2IPUG

Pfa1 fab fragment complexed with abeta 1-8 peptide
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
223
structure length
219
Chain Sequence
QVTLKESGPGILKPSQTLSLTCSFSGFSLSTSGMGVGWIRQPSGKGLEWLAHIWWDDDRSYNPSLKSQLTISKDAARNQVFLRITSVDTADTATYYCVRRAHTTVLGDWFAYWGQGTLVTVSAAKTTAPSVYPLAPVCGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSGLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for passive immunotherapy of Alzheimer's disease
pubmed doi rcsb
molecule tags Immune system
molecule keywords IgG2a Fab fragment Heavy Chain
total genus 42
structure length 219
sequence length 223
chains with identical sequence H
ec nomenclature
pdb deposition date 2006-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ipuG01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ipuG02
4CN4A 4KKLD 4NKMB 1HI6A 4NZTL 3TNNA 3UTQB 4PGCA 4XMLH 3C5ZA 4PP2B 1EJ6A 1EHNA 4WWKD 4JFYA 4K7PL 5KVGL 1N6QH 1XF5A 3Q6FB 2OTUA 4XP5H 5IEKA 1QZ1A 4U6YB 4WFFE 2NCMA 4C56D 1KENH 4XP9H 1A22B 3RWGA 2DIJA 1DZBA 2M1KA 5KVMC 3O81A 5DHXB 1FFNB 1S3KL 1A21A 4E41A 1JPTL 1L7TL 3K8KA 4Z7VF 3STBA 4G7YH 5J13C 1FNEA 2XQYK 4P4KD 5T33H 5B21A 3HMXH 1WBXB 1YY9C 1C7TA 2EO9A 2R1YA 5MENB 2DM4A 1S7UA 4WFGE 4AQOA 3HC3L 5CEZD 4OZIF 4M61A 1UQSA 3EJYC 1LDSA 4UT6L 4NO2A 5MEOA 2WIIB 2DJSA 2YA2A 5GZOD 1E6JH 2FZ3A 5FUOH 1KCUL 1N2RA 2HFFB 2YS4A 3LIZH 3ESUF 4LEOB 3DBXA 4GKNA 1G6RH 2J88H 3QFDA 5C3LD 1AFVH 1JL8A 3U0TA 1P7KA 3NPSB 5FA3B 3O45B 3UBXI 3VRIB 4F7EB 3FCTA 5DUBB 5DHYA 1FZOA 3QO1A 1KPRB 4XAKD 5D93C 5C08D 5GS1B 3QCTH 5ILTH 3ZHKA 3NA9H 1MF2H 5SX5K 1A6ZB 1H3VA 4HMDA 4NFBA 4QRSB 2A77L 1KN4L 4N90D 1OM3L 1E28A 1EMTH 1X7QB 4JY4B 4M8VA 1ZWIB 2OTPA 2XOTA 4NFDA 4QTHB 2XNAA 5BZWB 3PP4H 2QR0A 3EYOA 5IJKA 4YDKH 5E6IC 4Y5YB 15C8L 1KJVB 1IC7H 1FV1A 2F53E 3RP1A 1M05A 1T1WB 4GAYA 3QG7H 5T1LB 1H0DB 4HS3A 1Z2KA 3ZE1E 3O0RH 2CK0H 1RZFL 5CGYD 2OZ4A 1T1WA 5SWSA 2OQJB 3P9MB 3VWJC 4YHMH 4X7TB 1XF3B 1OD7A 1TVBA 2P47B 2DS4A 2FBJH 1I1AB 4UU9A 5E6YA 5GGQH 3HTLX 4NO5A 3CVHL 1PY4A 4QYOA 1L9NA 3U4BL 1F97A 5DJCB 3MLUH 3KPLB 1MVFA 5EC1B 2VE6A 5E70A 2NY3B 2YPLA 4QY8A 3VXMA 1WAAA 4ODWA 5BW7A 1V7NH 5MP6L 3MV7A 1ZLWH 5D8JH 1MCWW 4FQ1L 5CD5C 1M1SA 4ELMA 4PRBA 4RA0C 4JCLA 4U7MA 5D71H 1N2RB 5FM4A 4CVWA 3VD3A 2BVPA 1TFHA 2VXQL 5D7LB 4RIRA 3EJYD 4PJHB 4X99B 3EGSB 3LEVL 4AL8H 4YDVA 1YDPB 4X9HA 1U8MB 5JLZA 1M7DA 3VWKA 2WWMC 1QHOA 5IHZB 1IGTB 5D1XD 1A0QH 5MENA 1YY9D 1IAIH 1VA9A 1YNKL 3SKOA 2HG5B 5FUZL 4LRNL 2XPGB 4KK6C 4LVNB 3J8F7 5D7SL 2FJGB 3CUPA 3HPLB 1KIQB 2VDRH 3TN0A 3G6JA 5F6HI 3EDKA 3GBMH 4G43A 4ZS7H 1F4AA 1MQ8A 2B4CL 1QFWH 3RU8H 4BZ1H 4J1UB 3L9RB 3KPSD 4TUKL 4XWGL 3TIEA 2C4FT 5HI3C 1P84K 5CS7A 3QG7L 4NC1E 5CMAB 5D7LA 3DO3A 4M8QA 2PTTB 3OKKA 3VGFA 3DMMA 5EORH 1JWSB 5HYFA 1JN6A 2R1WA 3F58L 3PDOB 2ADFL 1T2QL 4OIIH 3U46A 5DVOA 2NY5L 3HB3C 3D3VE 1QYGL 2JB6B 4Y4FD 1DLHB 3L3GB 3A6BL 3DPBA 5JW4M 3WHE0 3EOBB 2ZOKA 3DWTA 5FKAB 3KLHD 5C0BA 4ZUWA 1JNJA 1MCKA 5HHVH 4F8TA 3ULUD 3T3MF 2DLGA 1CE1L 3UAJD 1KXVC 4PRPA 4WTXA 3MOQA 5I1IH 1XT5A 1QRNB 3K8MA 1QFHA 1U0QA 3SHSA 5HI5D 1J0HA 1HINL 3NIDF 2VLRB 3PJSA 4M6OH 4XVTL 5A2KH 3VRJB 2MPAH 2YUWA 32C2B 4XX1E 1EEQA 4WVRA 2EE9A 4DCQB 3FQNA 3CX2A 2FYYA 4F58H 3DGCR 3ESVF 5C6PB 4BFIB 5I1EH 4XHJD 1WZLA 2CIIA 4HPOL 4MAYB 1A14L 3LEXB 4G80B 3PXHA 3VE0A 5FA4B 1TCRB 3GO1L 1KBGH 2X4NA 1WIUA 2FX9H 3S98A 1Q94B 2C3WA 1YN6B 3GB7B 9CGTA 3KYMA 1HHGA 2YXFA 4LPWA 5I1DA 4OZHA 5CIPB 4JO4L 2FGWL 4NO0A 3FQUB 2Z4QB 4YBHA 4MLIA 2GSGB 3ULVE 2HRPH 2OR8A 3V52H 3BPLB 1QRND 5IVXF 1B0WA 1RJLA 3TO4B 5C09A 3MRRA 5JW5B 4LCIH 5E4IA 1IBGH 5JMRA 1NGYB 2DLEA 3C60C 4DAGL 2X1PA 4GG6B 3OL2A 2HFFA 1I3GH 4XPHH 4L8BB 4DAGH 1SJEB 3MGOA 4M48H 4R7DB 1K8DB 1W72L 1G0XA 1WITA 4KI5E 4NNYA 3U4EB 5A3ID 3HC0A 2AGJL 5IVXA 3JV4B 4WEBL 1FL3B 4OCYL 3WN5A 2FGWH 2B7DT 3O3BB 1F58H 2AGJH 1S9KC 5C92A 1L6XA 3X14A 4FXKA 5DSCB 4QHMA 1DTUA 1NGZA 2XQYG 3WCYA 3PQYD 2MQ3A 5TE4H 2FEDC 2VDNH 4ZXBC 3MTRA 4ZXBB 3MBXL 3QHFL 4DN3H 1PG7H 4LPTA 1ZTXL 4RCAA 2AK4B 1ODAA 1GSMA 2KZ1B 3GMNA 1F11A 1MREL 1KEMH 1VFAA 4L8DA 2BOCB 4X4YB 2VXSL 2VQUA 4LKCA 1E4KA 4YDLC 5TF1H 3S7GA 4NCC1 4DCQA 1N6QL 4M1CC 3MSPA 3FB5B 4WI5A 1ZGLM 1A1NB 5JHDB 2OX5A 3OB0K 1I8IA 2BSTB 1XR8B 4XZUA 1VHPA 3UAJC 1QACA 1RK0B 4YX2H 2R2CA 5F7FA 5HGHB 2D0HA 2P5EE 3SGKA 2RFXA 3TYGL 4Z7WE 4WI6A 1AR2A 3KPPB 4NNPL 3UROR 1CDCA 3BEWA 4FFVC 3OMZA 2EICA 3NCMA 4F37F 1DQDL 1S3KH 3T2PA 4HIEB 4Q9BA 5CUSL 2AXGB 2A74B 4QCIA 4PJ9C 1FL6B 1UZ6F 5CEYB 2FR4A 4U7KA 4FFWC 1MIMH 5C0GA 3SO5A 1DBAL 4KK6D 3PQYB 5ISZB 4FQ2L 1NAML 5JHDD 1NFDF 1RZKL 1OGAA 4RMQA 4GMTH 3P11L 5GGQL 4ZAKD 2XPGA 4P4KB 4ZDHB 1KLUA 1F3JA 1VERA 3LS4H 4HLJA 4JZNA 1LP9A 3AS2A 5IMOB 4XPGH 5E99H 1PLGL 1AO7A 3OGCA 5CUSH 5AUMA 3MNWB 4YHZL 4GXUN 1YN7A 5KSAC 3NFNA 4QRRE 3T08A 3QI9A 4K55A 5EFIA 2DMKA 3TFKC 4NSKB 4U1HA 2AW2A 4KMTL 3LDBC 5GRVK 3VXRB 3ABZA 1AXSB 4HBCL 1BZ9A 1NKRA 3QFJB 2F8VA 3IGAB 5EUKB 4O2EB 1R5WA 5EB9A 4H8WH 1BPVA 1CFNB 5SWSE 4ZYKB 1FDLH 4JG0H 4OKVA 3KJ6H 4NHCH 3L3HA 2ICCA 2EDXA 4OZGA 3TBWA 3D18B 1UM4H 3BPCB 2BY0A 3OAZK 5B3NA 3EUUA 4HWBL 1Z9LA 4P5TC 3EYFB 3C09C 4F9LA 4LPYA 3EOAA 1IGJA 