6UA 2XLLA 2R1YB 1I1RA 5D7EA 3W11D 3QUYC 2VZOA 2P8PA 3SE8H 1EFQA 6PCYA 4HLZG 3WMPA 5CZXC 3E8UL 5E94A 5CEZE 4DP0X 4ZMXA 3JV5A 5IW1B 3KLHC 4G9FB 4H88H 1TJIL 4FXKA 5D4HA 1R17A 2JI3A 3FB8A 1Q90A 2NZ1A 3CGTA 1UM4H 2L7QA 1UTDA 4HOZA 2W07A 2GQHA 4KITB 1IAKB 1KB5B 5LBSA 4LCUA 2WQAA 3ML9A 1UWXH 4O02L 4QDGA 1R5IB 3TIDA 3HHMA 1LXMA 4NX0A 1T5WA 3S7GA 3L1OL 1WISA 4PPTA 2WNWA 3AFLA 4KO5A 3ZE1E 3OC5A 2A99A 3AG4B 3G6JA 1T4KB 1UB6A 3TBWB 3EGDB 3LZNA 3H55A 2WTRB 5GS0L 5F71A 1I7ZA 4XMWA 3NQIA 2OJ1A 2NT0A 5F7EL 5AW1B 3FRUB 3RWEB 1M53A 3BUYA 4WUKL 3N42F 4YHLH 3M1OA 5ID0A 2O61B 3BIKB 2DI8A 1UM6H 3O41A 4GAFB 4JY5H 4AZUA 1S7RB 4U3SA 3QK0A 3BKMH 4JN1H 1OTSD 3L4XA 2YZ8A 4HD5A 4I87A 4EUPG 1G94A 4UM9B 3M7OA 4L3AA 2WMPA 2CXKA 2FIKB 2EDLA 2FO4A 4Z7NF 4MNGB 3VXNB 3IS0X 1SGKA 2Z1KA 3NFSL 4OD3L 5FYJU 2VL4A 4ZFQA 1U3HC 3SQBA 1MH5A 4PLKC 5K69A 7TAAA 2RAMA 2NXYC 1HWWA 2X44D 1FFPA 2ZKHH 1Z5HA 2NPLX 4N0CC 4HG4J 2O5ZH 3GK8H 5DHVB 3VXRD 2VN4A 4M7LH 1DJZA 3LNEA 1RZKL 1JDAA 1L5GA 1T5XB 3SSGA 4O58H 3WHXA 3WAJA 3K72B 1BYPA 1KBKA 1A7BA 1T6BX 2HJKA 5DD3H 2NW2B 5DHDA 1TNMA 1CLVA 1A4AA 2ZTBA 1UXWB 3VFGL 4HETA 4J6IA 1KPUA 1M9WA 3CZSA 3SPJA 5JORA 3SBQA 2HG5B 2ALAA 3BE1L 2VDKL 4JM2C 3U36A 5HYIA 5FKPA 1G7HB 1ZMYA 2WY3B 1TSRA 4CC0A 1XHHA 3QRGL 3TC9A 4TNVK 2IXQA 4JPVH 4ZOEA 4LKCA 2R29H 4C4UA 2FGWH 1QSFE 3TOPA 2K7QA 1YYML 2X4SB 1IC5H 2YEZA 1NAMA 1D6VL 2AK1L 2NX5E 4FZ8L 3D25A 1U91B 4UTCA 4U1SA 3HI5H 3CVHA 4J3VA 3GSWA 4YBQD 4YGVA 4IRZH 5HJDA 1OZTG 1HCVA 3AACA 3GMNA 3LX9A 4QOKB 4BCXA 5DVKA 3H7BB 1H8LA 3UAJC 1AKJB 2X7LB 4LPYA 5ES4B 4Y9EA 4LRNH 3FOMB 3EO1B 5IKCB 3BUPA 3BAYA 3DMMC 3MV7B 1KWKA 4Z7QB 1MCEA 1MCPH 2E7BA 2HFEA 4ZXBA 1U6AL 3RZCC 3SDYH 4FFZL 3WJMA 1WWWX 3FYEB 5EUOF 1XB3A 2Y5QA 1TZOA 1T4WA 2UY7A 5DJDA 2PTVA 2UWEF 4GO9A 5SX4H 1URZA 3G08A 4DKDC 5A6MA 2ZXQA 1ETJA 3X14B 4RFEB 3MUJA 1JN6B 4A6YB 3EO9H 3LV3B 4XHJC 4JHBA 4C56E 1ZLUH 3ZYJA 1VPOH 2AJ3B 2RQ8A 3S88L 2P8LA 1DE4B 1QTPA 1HH6A 3LXUX 1DQTA 5AYTA 5IVXA 2GEQA 5BXFB 2BSEA 2G30A 1IMHC 4Y2DB 1CLYH 4L1TA 4DO4A 4XC1L 1O7VA 4KDTC 3UYPB 4OLUL 2YMXL 5FFGA 2OI9B 3H56A 1XF1A 1WUNT 3L5WA 2B3RA 4OM0H 4GBXD 3T8XA 3H8NA 5LXGH 1UQSA 4Z6AT 4N85A 1RZFH 2HA1A 4DVRL 2V2WA 3BSZL 1QWHA 3EF7A 3MV11 3QVAA 1KDJA 4PBXA 3L95A 1D5BB 4C55A 2RCSH 1XGQA 5CLZA 2L7UA 5F88B 4OV5B 1CGXA 3LRSA 4FQCL 4OGZA 4ZTEA 1PZUB 3QDGB 2NOYA 1VESA 3P3SA 1B2WL 3ARDA 5TH2B 3U9UB 2F54A 1MWOA 2CDGB 4KK5C 2VDML 4JG0L 5DMGD 5HVHC 3KYNB 1FL6B 2K3HA 5ENWA 2AQ3A 3VFSB 1JUFB 2JKWA 3CU1A 1U8OA 4CSTA 1A6ZA 4IM8A 3DXAA 4JFPA 3FB5B 4JDVB 1K5NA 2NY6B 4JFHE 3QJSB 3OV6A 2ZICA 3Q6GH 4LOUD 3RY6A 4U1MB 4HGWB 32C2B 4XB7A 5D55A 4OGAD 5DO2D 2XI9A 4MZ3A 3T2OA 4PRHA 1JNNH 4QAWA 3QDMA 3RU8L 3TA3B 3NPZB 4XPGL 2WN3A 2VM4A 4I0PD 1AD9A 2OR7A 1JV2A 3KGUA 4TLSA 4UT7H 1EQWA 3ARSA 5EC2B 4J8QA 2VM9A 1XBDA 1P2CB 1VHPA 4PGZA 3BWAB 2EVGA 4S0SD 3SY0A 3VI3F 5JW4Q 2EH7L 2IADB 4JHZA 2ADFH 2DQHL 4PVNA 2VXUL 4KOBA 1HILA 2WXNA 3PV6A 3V55A 1GGBH 1SF3A 5L88H 2I60L 2IH1B 2NY5L 3A0OA 2M1KA 3SDCD 2K78A 2X6MA 2Y3NA 4L8SA 1AHWB 1BVKB 2BSSB 3MMEB 4MYPA 3AW5A 4NQVB 5TFSL 2HKHL 1S8DA 2CD0A 1OARH 3QIUB 4ZRGA 4CMMB 4PWHA 1JZ6A 1HX0A 2OW6A 2GBUA 5D1ZD 4IOIA 5HYSG 3Q8EA 1MJJA 1OAYH 4LL1A 3DVNA 4RRPA 1MIMH 1VFBA 4BV1A 3V4PA 5TDNB 3HFFA 1RJLB 4X9GA 3SYCA 2B15A 2CMRL 4YJZL 1NOAA 4GG6B 4GFXA 4KKBC 1ZVHA 1ZHNB 4LSTH 3CVBA 4FCHA 4PAZA 2B08A 