2IPUG

Pfa1 fab fragment complexed with abeta 1-8 peptide
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
223
structure length
219
Chain Sequence
QVTLKESGPGILKPSQTLSLTCSFSGFSLSTSGMGVGWIRQPSGKGLEWLAHIWWDDDRSYNPSLKSQLTISKDAARNQVFLRITSVDTADTATYYCVRRAHTTVLGDWFAYWGQGTLVTVSAAKTTAPSVYPLAPVCGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSGLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords IgG2a Fab fragment Heavy Chain
publication title Molecular basis for passive immunotherapy of Alzheimer's disease
pubmed doi rcsb
total genus 42
structure length 219
sequence length 223
chains with identical sequence H
ec nomenclature
pdb deposition date 2006-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ipuG01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ipuG02
1FZOB 3LKSA 1L7TL 4X4ZA 1IJ9A 3GMQA 1X4ZA 5TQ2L 4L8SB 5HVWA 3J7HA 4XNMB 1MUJA 3SKUD 1Y6KR 4UDTA 5IMKA 4WNQA 4JVWA 2D0HA 3MRRA 3BAEH 2AJVL 2XG5A 4YC2B 5E2TL 4CJ0A 4YGVA 2AK1L 1AO7D 3D2UA 2IPKA 5KANG 5T3XD 2I9TA 5J9PA 1AD0A 3B9AA 5IBTH 5HYJA 1A6ZB 2PYEA 4EXKA 4XP1L 3PDGA 4HWNA 4UILH 4EZMA 5ITBH 3RJQB 5K9OA 4YFEA 1S9VB 4JFYA 3DGGB 5D2LB 1V7MH 4JDZB 1X7QA 2X44D 2NNAA 4MXVF 5IJKC 1EBPA 1KN4L 4OGXL 4XWGL 3IDGB 1HIMH 2OJZH 1LDSA 4GAYA 4LKCA 3P2TA 3ZE2E 1H0DA 5K9JH 4OV5B 3VJ6A 3O41B 4LBEB 1MVUB 3I75A 1BX2B 3MXWH 1EIBA 4WHYG 1ACYL 4J6RH 4ERSL 1RUAL 2VN4A 4GAJH 2YMXH 4LEOB 1EEUA 5FECB 3V79C 3QIWA 5LAXA 3KHQA 5SWSD 4RMTA 1QBBA 2P46B 1OGAE 4OD1H 1CL7H 2ICEA 2OI9C 5ESQA 4FQQB 2XN9A 5HDLA 4UV7H 1JNHB 1BD2E 4IDLA 3GSQA 5I19H 1X5AA 5I6XC 1F58H 5C9JA 1QBML 4E0RA 3C5SB 3GMNA 1U8IA 1FZMB 2ZOLB 3VMOA 5E6IC 5FOBA 4Q2ZB 4ODVL 2DQHH 1OTUD 2NR6D 3VFOA 3OKDB 2NY1C 4ZFOA 2R1XA 1AJ7L 1NBVL 3OKLB 1T5WA 3F5WA 4RGMC 1DCLA 4L4VA 4Y4KD 5I8KH 3FO1B 4HMCA 3TO4B 2JB5H 2A6DA 2X4OB 4MVBC 4IS6B 3EOTH 5I73C 1R24A 1NFDA 2FBJH 3UTTE 2CUHA 4JZNB 1HH9B 1SEBA 32C2A 1FSKB 1P4IL 1I85A 4NFDA 1CTNA 2NLJB 4OI9A 2CXKA 2R1YB 1MI5A 4LCWE 4I0PD 3EJZD 4OCLC 5LXGH 3VXUA 4WI6A 5D6CA 5I2IB 3QI9A 5DO2D 2CXGA 3NN8B 4Z8FL 2B0SH 5C08E 5D9SB 3MO1B 4HX1A 3TNMA 4RRPA 3HMXH 3LVEA 3GO1L 4XMLH 3QPQD 1WVZA 2XQYK 2X40A 3LKSB 4HUVA 2V17L 4AEIH 2APTA 3GMQB 4TOYH 1C7TA 1JF1A 2VXTH 3IYLW 1R3IH 1MUJB 2VZSA 4AJ0A 4UDTB 5IMKB 4HUUA 1HHJA 1U2HA 2FYYA 4WNQB 1HDMA 3P4LA 3MRRB 1AXTL 4R8WL 4PIRF 3UXFA 4YGVB 5DMJB 3D2UB 3AS1A 4OQ1A 2IPKB 1F00I 2I9TB 4V1DD 5E9DE 1AD0B 3AS3A 3QDMD 5HYJB 2PYEB 2EDLA 4OIIH 3UEZA 3MXVL 2XZAH 4PJ5A 4YBLB 4EN3A 1F4XL 3R1GL 4JFYB 3N1QC 5CWSA 5C3LD 3P11H 1X7QB 4H1LG 2NNAB 4HGWB 4K3DH 3QHTC 4GAYB 4LKCB 4RAHA 3ULSA 3VJ6B 5B3JE 3LEYH 1RURL 2IH3A 5JQ6H 3I75B 2R69L 1JGUL 1CD0A 2XACC 5HGBA 2I24N 3QIWB 5LAXB 4XP6H 5E08L 3ABZA 3EYUH 5IJVA 1IGTA 2ICEB 4KK9C 1CICA 5ESQB 5T5NF 4GXUM 3K8LA 3T3PE 5J3HC 2XN9B 5CGMA 2Y72A 2RCSH 5IBUG 5E2VH 3GSQB 4ALAH 4UZGA 3VFVA 5C9JB 2C5DC 4E0RB 3MRHA 3GMNB 1U8IB 3L3HB 1N3NA 3TT1L 5FOBB 4YDLC 3VFOB 4GRWB 3L3GA 1T20A 3ARXA 4ZFOB 2R1XB 4HFUH 2P24A 1T5WB 3F5WB 4L4VB 3STLA 4P2QD 1CCZA 4H25A 2A6DB 4Y19A 2XTLA 4D8PB 4H0GA 2XZCL 1R24B 1NFDB 2DTMH 3U82B 4NWUL 32C2B 1SEBB 2F19L 1QR4A 3N1FC 2YN3A 4ONGL 1MI5B 1N6VA 3FQNA 4RGNE 3VXPA 2EDHA 3BD3A 1S78D 3VXUB 3UZEA 5D6CB 3QI9B 2QSQA 5F7KC 5D2LF 1BZ9A 3NCBB 3O4LD 3TNMB 2O5YH 4YNYA 3ZLQC 1VPOL 5EZIH 1YUHA 3W11C 1EEZA 4MA3A 4QXGL 1RU9H 3VWKC 4NP4H 3PL6D 4HUVB 2FECL 1CLOH 3MUJA 1JF1B 4EUPA 2ZG1A 5FYJE 2WZPD 4G3YL 5D7JC 3SGEI 4R26H 4LPUA 5DD0L 4HUUB 1HHJB 5C09A 2FYYB 5I66A 1HDMB 3EJYD 1MJ8L 4DN4H 4D0CA 4XPGL 3HNVH 1CQYA 5CCKL 5C7XL 4OM0L 1PAMA 1D3CA 4K3EH 4PJ5B 1OT2A 1S9WA 4EN3B 1YNKL 5CWSB 4C56A 3ARGA 1VERA 4ZYKA 5CKAA 2EXYD 3MRDA 2VABA 2XZQL 4NJAL 1ZOXA 3ULSB 2BJML 2EDRA 2Q8AL 4E41A 2Y36L 1WUNT 2IH3B 2OL3L 2E8ZA 4P46C 5HGBB 3CK0H 1NH6A 1J18A 4B41A 4WEUD 4U6VL 3MMEA 4YZFF 5LCVH 1IGTB 4NUJA 3JWDH 1WWWX 3IAPA 1A6AA 2R0ZL 4G42A 5DQJA 4I3GA 2W9DH 3U9UA 2YUWA 3VFVB 5IEHA 3GSXA 3MRHB 5JIIA 1AO7E 1N3NB 3ZTJH 4N0CC 5T3XE 3RZCD 4HJ0C 5INDA 5E70A 3L3GB 1T20B 2P24B 3EYOA 1FVDA 5C07A 1W2KT 3STLB 2Z91A 4J3WA 4N8CH 4Y19B 3O3EA 3T0EC 3CPLA 4OQTA 4FFVD 1FGVL 2V5SA 3H9YA 2IGFL 3PV6B 3G9VA 2OTWA 1MRFL 4NQUA 5JUEL 5C0ND 5I8OH 3PG2A 1CYGA 5D2NB 3CMOH 3SEPA 5CIPH 3MLRL 5ALBH 3FQNB 4NM4L 3MOBH 3NAAL 3VXPB 5SWSE 3T8XA 2AERT 1T0MA 1JFQH 1KYOJ 1M6OA 3ULVL 1DN0A 5IVXA 1BZ9B 4G6AC 5E0QA 4YNYB 1YUHB 2PO6A 3GJFA 1EEZB 4I3RH 5HI5C 1R0AH 4MA3B 4U05A 5IWLA 2R4SL 1S7SA 1AR1C 3VD5A 2GTWA 5C09B 5I66B 4X4YA 3SGDH 1IT9H 4PLJD 3W0WD 4D0CB 4MB4A 4Q58C 1ZHNA 4PR5A 3WN5A 4R3SA 1NMBH 3VDAA 4S1SL 5C0AA 3S88H 2J12B 2AJXL 3OJMB 4M5ZL 4C56B 3ARGB 4ZYKB 2G2RA 1EXUA 3MRDB 2VABB 3C8HA 1NBQA 5HHQA 2DB8A 4PLNC 1VFUA 4E41B 3L9RA 4K71C 4LVOB 5EDXA 2EDEA 4UUJA 1TETL 5DURD 3BQUA 2H1PH 4ZUTA 1A1MA 2Y1VA 4GXVH 4XVJH 4HWEL 5EO0A 3MMEB 2HWZH 3SGEH 1NFDF 4M7KH 1TJHH 2Q8BL 3ARBC 4MQXD 1A6AB 3UYOD 3RKPA 1AC6A 5FHBH 4H88L 4G42B 5DQJB 4F7CB 4G6ML 3U9UB 3WLWC 5IEHB 3GSXB 2COQA 1YA5A 1VFBA 3NA4A 1LEIA 4KJQC 1JK8A 4V1DE 1XGTA 3QDME 1DSFL 1G7IA 5INDB 1T21A 1A7QL 2X7LB 1TJGH 2WBJA 3EYOB 1FVDB 2GT9A 5C07B 5JIHA 1IBGL 4FFWC 2Z91B 4PUBH 2P4AB 2IPUG 1KCSL 2NY5L 