2BNRE 1N0XL 1LWRA 1W72A 4XTRC 1VFAB 5EZLA 4LGRB 5LGHH 3C08L 3V6OE 3GSNA 1S78D 1QBLL 1EAJA 4LFHD 1FSKC 4MA3B 1SJHA 5J6GB 3TNMA 5DFVC 4M5ZL 4Y4HC 2XA8L 3PV6A 2B2XH 5IMKB 3P9LB 4OGYH 4Y5YA 35C8L 5F3BB 1CF8H 2MSPA 4WY7H 2E8ZA 2V9TA 3PDOA 4JJ5A 1BIHA 4RX4A 2GITB 3D85B 5ELIA 4V1DD 3IAPA 4YGVB 4UAOB 3VXOA 1JZ4A 4OCWH 5IESH 4PJXA 4H20L 1JTPA 3DV4B 5K9JL 4TNVK 5MEPB 3MGTA 4H1LG 4RX4D 4OD2A 1QRKA 5JQ6L 1MI5E 4Y2DB 3MREA 2QQQA 4RSVA 1GGBL 4KDWA 1MQKL 1MJ7L 1QBBA 2CKBH 1IT9H 2EDOA 4M02A 3MRJA 1FG2A 3ARBA 4NGHH 4G42A 1ZT4B 5B38B 1G9ML 5KSBF 2QLVB 5FKPA 4QHLA 1NEZG 5BO1L 3TJHD 4OZHB 3QQ9C 2IQ9L 1U8PA 4XB7A 2P1YA 5INDA 5FXCH 2BMKA 1IC4H 2IALB 3WJJC 3BWUC 4JO1H 3EYQC 5A2FA 1CU4L 3KHQA 3QQNA 1IFHH 3OKEB 3DRQB 3LKNB 4PJIA 1W72H 3TZVC 5KN5A 1CTNA 2CDGB 1TCMA 1T03H 3ZL4H 3FO2B 5FYKE 3U0WL 5F9WC 3TPUA 1C12B 5E6IB 1FO0A 5F9WB 2OMBA 5I8EB 5AG8A 4HH9B 3LCYA 3ZL4L 4EIGB 4XVJH 1JNHA 5L8KB 5TGBA 5FYJH 1N59B 3PWUA 3ARGC 4JY4A 3QUXA 1H3XA 4CUCA 3ZE0F 2VDLL 4ONOA 1OAUH 3K0WA 3D2UA 4WU7A 5DJXA 3RWJB 3CXDL 4U7SA 1T22B 4NKIL 2VDLH 3VJ6A 3NCCB 3BX7C 1QYGH 3ARDD 3MRBB 3P30H 5T1LA 5JW4Q 3WXWL 2EDWA 2DQDL 4U2ZA 3O2DL 4C83B 2ICWI 4MNHB 1KIPA 1VEOA 5EU4B 1I8MA 1JTOA 1SEQH 1YEFL 1KGCD 2Y6SD 3HLAB 3ZTJG 1X9QA 4E41D 3HAEH 5I1HH 4OUUA 1QR1A 5IW6A 4KXZI 4WFEE 1IM3B 1H3WM 4RGND 5ACLA 4TSCH 3HZYA 3I50H 2GTZB 4HS6A 4IMLB 4M1DL 4PRAB 3QFDB 2BDNH 5JOFB 3N85H 4HKXA 3GMRA 5J57B 4M7ZB 2I27N 4HGWA 4X8JB 4KKLC 4N1CA 5FM5O 1RY7B 3QXAB 4FQXB 2CDEB 3QUXC 4IRJA 2D3VA 4OZ4A 5SV3A 2OYPA 3VFGH 3U7WH 1I85C 4PLNC 1U41A 3IVKA 3ZDXE 5F1KC 1Q38A 4K94H 3WJLA 1ND0A 5TDNB 4HV8B 3NZHH 3GKZA 4Z7OF 1TDQA 2R9HD 2RCSL 3SDAD 4JFEB 3IFLL 3P0VL 4ZO6A 2RR3A 1T6WA 3W39A 2F5BL 1I1RA 2JIXB 3DRTA 3GFUA 5F7NC 3NCBB 1KN2L 4WO4A 4ODVH 5GPRA 1AGEB 2YSSA 2OI9C 4DQOH 1ZA3B 2XTJD 2NZ9C 3R06B 1CDUA 3WIIL 4D8PA 8CGTA 1WVZA 1HH9B 4E41E 4MD0A 4PJ7B 4ALAH 4ZFOA 2C4XA 5KSVA 2X05A 4G7VH 4DVRH 5E94B 4ALAL 4NC1C 4W4OA 2WSKA 3PGFH 3V0WH 4NWTH 4OLXL 3W2DL 1P1ZB 3JZ7A 1XCQB 5EU6B 1ETZA 4ZOAA 2A6IB 2IPUG 1IC5L 2WV3A 3M17A 5ALBH 3D2UD 2ZUWA 1RVFH 1G0DA 3T8XB 5IQ9A 4U3XA 4TUJA 2GJ6A 2PYEB 2VLKB 3D69A 3IKCA 1CDHA 3THMH 1FZOB 5MERA 1JZ6A 2C3XA 2GUOB 5D4QA 5CHNA 5FOBB 4D3CH 4LQFL 4KZEH 5GRWA 1KLUB 2QHRH 3KXFE 5JNYA 3H0TB 2BJMH 4IDJH 4GW5A 3ULVC 3T04D 3SE9L 3QUZA 5IKCA 4HUVA 3TT1L 3DXAE 3VFMB 4R4BA 4LP4A 3G9VA 3ZHLA 2FJFB 3DVGA 5GGRB 1OCWH 5C07B 2XKNB 1MFCH 3WNLA 2XXMB 3D85A 5TF1L 3GRWL 3QDHA 4G8FB 3MO1A 3CSBA 3CFDA 2AK1L 2QQNH 2OXGA 2Y4SA 4JVPA 5BVJA 1OAXH 3DECA 1OGAE 1KCUH 2X41A 3RZWA 3EO0A 1WUNT 3W5MA 2CLZA 4YXKL 1T22A 3VJ6B 5E7BA 5D7IA 4MA1C 1NEZB 3OJDB 2C4FU 1NAKL 3WS6A 5DJ2A 4P5TD 2IADA 1EFXB 5T1KB 5JA9A 2ATKB 2BVOB 2CIKB 4APQC 1QSFD 5LAXA 3EOAB 3UTSE 4S0SD 5IEKB 2J3SA 5TJWK 4JFXB 4XP6L 5I18L 4HPYL 3DXAD 2V7NA 1BJ8A 1U8IB 3MACH 5GRUL 5H8DA 2ZUUA 2YD8A 5J1SC 1RU9L 1RIUH 1EA9C 4MD0B 3V5KA 3CFBA 3G6JF 1AP2B 4LVHC 4J4PA 4Y7MA 1ZHNA 2VWEE 4JLRA 3LMJH 4ZYKA 2YPLE 3VXME 2KDGA 3CK0H 2B1HH 3SDCB 3G04A 1FQ9C 3MRCB 4KDVA 3LZFL 1PKQA 1U93B 1T7VA 5FM8A 5D9SA 5D7JD 4I8DA 2OZ4H 5J1AB 1X3DA 3QUML 1IC4L 3OX8B 5IVOA 4R8WL 3VXNA 2R23B 3X14B 4P9HC 3JV6A 1HHHB 2EDFA 4F15C 3C6LD 4Y5XB 1SBSH 3BSZL 1V7ML 2P4AB 2V2TA 4NGHL 2CJUL 2HT4C 4XBEL 3UC0H 4P9MH 4XVJL 3IFNL 2JELH 2D0FA 4F7MB 3A6CH 4QOKE 3RL2A 3I9GH 1OPGL 3GMQA 2YR3A 5D96B 5I0ZA 1FZMB 5DD5H 3SBWA 4CMHB 4K3JL 1RFDH 3ZYJA 4POYA 5CJQH 3ZE2E 1MCJA 1AO7B 3GJEA 4BQ6A 2YN3A 1FGNH 4MJ6B 1J8HD 1OTTC 4KMLB 3C6SA 3GJFB 1CLYH 2D31A 1T7ZA 4JO1L 3KYMB 5I1DB 1BFTA 1CE1H 1MCOL 3N1QC 2Y7QB 3SDXF 1IEBA 1V7MH 5TDPA 5HHQB 2FX9L 4K9EH 3S37L 4XRCA 5E9DD 1EGJL 4ZUTB 3D87B 5JDJA 2O61A 3SGEH 4PJ9A 3ILPB 4YK4B 3CZFB 2F5AH 4CAGA 4Z7QF 3FT3A 4JRYA 4WV1C 1QUNA 1XR9A 3X3FH 2DTSA 2R0LH 1IAIM 5JHDE 3L3HB 3NAAH 5C0AA 5D72H 3FN9A 3TYFA 4Q7DA 1QLEH 5DRWA 2CDGA 2GEEA 4YZFE 1PKQB 1U93A 3T0XA 4QRUB 1J8HB 3G6DH 3X17A 2XQBL 4I3RL 3ARDB 4K3DH 2EDTA 3MRDA 4WW1A 4N9OB 1FZKA 1HNGA 3BP4A 4Z7OE 3CFBB 4OFKA 5CJBA 5GRZA 4JFDD 4LKXB 4JKKA 5IB3B 1MFEL 1OT1A 4HWBA 4AG4H 4UDUA 1HXYB 1VEMA 5DJAA 1FG2B 3VFVB 1HHIA 1TXKA 2ZCKH 2NNAA 2NW2A 3NOIA 3QWQB 4YHLH 4L4VA 1VFBA 4D2NA 2OMNA 2BRRL 2D03L 3DARA 4WHDA 3QXAA 4FQXA 5KZCB 3CIQA 3V0WL 2IBBA 4QWWC 1JWMB 1HOCB 4I3GA 1G7PA 1IGCH 1MCBA 3WFDH 1A4KB 5DYOA 4MJ6A 3QEUA 2LFGA 4G6AC 3FRUB 1BD2D 3VXUD 1RHFA 2VZUA 3HZYB 5K93A 1IKNC 3O4LE 4DQOL 1LK3L 4X99A 2X70B 3WKML 3EO9H 4U6TA 5DD6B 2X9XA 3ARYA 2HTKC 1D5MB 3VRLF 1KN2H 2IH1A 3NH7H 1FYTB 3AY4C 1IKFL 3GJFK 1Q0XH 1GL4B 1CICA 4X98A 1D5IH 3X11A 5CEZL 2V2TB 5SX4I 5ISZE 1EIBA 3HG1A 4I77L 3FB7B 4UNUA 1WISA 4RFOL 5B3JF 3VFVA 2Y5TB 4U3HA 2JE8A 4RAHA 3VGAB 2JF1A 1EMTL 5IBTL 1F8TL 3C09B 2WP3T 1I7RB 4MXVF 4S2SB 4DN4H 5HYJB 4TVPL 4HSQA 1V3MA 4U1JB 5J1AA 2IPKB 5FYKU 4LSVH 4KJYB 4LKCB 2CGRH 3GSOB 4JHWL 2ZSWB 5DD3L 4NQXB 1NCTA 4P2OC 1E0OB 3D1MC 4O2EA 5M7QA 3T0VA 5JOPE 1Y18B 4JFFB 1QBAA 3P0VH 3PV7A 4BFIA 2FBJL 2XN9D 1DEEB 3WS6C 1ZTXH 2ZUQB 1INDL 3NCJL 1FV1B 1MREH 1J10A 3T0ED 2FX8L 3OHXB 1IAKB 1LNUB 1QSVA 3UTTA 4JN2A 3MRHB 3WN5B 3BN9C 5LAXB 2NXYC 1U8JB 1MCHA 2X9WA 4DGVH 3AY4A 4BSWB 1SM3H 2R15A 5GGSB 1TLKA 4OFIA 