3GD1C 3IMUA 5KJ7E 2WXOA 5DUBA 1FGVL 3BZ4B 2G5RA 1JPFA 4ZNEE 3CUPB 2DYRB 2VE6A 5K59E 5FCUH 4X7TA 3SJVB 3GHBL 3LIZH 2GY7B 4ODVH 2IH3B 2Q0ZX 3DX4A 4IW4C 1KJMA 3C5ZB 5D2NB 4NOBA 4PMFA 3VXMD 1QD0A 1MRFL 1Z9SA 3MC0A 3MGOB 3O0RL 1R3HB 1QSEE 1IT9H 3KM1A 1EK3A 5HPMA 1YY9D 4Q89A 1TDQA 3PGCA 4U6XA 3LEVL 5I1AB 2ZX6A 3OX8B 5AKSA 4AQAB 4KNSA 5DJ6A 3KYKH 3KH3A 3QHFL 3U6XA 2F53B 3HCVA 3GSRA 3HRZB 5FDWA 1IAII 3QRLA 5IB5A 1K8DA 3CD4A 2FBJH 1UD3A 4MD0A 2ITFA 1AP2B 4FN0A 5IEHB 2HH0H 2DQJL 2FLRT 4WDIA 5F7BA 4Y2NA 4LCWB 3TURA 3AU1B 4TLKA 1UASA 3NZSA 2XA8H 3NACH 4PJBB 3PWLB 1CT8B 1GC1L 3HUJB 2I9TA 5H35A 2WGXA 3SE4A 5IHUH 4LIQE 4QJ5B 1HL9A 3DV4A 4QGTA 3OJMB 5DJAB 1MXGA 5FFOA 3T0ED 4QY8B 3SB3A 4AW4A 2HG0A 1HI6B 2G2RA 2QFPA 4LNVA 1HOCB 4FFYA 3BLBA 4NO5B 1L3WA 4OIAA 4W4OC 3B2UD 3OWEA 3QDJE 4TOYH 1KWGA 4AH2B 2LU7A 4U1NB 4AMWA 1ET5A 4MFHA 1ZANL 4Y5VC 4ONOA 4PJGE 1MUJA 4BFOA 5I23A 1TQUA 5GGVL 3EH3B 2Z7YA 1ECYA 1U8LB 5FOBB 4DK6A 2YPLB 4OCSH 2LOEA 2WNKA 5DURB 3L3OA 3SCMD 1Q9KB 2EE2A 4G7QB 1OWRM 1MG2C 3UPAA 4MD5B 1XT5A 1ERNA 4CJ0A 3ZKMD 4TQ8A 3FAXA 4IK6A 4JRXB 3NVQA 4QJ3B 2ZIDA 3M46A 2YAPA 1P5VA 2XZZA 5FDYA 1W6LA 4Z76A 2VZUA 2VXTH 2YGVA 4R90H 5TE6L 2HRPL 1MF2L 3BUDA 2P7TA 4HPHA 5BV7C 3IKKA 1XL4A 5LGHH 4KX9A 5I1HH 1TFPA 4M5YL 4GO6B 1CLZL 1WA1X 1U92A 2A83B 1JF6A 3L5IA 4GQRA 2YPVH 5BRPA 1IEAA 4G42B 3R8BB 1H3VA 4Z18A 1MNUH 2YXFA 4TUKL 1A1NA 3BP7B 5C0BE 3CDZB 1SEQH 4QRSA 1SDYA 3MNWB 5DVOA 1BXXA 1FFQA 1BOGA 5D6CB 4BFIB 2HFFB 5C0CA 1VFAB 1MWAB 5DD0H 1MCWM 1T5KA 3LY6A 4PW4A 3L9YA 1YHPA 4I3SH 1MFCH 1LQBC 3JWDH 4GH7B 1MZZA 5KJ4A 3MJ9L 4P2RD 2H0PA 4RMBA 2NY3C 4X5LA 1LDSA 2OFQA 4IOFD 4DGIH 2G0KA 2LLNA 4JY4B 5DEZA 4FQJL 3QWRA 2DLEA 1GZPB 1GVIA 1VERA 2WM0A 4G5ZH 4IRSC 1OP5K 1IGIH 5DJCB 3NSDA 3MNMA 1H5BA 5C0GA 1U8MA 2ZOKA 4WU5B 4FA7B 5LQBH 4NNPL 1CXIA 4MB4A 3UERA 3NFNA 2IMNA 1E8WA 1SRDA 1FFTB 3B2VH 1HWGB 2CRYA 1NEZB 5KVEL 5C86A 2CK0L 4ODUB 1CGSH 3JWNG 1RZIA 3LZRA 4DWHA 5B7EA 4MBOA 2FYYA 4Q9BA 3VFWB 3ME0B 3V8CA 3BZFA 4M61B 4JB9H 5CJXC 1LDPL 3L4YA 1T1XA 2NXZB 3BO8A 4WW1B 5J6GA 2ROYA 1R5WB 3MA7B 4LSVH 3W9DA 3VXSA 5DR5L 3EYSL 4PYGA 5JMOC 2F74B 1YNKL 5HDQH 2XZQL 3R19A 4EO5A 1I85C 4FNTA 3Q0HA 5TQ0L 5I1EH 3D3VD 4CN4A 1Z3GH 3EZJB 2GCYA 1WWCA 2WWKO 3B5HA 4OM1L 1O0VA 2VLJD 2HKFH 3IDYC 4JMNA 4ZS6D 2EIZA 1CFTB 1J8KA 3GI8L 3VD2A 1ZVNA 4OFPA 2FE0A 4XO5A 5SX4I 4NN6C 4YFEA 2AHIA 5AYQA 3FQTA 3PGDA 1QUPA 4JR9H 1FYTA 4GSUA 5C2UB 5FYLE 4TUOB 4JZNB 2ARJA 5HHPA 2HAZA 2IWFA 1FFOA 3QUXD 4NNXB 1FL3B 4P5SA 1WF5A 3RHWF 3OKLB 1S9WA 1LK2B 5FYKL 4EVNB 3C08H 4ZPTA 1DJYA 2XIIA 3C60D 3ZDYB 2NUPA 5HDBE 5JIDA 1NGQH 4PRAA 3LRLA 3IGAA 4JAMB 1F2XK 2NY4B 4YDMA 1HKFA 3MCKB 4M5ZL 3C6LD 3CLEH 3U25A 3RUGB 5DJZB 2D73A 5I71B 1K6QL 3NZUA 4AY0A 5SWSB 5AUMA 1BZ7A 2Y9RT 2WV3A 1ZT1A 4CMHC 2IDFA 5BUAA 4ATWA 1CD0A 1H9VA 1RZ8B 1YEGL 3BWZA 3KYOB 4UYPA 3S37L 4KJPC 4AIZA 3HVNA 2IPUG 2VR8A 3BP6A 3MGAA 2XZAH 3QIWC 4U2YA 2TSAA 3L9RB 4NZDA 2AS5M 1R9FA 5KBNC 4WO4C 3MRGB 2Z0BA 1L9MA 4WHTA 1EZSA 2QR0B 3L6FA 4WW2B 3WJLA 2MNWA 3UEZA 3S2AA 1M7DA 5DK0A 4X7SL 1J5OH 4ATTA 4WJG3 2DDQL 2P8MB 3MU3A 4B96A 3ZDZB 5I16B 3IKCA 1XMWA 2C3VB 4XNZB 3WNMA 5IWLA 4FXGB 1OB1A 1CVRA 3N85L 1BXUA 3KS0J 4IU3A 3SDXF 4UDTB 4YXLL 3BW9B 4PJAE 5DD6A 4ANKA 1S9YB 3NK3A 1OGAB 3ECUA 4KY1L 2LTQC 1PEZA 4ESKA 4YHYB 5E8EB 3HN5A 4X6CF 1BQHA 3U2IA 4MQ7B 3MUUA 3QORA 2AVFA 2OMYB 