2IPUG

Pfa1 fab fragment complexed with abeta 1-8 peptide
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
223
structure length
219
Chain Sequence
QVTLKESGPGILKPSQTLSLTCSFSGFSLSTSGMGVGWIRQPSGKGLEWLAHIWWDDDRSYNPSLKSQLTISKDAARNQVFLRITSVDTADTATYYCVRRAHTTVLGDWFAYWGQGTLVTVSAAKTTAPSVYPLAPVCGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSGLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for passive immunotherapy of Alzheimer's disease
pubmed doi rcsb
molecule tags Immune system
molecule keywords IgG2a Fab fragment Heavy Chain
total genus 42
structure length 219
sequence length 223
chains with identical sequence H
ec nomenclature
pdb deposition date 2006-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ipuG01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ipuG02
1U36A 3MGTA 15C8L 3TN0D 4U3CA 4ONOA 1CICD 3QNYB 3PWUB 1RZJC 1NCWH 2ICWA 4HSQA 3PDOA 3SGJA 3PG2A 4JRYD 1BVLB 1YY8A 5EFIB 4OQTH 3TC9A 5A2JH 4PFEA 1ITCA 5CINL 1JHTA 4EUPH 1CL7I 1IC4L 2OR8A 1SM3L 1R3IL 4RFOL 1PEWA 1OAXH 3S37H 1P6FA 4OD1H 2YEZA 1CI5A 1R3LB 1FNAA 5EZLB 3OTTA 4ZXBC 4NQCB 3F7RA 3RVTD 4RFEB 3HE6D 2VISB 2NTFA 5LCVH 4M02A 4FFZL 4FFVD 4ODXB 3TM6A 3UTOA 4YNYA 3ULVL 4MDIA 2JB5H 3WFCH 4TUKH 3SE9L 4TNWK 3BQUA 2BHYA 5J12C 3RNQA 1RK0B 5E2WL 1TETL 1CFTA 3B3IA 4NT6A 3SHSA 4WUUD 1GIGH 4HV8B 1P2CB 2EXYD 1QR1B 3ARQA 3O6ML 4KJQD 3AS0A 4M00A 3VXRA 3TBYB 5DQ9B 3IDUA 4XVTH 4KRNA 3I02A 1HQRB 1C5CL 4MJIE 1K85A 1G7JB 1GGBL 1TQCB 2X4NB 4JJHA 3D18B 3LQZB 1L7IH 3EO9L 4ALAH 1RFDH 1FV1A 4OM1H 5DRZA 3IKKA 4JN1L 5EO9A 2MQ3A 3RL2A 3TYFA 3B5HA 3FTGA 1YPZB 2GYSA 3MRNB 3QUYD 3PV6B 4BZ2L 2A38A 1L6ZA 3LEXB 1JWMA 4Y4HD 1CXFA 1RZGB 1XR8A 3JV6A 3TBSA 5MEQA 3O4LA 5AYQA 4Z9KB 5D1XD 3CPLB 3G9AB 2JTDA 4LP5A 5E8DL 5FK9A 3PQYA 4OFIA 1AD9A 2FH6A 3U82B 1U0QA 3INUH 4OGXL 3JUYA 1MFNA 1QFHA 3O41B 2IC2A 5ABDE 2BVOA 3ISWA 1X7QB 1P4LA 1FC2D 2DDQL 3TVMB 3DRTB 5L8KB 4ZS7L 3VGFA 5D2NA 2V2TB 3Q1SL 3K3QA 3F58L 1FAIH 2WANA 4LLMA 5MERB 5DEFA 3SOBL 3VU2A 4M1DL 4MCYA 4XP5L 1M4KA 2FJHB 2D31B 4FA8A 1RUQL 5C70A 3GJEA 5FKAB 3GHEL 4PJFA 1U8OB 4QXGH 5AZ2H 4DGYL 1DVFB 2WBJD 2FDBP 1JPTL 3RGVC 5HI4C 3LEVL 5JO5B 2ERJC 1WCQA 5E8OA 4RDQG 2FB4H 1NAMB 3JTTB 2GFBA 4AT6B 4LSUH 3E0GA 1MHHA 3ARFC 3CXHJ 4PB0L 4PJ8C 4KUZH 1F11B 1AR2A 5HD8C 4NQCD 3E8UL 3ILPB 2IBZY 5D7JA 2E6QA 4DZBA 5HGGS 3T0WA 4K3DH 3DXAA 4M4RA 3QULB 4OTXH 2EZ0D 4WW2B 1V7MH 5C0AE 4JFFA 2BNRA 3LRSA 4U1SA 4GUPA 3CC5A 4XP4L 1D5IL 1J5OL 1YDPB 2C3WA 3UPRB 2VXSL 3RDTA 2IG2H 1A6VL 2IGFH 4LCYB 3V6ZA 4JFOB 1OW0A 2P24B 4AQ1B 4HT1L 3TV3L 4JPKH 2OMBA 3D69B 4M8VA 1J9CT 2OJZL 5IB1A 3MACL 2VQ1B 1XGPA 1YY9C 1GGIH 1FNGB 4U1IB 3G6DL 3FQTB 5GRUL 4XXCC 1NC4B 2EIBA 1KCLA 5T1MB 5TGBB 4O5LH 3OR6B 5EU5A 2W0FB 1HKLH 4ELMA 3X3FH 4HBCH 5E4EB 4ZD3L 5ISZE 2VKWA 4JQXA 5KVEL 1W8NA 2Q86B 2BRQA 2EYSA 1VEPA 4HWBH 2DIBA 4YDIL 4J3XA 1CT8B 4ZPVA 2A6IB 1OP9A 3WDIA 1JNJA 2AJXL 3G6JF 3PWLA 4M6MH 3VXMD 3CH1B 2MCPH 3D39D 1MCSA 3ARTA 4N8CL 1EEZA 3OX8B 4U1KA 2G60H 4QRPA 3H6JA 3BEVA 1UXSA 3EDJA 3MJ8A 3T65A 5DJ6A 2J3SA 1GJIA 4XBPA 4OQTL 3KJ6H 5IW6B 3EJJX 2KZ1B 2ITDA 1G6RL 1QFWH 2VDNL 3BISA 4EIZC 3QDJB 3QNZB 1FYHB 4JB9H 1CICB 5JPNA 3SKOB 2RFXB 4FHBD 1TCRA 5F7LB 4PRBA 1HHHB 4WHYH 3ORJA 1YYLL 1NMAL 1V7NL 2HP4A 4IIQB 1IZJA 4JKPH 3VFRB 1BX2A 5D8JL 4OLEA 4U0QB 2NX5B 4HKJB 3AREA 1D7FA 2ITDB 3OKMA 5HTSA 5HYEA 2D0HA 1J11A 4MZ3A 3O3DA 1NCAH 4PJIE 1KSRA 5KOVC 1BQLL 4LASH 2WUBH 1OTSC 1BWWA 3BWAB 4ZOBA 1OLLA 4M1GL 3ZYOA 1MCIA 4PJEB 5DJXB 5ID1B 3VFRA 1ZT1A 5C1MB 4UNUA 5J4MA 4ZSOB 2HT3D 3GMNB 5TDOB 3EYUL 3UYRH 4PGEA 1DANT 5K9JH 3SQBA 3RUGF 2W9DH 3QWOA 1CXKA 3MV9D 5DQDL 5DD3L 4E5XA 5EWIL 1SJEB 5EOQL 3RBSA 5EORH 5C86A 5CZKA 4J23A 3BX7C 4NC1C 1R6VA 4M5YL 5DJ2A 5TE6L 1A1NB 2KKQA 4G6JH 3O6FD 4N90E 1ZA3A 4KJWC 1CL7H 1A2YB 4PJ9B 1DQML 2RIKA 1CCZA 5J9PB 5SWSB 4WY7H 4WDIB 1MJJA 3DVIA 1K4DA 3MRHA 4YXHL 4JZOB 5T33H 5GGVL 1A6WL 2OBGA 4ONGH 3WDHA 2AK4B 4PR5B 3DBXA 2LVCA 4NPYA 3G6JE 1J1PH 4RWYH 4RBPK 1DBMH 3N85H 4NQXB 3AB0B 3O3BB 3VI4E 2BDNH 5BVJB 1M6OA 2VB5A 1EHAA 3GJEB 5FKAA 1QLFB 4N1HB 1HSBB 2F53E 3F58H 3DVGA 1XGTB 2OR9L 5GS2D 4Z8FH 2CIIB 5HGAB 3O3EB 5LBSL 5DUBB 4Y4KB 1QVOA 4YQXH 5HVHC 2OP4L 4M03A 4NO0A 1OARL 2VERN 4IOFC 2OYPA 5GGTH 2HN7A 4JVPA 1UKSA 4NZUL 5HYSA 1FO0B 5ADPH 2YN3A 3FQXA 3MRGA 3RVTC 2X1OA 5C2BL 4KHTH 3QFDA 2RCSL 5IFJB 5DO2C 5B8CA 1VACB 4WEUD 5DEGA 4O51B 4X4ZA 4PJDB 4XI5D 1F2XK 1OGTA 3RVWC 3VXNA 3MRPB 3E8UH 4JFED 4NQDE 3V4UH 5DRNA 1XF5A 4A6YH 1YMME 3MUY1 4MS8D 2PW1B 1FG9C 4S0TD 3NAAH 2VLRA 5FA4A 1DUZB 2ZOLA 5B8CC 1RULL 4PGZA 3DXAB 1CDHA 1FIGH 3M07A 4KKLC 5EIQA 2J2ZA 3NOIA 4JFOA 3MRCB 1DEDA 2X6MA 3E6HB 5E9DB 2HVJA 4ELKB 1P4BH 5M95B 3A6BL 4FXLA 2GCYA 3MRQB 4JRYE 1JPSL 5D6DA 1NFDF 1NEZB 3N1FC 5I8EA 3QQ9D 4BUGA 1RUAH 2EDBA 1D5XB 4JKWA 4U1HB 5E00A 1FH5L 5ESQB 3OKNB 5MEPA 2Y07L 1F6FB 2GAZA 3PE9A 1MVUA 2W0FA 4YK4B 1D5BA 3FKUS 4KRPD 5I1AA 1IBGH 5IR1B 4TULH 4LSRL 3QIUD 1ZSDA 4UNTA 5I8KL 1EBAA 5IIEA 3NIFF 2HWZL 3WO3B 2ZUQC 1M7IA 5FUOL 2J6EH 3GFUA 4JM2A 4CUCA 1JBJA 3JSSA 5KAQG 5TE7H 1K6QL 4MJ5A 2F58L 3MA9L 3U7WL 1U9KA 1IZKA 2NX5E 1S7WA 3ALXA 3MV7E 4M9PA 