4KRLB 3C60A 4Y5VB 4ZSOB 4TVSa 1RPQA 4HCRA 3WFHB 4G6MH 2VDQH 2HFEB 2B5IB 1AFVL 1OB1B 4IRSB 4GG6A 2OZ4L 1IGYA 5J3HD 3UTSD 1T1YA 1T1ZA 3HS0B 4HS6B 3STLB 2VKWA 4M1GL 3MO1B 5IHZA 5IEHB 3RVUD 5KSBA 1N64L 4JB9H 1G7HB 4F33A 3REWA 3MZTA 4JKLA 3HB3D 2MJWA 1G9EA 3KPOA 4ZD3H 1R3JA 4ZUUA 5DTFB 4P3DB 4D9QE 1ADQA 1AQDB 1E27B 4NQCE 1F4WL 4GXVH 4LGSB 1ITBB 1H3PL 1JPST 4XVUD 5DWUL 4HZAA 5ICYB 5KJRL 3VGGA 2DI8A 1UA6L 1G7QA 4X9BA 3BEVA 5FO7A 4KJWC 4R8WH 2ZCLH 4HXBL 5FB8B 5IUSA 1FAIL 3QSKB 1AGEA 5HVFB 3KPTA 2HKHL 32C2A 2JB5H 4GW1A 4YXKH 4B50A 2ADGB 3FB5A 3ULSB 3WO4C 4NPYB 4OZGE 3N1MC 3QUXB 3LQZB 1RUAL 2J8HA 3KXFD 2A73B 3AM8C 5C0FA 3ULUF 1KF9B 1SY6A 1VKXB 4RFNB 5C08E 1I9RL 1A1OB 1BFVL 2NPLX 2XZAL 4OAWB 3SDCA 4PJ8D 4JFPA 1ZAGA 5D1ZD 3RVTD 4JPWH 4ZFOL 2XT1B 3UC0L 1NGPL 2YSSB 1VFOA 2E9WA 4HIIB 4R97C 2FX7L 3U9UA 2O5YH 4QYOB 3MROA 1AQDA 35C8H 1ITCA 2V6HA 4HFWA 1E28B 4K8RH 1QR1B 1OW0A 5DHVB 4R7DA 2NY5H 3RI5F 3WE6A 3AGVA 2VOTA 1Q72L 4ONGL 1DVFA 2WWKT 4GAYB 1T1ZB 1L0QA 2BCKA 4P2CG 2D7QA 1KTKE 2DQJH 1CVSC 3RUGB 1OQOA 1NAMA 2H26A 4UBDD 2B8OT 1KPVA 1XH3B 3QA3A 1X7QA 4TN9A 2F9BT 3U6RA 4JFDE 2HJFB 4OI9A 5IW6B 4UV7L 1QA9A 4NO0D 5ECJE 1FDLL 1UCBL 1JF1A 2VN7A 4WUUE 4G8EB 5EOCL 4LCWE 4ODUB 3SY0B 4F7TA 5BRZB 4L4VD 3HS0A 4YFDB 2AJ3A 4HMEA 5FYKD 2C1OA 5H35B 5CD5D 4RMTA 4GSDL 3MCLH 3L3OB 3PNWA 3SOBL 2YUXA 3NFPA 4WFED 4P46B 3BXNA 4MDJA 2EYTA 1OSPH 4GQ9H 4RBPH 1BHGA 1BWMA 3SOBH 3K2UL 1MIEL 3FFCE 1Z3GH 4S1RL 4HJ0C 3W9EA 1OHQA 5I1CH 3PWLA 3KPNB 4OLYL 1BQLL 1TNNA 3VG9B 4LARH 2R2BA 4JRYE 4UV7H 4OLUL 3GM8A 4PGJA 1CIDA 3BIBX 3U2SB 3L3DA 5DVNA 4OBRA 4PRID 3MUHL 4FQXC 4YXHL 4PJGE 5JOEA 1FH5L 3JBG7 1YJDH 4Y0GA 2AV1B 1FN4A 4OIBA 1F4XH 1P4LA 1YA5A 2LTQB 3E8UH 3O6FB 4LGPB 4GRWF 4X5XB 1MI5D 3HCVB 4HUWB 1T3FB 3QULB 4ONGH 3IB4A 1RHHB 4R26H 3W39B 5J89A 1GPOL 4LLWB 2EDEA 2ESVE 3DMMC 3N06B 5B39G 3HRPA 5E1AB 1FBIH 3O8XB 3D39D 1BLNB 1GPOH 1LK2B 5GZNC 3AMKA 5FFLA 1UADC 4PY8J 5B22A 4L9DA 3HN3A 4MB3A 3UPCA 4KXZH 2YEZA 1UYWL 5DUBA 2FJGA 3CUPB 2MFNA 4OD3L 5F7HA 2OSLB 3BZEA 2R29L 1ZE3C 1KELH 4I48B 4YQXL 4EI6A 1ZLSL 4KZDH 2EYRB 1YZZA 5J0BA 5C0CD 3OWEA 5IB2B 3D3VD 3EDFA 3BKYL 1C8PA 1DL7L 2Z8VC 3W9DA 5EIVA 1DQQB 4H25B 4LAQL 3SCMD 5DD6A 1S9WB 1NBYA 5JTWA 2R1XB 3ELAT 1J05B 3BISA 4NN5B 4OCXH 5CZKA 5FUCE 4WW2B 5DRXB 4GQ9L 4JQXA 3FFCB 3JTSB 3EJJX 1NMCB 3TWCL 4PUBL 1N6UA 1BBDH 4JN2B 5I30L 2WWKO 3EIFA 1NSNL 5F7MC 3PP3H 4CVZA 5E9DB 3LD8C 4I9WE 2QL1A 3TBWB 3PV6B 5E2VL 5IMKA 1HOCA 1PYWB 2W65A 2EIZA 4Z7UB 2A6JB 4B5EA 1PEWA 5FA4A 3DURB 1UM5L 1LVEA 4JQIH 3LKSB 1R3LB 3G5YB 4KKBC 4G7YL 4EI5B 4OKDA 3OPZL 1MF2L 3BN9D 4ORZC 2OL3H 2PYED 1YMHA 2VDMH 3RNQB 1QG3A 3OAUH 3OKOA 3M1BA 3HRZA 4I3SL 4J23A 1FZJA 4R4FH 4QNPE 1OLLA 1IEAB 2ITCA 2N7BA 3GIVB 3SKNB 2V2XB 3CVHB 3M07A 3X13B 4G6JH 2ADIA 4DOHE 3LIZL 1YN7B 4RMSA 1KENL 3BP4B 4LCUB 4Z95L 1YMMD 4PLKC 3RDTC 2VLJB 3QIUD 1H9VA 1AJ7L 4GBXD 4HXBH 2Q3AA 3MCKA 4LLDB 2WNGA 3WHXB 5I15L 1LQSR 2CH8A 1VACA 1CIUA 1UM5H 4TULL 3U9PH 3VFRA 4TSBH 5EZOL 4DGYH 2GJZA 3HMXL 1R24A 2WBWB 1HIMH 4U1JA 3QJHB 5K33A 1KIRB 5T5FH 5FYLH 4JN1H 2C7UB 4LHUD 3HAEB 3WXVL 3TH2T 4GXVL 4I4WA 4BZ2L 2ZNWA 4YE4L 5IFAL 3V4VL 4G9DB 5DYOB 4JREC 3PE9A 3QRFM 4WEUD 4K7FA 4M9OA 4MZ3A 3P77A 3RTQB 2APVA 2XA3A 4PJ7F 2YA0A 3KVQA 4Q97A 1ZHBA 5T5NF 2VZTA 4RRPA 4QRPA 5DMIL 4GT7A 1AO7E 4P4RA 4XGZA 4XP6H 3PDGA 2J4WL 4MLSA 5EPMB 4GRWB 5FYLL 5IHUL 2X89D 4OCRL 1I8IB 4PJCB 1SYSB 2YK1L 3MCG1 3VDCA 1HYSD 1FVCB 1OAZH 1ORQB 3SGKC 4KC3B 5C0RL 3MRGB 5GGUB 3UYRH 1FVEB 2HT2C 4XCYA 1IT9L 3QT2A 1G9NC 3FO0L 4D0DA 4ELMB 5LG1A 3DGGA 4ZO9A 2CSPA 1ZT7A 3Q3GA 4NQXA 3TBSA 1YEHH 2IG2L 2YRLA 2IQAA 1C16B 3QEGL 1GGYA 2ADJA 2AEPL 4L3CA 1BF8A 1FHGA 5AD0B 2ADJB 3JVGA 3UO1L 5EO1A 4FNLH 4HX1B 2R0KH 4WHYG 3C6LC 4X4XA 3HZKB 5CSGA 1OF2B 3OR6A 2FNBA 3P4LA 3HC0B 1YMHB 3FOLA 1ZSDA 2VQTA 3GBNL 1NGXA 2DIAA 3ARWA 4ZTPH 3CFEB 2UZIH 1INEL 4UQ3B 1XGRB 4KMQA 5GGRY 4KI1A 4QHKJ 2Q7NA 1GZQB 4P99A 4Y1AA 5E2TH 1INQB 2IAMC 2CLZB 1G7JB 1GGUA 1MCFA 3V5KB 3AREB 3MYZA 2KH2B 4OFDA 3HI5L 1QSED 2X70A 2H3NB 4N68A 5BZWA 3VI4F 2ZJSH 1N8ZB 3MV9D 5BRZA 4F7TB 5HHPB 4AT6B 2BY1A 3QDAA 5IVXB 4CMHC 1NCBL 5IOPA 1QQDB 1WBZB 2R0KL 4NZRL 3IYLW 1I1CA 1LEGA 3PWPB 4G9FD 3MLZH 4QXTA 3U4BH 5E00A 3LN5B 4KKAC 2WZPD 2DWEA 1KIQA 4NO3A 1B4RA 4OLYH 5IHLB 4N0YH 3LH2H 4R4NC 3T4YB 4ZOBA 3GJFA 1HHJA 1BX2B 3DROA 1A9EB 3MLSH 4HUKB 4GH7B 4P23C 2BFVH 3UJTH 4KI5D 4JRXB 4CW1B 2R69H 4J12A 4EEEA 1TENA 5E8NA 1KYOJ 1MFBH 4ZODA 5D71L 2PETA 4X5WB 5HYSA 4W81A 4HC1H 5K9KA 5JA8B 5E2JA 4YH6A 2NY2C 4OM1H 5DJDA 4F8QA 3S88H 1EH9A 4PRIA 3V4PH 5I75C 1S9YA 6CGTA 3QQ4A 5DO2D 1NCAL 2FB4H 1GZPA 4K3DL 3QEQA 1UKQA 1UG9A 4WJ5A 1KCRL 4M7LT 5I8OH 1R5IB 5E08L 2A6DA 4G9FB 3ECBA 1GRWA 4XZUB 2J8UB 3T0EE 2YPLB 3FKUS 3VXMB 2HJKB 5J11C 3U2SA 4HWUA 1J1PH 3CMOH 5DJ8A 3VGHA 3SEPA 4X6FA 1IAOB 1ZANH 4Q2ZB 4KRNA 4S1RH 1N7MH 1KIUA 2BSSB 5DD5L 3QUMA 4X80L 1QFUL 4YC2B 1KXTB 3OG4B 5L2KD 3O6FC 3QPQC 4KK8D 1CFVL 5HHMB 1UGNA 1MHPH 1WBYA 3QUYC 2Y7QA 4UI2A 3QNYB 2BNRB 3QUYB 1QBML 2IWGA 5JORA 4G3YL 3EJZD 1OWRM 4PLOB 5BOPA 2X40A 3E6HA 4EN3B 1QFWM 3IXAA 1R3HA 1KACB 3O3BA 4MWFB 4URTB 2QQLH 3ARBD 