1SYSB 3DOSA 3O3EB 3CPLB 5GGTL 1W72H 3B9KD 4Z5RB 2OTWB 4FQLL 1B4JL 4OGYH 4MS8D 4KI5C 1NGPL 1DLHA 3QNYA 1UWXK 2UYLA 4GW5A 4OLUL 1A5FH 1AFVH 3QDHA 3AY4A 3H3PL 3T8XB 3MTRA 3V52H 1DQML 1T0MB 3S37X 1M6OB 4NKOA 1DN0B 3UPCA 3PGFH 5IVXB 3ZHLA 4K9EH 4UBDC 5DJ2A 3MLZL 3RNKA 2CRYA 1BQSA 3F7YA 4MCYA 4UI2A 2PO6B 2F54A 4NQCE 3GJFB 4P3CH 2O61A 3INUL 1V7NL 4RMSA 5E8NA 5ILTL 5L6YH 1JPTH 3U48A 5F9AC 5B4MD 3UTTA 1S7SB 5I18H 2IADA 2GTWB 4X4YB 2NW3A 1WGOA 4JRXD 5JDJA 5AYQA 4P2QE 5H2BA 1EHNA 5I30H 3CDGA 4WFGD 1ZHNB 2LU4A 4IMLA 4PR5B 3WN5B 4R3SB 1JNNH 4LEXH 3CFEA 5A2KH 1NGYA 4IIQC 5C0AB 5CEZL 3ARDA 4O2FA 1EXUB 4H20L 4W6YB 4FQPA 3JV0A 1JMXA 3GBMH 5HHQB 3MJ6A 4TSBL 4WEBL 3ULUL 2CMRL 1SMOA 3GSNL 2D4DA 3NIDE 3L9RB 5EWIH 3O2DL 4M1GL 4UUJB 2CK0L 4ZQKA 3RA7H 1BFVL 3BQUB 4X98A 3MJ8A 4ZUTB 1J1OL 1ZHLA 3O4LE 3JBG7 5J13C 1OAKH 1OM3L 4ISVA 5EO0B 4UIKH 3WXWH 3AC0A 2EH8H 3BKYL 5JXEC 3S96A 1E6JH 1IGYA 5IESH 3LN9A 4OF6A 2VRAA 4IDJL 4HWBA 3STBA 2NXYD 4UTAH 1HILA 1FLRH 4H8WC 1BQLH 2NY7L 5DD3H 3QUYD 2R2CA 1VFBB 5FGSA 4IOSD 1LEIB 1JK8B 4PJFA 1DBBH 1T3FA 1YPZA 4AG4H 1XGTB 1XGYH 2Y07H 2CLZA 3PE9A 1G7IB 1T21B 1ACZA 3S34H 3EKCA 5E2UH 2WBJB 2GKIA 4XCFL 2FCBA 4W4NA 3W81A 1UA6H 3IJSA 3K80A 3NTCH 5GS3A 3DX6A 5FF6A 1N5YL 5E8OA 5CZXC 2OQJA 3KNBA 3WO4B 1FFNA 3KPRD 3QNYB 1P7QA 2DIBA 2UYLB 1YECL 2A6KA 3MJ9H 4H8WL 1KBGH 3OXSA 3BDBA 1FO0H 3JUZA 1EZVY 4NUGH 3ZDYF 3BP5A 3LEXA 4EJ1C 2B4CH 4JEGB 1A7NL 4NKOB 1DJSA 4G5ZH 2NY2C 4I48A 3VI4E 5DJ2B 1KB5H 2BNUA 3TIDA 1A3LL 3RNKB 4YUEL 1NMAL 2DQJH 3F7YB 4MCYB 5GQBA 3MRMA 3WFCL 2F54B 1MHPL 1K4DA 2AEQL 3QWRA 3V6OA 4M61A 5E8NB 4L4TA 4E9LA 3G08A 2AEPH 4OFDA 2QQLH 4Y88A 4O9HH 4LSSL 2FZ3A 5KSAA 3AS2A 2IADB 3BW9A 4NWTH 4PD4K 1DEEA 1MIML 5BOZG 2BVPA 5H2BB 4I18A 5T1KA 4IMLB 1FJ1A 4DGIL 3UJIH 3O9WD 5FYLL 1RZIA 4FQXA 3CFEB 1NGYB 1H8OA 5TQ2H 3ARDB 4O2FB 2DLFL 4UQ3A 5GRYA 1OAZL 2Z31A 2NY4D 2VLRD 2B20A 1FIGL 3TPKA 2GK0A 4M48L 2JIXA 4IOIA 4S1RL 2A9ML 5E2TH 5J12C 2AK1H 4ONFL 4ZQKB 3RL2A 4X98B 3F6IA 4XHQA 3MJ8B 1ZEAL 4OSUL 1ZHLB 3QDJA 3ZMRA 4BZ1L 4M7LL 4ISVB 2IFFH 2W9EL 1KTDA 3HB3C 1KN4H 5C3TA 1IGYB 3S96B 4OZGE 1ED3A 4KRLB 1KPRA 5IQ9A 2BC4A 1HILB 2H8PA 1DL7L 2RFXA 2VLMD 3QUMB 3FO9B 1X5LA 5DQDH 1ZAGA 3W0WE 2A1WL 1ACYH 3DV4A 4ERSH 2CPCA 4PJFB 1T3FB 1YPZB 3MA7A 3PP3K 3QB7C 5IVXF 4KXZI 2Z93B 4CW1A 2CLZB 3LMJL 4XPAL 1QNZH 4M6MH 3TYFA 5CSBA 1Q0XL 3C8DA 3QJFA 1U41A 2GFBA 3IJSB 4Q9QL 1BQHG 5FF6B 3DX6B 5AZEH 1QBMH 2APXA 5TDNA 5E8OB 2OQJB 4QHKJ 3KNBB 4Y5XA 4ODVH 2XKSA 5EIIA 3X13A 3DVGA 1P7QB 1S7WA 1JGEA 3U4EA 1J7VR 4C4KT 1AJ7H 1NBVH 2A6KB 5HYEA 3BP5B 3LEXB 4TNWK 4JZOA 4POUB 3QPXL 5K33A 5L2KA 5ERWA 1FRGH 1FBIH 5E6ID 5F89A 5I16A 1EEYA 4I48B 2OYPA 4Q97A 2BNUB 3TIDB 4W6WB 1S7TA 4HS8L 3MRMB 3D5OF 2NY1D 5F7NC 4Q9RL 1P4IH 1OSPL 5DFTA 4M61B 4PREB 4QRRD 4L4TB 3G08B 4MVBD 2KQNA 5L0QC 3FRUA 2FZ3B 3AMKA 3NACL 5KSAB 4MJ4A 3BW9B 2GSIA 5FFLA 4Z8FH 1DEEB 5F7WC 4PJAE 3U83A 4U49A 4NN7C 5KOVC 2BVPB 4LHUA 4U6TA 4I18B 5T1KB 1FJ1B 3ARPA 3BPOC 3MNWA 3Q6FA 3V9FA 3TCXA 4OIAA 1RZIB 4FQXB 4I2XE 4URTB 4RBPK 1TVBA 2V17H 4UQ3B 2W38A 4Y2DA 2Z31B 3UJJL 2VE6B 5F1OB 3ELAT 5DLMH 2GK0B 3G9AB 1U8HA 5FUOL 2JIXB 4IOIB 1J8HD 4R8WH 3NZ8A 1UEMA 2EDXA 2W9LA 3RL2B 4U1KA 1Z2KA 4EDWL 1SBSH 2YWYA 5HHVL 5A2FA 3QDJB 4JR9H 3DARA 3MXVH 3Q5YA 5DI8B 4PG9A 4ZD3L 1F4XH 2NY6B 5EBMA 3AS0A 3JUYA 5IG7A 1KTDB 1TTGA 3IXAA 3TNNA 4EIZC 2FHBA 1ED3B 1NC4D 5C0JA 2LAGB 5IQ9B 2BC4B 3HMXA 2H8PB 4KDTC 1RURH 3VMPA 2DD8H 2RFXB 1FYTD 1NGWA 2R69H 4YHYB 2IQ9L 1JGUH 4JRXE 3DV4B 4Y0GA 1DQJA 4WFGE 3MA7B 2P8PB 1ZLVK 5E08H 4CW1B 4UDUA 2AABL 3PUCA 1U3ZA 3TYFB 3LIZL 3QJFB 2GFBB 4MD5A 3R8QA 3MGTB 4OLZL 4QRPD 5MHSD 2R29H 5HHXL 1JF6A 5TDNB 4JGMA 5IHLB 1FG9C 4KK9D 3TT1H 1WCBA 4Y5XB 3WIHL 2ZUTA 5J6HA 4ZSOE 5EIIB 3TBVB 5J3HD 3X13B 2VDPH 2VDNH 3DVGB 1S7WB 1JGEB 3U4EB 5IHUL 4CRPA 4LOUC 5JXAL 4O00A 3O4OC 4JZOB 3F7PC 4XC1L 5L2KB 5ERWB 3EGSA 3QDGD 1A14L 5F89B 5I16B 5KG9A 5SWQA 1EEYB 1CLZL 5J89A 1LEKA 1EZVX 3N9GL 3ET9F 4OI8A 1S7TB 4L8CA 4NWUH 2F19H 1T7ZA 1ZLWK 1Q9OA 4YH6A 4ONGH 3FQXA 1MAJA 4Y7MA 3E3QC 3DYPA 3PJSA 1XIWA 3FRUB 1A7OL 2VLJD 3EZJB 2QR0A 1P9MC 4GG6A 2GSIB 5K59F 1GYAA 1K5NB 3LDBC 4LHUB 5IB4A 2N1KA 1XCQA 3CFJA 3MNWB 3Q6FB 4KAQL 1HK6A 4PD4J 3MLXL 4QXGH 4Z7WA 4MNGE 1T89C 2IBZX 5HJ3A 1TVBB 1SY6H 3ZE0E 4Y2DB 4D0BB 3KPRE 3QDAA 3UPAA 4G3YH 3U0TA 3FTGA 4PJFF 5JORA 1YPZF 1U8HB 4RAUA 4NC0B 3W11D 5L2JA 4Z6AT 5E5UB 5CZVL 3NZ8B 3P4NA 4XPGH 3VWKD 4N0UE 3OJVC 1VA9A 1UVQA 5CCKH 5C7XH 4U1KB 3ZO0A 2XXCB 1WIUA 4OM0H 4FMFA 1J0YA 4R6UA 2RB8A 4YHIA 5D7JD 4PG9B 5EBMB 4JO4L 2ESVD 2LFGA 3X17A 3SKOA 5IG7B 3IXAB 4TNVK 4EQ2A 2YWZA 3ZHKA 3TNNB 4NJAH 3ZYIA 5C0JB 2IAND 2BJMH 4HW6A 4PJHA 1L6ZA 2Y36H 3AU1A 4MJ5A 1E4KA 4P4KA 5IW3A 1NGWB 4JO2L 1EJOL 1BVZA 4QGYA 3U7WL 3DXAD 4JZJA 3SDCC 2DYPD 1YNLL 1DQJB 3QEQA 3U36A 4OD2A 1I4FA 4U6VH 5D7IE 4UDUB 3I02A 2EE3A 3LPWA 4I0KA 1G1CA 2VWEC 5D93C 4MGXA 1M7DA 1DQQA 3ZT7A 1G7MB 3O4LA 4MD5B 3JXAA 4XP9L 5FDWA 2R0ZH 4XAWL 1C12A 4JFFD 4P46D 3VXTA 4W4OC 3BD5A 3VGFA 5FUCE 1JGVH 4K7FA 5CJOL 4HLZH 3MRNA 3VH8A 5FGRA 1WCBB 5TFSH 5ICZA 5J6HB 4L9LC 5D8JL 4F80A 4YHLL 4LSVL 3JVGA 3HHRB 4XWOD 