4MZ2A 3BRFA 3QCVL 1LO4L 5DA0B 2YUZA 5E5MA 5ECJE 2J8HA 5DQJB 2IANA 2VZUA 3LRHA 3VXRB 3SGDI 4KJPC 4OKVB 1NBVL 1H3PL 2XNAB 3JWDH 4EXPX 1IGML 4DKFL 3OX8A 5LGKA 2I24N 3WHE1 5IHLB 2APTA 4L4VE 4F37F 2Y9RT 5DFVC 4HUKB 1B0GA 1T3FB 1MRDL 5HHPA 1H8OA 4JKLA 2CDGB 5HHMB 3IFPA 5J56B 4JB9L 3PWJA 3GJFB 1BREA 4FZEH 2IADB 2BVQA 1OQOA 2DIAA 5F7FA 1BEYL 2FX7L 2HAZA 4KVCH 4JRXE 2GSGB 4IMKA 1IGJB 1I9JL 1SYSB 3LIZH 3OKMB 3X11B 2EDEA 2XNAA 2YZ8A 1TJGL 5IROA 2DICA 1XCQB 3NMEA 4XCNB 3S5LG 1YEKL 3MXWH 1OTTC 2DL2A 4EN3D 4NO3B 2HJLA 3QFJD 4YPJA 5FDWA 3MRNA 1RJCA 4Y2DA 5HHXH 3BH8A 4FFZH 3V0AC 4APQB 2I5YL 3V6OC 3GJFA 4LASL 4NZJA 2OLDA 4H1LA 1LEIB 3GIVB 5IW1A 4FQCH 5HDLA 1X5FA 3UTPE 4P3CL 12E8L 4WW1A 4M1GH 3RWEA 2MKLC 3I75B 4DQOH 1CD8A 3H9SB 3RAJH 1A7OH 2ORBL 5DRXA 4GBXD 4Y2DB 3S36X 4X5LA 5I74B 3I6LD 4F8TA 3SDXB 4O02H 3DROB 3SN6N 5EA0H 2KPNA 2X70A 3BHBA 5IBUB 1CBVH 1FRGH 2OQJA 2DQJL 4IJ3C 2YPVH 3QUXA 2VABB 1YEEL 4Q2ZA 1XH3B 3ZKNC 3C08H 1MF2L 2X10A 3WFHA 4BQCA 4K7PX 1EO8L 2BOCB 3VI3F 1S7RB 5J89A 3SBWA 1A1OA 4XNUL 4XC1L 4F2MA 5I8OH 3CFKA 2XACC 3STZB 1H3WM 3SCMC 1HQ4B 3WIHA 1MCWW 4PJDF 4YHZH 1JHKH 5EIVA 1I8MA 2J7LA 5D1ZD 4PB9L 4XNXH 2MHAB 4AEHL 4X83A 3WCYA 3ZE0F 3BJ91 5HGAA 1I3VA 5L8JB 2FBOJ 4RGOH 1GHFL 1GZQB 1HKFA 3G08A 4FZ8L 1NBYA 43C9B 5DJ0A 3Q6FB 1QLFA 3A6CL 4IRJD 4XVSL 1KEGH 4G8GB 4IRSD 3MV8A 3FFDA 4L8SA 5LBSH 1X9QA 5CKGA 4FQXC 5E6ID 3CLFL 3CFCH 4KKCC 1TXKA 4M1DH 1A0QH 4XT1C 4U6YA 4NDMB 4GJTB 3RY6A 2G5RA 1RUQH 2A74A 5IQ9B 3QA3B 3W11D 1NMCB 3UTSB 4MD0A 3QR2A 1MRFL 4HS3A 43C9A 4X9HA 1GGYA 2VLJA 1UQSB 2YEZB 1A6TA 1SY6A 4YUEL 4OGZA 2AEPH 5IB4B 4KUZL 2IPUK 1ZHKB 4I3GA 5D7KD 2DIJA 4HC1A 3JWOH 5BW7C 2PYFB 4H25A 4K3DL 2NW2A 3SGDH 4X80H 1R5WA 1A9EA 1FL6B 3VFNA 1YMHB 5I6XC 4P57A 3HTLX 3G04A 4P3DA 4XPHL 5GS0C 4U1MA 4D8PB 5GRVK 1A22B 1ZHNA 1Q9OA 1U8NA 4JY5H 3AY4C 5EUKB 3E2HB 2DRUA 5I8KH 4K8RL 4HT1H 5IWLC 3VRJB 1SVCP 1CFTB 2NXYD 1FV1B 3MGAA 4LOUD 5SWZE 4ZS6C 2BSRB 3DURB 1NCBL 2AQ1A 1EFXB 3IB4A 4IRZH 5KS9A 5ID0B 4Y19E 4HZAA 5KSUB 3SKOA 5C6TL 4KPHL 5DMYA 1WAAF 2Z92B 3S5LA 5L6YH 4BQBA 3ROLB 4NWUH 4F7CB 3MBEA 4BZ1H 3TYFB 1OTSD 1K8IB 2GTWB 4R96B 3JWDL 4ZQKA 5HGDB 3QXTA 2ENSA 3WV0A 1VGEH 1Z9OA 1V3JA 5I1LB 4OBSA 5EO1A 4OUOA 4IRJC 4OZGE 2C7UB 2P4AB 3V6FB 1FP5A 3VXSE 2Y5TA 3AS1A 3BKYH 2WWKT 4TQEL 3KLAA 3BYYA 4I77L 1LK2A 1N26A 4OCSH 4L1HA 1CGVA 2AJVL 4NOFA 3MX0A 1S5HB 4JFFD 1V8HA 3LIZL 5E2VH 2I60L 2PW2B 3BH8B 2JCCF 3IETB 3SDDB 4UTAH 1WGOA 1BLNB 1QRKA 2R2BB 2Y36L 1T66D 5DJAA 3GMRA 3VE0B 5IFAH 5HHOE 4POZC 4X9FA 1HE7A 4YE4H 1NSNL 4NYLA 1ZS8B 1YYLH 2V5SA 3B9KB 1EFQA 1PZ5A 1U8HA 4WNQB 4ELME 5EPMB 2XN9D 2E3VA 3U46B 3KHQA 4BFBD 3HG1B 5DJ2B 1QRNE 3OKDA 1EGJH 3TCLA 4G8EA 5KW9H 3CAFA 4WFGE 3LZFH 2EDLA 1CFQB 4NUJA 2DF3A 1KIUA 1ZK9A 3LKSB 2F8XC 1H9VA 5ESVA 3BHBB 3MV11 3RWEB 4ZO7A 5F6IB 3NFPA 3O0RL 3MRIA 4QHLA 3WNMA 5HYSG 4PP1C 4GG6E 1IT9H 3WUZA 3TA3A 5GSVA 1X5KA 1QP1A 4MWFA 1QSED 5FYJE 3OKDB 1IEAA 4X99B 4XNMB 1T2XA 4RZCB 3O11A 4KDTA 4UT7H 5F88B 4JO3L 2DD8L 4YHIB 5DQDH 1GGUA 3UZEA 1MF2H 5CJXA 3JWOC 4N8VB 2X4TB 3CC5B 3MRFA 4L3EE 1A47A 1NGZA 1XIWA 5FGCE 4JFPA 4PJ5B 2F54E 4M6AA 1ZANH 3V5DA 3BOVA 4XC1H 5TE6H 4KZDL 3KPSA 5CWSB 4P2QD 3DTXB 3IFLL 4OB5L 5ERWB 2EDOA 2W38A 2YC1A 5EBMA 3GDBA 5T3XE 3KWWA 2XZAH 2VLKA 3SE8H 3D6GA 4YDLC 3DUSA 1BZ7B 5EZIH 5F8QC 3TVMD 1B4JH 1NC2D 1OGTB 4ZFOB 3NIDE 5E7BA 4HMDA 4IM8A 5JHDE 5BOPA 4HDIB 5SWZB 2PXYA 3JWNC 5DFVD 2XZQH 5FHBL 3MNWB 1GRWA 1S9XB 5HHNB 4Z18A 1P9MC 1PQZA 3U1SL 4AMKL 4CADA 4YHNA 1X5XA 4PRDA 2IFFL 5JIHA 4YIQB 4F3FB 3GMPA 4DFHA 3DYPA 3U9UA 5FKPB 4PJAB 3ARBC 1SQ2N 5IEHA 5KN5B 5CEZD 1WVZA 2FD6H 3HMXH 4JM4H 4OCRH 4KHXH 2D7OA 4NCC1 3MRQA 1TZIA 3D87B 5ETUA 3Q6GL 4QOKE 2VSDA 1NAKL 5BQ7A 1EUTA 5E1HB 3O8XD 4E42B 1BQSA 2BVTA 4MNQB 3BQUB 5C0BB 3PQYE 1WEJH 1AGFA 3P4OA 5KVDL 5AYUH 1TJHL 3G5ZA 3VD7A 4RAHA 4NKQB 2ED9A 3D85A 1DQDH 2WWMC 4UT6H 4X7CC 1ZSDB 2LQRA 1BGXL 2NYYD 2NXZD 2ADGB 3HCVB 3D3VA 4LQFL 4A6YL 3EHBD 4HIIA 4U1NA 2Z35B 4LPTA 3D18A 5F7HA 1RULH 1HCFX 4X80L 4R97C 3RWCA 5F7WC 2NY2B 4ZYKB 5J6HB 5I1GL 3QG6B 1R5WB 4PBXA 3VFUB 4OF5A 4HF5L 4U4BA 4M6OL 4OGYL 1AGBB 3HA0A 3X3GL 5F1KC 5CMAB 2BC4B 5J13B 2P5EA 3VGEA 4BSJA 1YEHH 2RQ8A 2AJSL 5T1KB 3SY0B 4MX7B 1BFVL 4JFDB 4M62L 3T08A 4ZO6A 4FQJH 4PRIA 5E4IA 1T1XB 3LS4L 4LEOA 2AERT 5I6XB 4HFWA 5IMLB 3TT1H 3L5WB 2XFXB 4WUKL 4IJ3B 2HJLB 1CF8H 1KYOK 3IJHB 4AIZA 1GOGA 2E7CA 4XHQA 1N0LA 3RVXD 1AIFA 1RZKC 4EUPB 1HH9B 3MV7D 2FEEL 1B0RB 3D1MC 3L9RA 4E5XB 5LXGL 2VC2H 4HIEB 3ILQC 3TCXA 1RHFA 2Q87A 1IAII 4HLJA 2APBA 3BAEH 1T0PB 4GKNB 1RJYA 4RIRA 1H3PH 2YPLD 5DHYB 1PX4A 4LHQB 3P2TA 4TQEH 4RQQA 2H2SD 3BP7A 4KZEH 5BV7H 2RHEA 3RX8A 4Z5RA 2Y5TB 2VWEE 3WXVL 5JOPD 3I75A 5TJWK 3ULVC 1XR9B 5IQ7L 4WHTB 2GK0B 2XA8H 1FFPB 1TZHB 1ZWIB 4WO4A 1C08B 2YMXL 3FB6A 5D5MF 3BPOB 1VEOA 1JNHB 4FZEL 1A6UH 1S7VB 1MCOL 5BZDA 4LDLB 2OXHA 3KYKH 2M26A 4L9LB 3TCLB 5J06A 2CDEB 5FEBA 3C5ZA 5IT2H 5L88H 4DGVH 1OGAB 2GJ6D 1BFOB 3V0VA 3BP7B 4JREC 1K3IA 3B9KA 4J6RL 3L5IA 3OL2A 4KKNA 1NCCL 4PLJD 5C0GB 2ERJB 3EKCA 2J5LB 4X7TA 1AXTL 5HHXL 2W92A 1IGYA 3PWVB 3PP3K 2V17L 2F74B 4FP8L 1C12A 1MHEB 1G6VK 4KK5D 1INEH 