1H8OA 4JKWA 4RFEB 2EYSA 1RZGA 2NX5B 4PY7A 1F6AA 2BHUA 4JGMA 2CKBL 4PUBH 3UEZA 4TSCL 1IGIL 5HGAA 4MZ2A 1B4JL 2A0LD 3U6RB 3O11A 3F62A 2HKFH 4L5FL 3VFMA 2FH8A 1U3YA 1BBJB 4WUKH 1WFUA 4ZS6C 4NZDA 1DANT 4PBXA 5I16B 3TVMB 4GKNB 5BS0D 3QHFH 4UT6H 4BYHA 4DN3L 5DMYA 1QLFA 2GI7A 1V5JA 4QRRB 2ICWB 3VGBA 3VXPA 1FYHB 2PO6C 3S4SB 3IDMB 3ZDYE 4QO1A 2ICEB 3GO1H 1KIRA 3SDDC 4FQHB 4Z6AT 2YWZA 1CT8A 1OP3H 5MEQB 4XNUL 3BVNB 2EIDA 3OKDB 5EOTA 4YAQA 3VFSA 3UJIH 3E6HB 1UFUA 4C83A 1C1EH 1AJ7H 1HHKB 5GS1C 2CXKA 1PGRB 2FX8H 2EO1A 2UWEB 2NX5E 4GBXB 2EXWC 5F9OH 3NGBC 2FO4A 2V2XA 3CVHA 1JNNH 1Y18A 2MOVA 2UUDK 4LCCA 4LPUA 3OXRB 5EUOE 3M8OL 4LCCC 5DEGB 2FIKA 2AKRA 1A2YA 2D7PA 3PHQA 4QXGH 2LAGB 3L95A 3MR9A 4FQPA 1UH4A 1U8OA 3A67H 4IRZH 4FABL 2DWDA 4LHUB 3JVGC 5FHAH 2ZUVA 3LKSA 4Q6IC 4XVSH 2F53B 4OGZA 1DQTA 4L9LA 1TJGH 5C6TH 1YMME 1U92B 5IG7A 5E9DA 2AXFA 5KOMC 1GZPB 3QUZC 1P2CA 4M6NH 4D3CL 8FABB 5BJTA 4QTHA 4F7CB 4FZEL 5I71B 4M93C 1S7RA 1JF1B 3QDJE 4HKZB 5HDQL 1IKNA 4JDTL 5C7XH 1GOHA 2MTPA 3C8KB 5MP6H 4FQLH 2APBA 4NWTL 1BD2B 3VXUB 4KQ3L 4ORGA 4DFHA 3DX7A 3GUTA 4MCZA 1W0YT 2DQHL 3K4AA 2P5ED 1L6ZA 5FA3A 4LLVA 5GGVL 4W70A 5GRJL 1KIPB 3B9KC 2R8SL 5HI4D 5D1QC 2B2XL 1I4FA 3I75A 3LRHA 3ZTNH 4H26B 1SEBA 4XH2A 1WBYB 4R3SA 2GTWA 2X4PA 4PIRF 3IDYB 3NZ8B 5IK3B 3SE9H 2B4CC 1BEYL 3QIBB 5FGBC 4PBVC 1NLBL 3QIBC 1UEMA 2DB8A 1ZK9A 2NY6C 1DDHA 4NQUA 5EUOB 3RKDC 1RIHL 4HWBH 3TPKA 3TLRA 1JNHB 1XF5B 4KJWD 5C0RH 3O8XD 3UYPA 3D39B 4HIIA 1V7NL 3TGXA 3PL6C 5E5MA 3LH2L 5C08A 3VFTB 3QIUA 1NC4A 4P9HH 1PD6A 2A2QT 2R8SH 4AEIH 3P4NA 5D7SH 5HY9A 2LVEA 1HSBB 4IOFD 1FFNA 2Z92A 5ABDE 3O3DB 1UKTA 2PW1B 1P4BH 3WLWD 5CP7B 1JPSL 3VFSB 4DK6A 5TQ0H 3BJ91 3TYFB 4OF6A 5DUML 5HYQB 1FORH 5HHXL 3RZCB 3RL1A 1Y0LB 4GLRH 4V2CB 1QLEL 2VXUL 4G6KL 4ZG1A 1RUQH 2DQFB 4IRJB 4N8VA 4MJ5A 4HMCA 3MXVH 4OKVB 2Z8WC 3QDGA 1CD8A 3QPXL 3IU3A 3QXTA 4JQVC 5KN5B 3MRIA 3AROA 3O3UN 4Y19A 3Q48A 3AREC 2EZ0C 3MXWH 3FT4A 4YHPA 3ARBC 2MCG1 4Q6IB 1BVLB 2VSCA 1LGVA 4Y19E 4ZTPL 1UWGL 3MNVB 1M71A 3L1OH 4ONHA 4JR9H 1U8PB 4XC3L 5DVLA 1JI2A 5EC2B 3QRGH 4QHLB 3JWDL 2QKIB 2SEBA 2PW2B 3RWHA 3HAEG 3G5XB 4RFEA 2FBOJ 2BRQA 1WK0A 5F7WC 4K2UL 3NAAL 3MOAL 1FC1A 3VXTB 3D85D 2G60H 4UOW1 3RZCD 2O5ZL 2ICWJ 3RIFK 4ODTL 4LCWA 5IROA 1GIGH 4XMKL 1RURH 5HHOD 4DKAA 3VD5A 4JPVL 2JKXA 2I5YH 2H1PH 5DS8A 5HDOA 3O6KL 3HPJB 2HRPL 4HIHB 2AJSH 4L4VB 5TH2B 2YBRB 4J3XA 4NFCA 4GRMB 3KLAA 3AXLB 4R0LA 2NY0D 5BO1H 3GSNL 5MI0B 4BK5A 2BSRA 4O2FB 4Z8FL 5JHDA 3WFCH 5C09E 2UYLA 2P8PB 3IDIB 3UPRA 5IB3A 3G5ZB 5F96H 2Y1VA 1D3CA 3DVFA 3F12B 4M48L 4U05A 1FGNL 2H9GB 3PWPD 4PBWD 1X5ZA 3S96A 2EKJA 5HHNA 2VISB 1R5IA 3T65A 5I1LA 3TV3L 3FT2A 4K8RD 3DI2B 1XGYH 3IGAA 3RWGB 4MD4A 4ZUVA 5EZLB 3TV3H 3HHRB 3DX9A 4KDTA 2BMKB 1QSEE 1FNSL 1J1PL 1CG9B 2CLRA 1KB5B 3GSWB 3DHMA 4HIJA 1YEKH 4WFHD 4EN3D 2ILLA 4KPHH 4P9ML 5CJOH 3ZKMC 1X5XA 2Z91A 4NHUA 3BZFA 4L8SA 2BY2A 3KPQA 1QPPA 4J3OC 2RGSA 3DJ9A 4G42B 2YOCA 4PLJD 2Y23A 3W11D 3JXAA 3RNQA 2ATKA 2BVOA 4U6VL 4L4VE 2IQ9H 5D7LE 3VH8B 2VDKH 2V2WA 2XY1A 5DMGD 2Q20A 2NY3D 4MYWB 3UYOD 5EU5B 5KVEL 5KBNC 3DV4A 1U3HB 3MODL 4R26L 2Y9RT 1CYGA 3TBTB 4ZUUB 5L7XH 1MCQA 3JUZA 4KKCD 4XP9L 2NTFB 3PG2A 1RSFA 4K7PH 2KL6A 4Y1AD 5L8JB 3IFOB 3R1GH 3VWKC 3VD7A 2L7UA 4JHWH 5EG6C 4NO0B 1DEDA 1MHEB 2WK2A 4S1DD 1K8DA 2XI9A 5CZVH 4BZYA 5I9QB 4JE4B 2E27L 3EOYG 3REVA 1LEGB 3PWPA 5FECB 4YO0A 3QIWA 4WI2A 1X5IA 1KGCE 5KTEH 4TNWF 2XTJE 4Y5XA 4NUGL 1RJYB 3LAFA 4UQ2B 2COQA 5IIEB 4HPOH 1N8ZA 5EO1B 4DK3A 4X6CA 5D2LF 3FQUA 3AU1A 4QF1A 1ZV5A 5E2WH 1M6OA 4JM4H 1YN6A 3GB7A 3IFPB 3QUKA 3OAYK 2GJZB 2EIBA 5C09D 4Y1AB 3GMLA 5IBUG 4AEHL 4KY1L 3F65A 1MLCA 4YK4C 4OQ1A 1NBVL 1VDGA 5JUEL 3RJDA 4XCFH 3ZO0A 1YC7A 3QFJA 5KSVB 1WTGT 3FQWA 2VJXA 5BS0B 5L0QC 1J1XL 3HFMH 1AGCB 3O6FA 4N90E 4NC2B 1JTTA 4NP4H 4Q9CA 4O58H 4CU6A 1ZHNB 2DLTA 2R29H 5CJ5A 4TPRL 1A3LH 4TNWK 4Y88A 4KQ3H 4I0PA 5EFIB 4WO4B 1ZA6A 5JR1H 3RVXC 5SWZE 3MLXH 1A7PL 1UM6H 1B6UA 3HI6L 5CLWA 2WBJC 5ERWB 2YD9A 3MJ9H 3RWFB 3JTSA 4NYLB 3MV8D 1I9JH 4U31A 4G8GE 3WN5C 4GRLA 5E2WL 1F3JB 3MRFA 4PV8B 5D8JL 1JNLH 3PP4L 3L5IA 5F7UA 1BP3B 4HT1L 4PJEB 4R3SB 4PJDB 1KC5H 1AY1L 4XVSL 1CXHA 4PTUB 1CGSH 4JHAL 3P0GB 4KJQD 4CN1A 4NP4L 1VPOH 2R0ZL 1A3LL 2PYEE 3U0PB 5GQBA 3O2WL 4GMSH 4GO6B 2CKBA 4HZLA 1J05A 1A0QL 4X5LA 3DUHA 5DMJB 4P46C 2RB8A 5C7XL 1S5HA 1CD1B 1AR1D 4J3WA 5DR5L 5F6HJ 4R4BB 3TZVB 1TCRA 4L8BA 1HXMB 2ARWA 5E8EB 4KMTH 8FABA 3G6AB 3O3AA 3N1FC 4LP5A 4H1LH 1K2DB 3G08A 4BKLB 2DYPA 2CLVB 2J5LC 5INCA 3VH8A 3F7PC 1V8HA 2KBGA 4WFFD 3LV3B 3GSVA 4G9DA 1GCFA 1TJGL 2W0FB 4IBLT 1IGTA 2JJUA 4OFYD 1UCBH 3D0LA 2O5YL 2E6JA 5IM7B 4GRLC 3FN3A 1I1AC 3BFOA 4M6ML 5EZOH 2VLRE 1JHKL 3H3KA 2A6KB 4DGYL 2C9AA 1KB5A 3QCTL 3H6JA 3MR9B 1ORSB 1UZ8B 3VCLB 3ARED 1R3KB 3BGFC 3QWOB 2FIKB 1IMHC 1NMBH 1LD9A 1DQLH 2JJTC 3NCYS 2JJTA 1Q1JL 2Z92B 4PS4H 2V5RA 5BW7C 1N5YL 4D8PB 2IANA 5GGSY 4PS4L 4IIQC 3D39E 5AZ2L 3A6CL 4QEGA 2BC4A 4A2LA 2IH3B 1FAIH 5EBLA 3DVNA 1IGMH 4FTVA 2HKHH 3OZ9H 4CN6A 3LVEA 2BNQB 2ZOLA 4QRSA 4V1DE 4LU5H 1EFXA 1G7LA 4Y16C 2AABL 4L4TB 4P57B 5DEZA 1QKZL 2PTUA 3QQ9D 4MXWH 3W9DB 1A14H 2LV4A 1CLYL 3KLHC 4NKQB 5C2BH 