4OZIB

S2 protein complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
188
structure length
180
Chain Sequence
SPEDFVYQFKGMCYFTNGTERVRLVSRSIYNREEIVRFDSDVGEFRAVTLLGLPAAEYWNSQKDILERKRAAVDRVCRHNYQLELRTTLQRRVEPTVTISPHNLLVCSVTDFYPAQIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DQ alpha 1 chain
publication title T-cell receptor recognition of HLA-DQ2-gliadin complexes associated with celiac disease.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 180
sequence length 188
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4oziB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4oziB01
2X70A 2Z93A 4I9WE 5E1AA 4XXCA 2HVJB 2IANA 2NXZB 4WUKH 5E24E 5D1XA 3E8UH 3OKDA 2GTZA 5DZNA 5ACZA 2UYLB 3FT3A 3QUMB 4KKAC 3P30H 5ERWA 1HI6B 1OTTD 3KJ4B 4GW4A 4PJGA 2Y36L 4L4TE 3ARZA 2P4AB 1L6ZA 5BV7C 4KZDL 1FFPB 5TJWK 4L4VB 3O45B 4BH7A 3V0AC 2PTTB 5E8OA 3ZKXC 4QF1B 1S7WB 3QIUC 3R0NA 4S2SA 2HJFB 3CLFL 3UJJH 4ODUB 2ATKB 2J8OA 1BIHA 1KXVC 1S7QB 2W91A 2FBOJ 4ODWB 1KCRL 1Z9OA 4N5EC 3ZDXE 3BUTA 5F44A 4QXTB 1Z5LA 2YEZB 1SQ2N 4LIQE 1I85A 4GMTL 3T2NH 4XRCB 3FJTA 1YEEL 5BZWB 3DX6A 3JUYA 1EFXA 2ESVD 4RGNE 3JV5A 1D9KB 3L3KA 1JTOA 3S36H 3ESUF 1QLFA 4RGOL 1DLFH 3EOAB 5FYLD 1T83C 3NGBB 1R3HB 4M7LL 3VXUA 2YD8A 1MHCB 3G6JE 2F54D 5JHLL 4HPOL 3GSRA 2I9TB 3OAYH 4DTGL 5HD8D 2Z31D 1JWSA 1QFWI 4XP6L 5IK3A 2FATL 2OXGA 4QTHA 1JPFA 4CNIB 5CEZE 3MMEB 4AYFA 2ZCKL 2R39A 5MEOA 2H26A 3OQ3B 4NQVA 1ZHBB 5TQ0H 4QWWD 3AM8A 3TJEH 4I48A 3QH3A 4FQXD 4AEFA 2LFGA 5I8CA 2APXA 1NMAL 1ZHKA 4YDVB 1TCRA 4HIIA 5JNYB 2GK2A 5KS9E 5DMIH 4NT6A 2EDKA 1D5ZB 3CFDA 1LD9B 5GGRB 3P40A 4XC1L 2DLGA 2OR7A 1NGWB 4YHZH 2EH8H 4NM4H 1A4JB 1NLBH 2EDLA 1I75A 7CGTA 1PDKA 4Y8AA 1PD6A 3JSSA 1RZ8A 2APFA 4LQFL 4XP9H 4IRJD 3LQAL 3QWOA 2VXQL 2IADA 1IAIM 3UJTL 4XNMB 4JREC 4LKXB 4JRXA 3MJ9A 4U6TA 3NPSB 5JLZA 1QEWA 1NBYB 5KVDL 1FRGL 4L8CB 1S3KH 1F45A 5CKAA 4EKXA 3PHSA 3IDXH 3KXFE 5HHOD 2GJ6E 1EO7A 3NCFB 1U36A 2P24A 1L7IH 3ZDZE 3PV6A 4LASL 3TBSB 3BHBB 4CADB 1UFUA 3TA3B 1DQMH 3GSNB 5JIHA 5DK3A 5E5MB 4IM8A 4XWGL 3MLUH 3S35H 1BOGB 3VD3A 3KYAA 3T8XB 2FLRT 5D7IF 3ZT6A 1EERB 4GKSB 3BVNB 4FQ2H 3ECBB 4RAUA 3RWIA 3OAZH 4NC2B 4PRIA 3MRPA 3F7VB 3CH1B 4PR5A 1MJUH 2DIJA 1VDGA 2H6PB 4DKAA 1BF8A 4YBQD 4ODBD 1NGPH 4KJYA 5BXFB 4PY8I 4WWKB 5DR5L 1D5BA 1CDGA 4OZIE 1FP5A 2XA3A 5F9WC 1UYWH 4W6YB 1CE1L 3BN9D 5EU3B 5I16B 2OP4L 2FWOB 1OARH 1FCGA 3LZFL 3A6BH 3S37X 3BPNB 4OFVA 5T1KA 5D7LE 4U1MA 3JTSB 5FM8A 2ED9A 4X7CC 4W81A 3SDYH 2ZOLA 2NXZC 2IBGA 2IH1A 2YMXL 2FX8L 4F33A 3S34H 3GMOA 2F19L 3IFOA 5H35B 1UXSA 4Y4KB 5DI8B 4HWEH 1R5IB 4LLUA 5JW4Q 3KJ4C 3LSOB 4G8EA 5KSAD 5I30H 1WV7T 5KW9H 4G3YH 2R1YB 4F3FB 2W07A 1FFQA 3MLRH 3EZ8A 3IJHB 4Y5VB 1CGYA 2XN9A 4NM8L 4E41A 4F9LA 5EOTB 1YMHB 4JDVB 1KJ2B 4GQ9L 4O5LH 3NCJH 4MXQD 5FGCB 4DZ8B 4LFHD 4WU7A 2BERA 1YN7B 3I2CL 5T3XD 1YNLL 1NBVL 4JDTH 1A1MA 2EC9U 5DURD 2VXTH 4XPHH 3TIDB 4YXKH 3F65A 3SBWA 3MRFB 2MKLC 1IGCL 3MXWL 2A74B 4EIGB 3MOQA 4OFYD 3EZJB 3HE6D 1IZKA 5DT1H 3MLYH 2L0DA 1D9KC 3BD3A 4M4PA 3WHXA 6CGTA 4G9FE 4OCRL 1JFQL 3DSFL 4C56B 3HMXA 1H15B 1A7NL 5GRWA 3ROOA 1GC1H 3CX5J 1EH9A 5IB5B 1YMMD 2F5BH 1NUFA 4ZS6C 1MFDL 1DQLL 1YQ2A 2RFXB 1ZA3A 4PJ7F 4BFEA 4HF5H 4N8CH 3DSNA 1HN1A 2R0LH 3G6AB 1SVCP 4XZUA 2PYED 3QO1B 1RIVL 9CGTA 4Y19E 5KSVA 4ZODA 5FK9B 5EH1A 3RY6C 4XVSH 1CL7L 4UBDD 1DCLA 1PG7X 2XXMB 4Z7UE 1AP2A 5MEND 4AY0A 4A6YB 2C1PA 4KQ4H 1KG0B 1S7RB 1U8KA 3TPUA 2JJUA 1U3ZA 5HGBB 5IT2L 1QRNB 2IQAB 3LS5L 1DQDH 1SY6A 3PHQA 3X14A 2VLMD 1JUFB 3AVEA 4F15B 3HNTL 1E4WL 4G8GD 1YEDA 2WZPD 3QXAA 3N0PB 4I0PD 5D4QA 2X1WL 4UINL 1F4HA 4IRSD 3TIEB 5D2NB 1PKQB 3D69A 2V7NA 4TUJB 4XPBH 4ZO6A 4JFED 2EEDA 1YEFL 5JQ6L 3C9NB 5AWNH 4DKDC 2V17L 2XZZA 2A77H 3NPSC 3ZE0E 5BJTA 1T5WB 5ITFA 3ABZA 1W8NA 1KCLA 3LPGA 1CFVL 3NFSH 4S1SL 4OD1L 2WUBH 1BZ7A 1O7VA 4DAGL 4PLKD 2JKXA 5ITBH 3ETBF 1P4IL 1J05A 4KDWA 1QKZL 1ZSDB 1B9ZA 5SX4H 1HH9B 1OLLA 3L3HB 1CDUA 5JMRA 1A4KA 2DQJL 1CFQA 3N9GL 3RKPA 43CAA 3EBAA 3UTZB 4R0LB 3O2WL 2Q86B 4LLMB 5FB8A 3C87A 2VC2H 1J12A 3DURB 4GBXB 3BKCL 1FYTB 1P4LA 1ZHLB 4FFYL 1MFBH 4F7TA 3V6FA 3VG0H 4WENB 4FXKB 5GQBA 3EO0B 3PWPA 3X13A 4NBZB 3EDDA 4PBVC 3E6HB 2P5EB 5CJBA 4QRSA 2BNRD 2DBJA 3OKMB 2EECA 5ICXA 1JP5A 3M17B 1S8DB 4AIZA 5TDPA 4NZDA 3WO4B 4ZSOE 4JG1H 3QEQA 4WWKC 3STZB 3U4BH 3D0LB 5IP4A 2YRLA 2W65A 1IGTA 5DTFB 1FGVH 5K9QG 2D31B 2FR4B 2ZSWB 5FA3A 3RNKA 3BPNC 3N1PC 3MLVH 1IKNC 1K85A 4MD0B 2PR4H 2XKSA 4LRNH 2XQYG 4ODSH 1DBJL 2BSRA 4J2XA 5KZCB 1OB1A 4Z7VB 1MQ8A 1QLRB 4Y4KC 3E2HB 5SX4I 3LKQA 1YPZF 2AK1L 3CFKB 3VXRD 5GS1B 3C5SB 1AD0B 4JGMA 1E6JH 3MA9H 2VLLB 2MCG1 3NH7H 3WS6C 3KWWA 4JFYA 2JJTA 4Y5VC 2VLKD 2C7UA 5CLTA 4HCRA 3LKSB 2DOCA 4H1LA 1ULVA 1KB9K 2R69H 4QRPB 5LWYL 4FP8H 1BQHB 2L7UA 5CSZB 1Q38A 4GMSH 1ADQL 5K9JH 3GSUB 3V9FA 4ODXB 4Z0BL 5IVXF 3SCMB 3PJSA 4P5MB 4OLYH 15C8L 1OGTB 5IMOB 3RL1B 1ZMYA 3CFCL 4P23A 2Y5EA 3MZGB 4NQXB 4M7LT 3EO1A 5BO1L 5ICZB 1N0XH 1NMBH 2MOVA 2A1WL 4X4ZA 4RRPA 3OGCB 2CD0A 3C08L 4JN2A 1FNFA 3BP4A 2DQGH 4LF3B 5BOZG 3BH8A 4BFIA 1Q9LA 4HS3B 1SBSH 3TNMA 1I8MA 1FVEB 4YEFA 4X7FC 2Y25A 4V1DD 