3BH9A 3GM0A 3VFSB 3OGOE 2H8PA 3KYMB 5GRJH 2ZUSA 4JO1L 4JRXB 4RX4A 4P2RE 4Z0XB 4OLVH 3P77A 2X41A 3LQMA 3FFDB 1MQKH 4U1IA 1L9NA 4DQOL 4JG0L 1WQVT 1T22A 3MRIB 4YEEA 5JMRA 5DJZA 1N3NB 1ND0B 2BY3A 3GSOB 2RGSA 4RRPG 5INDB 5CZXD 5BV7B 2CDFA 4JHZA 3QZWB 1VERA 4OZFA 3L3JB 4JO3H 4P4KC 2BFVH 8CGTA 3UPAA 1C7SA 3DUUA 2LAAA 1NMBH 1BBJA 5EZJA 1KLGB 2ILLA 3DGGB 4GAGL 3MLXH 1N4XH 4WI3A 3TIEA 3RGHA 1DQLH 5FO7A 3DUSB 3C08L 5CIPA 1X5YA 2CK0H 4HH9A 1DP0A 1T66C 1WCBA 3QQ9C 4APQD 5JHDA 4HUWB 1IAOA 4CL7A 1Y18B 1FQ9C 4QOKB 3T2OA 3MRRB 2IMNA 4RFNB 3MC0A 1BPVA 3TA3C 5K9OB 5KVFL 5I1KH 4MQ7B 1B6DA 5EUOF 3ZE1F 2ZOKB 3OB8A 1NDMA 1H5BC 5E70A 5CSBA 2QHLA 4OJFL 4RGOL 3RGVA 5IB5A 3U1SH 3NIFE 5DMKB 1E4JA 3LN4B 1FO0H 4GBXB 4Y2DD 3ARZA 3TN0A 5JHDB 4G7VL 2VXUH 3JV4A 1I8LA 5J11C 5E99H 5C0DB 2LU3A 5FKPA 3VXME 1LWRA 1FL6A 3VFNB 2DM4A 4I2XB 3P4NA 4LP4A 3CFCL 2OTUA 3BW9B 4GH7B 2J8UE 5DI8B 3G04B 3WXWH 3WDJA 3TPKA 1FGVL 1INDH 4X0KA 1JF6A 5J12B 3O9WD 3LB6C 4RA0C 3FHAA 4BQ8A 1Q9LB 5I1EL 1I8IA 4Y5VB 2YK1L 1MH5A 4WI7A 4NO5B 5DC9B 5IV2A 1RK1A 3GUTA 1CVRA 3U0PA 3ROLA 4GW1A 4ZAKB 3WLBB 3HCVA 1KIPB 4PYHA 5J1TC 1S7TB 5CP7B 4O2EA 1I7TB 1FNFA 4R4NC 1L6XA 2FEEI 4KTDL 3LSOA 2GY7B 5TDNA 5HJ3A 2HJFA 4NC2B 4QY8B 1G9ML 2NTSP 3WN5B 5AUMA 4NQVB 4MA3A 2EC9U 1ADQH 5DMGC 4MAYA 4CAGA 4PJBA 3I50L 1ZOXA 3MQIA 4XCYA 2KH2B 2X9YA 1U8KB 4Y88A 4Z7VA 1J05B 4FQQA 4URTB 4ODVL 1G7JA 4JY5L 4M1CD 1KG0B 2BNQA 3T4AA 4CKVX 4FQLL 3HC4H 4PJCF 5IUSA 5HHOD 2AJ3B 1GXEA 5I73C 2ADJB 3DMMA 5DHVH 4Q2ZB 3IAQA 3VRLE 3H3PH 1NCBH 2JCCB 5JUEL 3EUUA 4YHMH 3PWNB 3VWKB 2VUOA 3MUGB 4P4KA 3P9LA 4YDJA 1UWGL 4EKXA 2V2XA 3O6KH 3CLEH 3IFNL 4X6EA 1KPVB 4K8RD 4H0HB 1I7ZB 1LO3H 4QGYA 5T5FL 4C4KO 4PREA 4ODWA 2VLJD 5IVNA 1S7RA 4WGWB 3AFLA 3DX8B 5F7NC 4L29B 2P45B 4IOSD 4MNQD 1QPXA 4RGMC 1JNLL 4QRSA 4LLWB 2BRRL 3G5VB 3OAUL 4NQDA 2XA8L 1FZKB 3C5ZB 4JREB 5D1XB 2A83B 4OZGA 2V2TA 3C09C 5SWQA 1JGVH 3BD3A 2ESVB 3VGAC 5SWSA 5KSAA 4GXUN 3QIBB 1CDGA 2R4RH 4PJCB 3RTQA 5GSVB 2AXFB 4YEFA 1T0MA 5DJ0B 5EO0B 1UFUA 3BI9X 1UENA 4XP6H 5IG7B 1OB1A 1N7MH 2OJEB 1Q8MA 3DX8A 3IJYA 3T0DA 4HIHA 5JDSB 4OBRA 4G42A 1QNZL 3SDYH 1S7UA 2H8PB 1R5IB 1J1XL 5EOTA 5IBTL 2ITCB 4BSWA 2V17H 5IW3A 4AH2A 4XMLL 3X14B 4K71B 4OCYL 5E95B 3EOAA 1JMZA 3THML 5IOPA 5L2KA 1UKTA 1PDKA 1A64A 3T0BA 2VXQH 2YC1B 3O6FC 3GNML 2NCMA 1YEFL 5FM5M 2K7PA 3C6LB 5C92A 4PY7B 2WP3O 1PG7L 2JB6A 1X5AA 5C0ND 5FECA 4Y5XC 4NNYA 2UWEA 1RIHL 3GSOA 5D7IF 4H5SA 2ICWB 2WBJB 4H0GA 1NMBL 1CD0A 4JFZL 5E4EC 1U8PB 2V7HA 5CP3H 5HHNA 1QO3A 2P5WE 2R2CA 4NUGL 4KQ4L 3B2VH 3AS2A 2A1WH 3TJHC 2JF1A 5KSBB 5BZWB 2P24A 2CO7B 5D2LF 1KJ3H 1B2WH 4CMHC 5BRZA 4HGMA 4UU9A 2WWMD 5BO1L 5LGJB 1CFVH 1PG7W 1TIUA 4OM1L 4GMSH 4Y8DC 1QBLL 3NA9L 2AKRA 3B83A 4U1LB 4NSKB 4U1NB 4NJ9L 4I5BA 4FABL 1RZ8A 5ISZB 1NPUA 4FXKB 2K7QA 2VL5B 2X4OB 1D5XA 1XGQA 1P1ZA 4U0RC 3G5XB 4LVNB 4C59B 1BD2D 1CXEA 4BKLB 3MJ8B 3T65B 1D5BB 5I1AB 3QUZC 4KK5C 2R9HC 2R1YB 5I1IH 5CEZE 3QUKB 4JJ5B 5T3XL 2BNUB 5H2BB 3KPRB 2D0FA 4OAWB 4QRPD 2KDGA 2C1PA 5JHLH 1KB5B 3GSVB 3P0VL 4OCNC 4X0KB 4ZNEA 5JMOC 1Z9MA 3QT2A 4NSKA 4Q97A 5EZOH 1J1OL 1G7IB 2AAVA 5JQ6L 3UDWC 1GVIA 4JRYA 1FAIL 3LAFA 1KBGH 5F1OB 3RHWF 1VCAA 2Y6SD 3VXMB 1T5XB 3L3OB 4BFEA 2NX5A 4HKJA 3QUKA 3T2NL 1QA9A 3AUVA 1VPOL 2C1PB 3MLRL 3IF1B 4XPAH 4AIXA 3QI9C 1UVQB 2NW3B 4TNVF 1G7IA 1BGXH 3LEVH 5TF1H 2DQEL 5EO9B 3GBMH 3AB0C 2FB4L 3IAGC 3WS6A 1YPZA 2OXGA 2P44B 3MRMA 1U3HD 2F8OA 3RL1A 5LQBH 1OF2B 1BLNA 4Z7VE 4KGLA 3W0WA 1ADQL 5AEAA 3KPSD 2Z91B 5T5NF 2OS7A 3OQ3B 3QFJB 4JPVH 2YD3A 1LK3L 4XXDA 5L2JB 1MQ8A 1IAMA 4M93C 4M6OH 1UM6H 3NCYP 5C09E 4LLMB 5MERA 3WHXB 3QJHB 1E6OH 4F33B 5IB2B 2E7LA 2O5XL 3NFSH 4V1DA 3WN5C 3MOBL 4RQQB 4DZ8B 2VDLH 2W65B 1P69B 4M62H 1O7VA 5E03A 1JUFA 3U4EB 5F88A 4B0MM 5EU4A 3RZCC 4KUCF 3TV3H 4NCDA 4OD2A 3UC0H 1GZQA 1QRNB 3MACH 4WUKH 3K80A 4LLQB 4PJ5A 4X98A 2YN5A 3M1BB 4X7TB 5CGMA 1NCWL 4KWUA 8FABB 2AK4A 1SBBA 1BZ9B 3LKQB 4PJFB 2KQNA 3TO4A 3CLEL 3O6KL 3QXVA 3I6KA 5C8JA 3ZT6A 4LCCC 5J9PA 2VC2L 4XGZA 3FQUA 1QEWB 3V7MA 4JRXA 5KVEH 2CJUH 5GRZA 4QNPE 4TPRH 4TVPE 4YDIH 4NRZA 2ATKA 1CD1A 1NJ9A 3VXPA 1WIOA 5CWSA 4LCCA 4TOYH 5ENWA 1OGAE 2OR7A 2WMPA 1M6OB 1OAZH 1UT9A 5HI5C 1S7QB 2N4IA 4CVZB 4W4OC 3WXVH 1FGNH 3H3KA 1NLDL 2AV7A 4QRRD 2I9TA 2GSIA 2P8MA 3KJ6L 4XP6L 3VFPB 3PHOA 2XN9B 5EFIA 3FQWA 3O2DL 1NDGA 3QO0A 5ANME 3GMQB 3T0VA 1OOAA 4WTWA 4CADB 4YO0A 2BVPB 3IFOA 5CSGA 3MBEC 2WINB 5IT2L 3ZKXB 4JVUA 1Q1JH 1NBYB 5K9KB 2QSCL 1QSZA 1T2JA 5SX4I 4FQHB 1GGBH 1CR9L 3CFEB 2NY3B 3F7QA 3V4PL 1YEDA 2AJUL 4O51A 1R5VB 2JB6B 4U7SA 5CIPB 1OAXL 4JCLA 2ADGA 3S37L 4JZJC 2MFNA 3RZWA 4P2RD 4JKPL 3LVEA 3VA6A 1NC4A 3GBNH 2VDMH 1JE6A 2HA1A 2Y1VA 4WEMB 5D7SL 2NMSA 4MQ7A 2A74B 5D7IB 1R3JA 2DQCH 1ODAA 4EJ1C 3HZMB 5MEOA 5C2UB 5JR1L 4K9EL 3MFGB 3RVUC 5BCAA 5FXCH 3SGKA 2I07A 4CU8A 4UINL 4JFZH 4TUKL 1WSST 3GM8A 3V6BR 1ONQA 5ID0A 1D9KD 4NUGH 32C2A 4WI5A 4MMZC 3VG0H 3BIKA 4ZFZB 2JJWA 2VNCA 1ZLWK 4BSVA 1L7TH 2HFGH 2CK2A 2C3VB 2B1AH 3RX5A 4YXLL 1L7IL 3BGMB 3EO9H 1KN4L 4LRIA 3QISA 3L7EB 5EO1B 4JHAL 1BJ1J 5DRWA 1S9YB 4XPTH 5GS1B 1EAPA 2OM5A 3GSVA 1VENA 3BEWA 3DX6B 1VFBA 1XEDA 4PRHD 5I1IL 