4QRRA 4M5YL 3BUTA 4P2RE 3BDBA 4Z7NE 1U9KA 3O2VL 1FNHA 1EZVY 2K9UA 5FK9B 1EUUA 4P2RA 3UZQA 4D9LL 3TN0C 2LU4A 5ICZA 2EDNA 1MJ7H 2HN7A 1MPAH 4JAMB 4DW2L 5BQ7A 1C08A 5D5ME 4P3DA 3G5XA 1WIOA 5DJYB 4HFUL 5HJ3B 1CDBA 4R7NA 4BH8B 1O5DT 1MPAL 1XZ0B 5ESAB 4DW2H 1CFBA 4JY6B 3BI9X 4MJIA 4J1UA 1BLNA 3MOAH 1KTRL 5DRZB 4ZFFB 2X4NB 1IFHL 1S7WA 4TTDD 2YD4A 3V5DB 1QSZA 2XRAL 4BSVB 1JHKH 5B8CC 5T3XE 3CCHB 1H3TA 1GVIA 4MQSB 2DL9A 2DQTH 3F7VB 4UINH 5CHNB 3VXSE 2I24N 1W0WB 5F7DB 1IL1B 2MKLC 4YHIB 3ZDZE 3TNMB 1F42A 4Y4HD 1AHWA 4Q9RL 3P73A 3NABH 4OI8A 2KKQA 2X4SB 3MXWL 4PRDA 4UT9H 4LFHG 1TVHA 5FV2A 4F80A 4MVBC 2AJSL 3PGDB 1LK2A 5JXEA 3SKUD 3C5JB 1RK1B 2ZWLT 4LLQB 4Z7VE 1YEIL 1MNUH 3VWJB 3IDJB 3ARFC 1IBGL 5I8EA 3VW3L 1B9ZA 4A6YH 4K2UH 5JW3L 3T4AB 1UEYA 3R06A 4MJID 1MEXH 5C08B 1U8KA 3VFTA 4NZRH 4Z9KB 5I1IL 4RGNC 3DRQA 3KPLA 4FRWA 1LE5A 1MWAL 2A73A 2NY0B 3S36X 5FGBA 5HD8D 4P2RD 5CBEA 4TQEL 4N1HB 4E5XA 2FWOB 1C5DA 4KUZH 1CDIA 5CWSB 1JZ7A 3H7BB 5IWLC 1I7UB 3QHZH 3IAGC 2I9LA 2VITB 3SKJL 5BQ7B 5IEHA 3WIHH 5F8RC 4H26A 3KPRA 3EO0B 3HG1B 4KTEL 5F6IB 3RIAK 4O00A 5IBUB 4NO3B 4G7VL 1S7WB 2WAHA 4U1SB 1VCAA 5T3ZL 4MMZC 1EPFA 3TA3A 3VI3E 4I5BA 5GGRA 1DBAH 3TA3B 4TTDC 4FG6D 3K8LA 5I76B 3H8NA 3BESR 1YY8B 5D1ZA 2D7OA 3DVNB 4HHAB 1GGTA 1MIEH 4EIZC 4ENEC 4YR6B 1WCQA 1LO4L 1T2JA 1M7IB 4QTIL 3MRIB 4MS8C 2YD2A 1LO5A 1BGXL 2HFEA 3NCFB 5EULV 5FDWB 1OTUC 4L3EB 5BV7L 3ILQD 4PJEA 2HLAB 1A7PH 1UM6L 4J6RL 4HCRL 3CX5J 2MKWA 1Q9LA 1UWEH 3I02A 3PWNB 3WSQH 3RY5A 4X0KA 1U8JA 3KS0J 2VL5B 5C0IA 3KJ4C 2HTLC 2IPKA 4UTBH 1NFIB 3PGFL 3RWCA 1PQZB 2A6KA 3VXQB 5KW9L 1MHHA 4GW1B 2GY7B 5HGDB 2DBLH 1CGWA 2LVCA 4NNXA 4XCFL 3RDTA 5AAWA 1HI6B 3TNNB 2HWZH 1T83C 1LP9E 5ID1B 1DFBL 1X4XA 5J9PB 1KG0A 1N3NA 2YA1A 4FFYH 4HS8L 4QRUA 2VXSH 3VGDA 3K46A 4F57L 4JDTH 5HHOB 3H3BC 4JQXC 4XNZB 4NT6A 5TDOA 2QSCH 5HVGB 1K6QL 2G9HA 3PL6B 5C0BD 4ZXBD 5EU6D 5ID0B 2EE2A 1A6ZA 3HC3H 2DBJA 1HQRB 4PJDF 3CZFA 4G8IA 1OGAD 1BFOA 1D7FA 2A6DB 3FRUA 3DUSA 5IJKC 3S97C 2HT3D 1MJ8H 4NQED 1XIWD 3B6SB 2P7TB 4JM2B 3PWJA 3RTQC 4IMLA 5TDPB 1X4YA 5LWYH 2Q86B 3GK8H 2DRUA 3DTXB 1AD0A 1FCCA 3BOVA 1ZVSB 2X44D 4X4ME 5AYUL 1P7QD 4Z77B 1CFTA 5C71A 1CBVL 1IZKA 1F6FB 4ODBD 2CO7B 1BZQK 1UB5A 1HHJB 3BKJL 4O9HH 3U36A 4N8CH 3O2VH 1CGTA 5JORB 5MHSD 2E7BA 4UIKH 4HF5H 4OGAC 5JPMB 1X5KA 1OAZL 1FFPB 3QXDB 3O6LH 5DWUH 4YFEA 3LDBB 1F3DH 1VENA 2HYMA 4OGAD 1KEGH 2W91A 1UACL 1F90H 1BD2E 5DQJB 3VXUE 3L5XL 2X7LA 4PJXE 4QHNB 4XB8A 2P43B 5DMIH 1KLFA 4N0CD 3ES6B 1A6PA 1NCCH 1U3HD 5HYJA 1ZA6B 2QHLA 4L3CB 1CLZL 4M1GH 2DD8H 4LSSH 3S37X 4CL7A 4EI5C 2VXTL 2NY1C 4XT1C 2N56A 1GIGL 1RJCA 4XMKH 3AAZB 5EO9A 4L8CA 4X4YA 4K71B 5D6DC 1Q1JH 1MAKA 4K8RC 4EDXA 1PEZA 5JO5A 1UZ6E 1HNFA 4ISVA 1AHWC 4ZMAT 2IAMB 4NBZB 1A6AA 4PJAA 3QRGL 4YWGL 3UBXG 2GFBA 4GRWH 1I9IH 1KEGL 2VLJE 3F7RA 3GSNH 3S3PA 1UWGH 1MSPA 3S88L 3SGEI 1ADQL 4ODSL 2AJVH 4UV4H 1VGKA 2W9EH 3MNWA 1JUFB 4JDZB 1JWSA 5F93C 1B0RB 4PGDA 3IDNB 4WW2A 1OTSC 1YUHB 3GBLA 4ZUTA 1MLBB 3F58H 4GRWE 3H2WA 2ZUTA 5FECA 5E99L 2RIKA 4P2QE 3FO9B 3QNXB 3ZT7A 2IH1B 2Q76B 2R0WH 3VG0L 4EDWL 1KTLB 5GSRA 3SJVA 2ID5A 4WY7L 3NBNA 4N0YL 4OB5L 4JR9L 2G75B 2I25N 2XFXB 5TFSL 1U8MA 2G75A 1BQLH 5ESVA 2GYSA 3RIAF 2LQRA 3IDUA 3VXNB 1PW3A 4OM1L 1CE6B 4KTEH 1TPXC 1QO3B 4MGXA 5T3ZD 3MRNA 5MI0C 4O02H 1U3HC 1MFBL 1MJJA 3SGDH 1JFQL 1RUQL 4FZ8H 2XV6B 3V4UL 5I1KL 5T5NG 2OK0L 1UCTA 1MRFH 4N0CC 5HTSA 4TQEH 4D94A 5I66B 2NMSA 1K5NB 1HHIB 1CK0H 3VFNA 4OQTH 3VG9C 5TE7H 5EC1A 3BP5A 1NUNB 1XF2A 5T3XL 5LCVL 3QJHA 1J1OL 1NFIA 4J2XA 4PB0H 1B88A 3M1BB 4K23H 4KJPD 4XBGA 3VW3H 1AKJA 3W9EB 4FQJH 3ARXA 4GQPH 4WUUA 2JLLA 4PRPB 1YEIH 2X4RA 4GW4B 3DURA 1SBBA 3QJFB 5JPMA 1M05B 4K94L 4RGMC 3BRFA 1OGTB 1IM9A 1EBAA 1CE6A 1QD0A 2FDBP 4XHJC 2V7NB 4Z0XA 4YBQD 4H1LA 5E5UB 4R90H 1JGDB 3GI9L 1NBQA 4AEFA 1G84A 4PRPE 3FFCA 4K7PY 5GISH 2AI0L 4NNPH 1KULA 4AG4L 3SKMB 3QIWB 1FFOA 1MY5A 1H5BC 1VGEH 4QXWA 1U8QA 2NW3B 1EERB 3Q1SH 5KZCD 3KYKH 2A6JA 1J1XH 3HFML 4RAUA 4QKXB 3PHOA 3Q2CA 3MRKB 3PWPE 1MFAH 1RZJC 5MERB 4NN5C 4ELMF 1JHLH 3HNVL 1CXIA 2H8PB 3ISWA 5I76A 4JM4L 3PABB 3OB8A 1WWCA 4BZ2H 4BQCA 2AXGA 2RCSH 2WIIA 1A3RL 4PG2C 1MH5A 3WLWC 4NKDB 4Y16A 4JO4H 1YPZF 2HTLD 5I17B 5IQ7L 1U3ZA 3DXAA 2P5WA 4OGXL 1E6OL 4GG6E 1W2KT 2VYRE 3MV8A 5LGJB 1NGQH 2OI9B 5ITBH 5I15H 4X4XB 3QWRA 4LLUB 4OSUL 1JPGA 1MFDL 1P7QA 2V5SA 5D70L 4YDLB 4JO2H 4Z76B 3I3EA 1NCNA 1WJ3A 3RWCB 3AFLA 1MRCH 3OKYA 4YPGB 4F2MA 1J0IA 4GLRI 5KVGH 2R4SL 2ESVD 2W0PA 4HH9A 3VFPA 3BH9A 2I07B 1GHFL 2W60A 3RNKB 2J8UA 4LNRA 5KAQF 2XN9B 2AV1A 5IHBA 5D96C 5F7DA 5LGJA 4CMMB 1UXSA 4M7JH 3QIUB 4YLQT 3L3OA 3PNWB 1E6OH 1QFWI 4NM8L 2ZCLL 4JM2D 1UH2A 4LSTH 4XCNB 5ITBL 4DOHB 4AK1A 1PQZA 1HIML 1XMWA 1D5BA 1CXEA 3MV9B 4OLZL 5DTFA 3IJHB 3HG1D 2ZPKH 3O8XC 1N5AA 2E7CA 3T09A 3C08H 3R4DA 5TH2A 2VDOH 4TUOA 5HPMA 3MJ7B 1K4CB 3VMPA 1KPRA 2XZAH 3JWDC 1ZT4A 5GS1A 1DUZB 1F00I 1OAXL 4XPFL 1W0WA 2JIXD 4LEXH 1DQJB 2XWBB 3QO0A 2DQIH 2X4OA 5DURB 5DUMH 3DNKA 5FUOL 1RZJL 3FHAA 4XP5L 1Z6JT 5ACMA 4KQ4L 3ZKND 3QIWC 1YEJH 4JPIA 4Y2DA 5DD3H 1H5BB 1MOEA 2Y36L 3LN5A 5LJYH 5FM5M 2PXYA 2FZ3B 3MC0A 3WD5L 5DZOA 3EGSA 3NMEA 3V7AG 