5D72L 3DLQR 5KG9B 5SWQB 4N0CD 4JFHE 4HJ0D 1LEKB 4R7DA 1DP0A 4QTIH 1TIUA 2IGFH 5J6GA 1JHTA 4L8CB 1MRFH 1MCLA 1X5IA 3GSVA 5JUEH 3SQOL 3FQXB 3R0MA 4YXKL 2YD6A 3PJSB 3NAAH 3T0ED 4LLDA 1XIWB 2MQCA 5E1HB 4AENA 1EMTL 4QXTA 4GG6B 1S8DA 3WS6C 3KJ4C 2VAAB 4KGLA 3BUYA 3GEWB 4OUUB 3VXRD 5IB4B 3ES6A 4O51A 1XCQB 3CFJB 5TDPA 4NQEA 4UV4L 2JJTC 1MCHA 4X8JA 4Z7WB 5HJ3B 2E27L 3ZKXC 4LLUA 3DBXA 4KPHL 2BY1A 4G6AD 4BM7A 2E3VA 5BOPA 2R4SH 1JHKL 3U0TB 4V2BA 3RL1A 2VIRA 5JORB 4RAUB 4BFEA 1LEGA 1RULH 5L2JB 2FO1A 1MCRA 5HI5D 1QFWH 3P4NB 5D1QC 5DRZA 1UVQB 4FNLH 5GJSL 4BZ2L 1MLBA 5CIPA 1P7HL 2B1HL 4M3KB 3T0VA 4S1SH 4YHIB 5DQ9A 4HDIA 1AR1D 2ERJB 2VYRE 2AJXH 4JHAL 1WK0A 4M5ZH 1MF2L 3SKOB 2AQ2A 5D7LD 2W92A 3FN0L 3K0WA 1NAKL 4PJHB 3HS0A 2GITA 2H3NA 3AU1B 2EE2A 4MJ5B 4P4KB 4QKXB 1TETH 3KYKL 4LLYA 5ACZA 5FV1L 3MUY1 5C8JA 4JZJB 4LQFL 5D7SH 5J0BA 1TCMA 3QEQB 4HWEH 3U36B 3BIAX 2E7HA 4OD2B 1I4FB 1HXMA 1MCNA 1H3VA 4PY7A 2HKFL 3I02B 3NVQA 5FM4A 5T5NG 3RPKA 2Q8BH 1M7DB 2A9NL 1DQQB 1OF2B 2F8VA 2GJ6A 4LPVA 3O4LB 4XVSH 5FDWB 1OAXL 1C12B 4H88H 3VXTB 2Q7NA 4RDQG 5KVMC 3WNLA 4K7FB 3V0AC 1KJ2L 1J8HE 4TYUA 1MHEA 4R90L 3VH8B 1JRHL 3NCYP 5HI4C 1M4KA 3ARBD 1A7QH 1FGNL 4ELME 1IBGH 3BJLA 3GUTA 4KJQD 1KCSH 3PWPA 2NY5H 5CHNA 3TH3T 2QKIA 3S5LG 3P4OA 5J6GB 3SE3A 1D5IL 1FYTE 1B4JH 4FQLH 3C5JA 3QIBB 2QSVA 3GSVB 1NGPH 4MX7B 4OM1L 4LNVA 4FFWD 4HUNB 2GAZA 1HYSC 4OLUH 4PJXA 4LLDB 3H3PH 4JQVC 1DQMH 4DOHB 5D5MA 1FFPB 4AENB 4QXTB 3WEXA 1S8DB 5TE6H 3BUYB 2VH5H 4KI5D 5EZLA 3MLZH 2YR3A 5DRWA 5MHSE 2ZUWA 4O51B 5TDPB 3LZFL 3MV9D 4NQEB 3T3ME 5KVFL 4X8JB 3INUH 3BDYL 5KVGL 4LLUB 1CK0L 3DBXB 4LIQE 1MEXL 1OD9A 3B2UC 1PX3A 4NN5C 3C9NA 4UBDD 5DHYA 1F5WA 4JM2C 1CIDA 3RL1B 2VIRB 1W72A 1B6DA 1LEGB 4F9PA 5BZWA 4S11A 2BSSA 5M7QA 3KYOA 5DRZB 3QDGE 1MLBB 3CXDL 5CIPB 4JANA 3IDUA 2PTVA 5DQ9B 4HDIB 3N1GC 5F7MC 3UROR 5CEZH 1CU4L 4AL8L 2OMBA 4OBSA 4H20H 3G5VA 2W60B 4CGTA 1WT5C 3QUZA 4TSBH 4WEBH 2CMRH 3OHXA 1FC2D 3ARFC 3C5ZC 2XKNA 2GITB 2H3NB 2VLJE 3HS0B 3S4SA 3O2DH 4M1GH 4GAGL 4LLYB 3BWUC 1TCRA 1BFVH 3RVXC 5ACZB 1S9XA 1J1OH 3NPSC 5C8JB 1T6VN 2NX5A 5HVGB 1OM3H 1HXMB 4MB5A 3DUSA 3BKYH 5I76A 5DC4B 4ZFZA 2DLTA 1IQWL 2GJ6B 4L8DA 3B8SA 4XX1G 2H2PC 2NY7H 2EDBA 3MPCA 5FGBA 5ID1A 4OGZA 5JXED 1MHEB 3OKOA 1OP5H 5HYIA 4GG6F 2VDML 1VKXA 15C8L 5H37H 3S6CA 4KZDL 5DS8A 1S3KL 4NCDA 4XCFH 2ESVE 1JGLL 2J1KA 3OKKA 4OCWH 1K9TA 4Z7WF 3GUTB 3BRDA 3PWPB 3MZGB 5CHNB 2IANE 1N5YH 2FL5A 1HN1A 3P4OB 1Q72L 5FKAA 4ZAKC 3C5JB 3C6SA 3JTTA 3MV01 1FNGA 4DVBA 3KLSA 1NUFA 3DXAE 2EO9A 1AY1L 5D70L 1FNSH 2GAZB 2MFNA 1GGBL 1YECH 4PJXB 4KFZC 4H8WH 5D5MB 3WEXB 1A7NH 2CKBL 4RISL 1HHKA 5T1DL 4XPBL 5DRWB 4JFFE 4MAYC 4YUEH 1NMAH 5CUSH 2MCPL 2Q3ZA 1WV7T 3WFCH 3KLDA 4U3CA 5GGVY 1GOHA 5HI3C 2AEQH 3BPCA 1M05B 2FIRT 3IAQA 3BXNA 5DVMA 3H6JA 1A7PH 2NY2D 5C0CA 4YR6A 4Q0XL 3C9NB 2BNQD 3FJTA 4HK3J 4LVHC 4ZNEE 1GHFL 1ZTXL 1F90L 4LSSH 1QSFA 1P6AB 1ORSA 4W81A 3Q48A 3QUYA 5BZWB 4LRNL 2GTZA 1MIMH 2BSSB 3MA9H 4GKOA 3KYOB 1QUNA 3NFNA 4DGIH 1CLYL 1LP9A 3EAKA 4JANB 4ZFGL 2BVQA 1D6EA 4FN0A 3VXQA 5AG8A 2LTQB 3MJ9A 2EIZA 1FO0A 4JJHA 4U2ZA 2DLFH 4M7LT 1A3RL 2G75A 3G5VB 1FIGH 1VEMA 3QUZB 1KLGA 1FDLL 5SX5H 3OHXB 1KB5A 3WHXA 2XKNB 4S1RH 2A9MH 4MNGA 1LE5A 4TUKL 4ONFH 3S4SB 1NLDL 1TCRB 1WISA 1S9XB 4JKPH 3KPRA 1YZZA 2NX5B 3WS3A 4BZ1H 2J2ZA 5FCUH 3C60C 4M7LH 3A6CL 3DUSB 2E6QA 5I76B 4ZFZB 3VFWA 3BT2L 3L5WB 3MODL 3WJJA 3RKDD 1P53A 4L8DB 3WV0A 4F15B 4JM4L 1DL7H 3A0OA 5ID1B 1TQCB 3HB3D 3OKOB 4OCNC 2AXHA 5ISZA 1VKXB 2X9XA 2X89D 1RAMA 5DR5L 1PD6A 4JRYA 3MR9A 5DS8B 3LMJH 4XPAH 4CU8A 1U8MA 2IEPA 1Q0XH 2XG4A 3O2WL 3OKKB 4JVUA 4Q9QH 1V3MA 1HHIA 3K8MA 1TXKA 5IT2L 4ZUVA 3O9WA 2FL5B 5FB8A 1FAKT 3VDBA 3CX2A 4TUJA 3GGWA 5F88A 1FNGB 3LKQA 3CFBA 1HNFA 4DW2L 3TBTA 2VLRA 2JE8A 3ZYJA 4Z7OE 4KRPC 3WL9A 3VG9C 5DD6A 3QG6A 3HC4H 3IB4A 4P2OD 3AXLB 2EDFA 5JW4N 5F7UA 1HXYA 1CXLA 2J5LC 3QPXH 3B3IA 3ZL4L 1ROWA 1A4KA 3WFBL 1X5ZA 2DBJA 2DI8A 4HS8H 2A77L 1H3UA 1P4BL 3D6GA 3BPCB 1OSPH 3JV6A 1KPVA 3BXNB 1TQBC 5C0CB 1B0WA 1MFBH 5F7EL 5I1JL 8FABB 3NACH 1QSFB 2DWDA 1ORSB 1FL6B 2IAMA 4MAUH 3QUYB 3QA3A 4KY1H 4M1CC 5IJKA 3C09B 3NFNB 4U1HA 5TDOA 2C3GA 4J4PC 2DQIL 1OVZA 1LP9B 3EDEA 4M1DL 2BVQB 1D6EB 3T08A 4DEPC 3VXQB 5KJRL 5BRZA 2J3SA 4J3OC 1FO0B 2G75B 5F8RC 4GLRI 3UJJH 4CMHC 1Q38A 3T0BA 4QOKE 3L3IA 1KLGB 2APWA 5FUOH 1CF8L 1KB5B 3WHXB 4MZ2A 2E9JA 1LE5B 3OTTA 3B5GA 5DGQA 4EDWH 3KPRB 4KI5E 5HHVH 3EDFA 3WS3B 3MV9E 5CJ5A 3VFWB 3KPSB 3D85D 5E6IA 1T7XA 2AGJL 3FQUA 2KZWA 1U42A 3AM8A 2XICA 4M93B 1OT1A 2B8OT 4PJ8C 4PJXF 2IQ9H 1PQZA 4XXCA 4PRHE 4QRRA 5D5MF 3BPNB 1J11A 3E2HC 5ISZB 1RIHL 3OMZA 2BDNL 3KYMA 2LQRA 1E27A 4JRYB 2ZKHL 3MR9B 2AABH 3IT8D 3SE4C 1U8MB 3H2WA 4OLZH 3PNWA 4LLQA 3MREB 2MPAL 1QKZL 5HHXH 4ZUVB 3ILQC 1BJ1J 2XRAL 3O9WB 2N7AA 4FXLA 3RY6A 5FB8B 5IBLC 4C83A 3GGWB 5F88B 3WIHH 3LKQB 3CFBB 3TBTB 3WJLC 2VLRB 2V6HA 3WL9B 2X05A 5DD6B 1RFDL 5IHUH 2ZP0T 3QG6B 4X7SL 1HZHL 1QP1A 2QEJA 5JXAH 1HXYB 4X6EA 1J8HA 1PEZA 2P48B 3B3IB 4XC1H 4RFNC 3BMWA 2UZYB 1A7BA 1A14H 4G9FA 5J57B 1MJ7L 1CLZH 5HHPA 5SWZA 2BK8A 4YBHA 3N9GH 2FX9L 1J9CT 4N9OB 4NQVB 6FABL 1Q94A 4ELMA 2AEIT 1LMKA 4LOUD 