2ZONA 5HHVL 2N59A 4HFUL 1W72A 4F91B 1MN4A 3O8XA 3QZWB 2FH8A 2BNRE 4GRWH 1V7NL 1NMCC 2IWGA 3K2UL 5T3ZD 4RISL 4J3WA 1OD7A 1M1XB 1ZHBA 4U0RB 2G0LA 4KJQD 1DFBL 3TJEL 1N19A 4Z7AA 3CBJB 3ETBJ 2OL3H 2H1XA 4MDRA 5BVPL 5LUMA 4EDXB 1PS3A 1MI5E 1IUZA 1DLHA 2F0CA 4XMLH 4P49A 3K8LA 5D5ME 2BDNL 4ZTOH 1LE5A 2AGJL 2QJDA 1KXVC 3PCYA 4AT6A 3ZIYA 3X3FH 3S37X 3V52H 3II3A 5DRWB 1TQTA 5EC1A 3RYMA 5EU5B 5L2JA 2QTVA 3HB3D 3Q2VA 4QRUA 1A66A 4G6JH 3FC8A 1QEWA 4HWBH 4XP4H 3OAUH 4FP8L 4E9LA 1KYAA 3ARRA 4A67A 3DIVA 4YX2H 3UAAA 1F4WL 3QO0B 3Q05A 1NBQA 4H8WH 5K39B 3UG5A 2Y5TA 4B9PA 3TEXA 3B5TA 1A14H 1LMKA 3CTTA 3T0DA 4NM8L 3DHMA 5ESVB 2XFXA 2H2SC 3V0VA 5DEGB 2H4EA 3VGEA 5DJYA 2DBJA 4DUXA 2CIKB 2XNAB 2DKUA 3GSQB 3GF8A 2AV7B 4FG6D 2OQJA 4Y89A 3NSCA 1SXZA 1JHKL 1Q9LB 5SV3A 1U8KA 2ZWKA 2QQKL 4JEGB 1QLRB 1KC5L 2KDGA 2I25N 1SYVA 5F3BB 3ZUCA 4WKZA 1Z66A 3IBEA 2X3BA 4P06A 4QTIL 4AX3A 2MCAA 2AEIT 4D0BA 3QUZB 3KM2A 3MACL 2WBKA 1M9SA 1PX4A 2OV0A 3GMRA 4HT1L 4M6NH 5F7FA 4ZK8A 3U2SA 1ZK9A 1H15B 1VCAA 2ETWA 5BCAA 3CDYA 4KX8A 2CO4A 3S96A 4XVTL 4NUGL 2CIIB 4JW3A 4PRBA 4Q9QH 3UTQA 3OKOA 1UADC 3S2CA 2ZZUT 4KAQH 4Y5YB 5ISZE 2J25A 3R7RA 5EN2A 4QNPF 4PSRA 1FZKA 3CDGB 1H8OA 2JV6A 4Y4HC 1BQHG 3I3EA 4BYHA 2WC7A 1G7MB 1M42A 4WU7B 1K8IA 4PWGA 1CGYA 4BZ2A 1F3DJ 3HZVB 4RGMC 3P02A 2R7EB 1RUAL 2E4FA 3TYFB 2CAKA 2Y7QB 5GS1A 1FAKT 1FRGH 5T1KD 5I1LA 3PV7A 3TVMA 3VGAC 4DP4X 2D03H 2CCWA 4YHOH 3CX5J 4C83B 1KLUA 4B9ZA 1X9UA 3TT1H 2GG1A 4YAQB 1FYHB 2XIBA 1JJUA 1AZRA 5CD3B 3T3PF 1RULH 3PPEA 4FHBD 1JV5B 1UH3A 1XMEB 2PTUA 4FKKA 2QPFA 2Z31A 4Z7VE 3B5GA 4NKIH 3ZE0E 3ATAA 4OT1H 5E9DB 1HYSD 3BQUA 4Y4FB 4RAVA 1A6PA 1FO0A 1FVCB 1T83A 4KI5C 4PWJA 5EUKB 1OSZB 1KIQA 4L0ZA 1YNLH 4NZUH 5E23A 4RGNB 1Y18B 2P5EB 1REIA 5FGCE 3O0LA 5LVEA 3R4DA 2HJLB 3FCTA 4MD4A 5GGRY 3ZKXC 5IGXL 1QA9B 1NGZB 2O5XH 3NH7H 2DD8H 4LSRL 5LBVA 4GQPH 3MV8E 3K46A 1F90L 5JW3H 3BP4B 2ENSA 3LDBB 4YEFA 1S7VA 3QFDB 3FQWB 3ZHLA 2VR7A 3FU8A 1MCCA 5JHMA 3IJSA 3QO1A 4D0DA 1GS6X 1E4KC 1FL5B 4G8GB 4W9CC 3DI3B 5T3XD 2PR4L 2A77H 1ETB1 5D4IA 3TBYB 4OAWB 4XWOC 4Z3FA 2IV9A 1YEFL 4UINL 1S78D 1OCWL 2BVYA 2CR6A 3MNVA 3OKKA 5FM5M 4L3FA 4X7EC 4MAYB 4O2FA 4R2GB 4NHCH 3QG7H 5D7IF 1TKWB 2QSCH 1SYSB 3L7FB 1SN0A 2XKSA 1CUOA 3ZDXB 1ZLVH 3ELQA 1P5UB 2YUZA 1D7FA 5EU7E 4K3EH 3UOAB 1V7MH 3BFOA 3B2PA 2QQNL 5AVXB 2ERJB 2ATPA 1I9JH 3O6LH 5FO9A 3IPEA 2Q10A 4G1MA 4LHJB 4K4KA 3VE0A 1Y6MR 3R7QA 4I85A 5HYQA 4RAHA 1WBYA 4N90E 3DSNB 5DZ9A 4JFFB 1AGCB 1I8IA 1YVLA 2H32H 4XNQA 4L05A 3O3AB 1NGPL 3HLAA 2X89A 5FGSA 1RIHL 1IFRA 3W37A 3B4NA 2VDLL 1X5JA 3N6YA 2VDOH 1C5CL 3FT4A 3QZPA 2Z93B 3WFBH 2XBDA 4CU6A 1Q38A 5DVNA 1JBJA 1JGUL 5I0YA 3V7AG 1HZKA 1JVOA 1N6UA 2VISA 4PW9A 2YC1A 3DPBA 5FHAL 5D1QC 2Q7YB 4UM8B 5TE7H 3C8KB 5AG9A 3STBA 2WAQA 2PCYA 1K9TA 1RK1A 5GGTH 1KENH 1MAML 1F1GA 1IAIL 5HY9B 5F0PB 1CBVH 1ROWA 4GNKB 3PQYE 4MNHB 3QG6B 4P2AA 3OKDB 3OJDB 4WWNA 2F5BL 5D1XA 3SDAC 3SZKC 3U1SH 1KELH 3BI9X 5JPNB 3TZVB 1USQA 1KCBA 3QISA 1ED3A 2H3XC 2VNCA 2X0WA 5KJRL 3AAZA 4ZXBD 1EHKB 3MLXL 3N91A 4KROD 3AVEA 2E7LA 2FECI 4F7MB 3LXBA 2X4PA 4PJEE 5AOLA 3KXFB 3CH1A 4E9RA 3SE8L 4X8JA 3LSOA 1G7JB 3QA3A 5EO1A 2R69A 2WLLA 3ATEA 3S3CB 3PHOB 3O3DB 3UTPD 2IALA 1BQLH 3QEGH 4YIQB 4WFGE 4H88L 2Q20A 1YJDH 4M00A 5JUEH 3EHBB 1UM4L 3MRMA 1S3RA 2J6WA 4S1DD 4B9IA 3HAEA 3IE9A 1SLXA 1X6LA 4YSQA 2AFNA 1J0IA 4M8QB 4YC2C 1NOFA 5CLTA 