3KCWA

Crystal structure of ganoderma fungal immunomodulatory protein, gmi
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
110
structure length
110
Chain Sequence
b'SDTALIFTLAWNVKQLAFDYTPNWGRGRPSSFIDTVTFPTVLTDKAYTYRVVVSGKDLGVRPSYAVESDGSQKINFLEYNSGYGIADTNTIQVYVIDPDTGNNFIVAQWN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords immunomodulatory protein
publication title Single cysteine replacement at Leu6 increase the potent and thermostability in Ganoderma fungal immunomodulatory proteins
rcsb
source organism Ganoderma microsporum
molecule tags Immune system
total genus 27
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2009-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09259 Fve Fungal immunomodulatory protein Fve
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3kcwA00
3KCWA 3F3HA 1OSYA
chains in the Genus database with same CATH superfamily
4NUGL 1M56B 2X28A 3LIZL 3O41B 3QZBA 4JPSA 4OD2A 1FNSH 3EHBB 4P46D 3RIAK 3RIFK 4K7FB 3C09C 1W16A 4PJGF 3HC4L 3IAGC 5C8JA 1OVZA 4XP5L 1BQHA 1C16A 3NAAH 2VXSL 4DVRH 4CDGC 2N01B 2NUPB 4ZO9A 3QCUL 2VNCA 4AMKH 1TFHA 1U2YA 2X4UB 4XPAH 1Q9WB 3ZHNA 1TZHB 2ODHA 2NSXA 1JK9A 5F72S 1FH5H 1XT5A 4H26A 2G2PA 3LHAA 4ZTEA 4YNYB 1Y0LB 2H45A 4PJEA 4YIQA 5DFVC 3IGKA 2OXHA 1QR1A 5AOIA 1NAKL 3MLWH 2YD3A 1FYTD 3HA0A 5GSVA 2DQJH 4KI5D 4H44C 3KWWA 2EIMB 1CTNA 3HBQA 4PRAA 1QD0A 5CJQL 1NJ9A 2G0LA 3AG2B 4WI0B 4YC2C 5SWZD 2GG1A 4LCUA 4QO1B 1HILB 5D55A 3BPNC 2ARJA 2E3VA 1CLYH 2AAAA 1SN0A 2H6PA 3BDYH 4L8CA 1YO4A 4HDIA 2V6HA 3CFUA 3EYSL 4X6EA 3ZU8A 1Z9OA 4Q9RH 1PLGH 1MCNA 3WJLC 1TEYA 4YBLB 2EO9A 1TJHL 4OIIH 5F88B 3TYFA 5KVGL 3VD2A 3WFDH 1N10A 4OLWL 1IGML 3NFSL 4YX2H 1DANT 3V0VA 5GIRB 4Q0XH 1XGPA 2OJEB 1MCCA 4WNQB 2OMWA 4KJQD 4MS6A 1K4CA 3MV9D 1Z3GH 2OMYA 4I18C 3GRWL 2YKLL 3T0XA 4DW2H 5AB2A 5A7BA 3MRQA 3F84A 4HD9A 4JCMA 4QAWA 2XV6B 2WQSA 3WXVH 3Q05A 1KCWA 3B6SB 3MN8A 3D2UB 5CGMA 5JPNB 1R3HA 3GI9L 5L4MA 3I3EA 2DMKA 2VAJA 3SIKA 1IEBA 5BQ7A 4O5LH 3QR1A 4O2EA 4R2GD 2F74B 4ATTA 1MFCL 3BH8A 4X0NA 1BX2A 4DZBB 5IVZB 4S2SA 4XI5D 2F1EA 3HE7A 1YQ2A 5DMGD 3TFKC 5C3TA 3CFKA 4YDJA 5ALBL 2CHWA 5I15H 2E7BA 3MRIB 4F1SA 3MV7A 3JV4B 1E8ZA 2F18A 4Q7DA 4DKFH 4PB0L 2YN5A 5C9JB 1MUJB 2WD0A 4QRPB 4HWZA 2XHNA 2B5IB 4N26A 1VZIA 1ZWIB 4TL4A 3MOBL 5C0ND 1I31A 2EEXA 4XCEA 4LEBA 4J3OD 5IQ7L 2CCLA 2AJYH 3EBAA 5LNGA 3QO1B 3RGBA 2OJ1A 1VFUA 2OMXA 3FQTB 1TU2B 4JL1A 2R51A 3IXAB 4IOSD 1OXYA 4WU7B 1KTCA 3B2VL 2OKMA 1A6TA 1WICA 5DRWA 5GRVL 2XIDA 1ILUA 4UDUA 4D0BA 1TYJA 2CO6A 1NKGA 5MI0C 3U7YL 2KZWA 3G6JE 3MRRA 1CLOL 4FYRA 3KBFA 1JNLH 1HOCA 4WSKA 5AYUH 2HVJA 2F6AA 4OAWA 2CXKA 1T5XB 5GGUA 2QGDA 1E5YA 3W56A 5B38G 2ZP8A 4K4KA 1HWGB 1KJ2L 1RULL 1QFHA 1NLDL 3C9NA 4NM4H 1CT8B 2ENYA 1TKWA 3WENA 5DR5L 2SEBA 2CKBB 4OZIB 3ILQD 3SZ6A 3Q8FA 3DGGA 5C2BH 4RDBA 3NYKA 3V5HB 4Z7NF 3ME0A 3SE4C 4HCGA 3CZJA 2BOBB 4NO3B 2EDRA 4PJEE 5C7XL 2OAAA 3MV8B 4PGJA 1HEJC 3BT2L 3HZYB 3LS4H 3IK2A 5CCHE 3S35H 4MTMA 2W0PA 1U8IA 5FF6A 5FO9A 4D3CH 4WW2B 4GNKB 2X4TA 2E5EA 4NO2B 1J5DA 3T8XB 3AXLA 4K8RH 1KY7A 3F5WA 3CZFB 1NCTA 5FC9A 4BUHA 4Y2OB 2EDEA 2RA1A 5HVHC 4PLNC 3K74B 4QRSA 2GY5A 4IBSA 5LNDA 5I6OA 3DUSB 2P80D 4MD4B 4ABWA 4HK0A 5D1XA 4R5VA 3VWKB 4Y19A 3WMQA 4AJWA 4GKSB 1NGPL 3Q0HA 5D7KE 3K72A 1IX2A 2NYYC 4RRPM 3EJRA 1I1AC 5F1SA 3CPLB 5CP7B 4AVJA 1V05A 4GSDH 4QKXB 4A7TA 2YO3A 4CJ1A 4KRMB 2EUVA 4M29A 3LB6D 4BSVA 4H5SA 3JVGA 3TIDB 4P9HL 4XTRD 5F2FA 5DYOB 1SEBA 1ES0A 2NUTB 1A5FH 1BSIA 1GPOL 4POYA 1WFMA 1JVLA 2YUZA 3HG1A 3HCVA 2WXQA 5AB9A 3EG9B 3PJSA 2D2CC 1KFAH 3G5WA 4YS4A 3M8OH 4JFHE 1NCGA 2YOAA 1N9PA 4NZRH 1L7TH 3ZSTA 1J9TA 3R06B 1NFAA 1BQRA 5I73B 3QP3A 4W9FC 1WGVA 3ECWA 1DVTA 4Y2DC 2FHFA 4FQ2L 4PS8A 1JD7A 4K94C 5GJTL 4UTBH 1B0RB 4ODSH 4X8XA 3MV7E 3RVUC 1LO0L 4QXVA 4P2RA 3P54A 4A2HA 4O2CA 1IL1A 1L0PA 2YD4A 3MLZL 2V5TA 2X2UA 3KHQA 4JKWA 1XCTA 3ZE1F 4NQCD 1L9PA 4GT7A 2VCOA 3MCKB 1AMYA 3SKNB 3QXVA 1E4XL 1EFXD 2VDML 4HAFA 2XWRA 5AYQA 5B3NA 3IN2A 1AZRA 4OF8A 1PZ2A 2DF3A 4ENZA 3WN5B 2DRUA 5D4HA 2HVKA 3QIBB 4AYGA 3D07A 2GB2A 1IVTA 1JTPA 5EUOF 4ZMOA 4Q56A 2GC4C 1NEPA 3SBRA 1KWKA 4JMNA 2IADB 3E7JA 5GGSY 4KK6C 3ZW3A 2KZKA 4Y4FD 3FYEB 4P4KC 4ZRGA 4WZ9A 4HCFA 4ZDHA 3ET9F 3SE6A 3HAEA 4X9HA 4F20A 4Y4KB 4HXAH 5I18L 3REWB 4G1MB 5BJTA 4GH7B 1HH6B 1QW9A 2HWZL 1R34A 3QUYD 1XHHA 2C3GA 4CMMB 1ZLUH 1A65A 3TCXA 2UY6A 4DHLA 2XVLA 4JRYD 5KVFL 4PR5A 3QXAA 1UD5A 1G9NH 1MFAL 1MCWW 2R1YB 3HN5A 3NGBB 4ZFFB 2WC7A 1SFHA 1JPTH 1URIA 2MWCA 1U3HC 3ZT7A 1BOGA 2X12A 3DJ9A 2XTJB 3K8LA 2FJGA 2BNUA 2K9UA 2P8MA 1NIBA 5DEZA 3CHQA 5GS1A 5F1NA 2VXQH 4X5XA 1RFDL 1AKJD 4KKQA 1FIEA 3FFCA 1G7IB 2GBTA 2R39A 1I8KB 4FFWC 3SGKC 2J8HA 2YUXA 4CW1A 5I82A 1OAKL 1E6JH 5D2NB 3ZBMA 4AENB 2FJUB 3V79C 2CPUA 1U8KB 2VE6B 1T3FA 2IPTH 4ACTA 2IPKB 3L81A 5D1XE 4JHBA 4F93B 2BS8A 4Y19E 3X1NA 2P8PA 3OKOB 2VLRA 2JQMA 2BHYA 2NNCA 4J8RB 4BRVA 1ZS2A 2VR7A 3U36B 4FLOA 3LAFA 4YEFA 4A6YH 1UATA 5JOFA 1G43A 2G0KA 2O5XH 4NXSA 5EU7E 1PU0A 4ZZKA 1F4HA 1NFDA 2P7TA 4HIIA 2X6VA 4X7CC 3NPZB 3M7OA 4Q58C 3TBBA 4LAQH 1UWYA 1N8OE 2ZKMX 3HG1E 1EX0A 5EZJA 4H0IA 1GGCH 2ESVD 3UTZA 4MS8D 1RUML 4GRLD 