4CNIB 1YEIL 1KPVB 4DUWA 3EBAA 1VEOA 5A40E 2B5IC 1S7VB 2L7JA 3U4AA 3PGCA 1BGXL 1REIA 1FYTA 2CDEA 1DN2A 2IAMB 1VFAB 3O3BA 1TMCB 3QA3B 4NCC2 1RZ7H 2CDGA 2PXYC 4XI5C 1YEEL 1U92A 4U1HB 4KAQH 3MLXH 5C0RL 3K4ZA 4PS4L 5BRZB 4U1LA 1Y0LA 2YEZA 4QRPA 4PFEA 3L3IB 1TITA 4UU9A 4GRMA 3WFZA 5TF0A 3N85L 5CZVH 1T66C 1VGEL 2NTFA 1UKSA 3W9EA 2OI9B 1NGQL 3X3GL 1EERB 4JREB 4Q6IC 2OSLB 3RHWF 3TZVC 5IVOA 3D3VD 5F9JB 4JO4H 2GJJA 3VFTA 4O2EB 1KCVL 5T3ZL 5E6IB 4YEFA 5GHWL 3HE7A 1B2WL 2BNQE 1OP3K 1YQVL 2FD6L 3GMMA 4XVUD 1GZPA 3DECA 4D9LL 2NY1B 1X44A 4JO2H 4PRBA 4RGMB 3U7WH 1PQZB 4QRRB 1T2JA 4YFLI 1YNLH 5JIKA 3ESVF 1PKOA 5I73B 4GLRH 4X4XA 1WBZA 2O5XH 3KYMB 3WNPA 1FFRA 1E27B 1DFBL 5KANI 2X9WA 2EDTA 2AVGA 4LHQB 1U3YA 3PNWB 4DUVA 4FXGA 4LLQB 5CJOH 5JPNA 3B5HA 2ZOKA 5DC0A 2MKLC 4LCUA 2R0WH 4C83B 1ZHKA 1HQ4B 5D8JH 1O0VA 1MAML 3QQ9C 2VUOA 2D7TL 4YHLH 5EO9A 4LSVH 3ISWA 4X6EB 3BEWB 1LP9F 3VWKA 4LSRH 4M62L 2E9WA 2ADFL 4WO4C 1YNTA 3ALPA 5E4EC 4G9FB 4LGPB 3V6ZA 5HHPB 2BZDA 5SWZB 5IMOA 5IQ7L 5FYKD 3VFSB 3VFNA 3ZHDA 1Q94B 2QADC 1KCRL 5C0BA 1ZGLA 1WQVT 3U0PA 4U7MA 1PSKL 1JPGA 1RIVH 4YXKH 1KB9J 5HYSA 4P23C 4X6DA 2C1OB 3PGCB 4M3JA 5I1LA 2CDEB 2OM5A 3T2OA 3DURA 4YDKL 3O3BB 3T65A 3C6LA 2CDGB 5FYKH 4U1MA 3RBSA 1L4IA 3UC0L 1NCDL 1Z6JT 3W2DH 2BNRD 3B9EA 4KROD 3RWGA 4TTDC 2E27H 2LE9A 2X1OA 4KPHH 4U1LB 4GOSA 1Y0LB 4JFFA 4QRPB 1W0WA 3KXFB 4XHJC 1JHKH 1JPSL 2EZ0C 1LDPH 3NIFE 1BMGA 4UU9B 1SVCP 4GRMB 2PN5A 2NTFB 1S9YB 5CD5C 3W9EB 1E4WL 3R06A 2J8HA 5A16A 1FL5B 4BZ2H 4CDGC 1WJ3A 2B1HH 3MBEA 4KKCD 3B5TA 4JHAH 3IF1A 1MF2H 1MCKA 3K8KA 1KN2H 3VFTB 3OWEA 3IJYA 2QHLA 1XF3B 5KZCB 4UOW1 3LN5A 3FN0H 4MNQE 3FFCE 1UM4L 1G0DA 3HE7B 1NAKH 4YDLB 5B39A 2JCCE 4C4KO 3OAYK 3KYKH 4I3SL 4NHCH 4PRBB 3CLFL 5EZOL 2DWEA 1JUFA 4L9DA 4YHNA 3T0EA 4XMPL 2MJWA 4X4XB 3RTQA 1WBZB 4GXUN 2Q20A 2HKFH 5EFIA 4RAVB 2X1XR 3RDTA 3VXRA 1BJ1H 1MFNA 1OAXH 1F4AA 4FXGB 3DNKA 4JKMA 5JPNB 1KJ2H 3ZKMC 2ZOKB 4R90H 4LCUB 1G6VK 1IKNC 4NQDD 1JRHH 1ZHKB 2E7MA 1RZGB 3HI1B 1KACB 1FGNH 2YC1A 3TIEB 5LGJA 2W0KA 2B1AL 2H32H 4JKWA 3VWKB 1CXEA 3KR3L 2OP4L 2MQ0A 1YNTB 5HI4D 3EJJX 4U2YA 5IMOB 3BZDA 3PXJA 3VFNB 3FHQA 1D5IH 4I77H 4IRSD 5C0BB 1ZGLB 3OG6B 4OM1H 4AM0A 3U0PB 1RZ8B 3DX8A 5D7LA 4PJDA 4P5MA 1JPGB 5HYSB 4LVNC 4D94A 4X6DB 5B38G 3O6ML 5I1LB 4WWKC 3G6JE 3DURB 3T65B 3RWCA 2VSDA 1WZKA 1VADB 3C6LB 4GS7C 4U1MB 1IAMA 3IJHA 3LQAL 3HI5L 5KVFH 3RWGB 3BDYH 4PTUA 1CK0H 1F02I 1MEXH 4X9HA 3STZA 2IMNA 1W0WB 1FG2A 1ODAA 4RMUA 2R23A 3S3PA 4NNPL 4WTZG 3P9MA 2FDBP 1P84J 3DI2B 4U3HA 4EI5A 2Z9TA 3ME0A 3DWTA 4S0SD 5A16B 3GJFK 3NA9H 3CXDH 2PKDA 3WIFA 3VGEA 5M94B 2NCMA 4FABH 3MBEB 4JM2D 4ZXBA 3UBXG 4AL8H 3IF1B 3WIIL 3GHBH 3IJYB 2C7UA 4P49A 2J88L 4Y5YA 4ZOAA 2C9AA 3O6FD 4MB3A 4TUOA 5K9QI 3EUUA 3LN5B 3SDDC 1F6AA 2I25N 1NCAL 2CO6B 5EU3A 5B39B 1UB6A 4TPRL 4GAGH 2IG2L 4P5TD 1GZQA 4NBZB 5ECJE 1OPGL 2HTKC 2O26U 2DWEB 3D39E 1JUFB 4YHNB 3T0EB 1UEYA 1KIPA 3F65A 3RTQB 4DGYL 5EFIB 3ARFD 3C5ZD 3UTSD 2BOCA 5CP3H 3RDTB 1IQWH 3RVXD 4ELMF 1OLLA 3VXRB 3ZT5A 4NHUA 3C2AH 3B9VA 4OAWA 4TQEL 4X7CC 4M7ZC 2VDMH 4GBXA 15C8H 2DLIA 4KZDH 4JO3H 2YC1B 3I50H 4EQ3A 3GM0A 2LAAA 2FJFA 5LGJB 5MEQA 1XGRB 2ZSVA 1JGLH 5E7BA 1EA9C 3O2DA 5ENWA 1E6OL 1WZMA 1J87A 3KGRA 4HWZA 2KBGA 3VWJC 1BBJA 4LLMA 3BGFC 3RBGA 3RWEA 1VEPA 1Q72H 3U2SA 3KPPA 3VCLA 4AM0B 4APQD 5D70H 2ICWA 5D7LB 4PJDB 4HKJA 4P5MB 4X9IA 1GGBH 4RGNC 4PJ9D 1SQ2N 4I4WA 4ZAKD 2CKBH 4RISH 2WWMD 5T33L 3RWCB 1U8JA 4H1LH 2M2DA 4XPBH 3FKUS 3PV7A 1NANI 4UMGA 2MCPH 3IJHB 4DN3L 5J56B 4PJEE 4K71B 1FE8L 5JQHC 2VWEE 4GG8A 4PTUB 4ONHA 4XBPA 3STZB 2MQ3A 1WIOA 1GHFH 1F90H 1FG2B 4MAYD 2R23B 6CGTA 1L0QA 2X4RA 3PABA 2DMBA 3P9MB 4LRNH 4XNZB 5HI3D 5JXEA 4KK6C 4EI5B 4YQXH 1JPFA 1S7QA 3OX8A 3OKMA 4TVPD 1AQKL 3WIFB 4ZFGH 5C71A 5FYKE 1MLCA 1OARL 4ZXBB 3IKKA 1A3RH 4LSTL 1U8LA 4Y5YB 1TZHA 2X4NA 4TUOB 3OGOE 1NUGA 5EIVA 4Z9KB 1FDLH 1F6AB 1A21A 5DUBA 4HXBH 5EU3B 4Z7NE 4XPHL 4Y16C 2WV3A 1UB6B 1NLDH 5DVKA 2E6JA 4Y4HD 4NJ9L 5IFHL 1GZQB 2E7LC 1C5DA 4TVPH 4BELD 3L5XH 5LWYL 5FYJL 3SJVA 1KIPB 4XCYA 2DLHA 3A6CH 2BNRE 3V4PH 2DQEL 3QUXC 2BOCB 3AAZA 3BT2H 2JK5A 3MODH 5D1ZD 1Z0NA 3CSGA 1RZKL 4GMSL 4YHKL 3RX5A 1CBVL 4NHUB 2BCKA 1PX4A 5TJWK 1L9NA 4A6YH 3FRPA 4JM4H 1KENH 1MVFA 5E2JA 3C60D 3DROA 4IBLT 4OAWB 4X6DF 2KH2B 1A8JH 5DJ8A 4RWHA 3KDMA 2EDKA 4GBXB 2C1PA 4NO3A 2BNQA 5DR5H 2WUBL 3HCVA 3QR2A 1IC1A 2XV6B 5I74B 2FJFB 2OR9L 4HMEA 3GSNB 5MEQB 3O2WH 1TNMA 3BAEL 4P9MH 5ENWB 5GJTL 4B7IA 4A2MA 5IT2H 1FV1B 1DQDH 1FC1A 4HWZB 1BBJB 4LLMB 3P4MA 3RWEB 5IBTL 2EDWA 4CL7A 5CBAA 3U2SB 1MNUH 3KPPB 5ITBL 4UILL 1EHXA 4P2CG 1U0QA 3VCLB 4DW2H 2A38A 1B0RA 4KV5E 4KK8C 5L9DH 1Q9KA 3OAZK 4O2CA 2OJZL 1F3DJ 4GRLC 3KJ6L 4I4WB 5CAYB 2VDRH 3ZL4H 2A6JA 1DQLL 1G7JB 1U8JB 3WFBH 5T3XL 4J6RL 4LHJB 4HG4K 3RY4A 1P4BH 2CH8A 3MSPA 1D9KC 4GG8B 4NQDE 1NGZA 1ZANL 2O93L 1IC4H 4ONHB 4XBPB 4R0LC 3IU4H 3VD7A 5I1JH 5F7EH 4XBEL 5FO8B 1I9IL 4DGVH 4YJZL 4UV7L 5J13B 4PV8A 5IB2A 3SY0A 7FABL 2X4RB 1I1AA 3PABB 3O45B 4Y4KC 3HLAB 5GRVK 1P4LA 1FCGA 1JPFB 2HJFB 3OX8B 1XF5A 2H9GA 2Z92A 3OKMB 4M1DH 4HC1L 2DQHL 4BFBD 5BS0D 1CDCA 5KJRH 2D31A 1MLCB 1K3ZA 1U8LB 4M1CD 1GGCL 2X4NB 