5EHFA 4L4TA 2DJ4A 4NRZB 4X5WA 1I7TB 1JWSA 2YKKA 1I3VA 2A38A 4KKQA 3UTSA 2A73B 4CJ1A 2ATKA 5CF3A 4P3CH 5DRNB 3EH1A 4NQSB 1LTXA 4E0RB 1JPGA 2XG4B 1PZSA 2YLKA 2F58H 1UD6A 5I6KA 2C34A 1ILSA 5EU7C 4YE4H 4YHLL 1YDPA 4FQXD 4LAQH 3ARDD 3G5ZB 3DGGA 1UM6L 3HOGA 3X17A 2YGPA 2P80D 4JY5L 5C92A 1E5CA 3CV5A 3S3PA 3GMQB 3C12A 4HIQA 6FABL 3BKML 3F6IA 4JN1L 1RCYA 3DXAD 3I9GH 3RIKA 3O11A 4FI7A 5EU6B 4X4YB 3K81A 2RTTA 3K71B 1T7VA 3CFMA 2JB6A 4JJ5B 3D4YA 5E8DH 4PRHD 5F1NB 3QDMD 4HLJA 5ICZA 2LFGA 1IM3B 5FXCH 2WNXA 5LHDA 3PDDA 2H1PH 2HUEA 5TQ2H 4NYLB 1ODUA 2P28B 4JZJA 4KDVA 1D5ZA 5KSVA 3DBSA 3OHXA 4LKXA 4NQED 5AW2B 2DF3A 3GK8L 2BHUA 3L5XH 3KPRE 5MI0C 1JI2A 1F4YH 3GLDA 3RWDB 2BP0B 2R15A 5IBLD 4HF5H 1F11B 3PWNB 4XBEL 5DD3L 2X1PA 3NN8A 2DAVA 5C07E 4MA1C 1U8IB 1C7SA 1KGJA 1E5BA 1TZ8A 5KTEH 1T0MB 4PP1D 3EOTH 4LLWA 3OLGA 1CXEA 4JPVL 1D9KD 2R29L 2FGWL 4WUUE 5F89A 1U58B 1JGDA 4NRYB 3WY3A 5ITBH 2V8MA 5IQ9A 2W59A 4CNIA 2XPZA 3CZKA 4WWKA 2VDQB 3HI5L 5D7SL 5JW4M 1LEIA 3NJNA 1QW9A 1J9TA 4IRZL 3MXWH 3V4VL 4EPSA 1A21A 1G9MC 2RGSA 4NFCA 4PRPE 4GT7A 4XOBA 3WFCL 3X12A 1E27A 3CXHK 3C2AH 3DC0A 2BP8A 1PYWB 4WJ5B 4N86A 3FU7B 4MJ6B 2FBOJ 4NP9A 5ANMA 3N5AA 2H26A 5HGHB 3MRKA 5EV7A 4LRNL 2V9UA 1UZ6F 3HAEG 4CVXB 4UT9L 2VLRA 4H8WC 1MCPL 5DSCA 4JBSA 1PZCA 4CC4C 1IB5A 4W9EC 4EXKA 4WEBL 4KVCH 4YUEH 4HWZB 5E5MA 2BOLA 3PWPA 2BX5A 2NY0B 5K5YA 2W8CA 1JS4A 5DQ9A 2NZIA 4APXB 2ADGB 3EO9L 2CHXA 4MNQD 4N2IA 4RIRB 1BIHA 4AE1A 4BQ6A 1IC7H 4YBLC 3T2NH 1WBZB 1JI1A 1ESOA 1VPOL 2CNZA 5BS0E 3L4CA 2OYPA 3HBGA 3FUJA 4HH9B 3TCTA 5ESAA 2KBGA 1CLYL 3PJLA 4JFTA 3O6FD 4CBPA 1GKOA 3DOSB 1NBYA 2V3EA 4P2OD 4YMPA 3CPLB 3MZTA 3Q5YA 4OM0L 2D7QA 3MSPA 4G9FE 3T6ZA 3KHQA 1SXNA 1RK0B 1XR8B 4O51B 5CIPB 5LXGL 1C8QA 1RZFL 4HX1B 1CE6A 2A74B 4IEFB 2YHGA 4XAKE 4Q8BA 2AITA 1G1CA 2J2ZB 2XN1A 4WY7H 1YUHB 2F2HA 5DJ8A 4GUQA 5E8NA 1BFVH 2RCSL 3K1DA 4EZKA 4Q97A 4ENEC 1NPUA 2E7HA 5I1IH 3VD4A 1MFNA 3B9KB 4FS0A 1QO3A 4HUWA 4J3TA 1PJWA 2Z91B 1DUYB 4JY6B 3EXJA 2FT8A 4N5EC 4OCNC 1ONQB 1DVUA 3A24A 4P46A 1HHHB 1IC0A 4Z0XB 3WLWD 4LEOB 1UXLA 2CHNA 2W0LA 3KW8A 3MOAH 3FONB 3V5KA 4AJYV 3QXAB 2BO0A 3HPLB 2OCJA 4HGKC 4NUQA 2DLFH 3IFPB 4K8RD 5BW7C 3Q6GL 4GRWB 2OLDA 5HDWA 2GJPA 3D69B 3ZMNA 4PV9A 2I07A 4RZCB 3ZPDA 1RZGB 1JGVH 1ZA3A 5IQMA 5D7KE 3QJQB 4FQQA 3MBEC 3QDAA 4UT7L 4QXVA 4ETQA 3MUY1 2OL3B 3JUYA 3P3RA 3CCHB 3WNNA 1WFUA 4Y1TA 1T89A 1CZ8H 2VXVH 1F18A 4MNGE 4UTAH 4X80H 2VW4A 2YK1H 2Z8VC 4Y9BA 3ISRA 4J8RA 1KGIA 3PIQA 3U46A 3OMZA 1NAKH 1LNUA 3L13A 1JHTB 3K6NA 4OUUA 4DPCX 4QD2E 5JA9A 1GGBL 3BUBA 2A9CA 4M03A 2QKIB 3TBBA 1MSPA 5CCKH 4FX5A 1KZYA 1K2DA 1QLEH 3L1EA 4LVOB 1MHCA 4L29A 1QI3A 1PZBA 2JJTA 4LVNB 3V0HA 5DI8A 2OSYA 1OARL 4HEME 5ALCH 1JPSH 2XQYK 5DU7A 5JTWA 3QHZH 5TPWH 4PP2A 5EOQH 1ITCA 1CICA 1DDHA 3PFQA 1YC8A 1OAYL 4XH2B 1VGEH 2WWOA 1MIML 4UTBH 1ECZA 4G8EB 1UH4A 3L3JA 4OFQA 4QRQA 3V5DA 5CBAB 4XVSH 5IY5B 4BH8B 3MV9D 3MRFA 4OZFH 2NZ9D 5C0CD 3BPLB 1C08B 1HE7A 5K9JL 3LD8C 1RKRA 4ZFZB 1KYOJ 3WI9A 4KDWA 2ADJB 5FV1L 3CC1A 1FP5A 2LGNA 3WNLA 4OJEH 3N44B 1KYDA 3HI6H 2MQ0A 2NTSP 2LU4A 1A7PL 5M94B 3QWRD 2YS4A 4HUUA 2ISDA 2DMGA 3LIZL 4BA0A 1QSFA 4ODVL 1QBBA 1C5DB 3RDTB 1CXLA 1PEWA 3RJDA 4L0PB 4YLQT 4D7BA 5E1AA 1VAHA 2VITA 4OBRA 1UCTA 1G1KA 5EF3A 1DR9A 3MV7E 5FLVA 3SKNA 1RZJC 1T22B 2D7MA 4GW4A 5E94B 4Z7QE 1JXGA 4NKDB 3DETC 1IT9L 1E9OA 3A67H 3FUMA 4LLMB 