2J44A 4HHAA 4FLHA 3QI9A 4GO9A 3U7AA 1Q9KA 4MD0A 4HC1L 2GITA 4D8PA 1PEWA 4A7GA 1DQML 4WDIA 5JHLH 1R5VA 2X3CA 2QKIA 3F7VB 3FTGA 4FQ1H 4G7VL 4PJ9B 4PQXA 5TGBA 1FFQA 3INUH 1IZJA 4ZMXA 4P2RE 4PJBA 3S3JA 2AV7B 3SDDD 1N70A 1BD2D 5B8CA 3KXFA 2NZ9D 5KSUA 4GUPB 5T1DH 3CXFA 5ADPL 4QRUB 5CEZH 5AD0A 1OGAB 4RISH 4X99B 1UXSA 2Y36H 2VDKL 5I6LA 1LTXA 1RZGB 3LRSA 5AQ0A 4NNPL 4M3HA 1OW0A 2E7LC 4MQXD 4HALA 2BMKB 1MFDH 4S1QH 2I60H 3NOIA 1T1WB 2NNFA 4PFEA 4WHTB 3DECA 4DN4L 1HL5A 1QTSA 1DLHA 1UM5L 3FSZA 4V11A 2CALA 3COOA 4ONHA 5CWSA 5CZXC 5IK3B 5ACMA 3THMH 1T0MA 4N86A 3RTQA 5HGBB 3VB9A 3PAZA 1KF9B 5I17A 3PAUA 5T3XL 4KVCH 3V0IA 4IBWA 1BWWA 2ZUQC 4HWNA 5FKPA 5FX3A 2UUDK 3LQZA 1MCLA 4Y5XA 4XNZC 4A37A 1GJWA 5IB5A 1M3JA 1KJ2A 3KPSB 1UA7A 4GAJH 1AXTH 3QRGL 3I75B 4HJJL 4IU3B 3L3OA 5B39A 1MH5A 3K6FA 3O3DA 1D6EA 4X8JB 5DK2A 1QZNA 3JVGC 4B6ZA 3FFCE 2PPEA 2F53A 2FWOB 3NP4A 2WUCL 3RZCD 3VGGA 3GXFA 3IDGB 2AV1B 3AY4C 4YHOL 1WZ1H 1PX8A 3D8MA 3HG0A 1JXKA 5F7BA 5D6DA 1ZIBA 1UWFA 2PW2B 4LEEA 4F15C 5E08H 1JPGA 2G3XA 2VLRE 2L04A 1BXXA 4XAWH 3U0WL 3II3A 4ANWA 5ESAB 3S3BB 1YNTB 4O02B 5FWQA 1WWAX 2EYSA 4KWUA 3W0WD 4P5TC 2R1WA 5HHOA 3T6XA 1NFDE 3MC0A 3R4RA 2QSCH 3ARFA 1TZIB 1BVOA 4W6WB 4G3YH 4GRMA 4Z7VF 1BYOA 1ZT1A 5KUMA 1ZEAL 3L4YA 1NAMB 1W15A 4CSPA 8FABA 4LQ1A 3HR5B 4ODHH 3HG2A 5GGRB 1U8HA 2GJZB 4M6MH 3RWEA 5LBGA 4UBDC 2EDMA 4JZNA 3C6LD 1I4FA 1RL1A 2NY2C 4GMTL 3U30C 4GAYB 1RMFL 3AMKA 4KC3B 1LP9B 3CDFA 3HPLB 2HJKA 4KXZI 3JSSA 4L4TA 5IVNA 4PTUB 3CH1B 2WWNA 1L3WA 1PDKB 5ADOL 4FXKB 4UTAL 3Q6GH 4LE8A 4UB0L 2J8UF 3MJ9H 2YD1A 4PJBE 2MCPH 4AGMA 2PO6A 5DI8A 4YMPA 2KI6A 2AEQL 5E1GA 3KXFE 3X1FA 5HXMA 3QJVB 5KEZA 2DOCA 1PKQA 5FGCE 2MNUA 1DN0A 3AU1A 5DRNB 5IUCA 1IAOA 2HMID 1B0WA 2Q3ZA 1OAZH 3FZUD 4DPBX 1FZOA 1IGCL 3U4BH 4IRZA 2V3EA 3FOMB 3NJLA 3BKJH 4I48B 5C3LD 1XEUA 2Y23A 2I5YL 3HUJF 3WKMH 1C08B 2X70A 4X0KA 4Z0XA 4N2AA 3ZUCA 3ZKXB 5I0WA 4F9PC 2RQEA 4YL4A 4AKOA 2NR6A 1DSYA 4P3DA 5L2JA 1P4IH 2VDOL 4WO4C 4DGWC 5EBMA 2IVFC 3BUTA 3DV6B 3JV6A 2HX7A 3RE0A 5DXWA 1T89A 3MU3A 5F8RC 1DBKL 4G1EB 4QRRD 2A77L 2BSBA 3T0EA 4UUJA 5FPIA 4KDVA 4OM1H 3RIKA 5INCA 4ANVA 5A2LH 2DLFH 2CK2A 3R19A 1WEJH 4L1BA 1XXDC 4LVOB 4AM0A 4AUUA 1MRFL 3BD3A 1JZJA 3CXHK 1OF2B 3QQ4A 1JV2B 1M4KA 5HHNA 1A7RH 3EH5B 4NN5C 3N9GL 2L7EA 4FOMA 5FFLA 4KI5F 3FRUA 1T7XA 3OAZH 4YDZA 3QFJB 5CJOL 1FO0H 3M6DA 1FL6A 1NCAL 3OHXA 1XCWA 3D3VA 1XZ0A 5C0AB 2XVBA 2PNDA 5H37G 1UZ6E 4KKNA 5MERB 1WRFA 4RMQA 1HOEA 4RGMB 2ZCLH 3P3TA 4M7JH 4JRWA 1ZDSA 3ASWA 3L7EB 1OAUH 2ITDB 2XZAL 4JM2D 3HRPA 5C1MB 1A1OB 2CDEB 1JMZA 1K8DB 5HJ3A 4D9LL 4TRPH 2F53E 3HNSH 1GXEA 3VX1A 3MNVA 3VXOB 4DJMA 4AVIA 1GW6A 4GKNA 1NLBH 1JHTA 3A21A 4KKLD 5IQOA 4H88H 1BPLB 2D4FA 3BWUC 3CFDB 1ILSA 3NIGB 3K3QA 1ET7A 4BUQA 4EQ3A 1N6UA 1W2KT 5I1KH 5CU9A 3ARBC 1FNFA 3P3RA 5HHOE 4NC1C 4AQAA 1OP3H 4N3TA 3ZDXE 3M1CA 5JQ6L 2CRYA 2WGXA 1JWMB 5LKNA 3GRGA 4P2OD 1AY1L 2CMRH 3D48R 4MJ6A 2R2CA 1DBJH 4HXBL 3TVMA 4NX0A 3S34L 4YDVA 5FYJL 1L9TA 4RBPH 4KV5E 3G5VB 1T1ZB 1D3CA 3IDMA 2ZOUA 5AW7B 3GLEA 5I1IL 2F58H 1NBVL 4ADGA 1LVEA 3U1SH 3DO4A 4QXUH 1PZBA 4Y8AA 2NPLX 5KZCB 3TOPA 2ADGB 3JTTB 3O2DA 2YAMA 4L4TE 4WTQA 4AC4A 5EF2A 1TQCB 2BSSA 3QC5X 4JB9L 2ZAHA 1YMHA 2R29H 5D7SH 4HS3B 3JWDH 3MLRH 1EANA 3EJJX 3P73B 5F9WB 3RAJH 3MJ7B 2FEEL 3VW3L 2A4CA 4M1GH 1NUFA 1PKQE 1U33A 2HT3C 2EDWA 3GKZA 2EDQA 3NSDA 1UASA 2ATKA 1JCVA 3HLAA 3QUXD 3STLB 4F33A 2C8NA 2ATPA 1IILE 2JKNA 3ZGHA 3FB6B 3IKKA 1D5ZB 3NRPA 4ZQKB 2HKHH 3WNJA 4K3HA 3V9CA 1Q90A 2OR9L 3OPZL 4BH7B 3L1GA 3MRLB 5GGTA 3ARGC 4H1LG 3AAZA 1BM7A 2F15A 5I2IB 5E8DL 2E76C 3I3DA 2J4WH 3T0EE 1C5DA 3QYCA 4ONGL 3RI5K 1HTYA 4I0PD 1V3MA 4YHKH 3V0JA 3VFPB 2DWEA 3WFEL 2VMJA 3HI1A 3L1OL 1E0OB 2D4DA 3ARSA 3VXRD 3DO3A 5JIQA 4N2EA 4PMFA 1S8DB 1OP5H 5FO8A 1NBYA 4LLWA 4X7TA 1NCBL 2OMNA 5CZVH 5D8JH 5DTFB 1I82A 5DMIH 2QVKA 4LHUB 2BVQA 1RIVH 3GJFA 2Y1AA 2JJSA 4MD5B 4LLYB 2WYIA 4ERSH 1DQIA 3HS0C 4XH2A 4QI3A 5D6DC 1JYVA 2XU9A 2I9TB 2XVGA 4AIOA 3D3VE 3OKMA 3S37X 2ORBL 2C9UA 2YQBA 1K2DA 5F9OH 3QORD 2Y5EA 3R4DA 3ULUH 2OZ4H 3O3BA 1AQ8A 1VGEL 4WSGA 1RCYA 5BVJB 4WJG3 1YN7A 4PS4H 5I8CA 4EN3B 2QADC 3PABB 1NCWH 4Z76A 4MYPA 5KJRL 4BWWA 5BS0D 4R26H 2FK9A 1MXGA 3ARFC 3EYOA 3T5WA 1DFBL 3B9EA 5C0JA 1ZGLM 1XH1A 5KVFE 2YPLD 3GNMH 3ECQA 1U8NA 3RX7A 4YXHH 4HUVB 1TCRB 3EOAA 2ZYIA 4GW4B 2QQNH 2DI7A 1Y18A 4JR9H 1BZQK 4DKAA 2EVIA 4IGBA 3HZ3A 4OH2A 1DR9A 4MKMA 1AJ7L 3L3GB 3PWLB 4AL8L 2CUHA 2VDNL 4B9CA 4YPJA 4ZPVA 3X1GA 4P9HC 5AZEH 2CG9X 1WFJA 4BCYA 4BXVA 4OGYL 4KZDL 3C6EA 2A6DB 4P49A 3QIUB 1HEZA 5D7LA 2W92A 4FFZL 5DFTA 1R75A 3A5VA 3K8KA 2X6AA 1G6RB 1F4YL 2W9DL 3PWPD 3NJMA 3HFMH 3CBJB 1PJ9A 3WO4C 1XGTB 4H25A 2A73A 5D5MF 5LDSA 5EUKB 3SOBH 4DUVA 3MOQA 5DQJB 1GTNA 5A2BA 1JDDA 3FUJA 1QA9B 1CCZA 2YOCA 3SCMB 2WTPA 2G5BA 1QBLH 3WTUA 5JIKA 2K3TA 4MNGB 1T89C 3H9ZA 2NY0B 1C8QA 2VDQH 1TVBB 2PR9A 3CVHL 1I1RA 2ZYSA 1JWSA 4J1UA 1RP8A 4KRNA 1TFPA 3NJVA 2BWQA 5EOQL 5CBAA 1D7DA 3B37A 3LXBA 3DJSA 1ND0A 3MROA 3UAAA 3B3IB 3LOWA 3VQ1C 1MVYA 4NZTL 1CDIA 4HIXL 4Y5YC 2XIBA 4OIFA 4QTIH 4M7LL 4UTAA 1INEH 4GIPD 5D72H 1BZOA 4NRXB 5DD0L 5IB1A 4YSOA 2QQLL 5DVPA 1A6UH 3LPPA 4TUOB 