5I8KL 4YHZL 4K7PY 1S5IH 3E1F1 1X5XA 1CF8H 1WF5A 3MRFA 4KUCF 5DUBB 4J4PD 4JFQA 3WE6A 4LVEA 2YA1A 4AZ8A 2FBJL 3NPZB 1WBYA 5DO2C 1C5DB 2FH8A 2EIDA 5DMYA 4DKDC 3RIAF 5K93A 3HE6B 3ZDZE 3SJVB 4XCYB 5TGBA 3NIGE 4LPTA 2E6PA 5CSZA 5LXGL 1JVKA 5MEND 3TCLA 4LRIA 2AGJH 1SMAA 3BP4B 2BCKB 2YPLD 5F7FA 1LE9A 4G6FB 4PJDF 1CFQA 4PJIA 1EAPA 3MRQA 3DROB 3SDXB 2LU7A 5DJ8B 4MNHA 2UWEB 3IDYB 3KDMB 1RIHH 2NY2B 5IFJA 2C1PB 4NO3B 4AEIL 3I9GL 2BDNH 2DJ4A 4MQ7A 2ZKHH 2WK2A 3HCVB 3O81A 5DRNA 5E5MA 4GKSA 4PJ8D 3P9WB 4JCLA 1I7RA 1AGBA 5EUOA 3TFKC 1NFIA 4HLJA 1N6UA 1IGCH 2MPAH 1QKZH 3V8CA 1BFOA 2XRAH 1YEDA 2VN7A 3GK8H 3JWOL 3P4MB 3QXTA 1YEGL 5CBAB 2XZAL 4M4RA 5BZDB 1DUZA 3SCMC 1B0RB 4K3DL 4HH8A 1RFDH 1Q9KB 4O2CB 1HZHH 4P2RA 3ILQD 2YPVL 5D7KD 3SGKC 1CTOA 2WWKT 1MCPH 1FLTX 4QXWA 4Y4FA 3UTSE 2G9HA 5JQ6L 2A6JB 1MJ7H 1KCKA 1EPFA 4R2GC 3GSRA 3HUJE 2FX9H 5FCSH 3RWDA 6FABH 1WLHA 3O3AA 2IALA 5J12B 1YEIH 5AUMA 2NY0C 3OPZL 5EO1A 3D85A 3DMMC 1NGZB 4U7KA 2DTSA 3NCFB 4L8SC 4PV8B 2YUVA 5KSVA 1F2XK 5IB2B 3L3KA 4OF8A 4CN6A 1I1AB 4AQOA 1WAAA 3UO1H 3EDJA 1CXHA 1BBDL 3QIUD 3WIHA 3QWOB 1XF5B 4YC2C 5HYQA 2H9GB 2Z92B 1YEEH 4G80A 2RGSA 5JMOC 5E1AA 5C0RH 4KDTA 3SKNA 2GIYA 4PS4H 1GXEA 2D31B 4M7JL 4HFUL 3S7GA 4M6NL 3VH8G 5DMIL 3RVWC 5KSBA 5GISH 2BVUA 4XI5D 1OAQL 5I1IL 3MRFB 2JJWA 4JFQB 1DANU 3N85H 3CC5A 3WE6B 1O7SA 1VGEH 1NGQH 1V3KA 3DJ9A 3X3GH 1WBYB 5M95B 3GB7A 3GSOA 3DIFB 5A1AA 4HPOH 1SM3L 1FPTL 2OJEA 4F7TA 4JHWH 4KZEL 5TGBB 5CSZB 1ZKAA 1KCVH 4PRNA 1T66D 3E6HA 1BWMA 3TCLB 3S97C 4TVSa 5GHWH 1B2WH 1YQVH 2FD6H 3FAXA 1CFQB 4PJIB 4MQSB 2YZ1A 1N0LA 3SDYH 4F3FA 3BD4A 1EAPB 3MRQB 4NO5A 4XH2A 4MNHB 1RU9L 4OFIA 3P0GB 2ADGA 4NC1C 5IFJB 3H9HA 4TVPE 3KYNA 1MCOL 5F70A 3ZKND 2V5TA 5DRNB 5E5MB 4WV1A 4GKSB 1DFBH 3PQYD 4R26L 4FQ2L 4YGAB 2FGWL 5GRUH 1FZJB 5IK3A 1I7RB 1AGBB 1HOCA 5EUOB 1NFIB 2APVA 2NYYC 1FP5A 1UCTA 4Z0BL 3RP1A 1WEJL 1BFOB 5FEBA 1YEDB 5BV7C 1P9MA 4K3EL 4XMKL 4HS3B 3KPQA 5C0FA 1IC5L 1DBML 1A2YA 1DUZB 5DJ0A 4X5XA 2D7TH 3Q5TA 1TVHA 3BPOB 4P2RB 4CADA 1B88A 3MACL 1T89A 4Y4FB 1IFHH 4M62H 3E6FA 2G9HB 2ADFH 1NC2A 4FZ8H 3T2QA 2XIDA 4PLKC 5IQ7H 2ZUQB 3GSRB 4MZ3A 3QQ9D 3RWDB 3X14A 3D3VA 3O3AB 1KCRH 3VFMA 2IALB 1IGJA 5AUMB 5FKPA 5EO1B 3D85B 4WCYL 1PSKH 3O3DA 2BSTA 1BEYH 4WO4D 4PRPA 4JRWA 3JWDL 1YMMD 2VDLL 2UUDH 5KSVB 5BV7L 4P9HC 3ETBF 3L3KB 1JPST 4YDKH 4JPKL 4JN1L 4IRJA 3UTOA 4JQIL 3IAGC 4G7YL 2V5YA 5HYQB 1AKJB 4G80B 3UC0H 1NCDH 3QQ3A 4ZO8A 1CVSC 5E1AB 2D03H 4OKVB 3SKNB 3IFNL 5GS0C 4YBLC 3ARRA 4ZTPL 2SEBA 3SDCA 1MCDA 1F6LL 4ODBD 3WD5H 3WBDA 2HYMA 5KSBB 2D7QA 3BISA 3CC5B 3PHOA 5GS2D 1JNLH 1E4WH 4BSWA 4CU6A 3LQZA 3GB7B 1TZGH 3GSOB 5I8OL 3QHZL 4XHJD 2CRMA 4X6CA 4PP1C 3GRWL 4WHTA 2EZ0D 1LHZA 2OJEB 4F7TB 1Q9LA 4PP2A 4YAQA 1Z3GL 4ORGA 5CD5D 1JFQL 2C4FT 1UM4H 5HY9A 3KPTA 4L9LA 5IGXL 4IOFD 3TJHD 2ZZUT 3WYRA 1HNGA 9CGTA 4I3SH 5F44A 5DHXB 4F3FB 3CLFH 1ADQH 4NO5B 4XH2B 1MJUL 3MV11 3CH8A 5EZOH 3K3QA 4POZC 1VGKA 3IDNA 4YBQC 1ZLVH 2ADGB 4K3JH 2I60L 3QFDA 2EEBA 3H9HB 3KYNB 3QEHA 3GKWH 4PJ7E 4WV1B 1CXKA 5IK3B 1HOCB 1ZVHA 4IRZL 4PJCA 1OGTA 4AT6A 4AEEA 3O6LH 3FN3A 1LO5A 2ITDA 3O6KL 4RA3A 1I1RA 1NMBL 5DUML 1QRNA 5ADOL 1CFTA 5D71L 3S36H 3KPQB 3MJGX 5C0FB 4OZFB 3MGOA 2QSTA 3VI3F 1A2YB 3LDBB 3K7UA 5DJ0B 1I85C 1TVHB 1BD2D 2JJTA 4LARL 4CADB 4KKAD 3OGCA 3K4DA 3ZKMD 3KR3H 3N06B 4WTXA 2OP4H 3E6FB 4XZUA 5MENE 4MJIA 5AG9A 1NC2B 3VXME 2EYSA 5ACLA 3QI9C 5IB5A 3WDIA 1BECA 2NZ9C 2YPLE 4YEEA 5MERA 3X14B 4GXVL 3D3VB 4XVJL 1TLKA 1ZLWH 4Q9BA 1CDYA 3VFMB 1IGJB 5FKPB 4MMZC 5D1QA 5JHDD 3O3DB 3RX7A 2BSTB 4ETYA 4PRPB 3PHQA 3CZFA 3CLEL 5JOFA 5HDQL 4YK4C 3O6MH 1Z9LA 3HC3L 1KJ2A 1MSPA 4FRWA 1G84A 4HZLA 4IRJB 4KK5C 3D9AL 4FMKA 4Q7DA 4JB9L 2FIKA 3LQAH 3QQ3B 4LCWD 5GRJH 4WWKD 3TEUA 1TJGL 2H32A 4PJIF 1F97A 1DBJL 2SEBB 3SDCB 2W0FA 1MREL 1K8IA 5INCA 3D87B 1FVCA 5D7KE 4PG2A 2VQTA 1QSVA 3PHOB 1W72L 2CO7B 3I3BA 4UT7L 4BSWB 1YN7A 3MC0A 1YEHL 3LQZB 3KLAA 1MRCL 2P5EA 5EUOF 4NYLA 4X6CB 3RPIA 4WHTB 1Q9LB 1A5FL 4PP2B 2VB5A 3NCMA 4YAQB 3WIIH 2VLKA 3QP3A 2BSRA 1BHGA 2J88H 4ORGB 4AIOA 1I1YA 1RUML 2ARJA 3V8OA 1OTTC 4JFPA 4LDLB 1AR2A 5HY9B 3VD3A 3I85A 4L9LB 1NCAH 2VZ3A 4PTTA 4JHBA 3WUZA 2WQ8A 1HYRC 4TPRH 2IG2H 1YJDC 1L7IL 1OPGH 3FB5A 1VGKB 3IDNB 3UTZA 4X80L 3TO2A 3G6AB 3AMLA 3QFDB 1U9KA 3SDDD 1U91B 4DGYH 3IXTA 5KS9E 5ANME 4YHML 2EIBA 3PIQA 4PB9L 4PJCB 2FEDC 2HTKD 1OGTB 4AT6B 4WUUD 1IEAA 4D9RD 3AFLA 3HFMH 3LHPL 1LO5B 2ITDB 1QRNB 2CGRH 3CFCH 1CFTB 3KJ4B 4TQEH 2DICA 3MGOB 5L8JB 5E7FA 1WAAF 2J8UA 1ZA6A 5D2NC 4L3EE 1B9ZA 1U6AL 1LK3L 1CD1A 3VD9A 1YJDL 1V05A 5EULV 3OF6D 3ZKXB 1E6OH 4XZUB 3EW3B 1PY4A 4LDEB 4MJIB 4NQTA 2EYSB 4Z7UA 5IB5B 3L5JA 3V7MA 3OG4B 5MERB 2NXYC 2WP3T 1CS6A 1I7UA 1NCCL 4QXUL 5KSBF 3MUGA 4NZTL 5DK0A 2AJSH 4UIKL 3TA3B 5CP3A 4IMKC 5D1QB 3FZUC 3PWUA 3CMGA 3CZFB 3VWJD 5JOFB 4NC2B 2ZWLT 3H9SA 4NBYB 5T33H 1KJ2B 1UWGH 4KGJA 3UTQA 1CGYA 4DCQA 3P0VL 2DMCA 4OZIE 2ZUYA 2FIKB 4DN3H 5I1EL 4RX4D 4RGOH 3ARFA 3C5ZA 5I9QC 2Y07L 5C0DB 3EO0A 1V5JA 1TPXB 5L8LB 5E8EA 1NUNB 5TQ0L 2W0FB 1UA6L 4ZOEA 3ARGC 2VZUA 3NTCL 4U1GC 3J8F7 5INCB 1FVCB 4UT6L 1VHPA 5D1XC 1CZ8H 1N0XL 2VITA 4HBQA 1YN7B 1GIGL 4LVOC 