4OZIB

S2 protein complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
188
structure length
180
Chain Sequence
SPEDFVYQFKGMCYFTNGTERVRLVSRSIYNREEIVRFDSDVGEFRAVTLLGLPAAEYWNSQKDILERKRAAVDRVCRHNYQLELRTTLQRRVEPTVTISPHNLLVCSVTDFYPAQIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DQ alpha 1 chain
publication title T-cell receptor recognition of HLA-DQ2-gliadin complexes associated with celiac disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 33
structure length 180
sequence length 188
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4oziB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4oziB01
3G5VA 3FHAA 2ZZUT 3BW9A 3KPQA 4WTZA 4WW2A 5C8JB 3BIKA 1ZSDA 4WFHE 3DHJA 1U6AH 3S35H 5JTWA 1A7RH 3HS0A 4YHOL 2FH6A 1J9CT 4JO2L 5BV7B 4HEME 3WSQL 3REVB 3AS1A 5E00B 1MCIA 2IQAA 3N85H 4QRTA 1ACZA 1VCAA 2DQTL 1I1YA 5E5MB 1A21A 4APQB 4DKAA 1E6JH 2IMNA 5DHVB 5FKPB 2GTWA 5A3IC 4WNQB 4DW2H 4N68A 4DAGH 2Z8WC 3AB0B 2HJFA 4LMQE 4KJWC 2DLFH 1IFHL 2DI7A 4WO4D 3MV8A 3F5WB 4J1UB 2OK0L 4H8WC 3RIFK 5L6YL 1J5OH 3HCVA 1WUNT 1AFVL 2Z31C 4A6YA 4HPYH 5L9DL 1BOYA 3E6FB 1X7QA 5FUZL 4I9WD 1F3JB 2J3SA 1MLCA 4PRHE 1AGEB 5TH2B 3QCVL 5MHSE 2A1WH 2P46B 5IB4A 1A0QH 4ODTL 1YY9C 3G6DH 1G84A 3KLDA 5FFLA 4LPYA 3LZFL 4MA1C 3O2WL 4WW2F 3SPVB 4O2CB 4LLWB 3BEWA 5BS0A 3NABL 4CADA 4OQTA 3PGCA 1FZJA 1PD6A 1BZQK 3N9GL 1YNLL 4C56D 2D7TL 5AYQA 3IDXL 3VWKA 1G9MC 1UH2A 1WFTA 4XP1H 3QCUL 2FX9H 4I48B 4O9HL 1AC0A 1EEQA 1T22A 3IGAA 4ZO7A 3BP4B 3CAFA 3QDGB 5AEAA 4M7LH 2AABL 1U3HC 2DKUA 4UDUA 2YHGA 2X70A 4JDVA 2CGRL 3MXVL 1YQVH 2RR3A 5C2UB 2ZCLH 4BELD 5JOFB 4QHUA 5GRXG 1KB5L 3C60B 1KEGH 5IW6B 4I2XA 5EO9A 1YEIH 5F88A 3L9RB 1JGUL 2NLJB 3SKOB 5FHAH 3RWFA 1UZ8A 3CXHJ 3AXLA 4JFQA 4X4YB 5C0NC 4HFWB 4WU7B 1SEQH 4MDIA 1I7TA 4U1LB 3L5WA 3FTGA 1PQZA 2F54A 3SEPA 4KK5D 4YHOH 3VI4F 3UTZA 4HHAA 1EVTC 2CLVA 3WSQH 3EO0B 2DQTH 2KKQA 2GW5A 2ZUTA 2EDOA 4D94A 5CBAA 2V2TB 3QJFA 3VJ6A 4JRYA 4U6XB 3ARDD 4HKXB 1FGVL 4L29A 1NPUA 3EDJA 5H8DA 4ZNCD 1S7XB 3U4EA 2E9IA 2OK0H 5ID0A 1AFVH 2QADC 3HMXL 4HJGA 5BVPL 3FOMB 4HPOL 4HIHB 5L9DH 3OPZL 4R4BA 3TYFA 1S9VB 2VLJE 5FUZH 2AK4E 3LKPA 5IMKA 3FONA 2FSEB 4WHDA 4OV6F 1CXFA 1BAFL 4LEOA 3QCVH 3VMOA 3WEXA 2ITDA 1BD2D 1VACB 1JZ3A 3EYSL 4ODTH 4JDZA 3T1FA 4Y1AD 3LZFH 4ZOEA 5D7LD 5GGTA 3O2WH 2A2QT 2RB8A 3MRKB 2HVKB 1S7VB 4DVBA 4LPWA 1JWUB 3NABH 4O02L 3QP3A 3NACL 2MQ3A 3N9GH 3Q2CA 1YNLH 3IDXH 1AKJB 4OBRA 1TVBB 1KT2A 1BWWA 3EOBA 4KROC 2QQLL 1RUKH 4O9HH 3EYQC 3OZ9L 1HH9B 3GMPA 4RGNB 1YYLL 3IFOA 2AABH 3DSNA 2ERJB 1A4JA 4ELMA 4TSAL 5F9JB 2CGRH 3MXVH 3FZUC 3D69A 4ZXBA 1C16A 3V5HA 3NZ8B 5D1QB 2XNAA 5E6ID 3QHTC 1Z0MA 3MPCA 3UTPD 3W11D 4MNQB 4Y1AA 3JWDC 1FJ1A 1IGYB 2L7JA 1JGUH 1RY7B 4ZFGL 5LG1A 4ZUVA 3NFPB 3V8CA 1J18A 4NKQB 5IVZB 4PJAA 1G7QA 3ZKSD 4XCNB 3VFWA 3VWJD 5D6DC 3LEYL 4GRMA 3IETB 1TZHB 4AEEA 1HQ4B 2AEIT 4LSRL 4H0HB 5DEFA 4X9HA 5D70L 4JFZL 4WI2A 1JRHI 1UJ3A 3OF6A 5DEGB 4FQQA 4CU8A 5IHZB 3JUZA 2NY2C 2ATKB 3O6KL 3QUKA 1CFTB 2A6IB 5SX5H 1F4HA 1FGVH 4GQPH 3O4OC 3ULUD 4CMHC 1OHQA 3MRIA 2OL3A 2ICWJ 1MQ8A 1YEHH 2P42B 3NPSC 1JGDA 1G6VK 5ELIA 4HKBB 1JPGA 4U1KB 2ICWA 4ZS7L 5JDSB 3W5MA 2OS7A 3QI9C 3SE4A 5IB3B 1T04A 2LE9A 3HMXH 5BVPH 4ELMF 1HN1A 4HPOH 3OPZH 4IHOB 2ZSVB 4KJQD 4UUJA 1B2WL 5C0FB 1A6WL 1NFDB 4BFBD 5FF6B 2VLRA 4CNIA 1VGKB 1UCTA 1BAFH 4JHWL 3TZVD 4U31A 3ULSB 1K2DB 1RJZA 3WKML 3OKMA 5IJVB 4GRLC 3RPIA 3R0MA 4BQ9A 2DTSA 4KDTC 3EYSH 3S37L 1Q8MA 4MCYA 5CJBA 4LKXA 1NBZB 1FL5A 1YYML 1A1OA 5CGYD 2YD9A 3F7RA 3H9HA 4PJAF 3U7AA 3HI5L 1XF2A 4O02H 3GUTB 4NKMA 3NACH 4F3FA 2NY7L 2HT3C 5HGBB 5GRZA 5IFAL 1BFOA 4GMSL 2A73B 4M3KB 2P47B 2DLEA 3OZ9H 3G5ZB 4GKNA 5BOZG 1K8DA 1RHHA 1X3DA 1TDQA 1X4ZA 4MS8D 4HZLB 4I3GA 5GS1A 5B8CC 2YPVL 3ZE0E 2FHCA 3SE3A 3U0PA 3DRTA 3L5HA 4I0PD 4OI9A 4M62L 2GT9A 3NIDE 4CDHA 1ZT7A 4PRIE 2AJVL 4ZFGH 5DJYA 2VR4A 4M7JL 3WDHA 1MCNA 1HE7A 4L3EE 3C5ZC 2X2YA 1IQDB 2CLRB 1WK0A 2DQCL 4P99A 2PYED 3LEYH 1W0VA 2N7BA 4P46A 2BMKB 4S1QL 3UTSE 4LSRH 3MJ8B 3MTRA 3U6RB 5D70H 3HLAB 4JFZH 4TSBL 1P4IH 3MA7A 1HSAB 2DWEB 4N0RA 1A1NA 1JYWA 3O6KH 3P0YL 2O5YL 2RJMA 5MI0C 3SY0B 1QTYT 4YDKL 2HTLD 3VRLF 3EYFA 3VXNB 1LO5A 5EU3B 5J6GA 1YUHA 2YN5A 3OKLA 3SDAB 1P7QD 2VQUA 3QO1B 3JTTB 4PFEA 4NUJA 1JV5B 4FA8A 3LMJL 3K80A 2H8PA 4FQCH 5C0DB 1AI1L 2G9HA 4TOYL 1GVIA 1M71A 1OGAA 5ENWA 3ARGA 3KS0H 2BX5A 4JHWH 4KI1A 4M43L 4PG2A 4WFHD 5BV7C 2H2PC 3OB0K 3B9KA 3UZEA 4QHLA 1JF1A 4KJPC 3GI8L 1QPPA 1YYMH 1R24A 1U95A 3OGOE 4JG1L 5E2TL 3HI5H 1SM3H 1P7QA 2NY7H 3DXAE 5IFAH 1E27B 1WZKA 1S7TA 1R6VA 2H3NB 3CVHA 1X9QA 2A0LD 2H9GA 3BPNC 5CEZE 2BVYA 5H94B 5FGSA 5JOEA 5C07E 4PY7B 4Q9RL 1IAIM 5DK0A 5JHDA 5D1XA 3MC0A 4URTB 4AEFA 2ZUYA 2YPVH 2IPUG 3BW9B 3N1FC 1WAAA 4M62H 2VC2L 4G6AD 1LDPL 3IS0X 4RZCA 3B4NA 5I1KH 2AJVH 3GSOB 1PX3A 4PRHD 2RCSL 3HS0B 5ESQA 2Z92A 4RAUA 4M7JH 5IVXA 1A7PL 5MHSD 3BRDA 2NQCA 2X09A 1ACYL 3DI2B 4YJZL 4QRTB 3DGGB 4XVSL 1U8HA 4LOUD 1CXIA 5HHME 2DQCH 4JQXC 1CD1A 2X7LA 1XF3B 3HG1E 