1A3RH 3KVPA 1F4XH 5L9DL 2DYPD 2RQ8A 1N6QH 3L9YA 5DEGB 1PZ5B 1BFVH 4XC3H 2HT2C 1RURH 4YAQA 3TS8A 1PYWB 1OE2A 3G5XB 2Y22A 4NQDD 2TAAA 1FVDB 4RIRB 4ZUUB 3LCYA 3PDOB 2Q8AH 3UZEA 3K5SA 3WL9B 4FULA 1DQLH 2EYTB 2FT7A 3MSPA 3TBTB 4HJEA 4AGLA 2WSPA 3HHSA 2VO8A 4DK5A 4Y1AB 3HJ0A 3RUGF 4DQOL 1SBSL 1K3IA 3D50A 4KJPD 4S1RH 2WCGA 4YUEL 3VE0B 1MDTA 5LGJA 5EO1A 4NO5B 3BSZL 5C09A 4N0UA 2H1PH 2CHZA 3SKOB 4IIQC 4MMZB 4J4PD 2OTUA 3PREA 1MCBA 3D18B 4AQEA 2QVFB 2WLNA 3FTYA 2GJ6A 4YN3A 2RFXB 1OSPH 4OZHB 4PJ8D 5IHHA 2B2XL 3RKDD 3L08A 1KOAA 1FGVL 1U9KA 2Z65C 3DTDA 4GKOA 4UT7L 2ZF8A 3HZMB 1JYWA 1BEYH 1MCSA 3TVMC 5KBLA 1S7WA 3V0HA 2CKNA 5FYKD 3MJ6A 4CSTA 3B34A 4P5KA 2VZUA 1H0DB 1R3KA 2W65A 5DVOA 1PLBA 3U4KA 1A7NL 3B7YA 4ZMVA 5EORL 5EFIA 3CK0H 2EIDA 5GS0D 3T0DA 4Y16A 5E6IB 3G7TA 3O3AA 4AQ8A 3JWOL 2ZICA 1K3ZA 8CGTA 4OLZL 3JTSB 1IGFH 2C7FA 4MBOA 3VXMA 3QNXB 4LVHB 4CUCA 5D70L 3L45A 2QELA 2X9ZA 4DCQA 5BOZG 3EHBD 5D7LE 5FM5O 4NHCH 3UBXG 1U30A 4D9QD 1KC5H 3EDJA 1SXCA 3VFWA 5JTWA 3QDHA 1T20B 4GRWE 2ZWLT 4HIEB 5E4IA 2Q5BA 5F3HB 1L9SA 3LH2L 1IV8A 1J5HA 1C5BL 3GC3A 2VSCA 5F7EL 3IJ9A 1Q0XL 4OI7A 1TJMA 1VFAA 2NXYB 3W39B 2IPUG 3OBAA 4ZUWB 3H9SB 3L4XA 3FJTA 3TZVC 2D7TL 3TNNB 2BP8B 3RY6A 4XPAL 32C2A 3FQNB 2ETWA 5I5MA 5E2TL 1RZ8A 2G9HB 2YXVA 5J6SA 2I07A 2YD6A 3K71B 1XH3A 5HPMA 3C60C 4KROB 1JZIA 2FSDA 3UJIH 1WBZB 2AK4B 3Q9PA 3ILPB 3TN0C 1U2HA 1RJYB 3C2AL 4YHYB 1Z5LA 5EO9B 3EOYG 1K6QH 3WLBA 4PJDA 5F6HI 1KGIA 1KLFA 4MXWH 5CU5A 3K6DA 5G55A 3CDYA 3TA3B 3WHXA 4AZ8A 1KB5L 2BCKA 1KIUB 2JJSC 3RDTB 1HXKA 2DTSA 4YZFF 2FLBT 4ZAKC 2VAAB 4DUWA 1OTTD 2NY1B 5HDRA 2BIIA 1KGXA 1E9QA 1UFUA 2DJUA 1OV8A 3IFPB 3K4AA 3RG1C 4R4BA 5IJDC 5KOMC 2AP2A 1PAMA 2WLZA 1LDPL 1OGPA 3ZLQC 3FT2A 2Y3AA 4P23A 4KFZC 4L05A 2BVOA 4OJYA 4BA8A 4EKJA 1PZDA 4MAYC 4HUXB 3VXUA 3VXQB 3FTSA 4P4RA 1S5HB 4YX2L 2DV6A 4Q0XL 2WOBA 3VA2C 1KEGL 2OYLA 5A43C 4L1HA 4Z3FA 3D2UD 1Z3GL 3GMOA 2OW7A 1FVEA 5GRXG 3WXWL 1A8ZA 3HI5H 5DQ9B 3NJFA 3FCSB 3WXVL 2MPVA 1EHNA 1KXVA 1R1CA 2AJVL 2RCSL 3ZQ9A 5C09E 5GRUL 3U0TA 4AZUA 3G9AB 4N0UE 4R90H 5E4EB 5FDYA 4HKBB 3VD5A 3P0YH 2CRIA 1TVDA 4MWFA 5I1HH 4XVJL 2ZKHL 3HBGA 2GJ6E 1AANA 4QRPD 1CF8H 4RGNB 4R6UA 3OLDA 5TK2A 4NBXB 3VI4B 5DK0B 2K7QA 2JCCB 4PBDA 2Q76B 4LHQB 1ZLWK 1CGXA 4U1NB 2HN7B 4DKFL 3KLHD 1OSEA 1KENH 2EKJA 2X2JA 1UT1A 4FTDA 1ETZB 4FXGA 4RFOL 2X9WA 2VLKA 4CC4C 3TBWA 1OWWA 4X83A 1KN2L 3C5ZB 5AB1A 4JANB 3NG5A 5ICZB 5J11C 4G9FB 2Y72A 1I7RA 3A4FA 3BIKA 3ZKMC 3SD5A 2RAMA 3ULUD 1G84A 1Q1PA 2GPZA 4TUKH 4ZTOH 3VXME 25C8L 4APQA 1U4EA 1JPEA 3QA3B 3CZSA 3PF2A 3IJSA 2AXFB 2G5RA 3PIQA 2ZCKL 3RL2A 5KVEH 4KTEH 4WNJA 1MHHB 3QCVH 1JNLL 5EU6A 2UYLB 1NZRA 2BW4A 5AYUL 4ES9A 1EO8L 4HG4J 1C1EH 4XMLL 1N59B 2E8YA 1HIMH 2V37A 2HFEB 4FQHB 4LOVA 4P57B 5D1QC 3IPBA 1IC4L 2IIJA 4JZOA 4KKAC 5FOBA 2FO1A 2OL3H 3AADB 3DVFA 3RGVC 3A67H 3MV8D 5F0JB 4MCNA 4G83A 4G7RB 1JNNH 3SPHA 3IJEB 5FO7A 1C12B 2FJFA 3FDWA 3GSUA 3H8NA 4PIRF 3BRDA 1NGZB 4MX7B 1WHPA 4Q9QL 4IS6A 2YJLA 3PQYA 1ODUA 2D9QB 3I6LD 4JVWA 1FG2B 1ZV5A 4O02H 3MMEA 2P5WB 2QEJA 2WO4A 2Q6WA 3C5XA 1C5CH 5IIEB 2MKLC 5KYUA 2Z4TA 3RWHB 5I1DA 4XX5A 3L5IA 2AJSH 2DDQH 5HHPB 2B39A 3SBWC 5IJVA 7PCYA 4PJDE 2UX7A 2AXJA 4OQTA 3VFNB 1JZ5A 4G8GA 2WXGA 4OZ4A 3ZL1A 1N3NA 2OQJA 3VWKD 2EIZA 2LVEA 3WIIH 1R3JB 3OWRA 3QIWC 2MSPA 4NO0B 3N41F 4RA3A 1YPZF 4LCWB 4WFGE 4Z3JA 1BG1A 3OJDB 4A7QA 3V4VH 4JG9A 3VXUE 5LN8A 1AXSA 4MB1A 4V1DB 1IGJA 2ZWSA 5EU5B 4KAQL 4QF1A 4P2AA 4R7NA 3Q48A 3VFSA 2F8VA 1ZLSH 1GZPB 3STZA 5D7JB 4Z7WB 1BFSA 1RZQA 2D7PA 2APWA 4L1DA 4L8SC 2D03L 1RZFL 2X6BA 4EDWL 4LSTH 1KMGA 4HIJA 2B14A 3CFTA 3DK0A 4XVSL 5F3FA 3RIFF 4RAUA 4JFTA 4EI5B 1RP9A 3OAYK 5DVKA 3HPJB 4NAJA 3W3BA 3MX0A 3PRZA 1X6LA 2G60H 2DMGA 5B3JE 1MQKH 1IKNC 5GHWL 4Y16C 4YHIB 3GSWA 4LMQE 2JXMA 5DZAA 4K3DH 3BJLA 2FHBA 4WW1A 1XF5B 4XOCA 5CLXA 5GZND 1DQJA 1ZRUA 4C54A 4GUCA 3QXUA 1ZHNB 2GIXA 43C9B 4DTGL 1DZ0A 4L8BA 5KOVC 4ZXBA 1UVQB 5FYLL 4ODSL 3FTZA 3B9KC 3BEWB 2VM9A 3VRJB 3KWTA 3O3UN 1SY6A 4IOIA 1PL3A 3IFNH 5BUPA 3GIVB 2JSFA 2VLKE 4H20H 5T5FL 4A1RA 2FD6L 4JFDA 1NPJA 1QFWI 3BD5A 3BLPX 4I1NB 5LUMA 3DX4A 4W9ZA 5A16A 3QIBD 3LKQB 3WIHA 1RVFH 1KJ3H 4X4KA 5GS2H 3U9WA 4AWJC 3LZOA 4HLEA 4Z3IA 4JMXA 2NW2A 5DJZA 2VISB 2Z3FA 4LPVA 5ECJE 3RY6C 3O2WH 3WMSA 1CFQB 3LJ3A 4EOWH 2IBBA 4OKDA 4PRPA 4LF3A 1QWUA 3K6SB 3LKPB 1CBVL 4WWID 5EU6E 4Y4KD 3ASOB 3E8UH 2NNAA 3NSJA 4MQTB 2VM4A 1E7UA 1FZMA 3MRJA 3L5HA 1DJXA 2ZSWB 3RLSA 1KCRL 5F6IC 5F70A 3SKUD 4PGBB 5SWQA 3ZIMA 2PW1A 1U4FA 2DMHA 4Z7QE 3F6LA 4O2FA 5ES4B 1V55B 3AS1A 4M62L 1FV1B 4GT0A 1DCEA 3PP4L 4LK4A 1J8KA 1UXMA 3SQOH 4NWUH 4XP6H 4Q74A 3PQYE 2VSDA 4W93A 3WBDA 3T09A 1JPTL 3JWNH 1AO7A 3P9LB 1TYEB 5F7FA 3BVNA 4HS6B 4N2GA 2PXYB 3H7BA 5PCYA 1I3RA 2Y2TA 2VXQL 4NNXB 1VFMA 1CD1B 3IMSA 1TSHA 4UNIA 4FMKA 3QQ9D 4G8GE 3QG6A 4LFHD 2FB4H 1E3XA 4JRLA 1MFUA 6PCYA 3ZYJA 1E6JL 4TKWA 3DX6B 2A74B 3KPOB 4RZKA 5F7WC 4QMEA 5HJGA 3T6QC 1BBDL 4ZFOL 5BW7C 4JGNA 4U6YA 2JKLA 2ZAIA 1WIPA 4J7RA 1DQVA 4NIYE 5IREA 3F12B 4A2GA 3CFJA 5EU4B 3NSFA 3BD4A 5I16A 1UG9A 3D25A 4WI5A 4CU8A 1RPUA 2JQZA 4XNYH 4FXTA 3EJYD 3NCMA 5DJDA 1NCCL 1E28A 1FL3A 3O6FA 2R0ZH 3QNFA 1ZE3C 4HJIA 