3RGVC 5DHVA 2ZUXA 5HGAB 2QADB 2FWOA 3H9ZA 5BXFB 1RZKC 4YGVA 3C6LA 4M62L 2NYYC 2EEAA 2JJSC 1IQDB 1JCKA 2IBGA 5IWLA 3UTTB 1IE5A 2D9CA 2V9RA 3RUGA 3RX5A 4N0RA 5JNYB 1HKLH 2X4OB 3ZE1F 4C56A 5CSZA 4X5XA 2J1KA 3BGFB 4N8VG 4NNXB 2B39A 1GZQA 2W9DH 1U6AL 1U8HA 1RVFL 2CKNA 4UB0L 1EVUA 5CBAA 1C5DB 5DURD 3CLEH 4EQ2A 3NTCH 2G60L 5TQ2L 2X4QA 4RWYL 3H3PH 1AGFA 1BJMA 4JFQB 3OKOB 1J8KA 4QRTA 2YPVL 1KB9J 2R56H 3JUYA 1RU9H 4D9QD 1G6RB 1T21A 3IETA 4WCYL 5T1KD 2AEQL 3HNSH 3P4NB 4HWEL 4J3TA 4PJIE 3RX7A 3WNNA 3EKCA 3SQBA 3S35L 4PR5A 2PXYC 5HSFA 2X2YA 1I8KA 5KVDL 3OXSA 3AC0A 4BQ8A 1DBML 1UWXH 3OKEA 3DXAB 4PJAE 2JIXA 3K2UH 1A7RH 3N50A 1MCPH 3QWOA 2JCCB 4NQCA 3QIBD 3QCVL 4XMPH 4LOUD 1ZGLB 1KJ2L 1T7YA 2BVQB 5CZXC 1MCPL 1R3IH 1WAAF 1NMCC 3UJTL 1F4XL 1UXWA 5DA4A 4NHCL 5EIIA 2AEWA 2CK2A 2HN7B 5FGCB 5DC9B 5KAQG 4I3RH 6FABL 4P2QA 4WCYH 3UO1H 1KXQE 2IMMA 1SJVA 5L8LB 3CPLA 2BNRA 4MHHG 5I17A 2F54D 1S5IH 1II4E 2IGFH 4NQEE 4PRNA 3JV0A 2XWTA 1FVDB 3I6GA 4V1DB 1ZHKA 4U1GC 1A02N 5FGCE 4NQEA 4O2CB 5EIQA 4BSWA 2D7NA 2NY7L 2XZCL 5B4MC 1FFQA 2F5AL 1KJ2H 2EYSB 4CU8A 1N59A 3PWUB 5EBLB 2I9TB 1FL6A 3NCEB 4KK5D 5DT1L 4UV4L 4JQVA 3FRPA 2X6MA 1T0NB 2AAVA 5BRZE 3HCVA 4I0PB 3SDXE 3AREA 1KB5L 3WXWH 1C12A 3QUYA 5E6IA 1DQML 4LSQL 3ECBB 1K3ZA 4JFFE 4JKMA 1BQSA 3GIZL 3ZDYF 3WS3A 2AQ3A 5F97E 3L3KA 2E9BA 4ZPTB 5HYEA 1ZSDB 3VG0H 1IGJB 3C8DA 4LSDA 4EDWH 1J86A 2HFGL 1K4DA 2GSIA 3MUGB 3EHBC 1OP9A 4ZUSA 4AEHH 1DBKH 3RAJL 3CC5A 4RMUA 1YEDA 2QQKH 5FF6B 3DSNA 3MBXH 4LCIL 5F3HA 3QI9C 3OGCB 4HKJB 4KJPC 3BEVB 1DSFL 5TE4L 1X5GA 2VDML 4KKAD 2OCFD 4OZIE 2UZYB 2C1OB 4XMLL 2WUBL 1S7TB 4PJ5A 4K71C 2EDLA 3GSOA 5EDXA 4N9GA 4FXGB 4YHKH 2V9QA 1WT5C 2EDHA 4CNIB 3GMMA 1IAMA 5I2IB 2H2PC 3FQRB 1QSEB 4IRZL 4B7LA 4WTWA 5IFHL 4XCEB 5C0GB 1J11A 1C08B 2NXZC 4PJCF 1GAFH 5INCB 1E4WH 4U6XB 1U91B 2VXVH 1FZMA 1KV3A 4AIXA 2PKDA 1WEJL 1D9KC 4G6FB 3HI1B 4YBLC 4UQ3A 1B6DA 1QO3A 1V3KA 4OLZH 5F44A 3Q1SL 4Y2DC 4NO2B 2ZPKL 5MEOB 5IR1B 3BJLA 4HUNB 1BOGA 1CS6A 4YIQA 1M7XA 1ZVHA 3GIZH 3KLSA 2OTWA 4FN0A 2W0LA 1WLHA 4EN3A 3OHXA 5HGBA 5C3TA 5I74B 2L0DA 4DGVL 4M7JL 1BF2A 1GOFA 1QFOA 4U6HA 3MLRL 4I13B 4C57C 4MA7L 4N9GB 4YEEA 3V0AC 3VFRB 5C0EB 4CU7A 4R97B 2QQKL 3QI9D 4ISVB 5DUPH 2G2RB 2GKIA 1K8IB 2WLZA 1DFBH 1NMAH 3EHBD 2DLFL 1VADA 2CMRL 5C0AB 5DMKB 4G6FD 1YECH 1P4IH 1I7RA 4S2SA 3OBAA 4S1DC 5HXMA 4KJQC 3Q5OA 4N0UE 2R2EA 4R2GD 2NY4C 1L9MA 4ELKA 3JV4A 2BOCA 5BMFH 3K80A 3CU7A 1CFQB 1JVKA 4ZDHA 2D2OA 3WFBL 2VTFA 2ED9A 4B53A 2Z93A 3MJ9A 5K9QI 2DLIA 5CP3H 3RY6A 5J12B 4F57H 3DO7B 3CXHJ 4GAJH 5I1JL 4LCWB 4W6WB 4DVBB 3BDYL 1D6EA 5ALCL 4CW1A 1PKOA 2UZIL 4Q0XH 4HWEH 2BK8A 3P2TA 3RUGF 2FSEB 4DVRL 5FCUH 2UWEF 3S35H 4GMSL 3O2WH 3U7AA 1RZKH 4JDVA 1YNKH 3MLUL 1ZLVH 3NACH 1OOAA 1KLGB 4GMTL 1P53A 2Q76A 4LRNH 3IU4L 4NRXB 4LNVA 1EEZA 1U42A 4NJAL 1IRAY 5KW9H 4Y2DD 4K3GA 2P24B 5TQ2H 4FQ2H 5IROC 4PYHA 1ZLVK 3LY6A 4AIOA 3DUSB 2OL3B 2VC2L 3JWOH 4H5SA 1TIUA 2YEZB 4WW2F 2VLKA 2ZJSL 2VITA 5DVKA 1EHAA 5IMMA 3LOWA 1QSFA 2QKIA 3WMSA 1A1NA 2C7UA 3RPKA 4POZC 4M43H 3DSFL 4FZEH 1V3LA 5T1MB 4HIEA 2JK5B 2APXA 2IAMD 3GSWA 1JZ5A 1G7JA 3MRDB 1VADB 4HFWB 3HE6B 3E6FA 5F1OB 3L3IA 2OR9L 4C56E 2A77H 3FT4B 4WUUB 3MBEC 5F1SA 4X6EB 5C86A 3BDXA 4K7PX 4MAYA 2MNUA 2PW1A 3SDCC 1NGPH 5GGTH 3AAZA 1P4BL 3LQAL 4XNYL 3OTTA 1RZIA 1DUYB 2ZOKB 3SJVD 4NIKB 4XNQA 2ESVB 3KYOB 4QHKI 4BQBA 3GIVA 1MNUL 2GAZB 1K4DB 1MCLA 2O26U 1FNFA 4P3CH 4PG2A 1ND0B 5TDNA 1P5UA 3PGDA 3EO1A 4ZNEE 1CI5A 1BVKB 1TJIL 4GXUM 5KSAA 1BMGA 5IK3A 3T2NH 1TZHB 2VISA 4Z0BL 5GGUA 4OF0A 3S37H 5D7JB 1J88A 1BQHA 1H3UA 1HQ4B 1KJMB 1UC6A 2H2SC 3B9DA 1INEH 2FX7H 3BZ4A 5E5MB 3SKOB 3DYOA 1HEZA 3ZHDA 1P69B 3IRPX 5F71A 2DF3A 2OSLA 4YR6A 4LLVB 3BZEB 2NY4D 2BSRB 2I9TA 3S3JA 2DJUA 1ZWIA 2GIYA 3LKOA 3QEUB 4DUXA 5IR1A 4CKVX 4K3EH 4PJHA 1P6AB 1I9EA 3H3PL 3ALPA 5A2LH 2BXYA 5HHME 3DVGB 4ERSL 5GSVA 3SO3C 1WWWX 1ULVA 2IPTL 3U30C 4PRNB 1NFDE 4MSWB 1URLA 3RTQA 5E8PA 1YEFH 3CPLB 4MCYB 3BUYA 5AG9A 5B8CB 4C58B 4YHOL 1PG7W 3KPRB 4M5YH 3MRRB 5JW5A 1J5OH 3QDGB 3QQ3B 1CGUA 3BO8A 4MHHI 3VMNA 5JOPD 1R6VA 4G8IB 4DGIL 3JWOC 3BE1H 3EFDL 2AV7A 4KVCL 5I2IA 4R9HA 4RQQA 4Z8FH 3BKML 4MA1B 2AJYH 3HA0A 1X5LA 4PGEA 1ZS8A 4LCYA 3PWLB 3BQUB 25C8L 5FYJU 3L3KB 3QH3B 3MFGB 4NKOA 4F58L 4X7TA 2OP4L 1R0AH 1JYVA 4NQDE 3ARFA 4X80H 2F54E 1HH9A 4PREB 1XGYL 2B20A 1GC1L 3BXNB 4PREA 4LVHB 4N8VB 5FKAA 2FATL 3FN0H 3G5ZA 4PJIB 3HR6A 1CLOH 3GMOB 4MA8L 5DRNA 3BH8B 2AXHA 1DBJH 4A6YB 3MODH 1XIWC 3NIFE 1XCQA 3TN0D 1JV5A 1ORSA 4KRMB 4OCNC 3MLRH 3GKWH 3PUCA 3QIBA 4DZ8A 3OF6A 5ACZA 2YBRA 1JJUA 3KPRE 5J6HA 3S4SA 3O4OC 1AD9B 2D0GA 2K7QA 4MDJB 4WIQA 4HC1A 4DEPB 3B9KD 5ADPL 4PJGB 7CGTA 4Y5XC 3C9NB 1FSKB 1IKFH 3O3AB 3BP6B 1BVZA 4PRIE 2VERN 5EWIH 4YAQB 4XPAL 1AO7D 5EOTB 1KSRA 2ZKHL 3TZVA 4ONFL 1NCDH 1OD9A 3O11B 1RZ7L 1PFCA 4RZCA 5BXFA 3TA3C 1JHLL 4QRPD 4WW2C 4NQSB 2ERJC 1G7HA 2BVQA 2JCCE 4PJ8B 4LVNC 4I18C 1I3UA 3TN0B 3VA2C 4C55A 4TYUA 5IFHH 3QUZB 3QCUH 3VA6A 2BXZA 3OXSB 1G7PB 4MAYD 5FHBH 1U8LB 4MQ7B 4JQIL 1JZ2A 2R0ZH 1JPFA 2EXWD 1NPUA 3FB6B 3ARFD 3RWJA 5GSVB 5KSBE 3M17B 4QLRA 1NEUA 4E5XB 1A7OL 4RZCB 3TP4A 3T77A 5ADOH 1Y0LA 3ARUA 