1IGYA 4HKZA 3CJJA 4X4ME 5F7UA 3S4SG 2DD8H 4K3JL 1AR1D 2AV7B 4A6YL 3NACL 2VZVA 2BVPB 1YUHA 4X5XA 3DGCR 5DJAA 5LQBL 4DCQA 5CZXC 3U82B 1S7VB 2VXVH 1G9EA 4W68A 3UDWA 4DVBB 4NRYB 1AGCA 3P4NB 4QHKJ 3U0WL 4F15C 2IAND 4EN3B 2Z35B 1KXQE 1HXYB 2A2QT 2FH6A 2NX5B 3DI2B 2HWZH 3I02B 3JZ7A 3VFVB 5CJXC 1B88A 1U91B 2AGJH 5TF1L 1N5AB 4M9OA 4K23H 4GH7B 4WO4A 4YAQB 4JLRA 1J11A 4DUXA 2DMCA 4NO5A 4FXGB 4Z78A 3OHXB 2VQ1B 4KFZC 2Z8RA 1KEGL 1RK1B 4JCMA 4K3EL 3V5DB 4YDLB 4NUJB 1N2RA 4PLJC 2PYFA 1B0RA 3NVQA 2YBRB 1T21A 1CGSH 2CUHA 4XHJD 1U3HA 3HUJE 3RZWA 3MRIA 1JGUH 2JELH 3D3VE 1YN6B 4YHLH 5FO9A 1CQKA 4AL8L 1KCKA 1G9NC 1PY4A 4JY5L 1I8IB 2Y6SC 1CGXA 4U1JA 4JKPH 2NY3B 1BVKA 4HPYL 3GSWB 5ISZE 3UTOA 1OAXL 3FMGL 4R0LC 2NTFB 3BAEH 4G80A 2V9QA 3ZHKA 4GBXC 5LAXA 3H9HA 4JPIB 4XPGH 5DJCA 3ULSB 1JYVA 2PO6B 4I8DA 3VXUD 5JR1H 3GBML 5D2LF 2BMKA 4XMKH 3MROB 4OLVH 1AE6L 4JO1H 3RA7L 3MRLA 4UU9A 3UX9B 3HZVA 5JW4R 2FZ3A 1G9MH 3WO4C 2OL3H 1C08A 1QFPA 3WFHA 5DHYA 2CO6B 2JB5H 4NRZA 1DEEA 2Y5TB 3GMLB 2E6QA 4JO3L 1FFNB 3CMOH 3NTCH 4JFDE 3CCHB 1L9MA 5I8EB 2YPKB 3DMMA 4OUOA 5BS0D 5BRZB 1QO3A 4KROB 3VWKB 4FMKA 3GIVB 4Y4HA 4JO2H 5DD1L 1YPZA 2LU4A 4R4NC 3PIQB 4NNXB 4TSAL 1DR9A 5GZOC 3IT8D 5E94A 5GS1C 4PTUA 3OJDB 5LKNA 3MCG1 1N0LA 1G84A 3G5YB 5EZOH 1JMXA 1QFHA 4YO0A 3HFML 4CBPA 3WLBB 3D6GA 3EDJA 5HHQB 3QQ3B 4Q2ZA 3LKOB 2J5LB 5D72L 4JY4B 3FZUD 1FIGH 4HEPG 5E7BA 4OT1H 3R8BB 1T20B 4NKIL 5C08B 5HYIA 4XVUD 3F5WB 5C9JA 1Q8MA 1SEBB 5I1JH 1JHTB 5TGBB 5GISL 3TO4A 4QRTA 3H42L 5I18H 3GHEH 4LCWE 1WBZB 3V0VA 3L6FA 2D7NA 4Q58C 1N3NA 3SCMC 2GKIA 1U8OA 1WLHA 1KB5B 1ZAGA 3O3UN 2C3HA 1RJLA 4JDZA 1MJJA 3VFPB 1NFDE 1GJIA 1P7KA 4DKEH 2UZIL 5GJSL 5B38B 2VN4A 4Y88A 4KI5C 1TVBA 3QDMB 1ZLUK 3E6FB 3F12A 4PRID 1ZT1A 4ZOBA 4MQ7A 1TZIA 3CFBB 1YC7A 5JW5A 1DQJB 2OZ4H 2AEQH 4H26A 5F93C 4L9DA 4WHCA 4N9OB 1NSNH 3GMMA 1UG9A 5DHVA 1PZUB 1M7DB 2J88L 2QHRH 4UDTA 4OZHF 3QI9A 4L8SA 3ZDXF 1QPPA 4XPFL 5C92A 2GAZA 4I18A 5T1KD 4Y7MA 4YWGH 1RK0B 3MRJB 1MCJA 2AXJA 3V52L 4RWHA 4JHAH 3VU2A 3K46A 4EN3C 3BQUD 2DDQL 5IHLB 5F1SA 3HC0A 1C12B 5I66A 1AI1L 4X7TB 3SJVD 3LRGA 3BRFA 1BLNB 3LB6D 2RCSL 4KVNH 1G6VK 3QO0B 3NIGE 5DEGA 3G6JF 1MREL 2F58H 3SKOA 4FN0A 4O2FB 4MA8L 2HFTA 1KFAL 4MJIA 2XN9D 4XT1C 4YDJB 4YDLC 4E41D 2ARJB 2E7BA 4UNTA 2CIKB 5T3ZD 1M6OA 1QTYT 2MFNA 1FNEA 2VABA 2XWTA 1I9JH 4I3RH 3FQXB 1T1YB 3P73A 2MCPL 3BD4A 4APQA 5JW3L 2ERJB 3W9DB 1U8PA 1RVFL 4O9HL 4HK0A 1QSED 3BEVA 3EJJX 4JPWH 4FQIL 1ACYH 35C8L 5IVZB 5JOFB 4HX1A 4XMPL 3FAWA 5KS9F 3MC0A 4PJHB 2NY3C 1RHHB 2MQCA 1LE5B 3DLQR 4YHPA 1YJDH 3ARGD 3FQNB 2VR4A 4I5BA 3GJFK 43C9A 5GJTH 4GAJL 1GGUA 2YD2A 1LEGA 2OR9H 3PNWB 1MCHA 3GHBL 4LAQH 1D3CA 2PO6C 3LKPA 2NLJB 4KJQD 1AGFB 3VFTA 5D2LA 1JI1A 1CIDA 3WNMA 5SWZA 3DVNA 1BECA 2XZAH 2Y7QB 1OSZA 2OTPA 3VRJB 1YC8A 2BHYA 4G43B 1E28A 4NKOA 3K2UL 3MSPA 2H32H 4XVTL 5D7SH 2IF7A 3HRPA 1XF2A 3UYOD 4D9RE 3VXNB 3CLEH 5IQ7H 1OCWH 4NQDD 5DHXB 3ZDZF 1G7HA 4HJJL 4MXWH 1I3RA 3I9GL 3VFSB 1D5IH 2E7LC 4LRIA 3SE8H 3BEWB 1IFHL 4ONHB 2OR8A 2IGFL 1I3VA 2DQEH 5E70A 2WV3A 3JV4A 5CS7A 2H45A 4KROC 4ZAKB 4PREA 1JPTH 5TF0A 3VWKC 4P2QB 1AGEB 4G6AD 4NN7B 1V3JA 5L6YL 4X6BA 5C0AE 2YKLH 4PJ5A 4OB5L 3WE6B 3SOBH 1JGVH 1UM5H 4H8WC 1UM6L 1YEHL 1BZQK 4PB0L 2EDBA 4H8WL 4N0CD 1IMHC 2OX5A 3WDIA 5EG6C 3LKNA 3GRWH 3OX8A 2J5LC 3AS0A 5C2BL 3FFDB 4OZIF 5EN2A 2WUCL 4J3UA 3LKRB 3FOMA 1NCBL 4RCAA 1XGYL 1HINH 2LE9A 3IAPA 5DRXB 2Y07H 2FECI 4KKBC 2Z92B 1ZTXL 4DUWA 4OTXH 3DXAE 4OKVA 4PTTA 4FFZH 5EBMA 1FH5H 2AEIT 4JB9L 5KOVC 5B3NA 1SMAA 2R2HB 1NDGB 4Q0XH 5E6ZA 2V5YA 1OGAE 3VRLE 5A43C 3AS3A 3UXFA 1RUKH 1U6AL 4XC3L 2G2RB 1F11B 1KB5L 3O2DH 4PRBA 5DJ6A 4YNYB 5LGKA 1KACB 1W72L 5DD6B 5DFVC 3ZZ1A 4ZPVA 1T4KB 3QJHB 4YXHL 3PWPD 3MFFB 1E0OB 3HNVL 1S9KC 1MLBA 3F58L 5C0DA 3X3FH 1G0YR 2DQCH 3BYYA 5MERA 2J7LA 1LO3L 3CZFB 3VFWB 4HIEB 4LFHG 4ZFZA 4Q97A 4XAKE 1YQVH 4WFHE 4CN6A 4KY1H 3BZEA 3B2VL 1LNUB 3Q5OA 3QEQD 2FEDD 5ANME 3NZ8A 1QFUL 4OZHA 4PY7B 1JCKA 4P9HC 3OF6A 3PQYA 1RZJH 2W9EL 4U6XA 5EWIL 1T0MB 1KC5H 1SMOA 5DJ0B 4WIQA 1UVQA 1ADQA 4PRNA 5EU7C 5I6XB 4U1NA 5FCUH 3W0WA 1HK6A 1UZ8B 4TOYH 3DRTA 4XBEL 5T1MA 3QUKB 1A6AA 1A02N 4KZEH 3BFOA 4X9HA 1NQBA 1CTNA 4PBWD 2ZPKL 3IS1X 3OJVC 1IM3A 5F7MC 4LGRB 3KYOA 3ARFB 4FZEH 1T7ZA 1N64L 3GGWA 2H2SD 3TVMA 4EZMA 1W8OA 3PL6A 4L4VE 1Z0NA 2Q76B 2BVTA 2FX9L 4JM4H 3KPTA 4K55A 4Z7UF 1FL6B 5T3XH 3IVKA 1OAUH 1Q1JH 1V7ML 1VFOA 3QXWA 2OXHA 3MA7A 2ERJC 4X0KB 1IEAB 4HUXB 5T1DH 4S1QH 1KIQA 1E4XH 4HXBH 2DM4A 4MDJB 4K3HA 4LARL 1JYXA 4EIZC 5GS0L 4M6ML 5IMLB 4Y2DA 5IW1A 3V7AE 1I8LC 3QIBA 1BVLA 1GGBL 1KIRB 2ITDA 1QA9B 1SEQL 2LV4A 3UBXG 4GG8B 3GM0A 5EIIB 3GMQB 1XAUA 2E7MA 3C5ZB 2YA1A 4Y8DC 1BEYH 2YD6A 1U8JB 4YFLF 5HI5C 5T5NF 1LEKB 4NQED 3NABL 3VD7A 3ZE0F 5FYKL 4B53A 2UWEB 2C3XA 4POYA 2B1AH 4OZGA 5KVFL 5J1TC 5HYQB 1DBKL 2W38A 2BVUA 1IC4H 5HGHB 4AEIL 1NKRA 1XF4B 4HC1H 5IFJB 3HCVB 4PGJA 5TFSH 5CEXA 5JOEA 1LK2B 3QWRA 1HIMH 1BD2A 4LPXA 5JPMA 2IWGA 4LVEA 4R4BB 4F7MB 1DP0A 5TDNA 1FL3B 1G6RA 4MJ6A 1VKXA 5HVWA 1JPGB 3QG6B 4KDTC 4LU5L 5DMGC 4ZAKC 5E9DB 5EOCL 5I15H 1E4XI 4NN7C 1Q0XH 3HB3C 2ZCLH 4Y1AA 3CSPA 