1USZA 4KKRA 4NJ9H 1SYSA 4W68A 3D4ZA 1OP9A 3QZWG 3I6GA 4U1MB 5EC2B 1E42A 2QLYA 2XFXA 3CCHB 1U8OA 4PJ9D 4NWTH 5IBLC 4C4UA 5E2WL 2W59A 4DAGL 2YFNA 4G70B 3C6SA 1X5AA 1L9OA 4WTWA 2IXQB 3IKCA 1DVFA 2WLHA 4L2YA 3U9UB 3UYPA 3VFGH 5GZOD 5K9OA 3INUL 5HP5A 1AR2A 5I6PA 2BCMA 2JB5L 1BD2A 4PCSA 1HZKA 3OM3B 3B9AA 3A6OA 3VXSA 5MENA 1P7HL 4HIHA 4LLQB 1F90L 4JFDE 4NFBA 5D7EA 1U6AH 4FZ8H 4JJ5B 5CJBA 2CO2A 4AL8C 1UCBH 4LVNB 4X6CB 1P53A 2WLYA 1CFNB 4XP9H 4ATWA 4FF9A 3ULVL 5CSBA 5AAMA 1CXEA 4UF7C 3QDJB 5TFSL 3D05A 5JDJA 1HCVA 5F7DA 1BGXL 2WO2B 4PRPE 5LB1A 4S1QL 3MR9A 4G43B 2I60L 2GJRA 3QUMH 4BYHA 3BFQG 4QPEA 3BYTA 4QTHB 5J6GA 4LBEA 4FCHA 3GSRB 2GSGB 3TEXA 4HEMA 4L9LB 4NCC1 4P5MA 2ZPKL 3FO2B 5ID0A 5JXED 1U8LB 1RHHB 3R0MA 5DURB 2VR6A 4M1DH 5CSZB 4JQXA 5K69A 2Y5TA 4HWEH 3SKJL 4AQZA 1BBJA 1AG6A 1ID5I 2HXAA 5EEWA 3QHFL 2EDDA 4Z5RA 2OMVB 4UOW1 3SO3B 3WELA 1A3ZA 1DZBA 2IG2H 4JHWL 3UIZA 3DSNB 4MCZB 3X13B 4UM8A 4PP2B 3KPSD 3PY9A 5HYSG 4AQ1A 4AKPA 5ID1A 1M57B 5DSCA 1K5NB 1KPUA 3WG7B 3BZ4B 3AITA 2AQ1A 2YK1L 1CF1A 1MCQA 1NCDL 1AO7E 1EJOH 2B4CL 4YXLH 2W60B 3KJ6H 1ZANH 3IPEA 1FZKA 3CN2A 2VGLM 2AQTA 3FHQA 4ICWA 3TO4B 4APXB 1R3IL 3AG1B 3M1OA 4U33A 2ZX7A 3EIFA 3TT3H 4U1GC 1WZ1L 3WAJA 1J1XL 2Z31C 2OYPA 3BP6A 1O0VA 3ESVF 3VRIB 2IH1A 2CD0A 1M7UA 4IU2A 5TJWK 3Q2LA 4M43H 2HJLB 3ESMA 3VGAB 3D9AH 3GMNA 3K81A 3W0WA 4RRPG 1Q9LA 1MWAL 1RZJH 4OVVA 2NW3B 1BG9A 2ZG2A 3FRPA 4PRBB 2FWSA 3CAFA 4NGHH 2DPKA 4LRIC 2W07B 4YC2B 1D2OA 2KBGA 2CRZA 1X5GA 4PGDB 4ZPTA 1LNUB 3O2VL 1V54B 1OAYL 3DVGB 2YGQA 2D2OA 3AZUA 3S88H 4F7TB 5JORB 2P24A 4HU2A 2DQFA 2FIRT 1Q94B 1RPQA 3MRCA 3WUZA 4E0RB 1T21A 1N8ZA 2FHCA 3NACH 4HJ0C 3OAWA 4FQXD 3NCWA 1PZAA 2J12B 4MVBC 4XO4A 1T04A 1MKFA 4M9OA 5AOMA 2GI0A 1N19A 3MO1B 3NJJA 5C6WH 3NN8A 3EYUL 4HH9A 3DPBB 1CURA 2PTTA 3EDKA 4LDEB 1A6AA 2F5BH 4X80H 5EIIG 1BD2E 2EH8H 4OZGB 4QHPA 4PHXA 5K39A 1P7KB 5MENE 3VXSE 5F9AC 3BVDB 2GY7B 3RPIA 1E4XI 1OB0A 3FB8A 3FCTB 4AT6A 5JXAL 1J48A 3HKFA 3VX0A 3L13A 3X3GH 2F2HA 2IBZY 2QSTA 3EFOA 3LNFA 2GJPA 1KYUA 5KYYB 2QVMA 2IOMA 4BFNA 4N4YB 4UTBA 1MCEA 5IOPB 2O5YH 4TVPL 4GS7C 3BO8A 3QGVA 3EBGA 4K7PL 3ZTJG 5JO5A 4KQ4L 2FDBP 4KTDL 1ET5A 3SDXA 4HS8L 2X9YA 1A0QH 4HEME 1CJYA 1U91A 4OM1L 4ZO6A 2XPZA 2BFGA 3KGUA 2PWHA 4L9DA 4L48A 2DLFL 2Q8BH 1HU8A 2PCFB 4ZYKA 1L9RA 3MRDB 4PRDA 4KDWA 2DH3A 3BZFB 3QFJD 1FNLA 1PF3A 1DBAL 2ROXA 2OM5A 2BRRL 3FL7A 3PHOA 4ZSOA 4ELMB 3UX9B 3OJMB 1A3QA 1A7RL 3Q8BA 2EILB 1MHEB 2WCSA 2VN3A 1NDMA 4RMWA 1SXSA 3BQVA 4I3SL 2Q3AA 3CVDA 4R3SA 2IAMC 5DJCA 5MI0B 1WBYB 4F8LA 5DVMA 1J1OL 1RERA 2CHXA 2XXMB 3T4YA 4HKJB 1TTCA 5KWYC 4BQBA 5HYIA 3V6OA 5AB0A 3F58H 1C7TA 3R1GL 4LEOB 3WOVA 4WGVB 4HUUA 4YVUA 1JN6B 4JZJA 2ZCLL 3S2AA 4Y4HB 5IMKB 3KCPA 4GQRA 2RD0A 3E38A 3L48A 1FFNB 1BAFH 4HAKA 4TRPL 2J25A 2OLDA 4HLZH 1MPAL 5BRQA 3MI6A 1QLEH 3OGCB 4OLYL 4PP1D 3CQPA 3KE0A 3GMMB 4U1KA 4HK3N 2P8LA 4F3FA 1OPGH 4XO8A 4YR6A 3L3JB 1FA4A 1PNDA 1ZVSA 4ZW8A 3S4SB 3W0WE 2VXQA 4EZJA 3M86A 1E4HA 1HSBB 1E67A 3T65A 4ZUTA 3U46B 3WLWC 3WUWB 1MJ8L 2VC2L 3L6FA 4XN2A 4JE0A 4WI9A 1FORH 5JW4M 2WLLA 4Y9FA 3OKKB 3DETC 5H2BB 1A6VL 3ARUA 4KGJA 2D0HA 1DBJL 4EDXA 1XMEB 1JOIA 3SE3A 2HLFD 1HS6A 3QUKA 5J1TC 1H5BC 2F58L 4URTB 3U1SL 2Z35B 4BCZA 1EPFA 4A6YA 2P28B 1XEDA 4FL4B 4YDMA 1I1AB 3SGJA 4FQJH 3ZDYE 1MJ7L 2CIIA 2D31B 3W9EB 4AYMC 1XIWC 4HUWA 1XV8A 3FHAA 3LNIA 5AUMA 4PJHA 5CIPH 1E27B 2B1HH 3WS3B 3QWOB 1VIWA 4HP5A 3RAJL 3UL4A 4GXUN 5F7MC 2IDSA 4I5BB 1UCTA 4M1GL 5GRJL 1YNKL 1KCSL 1U93A 3GDBA 4QT5B 2BNRA 5F7AA 4GI6A 5L7XH 5ACZA 2G4EA 2VRQA 3HC0A 3QJRB 1ED3A 3EGDB 4PRID 3T77B 2YRLA 4A2MA 4ZD3H 3RWCA 5TDNA 4U6VL 1GGYA 5JHLA 2X6CA 3QAQA 2UWEF 4BK5A 1QFOA 4MQ7B 5E9DD 3FUDA 3T4AA 1WS8A 5FYLE 2HKHL 1CFTA 1OAXH 3UTPE 2UZIH 3VFTB 4OZIF 4OCYL 4AQ1C 5LLIC 3CPUA 3G6JB 5E0QA 1ICTA 2FX7H 3DVNA 4AW7A 4UZGA 4JFQB 3Q06A 1ORQA 1VENA 3SDXE 5ANMA 4EO5A 1HI6B 4XWOC 5E24E 2CUAA 4WV1A 4GSQA 1DVYA 4LKCA 3UTQA 3L4VA 4LHUD 4LDLB 4AGPA 4MQSB 2VYRE 5C8JB 2KLSA 3MKKA 4ZSOE 2H1LM 2FJHB 4EN2A 3CLFH 4OM0L 1JZDC 3ZVVA 4EBQH 3TV3H 1NEZA 1JK9B 3V52H 3V6BR 3OAUL 4H26B 4G6FB 4TUJA 4XN9A 3NIDB 3GS7A 4EN3D 1QR1B 3DUUA 2BXYA 1MRCH 4JO1L 5BV7L 5IJKC 3V6OE 5GSVB 3BLBA 4FYSA 2AEIT 4Q4EA 2C9XA 2BFVL 3KWWB 4P4KB 3OB0K 4Z0BH 4MRBA 2Q10A 1KTLA 4XRCB 2VN6A 3RFZA 4PRAB 1O7SA 1OT4A 1NJ9B 4FXLA 2EDHA 4LCUB 3S98A 1TENA 1VJSA 4FLSA 2ARJB 4X98A 1JAEA 2H0PA 2H6PB 4OB5H 4K5LA 5KSBA 4HDIB 2CO1A 1LWHA 4FKKA 3GNML 4V2CB 5IFHH 2YMTA 4X6EB 2W5PA 1YQVL 4X7SH 4WGKA 5DS8A 5FGRA 2Z0UA 2V2XB 3CC5A 1WWBX 3TYFB 1VZGA 2YAHA 3D51A 1FIGH 3S5LG 5D96C 5FO2A 3QIUD 3V0VB 1E30A 1XGPB 3KPLA 2CO7A 2GC7C 4MXQD 1ERNA 2OMWB 3A0OA 1QSEA 3KW7A 1J12A 3WJJC 1K4CB 4JN1H 1AQKL 1RLWA 4MA8H 4ZMLA 4Z7IA 2OMYB 5ACLA 5K9KA 1QNZL 3W81A 2WXMA 2CJUH 3MRQB 1KIRA 5EIIA 4N0YL 1M05A 3HFML 2UZYA 4F58L 3SCMD 4LRNL 1R3HB 3TYGL 5FUCC 3E3QE 3UCQA 1UURA 1QOKA 5BQ7B 3NH7L 4F7KA 4NEHB 4O2EB 5C0RL 3BH8B 1BX2B 1PSKH 2NY0D 3CFMA 5GPRA 4S2SB 3HE7B 5IFAH 3CFKB 4FNUA 3QFDA 1Z5HA 3MV7B 4PJHE 3DRTA 4F2EA 4WF7A 3ZKNC 4HWZB 4QCIB 4JRXA 1GOHA 3TCTA 3SY0A 4XCEB 1S7SB 1HHIA 2BNRE 3MYJB 4J3BA 2ZOOA 2OMXB 4PJGA 3TA4D 2UXTA 2GW5A 3LKSA 