5T3XH 4EEEA 1A14L 2NR6D 3QXDA 4JDTL 5CEZL 5DD1H 4K7PL 3WIFA 1IQDA 1S5IL 3W2DL 4Z7UB 1J05A 1J1PL 1P84J 1CDBA 4ZXBB 5EU3A 5HPMB 2NY0C 2BDNL 2VXUL 4UDTA 4LU5H 1A7PH 4G8GE 2F54D 5F7MC 5C71A 2UUDK 3UCRA 3CVHH 2UVFA 3C60A 2K9UA 2LFGA 3PJSA 1INDL 2X9WA 2GTWA 2ICEA 4QKXB 3PP4H 2O5YL 1NBZB 4G9FB 4G8IB 2RB8A 4A6YB 2DQEH 4D9RD 2GITB 2QSQA 4PJIA 3NGBB 3QFJA 1C8PA 4POYA 3VD9A 4KV5F 4WUUE 2MQCA 4JO4L 5LQBL 4ZOAA 5DEFB 2EH8L 1IEBB 1N2RB 1F4AA 1JPTH 4X6DB 2AV1B 5GGSB 4X8XA 3HE7B 1AD0B 4LVEA 3I6GA 5TQ2H 2FECL 1Q0XL 1CGXA 3NAAL 1LK3H 3PXJA 4LNRB 4X6CA 3CZFB 2HKFL 3JTSB 4K94C 1HKLL 1OTUD 5C0GA 1B90A 5FGCB 4PJIB 5GRYA 1A6AA 1EEYB 2YBRB 35C8H 4PRAB 3MRDA 2DWDA 5CKAA 4E41B 4IBLT 5ERWA 4Y4KA 1QRNA 3KYNA 3SO5A 1DTUA 4WHCA 1KCUL 2EDWA 5FGBA 2OJEA 2GT9A 2CKBB 3DVGB 1JUFB 4WVRA 3BXNB 2VXSH 3MNVA 4JFFB 1IJ9A 1AQKH 4KJYA 5E6ZA 2V9QA 4O58H 4Z7UE 4OUUB 2R2HA 1U41A 2PO6B 3WFHB 3GBLA 3LV3A 4F9PC 4RISL 4OZFB 3SDXF 1E4XH 2J6EL 1GGIL 4U1GB 3ZL4H 1QFWL 4JHWH 4X6BA 2D7PA 4NZTL 3B9AA 3O3AB 3REWA 2F58H 4LLDA 1HQ4A 1RUKH 3RWHB 5FHAL 2D03H 3CXHK 4GFTB 5BW7A 5J7CC 1T4KB 3QCVH 4KJWD 1GGTA 1MI5B 4NHUB 1BM3L 2ZUUA 3FT4B 3GMMA 1CE1H 1A9BA 5T1MA 5A2LH 1JZ3A 1FVEB 3QDGE 1FNLA 5F93C 5T1LA 4OZIA 2VDPL 3TJEL 5DD6B 2R39A 2W1NA 4N8CH 1EEUA 1EHNA 2AV7B 4LLYB 2IALA 1D3CA 4RFEA 4EDXB 5IBLD 3C2SA 5A3IC 4HKBA 1VDGA 5CHNB 5D7JD 2EEAA 4K94L 4M48H 4PJAF 4HPOL 4KJPD 3V5HB 3DXAD 4AJ0A 2BNRE 4AG4L 3X13A 4P46C 3MJ6A 4L9LC 3VGBA 1CR9H 1H3GA 1JWUA 2FGZA 2CR6A 3P9MB 1XZ0B 3V4PH 3MNWA 1RU9L 4OLYL 4Y8AA 2ARJQ 3KLHC 4Q6IB 4WI4A 5TE4H 4Y1AE 3O4OB 5CUSH 4IIQA 2VXVL 2I07B 3UTQA 3QNXA 1M7IB 3QNYA 4HQQH 3DMMD 2AS5M 4XVJH 5GSRB 1QFOA 2VLRD 3H3BC 4JEGB 5MP6L 3V52H 1D5ZA 1CXIA 2G9HB 2Q8AH 4NO5A 4RCAA 1XGQB 4E42A 1T1XA 5ITBL 2JIXA 1ORQA 4OLZL 2XKSA 1FBIL 4M61A 4HJ0C 1UJ3A 3VG0L 1NCAL 1F90H 2AJYH 3ARDC 3QUXC 5FYJL 1FVDB 2D4DA 2FX9L 4Q6IA 1IM3A 2FL5A 2EIDA 3C5ZC 1Y0LA 4ZFZA 4OFPA 3FO1B 1A6WH 4U1MB 1L7TL 2HFGL 5C09D 3BE1H 3DURA 5KS9B 5AD0A 3R0MA 3B9KC 5EN2A 3WJJC 4C83A 1FDLH 3JV0A 4MAYB 4D9QE 3SE3A 3TWCH 3MRLB 5ALBH 3BMVA 3T04D 2CGRL 1A7NL 1PG7X 1QBLH 1YEEH 3NA9H 3IS1X 4JHAH 1DBBH 2CRMA 4LK4A 5DD3H 1SHMA 4HK0A 4YHLL 3TH2T 2CMRL 4N0YH 3VFTB 1MNUL 4NKDB 3M8OL 3X11A 3N06B 3O4LE 1NFIB 1A14H 1K3ZA 3MROB 1VFAA 5I8OL 4R97B 5L8LB 3IXTB 4H20L 3H2WA 5C2BH 3FOLB 1KN2L 4MCYB 4HHAB 3PDDA 5DGQA 4XNXL 4PJ7E 4CJ0A 4YXHH 1A7PL 3L5HA 5JW4M 5K59F 3CVHL 4S1QH 4DTGH 3V6FA 5F3HB 5EZOL 1J1OH 3A6CH 2IQ9L 4L4TA 1WICA 2KZWA 1SMOA 1A6ZA 4R2GC 5F7DA 1RZ7L 4NKIH 1BQHB 4XHJD 4HUNB 3WL9A 3T0XA 5KJRL 2XWBB 2VZSA 1ZLUK 4TUJA 5C09B 4LLVB 1BVZA 3IJSA 2AXGA 3KR3H 3O3BA 5FF6B 3A6BH 5BVJA 4GS7C 4L8BB 4LGRB 1HCVA 3SKNB 3D25A 5EC2B 3V95A 4DZ8A 3MLRH 1ZLVH 4P9HL 1MRFH 4QHUB 3MNZA 1WJ3A 4YDKH 1DJSA 5C08A 3WS3A 2NY5C 2Y07H 1NAMH 1ND0A 3C5SA 4LCWA 3UYPA 2A2QT 5BRZD 5GIRB 1RMFL 4NO0B 4AH2B 1ZV5A 4ZG1A 3V4VH 4TYUA 3E2HC 2GJ6B 1ZLUH 4ZUSA 1FO0A 1KACB 3MRKB 2HJKA 2EDFA 3C87A 4I4WB 2ZG1A 1SJVA 1FNGA 4Q0XH 5MENA 4ZPTA 1KIQB 1QLEH 3X14A 1L0XA 3MFFB 1MFDH 4MD4A 1R3KB 4LSPL 1KXQE 1AR1D 3Q0HA 3PHQB 1AI1H 3D0VB 4PTTB 3HR6A 3D39B 3QH3B 4G6FD 4J4PD 4U6XA 5FYKL 4EDWH 1I4FA 1HXYA 5C07D 3WO4B 4DAGL 3EOBA 4JZJA 1MHPH 3BD5A 3CJJA 4WW2A 4YH6A 4OZ4B 1IBGL 1DDHB 3TN0B 4N1EA 2NY2C 4K7FA 3MFFA 3WIIL 3F6IA 3WUWG 1RUKL 1NGQH 3QZWA 3CUPA 3MCG1 4RMQA 4KPHH 1KLUB 3U2SA 3VXRD 2XY1A 3O3AA 3REWB 2EYRB 1A7BA 1WC7A 3RRQA 5LGJA 4PJ7A 2DQHH 4MXVF 4U1JA 2PXYD 5GGRA 1FG2B 4BZ1L 4XX1G 1TJGH 3BKJL 5D6CB 3VH8G 1LD9B 5T5NG 2A77L 1OLZA 1R3JB 3IYLW 5IROC 4L8CB 1MI5E 1RK1B 3GUTB 1KEMH 1J8KA 3CXDL 1A6PA 1XZ0A 3CUPB 4AIOA 3KS0J 4NRYB 5E6IA 5T3ZE 2Y06H 4NBYB 1NBQA 3CZJA 3P4LA 3FONB 1HWGB 3OHXA 4KKAC 1F4WH 3LMJL 1YNLL 4YHYB 3F5WB 1Q9OB 1U8NB 5B3NA 2AJZB 5F3BB 2Z0BA 2BVUA 3BPCB 5CUSL 3E3QC 2FX7H 3OJVC 4MDIB 3CX5J 4GW4B 2YWYA 4O02L 3PNWA 1RVFH 2FR4B 3L3IA 3KG5A 1E6JH 3L3HB 4D9QD 3VXSB 3DVNA 4X4YB 3EOYG 2VDML 5CGTA 3S34L 1QBMH 1CGYA 1IQDB 3GHBL 3ULUH 1EH9A 5ITBH 5LWYH 2P5WA 1NL0L 4GG6F 4JFHD 4Q74A 3QIUC 4MHHI 2AJYL 5JR1H 4R4ND 4DGIH 2XRAL 3QUZA 2W60B 4KDTC 1UYWH 3BP5B 4FMFA 1TCRB 3EYQC 2L7JA 1MCQA 4HUXB 3TFKC 3O45B 2PYEA 1RI8A 3ARGB 4J3WA 3MJ7B 4LCWE 1FDLL 1FLTX 2B7DT 4FFWC 4KI5E 3VXQB 4PRID 3RWDB 3GRWH 2X5PA 3EYSH 1N5YH 3U4EA 4D9RE 2C4FT 3MJGX 4PTUA 1QSEB 1DBBL 1MUJB 5IHZA 5DJCB 2IPUG 4N9GB 4OIAA 4PJBB 3LPGA 3VWJA 3QI9A 4XRCB 3SDAD 5I8CB 4HG4J 3CSYA 2J8UA 3ROOA 3VE0A 2G5BB 3ULUF 3PWPE 2X4SA 4PV8B 4HXAH 5F3HA 4XTRC 1YUHA 5K9QG 1QEWA 5FUCC 4Q9CA 1OTUC 2E7HA 1S7SA 2VR5A 4K7PH 3QO1A 4JLRA 4Y1AA 5IJVB 3TNNB 1GC1C 1OB1B 4DTGL 4NZDA 1F4YL 1T2QL 2PYEE 4J7RA 2D31A 2BY2A 4CBPA 3NABL 4NKIL 3AVEA 3MLVL 3ZTJH 3OAZK 4RZCA 2YPKB 5HYFA 4JQVA 4ONFL 3QEGL 1DQJB 5F89A 4CGTA 4KJYB 1Q38A 4PP1D 2V7NA 2DLHA 3TA3B 2DMKA 5FOBA 5J3HC 1JNHA 3VGAB 3IDIA 4BFGA 2AXGB 5FF6A 1I1RA 1JI2A 4OI8A 2RAMA 4LVOC 1AE6H 4X9GA 1CWVA 3FQRA 2OK0H 5FAAA 3U79A 3GKWL 5GHWH 1SEBA 4JO4H 5DZNA 3HR5B 5I74C 3RWHA 3B4NA 4EIGB 4I4WA 2H2PC 1K2DA 4QTHB 2VMFA 5DJZB 1MY5A 3GMMB 1F11A 3K46A 4PJ8A 3GSUA 1QFWM 3QUXD 4IRZL 5GXBB 5AG8A 3VA2C 2PTVA 2X7LB 4Z7WB 2HKFH 3U7AA 4LLDB 4QXUH 2BOBB 4PJAE 