1IC7L 2OLDA 3AU1A 2DQFB 2NY1B 3PGFL 2Z9TA 4G6KL 1J1OH 1TTGA 2XPGB 3K1DA 1ZVSB 5ECJE 2HG5A 3KG5A 5FUZL 1CLZH 1OVZA 1P2CA 1U3HD 5IG7A 5ILTH 5IBLC 3SKNB 5GIRB 4DGVH 4K9EH 2WIIB 1NAKH 4OIIL 1N59A 1N8ZA 5D7JB 5D7LA 2AXGB 4EQ3A 4QOKD 4OZFA 4Z7WF 4BJLA 4NZUL 5F7EH 4JFPB 4ZQKA 3LPWA 1HZHL 3WIHA 5DEZA 1JHKH 4F7EA 2EDJA 3BT2L 4HUUB 4J1UA 5FGBC 2VL5B 5I1DA 2VERN 2FLBT 3S9DB 4QKXB 2ZG2A 5EORL 3QUYA 4YH6A 5JQHC 3IFNL 5F96L 4OCXH 1NGXA 5J9PA 1S9YA 5AZ2H 3MNWA 4R26H 3QEUA 2YWYA 4FQLH 5AUMB 3MJ8A 4HT1H 5E8EB 3OBAA 5DD3H 3DNKA 1H8SA 3C2SA 3I75B 3UJIL 3VDBA 4JQVA 4R4FL 1SYSA 5H37H 3T09A 4AH2B 4F2MB 3DX7B 3U9PH 4QRQA 4YDIH 5IW6B 3P11H 3EHBD 5I1LB 1AKJA 5D70L 4UB0H 3DMMD 5I6XC 3SQOL 3KLSA 4U6HB 5DEFA 2VN7A 5LBSL 4KUCD 3H7BA 3OAZK 1TIUA 1JNLH 3MGTA 3H3PH 1TZGH 3VFRB 1T22B 1I9IH 3KPLA 1QQDA 1AO7B 4JY6B 5DK0B 4PGEB 3V8CA 4G7YL 4X6EA 4EUPH 4O2EB 5E4IA 2XKUA 1I1FA 2ZUTA 4WW1A 1DE4B 2HTKD 3ARFC 4WUKL 4J7RA 3L7FA 4U7KA 1DQQB 5E99H 3HAEG 3E8UL 5HGDA 3G6DH 3X12B 2JTDA 1LDSA 3P30L 4HWZB 4MVBD 2DN7A 2XY2A 3FO9B 5IVNA 1J1PH 3TO4D 1KXTB 4JRYA 5FGCE 2OTUB 4CU8A 2JCCB 2P49B 2R23B 2XT1B 1HKLH 1X5GA 5I73B 4ZUVB 4BQ9A 4PP1D 1A6WH 2HFGL 4JFZH 2A83B 3MX0A 3UJJL 3BN3B 3QNXB 2GI7A 3KR3H 5B39B 3QQ9D 1KENL 4PRHB 1LE9B 1FE8H 3EOTH 4PJ8A 3C5ZC 3PDOB 4C56E 1SM3H 4TN9A 3S88H 1KIPB 2YHGA 3W11D 4LNRA 3HI1B 4Q7DA 3S36L 2X4UA 3HUJF 2AJSH 4M5YH 1DLFL 3QI9D 2ATPB 4WHYG 4BUGA 2AV1A 1V05A 2F53B 3OG4B 1HEZA 1VGKB 3QA3B 2NQCA 3QUZB 4M62H 1AGBB 1MNUH 3B2UD 4DVRH 4OF3A 2I5YH 1QRNE 2F8VA 5AAMA 4PS4L 3MRCA 4GS7B 3HZMA 4LBEA 3RVWD 5TQ0L 1BIIB 1VCAA 3TJEL 5FKAB 3P4OB 4QGYA 4Z7OE 4Q9QH 5D2NE 1PKQE 3ZDYE 2NY1C 4MGXA 3QYCA 2IPTH 4MJID 5DMIL 2GSIA 2K7QA 2ILLA 3HE7A 2F74B 3IXTB 4ZSOA 5B4MD 3TJHD 4OLWH 4LL9A 4OFKA 2HLAB 3HR5A 2EH8L 4NM4L 4YHZL 1OM3H 1NLBL 3W5MA 1IRAY 1K4CB 3QDJB 3AGVA 4XP9L 4HWUA 1RUAH 3A67L 4K8RH 5D7JC 5HGAA 4BH8A 4Z7WA 1P69B 1U8LA 1CICB 4LSQH 2ICWB 5IBTH 5EBGA 1S9VA 5EC2B 2ZOKB 5D7KD 2FNBA 1A6ZA 3VXOA 1A64A 1S3KL 3VA6A 2ZCHH 4QXUH 1INQA 4U0RB 4MNGA 1QNZH 5HHXH 3RUGA 3PXHA 4DFIA 2E6JA 1MWAA 3GNMH 1FYTE 5F7KC 3GUTB 5SWZD 3HNSH 2XACC 1AD9A 1YA5A 3RQ3A 5C0FB 4XBPB 2VNCA 3S97C 3MLUL 1AH1A 2X40A 2P5EE 2ICCA 3CX5K 5SWQB 2V2XB 4MX7B 2KKQA 4UILH 1AIFA 3EYUH 2FL5A 3RWFA 1WCBA 1EEZB 1MLCB 1NGYA 3ZE1F 4HV8B 3IJSA 5DJYB 1CGVA 5C07A 2BCKA 1TNNA 1MJUL 4NQUA 5BVJB 5IEHA 5ID1A 4HGWA 1J8HB 4PYHA 4AM0A 1IQDB 3D39B 5E7FA 3RTQA 1AJ7L 1AXIB 1NGPL 1R3LB 2WANA 1UYWL 4BQBA 1F4XH 2XXCB 3L5XH 2PXYA 1FZOB 1X5LA 4JFHD 4HH9A 4KXZH 3LVEA 2P48B 4Z7VE 1UGNA 3A6BL 4Y4FB 5HI4D 4LEXH 3TBVB 1CIUA 2N56A 3MOAH 2IPKA 1BZ9B 3D9AH 5TH2B 1HQRA 2AI0H 3SDYL 3IGAB 2A9MH 2W92A 4J8RB 4Z95H 3FRPA 5I1HH 3RWHA 2W0FB 1EMTH 3KPRA 3RI5K 3S34L 5J8OA 4HWEL 1UJ3B 2DIAA 2OJEA 5I30L 1A9EB 5KW9L 3GSQB 2E7HA 4EXKA 4QRPE 2G9HA 4N0RA 1F58H 5I73C 1UXWA 3ARPA 1D5XA 4OLZH 3U9UB 2ICWJ 4ZUWA 1DLHB 3EYFA 4GW5B 1WEJH 2VLRA 5DSCA 4QHLA 5DJXA 1GGYA 2XKNA 3BD5A 4O5LL 3NCJL 2EDDA 4Y5XB 5J12B 1CDBA 2EYSA 4X7DC 4CL7A 1XH3A 5EU5A 3NIGF 1KPRB 1DANT 4JDTL 3D18B 2X09A 1UA6H 2VXTL 4XPHL 1T2QH 4KMLB 4PUBH 5DC4B 5ETUA 4YXKL 1CXHA 1LO5A 4KI5E 3INUL 2LTQB 3MO1A 1MUJB 3LS4H 4OCSH 1TCMA 2R1XB 3NFPA 3MLYL 5DT1L 1G7PA 4G42B 2AXFB 1PKOA 2Q7NA 1GC1L 4JQXA 5I2IA 4KTDH 1JVKA 3O9WA 1AGDB 3B9AA 3OF6D 3PQYD 5C0CB 3THMH 3Q1SH 5K9OA 3RZCB 3BWAB 4FZ8H 1ORQA 4ZUTA 5MEQA 3GJFA 4GRLA 4HF5L 4ZNCD 3O6FB 2A6JB 5ISZA 4N8CL 1TVHB 4WI9A 2R0LL 2O93L 3SGDH 2EIEA 3W0WD 1ERNA 1OWWA 2R0ZH 4G8IB 3FO2B 4XVSL 4MMZC 1BQSA 3T1FB 5HDQL 2NX5E 4J4PC 4KQ4L 3WV0A 1JNHB 1IAMA 4KV5E 3RNQB 5FDYA 4J12A 5T33H 4D9QD 3RL2A 2VDRH 1DQDL 4JVPA 2E27H 3IAQA 5T3ZH 1CT8A 1WISA 3HR6A 3TVMD 5HY9B 2P8LB 3ILPA 4U1GB 2FB4H 3G04A 3IDMA 2QSCL 4W70A 1HHGA 5FA4A 3DGGB 4MCZB 2B39A 3O3EB 1OF2B 4G6JH 1U8HA 4XPBL 4JFDA 3SY0B 1DUYA 4QHMA 4O51A 3FO0H 5E8PB 1WBXB 1CICC 1P1ZA 5AWNL 5F3BB 3KPMB 2A77L 1KLGB 4R8WH 4P2RB 2QBWA 4Y2DD 5CD3A 3CDGB 4IIQA 3P4MB 4XXDB 3I50H 3D2UD 3MRNA 3QIBD 1NUDA 4RFOH 2X4SB 1CXKA 3NFSL 5C0IB 4Z5RA 4G8FA 4U0RC 3SO5A 2WUBL 5GSVA 4G5ZL 3S4SB 5E6IB 4XAWH 5ITBL 4X5LA 3IETB 4GRMB 1MCRA 4BKLB 4O00A 5C3TA 2O61A 5TQ2H 1CFTA 4GKZB 4OZ4A 1QR1A 1M1SA 2PKDA 2VIRB 4H20H 2Y4SA 4ODTH 3CU1A 3GMNB 2VC2L 3ARBB 2IALA 3AAZA 4D8PA 3TYFB 1HWGB 3UCRA 1MFBL 3RVUC 5FM4A 3VG0L 3EYVB 5TE4H 1Z9SA 2OTWA 3QWRD 1OAKL 1SY6H 1BD2D 2P47B 3IFPA 2XWJA 2P44B 2H2PD 4L29B 3TCXA 4HMCA 1U93B 4HMEA 3VRLF 1OQOA 4KRPB 2BDNH 3B43A 4JG1L 3PWVA 2V2TB 4HZLA 3U4BL 3MLTB 5BRZE 3C8KA 3P9MB 4CMMB 1C7SA 4Y4FC 1F8TL 4NO0B 4Y1AD 2QL1A 4Z76B 4GT7A 2M1KA 5ESQA 3MRHB 1VFMA 2EEBA 2ZZUT 2PR4L 2WQRA 4LRNL 4ODSL 3TBWA 3S96A 4QRUB 1BFOB 1DN0B 2FEEL 5CSGA 2NNAA 1ORSB 4OGYH 1TENA 3I3EA 1UJ3C 3VG9B 4PGDA 5C08E 3WUZA 1DJSA 4OLUH 1E6JL 3MA9L 3IDGA 1I1YB 4DFHA 2CRMA 3OKLB 5L7XH 2FIRT 3RVTC 3WNLA 2KQMA 1WFUA 2DJ4A 2MKWA 5FXCH 4DZBB 3CPLA 4YBLB 5ENWA 1WWCA 5D71H 1NC4A 5IJKC 3KLAA 1RJZA 3MRDA 2R69L 1FNSL 4NBYB 4Y5XC 4FP8L 5J12C 3CSGA 5JW4N 2CO7B 2I27N 3IDJA 4GMSL 4LLYA 2LVCA 1BREA 5K9JL 1BX2B 4CVZB 5KAQG 3RPIA 3QUYD 3QDME 2LTQC 4PJBB 1YYLH 4N0YH 3MCLH 3QUXA 2HT3D 3IB4A 2P7TB 