3KLAB 4MJ6A 2P5EB 4NYLB 3RPIB 3L7EA 1KSRA 1OARH 2ATKA 3R8BB 2VLKB 4LSTH 2BSRB 2PYFB 1YN6A 2X1WL 4TTGA 2CKBA 1I1YB 3HTLX 4KK6D 3EOBA 2ARJB 2B4CL 3CIQA 4M6AA 4JFPB 4H1LA 1AIFA 1EUTA 1YMME 3H7BA 4PTTB 4XPHH 1UKQA 4NJ9H 5IFHH 5DRXA 5F9OL 3FB5B 3F12A 5F3HA 3UTZB 3NMEA 3TO2B 5LWYH 5CFHA 5FYJH 3NFPA 2C4XA 4HQQL 4WTWA 2DQEH 1INDL 3MBXL 4H5SA 4Y16D 3IXTB 4ZS7L 1KUMA 5L7XL 1YYML 3GSWA 1CBVH 4GMSH 3PIQB 2NY4C 1IEAB 5FGCB 2V2XA 2MCG1 5E8DL 1HCFX 3UJIL 4P0DA 4C58B 1HSBA 4XT1C 3MRPA 3QUXD 2FJHA 5F1NB 2R2BA 3MRCA 2J8UB 2WUBH 3LS5L 1ZA6B 1F8TL 1GGUA 2OR9H 4RMVA 1CD1B 1D7FA 1CQKA 3EDDA 4B53A 5GJTH 4JE4B 4Y1AA 3SQBA 4NN5B 4Z7UB 4LGSB 3R0NA 3AVEA 1T80A 2XI9A 5HDOA 3HPJA 4N8PA 5DJAA 1I7UB 1CFBA 1JWMA 3FT3B 5ELIA 1R6VA 3MUGB 3GFUA 5DK0B 2IFFL 1QPXA 1RI8A 5ESVA 1GGYA 1HWGB 5IWLC 3KJ6H 4X7EC 3RHWK 3H9SB 4X6CF 2BXZA 2VISA 1BQUA 1DQLH 4FS0A 5T3XH 5DQDL 3UTQB 4DCQB 4OB5L 4HUXA 4KK8D 1XGUA 2W59A 4U6HA 4HJJH 4GRLD 1A3QA 3EO0B 5ESAA 3HG1A 1CFVL 5JNYA 1QNZL 3MV8A 1ZANH 4M6ML 5AWNL 3NPSB 1BWWA 4XBEH 1I9IH 2B39A 1VB9A 2CIKA 7FABH 2Q1EA 5AZEL 1DTUA 1PBYA 3BH8A 3F7RA 4FTVD 4PRID 2VITB 5TH2A 1D9KD 4TSAL 5FM5O 3FB7A 3CVHL 4MJ6B 4IHOB 3BQUC 4HC1H 5EH1A 3NCEB 4PJCF 3L7EB 4MSWA 4K8RD 4OZHE 3ZSTA 2ATKB 3RIFK 1GGCH 1YN6B 1UJ3A 2CKBB 4YHZH 4QNPF 3BI9X 1N64H 3EOBB 4YPGB 5JHDE 4H1LB 3BKML 1AIFB 1FRGL 3O0RL 1FBIL 3T0AA 3H7BB 25C8L 1I8IA 4FQCL 1QEWA 2ID5A 2GQHA 4NKIL 5I8EB 1NPUA 1KGCD 3F12B 1W8OA 2EYTA 1KYOK 5F3HB 1UC6A 1IGMH 3NFPB 1G9EA 2XY1A 4U0RB 4H5SB 2VMFA 1YEFL 4AY0A 1RHFA 5T1MA 3MRKA 5GGUA 2XTJB 3VMNA 5HVFB 1P5VA 1JZ4A 4LSPH 2V2XB 5IBUB 1T4KA 1H8NA 2WIIA 4H26A 1HSBB 5J1SC 3MRPB 3FFDA 2FJHB 1NCBL 2AKRA 4LP4A 2R2BB 3CAFA 1FL3A 1L6XA 3I9GH 3MRCB 2FX7H 5J1TC 5DF0A 3FHAA 1BJ8A 5IROC 5DLML 3LKRA 5SX4H 1UKTA 1SBBA 2C3XA 1PZ5A 2DI7A 1GVIA 3AY4C 3PWVA 4Y1AB 5A2JH 3BJ91 5GS1C 3MYZA 5J9PB 1PKQE 1SBSL 3JWOH 4LVHB 3U1SL 1U36A 1M1SA 4PJ7A 1YEGH 3HPJB 5BS0A 5DJAB 3CFDA 4U0QB 1LO0H 4JR9L 1JWMB 5K9OB 4JFDD 1N6QL 3M8OL 2RAMA 4YFLF 3TFKD 5ESVB 2I07A 5HPOA 1XH3A 2IQAA 2YPVH 4J4PA 1H0DB 2PETA 2DM2A 2DD8L 2VISB 3SCMD 4HUXB 4WUUE 2O5ZL 3NABL 4D9RE 3TVMD 1I9RL 1XGUB 1FORL 2BRRL 4U6HB 2DQCL 3OPZH 4HGKC 5ESAB 1C5CL 3HG1B 3T2NL 1WZ1L 4P3WA 3MV8B 3VXNA 1BPVA 1KLUA 4BSJA 4R2GD 1BVLA 2CIKB 4N0YL 4AYFA 4F57H 5KOMC 2R29L 4NQCD 4KJWC 2EIEA 3BH8B 2NY0D 5TH2B 4WFFD 3DMMD 1DQTA 1OAUL 1BBDH 3FB7B 2GI7A 2PCPA 4IM8A 1U3HC 5GGVL 5JOEA 2ZUSA 1QSEA 1T22A 3QAZB 2EYRA 3CDCA 5CGYC 1NBYA 1IM9A 2VDPL 2VDNL 4MSWB 2BX5A 3ZDZF 4PJ8A 3MFFA 4M7JH 4LAQH 5FAAA 4MXQC 4NFCA 4M6NH 1UJ3B 4ODHH 4G8GE 4N1CA 4PJBA 5DMIH 2PR4L 4R4NC 5E94A 4J3XA 1OAQH 5I1IH 3HNSL 3MV7A 1OWRM 1I8IB 3SGDI 2J8UF 1JZ3A 1FIEA 2DIAA 1J10A 2MMXA 4LIQL 2EYTB 1XR9A 3RVWD 1CVRA 1SM3H 1FPTH 4X5WA 4Z7UF 4KZEH 4XXDA 3ZE1E 1JI2A 3Q6GL 3DHJA 5T1MB 3MRKB 5GGUB 4HX1B 4KRPB 2VXSL 3JSSA 4V2CB 2AK4A 3ZSSA 1T4KB 2J5LB 4LSUL 2WIIB 4H26B 4BFGA 4OI7A 2HN7A 1DUYA 1T7VA 3FFDB 4RMWA 2AKRB 4QRQA 1SY6L 4W70A 5JR1L 4O02L 3SO5A 1MCOH 3THML 2D0FA 3VGAC 1G9MC 2HFEA 3RUGA 4FQ2H 2FGWH 3LKRB 1OTSC 1PZ5B 2ZUVA 3PWVB 5EC2A 3ZDXE 5IMLA 4Z0BH 1TQBB 1WEJH 3H0TA 5BS0B 2F53A 3CFDB 1T0NA 4XMKH 2DRUA 4PJGE 3TJEH 1IC5H 43CAA 5HHMB 1P1ZA 1DBMH 2YXFA 2PXYA 1CGVA 3QFJD 2OBGA 2NYYD 4E42A 2I07B 2CK2A 3TO4D 4BH7A 1IAIL 3GBNH 1I1CA 4F9LA 4ZO7A 1OB1A 1YY8A 3MACH 4DEPB 1L0XA 4LP5A 1UADC 3T0XA 3ARYA 1U2CA 2RHEA 4DK3A 2VJXA 1I3UA 4I18C 5GGQL 4WCYH 5IJVB 4FQXC 3VXNB 1CICB 3P3YA 1KLUB 4PLKD 1WFTA 2VDLH 1BVLB 1I7ZA 5BV7H 3TZVA 3QXUA 4JPKH 4JN1H 2YZ8A 1F4HA 4LCCC 1JGVL 2VNCA 4JQIH 4G7YH 4XWOC 1QRKA 4MXVE 2PCPB 4JFEA 1QSEB 1T22B 2EYRB 4JPWH 5TFSL 3ZT6A 1NBYB 1KTKE 1IM9B 2EECA 4GW1A 2FHCA 3PQYA 2EC9T 4PJ8B 3MFFB 2A73A 3IFNH 3LEVH 4ZTPH 2NY6C 4XCEA 4PJBB 1LQSR 4YE4H 3E2HB 4H25B 4WI5A 5E94B 1T5XA 2W0PA 3D2UD 5MI0B 3MV7B 4PRDA 3WUWG 2YSSA 4QTIL 5HYJD 2PYED 4OFYA 5GS0D 1J1XL 2P5WE 3QHZH 4BQ6A 4XNQA 1XR9B 3GRWH 4Z7VA 4Z7QF 1RMFL 4X5WB 1Z3GH 4XXDB 5HTSA 2NQCA 4RWYL 1AI1L 5D4QA 1MCCA 5IGXH 4CVUA 3N0PB 4PP1D 2BFVL 2AK4B 5HHOE 1MJUH 3QIWD 4FTVE 3AB0C 4PRIE 1EVUA 2HN7B 5I1HL 1DUYB 2I60H 2CD0A 4EI6A 3ZTNH 3EO9L 1YMMA 3BE1L 2DM4A 4EUPB 4M8QA 4K55A 4B5EA 2HFEB 3BN3B 1RK0A 3RUGB 1O7VA 3V2AR 1LO4L 2Z35A 5IEKA 1UH2A 1RULL 4IRZH 2OXGA 4POZD 1QFWL 1ORQA 4YBQD 4UAOC 5EC2B 5IMLB 2B5IB 4LLWA 4FNLL 4P23A 3O6KH 1A6UL 4YXHH 1G7LA 5DUMH 2F53B 5ADOH 1T0NB 5D71H 43CAB 2R2HA 1S9WB 1FNEA 1LWRA 3SOBL 1KGCE 2PXYB 4L4VD 4E42B 4BH7B 4FFZH 4LARH 1G7QA 1YY8B 3L3OA 2QBWA 4NKMA 3V0VA 1X4YA 3SKJH 4ZG1A 1NFKA 2R0LL 1IEBA 1DZBA 3CUPA 5D7SL 4N0RA 5DEGA 4D0DA 4GRWH 1MI5D 4LSDA 2HFGL 3VXUD 2YD7A 4NUJB 3P0YH 1MELA 1NEUA 3QI9D 3S36X 3CLEH 4XPFH 5I15L 5HDQH 4RQQA 1I7ZB 1NAML 2NZ9D 4XVSL 1QFHA 3TZVB 3FQWA 4MHHI 3HC3H 4G43A 3Q2CA 3DX7A 3HNTH 4P2YA 1I9JL 3D9AH 4RMRA 4NGHL 3M1BA 4JB9H 4JFEB 1UYWH 2CUMA 4QO1A 2WIMA 4GW1B 3PQYB 3EYSL 4X6FA 4JFDE 1BP3B 2A73B 1DBJH 1X6LA 4XCEB 1MREH 4KK5D 4M4PA 5CZKA 4B0MM 1T5XB 2C4FU 3ROOA 4PRDB 4HAFA 1OGAA 2G5BA 2HFTA 4I9WD 1BOGA 2YSSB 4UT7H 2DLEA 1YEHH 3N1PC 4PJ5D 1MRCH 2XKUA 5A2IH 1BD2A 1MY7A 4Z7VB 5C6WH 1DDHA 3CDYA 4M8VA 2GCYA 2XZZA 4PJ7F 1IKNA 1RUMH 