3RNQB 3RX7A 2BJML 3NAAH 4E5XA 4S1QH 5J1AB 2DYPB 3T0VA 1NKOA 4FTVE 1QFWL 3TJHD 2MTPA 3VD3A 2HJFB 1I8IA 3W9EA 3ZTNL 4TSBH 5EIIB 4UT7L 4FQXD 3P0YH 3HCVB 2O5YH 4A6YB 5DJ8A 4YDKH 5IB1A 3C60C 4LASH 1BP3B 1TTGA 4KKCD 4XC3L 1MY7A 4NDMA 3S34L 2H32A 3LMJH 4DK3A 3ULVE 1LWRA 1WBZA 3KWWA 1AI1H 1OB1B 1NCCL 4TOYH 3HN3A 2AV7A 1AR2A 3KDMA 1A2YB 4JJHA 1WAAF 2MJWA 4BSVB 3K0WA 1AO7E 4WO4B 4M43H 4HGWA 2DM4A 3F7VB 5EU5A 1FZJB 2XKNA 1RUQL 3IJHB 5JIPA 3CPLA 1SBBA 3AC0A 3RKDC 3GI8H 1RUAL 2BCKB 4K7PL 1T22B 2HJLA 3IGAB 4JG1H 4L8SB 5JW4N 1JZ8A 3VE0A 2DQJL 2LAAA 4TUKH 1MCFA 4JDVB 4UDUB 1JRHL 3X11A 1PW3A 4Z7NE 3MRQA 4P2CG 3BD5A 1T89C 5AUMB 4LVNC 4I2XB 1L7IL 4Q9RH 3O11A 1EVUA 3IDYC 4PJXA 3RWFB 2IBBA 1T83C 4BJLA 4C56B 3F8UB 1KFAL 4EXKA 3PGDA 1KIUA 3K4DA 4IIQA 2D7PA 1QD0A 4MDIB 1LDPH 1NGPL 2AK4D 3L5WB 5E5RB 1PQZB 2X42A 4XNZB 4EI6A 2RCSH 4KU1A 2I27N 4KAQL 3UTZB 1A7PH 4DKFL 4XAKE 4K7FB 2CLVB 1ACYH 3ME0A 2YPLE 4YXLL 5HYSG 1U8MB 3B9EA 5BRZE 5CBAB 1RAMA 2BJMH 3VJ6B 1O5DT 4ODXB 4LSSL 1JWMA 3BQUC 1JI1A 4L29B 5I76A 3G6JE 1YPZA 4LGPB 2HJKA 4KUZL 4P2OC 5KAQF 2X4QB 4KK9C 5EO1A 3ZTNH 3DX8A 4UT7H 5ID0B 2Q3ZA 3GRWL 5IEKB 5KN5B 4LVEA 1GOGA 1NMCC 1X5IA 4KGJA 3ZYIA 4WDIB 1MJ7L 3TYFB 1JWSB 5IMKB 3MBXH 2X9WA 4RIRA 1KELL 3T0EC 3LEXA 5TDPA 2KZ1B 4XC3H 2P8PA 4Z18A 1NAKL 5D7JD 3RVUD 3S34H 4LCUB 3D18B 1Z9MA 2VZOA 2V5SA 5FKAB 4B7LA 5IESL 4BH7A 3TA3A 3ARDB 1MNUL 4JDZB 2R2BB 3IU3A 3DUUA 4XB8A 4PJGB 4DVBB 4N0FA 1KB5A 5DVLA 3T0XA 3CFJA 1AD0A 4ZOAA 1RUQH 4ZDHA 1KT2B 2HTKC 3EOBB 3OAYK 3DECA 4OFIA 2MNUA 5EWIL 1RUAH 4K7PH 3UTOA 5J56B 1UG9A 1VDGA 4PRNB 5EU4B 1ZT4A 3IFOB 3E1F1 2DQJH 3VD9A 1JRHH 3ZHKA 2NY1C 1MCDA 3ZDXF 4HJ0D 3QYCA 3SGDI 1C16B 4X4XA 3M17A 5ALBL 2BVOA 1YPZF 5J89A 1XGQA 4Y1AB 2DI9A 1L7IH 5D7LB 3SDXE 3IJSB 2NY0C 8CGTA 3U7YL 2JIXD 4X99A 5F7EL 1KFAH 2Q87A 5IF0A 1CE6A 1JNJA 5I8CA 1G7QB 5LAXA 1NGPH 3IXTB 3WO3B 4OZIB 3TH3T 4Y5YC 4XTRD 2B4CL 2NY3D 4NFBA 1I9JL 1PBYA 4Z7OE 3PDOA 4KAQH 5FA3A 4DKFH 3QWOB 2OQJB 5CEYA 3HMXA 5B3JE 3D5OF 1XCTB 4RFEA 4YXLH 5IJKC 2VISB 5E6IB 4S1DC 3B5TA 1UJ3B 1ZT1A 4JM2D 4FXLA 4PJ7A 2ED8A 3L5JA 4LSSH 1LEIA 4HLZG 3ELAT 4PJ5E 5DF0A 4KUZH 4MWFA 1PZ5B 3VA6A 4CVZA 2VL5A 4RMWA 2GAZA 4LMQI 3VD5A 5HY9B 1C7TA 4PY8I 4PRPD 3GRWH 2XI9A 1NFKA 3VWJB 3HR5A 4XPGL 2E3VA 4DOHE 1HQRA 5KG9A 3P9WB 5C09D 1MJ7H 4OSUL 2NY5L 4JHBA 2O5ZH 1KELH 2NTFA 1NAKH 1JGLL 2WINA 5AD0A 1UXWB 1QYGH 1DUZA 2BHYA 5IESH 1SQ2N 2QHLA 4Z7WB 4PRID 4MCYB 3CLEL 3HFML 4P9HC 5GXBB 1MCRA 5I66A 1CFSB 2P48B 4QY8A 3ESVF 4YNYB 4L3ED 3QG6A 1XF2B 4JJ5B 2W07A 4NKMB 4GFTB 4KK6D 4PRPA 3WJJA 5K9JL 5D7IE 1BFOB 3D6GA 1E28A 4XT1C 3UTSD 2XRAH 3MQIA 3LH2L 3U30C 1HCFX 5C09A 5DVKA 4Z7QF 5FGBC 4YXHH 3WBDA 3TFKD 3LRGA 2BVTA 2V5YA 4LRIC 1K8DB 1RHHB 1U91B 4X6BB 3TZVB 5DZOA 4PJ7F 1I7RA 3T77A 5GS1B 3HUJA 3PABB 3Q48A 4NQVA 1BECA 4O2EB 4NN7C 3PGFL 3FQXB 3L95A 1HYSC 5BMFL 1RZKC 1ZT7B 4QHMA 3U7YH 3ZO0A 1PKOA 4WIQA 2OR7A 5DMYA 5HD8C 1NCBL 5F7EH 5L8KB 1C08A 2P5ED 5BW7C 5FOBA 1YN6B 4QT5B 4AQ1B 4JN2B 2HAZA 2B4CH 3ISWA 1I9JH 4XGZA 1IEHA 1V3JA 4JO1L 1EO8L 5TDNB 5F7YC 4MXQC 1V05A 1Z9SA 4LDOB 4U1NA 2VMFA 3GMLA 1JGVL 3KS0J 4I0PB 3MA7B 4ORGB 1A1NB 1PAMA 3KHOA 4YO0A 2A6KA 1OWWA 4LCWE 4JFDA 3R4DA 2P5EA 2C7UA 3EYFB 1NMAL 5J6GB 4ZSOA 4FFZL 2AJXL 2KQNA 3H9ZA 2AJSL 3LB6D 3B5HA 4U6VL 5CEZD 3FO1A 5I0DA 1AD9A 2EXWD 2PYEB 4FP8L 4XPGH 1RUML 1WC7A 5C07D 3B8SA 3WNKA 3TVMD 1U93B 3VFMA 4WW2C 2NX5E 1FYTD 2G9HB 4I77L 2XICA 1M71B 4ZTPH 2NY5H 3VFPB 2YEZA 3BRGC 5DO2D 3ARGB 3VXQA 3O2VL 3BZEA 1JGLH 1OLLA 2DIBA 1K9TA 3EAKA 4OT1L 4YDLB 5LKNA 2ZOLA 2GITA 1SEBB 1TMCB 4K7PY 1JF1B 3OKEA 4LVOC 3CLEH 3HFMH 3O6LL 1ZA3A 5MEPA 1R24B 1U95B 3QWRA 1P2CA 3FL7A 1P7QB 4M61A 5HHMD 5FYLE 3HC0A 5K9JH 2V17H 5IOPB 4HUKB 2Y72A 1XGRB 2HLAB 1S7TB 3LH2H 2RBLA 4FTVD 3CVHB 3VDCA 2H9GB 1UB5A 4WFED 3V0VA 1RULL 4G6FD 3AY4A 1OF2B 4TVPL 3H3BC 1DLHA 2PXYD 4ZFFB 4QCIA 4K2UL 2R4SL 4XXCA 5E9DA 2DD8H 4GBXA 1UCBL 5F6IB 2FJHA 5INDB 3CFCL 5IMMB 1HILA 2X4NA 3HE7D 1XF5B 4W70A 3PGFH 1WFOA 4DTGL 2D31A 3UAJC 5BMFH 4PP2A 4RZCB 1KCRL 4NZJA 5E95B 5B3NA 4XWOC 4XHQA 3DLQR 1J12A 1NCBH 2Z92B 4RAUB 5IVXB 4NQDE 3NA9H 1TENA 35C8L 2R1YB 3QH3B 4LNVA 4NGHL 4W6YB 5TE6H 1U8HB 1YC7A 5CSGA 5GS0L 3CSBA 1CD1B 2X7LB 1FFOA 4E5XB 2IJ0C 3VWKC 5HHPA 4UOW0 4MGXA 5BZWA 4JO1H 4NO0D 1BREA 1F90L 1EO8H 1IVLA 5TPWL 1YZZA 5IV2A 4LPCA 1JGVH 1KJMA 3GGWA 5J12C 3SJVE 3OKNB 4X7CC 2VSDA 1MOEA 3QXUA 4BQ6A 4M93C 4WHTA 4PRHB 2F8OA 3SKMB 5CUSH 3QULB 4RMVA 4Y0GA 1NMAH 3VXRD 2AJXH 2AJSH 4U6VH 4FP8H 4UU9B 1RUMH 2H32B 3OG4B 4P23C 4WUUE 3OJDB 3KWWB 1QLEL 5CKGA 4DVRL 3KPTA 4AK1A 4CDGC 5DVNA 4YH6A 2UYLA 4JKLA 4L3CA 5KVDL 3KDMB 3ARXA 1X5XA 1GSMA 3LKRA 3O2VH 4TN9A 4XNZC 4X4ZA 4ZO6A 1C5DA 1J8HE 5GSRB 5DZNA 4OLEA 4OT1H 4MB3A 4FQXB 2XKNB 3LVEA 1IBGH 1ZXQA 2R0WL 1CLOL 4ZD3L 3O6LH 1KUMA 4JGMA 5EBWA 4R4ND 2HJLB 2Z8VC 2YPLD 2BNQE 1JL8A 3VE0B 5BVJA 3DX6B 2NYYC 1KGCE 4U1IA 3U2SA 2XWTA 4GKSA 2GHWB 3X11B 4L1HA 1MCKA 3J7HA 3MRQB 1JPFB 5CD5D 2X6MA 3MRLB 2VZTA 1RULH 