1B4LA 1RUKH 5BRPA 4QTIL 1RKRA 1A6TB 1INEL 5D72L 4AEHL 5DRWB 4XHJC 3MJ9A 2KQMA 4D0BB 2CO6B 3UC0L 1MHCA 1A6UL 3MRRB 4TSBL 1N6QL 1HOCB 1FAKT 2IQ9H 2HVJB 1P5UA 4ENEC 4OAWB 5ANME 4K3JL 1BFVL 4XC3L 4ZO7A 3Q2VA 2W0FB 4FFVD 4BQCA 4K3EL 5AW9B 4E68A 5DUPH 3EXLA 5CEZE 1LK2A 3NMEA 3ZQXA 4Y1AD 5T8IA 3IDJA 2OTPA 3GTNA 4X6FA 2CK0H 3LMJH 3C9NB 2Q8AL 4KUCD 1TKWB 4PJIF 2SEBB 3BW9A 4GFTB 2G4GA 2IPUK 4AK2A 4P48A 3BAXA 4QIRA 3DGGB 3KH4A 1MAJA 4K0OA 4LLUA 4YGVA 1KFGA 4UV4L 4NP4H 3ME0B 3CMGA 4W6YB 2AANA 4BZ1L 5E2VL 1D2PA 1HKFA 1YY9C 1U8IB 2FBJH 5FF6B 5JQIB 1QO3A 4IDJL 4U0QB 4W9DC 1GAFL 5FO9B 4R9HA 5EEVA 3ULSA 3X1BA 2Z93A 1NMBL 1OSPL 2X4TB 4UOW0 3ZDZE 4PB9L 3AXLB 2EVGA 5IFJA 3F5WB 4IBTA 3VQLA 5KSBE 2ZUQB 4H8UA 5E6ID 5HD8C 2EE9A 4WUKL 3SYOA 5ITBH 5FW6A 5I1KL 1ZMYA 4QRSB 4NT6B 1DJHA 4Q6YA 4WTZA 1S9VA 4HK0B 5D1XB 2VKXA 4Y19B 3R8BB 3I50L 3O9WC 3WFCH 1LO4H 4ZFGH 3SGJC 4N90D 4NYLA 4RVBA 4UQ9A 4B9YA 2QDWA 4BKTC 1QSEE 1YY8A 1QEWA 4MA1B 4N1EA 3SDCA 4BSVB 2EXYC 4HMEA 4H5SB 3RI5F 1WF5A 1ZTXL 1V10A 4N2DA 1SQ2N 2WKGA 1MRDH 3KYKL 3S8GB 3TU6A 5A7EA 1SEBB 1D5IH 1ES0B 3QS3A 4AH2A 1CR9H 4L3CB 2NXYD 3HG1B 4KXZH 5FA4B 2Y1ZA 4PWEA 3HCVB 2X4UA 4FQQB 3CIQA 3PJSB 1KY6A 3AWFA 4F15B 1FI8C 2O5ZL 4IMKA 1OT2A 5K9JH 4M56A 4PI0A 5F0PB 3VVWA 3LH9A 2IGFL 2ZG3A 1H19A 4CA4A 3SDAA 3GMRA 1N5AA 3VU1A 3FSOA 3H55A 4KROD 4P5TB 4CVUA 4HLJA 2AK4D 5J5EA 4O00A 3BGMB 2MTPA 4G5ZL 4PLJD 5ELIA 1GJIA 1U8PB 1IL1B 2FEEI 4JRXE 4PLKC 4WI0A 4DKTA 2B59A 2JB6B 4GXVH 5DD3H 4P0DA 1O75A 1XCTB 1SBBA 3ULVC 3RDTD 4PJGE 1KTJA 4DOHE 5J57B 2NY1D 2WZ0A 3B7TA 4G6ML 4FN0A 2WNWA 1XAKA 3CX5J 1OF0A 2H7WA 2HVKB 2R29A 3QEHA 4AUJA 4Z7OB 4XCFH 4E2OA 1YEJH 4NUMA 4IBVA 4TNVF 3WIAA 3DJRA 2ITEA 3ILDA 4ICXA 4POUB 2OJEA 2R0KH 5LGHL 3BJ91 4U1SA 4LMQI 4XBEH 4ZDHB 5C0DA 4FA6A 3RFZC 4ALAH 4YSRA 1JI1A 4XX1G 2VERA 1JHLH 5DLMH 2AXHA 5BJTB 5JPNA 1OKEA 3WTSA 4B5ZA 5IW1B 4N0CD 3CFQA 3S97C 3R7RA 3NUKA 4PV8A 2UY6B 4TS6A 5HGHB 1J5IA 2P44B 4PR5B 4WO0A 1OCWL 4LHJB 1N7MH 4YHZH 3DI2B 2B4CC 4RGND 4G9DA 4N8CL 2JKSA 2N0MA 1BOGB 3VSUA 1XR9A 2QBWA 4YGAB 1DUYA 4BK8A 2FJGB 2OMZA 1ZWIA 5H8DA 5H94A 5JNYA 2P8MB 2YLKA 4B0MB 5F1NB 4X5XB 3MUY1 4GBXA 3QO1A 3C5ZD 4OKVA 2H3NA 2YHGA 3FFCB 1FWXA 2E47A 5JW4N 4XPGH 1YEFL 4CW1B 1F02I 1U8MA 4JG5A 4WU7A 1COBA 3J7HA 2YPKA 4WI2A 1T3FB 5KVDL 4BFGA 1RLBA 2FWUA 4TYUA 1U2CA 2OZ4A 1PNCA 5JDSA 1HESA 4P9ML 2XWJA 2P8PB 1MW0A 3ZKSD 4U7MA 4WHYG 5A3IC 4NDMA 2OP4H 4NQVA 5BOPA 1LP9F 5HI5D 1HKLH 2XPGA 3GMLA 4ZS6C 1MI5A 1NFDB 2P7TB 2NSQA 2ZUYA 4HIIB 4KJWD 5E1HB 3O6KL 1XF2A 4KTEL 3MLVL 4JFWA 3EJZC 4KI1A 5E8NA 2YARA 3QEGL 3VD7A 2GTZA 3HNTH 1I3GH 1HIML 5EZJB 3UTZB 1P84K 3Q01A 3UBGA 2M83A 1UFGA 4PMEA 4K55A 1T66C 2AQNA 4FHJA 4HHAB 3V5HA 3QI9B 2Q7YB 1Q9KB 3MV8A 2OL3L 4MD0B 4FG6D 5A6IA 2GITB 3UOAB 4D8PB 3ZL4H 4NI6A 4WDIB 2NNXA 1R5VB 1IBBA 2QKIB 3FTGB 4KOCA 5EUOA 3JXAA 1MOEA 1KBGL 2ZUVA 5TGBB 3RWJA 2P5WD 5I19H 5JOPD 3KMDA 1KXTA 4R8WH 4PJBB 1IAIL 2Q3XA 3KXFB 2O93L 1MFEH 4KGLA 3PPEA 5FGCB 3CZFA 4FS0A 3DX9B 4TSAL 3UJJH 3Q9QA 3K91A 5AD0B 1L9NA 1SF3A 2DDQL 5T3ZD 2XC8A 3JT2A 5B38B 1UXSB 2V4LA 4MD4A 3SEPA 5JZ7D 3LRSB 4NO0D 1AOZA 2C9PA 4LCWD 4OSUH 1QASA 1T6BX 2HT4C 5EZPA 5IBUB 4Z7NE 4AXWA 4Y9CA 2BO0A 4V1DD 2NQDA 3O6LH 4N3UA 4QD2E 4W70A 1G7QB 2FAUA 3HZVA 2VN7A 1DLHB 3L4CA 3PJLA 5KBNC 5CWSB 4QDGA 1T0MB 5DYOA 2NUTA 3GK8H 2PTUA 1V8HA 2YRBA 1OP4A 4XN1A 3RTQB 2E86A 1I9RH 2WWKO 4EI5D 5I17B 3IVKA 4AJ0A 1IT9H 2Q86A 2HTLD 4OLVH 2Y6SD 2WTRA 4YBQC 3J8F7 3BAWA 3FSWA 5FKPB 1N5YH 2H2SC 4X5WA 1HHGA 3LQZB 3UBXI 4Y5XB 5T33L 2ZUWA 3IM1A 1KEMH 1JPFA 4LCCC 2J6EL 1KJ2B 5J8OA 4KVNH 5E94A 5IROD 4O51A 2CGRH 1YJDL 4HIPA 1PMYA 3RYMA 5C6PB 1J5CA 1KBBA 4NC2B 4W6XB 3L3OB 5B39B 1D6VH 1MH5B 3O3DB 5D6CA 4KDTA 1BOYA 5DK2B 3AM8A 2M26A 3L9RB 4U1HA 4DNLA 4HPOL 2F53B 3BWUF 4XBMA 2VLMD 2HFTA 3L3DA 4LQFH 1DO5A 2X2YA 2Y6TE 3WN5A 4PTTB 3HS0B 2ZYHA 2GK2A 1DEEA 1J0KA 2FZ3A 1H15A 2YD8A 1KTRL 1ZOXA 1FFOA 3WY1A 1O7DC 6CGTA 1JPGB 1WH0A 4Y8DC 3CUPA 4D9RE 5CD3A 2R0LL 3RVVC 5HHVL 3MBEA 1UUNA 1G4MA 5HHOB 1E7VA 1MI5E 1DVSA 4P07A 1VGKB 4RQQA 3EXJA 3ARFB 4GRMB 3CG8A 3D06A 2ZG1A 1ZT1B 3RX8A 2XXCB 3ZE1E 3E8UL 1AMXA 1DDHA 2ZOKA 3RWEB 4R97B 3AQDA 4JZNB 4LPTA 1A7OH 1I4FB 2H32H 4JPWH 3TWCH 1PKOA 7CGTA 3MV8E 1JGUH 2HJKB 3ISWA 4B9ZA 1PZSA 1T2XA 1EEUA 5EUOE 1NGWA 4LARL 3AABA 4XZUA 3TT1L 2J7LA 2QPDB 2HUEA 2PO6B 4LSQH 5DI8B 1TTGA 2DI8A 4NWUL 3MODH 1TO5A 2CJ3A 4Q9CA 2PXYD 2RR3A 1SVCP 3APMA 1PKQB 2Y06L 5AZUA 3MCYA 1DN0B 4NNYA 2Y5QA 1IAOB 2WZ5A 1BVZA 1FZOB 1SM3L 4V33A 5HGAA 3NZSA 5FA3A 5I8EA 3NTCL 1VKXB 3AQXA 4AENA 4PBWD 5CR8A 5EWIH 1CXLA 2IPKA 2X70B 4X0KB 4Z0XB 3QJSB 2OTWA 2D3VA 4MB5A 4ETQA 4P3DB 2MH4A 5L2JB 1AR1C 4Z1PA 2VW7A 4PBVC 5IESH 4EUPG 3JV6B 5F0LB 3QQ3B 2YUVA 3RU8H 3A4EA 5DA4A 2Z64C 3T0EB 4UUJB 1G7MA 5INCB 2Y07H 1NGQL 3SB3A 4UQBA 1Z7JA 4ODVH 3RHWK 4AM0B 1TEFA 1F3DH 3IU4L 1YHPA 2HG5A 3QQ4B 1ETJA 5K93A 1Q1JL 1P5VA 4XNYL 4X9FA 3EZ8A 4HHWA 1E3FA 3GD1C 3FRUB 4WWPA 4EIUA 1LM8V 4NCDA 2OMBA 5BV7C 4UOJA 3OHXB 1A7QL 3D3VB 4O58L 3QHZH 1RK0A 1VRSA 5EU3A 2EDJA 1T4KA 4F9LA 3BEVA 3AWGA 4K94H 1BZEA 2V17H 3MFGB 3NEOA 2BY0A 2YUWA 4W9CC 1MJJA 3BI9X 3VTMA 5FLUA 4GSRA 