1F42A 3KDMB 1EZVY 5JDSA 3QCUL 5ILTL 4PJBE 5KN5A 4XB7A 3L6FA 4NWUL 3F6LA 1OTTD 2VAAA 1UA6H 4P46A 1HNFA 5FUZL 4GQ9L 4DW2H 2SEBB 4YJZL 3ULUC 4QHKI 5FA4B 3L5JA 3SE4A 1OW0C 5GZNC 4UDUA 3N9GL 1ONQB 5I17B 3BKYL 4OKDA 1OQXA 2CLVB 1CE6A 3C60D 4CDHA 4NN5B 3QIWB 5DK0B 4OCSL 1Y18A 1KCKA 3QUYA 4AY0A 1EAPB 4NZTH 1QO3B 3O6FB 5F1NB 3LD8C 3O4LD 5ITFA 4QRPE 2Q86A 5GGUA 3PABB 4F37K 4I9WD 1CLOL 2XKNB 2A77H 2BSRA 3C6SA 3L5XL 3DSFH 1T1WA 4HV8A 2F5AH 3GIZH 1LD9A 5JW5B 4KVNL 1L4IA 2FBJH 3UX9B 4YHOH 4MD5B 5I9QB 3V0WL 4RMSA 2R9HD 4G7YL 1BBDH 1JYVA 1KXVC 3O6FA 1PKOA 3VH8B 1KFAL 4PRHE 3LMJH 4MNHB 2B1HL 1ZVHA 2JK5B 5IMLA 5EU6E 2C4XA 5I1LA 2XICA 2PCPB 1BHGA 5CS7A 3RBGA 1A1MA 5H8DA 3H7BB 1MCFA 1ZTXH 2MQ0A 5DQJA 3PL6D 4YAQB 4PGJA 1UH4A 2P5WB 2E27H 1YNKH 4KH2A 3O3DB 3FZUD 2AI0L 1H3XA 1U8IA 5IVOA 1LK2B 1KB5H 1QBML 4EI6A 3VFGH 3QUMB 4XNYL 4X4XB 2Q8BH 5LWYL 4HQQL 4E41D 4EXKA 4YFEA 3IFPB 5JPMA 3QDAA 4OFYD 4R4BA 4G6MH 4HZLB 5GGQH 1F6AB 3SGEH 4NO0D 4ZSOA 3HUJB 4OB5H 3FN3A 1U8HB 1T5WB 1ZE3C 2A9NH 2BY0A 2XV6B 2DQTL 1ES0A 5DJCA 4M3JA 4MJID 1LP9F 4Z7OE 4M93B 4XCFH 2X05A 3HN3A 3WFZA 1HOCA 4NFBA 4WRLA 5EUOB 3OGCB 2EKSA 1XF2B 4X4ME 3UJIH 1KTDA 1HSAA 3BD4A 3JV5A 5FHBH 2QADD 2R0LH 3MREA 3VI4F 5GZND 3GZKA 3MNVB 1IAKA 4LPVA 5I1CH 4PP2A 4WO4C 4M7LT 3EO0B 1W0VB 3LS5H 2BZDA 2G2RB 2V5MA 4LOUC 4H0IA 2X4UA 4ZUUA 4XC3L 2I9LB 3EFFB 4XX1E 1ZA3B 3TPUA 1MPAL 3TN0C 3SCMB 2E5EA 3UTPD 3MRKA 1FZJA 5D2NE 5IHBA 3HC3H 1YUHB 4Q58C 2HJKB 2NY3D 5KVDH 4MYWB 3SE4C 1T2QH 2PO6A 3KXFE 1IC7H 5I76A 2DQGL 3KPPA 4OJFH 3SJVB 4KMTL 1AQDB 1I1AB 1ZA6A 4N5EC 5EBGA 3HAEG 4S1QL 2X4UB 1FJ1A 3QEGH 3HE6C 4UQ2B 3U4AA 2VTFA 1BZ9A 3UTTD 4PTTA 3MXVL 4G80A 1OM3L 1HILA 1N0XL 3T77B 1KLGA 3DGGA 3WFEH 4PJXA 1IILE 3V2AR 3UO1H 4D2NA 2VLKE 2CIIA 2IFFH 2JIXD 3OB0H 2V7NB 4FFYH 4O2CA 4OZ4A 1T0MB 2QLVB 1FLRL 4G6KL 1DSFL 1RIVL 25C8H 4PRDB 5D93B 1U3YA 4FQXA 3C5ZD 2EIZB 3B9EA 5E2UH 2XTLA 2AJSH 4O2FB 2IALB 4HUMB 1S7QA 4LPYA 4LRNH 4TTDC 5AYUL 2WSKA 4E0RB 3MRCA 4NZRH 5GGRB 1PSKH 3ETBF 5FCUH 4EQ2A 1SY6L 2F53B 1G0DA 1LP9A 2P47B 2H1PH 1DLFH 3P30L 5GSRA 1A3RH 1MEXH 2R0WH 4KTDH 4LPWA 4ODXA 3RHWK 5GZOC 4XNZB 2N56A 1U58A 3QRGL 4IMKC 4RBPH 4I18B 1U8LB 4FG6D 1DUYA 2AVGA 4JFXA 1EFXA 5IESL 5C07E 5CD5C 1S9YA 4F7EB 4OFKA 5DLML 1FVCA 3RNQB 5L0QC 3QG6A 1GGCH 5F9JA 4AL8H 4YDVB 1J8HB 4DAGH 4MB4A 1YEGL 2YPLB 4YZFF 4NQSA 1QHOA 2QQNH 2DMBA 3G6AB 1H8NA 4K2UL 4YFLI 3PGFL 1HQRA 3FO9B 3B2UD 3AREB 3ZHLA 2NXZB 3NZ8A 3IRPX 2PN5A 2A0LC 4NC0B 3QIBC 3L5XH 4MA3B 5EU6D 3RNKA 3STBA 3VXSA 1JV5B 5A43C 4NHCH 1G9EA 1E4WH 2C3VA 1WZMA 3WHE0 3ARGA 2R2BA 4G7YH 3OXRB 3PQYD 4X7SH 4NM4H 1AXTH 4ODBD 1NFIA 1T5XA 3S3PA 3ZDYF 4HMEA 4U7MA 2VDRL 5IVXF 3QUZB 3K7UA 3VXOB 5C0IA 3D3VD 1J87A 3W82A 5FB8A 3LQAH 5E5RB 3DSNA 5LCVL 4FNLL 2Y06L 3U30B 1S7XA 1XCQA 3EGSB 3O81A 1ZTXL 1K8DA 4JG0H 3I3DA 1G7PA 4F9LC 4QF1B 5DK2A 3SGKC 3O9WA 1T7XA 1MLBA 1O7SA 4Y19A 3SQOH 2O61A 3C2AL 1PKQA 1ZVSA 4IMLA 1XAUA 1T89C 3QEHB 4X9IA 3PHSA 5E6IC 1W0YT 2K1MA 1N4XL 3B43A 4JZOA 1DE4B 1YC7A 4MQXC 1DQLL 4XMLH 4NNXA 4J6RH 4P4RA 3RWIA 4JANA 1NCCH 3W0WE 3C5SB 3MLTB 4MAYD 4YXKH 1G7HA 1PG7H 2L7UA 2I27N 5B3JE 2X09A 4ZTPH 5GRJL 3AREC 5ESAA 4ZTOL 3UJIL 5BRZE 5E56A 1XH3A 1YDPA 2OL3B 4LLWA 4XP1H 2AV1A 1H0DA 4UQ3B 5DVLA 4OV5A 3GRWL 5IG7A 2HLAB 5E8DH 1WZ1H 3H9ZA 2X70B 1KCSH 3INUL 1RJLB 4OGXH 3LEYH 3O3EA 3G9VA 1EHXA 4TTGA 2AK4D 2UV3A 3ULSB 1ZEAL 1MOEA 3U4BH 3U7YL 3GJFH 3WNPA 4KK9C 1HHGA 3OKLB 3P11H 4M43H 2Y72A 1TJIL 5L2KB 2CK0L 2QHRH 4QO1A 3DPBA 2X1WL 4JRXD 4F2MB 4K07A 1HXYB 1H0DB 2G75A 3Q6FA 2QQLL 3TGXA 4YDLB 4Z7WA 3C6LA 4WGVB 2WM0A 4QHNB 5EOTB 4LKXA 3MGOA 3ZHDA 4FQ1H 5HI3C 5K9QI 1KF9B 1FG2A 5DF0A 5B38A 1DDHA 2AQ3A 3EOAB 1ERNA 3WJJA 3IGAB 4ISVB 4PJ8B 3L95A 5TGBA 1ZA6B 1DUZA 2ZOLB 4YZFE 3FFCE 1J8HE 4U0RB 4LSSL 4Z78A 4HS8H 1UC6A 5JXAH 5FDYA 1G9MH 5C9JB 2H3NB 3MRBA 3QUZD 2A6JB 1RZKL 3QAZC 1J12A 1D6VH 4UAOB 5DI8A 2PO6C 3KPTA 3V79C 4HX1A 4RX4D 4TVPD 3R0NA 1M7DA 1AE6L 2GJZB 5CJ5A 4U1GC 3VFUA 3MOQA 5EC1B 2EDYA 2NW2B 3DETC 2EE9A 4GW1B 4ZAKA 3QHTC 5T3ZH 2IGFL 1BX2B 1Q9KB 2QR0A 4JJ5A 5E1AB 1BF2A 2NY3C 4ETYA 1LE5A 1Z5LA 5KZCB 1CICC 1YA5A 3N0PB 4DN4H 4ONHB 2FR4A 3WE6A 4HJGA 3RL2B 3UTSE 1UZ6F 3RU8H 3EZ8A 1NGWB 5CP7A 2R1YA 5BJTB 4OCLC 4Y16A 4EUPA 2E9BA 1VB9A 4ZFGL 5IFHL 5I2IA 4PJEA 5DJXA 5ID1A 1AKJD 3B9DA 4R90L 4MNGE 1ZHBB 2X4QB 3KYAA 4KY1L 1QA9B 5FYLD 4I3RL 3OF6D 3BSZL 2BRRH 4LKCA 4ODVH 1LNUB 1LVEA 1MUJA 4HCRL 1S9VA 4FQLH 2HT2C 4MNHA 2EDDA 2UWEE 3IKCB 3U0WL 1RJYB 3TEUA 3J7HA 3UC0L 3V8OA 1JNNL 3MV9A 2NY7H 4GOSA 5GJSH 3GMNA 1A1NA 1ORSA 2FWOB 3SKMA 1Y6MR 1IE5A 4JZNB 1SBSL 1BD2E 3TA3D 1LEIA 5EU3B 2J8UB 1N7ML 1P7QA 4P59H 2X4QA 1EK3A 1SJEA 3RTQC 4X6EB 4WDIA 4XXDB 3AY4A 5JOPE 1K9TA 3N1GC 4Z95H 3QXDB 4X7SL 4PUBL 3PWPA 4P23D 4JLRB 5IJVA 4P2YA 2DOCA 4PJCE 4GLRH 4PLOB 1MLCB 2CDEA 4R4BB 4PJ7F 1YC8A 2FEDC 4PJ8D 4IRJA 2VXQL 1Q0YL 1JNLH 3HAEB 2QADC 2FHCA 2Y7QB 1HN1A 5GIRA 2FJFA 1KULA 4M9OA 3WLWC 4C56A 2P8LB 3RJQB 2VABA 3QWRD 4WNQA 3PP3H 1F3DJ 5KANI 1F3JA 2E6JA 3D9AL 4TTDD 2KQMA 4F7MA 2V5YA 4JR9L 2DYPA 1MFEL 3AC0A 4JVWA 3QIWC 2AK1L 2EIEA 2A1WL 3FMGH 4XAWL 4PPTA 3S3SA 3VFOA 4JFDE 1ZT7B 3NIGE 