2GUOA 4TVPH 1R3LA 3ZT6A 4PJXB 1K5NA 3AM8A 4MQXD 1H8NA 2YXFA 4MNHA 4K2UH 2R4SH 4YK4C 1T0NA 1IL1B 1N6QH 4PJHA 3WFCL 1UCBH 2B2XH 3CFCH 4Y16D 2YK1L 4IIQB 4DTGH 1KCRH 5DUBA 3Q6GL 4RRPA 35C8H 4LIQL 5I73C 1K6QL 4HH9A 4NGHH 1VEOA 3QAZB 1VB9A 3CXDL 3TH2T 2NCMA 1Y6NR 3HZKA 2WWMD 3H7LA 1IC1A 5E8NA 1EUTA 1F90H 5TPWH 4R7NA 5I76B 1E4WL 2EIEA 4PJEA 2HJKB 2XFXA 3DROB 4FFYL 5EO1B 5K9QI 4K8RC 4F7TA 3ZTJG 1A1MA 5JPMB 4OKVB 4YDIL 2AK4B 2V2XA 3PP3H 5LGHL 4JDTL 5GGSY 5GGRY 2FIKA 4ZXBC 4U7KA 4HUUA 4QGTA 2CRIA 3QIBA 3SGDH 4L4VA 4RIRB 4U6YA 4XAWH 5F9OL 1WTGT 4POZD 1LMKA 4H1LH 1GAFL 1IEAB 4BH7B 3WD5L 1QLEH 4PJHF 2Y9RT 1W2KT 2V6HA 3DUUB 4HFUH 2V5TA 1MPAL 4QXTB 4X98A 3TNMB 5FUCE 4R97B 1FVCA 3WFDH 5F9WB 3CFJB 4BFIB 1AD0B 4XNYL 4G3YL 4ZUUA 1BFSA 3X3FL 4ZDHB 1ND0B 1T21A 2ICES 1CLOH 4IRSA 1WWAX 4ZD3H 4XPFL 1FZMA 3E3QE 2JJTA 4JFFD 5KSAD 5KANG 4YHYC 3PQYE 4X6FA 4Y7MA 1ZT4B 3U83A 1UWXH 2AQ3A 5FYJU 4CVUA 2JE8A 5D7JB 4WI7A 3CX2A 2V2WA 4OFYD 4X4XB 1I3GL 1RZJL 2BVOB 4PJEF 5EORL 4ETYA 3HPJA 3SE4C 4P59L 5E2VL 2B20A 1XAUA 4X99B 3WFCH 3AS3A 5LBSL 4AEIH 3QHZL 1CE6B 2YK1H 4JFFA 2CO7B 4R0LA 4AIXA 3WHE0 3O9WA 1XEDA 3F7YA 4M7LT 3Q6GH 1G6RL 3KHQA 5FA3B 4H20L 2DWDA 4LIQH 1IAII 4K07A 1K6QH 4RFEB 1HHJA 1H5BB 3CCHB 5FUOL 3CXDH 3HI1B 4Z6AT 3E2HC 1NCUA 4O4YH 4OCXL 3LPFA 1H15B 1LEIB 2JIXB 4PGDB 1L6ZA 3FQRA 5DMJB 5FM5M 4UQ3B 3X3GL 1TJGL 4FFYH 1NFIA 4CVZB 2BSRA 3FFCE 2AXFA 4JB9L 2GAZB 4YDIH 1FFRA 3T4AA 5LGHH 4JDTH 3HR5B 2FD6L 2NY3B 3SE3C 1HQRB 2WNGA 4HKJA 1NGXB 3L3JA 5GJSL 4WJ5A 4UNUA 2Y25A 2WBJD 1FNAA 5EIQA 5F9OH 4JM2B 2JJWA 3OQ3B 5SWSE 3MYJA 3RL2A 1DUZB 4LSQL 1GAFH 1NMBL 4HUXA 2FJFA 2C4FT 4OM1L 1NJ9A 3WD5H 2ORBL 4WHYH 4K3JL 4KHXH 3GNML 4NRZA 3KYKL 3V4UL 3Q5TA 1SHMA 5GZNC 5IBUB 4QY8B 4RX4D 2E6JA 1MPAH 4C55A 4P46C 1OSPL 3UPRB 3AVEA 3QG6B 4PRAB 4PRPB 4XNYH 1C8PA 3X3FH 3LRSB 5DFVC 4IRJC 3BUYA 2VN7A 3VGAB 3UDWA 4YHML 5C09B 4OLXL 3MRFA 4JCMA 3IFPB 3VFNA 3MO1A 1AHWA 2OX5A 1I7RB 1TLKA 2IPTL 5HGDA 2SEBA 5F70A 3HUJB 1I3GH 1RZJH 4LCWD 2YKLL 5DFWH 2B5IC 5EORH 4Q7DA 4WUKL 5HVWA 5E2VH 4W6XB 4KRMB 1KB9J 5C92A 4L3EB 3MACL 1KACB 2XG4A 2YD1A 1R3JA 2DL9A 1P6FA 3EO9L 5LBSH 1C08B 3QDMA 3QHZH 3P30L 5FOBB 1D6EA 3UTSB 3ARGC 4IMKA 4BKLA 2NX5D 4FNLL 1ZWIA 4PG2C 3FJTA 5EO0A 4PJBA 3GK8L 1KIPA 3NCJL 2K7QA 3B9KC 4NRYA 3RDTD 1IKNC 5EG6C 4EVNB 3OR6A 4JO4H 3C09C 1IRAY 2FLRT 4U1NB 4GRWE 3GMLB 5GGSA 2IG2H 5FUOH 5GGRA 2CMRL 5GGVL 1JGEB 4GOSA 1R3IL 3BWAA 4KRPD 2BNUB 4NNXA 5HDLA 2A6KB 1UEYA 4JFDB 5TGBA 3O45A 3X3GH 1TJGH 2EH7L 1MCPL 2P5EB 5ICYA 1JK8A 8FABA 3BZ4A 4JB9H 4OIIL 5T5NG 2W60A 4PIRF 4QF1A 4ZSOB 4E0RB 3FO1B 5D1XC 5EFIA 3QRGL 2FD6H 1RJYA 4WRLA 1QLRA 5CFHA 3ILPB 5I1IL 5EOTB 3D9AL 1D5ZB 1OT1A 3VFMB 2IANA 5GJSH 1OP3H 2OBGA 4N5EC 4K94L 1NCTA 3TBSA 1CDIA 3FFDA 2YEZB 3RI5F 4AG4H 3N1MC 2HT2D 3BZEB 4OLWL 3WHXB 2PN5A 3L3GB 4LSQH 1NMBH 3UJIL 4OM1H 4N90E 1GGTA 2ORBH 4K3JH 3OKEB 4MD5B 2Y5TA 3I84A 3GNMH 3DV6B 1ZA3B 3KYKH 3V4UH 4NQDD 3L5IA 3JVGA 4U05A 4HWBL 5DC9B 5EBMA 3H9SE 2BOBB 1OSPH 1BEYH 3IDJA 2F53E 3PP4L 4FQLL 4PJBF 4XBPB 4M61B 4ETQA 1X4XA 3D39D 4Q0XL 1ZGLP 2HRPL 1S9XB 5C07B 1PFCA 4EUPG 3TVMB 4YHMH 4OLXH 1P53A 1FYTB 4GT7A 1G1CA 3OR7A 5MEQB 3T3PF 3NCYS 4FQ1L 1JPSL 1U92B 4Z7UA 2IPTH 4X6DA 2Y7QA 5TE4L 2YKLH 3ZE1F 1NLBL 3GIVA 1MHCA 4H26A 2D4DA 4OZGA 5HHOE 4TRPL 1X4YA 4MA3A 5DJAB 3MACH 1T5WB 4LP4A 4JKWA 5HHMB 2BSTB 3D39A 2YR3A 2CRMA 3P30H 1UM6L 1YA5A 3RWEA 2DTML 4FNLH 4U1HA 1YC8A 2QHRL 5F1KC 3GK8H 4MYWB 3NCJH 4G8IB 5JXED 4UDTA 1FFOB 3WIIH 3MRPB 2AI0L 3VRJA 5GRVL 1NEZG 1J8HD 2ZSWB 3CJJA 2PXYB 5BZWB 4OLYL 5CIPB 2VAJA 3N1GC 2XY2A 3P0GB 4BSJA 1A47A 3U0WL 1IGTA 2CMRH 3GGWB 3HE7B 4EDWL 4G80A 2FGWL 4QWWD 1MSPA 4CJ1A 2AEPL 3IJYA 4U3CA 2Z93A 5MENE 2BNQD 4WHTB 3QQNA 5TQ0L 1KGCD 1JNNL 1TTFA 4MD4A 2V7NB 2EH7H 5E7BA 5IQ9B 3VXUD 4EIZC 5I1CL 4OIIH 3CFBA 2DICA 2VLKD 5HPMA 1LEGA 2AJUL 4PJDA 3QRGH 3RZCA 3FT3A 3QUXD 5I1IH 2Q86B 3D9AH 4X6DF 3QFJD 4NO0B 4WTWA 5ICXA 3TN0D 4K94H 2UYLB 4L3CB 4HEPG 3LKRB 3MNWB 1Q9LB 4XPTL 4YHKH 4OLWH 3QEQE 3KGRA 4JGJA 4QRPE 4XP9H 3UJIH 4Q6YA 2VWEE 5CGTA 5IBTL 4Z77A 1T66D 1HH6A 1EBAA 2XZAL 3UTQB 1PY4A 1MI5A 3MUZ1 4H5SA 5EBWB 4KFZC 3D3VE 2VJXA 1MRCL 2FL5B 2YD2A 4HWBH 4MJIA 1VKXB 4PLKD 3VXRB 2VLKA 1L9NA 5F1SA 4U4BA 5I6XB 3CFDA 4FQLH 1GYAA 1ETZA 3EDDA 2EE2A 4Q0XH 4PRBA 2HRPH 1WLHA 1XGPA 1A6VL 3RFZC 2W9LA 3EUUA 5F21B 5K59E 2ICEA 2X10A 3WNPA 1N3NB 4HLJA 4RGMC 3MBEA 4FQ1H 3SO3B 3QA3A 1T0MB 5HI5D 5DJZB 5LXGL 4PJHB 3B2VH 4ISVB 5TE4H 1M7DB 2EDEA 1T3FA 3QDJE 2VXVL 2YPLB 1G7IB 1T80A 4K55A 4TRPH 3S98A 3TA3C 5C9KA 1KG0B 4PJDF 3STLA 4PJFE 1F4YL 3BZDA 4NQSB 1UM6H 2VDOL 5JORA 2ARJA 2DTMH 2NXZC 4OZHF 4RQQB 4TUOA 3ULVL 2YD4A 2QHRH 4I5BB 1MAML 2Q3AA 2AI0H 1CL7I 3GJFA 3W39A 1IC4L 5E8NB 4OLYH 1KXQE 1LE5B 4R7NB 3K4ZA 3MV01 5F7UA 2WQRA 3SKNB 4H1LA 2VIRB 3RGHA 2XFXB 3U0WH 4Y16B 5CSBA 4EDWH 2HMIC 4ZQKA 2QSQA 3EOTH 2FGWH 5DQJA 1I9IL 2AEPH 3GJEA 3M8OH 4MAUL 4EEEA 5TQ0H 2FIKB 1JNNH 1YNKH 2UV3A 2AKRA 3MA9H 3ROLA 5I1CH 4F7PA 5DDHA 