2HKFH 1N0XL 1NMBL 4XCFH 5IMMB 2R0KH 1MRFH 1EO5A 5HYJB 2E3VA 3BO8A 4M43H 4NDMB 1P6AB 4YQXH 1ZHNA 3RZCC 1I4FA 2DQGL 3U0TA 5A3IC 2ZJSH 1PX4A 4JGUA 1SBSL 3O6FC 1E4KA 4PRAB 1J8KA 1AKJD 3MRGB 2XRAH 4PGCA 4DK6A 3PWJA 1T03H 5EU7E 3L3DB 4C58B 4RRPG 4YK4B 1XGTA 2AAVA 2NY7H 1YYMH 2BHUA 4ZUSB 5DK2B 1CD1B 4RNRA 1A22B 4GSDH 4PFEA 1Q9KA 3Q3GA 3EOBB 2DD8L 4UV4H 1FHGA 3TFKD 3HLAB 1QSFA 1R5VB 5FHBH 2VXVL 3FOLA 5GHWH 2VUYA 5C0GB 1IC5H 5CCKH 3OKEA 4WJ5A 5FKPA 5IV2A 3LCYA 4H1LH 1NBZB 4S0TD 3OB0H 5DJZB 2HWZL 4U1GC 5FOBB 5GGSY 1J0JA 2AGJL 1PZ5A 1BJ1J 4L8BA 5DC0A 1BAFH 2NW2A 2W60B 4JM2A 5E6YA 1NEUA 4JRYD 1S9XA 2XZQH 4HFWA 2VZ1A 2VH5H 4UMGA 5CAYB 4NNYA 1A3RL 2R2EB 5E0QA 4NGHH 3MR9B 4K7FA 1CGSL 3MRQB 4R7NA 4PJHE 1FO0A 3SKMB 5F97E 4BA8A 1JGUL 2JELL 2E9JA 1LEIB 3RJDA 1OPGH 4R2GD 4YHLL 4PJ8D 5J4MA 5E6IC 2ESVB 2EDHA 4RIRA 3D85A 5KOMC 1INEH 1ED3A 2QHLA 4KZDH 3RY4A 2D9CA 2P8PB 2J8UB 2P5WD 3DYMA 2R2BB 4NKMA 3WLWD 1WC7B 3O41A 4OSUH 4HXAH 4UQ3A 2X9XA 3ARBC 2F54B 5D1ZA 4XPGL 4WDIA 3PHOA 4OM1H 3DXAA 1G7QA 2Z31B 5JR1L 1UC6A 3PDDA 4XMKL 4OLVL 4JO1L 3TNNA 3V5KB 1OGAA 5I19H 1G9MC 4OFPA 3CK0H 5C0EB 2VAAA 1G9ML 2X7LA 4KRPC 2OL3L 3T4YB 4FQXB 2JB5L 4X8JB 3TCLB 4FA8A 3T65A 1AQKH 4L3ED 5B8CB 4P2QE 5DQ9A 1CE6B 3CMOL 3NTCL 1MAKA 4NQSB 1IAOA 3VGGA 2IMMA 4XB8A 3WN5A 3N1FC 4NO2A 3FTGA 4HPOH 4F7CA 1XCTA 3WNKA 2CIIA 3BE1H 4CU7A 2FATH 5ANMA 5C0NC 4NO3A 4HQQH 1LO0H 4IRJB 1K2DA 1KPUA 5HJ3B 3CUPB 3VG9C 4YHNB 4CJ1A 2B7DT 4N0UB 5EZOL 1FAIH 3B9EA 5KSUA 4MJ4A 5HHOB 3MGOA 3VXQA 2HVJA 1WQVT 1FIGL 3H6JA 1JRHI 4OT1L 1UEMA 4YBLC 2MHAB 5DC9B 2KBGA 3ULVC 4JFXA 2QADD 1RY7B 5I1JL 2BSTB 4ELKB 1X5JA 5I18L 3GHEL 5J57B 4GG6B 5DJDA 3RI5F 5JORB 1DBMH 3BW9B 5F88A 2CDFA 5IESH 4U7SA 1FFPA 1XGPB 3IYLW 4AEHL 3MV8D 4FQPA 3CGTA 4HUVA 4DKEL 1S7WA 3BDYH 4LGPB 2QSVA 1G7MB 4F8TA 3GB7B 1LGVA 5DGRA 4ZDHB 2CLRB 3VGBA 3PP3H 2ATKA 4MSWA 4MHHI 1QPXA 4WU5B 4ODWA 4FQHB 5C07D 5FO7A 4MQXC 2RB8A 4WI5A 2OZ4L 2AEQL 2DLTA 1DTUA 1NSNL 3RTQD 4JN1H 5J13B 2A73B 4RZCB 2VOTA 2PW2A 2QHRL 4MZ2A 4N90D 4IDLA 4YK4C 3QQ4B 4QNPE 3FN0H 2PXYD 1QOKA 2FH8A 5IIEB 4LDEB 4NNPH 3EYQD 5D96B 5MP6H 4YWGL 1F3DJ 2ZUVA 1H5BA 4NC0B 1IGMH 3Q6FB 2LVEA 2APVA 5EU4B 2I9TA 2EYTB 4JHAL 1Y6KR 1CI5A 4MD5A 1OTTC 1RU9H 5KSAB 3KPRD 4CNIA 4KVNL 3OV6A 1KUMA 1RJYA 2DAVA 4F8QA 1U95B 3WNPA 5JTWA 1CFNB 5FDWA 3IKKA 2F58L 5HPMA 3ULUF 3TH3T 2DTMH 4EI5D 3ARYA 1JZ7A 1F42A 2VLRD 4WW2F 3FT4B 5CFHA 1WWWX 3IDIB 4JZOA 5DURB 1CD8A 2FX8H 3LV3B 1I9JL 5BZDA 4I3RL 1LD9A 2G75A 2QQLH 1M05B 1NGWA 4Z7OF 3EFFB 1A4JA 3JWOC 4R3SA 3HE6B 3ZDYF 1ACYL 3BH9A 5T1LA 2EYRB 1S7UB 3MCKA 4X9IA 5DHVH 4HK3J 3VJ6B 1YJDC 3L3GB 1NBYA 1KTDA 1YMMB 3HG1A 4HDIA 1YJDL 2UWEE 3CC5B 3AS2A 4CGTA 3GMRB 4KK8D 4G6FD 5GJTL 3X11B 1ZLWK 2GJJA 3LRHA 1X5YA 2OR9L 3R4DA 4LAQL 5HD8C 2Z31C 5I17A 4NZTL 2NY5H 2H9GA 2FECL 3TBSA 2UZYB 2PYEB 2JK5B 3BHBA 3H9ZA 4X80H 4GRLD 2VAJA 3TA3A 4QWWC 5MENB 4MB5A 1XIWA 5D7SL 5GS0D 4NFDA 4HKBA 4FQXC 3O4OB 1BOGA 2ADGB 3T8XA 1RZ7H 5C09A 5IQ7L 1JFQH 3QIWA 1B4JH 1ITBB 4MXWL 3LMJH 3MNVA 3T77B 4WFGE 4D0BA 2HKHH 5E9DE 1D5IL 3ECBA 3MYJA 3QQNA 4G8GB 4O02L 5B8CC 3SE8L 1AHWB 1FLTX 5A16A 4I0PB 1IILE 1IARB 1MFDH 2DQEL 3CH1A 3F7VA 3OKKA 4IRSB 3GBNH 4JZNB 5IOPA 4LVOB 1L4IA 1KV3A 3UBXB 5FYKD 1M7XA 2D7QA 1JPTL 1QBBA 1KNOB 2VDKH 4IRJC 1R3IH 5BXFA 4WWKA 4JFEB 5F1OB 2HVKB 5I16A 4URTB 1SYVA 5DJ2A 2R4RH 2FWOA 3SOBL 1JGVL 2HTLC 1UM5L 1X44A 3FQTA 1TTUA 2VQTA 3B9VA 3GRWL 4BQCA 4LSTH 2X4PB 3QXVA 4MB4A 4BQ8A 4LSSH 1FZKA 1HINL 2Y07L 3MV7A 4Z7VF 4OJFL 2FX7L 2IPUK 4RDQF 5ACMA 4OTXL 1IJ9A 4MJ5B 4NPYB 2D7MA 4FFZL 5CJ8A 1FH5L 5J3HD 3SE4A 2AQ2A 2ICEA 1F97A 2UY6A 5CJQH 4AT6B 3QHZH 3RU8H 3K1KC 1RUKL 1FGNH 3IJHA 1E27B 3O2DL 5DA4A 4JDVA 1VSCA 5F7FA 1KJ2A 1LP9B 2V9TA 4JFOA 1XGRA 1G1YA 1OQXA 2BNRB 1K8DB 2VE6A 2FSEA 2IMNA 4NQCA 2EKSA 3T0WA 3U7AA 1F2XK 2G60H 5E2TL 3FCTA 5E8DH 3UTPD 4YBQC 2VMFA 4BSWA 2GQHA 4MA1B 3TIDA 3X3FL 1DVFA 4YJZL 4HAGA 2DQCL 3WIFB 1NC2A 5IB2A 2BC4B 3BN9C 2C4FT 3VD9A 1GAFH 2FO4A 4NZJA 1YQVL 4KY1L 5J13C 2P1YA 3KPSA 1RZJC 5E4EB 3REWA 1GPOH 4W4OC 4U1IB 1H15A 2HT2D 3PABB 1RIUH 1KC5L 4KI5F 5D96C 1AO7E 4WUUA 4ELMB 2XZCH 2RFXA 3RWJA 5DMKA 1C5DB 4NQTA 4X9BA 2H1PH 5FCUL 1VERA 3VXRB 2C1OB 1NEZG 3FB5B 5KSAC 4TOYL 4D0DA 1JZ6A 3OXSA 4KZEL 4EUPB 1O7SA 1X9QA 2VLKB 2YC1B 4N0FB 5GPRA 3RIAK 1FC1A 2EH7H 3DI3B 4JO4H 4OD2B 3MBED 3JV0A 4FZEL 1DL7H 2IQAA 4MXQC 2JCCE 4MD4A 1JUFA 4OUUB 4D0CA 3V6OC 1YNTB 4WW2A 3RX8A 4F7PA 5F8QC 1NC4D 3SPVA 4JM4L 5T3XL 1OAUL 1Q1JL 1MPAH 5IROA 4EBQH 4PJDB 1G7JA 5D2NA 2YD9A 4S1QL 5T1DL 1HHIA 1E4XL 4HXBL 3LN4A 3HE6C 1FNAA 4JQIL 4PRHE 1CVRA 1Y0LB 2AJZA 2EICA 3P2TA 5HHVH 1OTSD 1A7PH 3QUXD 4AQOA 3EJYD 5F6HJ 3EYOB 3DX9A 1EIBA 1FZMA 2R15A 3L9RB 3FQRB 5LWYH 1BEYL 4LIQH 4HAFA 1Q72H 5IM7A 2G5BB 4KKCD 3LHPH 4CUCA 3K81A 1IBGH 1ADQH 4FMFA 1IL1B 4HUWA 4Z0BH 1R5WA 1VPOH 2F53E 1HH9A 1S7TB 4V1DB 4UBDC 3L3HA 2B1AL 1D6EA 3DUUA 3GK8H 3HAEB 5AYUH 2XV6B 3CFCH 2YA2A 1IC4L 3FQUB 3O4OC 3VI4E 1UWXK 1BM3H 4IOFD 4HC1L 3DARA 2DQUH 1MCNA 2X70B 2Z93B 5TFSL 4PP2A 1FYTA 5DVKA 2IANB 1ZHLA 3MUGA 5F7DA 4M02A 2YD5A 1AHWC 1QSFD 2ZSVA 3QDGA 4I0PC 