2R2EA 3CG8A 4FXKB 1XR9A 1P7QB 4OQTH 1QPKA 1KT2A 4H13C 1WIPA 2ITDB 2Y7LA 1A7RH 2Q76A 3KYKL 4F58H 2W07B 3CFTA 4G72B 5ERWA 2EXWD 4H1LH 4LCUB 3ZHDA 4G5AA 2IDUA 2AQRA 3VXSD 2PWGA 3FPXA 2AW2A 3QB7C 1SOQA 1T5WB 1JRHH 2FAUA 2FBJL 2JQAA 5MHSD 4KQ3H 1T6VN 1H6UA 2HH0L 1L7IH 4XP6H 3HG4A 1AR1D 4XTRD 3ATFA 4EDWL 3NACL 2WCGA 2MPVA 1J8SA 1A02N 1HN1A 1HQRA 4K5OA 1KTKE 1CD1A 1NBCA 4KC3B 2OMWB 4ZQKB 5EZLB 1JOIA 5BUPA 1NIBA 1XZ0B 4A55A 5ID0B 4PS7A 1HVXA 5IZ7A 3NTCL 3KGTA 2W91A 4BGLA 1YYLH 4V2CB 1DN0A 5EBWA 4GKZB 2AABH 4TOYL 4B7LA 4NT6A 1OANA 1KJ2H 2WMPB 1JF1B 2FO4B 3POHA 4UDUA 1U42A 2GK2A 3IDUA 2PCPA 3QDGE 4XP1H 3ARBB 2IQAB 4ONGH 3JSSA 3SQBB 1MH5B 2EABA 2OSLB 2J55A 3P9MB 2EUVA 1YECH 1AXIB 3N0PB 5IFAH 1ZLWK 1L9PA 3ZU8A 2ZCHH 1UOWA 1EJFA 4PJHF 4PH8A 4NUJA 2XA3A 4Z23A 3D6GA 2J72A 2BW4A 1FAIH 3NJGA 2IEPA 5E6IA 1VGKB 2LR4A 3KLLA 1ZSHA 5CU5A 2VXTL 3T0AA 4R90L 1KPUB 3KPOB 3GINA 3HR5A 1GYWA 1U8HA 5EPMB 4F7KA 3U36B 1EIBA 4PV8A 3FSZA 4XVUC 5INCA 1WIUA 5DFVD 4LNRB 5J1AB 4YXKH 5I1HL 3BVNA 4ZMYA 1OTUC 2IXQB 1RZPA 2WXKA 4LKCB 5DZJA 1SDAB 3S48A 3D0AA 3R0MA 2YPVL 1XGUB 1QTSA 3E2HC 2ZUQB 4HKZB 5EO0B 1NAMB 2K70A 3HFML 5SX5K 3IDNB 4F7EA 3D25B 1T03H 3QC5X 5ESQA 4WTZG 5JYLA 4U1SB 1M6UA 3BVDB 1SEQL 4WHDA 3JZ7A 2VDRH 3H42H 4YGVB 1BIIA 3S5YA 3DTDA 4GS7B 3S36H 1RJYA 3I6SA 4IBTA 35C8H 2LAAA 2K7PA 4K5LA 5DD0L 3KMDA 4G6AD 3F05A 1BZ9B 2BSCA 4I3SL 1MFCL 3FSWA 3QR1A 3OAYK 3BJLA 1IBYA 3G9VA 2E8ZA 4D9QE 5IHZB 5HI5C 1TMQA 1SNRA 3U6RA 4NC1E 2V17H 2LAGB 4DGIL 3RFZB 4GG6E 3O8XD 3I6GA 4GFTB 3ZSTA 2OS7A 4KNTA 2B0SH 4WNQA 5A2AA 5DJDB 1IGIL 3WIHA 4BWWA 4MA8L 5LQBL 2NTFA 4W9JC 3THMH 3O9WD 3ZLQC 5FO2A 3IGUA 1BF5A 2H45A 3QJOA 4Y2DC 4AGLA 3B2VL 3A23A 1UEMA 4LPWA 2NYKA 4PJ9B 4JDEA 1CGSL 2P8LB 1QRNB 2Z4QA 4A39A 4R96B 3EYUL 5IVXB 3LPOA 1XGPA 3VGBA 2B3IA 3GMLB 9PCYA 5D2NE 3LS5H 4ZNEA 4JB9L 3SYAA 1UURA 1A6AA 1L0PA 2GUYA 1HS6A 3RVVC 4N2AA 3UTTB 4LSVL 4BHUI 3IBOA 4N3UA 4K23H 1FDLL 5IB3B 5HDQL 1UQSB 4FYRA 3D4GA 3VXQA 1AIFA 3NPSC 3D85A 5I1EL 1Z3GL 1F2QA 1T7YA 4NO3A 3VFNA 3L95B 1KTDA 4GUCA 4E2OA 2E75C 2JKNA 2GTZB 4RSYA 4X5QA 2F53E 2HKFL 3DVIA 3ZN6A 4NQXA 1QSEA 2YN3A 3WNPA 1YC7A 2ARWA 4XC3H 2XN9D 2VL5A 4KY2A 1TENA 2F54B 1IKFH 2XTJB 4LCWE 1LVEA 4JR9L 3BPNC 5F9WB 2V4LA 2BWDA 3Q8FA 3EBHA 4PJBE 3HUJE 1BLNB 1U8OB 1A6ZB 2H5UA 4JFPB 2WBJA 1OK8A 4PJDF 3EH2A 1K5NB 2XV0A 2FECL 4HLEA 1FVDB 2EE6A 4FEIA 3OKYA 2AJXH 4OZ4B 1KIUA 2BOCA 1CD9B 3IDMB 3AREA 2DQDH 3C08L 3V0JA 3WUWA 2IBZY 4PJ8A 3SPCA 1HT6A 3HS0A 3P3TA 1U0QA 4IYKA 1F42A 1NGQL 2ZUSA 1AD0B 4KRPB 2W9DH 4N2DA 3WIAA 3BEVA 4DJMA 2A7BA 3DHPA 3CLEL 2Y6SC 3CK0H 1ZDQA 3SY0B 1GOGA 3UC0H 5F8RC 1NCNA 3QHTC 5FW7A 3Q1SH 4PYHA 3KLDA 2YPLE 5HVFB 2IQ9H 3K8KA 4HIEA 1HILB 2DQUL 3QDJA 3UAEA 3QIUC 1VB9A 3PV6B 4BINA 5JHLL 2VWEE 1R19A 3G5WA 1CG9A 5BZDB 5LN4A 3GJFA 1DVTA 1RPQA 4MCZB 2EYRB 4Q4IA 4K9JA 2XZAL 4PJGA 2JTYA 5DS2A 2X05A 3L2LA 5F70A 4Y16C 1N26A 4JRXE 4E36A 5LNDA 3HC3H 4OI7A 1IFGA 1MFBH 4Z7WF 1LK3H 5G2NA 5KVFE 1NZRA 1S8DB 3P4LA 1FV1A 4GW5B 2E9JA 2BJMH 4EMZA 4CKQA 3RWCA 1GSMA 1WZ1H 2ZD0A 3PJSA 4IOIB 4IKIA 4PJCF 5GGSA 5J9PA 1J5OL 3GBMH 1MJJB 4J27A 3DVNB 5DJ0A 1SVCP 3V4PB 3ZUNC 4JKKA 2Q3AA 1KGUA 2BIOA 5AVRB 3HE6B 2G9HA 4TTGA 1S7SA 2CBMA 3RURA 5AVQB 3ARFA 4KK8D 2WTOA 4MMYA 2X3CA 2CNYA 5BOZG 1M2VB 2E56A 4ORGA 3MRNA 3RGVD 3MRDA 3TO4D 3APCA 3C5ZC 5D2NC 1U2HA 4DIXA 4LSSH 3V6OC 3MJ7B 