4JRWA 1F5WA 1UXWA 5F7DB 4D0DB 2CLZA 4I0PC 3QDJE 3MTRA 2HRPL 2P8LA 4KRPC 2MHAA 4NNXB 4GAYB 4GMSL 4TUOB 3GBNL 4WTZG 2DWDB 2VLMD 3QXWA 4JDVA 1CFQA 4NUJB 5FFLA 3QDGB 4FTVD 1PW3A 3WMSA 5C8JB 5DT1L 4HEME 4Y4HC 3D69A 5F21B 4NJ9H 3FQUB 4FABH 4PRNA 1ZT4A 1T7WA 2ITCA 2D7TL 2Z4QA 5DYOA 4AZ8A 2DQTH 5JW3L 4PY8J 4S11A 1IC4H 5ISZD 1U6AL 3V0VB 5EU6B 1W2KT 3PGDB 3GSUB 2XQBL 4LAQL 1WZ1L 4D0DA 3OR6A 1TVBB 3OXSB 4N9OB 4ENEC 3O4OC 1NKOA 1N6QH 3ULVF 3P73A 2BSTB 2IAMD 4XBGB 4FOMA 4G3YL 5F6HI 3FQNB 1V05A 2GCYB 4R8WL 3FO2B 4E0RA 3ARYA 1TJIH 3SE9H 4MNQE 3QO0B 1MI5A 4NHUA 1CFVL 1VSCA 4HDIA 3TZVA 5H94A 1X6LA 4BH8A 2QQLH 1RJZB 5DK3A 3QFJE 4MD4B 4IEFB 1AP2A 3W39A 3O6MH 1I75A 3ARRA 1YECH 3RTQD 3FRPA 4CN6A 2WLZA 5GRVL 3PXHA 1KJVA 1U8LA 2DQGH 1PKQE 1LO2H 5CAYB 4L4VA 3NCYS 4LSSH 1JPST 3PDOB 2AGJL 5F9DC 4QRRB 1V3KA 3L3DB 1NGPH 3HZVB 3I3BA 4HWEL 1AGFB 3P4OB 1RAMA 5DJDA 2R23A 4K9EC 5IEKB 4PV9B 4ORZC 5DVNA 1I7TA 4JRYB 1TZIB 4TSBL 1U8QA 4BYHA 5KSBF 2YWZA 4D8PA 3RA7L 3FO9A 4XAKD 3QDMD 4XMPH 5E2UL 4LHUA 43CAB 1EEZB 1EGJA 2YPLA 3A0OA 2YD2A 4YK4C 1NCTA 1YN7B 3GSRA 3VW3H 4R7DA 1JRHL 3BDXA 5FA3B 1XT5A 4Q9RH 5E6IB 1GCFA 2OTUB 4ZS7H 2JE8A 4MAYC 1MEXL 4XBEH 4TVSa 1PX3A 4WO4D 5LAXB 3BN9D 1MVFA 3R8BB 4LPCA 1CICA 1G9NC 3VXUD 2GK2A 3RKPA 3GHEH 3V9FA 1UJ3B 3QUMA 3TYGH 4DGYH 4NN7B 3RL1B 4RMVA 5DDHA 5B38G 1S5HA 1UM6L 5F96L 4YR6B 3HI5L 5HDQL 3MRJB 2IBBA 1YJDH 5C0CE 3CDFA 4WHYG 3MRHB 1HINH 1D6EB 4FFWD 4HBQA 4KV5E 5D7LA 3ZT5A 1S7XB 3O4LB 1K8DB 3ZT7A 1S78D 4DK6A 4NN6B 2YHGA 4O00A 1V7ML 4IDJH 1XF2A 4M8QA 2QSVA 3PV6A 5HVHB 3ARXA 5D2LB 4JHWL 4I3SH 4LNRA 1IFHH 5D96B 3JV6B 1XR8B 2JJVA 2W0KA 4FQXD 4XGZB 3SJVE 4YWGH 3CVIH 2QSCH 3QJFB 3V6OA 2B5IB 5IVZA 1R0AL 4X6DA 4BZYA 3HG1A 4GSDH 1NLBH 1DZBA 3BPNB 4JPKL 2AEQH 1GYAA 2HH0H 2OJZH 4J1UB 1QSEE 3MXWL 4OGAD 3TJEH 1ZGLM 3FOMB 1OAZL 3OBAA 1EIBA 3KLDA 3QEUA 4MMXC 4N8VA 4OCXL 2XWTB 4YBLB 1BIHA 3MV8D 4LARH 4XP9H 1CTOA 3G08B 4UINH 5BXFB 2OL3A 4X6FA 4F7MB 2X4PA 5J6GB 3DETD 4WFHD 3C2AH 4AG4H 5C08D 1O5DT 3FB5A 3O11B 1HILB 5I16B 3NVQA 1CXLA 5CJOL 2LTQB 1MHEA 4QRSB 2LVEA 4OV6F 2F19H 3TLRA 1EJOH 5IVXE 4DVRH 2I9TB 2DLFH 2F5BL 1PVHA 4PRNB 1Q1JL 4RAUB 3NN8B 4UOW1 5SX5H 2G60L 1TTGA 3QEUB 3BRGC 4LIQL 4YPGB 2BNRB 3LRSB 4U1SB 5I15L 1IGIH 4I13B 1XGUA 5F71A 3DTXA 1IVLA 4LLAA 2DQJH 3RIAK 2CXGA 4YHKL 2XXCB 1IGCL 1UB6A 4FQHA 2X4PB 1YYMH 5F6IC 4XPTL 3MA7B 4ODHL 4P23C 4QHNA 2F15A 1IC5H 5MENB 3FQXB 2DQCL 1FBIH 1R3HB 1BQUA 4TSAL 5FYJH 1AGDA 3ESVF 3DI2B 3RIAF 1OT1A 1QYGL 3MYZA 5B39G 4BUHA 4BSWB 5CEZH 3UPRA 2Y5EA 2HTLD 3W2DH 5I0DA 4NKMA 1JF5A 3HMWL 5DTFB 5DR5L 3NIGF 4ODSH 2EDJA 1QUNA 1FCGA 3MGTB 4R8WH 1T7ZA 2DI9A 1ZLSH 3B6SB 4ZAKC 4P2OA 1CU4L 4FZ8H 1A7NH 1T04A 2OZ4H 5JW5A 4QNPF 4NQCA 4XVSH 3A6OA 3OG4B 7FABH 3BO8A 4FQIL 4M43L 5C9KA 1WAAE 2Z35A 1IAIL 2YD9A 1LE5B 2G9HA 4L8CA 1GPOH 1WC7B 3Q5YA 4DEPB 4D3CH 4ZYKA 3VFMA 3HZYB 1YJDC 4NNPL 2HLFD 1NGWA 4LSVH 1LMKA 1I1CA 2VISA 2VH5L 2PUQT 5HHOA 1YNTB 3UDWA 2VXTL 1CE6B 3S37X 4OQTA 1M05A 3UBXG 2EO9A 2DS4A 3KXFB 5DC4B 4P2RA 4QRTA 5GS3A 5FYJD 5GGSY 2VL5A 2X4OA 3KLAB 3QCTH 4JQIH 3ZTNL 4Z7WF 4CJ1A 4L3CA 4MVBC 3V8CA 1YN7A 1D6VL 2QADB 1N8ZA 3ZHKA 5FYLH 3OHXB 3PJSB 5DZLA 4ACPA 1EV2E 4XMPL 5DK2B 1BF8A 35C8L 2J4WH 4PRPD 4IS6A 4HK0B 2EEBA 4U2ZA 5JTWA 1AH1A 1ORSB 2FWOA 3SKMB 2AJZA 5LAXA 2XZCH 4QY8A 1KNOA 4PS4L 4GRLA 3C60B 5T1DH 1Q72L 4Q9RL 4YGVA 3GSRB 5FK9B 1AHWA 1OHQA 1NUDA 4PJ5E 3T8XB 2HYMA 4HGKC 3RVVD 1F97A 1KTDB 2EH8H 4PD4K 4GKNA 2ZKHH 3LKRB 1Z2KA 5AUMB 1F3RB 1FSKC 5HHVL 3H9SE 1VFAB 2HTKC 1YMMB 2Z31C 3HAEA 5GRWA 1SYSA 1X5HA 1SMAA 3RU8L 1BP3B 3C6LD 2BOCA 1QLEL 5GGSA 4PJHF 4OLUH 4YLQT 1Z3GH 5HDQH 4OFDA 2CUHA 3PL6B 3O41A 3OG6B 1T03L 1CZ8H 2NY1B 4R90H 1QD0A 2HLAA 2JJTA 2GT9B 3RWGB 1WWBX 4PGEB 3MLYH 1A6ZB 3U0TB 2MSPA 1QSEA 2R0ZH 1LO5B 4WJ5A 1DVFC 2DWEB 4CRPA 4GLRI 3SDDD 2JJUA 4WW1B 1XIWB 4Y5XA 2CQVA 4XMKH 2VJXA 3GK8H 3W9EB 4O58L 5HHQB 2ZPKH 1OD7A 1R24A 3WJLA 5JZ7D 3KPQB 2GSIB 1BECA 1RUAL 4H26A 4RFOH 3U0TA 4NP4H 3NCCB 4JFPB 4QTIL 1FH5H 1FL5B 2HH0L 1PAMA 1MJ7H 4JY6B 1Z9SA 5SWSE 4XVUC 2PETA 4YE4L 2XOTA 2EC9T 4XPGL 2YSSB 4YHPA 3CFEA 3DUUB 2VLJB 3V52L 3IJYB 2KUTA 1TZGL 1XGTA 1T0NA 2OX5A 3HS0A 3WFCL 5KS9E 1W72B 3NPZB 1JZ5A 4JN2A 1BVKA 2HVKA 5C0JB 4UBDC 3D0LA 3R1GL 2F8VA 2YA1A 1I3RA 4I0CC 5IB1B 1RPQA 1AXIB 4LFHG 3O2DA 2CO6B 4JR9H 2C5DC 3V6ZB 3BZ4A 4EOWH 3UBXI 2H3NA 1S78C 1ZGLB 5FM4A 5EC1A 1NBVH 4EVNA 3SGEI 1J0YA 4JZJB 3TWCL 4R4FH 1SVZA 1RU9H 4OLYH 2EDQA 1A02N 2H9GA 5TE4L 1MCBA 2HVKB 2HT3C 2NXYC 4MA1C 4UT7L 2R1WA 1RIUL 5KSAC 4RGNE 2XG5A 1QFWI 1Z5LB 1NC2B 1D9KB 2X7LA 2R29L 5IVXA 1OY3B 1UWXH 1KJVB 4KKBD 3TBVB 1QYGH 1U8MB 3REVA 4HPYL 4OLZH 3ZKMD 1TTFA 4ODSL 4P99A 2UZIH 4AENB 3GGWA 3MSPA 1JWSB 2ED7A 1JTTA 3ARPA 1T1YB 3S36L 2ADFL 4U1LA 1VEMA 1B4JL 5ANMA 1XF3B 3SY0A 3HRPA 4G3YH 5DJ6B 2I26N 3D2UB 2NY6B 3PNWB 4NFDA 4ZQKB 2A9MH 1JYXA 1M1SA 2CLVA 3BPLB 4KKCD 3HPLA 1UZ6E 2CGRH 5HPMA 2C7UA 1J8HD 2ED8A 3ZO0A 1CDJA 4OAWA 5GPRA 3RAJL 4OKVA 3DX9B 4LKCB 1JWSA 4WWKA 3FB7B 1IEHA 3RY6C 3TNMB 4QXGL 1RZGA 3NH7H 4N0YL 2X4RB 4OIIH 4PJXF 3NA4A 4KK6C 4P9HH 2YD7A 3P0YH 2VH5H 3WFBH 1H8SA 2D9CA 4YX2L 3L5WA 1AD9B 