3SE9H 5I5RA 1NSNH 2HRHA 5HJ3B 2VO5A 4Z7VA 2XACC 1OGAA 3CLEH 5HJBA 1L0YA 4X99A 3TJPA 5A2CA 4WI8A 5AVTB 1MEXH 3MNVB 3SGDI 3NZHL 4RFNC 1W72L 5DYFA 4Z23A 6FABL 4GKNB 1GS8A 1JHTB 5E8PB 4WTXA 3QDJD 5IV2B 4K2UL 3BAEH 3MBXH 4J23A 3MUGA 1T1WA 4JKLA 5AVWB 2APSA 4YQXH 3GXMA 2BS71 3HG3A 3TH3T 4Y2NA 1OTUC 4U2YA 4AQAB 5IK3A 2NYKA 1J11A 1EHAA 1X9UA 4U1LA 1MCDA 3P0VH 5DURD 3FQ4A 3QWNA 3K1DA 2AJUH 2QGBA 1UACL 1MNUL 3TVMB 1IFHH 1ZD6A 4YDVB 5SV4A 5FDWA 5IB4A 3FBKA 5J9PB 3IDMB 3HRZA 4UIKL 4OFKA 2ERJB 4IHBA 4XCCL 1UOWA 3DNKA 4G6AD 3T8VA 4XVOA 4NLAA 2YQGA 2BSSB 2XQYG 5I66A 1YMHB 2XTJE 3FN3A 3UH8A 4B50A 1SDYA 2ZXQA 4HEPG 4H8WL 5JPMA 3EYVA 2C9RA 1E65A 4NM8H 1PFCA 4UILH 3WS6A 2ZKWA 4OZFG 3OZ9H 3SSGA 2FWOA 3C5SA 2BC4A 4I1RA 3TO4D 3ZTNH 2ATKB 2OL3A 3IDGA 2AV1A 3VG9C 1ZANL 3HLAB 2PP7A 3SPVA 2PYEA 4F33B 2ATPB 3N1GC 2NY6B 2XJLA 4X50A 3V4PH 5EZLB 2HA1A 4RESB 3T2QA 3EYFA 2APVA 1YNTA 3AAZB 4O02A 1GC1L 2APBA 4KUCF 3MNWA 4JHUA 1C5DB 4XB8A 3LEVL 2WBJC 4M03A 4GLRI 1D5MA 2UZPA 2Y0SA 4JDTL 4M43L 2DWEB 3N91A 3C08H 2ED6A 3HI1B 5ESQA 5F0MB 3ROLA 2DWXA 3NFPA 1RZJL 1NBYB 3HR5A 4KDTC 3AM8C 4HF5H 4LLWB 4X7TB 2GJZA 4NGHL 4CKQA 2CA3A 4OZHF 2BVQB 3GJFB 4LIQH 2WJ5A 4LSSL 1BPVA 4ZAKB 2L4OA 2MQCA 4XH2B 1YECL 2G75A 3RX5A 3UAJA 1EBPA 1AZUA 3OKMB 3VDCA 3V4VA 4FXKA 1AYOA 1NKRA 4AX3A 1K2DB 3T2LA 1Z6JT 1GIGH 3DIDA 3O3BB 2GFBA 4PRHA 1TUPA 3T08A 1CICC 2ODIA 1AH1A 5I9QC 1YN7B 3BPCA 1NIFA 4OLXH 5I8CB 4Z76B 3P1VA 4X9IA 2MCG1 3S0PA 9CGTA 3QYMA 1N0XL 4DETA 4PWHA 4DVBA 3EYOB 4Z7VE 3ZE0F 5C0JB 2X4SA 1OGAE 1JGVH 5LWYH 5JW4Q 3DX0A 4XN7A 2XRAH 1UKSA 2XI9A 5IEKA 1U8NB 1C08A 4BGLA 4JEGB 5AL0A 3EOAB 5C6TL 3SGEH 5EDSA 1I9IL 1Y18B 3DI3B 1AZVA 1I3UA 4IGBB 3RL1B 2YMXH 4BK4A 3TFKD 2NY5L 1TIUA 2W9LA 1KBWA 1SEQH 4JO4L 5DZOA 3VD3A 4AY0A 3GUTA 3WTXA 1A4JA 4TVSa 5LDUA 4PUBH 4E9SA 1W0YT 4ZPVB 1SHXA 3WFBH 1T22A 2O5YL 4QY8B 4XXWC 1ID2A 2XFGB 3WE6B 3EFFA 1HEZB 5D7LB 1YSOA 3FN0L 1OF2A 2KUTA 4M7KH 2KQNA 2BVUA 4GRWB 2FBRA 1A0QL 4L29A 1RI8A 3FS9A 4H25B 2F8OA 2A73B 4DH2A 5J11B 2H6OA 4YSCA 3DX3A 5GGSA 3EDDA 2BIMA 5H35A 2HH0L 2YD0A 5C0AA 4GUOA 2G5BB 2DQDH 5I6NA 4TSCH 4EIZC 5KVEE 4GO8A 1MQ8A 1ZDQA 2LFGA 2LFEA 3ETSA 3RB5A 2PWFA 5LCVH 1JWSB 1KTDA 2O1AA 3L7EA 1JHKL 4J1UB 4JFSA 4Y4HD 3V9EA 5IMMA 1B2YA 1Y07A 3ATAA 1IO4C 2CDEA 1WBXB 3GHEH 4OGQC 1A7PH 1AS8A 4GSXA 5LXGH 1TTBA 4XMUA 4K15A 4OIAA 1M9SA 4Z95H 5CBAB 2Y7QA 1KLUB 3MROB 1JPSH 3NT0A 1ND0B 3CHXA 4J27A 4KK8D 3VXOA 4Z3HA 5EF1A 3DHMA 2PYEE 1IFGA 3GIZH 4DFIA 4F57H 1JVOA 5IB1B 1QLRA 2EIBA 4AOFA 1OPOA 1ROWA 1QLEL 2QSVA 3IWVA 4P2YA 5T1KB 3PNWA 2WWOA 1YUHA 1P9MA 4F9LC 1DLFL 1JWMA 4YAQB 2WP3O 3HHMA 1RSYA 2QGEA 4WI6A 1Z9PA 4ODXA 4YHLH 5K59E 3G6DL 3DARA 4N20A 5FCUH 3FO0H 1OD7A 1FBIL 3ORJA 1M2VA 2R8SL 2WWMC 1A9VA 2VDOB 2BY2A 2WVUA 3HHSB 3VI4F 3L1EA 3UJTL 5DZNA 1FORL 2JCCF 3VM5A 4WI7A 2HB0A 2E6PA 1BVNT 5HI4D 4AV0A 1P4UA 5LGJB 5EO1B 3UERA 1MAKA 5C09B 3TBVB 4N0UB 1FPTH 1TEGA 2FTAA 3BKCH 4PRHE 1W8OA 1QBBA 2OTUB 3P73A 2BRQA 2X1XR 3VH8G 4AQEB 2GJ6B 2AITA 2IDCA 1GS6X 4ONOA 4EXKA 3UXFA 5DWPA 3GINA 5B1BB 3UBFA 1A64A 3KLKA 2F54A 1MCPH 3STLA 2RACA 5KN5A 3US1A 1M7IA 3FB6A 2BIOA 4ZQKA 5HI3C 4Z8FH 1R3KB 2W65B 5D5MA 1WD9A 1WAAF 3HRZC 5EFIB 5DRZA 4JCLA 3V8CA 4Y16B 4ZD3L 3O3AB 3ATDA 4P46C 3RVUD 4IDLA 4LPWA 4NUGH 2OV0A 3LIZH 2JMRA 3DPDA 2AABL 5DMKA 2DLHA 4DCQB 3VFPA 5JPMC 1EH9A 1DBBL 3HC4H 2FX7L 1S8DA 5IKCA 2XQYA 5CINH 5HHQA 2E27H 3U1PA 3VFWB 5J9PA 2VXSH 4ZTPL 4HEPA 3U83A 2HRPL 3QCUH 1DSWA 1HNYA 1QR4A 3N43B 3CSFA 5JYLA 2H0FA 1VFAB 2VKWA 1SDAB 2DQHL 1B0IA 1L7IL 4G6FD 4Q89A 4WWKA 2XTSA 4ZW6A 5C0AE 3V0FA 3W37A 3KPQB 4KI5C 4ZBJA 3P4LA 3QQXA 32C2B 4XNQA 3TV3L 3QUMA 4KK6D 3HMWL 1SXZA 1IAMA 1XH3B 2G2RA 3OKYA 5CJQH 5HPMB 1DJSA 4WEBL 3D30A 1MRCL 4H1LB 2Z8VC 2IO5A 1TLMA 3B9VA 4NZDA 4DERA 1AGCA 1HXMB 2HFGL 3EYSH 4HUVA 1Z5LB 1Q9OA 3ETBF 3EOTL 5I8KL 3WLBB 4KH2A 2MJWA 3JYBA 1KLFB 1QBML 5KYWA 3WHXB 5EA0L 4AZ8B 4AG4L 2BCKB 3FQRA 3LVTA 3RUGA 4F8QA 5KVGH 4OLWH 1IGMH 3NFSH 7PAZA 2H6UA 1G9HA 4HJGA 3WEBA 2IWFA 1XDTT 3MZTA 4KJQC 5IFHL 1BJ1H 3B56A 4Y5VC 5D7KD 4PVMA 4FP8L 4JQIL 5IVXA 3H4FA 3JWNE 3MACH 2D7QA 5IHLB 3GRWH 3VXUB 1VA9A 3ZTDC 1BHGA 4P4RB 2YFOA 3G08A 5C0BA 4ZOCA 2JJVA 4ADIA 4YXKL 3HVDA 4JGUA 3CIAA 3BVWA 1NWPA 1LQSR 3SYPA 1XGTA 3GI9H 4JN1L 1FVEB 3OWEA 3IYLW 1MFCH 4XI5C 2AGJL 5DMGC 4JFHD 1MY5A 4H0GA 2A7BA 5ALBH 3HE7D 3U0TB 2JJUA 4HMCA 1YJDC 3CN1A 3PHAA 4M93C 3RDJA 4MNGA 4MWFB 4PB0H 2Y7MA 1SDDA 3MV7D 5C0NC 3F83A 4J3OC 3MOBH 2J43A 4L5FL 5IQ7H 5J3HC 1OSZA 2N4IA 2W88A 3FH7A 2CLVB 3FUFA 2F54E 1J10A 1OALA 4ZS7L 4FXGB 3B2VH 4XC1L 3O3EA 2Z7UA 4XMWA 5D5ME 5I0VA 4KNQA 2FRGP 3U7YH 1CLOH 4NN7B 4G11A 2CCVA 1R17A 4LESA 4XWGL 5DEGA 1RUKL 1KYFA 4JAMA 4YFDB 4M5SA 4N8VA 1CO1A 5E00A 3IJSB 2F08A 3E80A 3PIQB 5D93C 2DM4A 2P5EA 3IMRA 1KV3A 1FVDA 4LL4A 1AGDA 4JM0A 3NEEA 1JMXA 3H9HA 3ILQC 5DR5H 4PY7A 5EU6B 4A2FA 4W9HC 4R5TA 2YPVL 4XZ4A 3G3LA 5E99L 3I85A 4R84A 3ZZLA 3QNYA 1SGKA 2YWYA 1ETA1 3DSFL 4JZOB 1PVHA 3S9DB 2JCWA 4NHUB 3VE0A 4JRFA 1UQSA 3BT2H 1X9QA 4BKLB 3S3DB 4Z7QB 3QAZC 1Y1DA 1YVLA 3FCBA 3SKOA 5FO7B 2FJFB 4HETA 1KPRA 3FQXB 3Q44A 2VTFA 4DWHA 1NEUA 1QZ1A 1UH3A 4IS6B 3PQYB 