3SGKA 1ZIAA 3HJEA 3CQPA 3QDHA 1NCJA 3N1FC 4L1SA 2EIJB 1GSKA 5FF6A 1EWHA 4TLTA 2HLFC 1P9MA 3D39B 1KJVA 5C0BA 4ELDA 3L3HA 4AEEA 2MKWA 5F0LB 1Z9SB 3KL3A 3BESR 3DBXA 1VSCA 2WKLA 4ZOAA 4BSJA 2X4NA 4U6XB 3REVA 2FQDA 3HPJB 4XMLL 4ZTOL 2FSEA 4L1HA 5EA0H 4A2HA 1YEDA 3F64A 4LBEB 4E9TA 1T7ZA 1E3XA 1V3KA 4JM2F 3X3FL 3HCVB 1FNFA 1G6RA 1NGXA 1QKZH 3V52L 3WNJA 3JV4B 1TVHB 5IB5B 1MOEA 1BV8A 1K8DB 4X50A 5DHMC 1WT5A 3N40F 4MS8C 1NC2B 4V1DA 5HHOB 2NYYC 4QLRA 4G6JL 5CSBA 5IM7A 3VACA 1QVOA 3MKGA 1JD7A 4XP4L 3NGBB 3FU9A 2PLTA 2UV3A 4IQHA 3VSTA 4YX2L 4B5EA 4QUOA 3S9DB 4H8WL 1A14L 1HXMB 4XO9A 3Q43A 2ZOWA 3QZBA 1F4HA 4K55A 1TQCC 3TPKA 2EDQA 3ARQA 5E6SB 3KBFA 3JWOH 3B56A 5L4IA 3IJ8A 4DCQA 5HJBA 2Q2LA 2X89D 2KUTA 5TDOA 4R0LA 1MUJB 2WBWB 2YWZA 2YJLA 2Q2EB 4K7PY 4G1EB 1LWJA 3P4NB 3IGKA 2EO7A 1ID5I 2PW1A 3DOIA 1ODAA 2RFXA 3L3OB 4PGBB 1ZK5A 1S9XB 2EDYA 1P6FA 4C4KT 1B0IA 1JRHI 2MNJB 2YD4A 4MXWH 5DD5H 3ABGA 2FJFA 2DEYX 3PXLA 3WD5H 1UT2A 1HU8A 3GZPA 3U0WH 4KKCD 4X6DE 4YPGA 1K3IA 1O7DE 2D0FA 3ARGD 4LPUA 2C1PA 1G9HA 3IJ7A 3QAQA 4MCYA 2DH3A 4LP8A 1TETH 1KBWA 3DIFA 4Q9QL 4Z76B 3ZDYE 4AMXA 2XWJA 2CZNA 1PU0A 3OLIA 1CGWA 5E24E 2P7TB 4KAQL 5D96B 4ONFH 3VU1A 3UP6A 1PX8A 2BNUA 2CRZA 1G9NH 3RUGE 2KKQA 1MW0A 2CO2A 3SGJC 1IEAB 2CLZA 3MCYA 3BP5A 5C3LD 2Y1AA 1C12B 3AB0C 3VFRB 1A1NB 3FB7A 1FRGL 1WJ3A 1U3NA 1I9RH 3QIBB 2VQ1B 3PXJA 2D03L 4YHOL 4S0HA 1MFEH 3TYGH 3JV6A 1UKQA 1EDQA 3GXTA 3TP4A 3B34A 2J1WA 4Z3TA 3VI4B 3FQNB 5AW9B 2X88A 4JFQA 5D71H 3UDWA 1RULL 1S7WA 3MX0B 1I4FA 2Q8BL 3SDDD 1ZGLA 3CZJA 5MEPB 1JF5A 3ZDZE 1I7RB 5JIQA 5E08L 4U33A 4NKIL 2EIBA 3QQ3B 3FHAA 5IQNA 3W11C 4UF7C 3LN5A 4OT1L 3V95A 4PJXB 4AQEA 5D7JD 4UZGA 5D4QA 4EIGB 1YPZB 1ACXA 2LVEA 1YNLL 7CGTA 4NZUL 3QEUA 4B5ZA 5C0GB 1OGAE 1U8MB 2ZOKB 5CD5D 4XE5B 3NFNB 3MA9H 1UENA 4XBMA 3BMVA 2ZAHA 1IZKA 5D93C 3T8MA 3B2XA 4NRXB 3ARWA 1E3FA 2O5XL 3NH7L 2DD8L 2XWXA 5HXMA 4HV8A 2JQMA 1ZVSB 4HC1H 3IYLW 4JFDB 4G2AA 3K4DA 5FCSH 1WCBA 2K8MA 4KH9A 4BFJA 5J6GB 3W9DB 5A6IA 5CGYD 1YY8A 1ZGLP 1OL0A 2XQBH 4WJKB 3SYQA 2W9EH 1O6SA 3IGFA 3LMJH 3W0WA 1EEYA 2GCYB 1TJMA 2ED6A 4NHCL 3QG7L 4LE8A 2QSCL 1CFSA 3SQOL 4CVUA 3LPGA 1RPKA 2JCCF 1OGTB 1HNGA 3FKUS 3OG6B 3B1TA 1R24A 4K3EL 5D5MA 1V7ML 3FO0H 5J1TC 3PGDB 3QWOB 1FNSH 2V8LA 1FYTB 2BRQA 2VQTA 1I9JL 3IT8D 1GZHC 3O6LL 4NQCB 4YSCA 5L2KD 4PTUA 3VQMA 5D2LE 1F1AA 2R2CA 3OQRA 3FSOA 4DGWC 1MY7A 2LLLA 2GAZB 1BAGA 3MRPB 1N3NB 4G7YH 1R34A 4U6VH 2HWZH 1KCWA 4QRAA 1ZE3C 1XO8A 5FR3A 1SFHA 1PZ5A 2VDOL 5DCCA 3IF1A 3VD3A 4FFVC 4ZPTB 2Y23A 1Q94B 4GJTB 4OSUH 3WFBL 4PRAB 4B41A 2RD0A 3IGAB 1FHGA 3JQOB 1OGPA 4R9HA 2X1XR 5E6YA 1IBHA 3NCCB 1BF2A 2BNQA 2IBBA 5BO1H 4AKQA 5GZOA 5AUMB 4S1SL 3DHUA 1KTLB 3P1VA 4CN6A 3BX7C 5GGTL 4WW2C 1KENL 3WTSA 4AIZB 1JMZA 3MQIA 1QG3A 5F1IA 5AOJA 1OSEA 1CBVL 1I1AB 3U1SL 4X99A 2KS0A 1XSIA 3B43A 1KELL 1MHEA 2HJFA 1F02I 2C8NA 5F3FA 4YBQC 2PWEA 2FHBA 4XXDA 1M7DB 5DK0B 1OGSA 3U4EA 4ELMA 2JSFA 2CDEA 4WK4B 3M7FB 4GKNA 4Z7UB 4FABH 1VKXA 1IILE 1MCQA 3PDGA 2WXLA 4LZKA 5JOEA 1OB1B 3T2PA 4IU3B 2WCPA 2N1TE 1D5MA 1RP9A 4KGLA 4UOW0 3X13A 1BQLL 5DD6B 3QEGL 3MJ8B 3WBDA 5JUEL 1YJDL 1RI8A 3TTYA 4JM2D 5ISZA 2I5YH 2TRYA 2GB2A 1BQHB 1QNIA 4MCNA 5AVVB 1GGIH 3BGMA 3QORB 5I76A 4OD2A 4U0RC 4BE6A 5JW4N 2VABA 1T7XA 1A47A 4BQ8A 5IJCC 1Q0YH 5JDSA 1OP5H 1KEGH 1F3RB 4ANVA 1VZGA 2DM4A 4XCYB 2WIIA 2XQYA 1X4XA 5F3HB 5AFAA 1X5GA 