3BUTA 5F3HB 4JQIL 5J7CC 4U6YB 6FABL 2BDNL 5BXFB 2AJUH 3TO2A 5CEZH 2JF1A 1FZOB 2IPKA 2YD6A 1O0VA 1VFBA 5MERA 1H3XA 5DJDB 3V8OA 5DMKB 3LD8C 1QSZA 4OV5A 3TF7C 3C2AL 4X98B 5IHLB 2QV2A 3MODL 1Q9KA 1T03H 4PY8J 43CAA 1QPXA 2XZAH 3V7AG 5DUML 1FZMB 4MDJA 1SJHB 2HN7A 3AAZB 4X6FB 1IAIH 1GGIL 4XVTH 5ILTL 4J23A 4EJ1C 5I0ZA 3FB6A 2LTQB 4FHBD 3WLBA 5AAMA 1M7IB 2V2WB 4WI3A 1A6VH 3OKKB 4UILL 1J05B 3GI9L 2APTA 3Q6FA 4FZEL 4NNYB 1KJ2L 4NQEE 3HZYB 2ZUUA 3FFCD 3CLFL 1FL6A 1A9EA 3T65B 1QFHA 5LXGH 2LV4A 3RUGA 3MFGB 5IB5A 1G7PA 5CIPH 2VDRL 3MV7A 3BDYL 4X80L 5JW3L 4JFFB 1F6AA 4R0LB 5KSAB 2VXVH 2KBGA 3QPQD 3GB7A 3F7YB 3TH4T 4P57A 1T7XA 5DJ6B 5IMLB 4F57L 1FG2A 2QQKL 4YFLF 2R23A 4HAGA 5SWSD 5HVFB 2VDOH 1HHJB 1RQ5A 5GGVY 4HGKC 1QRKA 3ULVH 3BHBA 1MAMH 1S78D 3HPLA 1GZPA 5C6TL 1IC4H 1FV1B 4F8QA 2EDBA 3G08B 4MA8L 4XXDB 2BSRB 3BP5A 5HHVL 1LP9E 3RBGA 1H8SA 1I9IH 3ARTA 1A14L 2PCPA 4MAUH 2AXJA 3SDYH 3BN9D 1PSKH 4MX7A 2NZ9D 1DN0A 4PJIE 5JW5A 1C12B 3CZJA 3ALXA 4HKJB 3NGBB 3L3JB 4L4JA 4E42B 2XTJC 4JQIH 3SN6N 6FABH 2BDNH 1EFQA 3MLSL 4FFWD 1PKQA 3K74B 1FL3A 4X4ME 1LD9B 2FJFB 4PV9A 5C08E 5FGCE 1P1ZA 3ARPA 3RUGF 1UVQB 2ADIA 5D7IB 5GGUA 5KSBA 4P49A 4WEUD 3C2AH 5JA9A 3MODH 5KOVC 1L0QA 4JRXE 4D3CL 1LILA 5DUMH 1R5VA 2FX7L 3VXPA 4Z5RB 3IDIB 1GGIH 1XGUA 2V9QA 5ILTH 3JV6A 3MRFB 2WBJB 5L2KD 1AP2A 1AHWB 5ERWB 2X4PA 4D0CB 4UILH 3GI9H 1G6RA 3RWGA 4FZEH 4KZEL 1KJ2H 3FOLB 5ICZA 3CLFH 4XBGA 1A22B 4Q58C 2FYYA 4HMCA 3I3DA 2YA1A 1KENL 4UI2A 1BVKB 1LNUA 4X7SL 1WTLA 1D6EB 2BERA 1C5CL 2VDRH 3BDYH 4CGTA 5JW3H 1KNOA 1D9KD 1FVDA 1ZWIB 4I13B 5EO0B 1U36A 2FEDD 2Y6SC 2Q8BL 43C9A 3D0VB 4F57H 4NRYB 4HDIA 1UZ6E 2QQKH 3VXSE 2EYSA 4LSUL 3S96A 4P5TD 4YXKL 4S1SL 2EEDA 2Q7NA 4LCWB 5JZ7C 5GGSB 5GGRB 3UO1L 3S4SA 5TF1L 4CW1A 5KSBF 1N0LA 5C6TH 3V6BR 1DQML 2X1XR 3H9SD 4NNXB 4ZS6D 4J3VA 3ALPA 4MA8H 2QBWA 3O45B 1TETL 5EU6E 4NKDA 4YDJA 5ICYB 1HNFA 1CS6A 1YMME 3AY4C 3X14B 2W60B 1UFUA 2P5WA 2NX5B 1R5IB 1T5XA 3MJ9H 3WKNA 1HKLL 4Y5XA 4CVXB 1A14H 5EZJA 1PYWA 4XXCC 3BGMA 3WIHL 4GBXC 4UQ2B 1RJYB 1QLRB 5KW9L 2HKFL 3RDTB 1ZGLA 4DN3L 3QIUD 3QUYD 5E8OA 3O41A 5B38G 2IQ9L 3QUZD 1I85A 2PO6A 3V6OA 4NOBA 1VHPA 12E8L 1KBGL 1UT9A 4KRPB 1Q94A 4Z0BL 1QSEA 1OP9A 3KYMB 1JHTB 1KXVC 1UWGL 5EBMB 1NUGA 2MKLC 5HYQA 3SDCA 1A7OL 4ETQB 4G43A 4L8BA 3QXWA 1YN7A 4D3CH 2H6PB 1KN4L 1AGBA 1CL7L 4O5LL 5CZXC 1MIML 2EDRA 7FABL 3QIUA 3OR7B 3UROR 5H37G 4F7EB 3FN0H 3VG9B 3ZKQD 5I1DB 5B39G 4LSVL 4X6CE 3KPSE 3RWIA 4HS3A 3H42L 4Z7UB 4X6DB 4RNRA 4Q6IA 1DDHA 5MEND 4U0RB 4Y2DD 3EYVA 4PGCB 5DRWA 3GIVB 4RDQF 4H26B 1EO5A 4NQDB 4N0CC 4ZO9A 4BH8A 4OQ1A 4OZGB 3T08A 1MEXL 5IROA 5DRZB 2FECI 1JNHB 1KENH 3D39B 5T1LD 3OXRA 4X7SH 2BNRA 2I9LA 5D2NB 3MLTA 1C5CH 3WFZA 5DD3L 3RWEB 1C5BL 1XR9A 4U1HB 1NBQA 1LVEA 4HT1L 2Q8BH 4OGYL 4UDTB 1PJ9A 3VRJB 4OCWL 4LSUH 1H0DA 5IB2B 4QRPD 5A16A 5HVHC 4KXZI 4YXKH 5HHQA 2R1WA 3N1QC 5C2BL 4Y2DA 3UO1H 5TF1H 3P0VL 4HX1A 4NWUL 4EI5D 4G80B 3D3VD 5GRJL 2EYTB 3V4VL 1BZ9A 4MQ7B 3OB8A 4NC0B 1A6AA 2Z93B 4X9FA 2DQDL 1N5AA 5CLTA 4MD4B 4TUJB 5I8KL 1TETH 1BFVL 4GW5B 5I71B 3WNOA 4NO2B 4WI5A 5FYLL 5IQ7L 4HH8A 3SO3C 3O6FA 4NJAL 3TV3H 5HPMB 5JLZA 3AM8C 1HKLH 5F1IA 3RPKA 4PJDB 3WIHH 5LVEA 3RZCB 3SKJL 5KW9H 2HKFH 4GSDL 1P4BL 4DN3H 4GKOA 4XVJH 5ICXB 5FO8A 4RWYL 2O61B 5A3ID 2IQ9H 4IM8A 1MJ8L 3EZJB 1H3PL 3QDJD 5ISZE 1KF9B 1EFXA 1HDMA 1KBGH 4WTZG 2BNQB 5EC1A 1HH6B 3NFSH 4KJWD 4Z0BH 3NFNB 1MCJA 2R2EB 5HDQL 3VXUB 1D5MB 1MREL 2VLKB 2Z31D 5EN2B 1ETZB 4KI5E 1JJUA 1A7OH 1MY5A 1TITA 4AMKL 1SYSA 4KKAC 4QHKI 1CL7H 4O5LH 2EEBA 1MIMH 7FABH 3QFJB 3WO4C 1CYGA 2ZP0T 4YZFE 4R96B 3TN0B 3WN5B 3VGHA 4LSVH 3QA3B 3F62A 2NY6B 1U8JB 3H42H 5F89A 5E94A 2AS5M 1YY9D 3ZE0F 3QIBC 2DQUH 3PWPE 2X5PA 4Z7VE 5A2JH 3NIDF 2V7HA 1T4KA 2BVQA 4WENB 3QDGE 2Z31A 1OP5H 3PJSB 3O3UN 4KMLB 1X5FA 1YNTB 1FGNL 1H3UA 2FNBA 3EHBC 3MLPA 5KTEL 5DD3H 5JORB 1C5BH 1XZ0A 1MFCH 3MLXL 4BZ1H 1U3HD 1I7ZB 4HT1H 3VFRB 4OGYH 1IEBA 1NAML 1BBJA 4IOSD 2C4FU 1TPXB 3GJFB 4IRSC 4P5KB 4OCWH 2JJTC 2VQ1A 1DE4A 3KPOB 2GIYA 5C2BH 3C5SB 3T2OA 4CMMA 3P0VH 4NWUH 5GRJH 5DQJB 5C0ND 1EAPA 3V4VH 3PWVB 2N4IA 4JZJB 2XWJA 4GG6B 4F37K 5KVMC 3KLSA 3HMWL 4OLVH 4QRRA 5CD3B 1BFVH 2R9HC 3ECBA 4BQBA 5FYLH 5IQ7H 5CBEB 5DDHB 4BQ8A 4NJAH 5CLWA 2DJ4A 4QTHB 4PJCA 1FVEA 5I1HL 4NQED 3SKJH 3TO2B 3MRDA 2HG5B 2IPKB 1P4BH 4GSDH 4LLMB 2YWZA 4IJ3C 1VFBB 3JTSA 5C6PB 5MERB 3ARZA 2VH5L 5F7MC 3O9WC 4RWYH 5D5MA 2MCG1 2VITB 3HG1A 3ET9F 1H3PH 2X4OB 4OCNC 2WIIB 5GS2D 4OGXL 3PV6A 43CAB 5A2LH 1SJEA 3OV6A 3P3YA 3MR9A 4LNRB 5HDQH 5HYJD 2HN7B 2FRGP 1MREH 2QADD 3I02B 5AG8A 4DQOL 1G7HA 4HW6A 3WLBB 1IAKA 3BPOC 4AMKH 1I7UA 4ZUTB 1TVHA 5IFHL 3V4PL 5FCUL 3VH8A 3WE6B 3O3EA 3IAPA 2UWEA 4KWUA 1P5UA 4OAWA 4O00A 4Y88A 1FL6B 2MOVA 2E27L 3GSQA 4ODUB 1TQBC 1GZQB 3RWCA 1G7LB 1VFOA 5L8JB 3RUGB 3IVKA 1G7JA 3MV7B 1DBKH 2VZ1A 4R3SA 2H41A 1OTSC 2BOCA 4R7DA 2RIKA 5HYJA 1QOKA 1WV7T 3GB7B 2RFXA 2VYRE 4P57B 1FG2B 5EH1A 4KROD 1PLGL 3IDUA 3U0TA 1OD7A 4YHNA 2R23B 2IPUK 3EYQD 3HKFA 1FGNH 