1S7VB 5I30H 2Y25A 5E8DH 4LLMA 5ALBL 1X5YA 2PXYD 3EYFA 1JGDA 1LMKA 5ERWA 5DR5H 4P48A 3HI6H 4ZFZB 2AJXL 1TVBB 2IF7A 4HGKC 2BC4B 3V6FB 1P9MA 3OSKA 3B2UD 1CZ8L 1RUKH 2P5EB 5FYLE 4Y2OA 1NAMH 2C1PB 5GS0L 1EO7A 5D5MF 3TT1H 4EBQH 4O58L 4Z7QE 4DZ8B 4JFXA 1AXSA 2HRLA 4LSUH 4X7FC 4HCRH 1HZHH 1IGFH 1NMAL 4P59L 1ERNA 4GS7B 5EWIL 1XGQB 3MA7B 15C8H 5C2UB 3EYSH 5IMOA 2WQ8A 5IGXH 1T1YB 3GSVB 4JY5L 3DROB 3TYGH 4GG6F 1I3RB 3FOMB 1FGVL 5MHSE 3H9SE 4NBYB 2AJVL 4ODUA 3MLVH 3SY0A 1DUZA 1IEBB 3S3SA 3KPMA 4ORGB 4I2XA 4LSPL 2A38A 4RDQG 3CVHH 1AXTH 4YDJA 3B3IA 3L5WA 3OJMB 1H8NA 4POUB 2DJ4A 3QPQD 3O6FD 5SWZA 2R0WL 2N4IA 2IMNA 3GRWA 5I16A 1U6AH 4K07A 5IFAH 5E8PB 2J5LB 2VNCA 2ZUYA 1DVFB 3MRPA 4YDKL 3LKQA 1OAQL 2W9EL 3FO9A 4X4ZA 4QXUL 1WBZA 1TZGL 3IS1X 4XPGL 3LD8B 4GRLB 4X8XA 2CDFB 2ZSWA 4R96B 1ADQH 4ODSH 3U48A 1WF5A 1PG7X 3MFFA 1VGKB 3BZFB 4GUPB 3DX8B 1C5CL 5T3ZE 2VMFA 3QDJA 3TPUB 3QNYA 3C5ZB 4PP2A 5D7JA 1YEGH 1Q9WA 5I1GL 1B3JA 4JPVH 5DDHA 4NJ9L 2P5WB 1JWUB 5DD1L 4MAUH 4NQVA 1N5YH 5JO5B 1YEHL 5H37H 4ESKA 3CDYA 1WQVT 3FOLB 4ETYA 1CICC 3FFCD 1AGDA 1ZOXA 1AP2A 4TOYH 5H2BA 4O4YL 4ZFGH 1NGZB 2F8OA 3FT3B 4PG9B 3NFNB 4OZGB 5ESVB 1LILA 4PJCA 4NRZB 3ULUL 3ME0A 2AABH 2XFXA 4JHBA 3TC9A 4XNZC 2CIKA 1CDYA 1F5WA 5C0AE 3JTTA 1OAKL 3B2VH 4YUEH 1AE6L 4XNMA 2J4WH 1EK3A 4BM7A 1TTGA 4DGIH 1YJDC 5SX4H 1DBJL 3U83A 1EJOH 1MQKH 3HE6A 5BVPL 4HW6A 2Q6WB 4NKDA 4PLKD 1RFDL 2XZQH 3ZE2F 1HSAA 3EFFA 4OFVA 3QI9B 3MUZ1 5HJ3A 1FRGH 1I1FA 2EEBA 1TJHL 2W0KA 3I9GL 3IDNA 3GHEL 4UDTA 1NANH 4NWUL 2AQ2A 5D2LB 1R0AL 3HMWL 2P44B 4EKXA 3P4OA 4MDIB 4MJ2A 1S7XB 25C8H 1D9KA 1VB9A 3B9KA 4S10A 3DLQR 4WHYH 3INUH 1ZLSH 5KS9E 1FL5B 1SVZA 4YUEL 2IAMA 1MRDH 2P5WD 4ZSOA 5KVFH 1EHLH 4YHKL 3DV6B 5D2LE 5GGSA 5GHWH 5HHVL 4Z0BH 5HGHA 1NSNH 3IU3B 2DL2A 4P49A 2VAAB 5HHPA 1GGBH 1HXYA 3NCYP 3KPQB 4R90L 3QZWA 5C0JA 2NY7H 3TO2A 1BBDL 2OJEB 3GJFH 3O4LD 2Z0BA 1LO4H 3W0WA 1RZIB 4R4ND 4WDIA 3ARQA 3FB8A 4P46D 4FQJL 1TETH 4D0BA 2Z93B 3TBSB 4KTYA 4J3VA 3JWDH 2E7LA 1YNLL 2Y07H 3MLYL 1PX4A 2EDJA 4MNGB 3TBVA 4M1CD 4YQXH 4TVPH 3S96B 1D9KD 2CRIA 1FJ1A 3AS3A 4W4NA 5I6XC 3TO2B 2YD5A 1IEAA 5CP3A 4I18A 4IDJL 1N26A 4PB9H 3WO3B 5KSUB 3HRZB 4IDLA 4JO3H 2ZCHH 4GRMA 5ICXB 4P4RB 1ZT7B 3Q3GB 3TWCH 3GHBL 3QEQD 1NCWL 5MEND 4FA8A 4Z7VA 3VGEA 3TJEL 3QFJE 5IB5A 5FDWA 2P8LB 3FONA 4JRWA 4E0RA 3BWAB 4K7FB 1KFAH 2F19L 3SDXA 1IGFL 5IB1A 1W8NA 3U36B 1FH5H 3RWDA 1S7SB 5HHMD 1EEYB 2YMXL 1MFCL 4U1IA 3SPVA 2ERJB 4HDIB 3MX0A 4FQIL 3TIDB 4Y89A 4BJLA 2GSGA 4JKPL 1MIML 4QCIB 4MNQA 3KDMA 4OV5A 2DQIL 3UDWC 3LPWA 2AI0H 1E4JA 3F5WA 3ZYOA 4PJDA 2B5IC 2KQMA 2BJML 4MNQE 4Z5RA 5HYIA 1BVLA 4Z7VB 4HUVB 3FRPG 5EA0H 1WZMA 2VQ1A 2C3GA 1MAJA 4YHNB 1EXUB 1FE8H 3CH1A 3IDXL 1KG0B 3QEHB 3O9WA 4W6YB 3U7YH 3O6ML 5EA0L 1X6NA 2P46B 4NYLA 4L9LB 5EH1A 5JR1L 1AD9A 3CX5K 5EOQL 2FYYB 2GJ6B 2PYEA 5EIIB 2HVJA 2I9LB 4JFDB 1KJ2A 2ADIB 2UY6A 4OCRH 1CGVA 4ZAKC 1WT5A 3FQRA 5ID0A 1P1ZA 4M7LH 4PJAB 4NQCB 2AKRB 3PHQB 5HGGS 1PDKA 1VACB 4ODVL 2X42A 3B4NA 3RVWD 1R3LA 1N3NB 3G5YA 4UB0H 1T4KB 4IS6B 4GAGL 3VFUB 1H15A 2Z8SA 3AMLA 3BQUC 1RZJH 3SCMC 3MRGA 1G6RL 3IKKA 2FL5B 1CL7L 4MJ5B 2Q8BH 1ZA3A 4M6NL 3ARFB 1C1EL 1D5ZB 4PJ5D 1RZFH 5AZEL 1FIEA 1F4HA 4YHYC 4ZFZA 1V05A 4KHXL 2CJUH 3EZJB 2VL4A 5EPMA 4M3KB 1OM3H 4I1NB 2H45A 1JYWA 4FQHA 1XIWB 3ZDXF 3V0VB 3CXHK 3I6GB 5BMFL 1OGAB 4HGWB 4X8JA 3RDTD 1JIBA 4UIKL 1YEJL 5CSZB 1PX3A 1S7XA 3IRZA 1U3JA 3DOSA 4Z95H 1SHMA 4JGUA 4XXCC 5C09B 3OGOE 1BFOB 1DVFD 5DUPL 4FP8L 1HH6A 1XGQA 5K9JH 3VD9A 2VXTH 4PD4K 4S1QL 3NIGE 1JGUL 1I1FB 3BKCL 3RGVA 1YEGL 1RUAH 3OKLA 3C8KA 3MV9E 5C6WH 5L9DL 3I6KB 2FJFA 3NZ8A 2IPUK 4XWOD 1MFDH 4NT6B 3DTXA 2GITA 3MNVA 5BRZD 4X6DE 3MACL 5GRUH 4LLYB 5T5FL 4JJHA 2VB5A 2WWMD 5KJRH 2GJJA 4Y4KC 5FYLD 3RA7L 1U92A 1IJ9A 4TTGA 3HE6C 4QGTA 4WU5B 4XVUC 1X5FA 3MRLA 4JFHD 1FN4B 1P84J 4JFED 1L0XA 3CFIC 4NOFA 3HE6D 5EBWB 1T0MA 4EUPA 2CUMA 3V0VA 4H88H 4LVEA 1IGML 5GJSL 1T83A 2BOBA 5ACZB 3ZE0E 4ZFGL 4MD5A 1PVHA 2NY6D 1WV7T 1N0XH 4HKZA 2UVEA 3RZCC 4G6KH 1AGFB 1BFVH 4O51A 2IPTH 3DX9B 4UOW0 5HHOA 3VDAA 2WW8A 5AYUH 4CVXA 3V79C 3GMNB 4P3CL 3BN3B 2NLJB 1JI1A 2A1WH 4OJFL 2CDEA 3UTOA 43C9B 2CRYA 4P46A 3MLZL 1JF6A 3GNMH 3WNOA 2NYYD 2GHWB 5EZIH 1XGTB 3ROLB 2E8YA 3VFWA 1DN2A 5CCKL 3ZKNC 5FO8B 4QRTB 1YYLL 1JK8A 3UZEA 4BUGA 4OGYL 4QXUH 1H3PH 1WFNA 2VLLB 3AB0C 2DI9A 4RRPG 1DSFH 4NQSA 4XMPL 3HZVA 4MVBD 4OZ4B 4OIIL 2P8MB 2ZG2A 5JQ6H 3CJJA 3QA3B 1N4XH 3BO8B 4ODTH 4DKEL 2PTVA 2ZG3A 4F37K 2XG5A 3ARDC 3RI5K 2Z35B 3C9NA 3E8UL 3S34H 4Y5VC 2VDRL 4M4PA 3RVVD 1OSZA 5DD0H 3B83A 3OKDA 5J4MA 2IAND 4L3AA 4RAVB 3R8QA 5DRZA 1J1OH 3BHBA 3SE8H 2XICA 1WWBX 3H7BA 5EC2A 4Y1AE 3UTPD 4M61B 3QO1B 4FTVB 4JAMA 1TZIB 5GIRA 3ULVF 5BJTB 4RNRA 1KB5H 4HC1L 4LDOB 1YPZB 5KS9A 5CZXD 4HUWA 2Z35A 1Y6NR 3V9FA 4ZSOE 5A1AA 2ADFH 5E24E 4U1NA 3WFEL 4J3UA 2VLKD 1T5WB 4QY8B 5D7LD 4X7SH 1LO2L 4OIAA 1N0LA 2IGFL 4OLEA 3RVXD 2FGZA 3RL1B 3QUMB 3OR6B 4GAFB 2NXYB 4LIQH 1KCLA 5INDB 1F3DJ 5K9OA 4ZOEA 1J9CT 1S9VB 2H32A 3BH8A 4LARL 5CEZE 3O3DA 2XIDA 4DKFH 1KFAL 3MJ8B 4GKSA 1U36A 2W0FA 4OZFA 3RWIA 4JFPB 1T4KA 4GOSA 5T1DL 4QOKB 3BQUA 5LBSH 1FBIL 1DDHB 5EUOA 3CSYB 4IOSD 