4PB9L 4WV1A 4F9LA 4MB3A 3CU7A 3PNWB 4YDKL 5E9DE 4P3CL 5FW6A 5CEZD 5FK9A 3BC9A 4MMZC 5GS2H 1DLHB 1HCZA 4GMSH 1LE5B 1ET8A 2F58L 3MUGB 4RGNE 2P5EE 4LAQL 1XCQA 3DO4A 4P46D 4FQ2H 5MP6H 4AT6B 1W8EA 3DMMD 3H6JA 1KXQA 5BRZA 4Z7VA 3WNIA 2EECA 3RZCD 3LN4B 5EC1B 2IDQA 1NDGA 1NGYA 5L2JB 3BIAX 2EH8L 3I9GL 4NI6A 4X0KB 1AQKL 1XB8A 2IAAC 4QRUB 4TPRH 1EDYA 1QEWB 4YZFF 5EIIB 5E8DL 4TM9A 1KGWA 4G8GE 4XHJD 3VB9A 5DMGC 4LRIC 2H0EA 2H1PL 2PTTA 4NKQB 5TQ2L 1UVQA 3HC4H 3CX2A 1TF4A 3MV8A 1EO5A 4K94C 4OZHB 1NM4A 2D8KA 4NPYA 3L5XL 1Q72H 3V0VB 2ZOLA 4OGAC 5DJYB 4LCCA 4R4ND 3TXAA 1TQVA 1F4YL 4DSYA 1WFTA 1JIBA 2IWEA 4HF5L 3R06A 3FFOA 4I0PC 3JZYA 3ZDXE 1F6LL 4L8BB 5IT2H 3QUZC 4WKZB 3GUTA 1JZGA 5L7XH 4LOVA 5BQ7A 1VIWA 4DN3H 5KTEL 3EOTL 1QQDA 2UUDH 2R23B 4XMKH 4G8IA 3AZUA 5T3ZH 3FRPA 3S3SA 1N5YH 4JFFE 4YBHA 1YZZA 4M3HA 3SD5A 5ITBL 1XIWA 3GMRB 1BJ8A 2RA1A 2AEOA 4JZOB 2KH2B 2M2DA 3QJVB 4Y4KA 3N3EA 1HFUA 5D1ZI 2ZSWA 3SDCC 5ID1A 1BD2E 4HWNA 1Y1DA 2H2PC 3S96B 3MXWL 4P05A 1XCXA 1V3LA 4PRBB 3WTUA 1IAOB 3C2AL 4LDLB 1OEZW 5EN2B 1BQSA 4UQIM 1FZKB 5J6HA 5CO1A 2CO6A 3GS0A 4KRMB 4J6RH 5B38G 1N0LA 1SHXA 4E5XA 1K8IB 3JXAA 1YMME 4PY7A 1GIGH 3TGXA 4DHLA 4OZGB 3VDAA 3IDJB 4KVCL 2F61A 5GS1B 3PG2A 5KANG 2NX5D 2XY2A 3BAXA 4FF9A 4R4BA 4LSDA 3BFQG 4R5XA 4XX1E 3TVMB 2FLBT 2HVJA 1NFDA 2MH4A 4FZEH 5JHAA 3NYKA 3G5XA 4G70B 2YMTA 2NNAA 3ALPA 1BMGA 1MVUA 1IC7L 2IOIA 4KVNH 2E0PA 3T2NL 2VAAA 3UYRH 3TNNA 2JKIS 4FAAB 3T0XA 3FTUA 3OZKA 1SF5A 2FX9L 4N2LA 2J44A 3P30H 4MHHI 2FGZA 2Z31B 4GIAA 3KXFE 3WXVH 1CYWA 1KCLA 1NOLA 2Y24A 3BQUB 3KCPA 2B9BA 1FO0B 4OUOA 4K0OA 1RHHA 3FCUB 4NKMA 4RAVB 2EXYD 2AJSH 4GAYB 5MERB 4PJEA 4NO2A 4F37K 1KNOA 3E6FA 3L08A 3LDBC 1YN7A 1XGRA 1PX3A 4PJFB 4LASL 4NUPA 3JVGC 2ZUWA 1BP3B 4HDIA 4KKBD 3DX6B 4LVEA 4MD4B 3A22A 2X4TA 4WY7L 2YD9A 1BFVL 4XWGL 3IU3A 3RPIA 4HKXA 3ILPB 4C56D 4CN1A 4DERA 2ENQA 4IBSA 2A0LC 4HCFA 5I1IL 2DMCA 5F1OB 5DHXB 1S7VB 3H7LA 3NJKA 2DIEA 4LSUH 3T08A 3QO1B 4FQHA 1RUPH 2AQTA 2W65A 5ETUA 1P7HL 2OK0H 3VQLA 2EDWA 5EOCH 2PYEB 1DQVA 3CZUB 2GI7A 3MOAL 1FGNH 1OCCB 2DLFL 3MNVB 2J1ZA 3T04D 1V27A 3K5SA 4O2FB 4XNBA 5HVWA 3US0A 2BVUA 3IVKB 2WNGA 3PPSA 2KT6A 4ZFOL 2ERJC 2A5UA 5LGJA 3OKEA 1JGVL 2HLAA 1RIUH 4XXWA 5GGUA 2DLHA 3ZKSD 5IMOA 5EU6E 3GXNA 3OZLA 2WGNB 4FQIH 5CEYA 4ZMTA 1CZ8L 2VXVL 2ATPB 2XKNB 5E6ID 3OJVC 5FO9B 4H2AA 2YK1L 4G1MB 3VH8G 3VE0B 5HYQB 3E6HB 4XNQB 3W38A 1MAKA 2O6DA 1NAKL 1F1DA 5CGMA 1N67A 4JFHD 2Q3XA 3EYFA 5C9KA 4QHNA 5CCKL 3ZKMC 1QLEL 1CQYA 2WYZA 3FT4B 4AQ1A 1IQWH 1U2YA 2H8PA 4LF3A 2CHWA 1DQKA 2CGRH 3BIBX 4AYEC 2Y2YA 1JPSL 2FD6H 3F7VA 3DJSA 3QHZL 5TPWL 2VISB 5EOQL 2NW3A 5I66B 2UY6A 3LJ3A 2X6UA 2YC1B 3DPBB 2AZUA 1VGEL 1XF2A 4GP5B 4ZZFA 4UTBL 5DHYA 4DVBB 3PAYA 3KPRA 3LKSB 4BKLA 1A2YA 4XVSL 3QQNA 1RK1B 3I02A 1U93A 3PP4H 4EN3B 3FMGH 1JK8A 3FTWA 2DJSA 2H0JA 5DT1H 1GGCH 5D1XB 2E6PA 5T3XH 4GUPA 2YSSB 4XNUH 1OCOB 4HUVA 2DEXX 2DRUA 3SE9H 3HI6L 4YDZA 3ZRFC 4DNLA 4WUUA 1HL8A 3FO2A 2X4PB 3PAVA 1Y1UA 4UOW1 4JLRB 3TBSB 1U8QA 2VXQH 4FXLA 3CH1B 4W9ZA 3W56A 1R4XA 4X8JB 4J3BA 2OZ4H 1AOHA 1X4YA 3GZOA 3FU5A 4IOFC 4PW3A 4PRPA 2I9LB 3A67L 3VFOA 2JI1A 3B8YA 3RTQA 4I3GA 4OQTL 3VXPB 1TVDA 4ZMQA 1VEOA 1NH6A 4F58L 2ZXDA 3FUNA 3BGFC 1ADQH 3BPOB 4Z7NB 4ODTH 5F0JB 3B83A 2XBTA 3L16A 4KKAC 4N3TA 4QRRD 1JRHL 2KQNA 2X41A 4KQ3L 4L4TB 2P48B 4PLJC 1TR7A 4X5WB 4BH7B 1L7IL 4XP6L 1OD9A 3F7YB 