1S7WA 3MRGA 2YPKB 2F8VA 1HHIA 5C08D 1IM9D 1IGFL 3DO7A 1B4JH 1U8QA 3BHBB 5D5MF 5C0CA 1GZPB 4YHPA 3FZUD 4OGAC 2MHAA 3FFCB 1AGFA 4HK0A 3RWHB 4ORZC 4YHIA 4ZFOL 3DYPA 1A6ZA 3T0EE 4JRXD 3LKOA 1Y0LA 1FIGL 1S7UA 3VGGA 3BPCB 1JNLL 3MLUH 3VCLA 3GSUA 4BSWB 3L3DA 1W0WA 3I6KA 1FO0B 4AZ8A 1U8PA 4AENA 5JW5B 1NUFA 1RURL 2ADJA 4GW1A 3HMWH 2PTTB 5L88H 5SWSB 2X44D 4K23L 2GI7A 4QKXB 4WWKA 1IM9A 2IALA 1QEWB 2UWEF 2W65A 4AT6A 1PKQB 1GOFA 3CK0L 5I1HH 1I9EA 3QEGL 3ULVF 2WWKO 5JW4Q 2FECL 1P1ZB 4IMKC 3L7EA 2AQ2A 1CD8A 2DS4A 1JN6B 4KKNA 2ADIB 3QEHA 2NY2D 2YBRA 5FCSH 4OFKA 4ZNEA 4OGXH 1KJ2A 2HKHL 3VGBA 1P9MC 5L7XL 3FO2B 1IILE 3AUVA 3SDDC 4FMFA 5D6CB 5FA4B 3PHQB 4DKDC 3QI9D 1QSFD 2NY5C 4GS7C 1NFDE 3LHPL 4DQOH 1FPTL 1AP2B 1R3HA 1ZHKA 5IFHH 3V4PH 2WBKA 2P7TB 2ZNWA 3JUYA 3RWGB 5D93B 3KYNA 5C3TA 3P9MA 4GRLD 1YMMD 2E27H 3RWJA 1W0YT 1BZ7A 2NY4C 1LNUB 3D48R 3I6GA 3QNZA 1KNOB 1K4DA 3QI9A 4LARL 1QSFA 1MHEA 2HT3D 2ZUQB 4O58L 5JMOC 3B9VA 3WJLA 2CDFA 5L2KB 4F7CA 3GMRB 3OAZK 1CZ8L 1PLGH 1D5IL 3CX5K 2EYSB 1OSZB 4XH2A 1CFNA 5I16A 1J0KA 3DUSB 3JVGC 1IGFH 1P7KA 2IBZX 5SWZA 1F4XL 2R0ZL 4JFEA 3TNNB 3SGEI 5T1DL 3D0LA 1FIGH 2OTWA 3G6JF 1KLGA 1RZIA 4ZG1A 1JNLH 1HSBB 5FO7A 3SQBA 1WJ3A 1D9KB 1W72L 1AJ7L 2XOTA 3QZWA 4P4KC 3IDMA 1PYWB 5M94B 1NGWB 5EDXA 5L2JA 1RURH 1ZGLB 3C5ZD 4DUVA 2CKBB 3PF2A 4P5TB 4K23H 5E8OB 3O41B 3MLRL 1C7SA 1BQHA 3BISA 3FAWA 2XZCL 3QEGH 4XVUC 1Q94B 3H9SB 4L4TD 4HLZH 3UBXA 3KR3L 3OGCA 4QRQA 3L7FA 4XP5L 5IW1B 3FT2A 5C0GA 5JA8B 2VB5A 2EDXA 1KIQA 2N1KA 3NN8A 3WFHB 4MMXC 2DMCA 2DQFA 4PJ5A 2HKHH 3LKQA 1NUNB 2FR4B 4L8BB 1T1ZA 1INQA 3C5ZA 2J1KA 4QTIL 3QIUB 5JNYB 4KXZH 2W9DL 3QUYB 1FORL 2ZG2A 3C8KA 3LHPH 4Q97A 1FPTH 3KXFA 3QUZB 3QIWA 3GJFK 5C7XL 3I9GL 3DRQB 3P73A 5FDWA 3WXVL 1IJ9A 4L4TA 4Y19E 2GYSA 3G5XB 5TQ2L 4BH8B 3RZCC 3QFDB 2H2PD 4H88L 1CU4L 2WUCL 2R39A 3CUPA 4KJPD 3W9DB 4YGVA 4U7MA 3OXRB 5F7WC 5HHXL 3BKML 5D96C 1LEKA 4OD3L 2DKSA 3X13B 4LARH 2VXSL 4YUEL 4R26L 4O58H 2EC9T 5IM7A 1HOCA 5E8PA 5ALCL 1FAIL 4N1CA 1CZ8H 4WU5A 1D5IH 2NW3A 1FO0H 4Z7OF 5ISZD 1EEYA 4W4NA 3VD4A 4K71B 5B3JF 5HHQB 2C1PA 4J3OC 1PG7H 4PJ9C 4CVWA 1MRFL 4Y2DB 1QR1B 4C83A 4P5MB 4HX1B 1F4XH 1AGCA 2OR9L 2R0ZH 3GSXA 1N5AB 5T1DH 5KVFL 2LVCA 4KI5D 2I9TA 5T1LB 3VXTA 4QRUA 5J3HC 3MBEC 3LSOB 5JLZB 2NY6C 1W72H 3ZHLA 1AJ7H 5F1IB 5GS0C 2E6QA 2UUDH 1MFBL 4D9RE 4GW4A 4S2SA 5JW4M 4QRPB 5FO8B 2M8XA 3MRNA 3PWPD 3OBAA 4OCSL 3MLRH 4TULL 1SBSL 3QO0A 1B0GA 4EI5B 3D3VB 3ILQC 2XZCH 3MV8E 1RPQA 2APFA 3QDGD 1WWBX 3KR3H 4XP5H 4WW1B 1UADC 3ETBF 1N5YL 1F11B 5FM5O 5K9OA 3B6SB 4LDLB 1SYVA 5E1HB 2Y5EA 5AWNL 5FHBL 3V6ZA 4DCQB 1U42A 1DQLL 2NNAB 4PLJC 3C60D 2HYMA 1VADB 2LU7A 3CVIL 1SYSB 2R56L 2EYRA 4M4PA 4QTIH 5IKCA 3WCYA 2W9DH 3IXAA 1YDPB 1FORH 4JQXA 2J8UA 1FFPA 3OX8A 3AROA 1F2XK 3I9GH 3QDJB 5E94B 5HHNB 5C7XH 4IMLB 4GRWH 1ZANL 3WXVH 2UY7A 3JXAA 3EYUL 1ITCA 3FN3A 1VFUA 1EJ6A 3SO5A 5MEOB 3VXMA 1NH6A 4PJFB 2V7HB 1UKSA 1ORQA 1T4KB 3F7QA 1MVFA 2WUCH 1CU4H 2Z31B 1HHGA 1EEZB 1FC2D 1GPOL 4XNQA 2H2SC 3RKDD 1DANU 3MUGA 3ESUF 1DVFA 3JV4A 5HHXH 4LU5L 3BKMH 4JFYA 4OD3H 3K46A 3F7PC 5J6HB 4P3DA 5J9PB 2VXSH 4YUEH 4R26H 1QUNA 3LS4H 4I2XE 5ALCH 1FAIH 4KVCL 3I75B 5CWSA 4P2QA 2VQ1B 4NZRH 2PW2B 4M9OA 3PHSA 1MRFH 4C56E 4CMMB 1X6NA 1FNGA 2W91A 2OR9H 5KAQG 1Z5LB 2F54E 5KVFH 1QRND 3LOWA 2VDPL 2NR6C 4PREA 4QRRB 1W8OA 4TNWK 4L8CA 1AIFA 2QKIA 5FYJD 4Z0XB 4S1RL 3WLWC 1U3HB 4LLDA 2M2DA 4ODSH 4PJCB 2P45B 5C0EB 5EC2A 4Y4KA 1FVEB 3WL9A 4NO3A 4DN4H 1Y6KR 3MRDB 4ZUWB 1MFBH 2XTLA 2AK1L 4WWID 1QO3A 4JRYE 3QXAB 2IGFL 3N50A 1RK0B 4FQ2L 4OCSH 3VDAA 4TULH 1SBSH 2DBLL 4XBEL 3BQUD 4GAGL 1Z0NA 1T83A 4RMSA 2IFFL 3PV6B 3QR2A 4HBQA 4P2OD 4R90L 3ROOA 3IF1A 4KK9D 4LAQL 1E4XI 1P4LA 3HE6C 3CFIC 2JK5A 3SJVA 3BP7A 3FB5B 3V6FA 4ZMAT 2Z91A 3MROA 1ADQA 4NJ9L 5FHBH 1ZOXA 5HYEA 1VFAB 4YEFA 1DQLH 1N8ZB 1UH3A 2WW8A 1NDMA 4NQEB 3MZGB 1TVHB 2R56H 4EDXB 1KTKE 4G6ML 3V7MA 3T0ED 3VH8B 4ZPVA 2I60L 1AH1A 4NWTL 5IIEA 1SJXA 3O3DA 3PIQA 3MGTA 1RIVL 4OAWB 1QA9B 5C9JA 2N7AA 4I0KA 5ANMA 3Q0HA 4HJJH 1NAMA 1ZANH 1BF2A 3EO1A 4P2OA 3RY6A 3SBWA 3EYUH 3IVKB 5A2IH 1NBVL 4OZ4A 1Q0XL 4HIEB 5HYJB 1IGCL 2BOCB 4R7DB 2PETA 1I9RH 2QADB 2YSSA 2YRZA 5DK2A 1OTTC 2HTKD 3MCLL 2HFEA 4JPIA 3U0TB 1P84K 3GSRB 4RMTA 2WUBL 1ZKAA 3C6LA 4LU5H 3MRGB 1M05A 1WVZA 4PTUB 1KPRB 1RZJC 3DO7B 2NY1D 1U8QB 2CK2A 5C0CB 3KYOA 2V9TA 4Y1AE 5HYSA 4KVCH 5D7LE 1AGFB 2AAVA 2PYFB 5I75C 4NT6B 3K8MA 4E41D 1WBYB 4PLNC 2YC1A 1MCHA 1S7UB 1Y6MR 2NY0D 3G6AB 3VCLB 1U8NA 1ONQA 5DC0A 3GSUB 1E4KA 1JMXA 4PJAE 3UYOD 3LV3A 3E0GA 3I6KB 3KLAA 5DRNA 1U8PB 1P5VA 3RTQC 2EC8A 4KROB 4NRXA 4GW1B 3OAUL 4YC2C 2VDPH 3TBWB 4M7ZC 1GRWA 1BLNA 1ZLSH 3DI3B 3ZT7A 1KPUA 2JCCA 1IM9B 4S1RH 5C08B 5FGCB 4MCZA 3S88L 3CH1A 5LQBL 5C0BD 1WWCA 4AT6B 1KTDB 2AK1H 2UVEA 2OYPA 1D5BA 4OCRL 4S1DD 3P9LB 4JRXB 2IGFH 1J88A 2J7LA 4WY7L 4PV8A 4DUWA 4FQ2H 2DBLH 2YBRB 4XBEH 3ZTJH 2VABA 2RQ8A 4GG8B 5CJOL 1EXUA 1T2QH 2IFFH 1MWAA 4IS6B 4LAQH 3PE9A 1H8OA 2F5BL 5EBGA 2EEAA 3L3IA 4MJ6A 4PD4J 