5TE6L 3BZFA 1OP3H 2DDQL 4MDJA 2VOTA 2VH5L 4JLRA 4OZHA 1CFNA 2WWKO 4K2UL 1L7IH 2AP2A 5LVEA 4WFFE 4X80H 1OTTD 4EI6B 5C0IA 5CLTA 1PG7H 3O11A 4FP8H 4M8QB 2FEEL 4PGEA 2J4WL 1B0GA 2QADB 1T7WA 1RK0B 4YHMH 4K23L 2ED8A 2Z35B 5KVDL 5IEKB 4HKBA 4PB9H 5AYUL 2JELL 1ORQB 5I0DA 4RA0C 3SN6N 3LHPH 4LLWB 1DBKL 4ZUUA 4LCWA 4P23B 1XF4A 1BQHA 1G7LB 3P77A 3W39A 4N68A 5JA8B 1UCBL 2R2HB 1FNEB 5C08A 3VFGL 1AGDA 4EBQH 4WJ5A 7CGTA 2G2RB 2FEDD 2NZIA 4WENB 5D2LE 5C0GA 5GXBB 3LPGA 4F58L 4WUKL 1U6AH 1G7QB 1LK3H 1YJDH 3L3OB 1XIWC 3DYOA 4NKMB 3X3FH 3V0VB 3SGJC 4XC3H 3TN0A 5LBSL 3NOIA 1D5BA 1IC7H 2ZG3A 1ZA3A 2ZCLL 3IFLL 5DEZA 1IEBB 4LDOB 3CUPB 4PJBF 4X6BA 1A1MB 1NCCH 5D96B 4J2XA 2MTPA 4QXUH 3OBAA 5DEGB 5E03A 1RZFL 4D0DB 2UY6A 4NZTH 1G0XA 3EDKA 1G6RL 3SO3B 5E9DA 2ZCHL 4RQQB 3FQWB 1U8PA 2HT3C 4G43B 3DX7B 3H42L 3OZ9H 5C6TL 3AROA 3P0VH 3M1BB 3UJTH 3SDDA 1EGJL 4NC1E 5I1EH 1TTUA 2BERA 3FZUD 1H3WM 4QHNA 2YBRA 1X9QA 3MGAA 5F96L 3ECBA 2ERJC 5TQ0H 1K6QL 2I9LA 2GT9B 3BP7A 4OCWL 3QFJE 4ODSL 2X4UA 5I1CL 5DJDA 2CSPA 4OF3A 4UT6H 2NW2A 1N0XH 3ROOB 3R4DA 5HD8C 4RFOH 1AQDA 1OGAB 2G5BB 4YZFE 1BOGB 5DSCA 4BK4A 1ZGLM 2ATPA 1GIGH 1L0YA 3SDAA 3RUGF 4P4KC 2AV1A 5KAQG 2APBA 1DLHB 4C56D 1BD2B 2NMSA 3ARGD 4JZJC 1FNSL 1DDHB 4GW5B 5JHLL 1EK3A 1F2QA 4XX1E 5D1XD 1AH1A 1T04A 5LGHL 1IAKA 2NXZB 3EIFA 2WBKA 3BUTA 5GRXG 3BZFB 4E41D 4MDJB 1J05A 4ELKA 2ZNXA 1WICA 5DJXA 4JLRB 1CFNB 4XP4L 1U8OA 5CUSL 3DV6A 5F9OH 3AREC 1EFXA 5CLWA 3NFSH 2O61B 3DGCR 5C0IB 1A7PL 3O11B 4HQQH 2YRLA 4PGEB 1B0GB 1INDH 3MBXH 5DC9B 3L7FA 3UTTB 4ZS7H 5L7XH 4Z18A 4D2NA 1YYMH 1GSMA 3MFGB 4HKBB 3KPLA 2NW3B 2HMIC 3JVGC 2QQKL 4ZMAT 1FFOA 3MA9L 2VXUH 3CZJA 4DJMA 3CDGB 4LCWB 5E8DH 2VR4A 4L3CA 1UH4A 3L5HA 3P77B 3W39B 4AEFA 5I75C 5HYJE 2PYEE 5C08B 3UMTA 2IFGA 1AGDB 5GZOC 4WJ5B 4GS7B 3LS5H 4UINL 3QIBC 5F7YC 1F8TH 4OTXL 4HF5L 1MQKL 3VDCA 1FQ9C 3DYMA 4BQBA 2IF7A 2NY3C 5BJTA 3TN0B 1PEWA 4L3AA 3RKDC 1D5BB 4JKPL 1ZA3B 5C9KA 4MMXC 4X6BB 1MCQA 2QSCL 5T5FL 2YPKA 1IAOA 5FCUL 1T1XA 1J1PL 4HPYH 4YDVA 4HUKB 5E9DB 4JFHD 3L3DA 1U8NA 1U8PB 2XN9E 4PJGA 5IB3A 4Z7VF 4LQ1A 3RU8L 4OB5H 1KTRL 3SDDB 2YRZA 4QHNB 2YBRB 1BOYA 1JYWA 1CFVH 4GO6B 2B2XL 1MHHA 3ECBB 4GRWE 5AWNH 2E7LA 2I9LB 5FYJU 1T2QL 4RCAA 5TE4L 3BP7B 5F3BA 2CLVA 1MAKA 2X4UB 4L4VE 5DJDB 4CBPA 4P2OC 4AIXA 4BH8A 3LRHA 4QT5A 2N4IA 5DSCB 4TSAH 2ATPB 3SDAB 3FB6A 3CVHH 1NFDE 2H45A 5C0AD 2AV1B 1K85A 1IKFL 1FFNB 1XCTA 2Q3AA 1KPUA 3HC4L 4DKEH 2FECI 5DXWA 3OXSB 4DFIA 1MI5E 1T04B 1IAKB 3ARTA 3U30C 1ZLUK 3VFRA 1AO7A 3LS4H 3VXUE 2XQBH 3BKMH 3O0RH 4HIHA 1J05B 25C8H 3BQUD 4FQCH 4AQ1B 3O2VL 4TULL 5DJXB 1U8OB 1RY7B 4NKIH 3DV6B 1K8DA 1EFXB 1K4DB 4EDXA 5ACMA 2XOTA 1MFBL 3GM8A 1UGNA 2X5PA 3L7FB 1YEFH 2E9BA 4MAUL 4QY8A 4WU5A 4LAJH 3IRZA 3KPLB 4KY1L 4R9HA 5HBBA 1FFOB 4HC1A 4N1HB 4RGNB 4L3CB 5SWSA 1T1ZA 1PLGL 4W68A 4I9WE 1I75A 3BEVA 3VXSD 1LNUA 1NCBH 4QYOA 4WFED 4HT1L 4JG1L 3V95A 4PJ5E 3FOLA 1KEGL 3LSOA 3GNML 4L1HA 4CUCA 1IZKA 4YDJA 1Y18A 1II4E 4DK6A 2R39A 3ZE2F 4TRPH 2HT4C 3TWCL 4OLXL 5F9WB 5BJTB 2C3VA 3SE9H 3E8UL 2Y06L 3UDWC 3MLVL 3U1SH 4P5KA 4QHKI 3BO8A 2MNUA 3FL7A 2YPKB 3IDJA 1N6QH 3M8OH 1T1XB 2EXWC 4D9QD 4Y4KA 5J4MA 4MCZA 1T7YA 1QD0A 2PW1A 1X5KA 2AEWA 3HAEG 4MD4A 4YDVB 2VZOA 4ODUA 3L3DB 4DVRL 1U8NB 1KPRB 2YXMA 1T83A 4OCSL 5IB3B 1C16A 4KTDL 3TESA 4CN4A 12E8H 2F54D 5EPMA 4F9PC 2O5ZH 3NABH 2HLFC 2HH0L 1I9RH 1H15A 2BRRH 1FORH 1XGQA 1CXFA 1IGIL 4I0PA 2DQCH 4Y5VC 3BGAA 1C5CH 3T2NH 1WZ1H 1UZ6E 4OZHF 1MHHB 5EORL 3IDXH 4N8VG 4X99A 3PF2A 5F3BB 2CLVB 4R97B 1EH9A 4N0YH 3RWJA 3KLHD 1CDIA 4OUOA 3OKNA 4Y19E 2XA3A 3AUVA 5EA0L 3B43A 4QT5B 1OAUH 5GGVH 1INQA 3FB6B 4WFHE 5FK9A 5EG6C 1G9NC 3GIVA 4KKLC 3ARDD 1KPUB 5D2NE 3RX8A 1DR9A 3HMWL 2ZPKL 2MHAA 4KJWD 4B50A 4UIMA 1AO7B 2PR4H 2Z8RA 3VFRB 4OZFG 1U3HD 4HIHB 4V1DA 3HNSH 3QDMA 5CGYD 4HGMA 4ESKA 2Y5EA 5ICXA 1QFWI 1LO3L 4F15C 3LH2L 3V4VL 2VR5A 1K8DB 4LIQH 4MXQD 3EHBC 2YD8A 2K1MA 4EDXB 4R4ND 2DL9A 2EKJA 2YD4A 1S7UA 2CDFA 5JW4M 2WP3O 4IJ3C 3Q6GH 3VW3L 1CE1L 4MXWH 4QY8B 1ZT1A 4WU5B 1RZ7L 1HSAA 3SCMA 2PNDA 2VXSH 1G9NL 3JZ7A 5C2BL 4BKLA 5SWSB 1QHPA 1T1ZB 2GJZA 4G7VL 4LSUH 1MRDL 2CJUL 2ENYA 2XT1B 3PDOA 3BEVB 1LNUB 3X11A 3WLBA 3IDMA 5JR1H 4O02H 1UACH 3FOLB 3LSOB 3THMH 4C56E 4EIGB 4YDJB 5CS7A 2AJUL 3TGXA 1SEQL 4NQCA 4HWBH 1E4XL 1U93A 4U1NA 4G6JL 4GMTH 3DMMA 2VSCA 5B3JF 2C3VB 1GH7A 3QUMH 4E41E 1RJLA 5GSRA 2VC2L 4ZFFA 4P5KB 3BO8B 5JIPA 4XVUC 1A7RH 5EU7E 3MNZA 3IDJB 3S5LA 1P7QD 3P40A 2YRPA 4Y4KB 1OTSD 1JF5A 4MCZB 3OAZH 4P2QA 2PW1B 5EZJA 4MD4B 4NZRH 1F6FB 1IAIH 4KJPC 2XPGA 1B3JA 4ODUB 3T3PF 1Z9OA 4YHPA 4E5XA 1C16B 5E00A 4RIRA 5ITFA 4S10A 1S9VA 5EPMB 5EOTA 1G9MH 4KH2A 1H15B 1XGQB 4I0PB 2WLYA 3C09C 4L4TD 5GGQH 2O5XL 4OT1H 2AQ3A 2UVFA 3DVIA 4X99B 4K07A 2I5YH 5C07E 4NO0D 2VZVA 2ICWJ 2OTUA 3RWJB 4QWWC 3OKNB 4BQ9A 3V4UL 3OB0H 3PL6A 4JQXC 4FQXD 1INQB 3GMRA 2DLGA 2OMNA 2R0WL 1CDJA 5FK9B 1MCEA 3GIVB 2Z31D 1JNHA 2QL1A 4JAMA 2ORBL 2MHAB 2WBWB 1WITA 4UIMB 2FEEI 4LSRL 2JIXD 1FZMA 2ZOLA 3EGSB 3EFDL 3LRSA 4V1DB 3QDMB 4LPCA 2DQTL 5IVXE 3VG0L 4KHXH 1CGTA 4NZDA 5ICXB 4PGCA 3MLPA 3OKDA 1IMHC 1OOAA 5DGRA 1J1XH 4M93C 2Y7QA 3OKLA 1Q9OB 2NY6D 3QFJA 