1OTSD 5L7XL 4U6YA 1TQCB 1D5MA 4L4JA 4P0DA 3PF2A 3KDMB 5F9JB 1TVHB 1J7VR 3KPOB 4PB9L 4X6BB 1S8DA 3L9RA 3ROOA 3MV7D 3KHOA 1OLZA 1HH6B 4GRLD 4Y4HB 3LS4L 2YKLL 3VFNB 1G6VK 2UZXB 4NDMB 2BDNL 2NXYD 3HUJF 2GJ6E 2EDKA 5I66A 3IDGA 4KHTH 2BNQD 3LV3A 2WANA 3WDJA 5FO9B 1LDPH 5CZVL 4L4TD 5FYJL 5GS0H 5I8KL 3OV6A 5EUOF 5SWZD 5SX5H 3V5DA 3C87A 3EYUH 1P4IL 4JRXD 4XPTH 4AIZA 3AUVA 3LRSB 1CD1A 1VFBB 1KEML 2FLRT 1D9KB 3WO4B 1WEJH 4R7NB 1NGYA 3ULVH 5HBBA 5F9OL 4OT1L 2FRGP 1DN0B 2VUOA 1ACYH 3LKOB 5JXED 4LRIC 3BRDA 4RFNC 4YBQC 4KI5C 1F6LL 1A9EA 1E6JL 2BNQE 3MRKA 1U2HA 4NM4L 4XNUH 2QQLL 2VDPH 1F58L 4CMMA 4FQQA 3B8SA 1NCUA 4UTAL 3RNKA 1MI5B 4JZOA 1RULL 3MRMA 1QVOB 4FXLA 4MQTB 1JP5A 4Y4KD 5CJOL 1PBYA 3ARPA 4PV8A 1QQDA 2ZUSA 5L0QB 2NY2B 3EO1B 5DJCA 1K6QH 2MWCA 2IC2A 4ZO7A 4LK4A 1JV5B 1XR8A 4YPGA 4Q9QH 3TCXA 3R0MA 2Z91B 4G6JL 4NHUB 1R5VB 4A6YA 1CICD 4CGTA 3ARVA 4YJZL 3BP5B 3RJQB 2AS5M 2FCBA 3VRJA 4OZFH 1OGTA 5J11B 3LB6D 2A0LC 1H0DA 4HS3B 2BHYA 3L5XH 5JDSB 3KNBB 4JZNB 3WKNA 3KR3H 3WDIA 3H9HB 1Z0MA 4K8RL 3QQ4B 2P24A 3VXSB 1RULH 2XNAB 5GJTL 4KWUA 1CT8B 1A6TA 3LQMA 1T80A 1FGVH 2FIRT 1XR9B 3BGMB 3UXFA 4HIXH 2OJEA 1OQXA 3S5LG 3U46B 2QSCL 4GFTB 3FAXA 4X6CB 1NGWA 5L9DH 5LGKA 4H5SB 3O45A 3VRIA 4KK8C 3ULVL 3BUYB 3KPSA 1LE9A 3CDCA 4NQEB 4O2CA 1CICB 4X98B 4CRPA 3DGGB 3CK0L 4J4PC 5GRXG 3REVB 5ETUA 1EEZB 4LSRL 3DHJA 4E42B 4PJEF 3NFSH 4FTVE 1NDGA 1UKSA 1T0PB 1MFNA 2J8UE 4XC3H 5F1NB 3T0EB 2F74A 1JGEA 1ED3B 1GGIH 1RK0A 2Y72A 5F7EL 4YGAB 5EO0B 3HUJE 5E95B 4UAOC 5C0DA 1M7DB 5DXWA 3E2HC 3E0GA 3IXAB 1J87A 3E2HB 5ANMB 2C26A 1G9MC 4YZFF 4UT7L 2NY1D 5F9JA 3CVIH 4CNIA 4HXAL 1LO0L 1NLDL 5E7FA 4ZAKA 1A6WL 1TJIH 4CADA 2EECA 4D0CA 3TBVB 1J5OL 5ETUB 5EU3B 2P7TA 2YD7A 3MRCA 4JM2A 1T3FA 2Q7YB 3V2AR 2XG4A 5KVDH 4PFEA 1OF2A 4PGDB 1J0YA 4HKJA 4PGBA 4HQQH 4F7PB 1UM4L 1WC7B 2BZDA 1JUFA 1MCRA 4JDZA 4UUJA 4ERSH 4XNXH 4X6FB 2Q8AL 3L3DB 4PJBB 4JPKH 4XNQB 1RD6A 1MHHB 4WGWB 5HHOE 2YPVH 5HDBF 3ILPA 4GBXC 4WW1B 5I19L 4QHNA 1RJYA 1AGCA 4UQ2A 5E08H 3VH8G 3VXSA 4C4KT 1F3RB 2YZ1A 1MHCA 5EZJB 3S5LB 2EH8H 1LO2H 5IVNA 4IJ3B 4LASL 4M5ZH 1DBBH 5EO9B 3GEWB 2ENSA 1A7NL 3F7YA 3SE3C 1DLFH 3IFPA 3SE3A 3FQTA 4XXDB 4GKOA 1IEHA 1OSPL 4JGJA 5GS2D 2BVEA 1NFDB 5E2TL 5E8NB 3WL9B 4FHBD 4KKBD 5GIRB 4WFHE 3L6FB 3TT3L 1E4XH 1BX2A 1NDGB 2XKUA 1HSAB 5EOCH 3X12A 5I19H 5TQ0L 3H42H 4MAYC 2EE6A 1SJEA 3ARSA 3RWEA 2GTWB 3EOTH 1IGCL 4X7CC 4Q6IA 2W1NA 3PHSA 4U0RC 5SWQB 1OSZB 1P7KB 2XQBH 2AERT 4QNPF 4LIQL 3RVVC 3O41B 5BVJB 2RBLA 5ISZD 3CFDB 5JZ7D 2BX5A 3B2UC 5CKAA 3RBGA 2P8MA 3QHZL 3FTGA 2FECI 3WIHL 2DQEH 3BGMA 1Q0YL 5IT2L 5JW4R 5HYSG 1KJ3H 5JXEC 1Q94A 2CD0A 4U1SA 2VDKL 2WINB 2A9NH 3UTTD 4NUGH 2P49B 2F54A 2R1YB 5IP4A 3PWJB 3HMXA 5CP7A 1P6FA 2GQHA 3B9EA 3D0VB 4ZFOB 1MRDL 2LTQC 3OZ9L 4RMVA 1P4LB 4ELKB 5D2NA 1NC4B 3V6BR 3CNKA 1AI1L 4U0QB 3CFKA 3LB6C 3D6GA 3X13A 4H0GA 2YXMA 3WIFA 2A6IA 2FATH 3R1GL 1U58B 4M00A 1JN6B 2R1WB 5E1AA 1E4WL 4JFQA 3MOBH 2AXJA 4F2MB 2X1WL 3KPNA 3T77B 2D7TL 4YHLL 4Y19D 3O4OB 2UWEA 2V5TA 2NTSP 3WFCL 2E3VA 2VKXA 4DEPC 4MQ7A 3DX6A 1FLTX 4OSUH 4DFIA 3IT8D 1C5BL 2BNUA 4NKIH 4PV9A 3INUL 5DC0A 1NDMB 5T33L 5SWZB 4IEFB 2H32B 4J7RA 4LRIA 4AM0B 3B3IB 5FHAL 4NM4H 2HJLA 4G8EA 5MEQA 1ONQA 1BAFH 3ARGD 1GHFH 4OF3A 3G6DL 2CRZA 43CAB 5LKNA 1G1YA 3PWNA 4CDHA 3QDME 3CLFH 1ZXQA 1FVDA 3OR7B 5D1ZC 5KSBB 3ARZA 3RAJH 4F7EA 1T1XA 1RUPL 1NBZA 4F3FB 1I4FB 2Z8RA 3I75B 3H0TA 1MAMH 3DI3B 4YFLI 4WTZG 1T66D 1F13A 1JYNA 4PJGF 1A4JB 3BMVA 1LDPL 4JO2L 3S8WA 2Q1EA 4ZFFA 2X4UA 5IQ9B 2VE6B 12E8L 2Z4QA 5C07A 3L7FA 4RIRB 3MPCA 1HK6A 2DMCA 2F53D 4RMRA 5DI8A 3TJHC 4OD1H 4N8CL 4FXGA 3BPLC 3OKNB 4PJ5B 4L1DA 5IKCB 1I1AA 4UU9B 5EU4A 3OXRA 1I8MB 2BNUB 1KCKA 1JPTH 1L7TH 3ROLA 4HEME 1P9MC 3TA3D 1GC1C 2NZ9D 1INDH 2B1AL 3NCJH 4HLZH 2R4SH 4JLRB 4HS8H 1A8JH 2P5EA 2VC2H 4RISL 4E41B 2X4RB 4XAKE 4NUJA 1FO0L 3PP3K 3LKNA 2HKFL 2QR0B 3EYOB 3ZYZA 3D25A 4R4FL 1F45A 5FUZH 4PGEB 3IJYB 4EBQL 3D25B 2EH7L 4HG4J 3RGVD 3ULSA 3STZA 4Y4FB 4JVUA 2FO4B 3X3GH 3UX9B 3IF1A 1SM3L 4L3EA 4U1NB 4KZEL 4P9HL 1PKQE 5M94B 4NZJA 1T2XA 1YQ2A 1KJVA 2DIBA 4BKLA 1LD9B 4MS8D 1WZ1H 5IGXL 1HDMA 4YHZH 4FQ1H 1RK1A 3HE7D 1T6VN 4FFYL 5DGQA 1S7VA 4TUOB 3C6LB 1T04A 2GK0B 3B9AA 2P5WE 1XFPA 2JK5A 3FQXA 1FORL 3GMPB 4NQTA 3LS5L 3R0NA 2XTJB 1TQCC 1AHWB 1AXTL 3MV9A 3QQ3A 3HPLA 4WTZA 1A4JA 3NIDE 4H8WL 3QDGE 5D7KE 4DTGH 2ZSVA 4MXQC 4JG0L 4PTUA 1ACZA 3E1F1 4XNXL 4HBCH 5SWQA 2V17L 3FONB 4UTBL 2DQJL 5AWNH 4YHML 4TSAH 2AJXH 3VFPB 2EDBA 5J06A 4HQQL 4XHQA 4C4KO 3ZKXB 3MRFB 3FQXB 2DICA 1BJ1H 1O7VA 2DN7A 1J12A 2ORBL 2RQ8A 3CGTA 3TZVD 4LLWA 1QLRA 3BP6A 4K9EC 3BQUD 1EAPB 1C7SA 4Q9RH 1WBXA 1PLGH 1A1MA 3NPZB 3DO7A 2K3TA 4ODHL 4PJFF 1KYOK 5K9QG 1MCOH 3O9WD 5H37G 3BH9B 3D0VA 4ELME 3WUWG 4YDIH 2ATPB 4P4KC 3IU4H 3B5TA 5T3XH 1YYMH 1GXEA 5EBMB 3LQZA 3MMEB 4JPKL 3NIGF 1T7WA 4DZBA 2BRRH 4A6YL 4FFWD 2NXZB 2PYFA 3BIKB 4NPYA 4OM0L 5CIPH 5DRNB 1SMOA 3FTGB 3D18A 4IOIA 1WWAX 5C0JB 5IW1A 1I1YA 3MZGB 1FNGA 1NC2D 4G9FA 3LKRA 1HHKA 5B8CA 3CVIL 3P30L 4FFZL 4ZPVB 1TMCB 4P2YA 1A6WH 3O2DH 2NY4B 1OAKH 2FEEI 1MJJB 1FPTH 1YPZE 1JZ3A 2CR3A 3QDMB 3D48R 4N5UA 1MWAH 1U8QB 5L2KE 4RQQB 2X4TB