1FLTX 5E99L 2F15A 4F9LA 5CZVL 4J4PA 4NJ9H 2VLRE 4GKZB 1ERNA 1ZHKB 2CIIB 4TTDC 5C0BA 3V5KB 4PGJA 3RBSA 1DBAL 1KEML 5GGQL 5IJKA 3TPUB 3HRZB 4G6MH 3D2UD 5F96L 3SGEH 2EE9A 3KYNB 2I60H 4NWTH 3S7GA 5CHNA 3ULUE 1RIVH 4Y5XC 2NY2B 1G7MA 5GHWL 5JQHC 1N59A 4LPVA 1BZ7B 3BJLA 1M4KA 4NO5B 4ZFOA 1NBVH 3VRLE 5CP7B 3QHFL 1N64L 5BQ7A 3NPSB 5FEBA 3IB4A 2EE6A 2FJGA 4U1JB 4Y4FA 3IDGA 2PO6C 3V6OC 3QI9B 2JCCF 1QSFB 1G9NL 3D25A 4OJFL 3KPPA 3OJVC 1RIUH 2CDFB 1CGVA 1XH3B 3MCLH 3Q5OA 2OMBA 2CJUL 3L3OA 3BSZL 5T1KD 5I16B 2Q8AL 2GY5A 1EDQA 3PQYA 1P7KB 2LU3A 3D2UA 5SWZB 3SDCC 2C3HA 2X4TB 3BP6A 4GRLB 5D4QA 1YMMB 4JZOB 3MRBA 2FATL 3EYOA 3TJEL 2OTWB 4EUPB 1HHHA 3LRHA 3MOBL 1KLGB 1HYSD 1X5KA 4N9GA 1WIUA 2CDEA 5FO7B 3JWDL 4M6OL 4HSQA 4Q2ZA 2I07B 4U1SA 5HD8D 4LFHD 3IDMB 4Q6IC 1KULA 1I8KB 3OAUH 5DD6A 4HUVA 2IAMC 4FQPA 1PEZA 4Y19D 4LRIA 3S88H 3AU1B 1D5XA 1S7RB 1I1AA 4HPYL 1JZ5A 4LQ1A 4NQUA 5DI8B 2AP2A 5B8CB 3C08H 4MXQD 3GBLA 2VAAA 4N8VB 4OCRH 3LKSA 2WZPD 5E6ZA 4QRQB 4PRDB 4WY7H 3L7FB 3FB8B 3FT2B 3KNBA 3V0WL 5C0GB 1AXSA 1DR9A 2VZSA 3NN8B 2A1WL 5GISL 5CJOH 2DQFB 3DBXA 3U46B 3LKQB 2ZUVA 3CU7A 1NGQL 1T7YA 4K71C 1T1ZB 4N0YL 2PYEE 4X6CB 2F5BH 3C5ZB 5E99H 3RA7L 5CZVH 4MAYA 1OWRM 3C8KB 1OGAE 4LK4A 3QIWB 4OZFB 4D8PA 4DEPC 4LSDA 4XNMA 1NC4A 1LO3L 1DBAH 1N2RA 5FDWB 1KEMH 3GMQA 5GGQH 4L4TB 1YJDL 5F96H 3O6FC 1BX2B 4LLVB 3K8LA 1YEFH 2ZCLL 4QHNA 5MI0B 2CUIA 4JY4A 4LBEB 1KEGL 1G9EA 5IG7A 1ES0A 3QHFH 1DLFL 1N64H 4QHKJ 1LEKB 3CSGA 4D9RD 1AQDB 4BZ2L 1G9NH 2W59A 4MJ2A 4Z76B 2VDML 3LQZA 2BC4A 2IH1B 5FAAA 4ZYKB 5E8PB 2ENYA 4WU5B 3RWDB 3ZSSA 1W72A 2CJUH 1SEQL 3BSZH 1EEYB 2A77L 3MV8D 1I8MA 5JHDE 2Q8AH 2C1PB 4JY5L 3E8UH 1E4XL 4C83B 1AGCB 2VERN 4X9GA 3UJJL 2F58L 1U9KA 3GSXB 3I6LD 2FATH 4LKCB 3TJEH 3G5YA 3MOBH 1TFHA 3VXTB 2LABA 3OXSA 5IVXE 1A7QL 3UAJD 4QRUB 4W81A 4V1DA 2EKJA 3JWDH 4M6OH 4PJ8A 2F74A 5C86A 4XWOD 3PHOB 1UACH 1UQSA 3H8NA 1U8KA 4HKZB 5KVGL 4S2SB 5ISZB 3BPNB 5BS0D 1XF4A 1A6TB 4X5XA 2DL2A 3BDBA 1RZ8A 3VWKD 1N4XL 1ZS8A 1OCWL 4JREC 4OD2A 5A2KH 2GY7B 4F58L 4G9DB 1NEUA 1AGDA 3BZFB 3LCYA 4Y4HC 4F80A 4NFCA 3V0WH 2QLVB 1HHKA 3FT4A 1TCRA 5K9OB 2YMXL 5GISH 4G6KH 3V6ZB 4HCRL 1NGQH 2Q6WB 4YPGA 4N0YH 1IC7H 2GJ6A 1FNFA 2HFGL 4HWZA 2EYRB 3RA7H 5IKCB 2E7LA 1S7QA 2JLLA 3IXAB 1JUFB 2J8UB 3PWPB 4P23D 1FFPB 1JTTA 3KJ6L 4NZUL 4Z7VB 3OX8B 5F7DA 4JKMA 1LO3H 1RUKL 4QOKA 5M7QA 2F54D 1YJDH 3PXJA 4UMGA 1ZLVK 3MNZA 1ORQB 4JY6B 3D85A 2RHEA 3QUMA 1HHGB 1NUDA 2YD5A 4C54A 4XNQB 2LAGB 2W0LA 5BV7L 3MCKB 5I2IA 4NQCA 3MUGB 1URLA 3UP1A 3MNVB 1DLFH 4JFYB 5FYKU 4EUPH 4WFGD 1S8DA 4JRYD 5IBLC 4UT9L 2NYYD 1RZGB 4P3DB 2F53A 4DFHA 4BZ2H 2VDMH 1L0XA 4P23A 3WS6A 3VW3H 3GM8A 3DVIA 3E6HA 4N0UA 2A77H 4PJXE 3T0DA 1N26A 4Y5VA 5KSUB 4JY5H 1A8JH 4GRWF 1E4XH 3O2DH 4JANB 4TNVK 1OGTA 3UJJH 3CFEB 4G8EA 2F58H 5GQBA 1KJVA 4NQXA 1JZ2A 1UWEL 4NNPH 4X7EC 5IMOA 5ID1A 2GSGB 3ZKXB 4PREB 2OTUA 4Z95L 3VXOA 1A7QH 1RK1A 2PTVA 5GRWA 5T1MA 2CQVA 2BHZA 4LLDB 4G9FA 3ULVC 5H35A 4IDJL 3WL9B 3U4AA 5KVGH 1YEHL 1QO3B 1TQCC 4LF3A 1MHHA 3RVTC 4LVNB 1YEDA 1CDHA 1YPZE 2CD0A 5FO9A 5FXCH 5HGHA 1N4XH 3IDYB 1YMHA 2D7NA 4FABL 1OCWH 3C9NA 2J6EA 4F58H 3IF1B 3S8WA 4K8RD 1QZ1A 1QRNB 3TYGL 4AIZA 5AYUL 2GQHA 3BP7B 3V6FB 2YMXH 3N0PB 4RRPG 4ZXBD 4XCEA 3F12B 4HCRH 1YECL 3WDIA 4EOWL 5JDJA 1FNSL 2HFGH 1IM3B 2J2ZA 4P4RA 3S3PA 4D9QD 5JXAL 1RZFH 3VGDA 3BMWA 4MQTB 4XI5C 3TCLA 3KJ6H 4NZUH 4PG9B 5C9JB 3BQUB 4LQFL 2V9RA 3O8XA 5ANMB 3EO1B 1DBBL 1QFPA 4P2OB 3EGSA 1J0ZA 5F7HA 3A6CL 4WWKC 1B88A 5HGGS 3STZA 4N8PA 4XWGL 3QEQA 4ONGL 4NPYA 3MUHL 2YSSB 1NMCB 1S7SA 4LCCA 1SMOA 3KLHC 3AS0A 5BV7H 1MUJB 3W0WA 3OF6D 1Z9OA 2CDGA 4JZNB 3I2CL 2P24A 2QTEA 2MFNA 4J3TA 1UGNA 3M1BB 1WCBB 4UT9H 2D7MA 1QQDB 4Y8DC 5DHVH 5DJXA 3T0EB 3CDFA 3BD3A 1K4CA 1U8IA 2ZG3A 4WTXA 5IVOA 1VENA 2YC1B 2NW2A 2QQNH 3PWNA 4J8RB 3U9UB 4ELKB 4BA8A 3MFFA 5HI3C 3WMSA 1IGJB 3LV3B 4EQ2A 1UWEH 2GFBA 3ZDZE 2VLRD 3H7BA 5ACLA 1FFNB 3GSNA 1II4E 5F7NC 1ZEAL 1P4IL 1EA9C 4Z95H 2G5BA 3PL6A 4MCZB 3FQWA 4HIIA 2APWA 3LIZL 2G2RA 2NY1B 3VFVA 5IUSA 4IDJH 3WS3A 2CR6A 3MRHB 3PWJB 4E41B 2JB5L 4M3JA 4I4WA 4UOW1 4ALAL 4PV8B 2NY0B 3LDBC 3QJHA 4UNTA 5DJ0A 4IOIA 3WJLC 2VABB 2C26A 4FABH 4FQCL 3MRCA 1EXUB 3LN5B 4OIBA 1HI6A 3ALWA 1MWAB 4GAYB 3TYGH 1KN2L 1Y18B 2AJZB 3L3IB 5F8RC 5AYUH 1HXYB 2EC9U 4JKPH 2D0GA 4Y5YB 2Z4QB 1OM3L 2BSSA 3S97C 1MLBA 5KS9A 2R2CA 5C0BB 1YECH 4GQ9L 4OF6A 4YIQA 4EOWH 1R5WB 2EIDA 1FNSH 3TEUA 4OF7A 1SM3L 4B0MM 5JXAH 2E5EA 3HAEA 2GK0A 4XPBH 2J5LC 1J1PL 4LQFH 1G7MB 3OB0H 3IT8D 3ES6B 4NN5C 4D0BA 5GZND 1DBBH 4CJ0A 4PRPE 3A6CH 1T2XA 2DIJA 4KHTL 3BKJL 3K1DA 4P46D 2FJGB 1BIIB 3AS2A 4XWGH 5C09E 4ONGH 5B38B 2X1QA 5C0RL 1J7VR 5EOCH 5DFVD 2ED9A 4IRJD 1FNEA 3BOVA 3HRPA 1JE6A 1Q9WB 3L3OB 5IEHB 3I2CH 5HYFA 3GMOA 5C3LD 3HUJE 4LDEB 3D2UB 5I1KL 3AGVA 4JHAL 1CFQA 1J0YA 3EIFA 5DA4A 3BP6B 3WV0A 3KPLB 3C6SA 2YRLA 4ZFZB 3L1OL 5F71A 3EYOB 3MOAH 1NGZA 4MXWL 4KGLA 2CDEB 3NAAL 3QIWC 2GTZB 2AJ3A 5B39B 4J2XA 2WWKT 4HV8B 1YEGL 5KS9F 5CAYB 4IRJA 1OGAD 