2AJVH 3VWJB 3UTSB 2ATKB 3ILEA 3MYZA 4JQIH 5TTRA 5HDOA 2BP5M 1QSED 3DRTB 3K0WA 2ENPA 4JRYB 4L9DA 4JQXA 1JPGB 3CVHH 4KMTH 5AWNH 1N68A 2QEJA 3A21A 3GSNH 4Q6IB 3B9VA 5H4ZA 1SMOA 3L4VA 4AITA 1OP4A 1AC0A 4PJAF 2NY3D 5AW3B 1ZV9A 1YYLL 2X42A 2R1YA 1LP9F 4PG9B 5C0NC 4XNYH 2A9DA 4MZ2A 4D9RE 4NI3A 3NEOA 4MKMA 4ZS6C 2WBJD 3NP4A 3O11B 5C7XH 1KIPB 2Y7NA 1ZLUK 1KJ2L 1BMZA 3LOWA 5IW1A 4WFHE 4G9FA 2BIPA 1O6VA 2JB6B 5L8JB 3P11H 4XP1L 5DLMH 4PCSA 3LQAH 3ARED 2BY3A 1KBVA 1YECL 1KB5A 1E2ZA 1Q1JH 2JB5H 5IFAL 1MHPH 2FYVA 2ZCHL 2CU9A 1R5IA 1A3LH 2DIBA 2FIRT 2GHWB 4JCLA 3VYOA 3QUXC 4LKXB 2NRDA 2FO1A 1CS6A 2NLJA 4GRWE 3MO1B 2XHNA 4L1LA 3ZRSA 3BAIA 3A3YB 1T4KA 1EZLA 3EGDA 3QDJD 3TBWA 1DFXA 4ZMAT 4DGYH 2HVBA 2YN5A 1T21B 1QX1A 1U8PA 3A6CH 4KI5F 5IESH 2LVCA 3FRUA 2XJKA 5LJYH 3ES6A 2YARA 3BIKA 1CFQA 3C6LC 5EUOB 4GEIA 4YXKL 1EXUB 4AYBA 3G6DH 5KYYB 3MXVH 4OFIA 1GYUA 3MJ9A 4LQFH 3BRGC 1S7RA 3P4OB 2IFFH 2PXYA 4PRIB 1NUGA 3CSFA 1GYAA 1JGDB 3FT0A 4XMVA 4CNIB 4EI5A 1T03L 4ODSH 2FIKA 4QR7A 1LEIB 2VDRL 4MNGA 3H42L 5CMAB 43CAB 1QABA 3S36L 4JM4H 3X2QB 1E27B 3ARFD 35C8L 3OAZK 4P5MA 2BP8B 4X4XA 1LL1A 2LU3A 3QUGA 3V8OA 3PWUB 3GIZH 4NDMA 1KB3A 1NIDA 2IOMA 2MWCA 2VLRB 4P4KB 1ZTXE 5K1JA 1GY1A 1FFNB 5DSCB 2V17L 3AY2A 2APFA 2DS4A 1EXHA 3VMPA 1KGCE 1ACYH 3K72A 3M07A 5FUCC 3WGUB 4HEMA 1R46A 2B0SL 3D8MA 1JZ3A 2EUWA 1ND0A 2VUKA 4BFRA 4F7PB 3PWPB 1JZ7A 2EVFA 4UIMB 5C0BD 5F9DC 3OZ9H 4KMQA 2HG5A 4PIBA 3THML 3SO3B 1OVZA 3WOVA 3NSXA 4NNYB 1KCRH 4TQPA 2C9QA 5FO8A 1JXFA 1DJWA 2FVNA 1IM9D 3UJTH 1USZA 3TU6A 1BCIA 4KO7A 3ATBA 4UV4L 2VN5A 4U7MA 5CSZA 1BBJA 3GRGA 3LS5L 5KW9H 4WO4D 2A74C 2BCKA 1R1CA 1W6WA 4MXVE 2EICA 1XF3B 4KJQC 1OHQA 3V0AC 3ZBMA 2GT9A 4HK3J 4K23L 1KCVL 3H7BA 1NC4D 5HHMB 3MRRB 1AKJA 2X7LA 4NPJA 2AXHA 2Q7AA 2NSXA 3UZEC 1AI1H 3JVFC 1QTYT 3EO1A 5KYXA 1JZDC 1UA3A 2K8QA 3MV7A 5DJ8B 5E8NB 5B8CB 4YHNA 3T77A 1HC1A 5C0AA 2QADB 4MJ4A 1JGIA 2A4ZA 4XC3L 3NEEA 1IKFL 1PD1A 3ZT6A 2WUCH 3KW7A 3X14A 3ZE0F 3V5KB 4WQOA 2AJ3A 5I5JA 1W0VB 5CILH 1DE4A 2AJXL 5IB4A 5KSBA 1A6TA 1UD4A 4AG4L 4IIQB 3BKCL 5BXFA 5HTSA 5HYFA 2OTPA 2ZXEB 4FQQB 2GIYA 4KK9D 3UYPA 4ETQB 4IMLA 4Y5XB 2W9DL 5EZJA 3ZHFA 5HSFA 4AGQA 2QKIC 3CK0L 4KTYA 5AOZA 3UC0L 2PPEA 3NBNA 2PO6A 4J8RB 1UOKA 3Q1SL 2WUBH 5FYLD 2IQ9L 4LVNC 4DP2X 2VCOA 1D5BA 4XNMB 5FLUA 4OV5A 4G6KH 1UJ3A 1K2DB 2ZXAA 2F9BT 1NCCH 1MHCB 3JTBA 2L3BA 2XWDA 5AW0B 5TH2A 3HC3L 3U9UA 1MFBL 1LK3L 5LNEA 3Q6FB 3G5VA 3KYNA 1FL6A 2BJML 3SGEH 3V2AR 2KPNA 4C58B 1XSJA 3BPLC 1WZ1L 1SJMA 3FB5A 1CICB 1DDHB 3GBML 3WS3A 1Z9LA 4KX7A 2WWNA 4PS4H 4JVPA 4U1MA 2Y1YA 3L3JB 32C2A 5L9DH 2D7TH 3JWNH 3V5DB 3P3UA 3MRFB 3S8WA 3TA3A 3MFFA 4B6ZA 3OXRA 3H53A 4M5SA 1VFMA 3M45A 5F7DA 1CURA 2LW3A 5CCHE 3RDTC 3DYOA 3QULA 2UZYA 4XO4A 3VVWA 1BZDA 1OZUA 3BWAA 2WLJA 4XN5A 3VFMA 4LSSL 3CFCL 1GY2A 1B4LA 1ASOA 3ZE2F 4RETB 5DXWA 2GUOA 1QSFB 5AB0A 5I8OH 5L0QC 1PY9A 3EAKA 4MVBD 3V6ZB 2F8OA 3PABA 4NSKB 1WSST 3ILQD 4FXKC 5E1AB 2YGNA 2IH1A 4ZQTA 4S0TD 4FTVA 3SKNB 4PVLA 1UD5A 4GW4B 1GTNA 3OKNA 1AHWA 1BQUA 1JD9A 1E9OB 2BSSA 3LZOA 3EJJX 4U7SA 1HYSC 4NQVA 2R2EB 4Y9GA 4CMMA 3H3BC 1XR9B 1KT2B 2FO8A 4Y4HD 5EA0L 4PS3A 1KBPA 2YFOA 1U3YA 4TQIA 2LHAA 3ZQXA 2WKOA 4J3OC 1HAWA 1QKZL 2FJSA 4FFWD 4IKJA 1RJLA 4IOSD 5TDNA 3OR7B 3SOBH 3WL9B 2I26N 4ACTA 3T4AA 4GG6A 3KJ4C 1W15A 2OZNA 1IGTB 1V3MA 2BNRD 3UBXI 1IO4C 1QRNE 4FCAA 1KY7A 1GAFH 3FN9A