2L4OA 3FO1A 1MCFA 1RMFH 3BPNC 1RIVL 1S7UB 5BW7C 2DM7A 4G9DA 4KROC 4OCXL 4K7PL 4RWYH 2QR0B 5J1AA 1AI1H 5IR1A 2V2TA 2ADIA 1T6WA 2OXHA 5DMGC 5C0EA 1HSAB 3SCMB 1GC1C 2PF6A 2BFVH 5FYKL 2X09A 4BKLB 1F45A 1FNHA 2GJZB 3W2DL 4YWGH 4OF5A 1ZT4A 4PYGA 1CD8A 3PDOB 3Q1SL 5I1HH 3UTPD 4PJGF 4OD3L 3X11B 3IDMB 4PGDA 3EO9H 3BE1H 3NN8A 5C0AE 1MOEA 1LDPL 2F8OA 4KKCC 4NQCB 1LO4H 3FTGB 1PJ9A 1U93B 4U1NB 2ICWI 2V9TA 3DMMB 4ZTOH 5BMFL 1RJLB 3HKFA 5GRZA 3QEUA 5GSRB 3RZCA 1A6UH 1QACA 4ZFFB 5DZOA 5CEYA 3GRWA 1KTLA 3IU3A 3MNZB 1NEZA 3S5LB 1F13A 2MKWA 1PZUB 3SOBH 1KN2L 4P2QB 4JKLA 1GC1L 4XGZA 5EU6D 5EZJB 5E24E 5IW6A 4NN6C 3WKML 2XPGB 3SKMA 5L2KD 4YHPB 2A83A 1KF9B 1P6FA 3QUKA 4E5XB 5E00B 3B9DA 4RIRB 5ITFB 4KC3B 4NHCL 2R0LH 2IAMC 1D5XA 1JGDA 4LGRB 5EOTB 4HGWA 3U46A 3K74B 5DJYA 2OS7A 1RHHA 3DETC 1N8ZA 1H3TA 2HFGH 3VXSE 4WFEE 4JFZL 2EC9U 3HR6A 5I15H 3QXWA 1NAMH 1A22B 2P8MA 1M71A 1YDPA 1RJYA 2OTUB 1SJHA 3BFOA 4LHUD 1TDQA 2JF1A 4NQXA 5I8CA 4R4FL 2KPNA 1I9JH 3PL6B 3MRNB 4NGHH 4OZGA 5DD1L 3GMRB 2OK0H 4BQ8A 1NLBL 4WHDA 1NMCB 5ICZB 3TP4A 4JREC 1HCVA 1ONQA 2HTLC 3EYSH 4Y2DD 2FATH 3CSYA 3QCUL 4JAMB 4NKQB 4IRSC 3W0WA 4D9QE 5I71B 5IVNA 2N7BA 3L3HA 4C54A 1RIUH 1WBXA 3LRSB 5C1MB 1JHLL 5JPMA 5HPMA 4R7DB 4HK0A 3IGAA 2XWJA 1JHTB 4PGCB 4I77L 3AM8C 2Y7QB 2VDOL 3QFJB 2F54E 4OCYH 4NNYA 4XXCC 4QOKD 2IMMA 1XR8A 5BV7B 2QHRH 4G9DB 4D8PA 2I27N 4K94C 4GUPA 5J1AB 4G8FA 5IR1B 4NZUH 4ODTL 2V2TB 2ADIB 2BP3A 2DDQH 1S7RA 5C0EB 1GJIA 5EIQA 3ES6B 3UYPA 3MRJA 4K2UH 1NKOA 1HINL 2J6EL 1ZT4B 5DFWH 4NDMA 3O8XC 3RY6C 4PGDB 3DVNA 3QXAA 1Z9MA 1H8SA 1OQOA 4LKXA 5L88L 3GMPA 2J4WH 1IQDA 3DSFL 4K23H 5KVDH 1YY9D 3WXVL 1A64A 4PRHD 4YX2L 5AYUH 4RSVA 2JELH 1T03H 3O6FC 2WM0A 2AS5M 2VXQL 3QEUB 1DBKH 3RZCB 3NA9L 1MCIA 5CEYB 1KTLB 4K94L 4FABL 2CRZA 1UCBH 3IU3B 1NEZB 5H94A 3VFGH 4PJAA 4P5TC 1WC7A 5K59E 3A67L 1ETZA 2YUXA 3GHBL 1AC0A 3WFDL 1MFAH 1PYWA 3BKCL 4XGZB 5IW6B 5GIRA 4WUKH 4F58H 5DK2A 3SKMB 2A83B 3B9KA 4I2XA 4J3TA 3MLWL 1PG7X 3QUKB 3MUZ1 4X9BA 2FO4A 5LBSH 1D5XB 2XA8L 2ZCLH 3IFLH 1JGDB 5HYFA 1T2XA 3U46B 5DJYB 1RZFH 1RHHB 4PJFE 4PY7B 1UG9A 1YPZE 1N8ZB 1XIWD 1G6RH 2CR6A 3DO7A 1BVKA 5JDSA 2ZCHH 4JGJA 3K81A 1EBAA 2DMKA 2P8MB 1M71B 1YDPB 3QRFM 2EKSA 1RJYB 1SJHB 4KRMB 3C2AL 4NQXB 5I8CB 3H42H 4WI9A 5C6TH 1IEHA 4OZGB 5EC1A 1EGJH 2ICES 4N0FA 3RZWA 5BQ7A 2X70A 1ONQB 2RR3A 2OR8A 2HT3D 4JO3L 3CSYB 2ZJSH 3I50L 5F96H 4X83A 3W0WB 1K6QH 4RDQF 3K1KC 4JRXA 4APQC 3CXHJ 4ODSH 5DT1L 1KG0A 5I1CH 1WBXB 4PV9A 5KW9L 5JPMB 5HPMB 4WGWB 2ARWA 4PJ9C 2QKIB 4HK0B 3IGAB 2XWJB 3HE7C 2VTFA 1KCUL 2LV4A 2WWMC 4HCRL 1A4JA 4QHLA 3VGBA 4NNYB 2EEDA 3V6OE 5JHLH 4GAFB 5FDYA 1XR8B 4L4TE 4ETQA 1FYHB 5HD8D 5LGHH 4GUPB 5KTEL 4G8FB 5DURB 3DSNA 3PV6A 5IMMA 1S7RB 4P4KD 4ZSOA 5CINL 2W91A 5EZLB 5I1GL 5D2NA 4XP4H 4ODWA 3MRJB 1N26A 3QEQD 5IF0A 4NDMB 3T0WA 5A43C 4NNXA 3DVNB 3QXAB 5AD0A 4LKXB 3GMPB 2PW2A 3KS0J 4XCNA 4JY6A 5DHYB 1IQDB 5K9QG 1FNAA 3CJJA 2V7NA 1W72B 4OJFL 3ARED 4IMKA 3NIDF 2QQKH 4XB8A 4YQXL 4YK4B 3VXOA 1AHWC 4Y4HC 3QDJE 5H94B 3PDDA 4PJAB 1WC7B 1ETZB 4UINH 2HMID 1PYWB 8CGTA 4OTXH 3EFFA 1EO5A 4HF5H 1OW0C 5GIRB 4QHUA 1MQKH 3QQ4A 3MLYL 5DK2B 5IV2A 3VU2A 3B9KB 2KUTA 4I2XB 4HXBL 4NO2A 5D1ZC 1TJIH 2FO4B 5CKGA 4ZOCA 5GZOD 4QHMA 4TVPL 4UOW0 3QIBD 3RVTC 3L5XL 3C6LC 2QSCH 5T5FH 5D1XA 2F5AH 1J1PH 2E7BA 3V4PL 2NY3D 4N0UA 1EO7A 3UTPE 3DO7B 1BVKB 5ADPL 4DQOL 5JDSB 2ITCA 1A6VH 2JLLA 5MEOA 4LPXA 3FQRA 2EKSB 4A6YL 1KENL 1A47A 4HD9A 4NQED 1AE6L 2Z8VC 3RU8H 1C08A 5EC1B 4N0FB 5BQ7B 2X70B 3EYVA 4RRPG 3VA2C 2X41A 2D2OA 2B2XH 2EE6A 3MBEC 3TBYA 4F7CA 5CP7A 1T2QH 3KPOA 5TE4H 4JRXB 4P9ML 1KG0B 5EU6E 3ULVC 4PV9B 1GAFL 5D7IA 1DQDL 5L2KE 5DVLA 3VI4F 3D25A 1NCNA 5FKAB 3U0WH 3LV3A 1MNUL 2X7LA 2F58L 3C6SB 3JTTB 1A4JB 1Z9SA 4QHLB 1YEKL 4DVBB 1IKFH 1JCKA 5L9DL 2YK1L 3U7YL 3OAUL 4HKZA 3TT3L 5B8CC 1SYSA 2VKWA 4ETQB 3RTQC 1NSNL 4Z5RA 2VDRL 3C8KA 5IMMB 5CJ8A 1HHKB 4N5EC 4ZSOB 3RDTC 1E4XI 3O2VH 4TULH 1QO3A 1KB9K 4ODWB 5FM5M 2J7LA 5IF0B 2WSKA 4JY5L 3ARVA 4NNXB 3BZ4A 4MNQD 3FFCD 1IC4L 5AD0B 3IU4L 4YR6B 2NXYB 4DGVL 2GJ6D 2PW2B 4XCNB 4JY6B 3BRGC 1RJZA 4F7MA 2V7NB 4L5FL 4G6KL 4O58H 2GTZB 4WWID 1GGTA 1I8LC 1LD9A 2BHZA 1DEDA 3CVHA 3G5ZA 4J1UA 3KAAA 1EX0A 3A6BL 1PLGH 4FQIL 3BN9C 3VXOB 5ABDE 4LCIL 4HT1H 1JZ6A 2EIZB 4S1DC 4JG1H 4W6XB 4XNXL 1KEGH 3GNMH 3AGVA 3ROLA 1SJEA 4P3DA 3EFFB 4OZGF 4QHUB 3QQ4B 1S5IL 5IV2B 3PWPD 5I9QB 3TWCH 4OLXH 4MNGB 2VXVL 1AGEA 4KTYA 4NO2B 3OV6A 3E8UH 2Y06H 5DYOA 3MLVH 5F7HA 4QHMB 5BVPL 1FNFA 3IETA 4P4RA 5DA0B 3RGVC 1W8NA 4U1GB 2EDDA 3K2MC 1UZ8A 5D1XB 2HT4D 4N0UB 1UXWA 2BXYA 4YXLL 4GRWF 4EXPX 1XMWA 2ITCB 5EOCL 5MEOB 4DVRH 4F7EA 3FQRB 5DD5L 4OCSH 4KTDH 4QTHA 2NY5C 3KVQA 2EXWD 4KQ4L 4UOJA 3C08L 3LD8B 4XNZC 1C08B 2HH0H 4EI5C 2RQ8A 4OF0A 1IGIH 1LVEA 3EYVB 4S0TD 4DKFL 1AGFA 2OCFD 5EORH 4M6OL 3TBYB 35C8H 5CP7B 4ZXBC 3KPOB 4O5LL 5FUZH 4Z95L 2GEEA 1HHIB 1MFEL 4Y5YC 2HLFD 1IGCL 4EUPG 5D7IB 5HVHB 3KG5A 5EA0H 1P7KA 3D25B 3HZVA 3GK8L 4PYHA 3VXSA 5F93C 3LV3B 4TUJB 3CFIC 5CSGA 4N5UA 1I3RA 2NY4B 1QQDA 5DTFA 1X5YA 2M8XA 3HMWH 1JWSA 2ZPKH 4HKZB 3QUZD 1I1FA 1MCPL 1AD9A 3C8KB 4MLSA 1A4KB 1QVOA 4NRZA 4GG6E 4PJAF 4KKLD 3BKJL