1H3GA 3U30B 3ARGD 3GSVA 4ODBD 1ZEAH 3VFUA 4LCYB 3WIFA 5T1KB 4X5WA 1H3WM 1HZHL 2PW1A 3B9KD 1D5XB 3LIZH 4U1MB 1VEMA 5DSCB 4LASL 1CBVL 1ZHBA 3IKKA 2OP4L 2JB5H 3LKSB 3TC9A 4ALAH 4JFDE 4NN7B 2D7OA 3R1GL 2P5EE 4MHHG 2Q76B 5D8JL 3N1PC 4ZSOE 3MXWL 4B7IA 3IKCA 1SJVA 4R4FL 3B83A 4YEEA 4UIMA 2FBJL 4ZAKA 5EZLA 1KN2H 4JQVA 2X4UA 3BH8A 2VZUA 5JHDD 3IYLW 5D1XD 5BO1L 4Y19B 1IMHC 1LO0H 1OM3H 3ZE2E 3CZFB 1IKNA 1QFUL 4L8DA 2GKIA 4GQ9H 1QLFA 1N2RB 2HWZL 4N5ED 3WXWL 2A83A 2ADGA 4WFFE 4TUKL 4CL7A 5J13C 1J1PH 5TE7L 4IDLA 5AG9A 1CD0A 2R1XA 3VDBA 1CGWA 5IG7B 3I3BA 2IADB 4KHTH 3BKJH 5BZDA 3C2SA 1GIGH 5ADOL 4I18A 3TO4C 3FRUA 5HGAA 1FYTE 3OJ2C 5SWQB 5C0RH 3G5VB 3SGJA 3KPQB 5D1ZC 3DX7A 3EJJX 4WW2B 3GKWL 3BIKB 5T3XL 1ZSDB 4NZTL 3B2UC 4KPHL 2HFFA 4CKVX 4JHAH 3GIZL 4QYOA 2F8XC 2A74A 4Y8AA 4PPTA 1KLUA 1WT5A 1NCWH 4X0KA 2FHBA 3AMLA 4RFNC 2OJEA 2IQAB 3L1OH 4LVOB 2VR5A 1I1YB 3LQAL 4NYLA 3OXSB 3CNKA 4MXWH 2GTWB 2I25N 4V1DB 1LP9F 2F74B 3P4LA 1RZKL 1Q1JL 4NFDA 1NCDL 3CC5A 4P2RD 4WFEE 1YEGH 3WHE1 5B21A 2XKUA 1U8KB 2H1PL 3NOIA 3V79C 3MV8B 1KPVA 1XF4B 3MREA 2OLDA 1HZHH 3EOAA 1RZ8B 5IK3A 3VXSA 4Z9KB 3CSYA 1DSFL 2EDFA 1X7QB 1DVFC 1CDYA 3MRJA 1CBVH 2OP4H 3MBXL 1MLCB 4BFEA 2HT4C 3OKOA 1F13A 5HI4C 1EV2E 3R1GH 1HHKB 3FT4B 1TCRB 3QEUA 3P77A 5D8JH 5CGMA 3QNXA 5IB4B 3MXWH 3Q3GA 4P2RA 1BVLA 4R4FH 4YPGB 1YY8A 4XCCL 1FSKC 2FBJH 2WAHA 5DD1L 3BEWB 3UC0L 5BS0B 1S7QB 3BIBX 4UAOC 4CADB 3UEZA 3PGCB 5BO1H 4EN3A 3U9PL 3VWKB 4FXKA 5F7DB 1QFUH 2W0FA 3GDBA 5ITFA 3ZKXC 2HWZH 3WXWH 4BQCA 4MMZC 3RNKA 2X70B 5J12B 1TTUA 1NC2D 3MNZB 4Y4KC 3QRFM 4B53A 1H9VA 5TE7H 4M93B 3QUMB 3VXRE 4QHUB 5I9QC 4EQ3A 3OAYH 5I2IB 5EO9B 4LLUA 1MFAL 5ADOH 5KZCD 5F88B 1QFWM 1F3DH 4HF5L 2C1OA 3GHBL 1UZ8B 1ZVYA 3AXLB 4JFQB 5H37H 3BEVA 1EO7A 1A6UL 2QR0A 4P23B 2OSLA 1I8LA 1RU9L 1UZ6F 3E6HB 3GKWH 4N0UB 2ZPKL 5T3XH 2VXUL 4NZTH 4KJYA 4I3RL 1I7TB 1MAKA 3K2MC 3FTGB 2F54B 4KPHH 4PJHE 4ZPTA 3ARFA 5CILL 1YQ2A 3GIZH 2CH8A 1NC2A 3MOQA 4HHAB 4A6YL 2GK2A 1KJVB 2EDDA 3MMEA 1UH4A 5IMOB 1S3KL 3LQAH 5ID1B 3QPXL 4CAGA 3FO9A 1FRGH 1XIWA 3TBVA 4I3SL 3QJFB 5D7KE 4JRYB 4HBCL 5T1MB 3TA3D 3A0OA 4G9FB 1RZKH 5DQDH 1Q1JH 5H35B 1NCDH 3RY6C 3SBWC 1WEJL 1VEPA 2H1PH 2NXZD 3RY4A 1KTLA 3QDHA 1B6DA 3U4EB 4HCRA 1T7WA 1YEDB 3RGVA 1BVZA 4XB7A 2ZUXA 5A1AA 4PJEE 5FO9B 3ZDYE 4HJGB 4OQTL 3GMMA 4R4BB 5HBBA 4YK4B 4AH2A 1HWGB 1DSFH 3DX9A 1GXEA 2FO1A 4NM8L 4JCLA 4FQJL 3C6LC 1HCVA 3C9NB 3IFLL 3LKPB 3FONB 1CFVL 2O5ZL 2X9XA 1DTUA 2HMID 4AIZB 4LEOB 5C8JA 1QYGL 3WEXB 1FHGA 2ITDB 4G8GD 4GLRI 5C0AA 3UTTD 3T1FB 3KJ4C 1F5WA 5I73B 1XFPA 2DDQL 2W0KA 4XCCH 3HC4L 4OKDA 3F6IA 3NIFF 5DD1H 2DRUA 3REVA 3SGKA 5E00A 3UC0H 1E4KC 5E5MA 3U9PH 1CCZA 4GAFB 4APQA 4KTEL 5FKPA 4HS6A 2XRAL 4CUCA 4WNQA 4P2YA 3GMPB 1LO4L 4LAJH 4YXHL 3FO0L 4RCAA 1A4JB 3BFOA 1JMZA 4JVUA 4ELMB 4NPYB 3D69B 3S9DB 4G8GA 4J1UA 1PX4A 4ZXBB 4UTBL 3UTTA 3V5HB 3MRMA 2XNAB 1OL0A 1WZ1L 3T3MF 2KL6A 1FJ1B 3TESA 1CGYA 2P24B 1MFAH 4QNPE 4HF5H 3GHBH 5DJ2A 5TFSL 2JELL 1A6UH 4ZUVB 1AGEA 15C8L 4D0DA 1K4CB 1U8IB 2FZ3A 5E03A 1QG3A 1RU9H 4HS8L 2ZPKH 4PJAB 2VXUH 1EX0A 4I3RH 4F9LC 3VFWB 2J12B 2CRYA 5CILH 4I1NB 4J4PC 1UM4H 4GRMB 4JFFE 4O2CA 4LLWA 4A6YH 1MVUA 2F9BT 5DEFB 3EDEA 2GFBB 1CD9B 1S3KH 2CUHA 2UZIL 3H7BB 3GSNB 2IFGA 4LSPL 2FBOJ 3QPXH 4FQQB 2VR9A 4OD1L 4YHYB 4I48A 4I3SH 3PL6B 1IC5L 3BP4A 3QUKB 2YZ1A 4HBCH 3SCMC 3FQWB 3C5JA 4HIIB 1BJMA 3MRIB 2FHFA 2OL3B 1WEJH 3MLVH 3O3BA 1JGDB 5GGTL 4Y4FC 1JPGB 4I4WB 5FUCC 5JOFA 2ICWB 4GAJL 1T04B 1MCQA 1UB6A 4JEGB 1S9WA 4IOIB 4OQTH 2WBWB 3E3QC 4UUJB 2NLJA 4NM8H 2CRZA 4FQJH 3IFLH 4JFHE 4H0IA 2VLRB 4ZTPL 4CNIB 1CFVH 2ID5A 1TZIA 4WU7A 3LN4A 1RJZB 4K8RL 3OKMB 3RPIB 1UA6H 4U1LA 5KS9B 5E8DL 4KI5F 5HSFA 4LKXB 3WYRA 2X40A 1FL5B 2DDQH 1A1OB 3HC4H 1UYWL 2XT1B 2EKSA 2DKMA 2XTJD 1M7XA 3H9HB 2OJZL 3E2HB 4BUGA 4F3FB 5D9SA 3HAEB 2V17L 4KTEH 5E4IA 3U79A 5A43C 2V2TA 2YA0A 5CJ8A 4D0BB 1LO4H 2NXYC 4WHYG 1VSCA 3FO0H 4GKNB 1FE8H 1HNGA 4KK8C 1I1AC 4MB4A 3T4YA 2DD8L 3R8QA 4UTBH 3U0PB 5GS3A 1DJSA 3DRTB 3DGCR 1WZ1H 3DOSA 3FOMA 5C70A 2GT9B 1Z6JT 1JYXA 2Y1VA 5EBLA 4U7SA 4B50A 2FSEA 5TFSH 2JELH 4JFDD 5DJYB 15C8H 3NPZB 3NA9L 4DGVL 1U8OA 1AE6H 2X1WL 3C6SB 3KAAA 4LCIL 4BFGA 5J4MA 4HS8H 1Z2KA 3HHRB 1VACA 1FZKA 5TE6L 4K9EL 4MAYC 1W0VB 3QDME 4P46B 2VUYA 1FNHA 3MRKA 2HVKA 1S7VA 5JMRA 1JWUA 2UZYB 4PJBE 2UZIH 4IRJB 1AKJA 3GSVB 4LSPH 1RVFL 4OD1H 3BIAX 2Y6SD 3IAQA 1IC5H 4X5WB 1HH9A 4IRZL 2PW1B 3UYPA 3MRRA 4WFFD 2A38A 5CUSL 2E9JA 1ORSA 1CXEA 2WMPA 1WSST 3ULUL 1LO5B 4HK3J 5FDYA 3QWRD 1XGYL 5GGTH 1YUHB 5JZ7D 3OKLB 2B5IB 4GAJH 3NZ8A 5D1QA 5GPRA 4MNQA 4NUJB 2DLHA 2H8PB 1FFQA 4JFOA 1IGYA 4HWEL 4XNXH 1OGAB 5ENWB 1CIUA 4ZAKB 2O26U 2X4UB 4K8RH 2PKDA 2IANE 4YBLC 4U1GC 5E9DD 4GBXD 1IBGL 3B9KB 4QHLB 5E8DH 1PDKA 1JHKL 1PVHA 3CXHK 3NIGF 4KKLC 3CH8A 1O7VA 1UYWH 1CDBA 5JPNA 3C09B 5FB8A 1EMTL 4PJ8C 2A83B 2ADGB 2OJZH 5FIEA 2G60L 5DEGA 3K1KC 5IHZA 4UV7H 3BGAA 4NHCL 1INEL 2WM0A 1KOAA 3GM0A 1AC6A 1D3CA 2ATKA 4XPHL 2A6IA 3K7UA 3WNNA 3LEVH 4AEHL 