4HVBA 2FBJL 3MMEB 2FO8A 2Q6WB 3GJEA 3HZMA 3NCYS 5TF1L 5KYUB 1QI3A 3MLTA 5I1DB 3Q1EA 4N5ED 5DEFA 2VITB 3I6KB 5IJVB 4B9PA 2IMNA 1N0LB 1IQWL 1INDL 3II1A 3B2XA 3RUGE 4G8GB 5D1XD 1NDGA 1N3NB 1CFBA 2OQJB 1VEOA 2EIZB 4Y19D 4DO6A 3S96A 3BWSA 4Q97A 5ITBL 1ZJAA 1O9ZA 3LB6C 5C07A 2R7EB 2AAVA 2EXSA 5IVXE 3CWGA 4XTRC 3CHOA 1BXUA 5IW6A 2QFPA 3QPQD 3K7UA 4P9HH 1AXSB 3PDGA 1IGJB 5C0BE 1WQVT 4QF1B 1OTSD 4FI6A 3VFSB 1T20A 1EO5A 1H3XA 1GPOH 4PJXA 4CL7A 5IWLA 2X6UA 1BYNA 2NY4B 2PP9A 1WZMA 4HIQA 2K9FB 4MLSA 3STZB 3DBXA 3VH8A 3HG1D 3RTLA 4CU6A 3UYRL 4HIJB 1MRDL 3HC3H 2K6YA 4RAUB 2OYKA 3T0VA 3H9SA 1OSYA 2R4RL 4U1GB 3HG4A 3TNNA 4FQ2H 4C56A 1OY3B 2Z31B 3A23A 5GJTH 4XMZA 3GSWB 5AW3B 3DTUB 4MNGE 2L3BA 1ZAGA 3V0DA 2JXMB 4N22A 3KGSA 3X1EA 4WW1B 3MLZH 1DQJB 2YBGA 4MAUL 4X6CF 1NL0H 1EMTL 1HCZA 2WQAA 3OAYH 4L8BB 2JKTM 1E4XH 1ZXQA 4MMXA 2VDMH 4PEEA 4WIQA 3PL6A 3RNKA 5PAZA 1KNOA 5EO9A 5C0IA 2GHZA 5FGBA 4UBDD 3FT0A 5DD3L 4JBSA 2F19L 1YEDA 3TA3A 9PCYA 3D09A 4JFDB 3UBXB 1WA1X 2WNKA 3GB7B 5A16B 2CQVA 2O6FA 4GQZA 2TRYA 1CZ8H 5I76A 3N55A 4WWKC 5INDA 2F0CA 2NW2B 4P04A 3CTTA 4OCSH 5DJZB 4HH8A 4Y4FC 1LK3L 1HH9B 1C8PA 2AQQA 5CIPA 4Z3TA 2UXVA 5I30L 2XNAB 2ZAGA 3MJ8A 2X6MA 1HEHC 1EJ6A 2P5EE 4PRPB 4LF3B 5I18H 4DUXA 2Q7NA 3QUYC 3OTTA 4F8OA 4AMXA 2HWZH 4OF7A 1FZMB 3MRJB 3GPEA 4DO5A 4XBEL 3L95B 4QEGA 4K73A 2KKQA 4FFYL 4ANXA 3N1FC 3IBEA 1FP5A 2ZXCA 1MFAH 2Z92A 4QRFA 5DLML 5SWQB 4TL5A 4O2FB 1QI5A 4H8WC 5I1GL 1H8SA 5ISZA 4C83A 1WT5C 1HWHB 5BQDA 3IGAA 3CN4A 1YPZA 3AQYA 1AIZA 3GO1L 3NP3A 1HZHH 1MIML 1NMAL 1AO7B 2CBTA 2NXZD 5CD5C 4OF0A 3FFCD 5EN3A 4N5UA 3BVNB 3TWYA 1OAKH 3X14A 2MPAH 5K33A 1I3RB 2Y2YA 5ICZA 4EVNA 4G9FA 2XQ0A 1P6AB 3EH3B 3S37L 2XN0A 3X2QB 4Z77A 2BVTA 3QG6B 1PG7X 5GS0L 2R1XA 1GC1C 1E3ZA 1WDAA 2VLRD 1RJCA 4OVUA 1IFRA 4HKXA 2IAMB 5EIQA 5C07E 4PWFA 4MNHA 4U6YB 3T6VA 1GOGA 3MCLL 3P4MB 4P99A 4MHHG 4R0LA 3CFJB 1XL4A 4PJXE 1OZUA 1TZGH 2OR7A 4MS8C 5I16B 3D25B 4GRLC 4DKEL 4P57A 1RUMH 3L4ZA 4XO3A 5DJDB 1E28B 3O6FB 4PCTA 5C86A 2YQ2A 1KLGA 4HC1H 3QI9D 3H9SE 1SYSB 4OCNC 3ALPA 4PGCA 1DQMH 2WTOA 4XNMB 4G7VH 4C56E 4HJTA 3I6GB 2XFXB 2HVBA 3SDDC 1U8OB 1PW3A 3AT0A 1SHSA 2X88A 2NZ9C 2HKAA 2WANA 3C6SB 1DVQA 1FG2A 3VAEA 4FHBD 2NMSA 1O6VA 3IKCB 1DVFB 3KXFD 5ADPH 4F27A 2X1WL 1CMOA 5IIEA 1A6ZB 5K9OB 3RWHA 1KDJA 5HHPA 4QRAA 2OSWA 4WRLA 2EQDA 4GAAA 4N2HA 5MENB 3OMIB 3VXSB 2VDKH 3R18A 4HIHB 4LLVA 1DJZA 2NY5C 3BCFA 4ZZFA 4NNPH 4MQXC 1A1NA 5LGKA 2A6KA 3B7SA 2UX6A 3TP4A 5CKGA 1NBZA 2Y1VA 3DRQB 5JMRA 4DN4H 1UTDA 3BVVA 1ECZA 4YDIL 4OLUL 4XPBL 3VACA 1AS7A 1UM5H 4OSUL 1SJVA 3QRBA 3KCWA 4OR1A 1W6WA 5EU5A 5F7DB 5AYTA 5IMLA 1IBDA 1CD9B 3MR9B 3OKEA 2ZD0A 2PPAA 1GZPA 2GTWA 1SZNA 5D7JA 3RTQD 4LBEB 1ZK5A 5T3XH 3SQRA 4W9GC 1X5MA 4P5MB 5ID0B 1Q72H 3W82A 4PVNA 1CGSL 1NBQA 1I8LC 2WNXA 3CU7A 4F8TA 2E7CA 3T3ME 4NLHA 3UZVA 2Q2LA 1H6TA 2Y5TB 3O0RL 1BBJB 4MZIA 3TIEA 2WXJA 5I1CL 3MHZA 1I9RL 4S10A 4Z5RB 4PD4K 4YHIA 1YYLL 2YKKA 1FSKC 1R5WA 3FUHA 1KCVL 1IARB 1L6PA 1TO4A 5ISZE 1ZSDA 3GZPA 4N68A 4UM8B 3QRGH 2DQUL 1BYPA 3SZKC 2YGPA 4AQ1B 4HJJH 5DSCB 4KK5D 1YPZE 2OJZL 3ZYZA 4M8QA 2VOTA 3KDPB 2FCBA 3VRJA 3RZCC 3V0EA 1G1CA 4KVNL 1T6WA 2WUCH 3GIVA 2F53D 4KH9A 4OGAD 1FZKB 3W5MA 1JL8A 1PG7W 2PABA 5TE6L 4G9FE 3O0LA 3CLWA 5JIMA 3U0WH 3ARWA 1X5KA 1XB3A 4X5LA 1T83A 2R56H 2BSED 4CAGA 3KWVA 5CZKA 3BP6B 4BFRA 3TM6A 2IH1B 4IU2B 5JR1L 4GG6A 5HHOD 4FNPA 3K6SA 2Z8RA 4PSPA 3ARFD 3GMNB 1ZEAH 5DFWH 5TE4L 1Q9LB 4OGXL 3FRPB 3VSVA 1F2QA 1CTMA 4PV9B 1PQZB 2XA8L 2CKBL 4N2BA 5L4JA 3I9PA 4GMTH 5FGBC 4ZPTB 3MLUH 1LQBC 1RMFH 3GHBL 4L3EA 1PGRB 4WCYL 2X05A 2P24B 3P3UA 2MOVA 5ADOH 1WITA 2DQFB 4MJ2A 4L4TD 3MRCB 4OV5A 2UY7A 4UB0H 1T21B 1N8ZB 3DLQR 2V5SA 4KNTA 4R83A 3PFUA 1T04B 2PO6D 5KBPA 1AGBA 2I24N 4X7EC 3NN8B 3RWFA 3FZUC 3UTSB 3CMOL 2HMIC 3LXCA 3P4OA 4HH9B 4J3TA 3OC8A 4JLRA 2WXKA 1IGCH 4HS6A 1D9KA 4DP1X 1BJ1J 1AIFA 5K39B 1ZKAA 1NFIA 5H37H 1AGEA 1FHGA 4ABQA 3DROB 4M6AA 2KMWA 3QEUA 3RPIB 3A22A 4FERA 2VDOH 4AT6B 2JV6A 4PJFF 2J20A 4DEPC 5I75B 3EFOB 2A74A 3KPOA 5EWIL 1DBKH 2DH2A 2E9BA 2A77H 4RDQF 4I3RL 3S7GA 4BSJA 1E2ZA 2VW6A 3WNMA 3T0ED 2EZ0C 3BO8B 3AREA 4J39A 3ZYIA 1UB6A 5JO5B 1L4IA 4K7PY 4U4BA 1CE1H 2WUBL 3FO1A 3SDXB 3WTWA 2WBKA 1U91B 5HGGS 4PJEF 1EGJH 4J6IA 4N2NA 3NIFE 4N6RA 3FU8A 2KLRA 3N9GH 4UV7H 3BP5A 4M5TA 1J05A 5DF0A 4MA7L 2JELL 3EGXB 5CJOH 3MOAL 4PRDB 4HZAA 1NCAH 1ORSB 1MF2L 3PHOB 4ZSOB 1NOAA 4X4ZA 1KWGA 3D3VD 3HNVL 3H3KA 3HI6L 5AW1B 1NDMB 4G5AA 4EJ1C 2HT2D 5JMOC 3US0A 5DJCB 5FM5M 1WLHA 1XGQA 3QEQA 3ISRA 5F1OB 5E8EA 3T4YB 4R0LC 5FLVA 3QHTC 4HUUB 1YA5A 4K94L 2V17L 1H3PL 2ZP0T 1VLXA 1KBVA 3VO0A 4MYWB 1UD6A 2JI1A 5F89A 1NSNL 2Y7OA 3IFOA 4N24A 3OLEA 1XVSA 3IF1A 1IM9A 3GMQA 3PP3K 4TLUA 3OMAB 2D7OA 5CBEA 3CZEA 2AS5M 1AKPA 4PJCF 3QDJA 4U1KB 1JE6A 2P8LB 1N4XL 4KMTL 4P2OC 4F3FB 4ZNCD 5KSAA 4GG6E 4NQSA 1NMCC 5AOKA 2VZOA 1QHOA 1WFOA 1AY1H 5TF0A 1ZVSB 4DGIH 3G04A 4HXBH 3S34H 4N2KA 4FTVA 4QLRA 4KTYA 3MRNA 2CM6A 2WWKT 5FYJH 4S0HA 1KYOJ 3TVMD 4D8OA 3T65B 2AVGA 1IBZA 4H1LH 2P48B 3I74A 4O9HL 4ZUTB 5I1IH 1IRAY 1NBVH 3L6FB 4IMLA 5CF3A 1GGTA 1LO3L 1EAOA 1SJEA 2WLLB 4L3EE 4OCXL 4OJCA 3T3PF 4F8PA 2AJUL 3VDAA 1UKQA 