3EO0A 5FIEA 4YE4H 3OKDB 2GTZB 3X17A 2ZUXA 1HOCA 3QCVH 4IRSC 5ACZB 3FT3B 4LPTA 3OKMA 1F6FB 4LVOC 1U42A 1KTLB 4PJGB 3HC4H 1HQ4B 2Q1EA 2AJ3A 2MNUA 5I15L 1BGXL 2D0GA 4PJAB 3STZA 4BH7B 1Q0XL 5E8OB 4JM2D 2ZCLL 5DTFA 3U83A 3QDJE 4S2SB 4X7SH 2D31A 5CGTA 1J1OL 2EIDA 4PJFA 5JOPE 4MD0A 4DEPB 4PLKC 1CLZL 1WJ3A 3QRGH 4M1GL 1MI5A 3MODH 1GZPA 2OL3A 3HS0A 3O6KH 1NAKL 2BSSA 4K9EL 4Z7VA 5KTEH 1QYGH 4JJHA 1D5MA 3DX6B 3D85D 4G9DA 4MYWB 4DN3H 1OW0A 4J3OC 4PD4K 1YEKH 3L3KB 5F7EL 4DJMA 2JIXA 2D4FA 4N8VA 3HRZA 1QLFB 2OCFD 3ZYOA 4I1NB 3DBXB 1EGJA 2WP3O 1JHKL 4HKXA 3VXUB 3VMOA 5I8OH 5D1ZD 2DQTH 1KELH 3GSRB 1EHNA 2BHZA 1JWSB 5IR1A 1RULL 5IK3B 1UCBH 1FN4B 4QTHB 4AL8H 3MUHL 2X9YA 2BVQB 4OCXL 1G6RH 1BHGA 1JF1A 5AZ2L 1EBPA 1I3UA 4NQVB 2NR6D 2BRRH 5IMOA 4R26L 3RL1A 4I48B 4FQLL 4MS8D 1HYSD 4HT1L 1J8HE 5GRXG 3D39E 1U2HA 4NQXA 4WI7A 5DD3L 5SV4A 4RAHA 3Q5TA 1TCRB 3O3DA 4HIIB 5E4EC 5DQJA 4MJ2A 1GVIA 3ZYZA 4B5EA 4NT6B 5BS0B 1LMKA 3WBDA 3G5ZB 3RBGA 3CFDB 3U9PL 4YDIL 1MHHA 4JG0H 3P11L 3ZTJH 3RA7H 5GSRA 4UB0L 4CDHA 4JPVH 1I7RA 1PYWB 1A0QH 4KKNA 4CDGC 1JNLL 2IADB 5M94B 1UADC 5CGYD 3ZKND 2AK4D 4OZFH 4B7IA 4HWBA 4JO3H 2AV7A 3RX7A 3IU4L 2BVPA 3WIHH 4Q9BA 4L4JA 4DVBA 5E99L 2Z91A 2V9RA 2OZ4A 1P9MC 4N1CA 4P46D 4EN3A 3PV6B 1A2YA 2WM0A 3VFVA 1L9NA 3TBTA 3TESA 1J1PL 3SDXA 3HMWH 5A2FA 4HFUL 4ZTPL 4RMRA 7FABL 4CN1A 4L1DA 1A6WL 1WTLA 1JV5B 1Z6JT 4POUB 4JFZL 4KGLA 3FRUA 3SE3C 3RWIB 3KR3L 4PRIB 3RDTA 1X5ZA 4HBCH 4PR5B 4FNLH 2OYPA 4IS6A 3EOTL 1YEJL 2HN7A 1FORH 2Z8VC 1SBBA 5EZLA 1YN6A 3H3KA 3LH2H 1A1NA 3S88L 1TPXB 3MRBB 4WTZG 1ETZA 3BIBX 5FYJE 4KJYB 3ARDA 5C0CE 2JB6B 4NOBA 1D5BB 1I8IA 2HMID 3L7EA 5L2KA 2H3NA 3GSWA 4PJHF 1PX3A 2AJSL 5DQDH 4M5YL 1AR1C 3U36B 5T1KB 3FN3A 4U1MB 1R0AH 3O11A 4JPIA 4XXCC 2ZOLB 3I85A 1A5FH 3BQUB 3ULSA 4F33B 4M62L 1MNUL 5CZKA 3GMOB 4DVRL 4ZOAA 3SJVB 4ZXBA 3IFOB 5KSBA 2I5YL 3VWJA 3K4ZA 4LLUB 1UB6A 2WNGA 4G8EB 4PJCA 2VZSA 5MEPA 4JFQA 4WV1A 4Q9QL 2Y5TA 2XN9B 2NTSP 4E41B 3GMLA 4TPRH 3H3BC 4KVCH 4WNQA 3GBLA 4XNUH 3CCHA 3VCLA 3V52H 4OLWL 4WU7B 4DEPC 4NJAH 3NCEB 2YPLA 4LDLB 1A1MB 1QSEB 3H0TA 1OM3L 3U4EA 4P2RE 1IZJA 1DBAH 1I85C 1ZK9A 4HUMB 1RUAL 4PYGA 4K8RL 1RFDH 3SGEI 1FNLA 2O5ZH 3WHXB 3G5YA 5T1LD 5IBTL 5KBNC 3ARGB 2ED8A 3ROOB 1MFEL 5HHQA 2ZCHL 4QXUL 1UB5A 4ALAH 3HG1D 1QNZL 3QJFA 1JZ4A 4IMKA 5HHXL 1ZA3B 3T0AA 1JHTA 3GNML 2OK0H 3HNSL 4XZUB 2W0PA 2X1OA 4XH2A 4PB9L 5CEYB 3VDAA 3BOVA 5KSVB 1MJ7H 4NQDB 3I3DA 3BX7C 1AP2B 4FQ1H 4YGVA 3AM8C 1XIWD 2C1PB 3TPUB 4UILL 5CKGA 5C09D 3EYUL 5GRYA 1U8MB 3KPQB 3PHQB 3QIWD 3X14B 3ZL4H 4ONOA 1MIEH 1YEDB 2VDNH 3QXAB 4DW2H 3E6FA 3B5GA 2Q7YA 1I7UA 1K8IA 2DTSA 1KYOJ 1K3IA 4TNVF 1U0QA 4YFLI 3QXUA 5EULV 4ETQB 2V7NB 4XVTH 1VEPA 4EXPX 1F4XL 3L5XL 2HYMA 4Z7QF 3MV9A 4UUJA 4LEXL 5BJTB 1I3GH 5C0BA 3MOAL 5ITFB 3T2OA 3D9AL 3FZUC 4YLQT 3EFDH 2AI0L 2V2WB 4CVWA 4Z95L 1RK0A 2ADJA 4XVUC 3C6LA 2F8OA 3MRJA 5I1HL 1K9TA 1BZ7B 2GCYA 1QUNA 5C0JA 1EA9C 1EMTL 3M07A 1RZFH 2EC8A 1EJ6A 3L3OA 4O2CB 1J05B 3DV4B 3O8XA 4X7TA 5DUBA 1NJ9A 1Y6NR 3MV7D 1MWAH 1BLNA 3DIFA 5L6YH 3ULVE 1A4KB 1NCUA 1CFQB 4FFWD 43CAB 1F58L 2ITCA 2X4NB 4LCUA 4NCC2 4OLZL 1QP1A 3I6GA 1ZE3C 2CGRH 1WEJL 1J10A 4PJBE 1P4LB 3D1MC 4F7TB 1MELA 3BZFA 2CIKA 2VLJA 3RIAF 5EBWB 3PWPB 3X13B 4QRSB 1MCEA 3BP7B 1UA6L 5IWLA 3FB8A 1T2QL 4NQCD 4PUBL 5ICXB 2XQYK 3JVGA 4L9LB 3MBXH 4AIZB 1RZGA 5HYJE 5TDPB 1TPXC 3EYSH 4MXVE 3B83A 1ZLUH 3K4DA 3QEQB 1DVFD 3LS4L 4OCSL 1NC2D 2QQQA 4KH2A 5F72S 1IGTB 3NZHL 3UAJD 4PJHA 3MUJA 4QRRD 5FA3B 3RNKB 3KPSD 1J0ZA 1WFOA 3TT1H 4W4NA 3Q1SL 3THML 1CXEA 5CJOH 2C3GA 4FZ8L 3SDCA 2IBZY 3X3GH 2BSRB 4TTDD 3BQUC 3WS3A 1CN4A 3O4LA 3RGVA 1AGFA 4GAFB 1OB1B 3HNVH 4WUUD 1LO2H 3UTTA 2Y7QA 1S7SA 3LB6C 4U6YA 5ICYA 2R0ZL 5HYFA 2UWEF 1RZKC 5TPWH 4K07A 3I6LD 3ULUD 2DMBA 2W9EH 2C7UB 5T33L 4MA7H 1JPSH 4F9LC 2VDRL 2E27L 5EWIH 1HWHB 5T3ZL 1ZLSH 3QCUH 1RUMH 3BEWA 4U4BA 4NKDB 3UTQA 1XR8A 1F00I 3F6IA 2FB4L 2ZNXA 3TN0A 2NZIA 5J6GA 4Q74A 4ZAKA 4YHKH 5C0RH 5IVOA 3SBWC 3OGOE 2E8ZA 2EO9A 4G6JL 5D6CA 4PJIA 1OD9A 2A6DA 3U6RA 4LMQE 2X1QA 2O5XH 1YNKH 5IHBA 3FO0L 3EO1B 3WE6A 2ESVE 3KLHD 2YD1A 1FVCA 3ARGC 3DJ9A 1NH6A 4R8WL 3L5IA 3I50L 4YXLH 4RFOL 2J8UE 5IFAH 4GOSA 4KJQC 3C8DA 1CZ8L 2CDGA 2FX9H 3LRSA 4JN2B 5L8LB 5FYLE 3VMNA 3BP4B 3LKRA 4NQEB 5DMYA 4XAWL 3LOWA 4PJ9A 4BFIB 1Q9LB 1V7MH 3F6LA 2F54E 1I8MB 2XQBH 3GJFH 5TQ2L 4LARH 1OD7A 3FB7B 4PV9A 1IGYB 5E5UB 4HKZB 4ODTL 2R2HA 3BZDA 4HG4J 2AJXH 4OAWB 3VXMA 3CDYA 2G2RA 4S1DD 5DA0B 4PG9B 2B20A 1NPUA 4X5XB 5DGQA 5DJAB 4DCQB 1KN2H 3B5TA 5BW7A 1YY8A 1SY6L 4OF6A 1ZS8A 2DICA 3QDGD 3FT2A 4N1EA 3EO9H 1JF5A 2VXSL 3PWUA 3MFGB 2BDNL 1MHEB 3I6KB 5DLMH 5IB1A 2IH3A 4JLRB 4YX2L 1GH7A 4NO5B 1LNUA 3WFDH 4Z78B 1T0NB 4N0CC 1N2RB 2PYFB 1AFVH 1B0RB 2W59A 3ROLA 1T21B 1EAPA 1T0MA 1U3HB 2FJHB 4N0UE 4LNVA 3MRIB 5DYOA 1IEHA 2X4OA 1F6LL 4U7MA 5IMKA 5HHOE 4QOKB 4QTIH 1MI5D 4OGYL 5F71A 5EUOA 1UZ8A 3V6ZA 4U1JB 4JVWA 4OLUL 2PW1A 1BVKB 2V5TA 1CU4H 5L7XL 2JIXD 4GG6E 4M6OH 4P3WA 2D03H 4MNHA 1WAAE 5LAXB 3ARFA 2DLIA 5CD5D 5DJCB 2DIBA 1UEYA 5ESVA 5D71L 1UT9A 2BNQA 3CAFA 3OZ9H 2BOCB 3RBSA 4LLAA 1FL6A 5F1KC 4OIIH 1TQCB 5HBBA 