2PYEB 1WITA 4PJGA 4JY4A 3EJYD 4JZNA 4OZHF 2AGJH 1KB5A 4NKDA 3LD8B 5EIIB 1B0RA 2AK4E 1RURH 1U93A 4PJ5D 4DCQA 3MLVH 2CKNA 5TQ0H 1T3FA 1VFBB 2HTLC 2P7TA 3MBXL 4Z7VB 4N90D 3PWJB 4Y5VC 1VKXA 2DBLH 3IJSB 1AJ7H 3MV8E 4NQTA 4EBQH 3RWDA 2J8OA 4NKOA 1QR4A 3PUCA 4M8QB 1JF1B 1FSKB 3DI3B 1I8LC 4FQ2L 3ARFB 4OSUH 2XIDA 4Y5YB 1F58L 5CCKH 3KHOA 5DMIL 1P84K 1N5AB 5ESAB 2OTWB 4E41A 5E8OB 2IAND 3HE6B 1OD9A 4H88L 2GHWB 3VRIB 3WSQL 1MHPL 2NY1C 4OLXL 3B2UC 2P5WD 2ZWLT 1K4CB 1KPRB 3CVHA 3KYOA 1Q94A 3UROR 3WS3B 1LEGA 3TT1L 3DO7B 5JO5A 2NZ9D 3WFDL 3BFOA 3GMRB 3OR7B 2B2XH 4LGSB 4LHJB 4L3EB 4XWGH 3RKDC 3KPSB 2DMCA 4M7JH 4OZHA 4JDVB 2FSEA 4KMQA 4PJGF 4L4VD 3UMTA 2CUMA 4PGBB 4XWOD 4ZUUB 1WV7T 2BK8A 1ULVA 1J0KA 4FFVC 5F89B 1M71B 3FAWA 3KPQA 1OP5K 3PGDA 5DUBA 5FYKH 5AG9A 3RQ3A 4JHBA 2DI7A 4NJAL 5BV7C 1A6AB 1EEYA 2YBRA 3VWJD 2C4FU 1FZOB 4KROB 3GSWA 4R2GD 4YBQD 2E8ZA 2XI9A 2B20A 5C0EA 4ETQA 1YNLH 2FCBA 1Z6JT 3WIIH 3LN9A 1OPGL 3ME0A 4GS7B 4BH7A 5L9DH 1NGQL 5B8CB 3CMOH 3KYKL 5DVMA 1R0AH 4OM0H 1CLOH 4MXWL 1WCBB 4K8RH 1QQDB 1MCNA 4JCMA 1CIDA 2J5LC 1WBZB 2B4CC 3GIZL 3KS0H 3EZJB 3FT3A 3S34H 1BJMA 4ZFOL 1HHGB 3SGJC 5DTFA 1E28A 1PFCA 1WIUA 4PG2A 4MJ6A 3RY4A 5EBMB 1KT2A 4P5MA 5C6TH 3ECBA 1AGDB 4FP8H 2A73A 2B1HH 2Q1EA 1N59A 5IKCB 1NEZA 3FT2B 4EOWL 2BXYA 1MCEA 4YNYB 3IFOB 3O6LL 1J10A 1WZLA 2CPCA 5A2FA 2VSCA 3B5GA 4UU9B 5IEKA 3MPCA 2LU7A 2QL1A 3FONA 4K3EL 2BVYA 2W9DL 3VFGL 1K5NA 3RPKA 1ADQA 1ZHKA 2IPKB 2IANB 1IGFH 1HEZB 3OPZH 4P57B 5TDNB 4N8PA 3W0WD 5E5UB 1T1YA 1TITA 4Y4FD 4R7NB 5DZOA 3HNTH 3IVKB 2V2WA 3OJDB 4QRQB 4WEBL 5A2KH 1GOHA 1CL7L 3PABA 3G5ZB 2A9NL 5D9SA 2NY2D 3D85B 5KVFH 5I1KL 5E7FA 2ADFH 2EC8A 5I71B 3NCJL 4G5ZL 3UTQB 3D3VB 1ZT1B 1GC1H 2VKXA 4UILL 1CLCA 1DBML 2BHUA 3H42H 2FLRT 5EUKA 2PXYC 5F7UA 4X5XB 4LHUG 5TH2A 1U8IB 4IRSB 2RJMA 2OZ4L 3K4AA 3IDXL 3VWJC 1A1MB 1DLHA 3BPOC 5EH1A 1QR1A 4XC3H 1H15A 1D5MB 3NZ8B 2DJSA 2BXZA 2GEEA 3U30C 1UZ8B 4JKMA 4N0RA 1IT9L 5ICXA 1GPOL 4HIJA 2Z91A 2BHZA 5FCSH 2XYCA 3M17A 1LDPH 4P2OC 1IMHC 2B0SH 4MX7A 3RNKB 2RCSH 1DQQA 5TH2B 4N68A 4R96A 5C0FB 1NGYA 4JPIB 1LE9B 2E7LC 2J1KA 4L29A 3S35L 5DD0H 1PY4A 4PBVC 1AIFB 4JQVC 1BOYA 1ZT7A 1OM3H 3MBXH 2FGWL 2GITA 2YOCA 1EEQA 3UO1L 2DBLL 1I1AC 4ONFH 4OD2B 1TQBB 1E27A 4R3SB 4W6WB 1WTLA 2VQUA 2QSTA 5LGHH 4XNZC 1XIWC 1FLRH 1L0YA 4G6KH 5I75B 1HSAB 1NEUA 2YRLA 3C5JB 4M7KH 4J2XA 4HWZA 4MCZA 2FO1A 1T22B 1MCRA 5FGSA 1IL1B 4DW2L 3KPSE 1F4XL 2E9WA 5FOJA 2OK0L 2LE9A 1KENH 5ESVB 2UYLA 2QQQA 3V6OE 3N9GH 2X44D 3BIBX 3WEXA 4L3EA 1NJ9B 3RUGB 3VXPB 3S7GA 1NC4D 4S0SD 3H9HA 5IB3B 3RVXC 1DR9A 1G1YA 2NY4D 1GAFH 4BQ6A 2YUVA 3TBTA 1G7HB 5C0RL 1MWAL 5I76B 3MRPA 2ATKB 2FLBT 4GG6A 3HAEH 5CEYB 4J3TA 2IANE 1PYWA 4NGHH 3RZCB 4UTBH 2IBZX 2F5AL 5DLMH 4X7FC 4LMQI 5K59E 4LQFH 3GSWB 3TF7C 4S1SL 3OWEA 4JGJA 4XXCA 3KWWB 2VAJA 4Z7NF 3FB8B 4EVNB 4X6CE 4NDMA 3LV3B 3ESUF 5I1GH 1N3NA 2ZPKL 3EAKA 2Z9TA 3L3DA 2WINA 5L9DL 5E24E 2W0PA 1BEYH 3RZCA 1CS6A 4PRHA 5AZEH 2EE2A 1REIA 4I18A 1A6TB 1VADA 4DKEL 5D1QD 3QDHA 4ZFOA 4DK3A 1BFVH 5DVOA 1RV6X 5T3ZD 3QUML 4GAJL 1RUML 3FQNA 2C3GA 1IM9D 1TVDA 4XNQB 5C7XH 4NM4L 3MOAL 3SDCA 1MCPH 3QPQD 1MAKA 5HYQA 2E7BA 5F1NA 1IKFL 3MLWH 1JHLH 3PGCB 3LRGA 3L3IB 1OSZA 5EU5B 5GGQL 1KT2B 4D0CA 4R7DB 1FNSL 3R1GH 1I9IL 1WFNA 3TO2A 5HHOB 12E8H 1JK8A 4PRHB 5BS0E 1BVLA 1YY8B 1EX0A 4KUCD 4YHYC 3L7EA 4HX1B 1A7OL 1KXTB 2VOTA 5M94B 4MA7H 4WW2F 1CQKA 1EERB 1BQHG 3VRJA 3NACH 4CMHB 2L0DA 1U8KA 5EA0L 1CBVL 3QDJD 1MCJA 2HT4C 5I73B 2BSED 1QG3A 2YA0A 3WIFB 2X40A 1F2QA 4GAFB 1KJ3L 3OSKA 5IGXH 2XT1B 3TZVC 3GIVA 4MXQD 3QEQD 1G0XA 5FYJU 5DVKA 1KPUB 4Z7QE 1AY1L 4G6ML 4YXKL 4EI6B 4PJ9D 2NY4B 3BPCA 1MREL 3ARFD 1HHHA 1AKJA 1UJ3C 2IJ0C 5L88L 3IXAB 3VWJB 1P7HL 4YHZL 3ZE2E 3MYJA 1F13A 3IT8D 4O4YH 4GKSB 3I02B 1T7VA 1URLA 4AIZB 4Y19B 1U2HA 5C0AB 3QHZL 4X6DE 3S36H 2AABL 5F7EH 5IMMA 2NY6D 1JYWA 3D85D 4GMTL 3CSGA 2CLRB 5HD8D 1S9WA 1QSVA 1DFBL 1BD2B 1G6RA 4UZGA 2OTWA 2ADIA 4HFUH 5GJTH 2APFA 3T2PA 4Y5XB 2G2RA 2EXWD 5EOCL 5JDJA 2E6PA 5JQ6H 1YEIH 2JB5L 3DXAE 3RIFF 3T3PF 1UZ8A 3VXUB 2C9AA 2W91A 1IAKB 1DSFH 1RIVH 3MJ9L 1LO5A 3S4SG 3WFBL 1N5AA 5C0CA 2UZXB 4G8GD 3VXSD 3W9EA 4MQXD 3H0TA 3D5OF 4GAGH 4NQEE 3WL9B 1I1YA 4WIQA 3CNKA 1A1OB 3QB7C 3QPQC 3QFDB 4S2SB 1DLFL 3KPLB 2R0WL 5EC2A 4PJFE 3BGAA 5TQ0L 3JWOL 1ZHLA 3D2UD 4QTHA 2PNDA 5GISH 5D2NC 2XWBA 1MCLA 2GFBB 4AT6A 4M7KL 2D2OA 2FJHA 5C0NC 5IESH 4Y19D 1UB6B 4MWFB 3WEXB 4NN6C 3QA3A 2BSSB 4NO2A 4FMKA 2MKWA 1DVFA 5DMJB 5C0EB 1KENL 4MJIA 2NY0D 2YXMA 3FZUC 5DMIH 5HYJD 3EBAA 4Z0XA 3DYOA 1AFVH 3FOMA 4CVUA 2QQKL 1DQJA 5SWQB 4FTVA 4CNIB 2BP3A 5SWZA 4Y16C 4NKMB 4NZRL 1GAFL 1H5BA 3GI9H 1T83C 1TENA 1WWAX 4U31A 1R3KA 5KSBA 5MI0B 3WNNA 3PHQA 4NM8H 5ICYA 4PJHA 4KXZI 5DD6A 5IJKC 3Q1SH 4GT7A 4ZMAT 1DBJL 3RY5A 3WFDH 2JELH 2DM3A 1DUYB 2Z8WC 1FZMB 4W68A 4HGWB 3ECBB 3FT4A 3K2UL 3UTTE 4UTBL 2J8UF 4ISVA 5IK3B 3N1PC 1E4WL 1D9KA 2IQAA 1BOGA 2CJUL 4QOKA 1M7DB 4KAQL 4KY1H 1UADC 4OGAC 4J3VA 3HZYA 3TBVA 3W39B 1U8JB 4PJEE 4OCWH 4TOYL 1JI1A 1MI5D 3SO3C 1X3DA 4RMTA 3HPLB 3HKFA 2Q76B 1TNNA 2RR3A 1QSFD 4H5SB 4G9FE 5DRWB 4K2UH 4D0BA 4JE4B 4Y2OA 2YR3A 5E2VL 4TRPL 2I60H 1SBSH 1B0GB 