4XP4L 3CVBA 1IFHL 5E6ZA 4EDXB 4H7VA 4JB9H 2Z6FA 3QUKB 4MCZA 3R8QA 4BJLA 3PU7A 3O9WB 3VW3H 5JIDA 3RGHA 2N7AA 4NPYA 2CIIB 1JYXA 4R4ND 4HUWB 1D5BA 4HJSA 3FUKA 3UDWA 3FU3A 2W60A 1IAII 1HAUA 4XMXA 1R33A 5TQ0L 1XCQA 3LS5L 3ABLB 4PJHB 3ML9A 1GR7A 5HDBB 3P9MB 3MV11 5ILTH 1NQBA 3UGXA 2NY6D 1U93B 3JV5A 2C4FU 2OR9H 2BNRB 1A9BA 3OPZH 2A9AA 5ACZB 3HC0B 3PYCA 1ED3B 1J8HA 3RWCB 5TDNB 5HJDA 5E8DH 1OOWA 2XUWA 4OJDH 1HDMA 4MDJA 3T4AB 2LU4A 3F7LA 4ONGH 1CFTB 3QH3A 2LR4A 1P4BL 3L5XL 5I71C 3V7AE 2NY3B 2OS7A 3QXWA 2IDQA 3DVNB 3WNKA 1ORQB 1NCBH 5ANMB 1K4DB 2J72A 1XF4A 3LX9A 3DJZA 4WV1B 3MRGA 1YEIH 4LKCB 5KYXA 3O45A 1S9WA 3IS0X 1LNUA 4CVXA 1XZWA 5E23A 1CI5A 1M42A 3EGSA 1J18A 4ZAKD 1QYGL 4XP1L 5JORA 3QORC 4E9RA 1F11A 2E6JA 1UH2A 3WJLA 3IDYB 4BFFA 1JF6A 1OK8A 4K23L 3LEYL 1NM9A 3JBG7 3I9IA 4ZMTA 1VGEH 2V7NA 4JQVC 1NEZB 5CEYA 2YAPA 1U21A 3QEQE 4TUJB 2WXPA 3NPSC 5KJRH 4YLQT 3H2QA 5T3XD 3DUUB 1QVOA 1NC4A 1DFBH 4I18A 2VXTL 1P7KA 5JHBA 1WIOA 1KTLB 4OLXL 4CSZA 3RFZB 3BOVA 4TTGA 1J0YA 3CZLA 2R4SH 3ZDZB 2GCYA 1SOKA 3FCTA 4IBZA 2CPCA 5CLTA 1P4LB 3VCLA 4IGBD 4X98B 2VMEA 1JWUA 5AVQB 1AJ7H 5KSBB 3MNZA 1PX4A 1VERA 2AQ2A 3C8HA 1SHWA 5D1ZA 3OB0H 4S11A 3RVTC 4AL8H 2VDNH 5KYYA 3T1WA 2ZCHL 2EINB 4XR8C 5E6RB 5GSRA 1E2VA 1IE5A 3QDJE 3BKML 3CC5B 4OGYH 3HEIB 3BP4A 3ULAB 3ARVA 4QYOA 1TVHA 1A6WH 1A4AA 2VLJB 1XBDA 2FH8A 4FFZH 4S1DC 4BH8A 2XWTA 5C0GA 5D7LD 1F4YH 1NBCA 2CO7B 2FX9L 2W9DH 3KPLB 4PUBL 4FTVE 3V55A 1QSEB 1H8OA 4GJTB 1D9KC 1LL1A 3KVQA 4XBPA 5K9KB 1AS6A 3RZWA 1X5YA 1ANUA 5BMFL 3RHWF 1TTAA 2TSBA 2YIHA 5F7NC 1KIRB 4ZFQA 4ELMA 2ILLA 3BAYA 4UYQA 5EIIB 1M05B 2UZYB 4LPCA 3LZRA 1J9SA 1ZHLB 3WEXA 2W38A 4FQIL 4OTXL 2EC9U 5CCJA 3CVHH 3EJTA 1MWAB 2VUYA 5KUKA 5IQNA 2LW3A 1E4JA 2ZOLB 2J57A 1FN4B 3AREC 4TSCL 4TLTA 5IHWA 3DYMA 3QFDB 4WKXA 4NZTH 3F05A 3L9BA 4JRXB 2HRLA 5LCVL 1KN4L 3ROOB 1QPXA 4M7LH 3SY0B 3W1ZA 4AEIL 4DK3A 1HHIB 4F7CA 2YAQA 4XPTH 5LXGL 1B4RA 2H32A 1RAMA 2QQLH 4PJGB 4DOHB 4XNAA 4IRJA 5L9DH 3LKSB 1J8HE 3SE4A 1YMMA 1LEIB 3GIZL 4OUOA 5FECA 3WAKA 4F57L 4WKZA 2EP6A 2G3ZA 1J1PL 4HBCL 1TDQA 2VABB 1AACA 4YWGL 2P42B 1MHCB 4NKQB 4QRTA 1KXQA 5ETUB 3ZL2A 1H3VA 1P5UB 3ETTA 2DKMA 3U46A 1WS7A 2ZXWB 4KJPC 1LK2B 5CS7A 4DQOH 1I75A 2LQRA 1HQ4A 1SBSH 3OKKA 5ALCL 1RJLB 2A4ZA 4X6DA 3IDJB 2VQUA 4X6FB 1X6NA 2V5MA 4YUEH 2HLAA 3H9YA 3BSZH 5FCUL 1UXLA 3FO0L 3BW9B 3VTAA 4EE2A 5C09D 5IUSA 3GWJA 1W91A 1WP6A 4LLUB 4YGVB 5EOTA 2O6EA 1CS6A 1I1AA 3RKDC 1SFDA 4P8QA 2GJ6D 1GCFA 2ICWJ 2B2XH 4TQEL 2GIMA 3WEOA 4EEEA 1KIQA 1VFBA 3LZFL 3LZPA 1FGVH 4O4YL 5KVMC 3BKCL 1E27A 3B5GA 4UT7H 3WS3A 4WENB 4UAHA 3V8OA 4I0KA 1A02N 4ESKA 3ULSB 5HHMB 2Z93B 1L5GA 5ITFA 5GS0C 2XN2A 4TTDC 3AW5A 5EORH 5IFJB 3MLSL 3AT8A 4NQUA 5AVUB 1NFDF 3L2LA 1WCQA 4OLZH 4Y16D 3RVXC 2ICEC 1FF5A 1SOQA 1MLBA 2WJ7A 4YSTA 3S36X 4A68A 1AD0A 3IFLL 3CFCL 4Y2DA 1S9VB 3VXMD 3ZRSA 1MLCB 5DCCA 5IQ9A 2CGZA 4LCCB 4JFQA 5KW9H 2E56A 3FQWB 2A6JA 1V7ML 1XWVA 4QKTA 4NYLB 3LH2H 5I28A 1YY8B 3UDWC 1QEWB 3PCYA 4A7GF 1C5BH 3SDCB 5F7EH 4HULB 3KHOA 1Q0XH 1CGUA 5CINL 4ELME 2E27L 4AH2B 1X5HA 4PJBF 1KJVA 2FJHA 2V2WA 2D7TH 1SXBA 1F3JA 4N28A 1SMOA 1YC7A 2K45A 3KGRA 2WHVA 3FSAA 5E2TH 2Z1KA 2R2HB 3BZDA 3VWJA 2Z7YA 2RIKA 3MTXA 5L4IA 2DJ4A 1A47A 1GHFL 2OCCB 3GMRB 3SDAB 1N5AB 3CHPA 1ZV9A 3A3YB 2EACA 4CADA 1A1MA 3C2AH 2YAOA 4MB4A 4P4KA 3LD8B 4XRCA 5EG6C 5B3SB 1U58A 2B59B 4YBLC 1T0PB 1KB5H 1OTTC 3KPPB 3SE8L 4Q6KA 3IJ8A 3KM1A 4V2BA 5SX4H 4KU1A 1YYMH 3EJSA 1LDPH 1YMME 4PJIA 4OJAA 4LCIL 2DM3A 1GY1A 1SLWA 2V2XA 3LN5A 1NC2A 3FF7A 3QEHB 4A67A 1SOSA 4C4BA 1AZZC 4P23D 3SKMB 4WFGD 3NJXA 4HJUA 1U3HA 4Z7NB 3VXUD 1G9ML 1KXQE 3GBML 3Q8CA 2X4QB 1G9EA 1KEGH 4IQHA 3F65A 1XD1A 1EAPA 5GS3A 3MACL 1LE9A 4U1SB 4F37K 4XOAA 2GBUA 4FHKA 1KGUA 1X7TA 2AW2A 2B77A 3WXWH 5C0DB 4X6DE 3SGKA 2A0LD 2RCSH 2AJVH 4WEUD 4XCNA 5GRUH 3VFRB 1GVIA 3V4PA 5IF0A 1WD8A 3GPSA 5D1ZC 3MLXL 4XVJH 2ZKHH 4PV8B 3CZUB 2B5IC 3F7YA 2LE9A 5F3BA 5AW4B 4GXFA 1EUUA 4GP8B 2ZX5A 1SJXA 3GLZA 4G9DB 2IFGA 3KLHC 5BO1L 5KYNA 4YDLC 1XR9B 3BSGA 1DUYB 4GYBA 3ETBJ 1HE7A 4OD3L 4QCIA 2OMZB 4RFOH 2DI9A 5F9JA 3SGDH 5H94B 2H8PA 5JNYB 1KN2H 2WINA 2EIEA 1CFVH 2A1WL 4UOQA 1S7SA 1VESA 2VLKD 4B97A 4GBXB 3MYJA 3KLDA 4OKVB 2H3NB 2YR3A 1B88A 4DGYL 3ZDXF 2NY7L 2WM0A 2G5UA 4CILA 4KXAA 1U8MB 1EIBA 3QNZA 1UHVA 5IBLD 5EMYA 4XODA 2SODB 2XPYA 25C8H 2YPKB 2ATAA 4XXCC 4U2ZA 4NZUL 4RNRA 1AP2A 4PJ7F 4APQD 4FJZA 2ZCKH 5JDSB 4IHOB 2XWJB 2V3DA 4KV5F 4XMPH 1RUAL 2I69A 2WQVA 1K9TA 4NDMB 1EO8H 3BHBB 3DURB 4NQVB 2PKDA 2W0FA 4XMLH 5EU6D 2Z4QA 2ZUXA 2XPGB 3GMLB 2DL2A 3ZRCC 1RH8A 1MI5B 1CD8A 4N9GA 3QPXL 1WC7B 1IC4H 5D2LF 1XF2B 1WG3A 2EH7H 5E8NB 5FK9A 3BVTA 3ZE1B 5GRZA 2GTZB 2KERA 3P2DA 3UBHA 3WV0A 2YRPA 2XN9A 1RK1A 5LHDA 1DL7L 1CGYA 2CHNA 4NQQA 1NGYA 2YA2A 1W0VA 4IRJC 3ZIYA 2IDFA 3DIFA 3D5OF 2E7LA 3NIDE 3VQ2C 4LLAA 2W0LA 4Q9QH 3HHRB 5FHAL 2BX5A 3TH4T 3PQYD 3BFWA 1EXHA 5EUOB 3RWJB 5JUEL 5MP6H 1T5WB 2ADJB 2ZKXA 1QFWM 1KXTB 1TQSA 3IRCA 4KO7A 1B2WL 4ZJ9A 2V7HA 4FABL 3VWKC 1F58L 4J12A 3UGEA 3M17A 4G8GD 4FLQA 2ZUUA 4PJIE 1WK0A 3F3HA 4MAZA 4NT6A 1IGIL 5A2JH 2CUIA 4DSYA 2RHEA 2X1PA 2YMOA 3KPNA 1KACB 4GLRH 2VDQB 4KAQH 4AXWB 2CM5A