3A6CH 3CXHK 1U9KA 2FZ3B 3WDHA 4R6UA 3CIQA 4N0YL 1C08B 2JCCF 3WFHB 2FEDC 4X4XB 2XYCA 4NRZB 4U1KA 5DD0H 4AIOA 1DEEB 2HKFL 5I0DA 2EDRA 4OLEA 4OIBA 4XCFL 2F9BT 2R0KL 4UDUB 1MRFL 1EHXA 1QA9A 3L3JA 4ZD3H 4YQXL 5EIIA 2EDNA 1CDYA 1VEOA 1NCDH 3DMMB 3FFCA 1VADA 4NYLA 2ZJSL 4LAJH 3GSXB 2XRAL 3MPCA 4ZG1A 2VRAA 3IU3B 1T03L 3W39A 5E94B 4PTUB 4Z8FH 2NY7L 1YYML 3WUWA 4J23A 1RUPH 4GSDL 1A21A 1NGZA 3RWCB 5IFJA 1CXFA 5LG1A 4UV4L 2JJTC 2H2SC 4Q2ZB 5FHBL 5GHWL 1BQUA 1A7QL 4HEME 4QXWA 5C9JB 3UYPA 1IC5L 3ZTNH 1EZVY 5CCKL 3MLWH 3T0ED 3WJJA 4M93B 4M7JL 3TO4B 5AAWA 3VI4F 3KDMA 4L8DA 1YY9D 3V6OE 4S0SD 5INDA 5T3XE 3L6FB 1BAFL 4OIAA 2Z8WC 4BQ6A 1N3NB 1JMZA 1U8OB 2XZQL 5ALCH 1T80A 5F1IB 2VH5L 1X5FA 1MJJB 4M8QA 5EZIH 1P7KB 1ES0B 4NJ9H 3T1WA 4NGHL 1SJHA 1JGLH 2P45B 1I8KA 2HLFD 3OG6B 5DJ8B 1ZVSA 1UH3A 5HDLA 3RDTD 3QEHA 4MQ7B 1TZIB 4HS6A 1QFWH 4RWYH 1OPGL 3DO7A 1YMME 3QAZB 5JW5B 4X5WA 1KLFA 5GIRA 2WIIA 3C6SB 1INEL 5DO2D 1WITA 4DK3A 2X41A 3GMMB 4UIMA 3ARDD 3VW3H 5SWSA 3U1SH 2PYEE 2HFGH 3QI9B 1HDMA 4HXAL 4OSUL 4L8SB 5L2KD 5EFIA 4XTRD 2OJZH 5MENE 2MSPA 2VWEC 2GAZB 4UNUA 4OM1L 1KENH 3UDWC 2HH0H 1NANH 3MJGX 5HHPA 2VLME 3HC0B 2C3VA 2XOTA 3DUSA 5I66B 4ORGB 5I19L 4G8GE 4ZXBD 3CK0L 3VWJD 5FCSH 3DRQB 5L9DL 4EI6A 5DEGB 4EJ1C 3SKOB 3WIIH 3DTXB 4XX1G 5E8EA 3T2PA 2HJKA 1AQKL 4RX4A 4MJIB 1N6UA 1I1AA 1QLEH 4JFEE 1F6AA 3KHOA 1M6OB 2GYSA 1KN4L 1FFOA 1FNEB 1KJVB 3PP4H 4KU1A 4AH2A 2VABB 2XWTB 4M1CD 4F2MA 4U1HA 1U3HC 2QTEA 3DX7A 5GRVK 3BE1L 5EPMA 1FO0H 3RVVD 1WZMA 2YPLD 4HQQL 1LO0L 1U8PB 1HNFA 3ARRA 1JGEB 4PS4H 4HK0B 4Q9RH 4E9LA 3BEVB 4XPTL 5BOPA 4HX1B 1OL0A 1T6WA 2GK0B 4WHTA 1CVSC 1FAIL 4JY6A 4WFED 5DK0A 4PGEA 5C3LD 1Q94A 3BPOB 5ADPH 2EDFA 1DE4A 3OWEA 32C2B 4AIXA 2W9DH 43C9B 5HHNA 1LEGB 2OI9B 2YZ8A 3LKPB 1NANI 3VFTB 1FPTH 5SWZB 1OHQA 3DVNB 4OF5A 3X12A 5I1KH 2QKIA 1OSZB 1LP9E 3LQAC 1TQCC 1E28B 4NKOB 2F5AH 3VXSD 3A67H 2J12B 2BNRE 2WBJA 1DBML 1M7IA 3RHWK 5IESL 1GGIL 3UPRA 3KVQA 1NCAH 2BSED 2BOBA 2HTLD 3BDYL 1HXMA 3IDNB 1IQWH 2JE8A 1RMFH 4BK4A 3KPOA 4XNQA 1M71A 1UQSA 4PJXB 4PRHA 4RBPH 3EHBC 1P84K 3JV4B 4NWTH 5CLWA 3DMMC 3ALWA 4PREB 4XI5D 3OJ2C 5DFWH 4JN1L 4M8VA 4ELME 3KYMA 1LILA 4X6BB 3HI1A 3FN0L 3VXRE 5FUCC 4JFFA 4O58H 1JL8A 1X5XA 3EGSB 2HTKC 3MV9D 4NNPL 1A47A 3LN5A 5MP6L 3OX8B 5C0BD 3QA3A 3U46A 1IGML 2VLKE 3QUZA 5EN2B 1EK3A 1PLGH 3FOMB 2C4XA 3C6LD 4KJPD 5L8JB 4MVBC 1RU9L 1AJ7H 5TE6H 4M93C 3TO4C 2LABA 1KJ3L 4OKVB 2BY1A 4P2OA 4PTTB 4EQ2A 1ZWIA 5EBMB 3SQBA 5B39G 3O8XD 2EC9T 3O6LH 1R3JB 2IJ0C 4PP1C 5D5MA 3B3IA 4QT5A 1W0WA 3FONA 3BPCB 1WUNT 4X9GA 4PJDE 2CK0L 2DTML 1F4WH 1UZ6E 3H9SA 3O3BA 5DJ6B 3QQ9C 3IS0X 4IHOA 4ZYKB 1S78D 2AVGA 4ZPVB 2GSGA 2VLJD 1QSVA 1K6QH 2QQLL 1MLBB 5C0DB 3QAZC 2YUZA 3QDJA 5MERB 4ZNEA 4ZFZB 3W11C 1QBMH 1CICA 4HLZG 3NZ8B 4OZHB 3UZVB 3OXRA 4TVSa 5EB9A 1NEZB 3OB8A 3V5HA 3QI9C 3PQYB 4L8SC 1KJMA 1PQZA 4V1DE 5MI0B 4JANA 4U6XB 3DO3A 5EA0H 1CBVH 4BSVA 1UVQB 3ILQD 4PRNB 3B2UC 2HRPH 3MLSH 2NY5L 4HIXH 4LSPL 4OCMC 4U1NB 3SDCD 3BWUC 3W0WB 3O4LD 2QQNH 4X80L 5DUPH 3INUH 3RGVD 2IANE 2AQ3A 4FTVA 3ZT5A 4H25A 3RVWC 3UTTD 1ITCA 3DRTB 2KL6A 1IEBA 1T2JA 1A6AB 4XBPA 2ZG1A 3LAFA 2HA1A 1RZ7L 3O2VH 3OAUH 4MX7A 4PJGE 1IM3B 3FN9A 1B4JL 1C16A 1T89C 3LMJL 5JDJA 4YHMH 2HKHL 3GGWB 3D0VB 4PJAE 3TJHC 3TVMB 5B4MC 4HV8A 2E9IA 1GOFA 2B0SL 4NCC1 1B6UA 3GBNL 3P3YA 5BVJA 4EEEA 1Z2KA 3GDBA 4HLZH 1J8HA 3MA7B 1KCSH 2VDKL 4JCLA 4Z0XA 1RHFA 3TN0D 1KIQB 1R3IL 5HDQH 1BWMA 4WEUD 3CD4A 2R4RL 3DV6A 2EKJA 4XCCH 1HHKB 3D25A 4Y2DB 3L5JA 3OJMB 3N1GC 5IW1B 1EXUA 4ZFFA 3D2UB 4KRLB 3QIBB 3TBVA 1BVLB 4NSKA 3BPOC 4LSTL 3IGAA 3QEGH 3QXDA 4LSSL 5EU6A 2W0FA 2FHCA 2OI9C 3TM6A 2QSCH 1Z3GH 1ONQA 5IHUH 5LGJB 5GS2H 4PJ9D 1UJ3A 5HDBF 3VXUE 4IOIA 1A9EA 1N26A 1IGJA 3GSQA 4OZGB 4YFDB 2CJUH 2NY2D 4XCEA 5MHSD 5CJQL 3QHZL 2VXUL 3RU8L 1FGNL 3B8SA 1KGCD 1XGQA 1I7TA 1DLHA 1QBLH 3V4VH 2Y9RT 5CEXB 3VXMD 1BD2B 5JPMB 3QFDA 4LRIC 2PTVA 3ULVF 4G5ZH 2G60L 1HYRC 5E8DL 1G6RB 4MJ6B 5GRZA 5E03A 1CFSA 2DQHL 1FVDA 1GAFL 5BS0E 4PJBF 3FO1B 5ACLA 3WJLA 5FYJU 2JJWA 1DFBH 5HI4C 4Y1AB 2AXFA 5D7IA 3MJ6A 3DHJA 4P4KA 1GPOL 4JHZA 3ARED 3KPPA 1EEYA 4IMLA 1BVZA 5DFTA 1RIUL 1MJ8H 4R90H 4MXVF 2HG5B 5F9JA 1OAKH 5F7WC 2XZCL 1P2CB 4GW1B 5IG7B 2A9NH 4TULH 5F1NB 2H1PL 3F8UB 5EO9A 4POZD 5LXGH 3JTTA 5H2BA 4WI3A 1FZJB 2BY3A 3T1FA 5EUKA 4ZQKB 1XF5A 1JNHA 2UVEA 1F8TH 4P3CH 5J06A 4ZUUA 2EH7L 4JO4L 1EVUA 1DL7L 4F7EB 3VH8A 2ORBH 1HILA 4J1UB 1KJ2H 4HGKC 2B5IB 5HY9A 2P8LA 3AXLA 2BNQD 4WI4A 1MPAL 1P7QD 3G5XA 3QUYB 4RFNB 4EBQL 4ZFOL 3DGGA 4PRIE 2R8SH 1NGXB 5J9PB 1S9YB 5H8DA 1VACA 3QEUB 4M6AA 3W9EA 5E8PA 5HHVL 1A7PL 3MREA 2NXYD 3AY4A 4R96B 5DWUH 1ZGLP 5AD0A 4ETYA 2EXYD 2CMRH 5A2IH 3CDGA 5MI0C 3V4UH 4XXDA 4ZO7A 5HYEA 2X4SA 2WLYA 2OQJA 1FNSH 3QFJA 4LIQL 2YK1H 1Q72L 4CKVX 5CP3A 3LHPL 4QRQB 1MQKH 1IBGL 1AKJB 4PJEF 1MFNA 5DD5H 5IGXH 3FFCD 5JHDA 3NCYS 3W2DH 1VPOL 5DEFB 4BKLA 2KDGA 3O3AA 3MGTB 3GK8L 5AYUL 4H5SA 5CIPB 3KPLB 1CR9L 1QQDB 2J8UF 3SJVE 4S1RH 1I7ZA 2M8XA 4X6DB 1BM3L 2CDEB 3GMNA 4X6EB 2DQUL 4U6VH 5I0ZA 3U2SA 1I1FB 3TBYA 1V7NL 4MLSA 2P8MA 3QG7H 3ULUH 2OS7A 1CDIA 3VFNA 2V7HA 1YEGH 