4HXBH 3S4SB 3VH8A 3SDAB 2VYRE 2ZCHH 1C5BH 4Z7QF 4AEIL 4F7CA 1ORQB 1R3LA 5EZLA 4XP4H 5ICZB 1D5IH 4Z0BH 4MXWH 2Q6WA 5C7XL 2GW5A 3LKPB 5IHUH 5I66B 3KPOB 5D6CA 2B39A 2VRAA 5KSUA 1V3LA 3ES6B 3MLWL 3MR9A 5I2IB 1INQB 1BAFL 5CBAA 1KJ2L 3QHFH 3RWCB 3LN5B 3KPRD 3HZVA 5MHSD 3LZFL 5EU7E 1SJHB 4KMLB 1XGYH 3S98A 5FB8B 1VGKA 5EOCJ 1QFPA 3GI8L 1Q9WA 2WUCL 5TF0A 2NZ9C 4APQA 5JHDD 4JY4B 4I18C 3D9AH 4LHUD 3VI3E 2H2SC 4M7ZC 1J0ZA 1UCBL 4IMLB 3SQOL 5ICXB 5FM8A 2AK1H 1ES0B 3WLWD 3ULVD 4ZAKD 2BERA 4LCWD 4F33A 1A21A 3DRQB 4JFYA 3LEYL 3QQ4B 2P48B 4RAVB 4BK5A 2FX8L 4ODTL 1QKZH 1MCKA 1ZKAA 4HIXH 1IGFL 3OPZL 2CDGA 1JGVL 3LQAC 4ZDHB 1ZANL 4QCIA 4POUB 1AY1H 2X42A 5E6YA 2B1AL 3W11C 1ETZB 1GZPB 1U3HB 3CPLA 4MA8L 2XZZA 4F58H 1D6EA 1G6RH 1EPFA 4X6CF 4JO2L 1U6AH 3DX7A 4PRPB 5JIIA 3EFFA 4RIRB 3NCJH 1J1XH 4PGDB 5IBTH 1Q94B 5B39A 1N6QL 2UY7A 4XNMA 4M7LL 1FFOA 2FO4A 1JGEB 4Z77A 3UZQA 5HDBF 1JGDB 3HRZB 3ROOB 3FO0L 3L1OL 5E8PB 5C07A 1YEJH 5HY9B 1YMMA 5AWNL 1VHPA 3FL7A 4PGCB 2IH3B 1P9MA 4Q6YA 2DLEA 2D7QA 1AC0A 3DBXB 2DM2A 1JFQH 4GRMA 2VLLA 2AW2A 3T77A 4DZBB 5DEZA 2V2XB 1T20A 3QXAA 5INCA 4H8WC 2P42B 1FZKA 4DUWA 4MNGA 1BFSA 1DQDL 4F9LA 4P23A 1B2WL 3O9WC 2M8XA 3ZYJA 4PJEF 1Z0MA 3QDGA 4YBQC 3M1BA 4OZIB 1PLGL 1EDQA 4OIBA 1B6UA 4RNRB 5GISL 4X6DF 4AQOA 2VN4A 4N8VG 3ZYIA 5I30H 4HW6A 5EOQH 1WFUA 1UM5H 4ZFFB 2YKLH 1QFUH 1OAYL 5IFJA 5JXAL 4GUPB 3STZA 3VD4A 4JPWL 5EULV 3VXNB 4P23B 1JJUA 4PJIF 4LCYA 3CFDB 1C16A 2P43B 1FPTL 4P5KB 3I85A 2QQKH 3FB8A 4UB0H 5GGVH 4I3RH 1RQ5A 2JJTC 2C3HA 2VDOH 1N59B 5LKNA 5LVEA 3VW3L 4LMQE 4F57L 4NNYB 1OT2A 4UIMA 5I1DB 1RJZA 1JNNH 5T3ZL 4PBWD 4P46B 1EHLH 2VDQL 1V3MA 5I19L 4H1LH 3WIHL 5FO8A 4G6AD 4MD0B 3CFDA 3T09A 5F1SA 2ZUQB 5KSAD 4HUVA 4ZNCD 3NBNA 2IH1A 3QNXB 3L3KA 2BNQE 4Y16B 1JK8B 2PYED 3O2WH 3BN9C 1VFMA 3PF2A 5DK0A 5FHAH 3EOTH 4KHTL 1U92A 5IFHH 4JM2B 4OCWL 3UTZB 3PGCA 3OKNA 4I5BB 4UIKL 5HYJE 2B5IC 2EXWC 3HPJA 4JFDA 1CE1L 1NUGA 2ZSVB 3VD3A 1JL8A 4GW4A 4KZEL 5FO8B 1S9VB 5I75C 1NFDB 2VDPH 2BC4A 1QLRB 1I3GL 4ZSOE 1MSPA 4N0UE 1ACYH 4KROC 2DLTA 3QAZB 4R0LC 1EO5A 4C55A 4MB5A 4U33A 1D9KC 4K94H 2O5XH 3NFSL 4M48L 4OD3L 4YBLC 5IMKB 4DKEH 3NPSB 4W70A 5T3XD 1UH2A 3FOLA 3EJZD 1CK0L 3ZTJG 4GAJH 3QHFL 4LNVA 9CGTA 4PY8I 4UI2A 4J8RA 4ZUWB 2HRPH 1MLCA 4L4JA 5DHYA 2OTPA 1C1EL 4KK9D 1N6VA 1JHLL 4JQXC 4S1RL 4LVNC 1INEL 4WWKB 5JA8B 4XVJL 4JM2F 1I9IH 1AKJB 4L4TD 3MCLL 3KJ4B 4OLVL 4N5ED 2NXZC 5KTEL 5IM7B 5GRXG 5BZDB 1UCBH 3FCTA 5E0QA 1W72L 1JTOA 4LAQH 4ZOEA 5D70H 5BVPL 1TETH 3IF1A 2FX9H 3OAYK 4Y16D 3RFZC 3DMMB 3UTTA 3MRDB 4HG4K 4X4XA 2WP3T 3H9SA 1OCWL 5HDOA 5IF0B 4ALAL 1HOCB 4N0FA 5TPWL 4NQXA 3VXTA 4PGDA 1RJLA 4MCZB 3O2DH 3QULA 4P2CG 1NAMA 1JGEA 3P77B 1IC5L 3BYTA 4OI9A 5E94B 1HHKA 3KNBB 4HUUB 4EI5A 4KVCL 2F74A 4JFFE 1AC6A 3R8QA 8FABA 4OI7A 1FL3A 3R4DA 3SDXA 3D39A 3QH3A 5EZJB 3SDCD 3UAJD 5I18H 2DQDH 2IPTL 3CFIC 4OZGB 1ZLSL 5D7LD 5B38B 1JPGA 1LO0H 1QQDA 4J4PA 3H9YA 3IDIB 4WI9A 1T1ZA 2DDQH 4XH2A 1I7RB 3HZKB 2IQ9H 4YPGA 2IF7A 1YEIL 4HMCA 4LSTL 1FGVH 1PGRB 4FQCL 5LJYH 3CX5K 3MJ9H 2J88H 3VCLB 2B8OT 5INCB 1SEBB 4C57C 4YC2B 3DLQR 4KK8D 2DQUH 3GSXA 1NCDL 1LILA 3FT2A 5M7QA 4MSWB 5AZ2L 5J11B 2H26B 4TNWF 5FV2A 3FFCA 2WIIB 2DTMH 5ENWB 1NH6A 1QZ1A 4YDKL 2Z93A 1OP3K 4YXLH 4Y0GA 2NY5H 1KN4H 1QFUL 1EO7A 4I0PD 3GO1H 5DJDB 3QDMB 1OVZA 3CFBA 3P3YA 3CMGA 4UAOC 2DQFB 2EECA 4Y4HB 3RKDD 3TYGL 2BJMH 4O2CB 3I50H 3GMQA 3QYCA 4C54A 3QUYC 2VITA 1WBZA 2V2WB 3OJDA 3BEVB 4FQXB 1Q9LA 2GAZB 1A7RH 5ISZA 2D9QB 4NRYA 1CG9A 3B6SA 2A6DB 1YJDL 3B3IB 4PB9H 3UZVB 4F57H 1J5OH 4YIQA 3C8DA 4F3FA 3BDYL 3K81A 1HDMB 4M7ZB 3UJJL 4LU5L 1ZAGA 3K8MA 2P5EB 2AXJA 5AD0B 3OJ2C 1F45A 3F5WA 1C5DB 4AK1A 5CHNA 3K74B 3H3PL 1V5JA 4PJHE 4FXKA 5JUEH 1SEQH 5D7IA 2NZIA 4H25B 2M1KA 3PP4L 5KSBE 4P2RB 1KYOJ 3AU1A 3FTGB 2ZSVA 5E5MB 1CTNA 1U3HC 2CXKA 5T5FH 3X12A 3I3EA 4OLUL 3MYJB 5IBUG 3LEXA 3X3FL 2DQHL 1KGCE 2YRZA 4OF7A 2EKJA 4HIIB 1DCLA 4HLZG 2IPKA 1T21B 5GS1A 1YPZE 4ZXBD 2C26A 1KNOB 4X8JA 3HI5H 2AJXH 3TNMA 3OAUH 5HHPB 1UVQA 3RPIB 1TPXC 4NQSB 3IXAA 2MCPL 1G6RB 3ZDZF 4HAGA 4HH8A 1RZJH 4N9GA 4Y2DC 2LV4A 5D7JC 4U6TA 3IDNB 4RAVA 1KEML 3L3OA 5E8NB 5J0BA 2EICA 3D3VE 2GY5A 5J3HD 2XY2A 3ARBD 3DX9A 5D2LA 3S88L 1MIEL 3UBXA 3NTCL 3RIFK 3LCYA 4QT5B 3UYOD 4I3SL 4LLVA 5EDXA 4Z0BL 4UV7L 1S7SB 2APXA 5FV1L 5I9QC 1FFQA 1AHWC 1OF2A 4NPYB 3C8KB 1KJ2H 5F7KC 1VKXB 3IDNA 3O9WB 1RVFL 2X1PA 4J1UA 1IGIL 4HZLA 1Z0NA 4XPGH 2BCKA 4G8FB 3S6CA 1HH6A 1E4XL 1AO7B 1XGYL 2A6KA 3AMKA 3F7VA 4HIJB 4AEFA 3IDYC 4ODHH 5H35B 2WZPD 3BT2H 4QWWC 3IXTA 4GAYA 4NQED 4TUOA 3VMPA 2XQYK 4DN3H 5KSAB 3TT3H 5IB3A 4DKAA 1VFUA 5D70L 2D03L 4LARL 1UYWL 3FJTA 4P4RB 5JIKA 3RWIB 5IF0A 2W65A 2WUBL 5DMGD 4OQ1A 4ZUTB 3QEQE 3SPVA 5HGBB 1TFHA 3B2VL 1X7QA 3HMWH 5D2LE 2QV2A 4PP2B 3LOWA 1QVOB 1U3JA 4H26B 4X4MA 1TVBA 3OXSA 5BO1H 1XR9A 5TPWH 3EYUH 3DHMA 4JGUA 1E4KA 2H41A 2OMNA 3NIDF 1I9RH 2F54A 3BGFC 4LIQH 1QSFA 4FQIH 4IDLA 3LKSA 3UJTH 5DJYA 1HYRC 1VACA 1DEEB 5DEGB 4MA8H 4PY7A 3VFWB 3OR7A 4M5YH 4IOIA 2VZ3A 3D0LB 3F8UB 3EO1B 3HE7C 3MRRA 3NZHH 1WLHA 3AGVA 1DQMH 1T6WA 3HHRB 2DQDL 2IPTH 2QBWA 4YO0B 5IFAL 4WFEE 5FYKD 5KG9A 3ILQD 3BPNC 3QG7H 3KDMA