3ZYIA 4F58H 4KK6D 1H3WM 3TVMC 4YE4L 4ISVA 5HGDB 1CDCA 4PJ7A 2XN9E 4P2CG 3QCVL 1MEXH 1IM9D 4E41E 5T3ZE 2GIYA 4L29A 2HJLA 3BIAX 1U93A 3HC4L 4JRYB 2Y72A 2DI9A 3GKZA 3MLTA 1QSEE 5SV3A 4TUOA 2QJDA 4UOW0 3HPJA 2Q8AH 3GI8L 4X7SL 4Y2DC 3R0MA 3IRZA 3QIBC 3L5WB 4R2GB 2Q6WA 4PJ8B 4U49A 5D1XD 4FOMA 1MVUB 2UZXB 1XF1A 3QRGL 3MODL 1KF9B 3O6KL 5KTEL 5FO8A 1QYGL 1DN0A 3NIDF 2PCPA 1KB9J 2IQ9H 4BFBD 1T5XB 2P5WB 1DDHA 4XMLH 3EDKA 5E2JA 4DN3L 1G9NH 1YEKL 4LNRB 2X4UB 1I1YA 1P53A 2GITA 1A3RH 2XG4A 2EDTA 5SWSD 1J0YA 3AMKA 2DL2A 1EV2E 2XTJD 5EDXA 2AV1B 3DVGB 4DZBA 4NQDE 2R0WL 1HEZB 5I8OL 2DQTL 1KELL 1C1EL 2EZ0D 1R3KA 2BFVH 2H2PC 5L88H 5M7QA 3MNZB 4QCIA 1UCBL 1JIBA 3U30B 1BX2A 5ABDE 3WKML 4GG6F 2DS4A 2CR3A 1G6RL 4NHCH 4K8RD 5H94B 3QRFM 1GCFA 1TJHH 4LBEB 2BRRL 4DGIH 1EFXD 4L3EB 2P7TA 2DWEA 3ES6B 3UROR 3RHWF 3IF1A 2R9HD 3KNBB 5IMMA 4RX4D 5CBEA 4HS8L 1B0GB 1XT5A 5ESAA 1I1AD 4ZSOB 1WBYA 4JG0L 3UC0H 4MAYA 1AXSA 4JPVL 1A0QL 2KPNA 2BY2A 3B6SA 1FJ1A 1BFTA 3ZLQC 2M2DA 5HGAB 4Z7WB 1U8LB 3L3DA 2BNUA 1U8QB 1ROWA 4JR9H 1ZT4A 3QDAA 4EOWH 4ZUSA 5I75C 3UO1H 1RSFA 5BVPH 1A6ZB 4OM0H 2K3TA 4XCNA 1INQB 1EGJH 3WIHL 2QADB 5KANI 4MNGB 3OR7A 5C0GA 1BJMA 3P0VH 3RUGB 4GUPA 3WXWH 1HH6B 2B5IC 1NBZA 1MWAB 2DJUA 4M4RA 1X4XA 3QUYC 4RFNC 4BUHA 1AD9B 3HMWL 3PWPE 1T1WA 4RSVA 2HT3C 3LD8B 3MV8B 4JZJB 2WBJD 2BK8A 3NFNA 1OP5K 3ARQA 5E56A 4JRXD 1AIFB 5FM5M 5GXBB 1VFAA 3QEQE 2FL5B 3RWFB 1WCBB 1NGYB 3MR9A 4HBCL 3MRQA 4MMXC 1GHFH 5C07B 2BCKB 2HFEA 4FNLL 4LCYA 1FORL 1MCPH 2PUQT 5ID1B 4QHKI 4HGWB 3LH2L 2R29L 4PJEA 3VXPB 3RTQB 2Y23A 3G08B 5HYSG 2ESVA 3TZVA 5IVXA 2D2OA 3O6MH 3KYKH 1TETH 4WRLA 2NY0D 4LDOB 2PXYB 3NN8A 4LCIH 2J8UA 2R2BA 4J6RH 4AEHH 5DQDL 2VUOA 3TFKC 1W72B 1VHPA 1R0AL 4X98A 2IPKB 4YUEH 4JFFD 4HWBH 1FAKT 2R56H 3KYNA 4LEOA 5C86A 1WT5A 1A5FL 5EOQH 3RWHB 2W1NA 1F3JB 3KPRB 4ONGH 4BYHA 3QUZD 4CW1B 5JZ7D 5E08H 2YPVH 4QO1A 2OJEB 5KJRH 1G7LA 1N4XH 1XZ0A 2YD3A 4FQXA 4P2OD 2APWA 2G9HB 2VISA 3DX8A 4EI5B 3U0PA 1D5XB 2A6KA 1FV1A 2X4QA 4TPRL 3EYFB 4ZUWB 4HIHA 2VLRB 4ZPTB 3WSQH 4GRWB 3ZHDA 4QHLB 5DJXB 1GZQA 4KVCL 1DBBH 3H9SD 4XNUL 2EYSB 4NJAL 1XH3B 5EU5B 4N9GB 4R2GC 3S5LG 4PJ8C 5JXEA 1J88A 5ETUB 2MJWA 2E8YA 3OTTA 4YDKH 4P4RB 1LO5B 1TTFA 2X89A 4UQ2A 1PEWA 1DBAL 3GI9H 3MO1B 3FB6A 3RAJH 4YHNA 1RFDL 5I8KL 3WLWC 4NQEE 3NFPB 3LQMA 1G7PB 2O5ZL 1Q9OB 4N0UA 4DWHA 2BJMH 3UTSA 1YEIH 1JN6A 4G6FB 5I2IB 4F9PA 2JF1A 1WZKA 2R4SH 3WO3B 4ALAL 1BOYA 5K9OB 1A6VH 2M26A 3MLZH 1XCQB 2IEPA 3TF7C 4J3SA 4ZUTB 5MEQB 4EDWH 1XF3A 3PWNA 2VWEE 3J8F7 5DDHA 2OK0L 3VFGH 4PGZA 2K7PA 3U30C 1VEMA 1NAML 3RKDD 4FTVD 4UTBH 1MJ7L 4Y89A 4FQ1L 2YRPA 2X4RA 5CJ5A 3LDBB 8CGTA 2VR5A 3GMPA 1IAIH 3RL2B 4X99B 1CGTA 3GB7A 4MNQA 3ZL4L 1LP9F 5GGRY 4ZDHA 1CT8B 4Z9KB 1MIEL 2VDNL 1N6QH 4DW2L 4HLJA 4WFFD 3RWGB 2CKBA 3IFLH 4NZTH 4WU5A 3GJEA 3ILPB 5HVGB 1OAZH 1NFIA 3IDMB 1GGCH 4WGWB 4OLXH 2EE6A 1HHGB 4BSJA 4HHAA 4JJ5A 3C60A 4JGJA 1U8HB 4QHMB 4O51B 5I76A 1P1ZB 5IJVA 4QOKE 2OSLA 1WZLA 1MF2H 4HSQA 1I3GL 5F6IB 5D6DA 5IIEA 5CD3B 1GXEA 4O02H 5C2UB 3ELAT 3EFDL 3MRNB 4H0HB 4Z5RB 3PG2A 4G8FB 3JV6A 5GSVB 1II4E 3AS1A 2QADC 3RJQB 1RZFL 4ELMF 1RIHH 4PRPA 1CD9B 4LLDB 5EU6D 3FQWA 4GXUM 3V7MA 5KVEH 4RA3A 3DVIA 4G6MH 1HCFX 5LVEA 2O61B 5AG9A 1AXTH 1CFTB 1MWAL 1JTPA 4OZ4B 3BP5B 1QR1B 2XA8H 3HHRB 1U92A 4P49A 1G7IA 1L0XA 4XNYL 3LD8C 4JZJC 1T1XA 3WHE0 3AAZB 3L3IA 2CGRL 2XNAA 4RAVA 4LSUH 4D8PB 1IAII 1U3YA 3WXVL 1MCQA 1H3VA 3V6OA 1FG9C 2FYYA 4KRNA 2OTWB 1NLDH 5AZEL 1S7XA 3D48R 3LV3A 3IFPB 2XWJB 3F62A 2XTLA 2IAMA 4OJFH 4ERSH 2FX7H 3MBXL 3EFFA 4HG4K 3VXTB 1U8IA 2ZKHH 3EYSL 4OFYA 3RTQC 1UZ6F 2H41A 3PWVB 2GUOB 3BXNA 4HZLB 4AZ8A 4ZOEA 1VB9A 1S7UA 2PXYC 4LPUA 4QY8A 3C8KB 3DETD 2DRUA 4IBLT 2FIKA 1YDPA 3BPLB 3EYQC 1QD0A 4P4KD 3ZKSD 4P9HH 5ESQB 3TT1L 4L4TA 5CZVH 5CJOL 2ADIA 1KCVH 3X11A 3TBWB 3X3GL 4P57A 5FUCE 4ZFOA 5E2TH 2ENSA 1LO2L 3S96B 5EC1A 2NNAB 3SGKA 2N7AA 4G7VH 4LLQB 1IGFH 3DUHA 4M7ZB 3VI3E 3IDGB 5TPWL 4BK5A 2FBJH 4XNXH 4LSRL 3MBEB 4EI5C 4JKLA 1RD6A 4MA7L 1JPSL 3CPLB 5ENWB 3MOBH 1ZLSL 1NC4B 1RUML 3QCUL 5JMOC 3KLAB 4I0PA 1RJZB 3MRDB 1W0VB 2WMPA 4NUGH 3IDJB 1QBAA 4LLYB 4OV5B 5EOCJ 1NDMA 4YHKL 5C0RL 2VDOH 3RPIB 4PJAF 2O5XL 3G6JA 3QUXB 1YNKL 3EDFA 5C8JB 3LEXB 4KTEH 1MH5A 4K7PH 4KK8C 3OKOA 4JQXC 4QHUB 3BO8B 5F3HA 1CF8H 4YXLL 4WVRA 1XR9A 5IFAL 1ZHNB 5JPNA 3DECA 5GS3A 4U3HA 2NZ9D 1MY5A 1I4FB 4B0MM 3AMLA 3U0TB 3QFJD 1IGIH 3P0YH 4GRLC 3QR2A 2XQBL 3GSVA 4MJ5A 4NPYA 4PGCB 1ZLWH 4UNVA 4JQIH 5GS0C 5JHDD 3NA9H 1XGTB 5KS9A 3QISA 3K2MC 1VGEH 2AJXL 3LEVH 1K5NA 4RNRB 3T3ME 4P23D 8FABB 1Q9KB 3Q3GB 5LCVH 3LDBC 1L6XA 5INCA 1QSFB 1LP9A 1KN2L 2CSPA 2FCBA 3FOLB 4AJ0A 2D7TH 1K8DA 2IPUG 4WJ5B 1F02I 3CVHA 5FKPB 5IV2B 4M00A 5HHMD 3EO9L 1B2WH 1PZ5B 1K4DA 4L8BB 3WIFA 3Q5YA 5DLML 4NFCA 4JM2B 1OY3B 3KXFA 2GJ6A 3PXJA 3WFDL 4HW6A 4NNYB 4NZRH 4QXGH 1AFVL 3AUVA 5F6IC 2X05A 4MQSB 4K7FB 1BBJA 1CLCA 1FO0B 4F37F 4U31A 1NCWH 3QP3A 2X4TA 3WFBH 2MPAH 4QTIL 1JYWA 3EJZD 3D85B 5J3HC 4PV8A 4E42A 3MLPA 1BGXH 3BIKA 3MRRA 4LLVB 4X7EC 5J6HA 4YIQB 4WO4D 5SWZE 2YR3A 2F8XC 4P99A 1CU4L 2YC1A 3O41B 4Y16A 4UQ3B 1ZV5A 4M6OL 3T0XA 5I1EH 2D03L 4U1SA 5D1ZB 3VFOA 3C5JA 3Q0HA 3PHOB 2NY4D 1G7QB 4OUUA 4OZIA 5D1QA 2I60H 1OP9A 4M1GH 1Q9WB 3OZ9L 2LAAA 4QHNA 1NL0H 3CZJA 3TNNB 5H37G 2F15A 3A6CL 2NY6D 4PJXE 1HSAB 1X5HA 5KN5A 1ZXQA 3C09B 5DD0L 3QZWA 1TLKA 4QYOA 3T65B 2ID5A 2HT2C 2FDBP 5DQ9B 4JFHE 4Q6YA 2ADFH 3BPLC 4HJGB 1L0YA 5FGRA 1IAOB 4ZD3L 3WN5B 4NO2B 3L9RA 3FQRA 3DROA 5K9KA 1NCDL 1XCTB 4EUPG 4QGTA 4OD3H 2CIIB 3SE9H 1RULH 4IRZH 1WIOA 3ESVF 1DQTA 2DQDH 4NO3B 2Q20A 1K2DB 1KPUB 4MAYD 2R1WA 2AK4B 3HAEA 1ZOXA 2AEWA 2XWBB 4Z8FL 4M7ZC 4P5KB 4RBPK 1RUPL 3NCYP 4HD9A 4PGBA 3MBEC 4PRDA 5JO5A 5KSUB 2P42B 3MGOB 3VXQB 1MCWM 4P46B 3WFCH 3ZTNL 4L3CA 3MLWL 1YECH 4JFXB 3FAXA 3ORJA 1NCCH 3WUWG 3K3QA 4G9FA 1KTLA 1FG2B 2C5DC 1HQ4A 5DJDB 2O5YH 4UV7H 2VDPH 1JI2A 4Y4HD 5F88B 2CDFB 4PJAA 5F21B 2UVFA 4XWOD 1UWGH 5ALCL 5BV7L 1OTSC 2YWZA 3QUXC 5EZIL 1CG9A 4P5TA 3EJYC 4HUVB 4NJ9L 3LN9A 3KS0H 1JGLL 1ZGLM 3IU4H 2FHFA 3SKJH 3P77A 4A2MA 4ENED 4MSWB 5CGMA 2NW3B 4Y19A 4KKCC 2CLZB 4OZHE 4PG2A 1CCZA 5AG8A 4X4YB 1QFWL 4Z7UA 4RWYL 5FO7B 3PQYE 4PY8J 2XG5A 1E4KC 4I77H 4HFUH 1JK8B 3ZKMD 4ZTPH 3TZVD 1U58A 3VW3L 2VITB 7FABH 2PW2B 2ZUWA 4LHQB 4IOFC 1Q0YH 3U1SL 3UEZA 1FLRH 3W0WE 3OPZH 3DBXA 5CWSA 2JJSA 2FO1A 1NKOA 2OJZL 2LQRA 5IF0A 1A9BB 1H5BB 2HH0L 1UWXH 1YEJH 1CLYH 4D9QE 3BKJH 1IKFH 4MD5B 3R06B 2BXZA 4FQQA 3NPZB 4RQQA 1FN4A 3LEYH 4E5XA 2BVQA 2ARWA 4MQTB 1RJYB 1MRCH 3GO1H 3RVXD 2CXGA 4CVXA 4KKLD 4ODVH 5FDWB 4JM2C 5DVLA 4WHDA 1EFQA 3WIIL 5HPMB 1F4AA 2I07B 1BWWA 2QQKH 4CJ0A 1QLEL 4WY7H 1XGUA 4XPAH 4LSDA 5IEKA 1VESA 3PP4L 4JZOB 3QHTC 1LWRA 5BS0A 1FYHB 5C70A 2E5EA 3G5ZA 5BZDB 1O0VA 4TSCH 2G75B 1FO0L 1NAMA 5CMAB 5TDOA 1KPVA 2ZG3A 4RMWA 3BYTA 5JXED 4IDJH 4XGZA 3CDCA 1WZ1H 4R3SB 1PYWA 4Q9RL 3BH9B 1J0KA 2X89D 4X6FA 5T1LB 1R24A 3MCKB 4DN4H 1ZA6A 1KTDB 3HG1B 4HDIB 5J0BA 5JA9A 5ADPL 3UTSD 4OZGE 2EE3A 5D1ZC 2W9DL 4OI9A 5CHNB 2H8PA 4WCYH 4CMHB 5I17B 4GFTB 5F7YC 2H9GB 2DLEA 1RJCA 1FPTL 5CP7B 5I1KL 5E2WH 4U2YA 4JPKH 4APQD 1BD2E 2F5AL 2NR6C 4X83A 1XIWB 1EAJA 4NBXB 1WIUA 4HKBB 4MS8C 5FUOH 1HYSC 12E8H 5C09B 4KK5D 1NCAL 3C09C 1JV5A 3TYGH 3QIWB 4M61A 1KSRA 4BZ2H 3MNVB 1MFEH 4D0BB 3RP1A 1IQWL 1RMFL 3MYJB 4K3DH 1T04B 5A16B 4HKJB 3OKKB 3WN5C 4MNQD 4P2YA 4Y1AE 1EHAA 5IOPB 4NWTL 2HT4D 4OGXL 3HPLB 3WEXA 3MRBA 1J0HA 1EEUA 4PB9H 2JB6A 1X5KA 4TVPD 3C60D 5CGYC 3ZKNC 4KHTH 1SYVB 5DJ2B 2D0HA 2GFBA 1MCWW 1JPST 5DRNA 3SGJC 3MRKA 4IJ3B 1DZBA 3FQTB 4O58L 1KLUA 2RBLA 4HJ0D 1MCFA 3U36A 3F7PC 3S3SA 3TV3H 1JWUA 3BSZL 4P46C 3BQUA 1PLGL 3G5VA 3V4PH 3CSBA 1FZKB 4LLWB 3ME0A 3SJVA 2GTWA 3MV7B 5ELIA 5TE6L 1NFDF 4OBSA 3LQZA 2FJFB 4R7DA 4PRPD 3QUML 2X1PA 2ICEB 3O6LL 4Y2OA 1I9RH 5D9SA 3IXAA 3UYRH 5KAQF 1J18A 1LK3L 4PJ5D 1F4WL 5JUEH 1QVOB 4L5FH 2CRIA 3F7RA 1NCNA 4JFOB 3VFUA 1XGRB 1A7OH 1X7QA 2VE6B 2FSEB 4NQCB 2EKSB 3M8OH 1EO8H 1K6QL 3FCTB 4EDXA 3M1BA 4BSWB 1QSEA 4X4MA 1Y18A 1DVFB 2O26U 1NC2B 5IB2B 1PG7W 2HMIC 2IAMD 2FO4B 4QRRB 4I9WD 1QBML 3SDDA 3KPSB 3BRDA 3REWB 2VDLH 3ARGA 1U8NA 2QSTA 3QPQD 4F80A 2IFFH 4ZO9A 3NGBC 4MWFA 5EA0L 1CBVL 3HI5L 2DKSA 3F7YA 4WUUB 3MLSL 2HRPL 1H5BC 4L4TD 4X6DE 3EDEA 3PUCA 4HIXL 3RWJB 4KUZH 1A1OB 5DMKB 4NN5B 4NHUA 1RV6X 2QQNL 5DUPL 1T7VA 4HBQA 4D0DB 1UWEH 4GQPH 2DL9A 5CEYA 3U7YH 4NP4H 5IQ9A 1I1CA 3OXSB 5IW3A 4Y5YB 3CFEA 4NQDA 3NZHH 3HUJA 3WMSA 2EIBA 5JIPA 3OR6A 5DRZA 3O2VL 1GC1C 3OAUL 3D3VA 5I1AA 4YHML 4JRYE 3VGDA 1H3PH 1S5IH 4KJWD 5JA8B 1U8MA 3KPQA 2EIZA 4U1LB 4MD4B 4F7PB 4D0CB 4WW2B 3PGDA 4TNWK 4M7KH 3SPVB 1Z0MA 4RGND 2XICA 1KCSL 1G7JB 2HFFB 1HHIB 4ETQA 3LN4B 4K7PY 1KEMH 2AP2A 1ACZA 2VB5A 2AJZB 4LHJB 4UT9H 4U3CA 4XCCL 1BFSA 1T1ZA 5E5RB 1BBDH 1CQYA 4FABH 2P5WE 5F89A 3DX9B 1FZMB 2V2WA 3QEGL 4OQTA 1D6VH 5IM7B 1JWMA 3PL6D 1A6UH 5CEZD 5HI3D 4CMHC 2XY1A 1Z3GL 5IHUL 3FHAA 4O2CA 1XFPA 4OI7A 5DMJB 4HUWB 1R5WB 3DV4A 2DLHA 3LIZL 1U2CA 3QB7C 1NCTA 3TA3C 1D6EB 2DMKA 3DUUB 4Q6IA 2CJUL 1XIWC 2GT9A 1B4RA 2ZUUA 2X4NA 3GSNL 3SDAA 4BZ1H 2N1KA 2Y06H 2MMXA 3QIWC 4PP2B 1QBLL 5GGTA 1NUNB 3V4VL 5FV1L 1A6TB 3KJ6H 3P9LA 3MUGB 3B9KA 5F7DB 1CZ8H 2ZSVB 3QDGB 4ODHL 5EBWA 4L3EE 3EKCA 2QR0B 4NWUH 2EXWD 2A6IA 2WINA 1HOCB 2SEBA 3TEUA 4C83A 3BP7A 4NOFA 1MVFA 4NRXA 4L9LA 2AJ3B 2AXHA 2VZOA 2E7CA 4P3DA 3H2WA 1RUQH 2DYPA 5BCAA 2Z4QA 4I4WB 1DFBL 1ZLVK 3KXFD 4B7LA 2GJ6D 4IJ3C 5A2JH 4E0RB 1RZIA 5IBUG 4PJFB 2ICWI 4LCWA 5IB3A 3PF2A 4Z7WE 1SJEA 1MJ8L 4R90L 1L7TH 4MA3B 3WD5H 5ALBH 1TJGL 2A9NL 4TULL 1MI5B 3VE0A 4CN4A 1GZPB 2OL3B 3HS0B 2BSSB 4KUCF 1NFDA 2VXSH 1DUZA 5LXGL 1D5MB 2OMNA 2XIDA 5IKCB 4MNGE 4FFWC 4G9DB 4YX2H 3RUGE 2K1MA 5I1IL 3SE4C 2JIXB 4N8VB 1N5YH 1ZANH 3HRZB 3NCCB 1JJUA 4TSBH 4XBGA 1VFBA 4P3CL 1A14H 3BGMA 4Y16D 5GZND 3HZYA 4HKXB 2ZUQB 1N6VA 3WYRA 1TZHA 2ORBL 3MV8E 4FRWA 3TO2B 5KG9A 4NKDA 1KJ2L 3MV01 1FSKB 1HHHB 3VI3F 5D1QD 5GGQH 3QXTA 5IR1B 4GKNA 2R8SL 2EDWA 3RY5A 1PEZA 1DVFC 3IJYB 4JAMA 1JF1B 5C07E 3VH8G 5D7LD 4LPYA 3UAJC 2BVOA 5L2JA 5F8RC 5E2VH 3T4AA 5DWUL 5CUSH 3D5OF 2WWMD 3O3DB 2CMRL 5DQJB 4N90E 1T0PB 5E8NA 3QULA 3V4UL 3L95A 3IKCB 1T3FA 3V2AR 4TTDC 2YK1L 3HTLX 1QHPA 5FYJH 1MHHB 4NQEA 4LHUA 3PGCA 1MQKL 2EDYA 5DD5L 2AJYL 5GSRB 5IGXL 4LOUD 4NN5C 3W2DL 1I7RB 1V3LA 2FEEI </