1V5JA 2YOCA 5GIRA 3I85A 1E0OB 5BZDB 2R8SL 5DVMA 3KPRD 5DK0B 5JHDB 3FRUB 5D1XB 5HGAB 3UZVB 4HAFA 1NGYA 4HKBA 2QQQA 1N6QL 5JDSA 5IB3A 4U6TA 2B2XL 1JYNA 3SOBL 5CZXD 1A7NL 2WQ8A 3DX7B 5C0JA 2A9NL 2YS4A 4IHOA 2ZSVA 2FLBT 4Z7UE 2Q1EA 4X6DE 1HKFA 1I1CA 2B1HL 2D03L 4YFDB 4HMEA 2BZDA 4QYOB 2WLYA 1VGKA 3O81A 1EIBA 1KLUB 1DFBL 5ESQB 4DGVH 1WICA 3QWQB 4X0KB 4LCIH 3ULSA 4ODVL 4OZGE 1BHGA 2OJEB 2ATPA 4NYLB 2E7LC 4K9EH 3P4MA 4N0CD 4IEFB 2CXGA 3D39E 4P3WA 4PBVC 3RHWF 1NBZA 5D2NE 4OFPA 3KPRA 4FG6C 4KQ4L 1ZLWK 2E9WA 4U2YA 5JQ6L 3CC5B 5EOQL 1I8IB 3W9EB 3D87B 1RVFH 1B3JA 1EBPA 1I4FA 3ARUA 1KPVB 3MREB 1CT8A 2IBZY 4IRZH 3G5ZA 3EOAB 5JO5A 5DJ8B 1BIHA 3CSYB 5IB1B 3JBG7 3ULUH 3BI9X 4HZLA 1XGYH 25C8L 4XAWL 2VXTL 4NDMB 4UOJA 3WS6C 4KZDL 4UBDD 3P77B 1WBZB 3Q3GB 4P2RB 4HWEH 1YEEL 4Y5VC 3CMGA 4PJDE 1YY8B 4NHUA 2AV7B 4LSTL 3CVHL 4LGRB 1OPGL 4HFUL 4HGWB 3WFDL 3PWUA 5EU5B 1IQDA 2CLRA 2APBA 3EFFA 1JHKH 3CPLB 3QXVA 4FXKB 4JHZA 3ARBA 4WV1C 4MJ4A 3I3EA 2JTDA 3MJ8A 1EMTH 4YPJA 4AM0A 3U6RA 3HLAA 3QQ9C 1P69B 2G60H 1MI5E 3VXUE 1HSAA 2DWEA 5D7KD 4NHCH 1INEH 1PG7X 4XPHH 5IGXL 2VLKE 1U2CA 4M1CC 4MVBC 3C8HA 3BRFA 1BQSA 4AEHH 4G42A 5CCKH 4LLUB 3HZVA 5AZEH 2R8SH 1WGOA 4OI7A 1WQVT 5HTSA 3O11B 4YE4L 1AR1C 3QFJE 4DWHA 3VGEA 3SDAA 5FYKE 3O4LD 3QO1A 3PGDB 4AEIL 4R2GC 3SOBH 5DURD 5DT1L 1A7NH 3DMMC 4Z8FL 2A9NH 5D2LA 3BVNA 2OXGA 5C0DA 2B1HH 2D03H 1DEDA 2BXZA 5I15L 1F02I 4EI6B 4PP1C 1NC2B 1DFBH 2BVEA 3ZKNC 4ODVH 4RFOL 2B0SL 2IWGA 5MP6L 3QIBD 4GLRH 4L4VD 3OTTA 4F15C 1JF6A 4GJTB 3TBVB 5KZCB 4O4YL 2J4WH 5J11C 1JWMB 4J6RL 4KQ4H 4POYA 3BDXA 4UINH 1CDCA 3O8XC 5JQ6H 2VLMD 5EOQH 1YPZB 3EHBD 3O4LA 2E8YA 1E27A 3DX8B 2DAVA 1KTLB 2EXYC 5DA0B 3P4OA 2I24N 3AFLA 5SV4A 3RGVB 5B4MC 2HRLA 2CO6B 2MWCA 4RGMB 5H94A 4IRSD 4LCCC 5IHUL 2YZ8A 3B9DA 3JWOL 5DHXB 2KPNA 25C8H 1EJOL 4GG6E 5FGRA 4KUCF 3LEXB 5TDPB 2P8PB 2KQMA 3TWCL 2VXTH 3MV9A 4XP6L 4KZDH 5C0AB 3TA3B 1MCOL 2E8ZA 4KHXL 2W1NA 3GSOA 1YEEH 4XZUA 2R9HD 3M07A 3IU3B 4LSTH 3CVHH 2NXZB 1OPGH 5D2LF 1EHNA 2FEEI 3W82A 4N0FB 1KB5B 1X6LA 3FKUS 3DGGA 1BOGA 1UKTA 1N6VA 4MXVE 4HS6B 1XF3A 3IU4L 2D3VA 4TQEL 4FFVC 3RNQA 5J1AA 1J1OH 2DYPA 3O9WD 1F6FB 3OJMB 5DLML 5EUOA 5DHYA 3PL6C 2BRRL 3MGAA 4RWHA 5EIIA 4G8GB 2OCFD 5IGXH 1T1XA 3UTTB 4JO3L 3MRMB 1IZJA 5I17A 3M17B 1XGQB 1GHFH 2ESVD 3T2PA 4YE4H 2AVGA 5D71H 5DJ2B 1ZLUH 1F4WH 4LIQE 4D0DB 2FZ3B 4R6UA 3M45A 5IF0B 2MKWA 5DT1H 4Z8FH 5I8CB 2YWYA 3BPLC 5LAXB 2YA2A 5J57B 2E6PA 3LD8B 4JFHD 5I15H 1OB1A 1KCUL 3RVXC 3RIAF 3RUGE 3PWLA 3MV7E 1A2YA 4BSVA 3PDOB 3GRWA 3H0TA 4WO4A 1MVUB 5CEYB 4RFOH 2B0SH 3F7VA 5MP6H 1OTUC 4JO4L 5FM8A 3GBNL 1S5HA 3IJHA 4NC1C 2IG2L 1OTSD 1ZT1B 5LJYH 3MZTA 2ESVA 4PJ7B 4DK6A 2BCKA 4J6RH 3BT2L 3C5JB 4L8SA 4G7YH 2H32H 3V5DA 1FYHB 1JVKA 4MWFB 3Q5YA 2VL5B 3VH8G 2W38A 3O3BB 1OY3B 2ZNXA 3MV11 5EUOF 4OGAD 5AUMA 1UB6B 4B41A 1S9WB 1P6AB 3REWA 5KG9B 3HA0A 5IHUH 3O6ML 3JWOH 1EJOH 4F33A 4C56A 4AG4L 1TZIB 2NTFB 3LN4B 3TWCH 3L6FA 2WINB 4XP6H 5AD0B 4OUUA 2VSCA 4HWNA 1MCOH 1RMFL 2KH2B 4KTYA 5I66B 1PKQE 5GZOC 5EZOL 1VA9A 2EKSB 1CR9L 4JO2H 4K7FA 4X8XA 1BEYL 1U8MA 4DGIL 5D9SB 3FQTA 5KSBE 3QDMD 1E28B 3P11L 4TQEH 3IU4H 4K3HA 2R0LL 4ODXA 2AW2A 5DLMH 4TTGA 1ZLUK 3S36X 2X4QA 2BRRH 2XN9D 1IFHH 3T77B 3T4YB 2HP4A 5L6YH 5IEKA 4KKBC 4JO3H 4WCYL 5KN5A 3MLWL 1IAMA 3SDDD 3VMPA 4NQVB 3L95B 4WDIA 2P43B 2XTJB 1JWSA 5EBLB 4QHMB 4JR9L 4XHJC 2R69L 1DL7L 1U8OB 2BY0A 4LCUA 3D18A 5FKAA 3BX7C 4ZAKC 1FZKB 4N9OB 4JQVC 3ARDA 1KCUH 2R2BA 3LPGA 3UX9B 3WIIL 4R9HA 4W68A 4XGZB 2XN9A 4PJGA 2IAND 4ZUSA 1G9NC 1P9MA 3CGTA 1QFWI 3FRPA 3GBNH 2NY4D 5KOMC 2D7TH 3SDDA 5L2KE 3BKYL 3B8YA 1SY6L 3ZKMC 1J11A 2HH0L 2FH8A 3QCUH 4YO0B 3NCYP 2DQGL 3BT2H 3MRRB 4PRNA 2ILLA 5EU4A 4P48A 4XCFL 4OFDA 1IARB 1RFDL 1ORSB 2C7UB 5EULV 1KV3A 4JRWA 1ZGLM 1BD2A 2N56A 4I18C 2C9AA 3GBML 1AD9B 3BD4A 1UEMA 1KB5H 2XZQL 1F58L 4ZOBA 1QP1A 3SGJC 1WC7B 3U7WL 4PB9L 5D7LA 3IJSA 4JFOB 2P5WE 1R3KA 4KV5F 3O6MH 2HVJA 3VXQB 1I3VA 5HPOA 4YHKL 5JIHA 1WT5C 4P4KD 4XP9L 5ITBL 2ZOLB 2GITB 1RMFH 1I3RA 3IXTA 2C3VA 4OZIA 1L7TL 2PF6A 5M95B 3V6OE 2OI9C 5EZOH 5MEPB 5JPNB 3IS1X 2OQJA 3QWOA 1CR9H 5FB8B 1XCTA 4X9BA 1P2CB 2VISA 1QSEE 5E6IA 4DGIH 4JE4B 1OLZA 3HC0B 4YBQC 5I1GL 4XVUD 4M6AA 3P11H 4PJGF 2R0LH 4HK3N 4LLYA 1UB5B 3BYYA 4EXPX 3V0VB 5GIRB 3DETC 1PZ5A 1PGRB 3QZWG 3MX0A 1DLHB 2VDKL 4QCIB 3BJ91 4P4KA 4U33A 1FAKT 1NGYB 5E9DB 5HY9A 4GBXB 3B2VL 1GJIA 2FJHB 4WCYH 3MLWH 5F72S 3VWJA 1HILB 2X4NB 5C0JB 2VZ3A 4O51A 2D31B 1BQHG 1YJDC 4PP2B 2IMMA 4H25A 4JR9H 2QEJA 2R69H 1MHPL 1DL7H 2DQEL 4N8VG 3T0AA 3UBXG 3D1MC 3WUWA 4H0GA 1UXWA 5CS7A 2ATPB 4Q74A 4Z7WA 1F4AA 3P4MB 1OOAA 4EN3C 2W9EL 3RZCD 3SQOL 1CFSA 2BNRE 3RVWC 5HHPB 3KPRB 4YNYA 2FEEL 1BM3L 2GJZA 4JJ5A 4ZODA 5IV2B 3S5LA 3EBAA 4OZIF 3NVQA 1KJMB 3BKYH 1SY6H 2R4RL 2HH0H 1I4FB 3O0RL 4PYHA 2QQLH 3EOTL 4OZFG 1CT8B 2DQGH 4TVPD 3EZ8A 3SE8L 5JO5B 4OLZL 3M8OL 1YYLH 4XCFH 2YRPA 1YNKL 4ACPA 1U91A 4X6BA 1MI5D 3TZVA 4TSAH 3MA9L 3QQ3A 1RFDH 4JFPA 3PNWA 3RVVC 4PJ9D 1MFDL 4MJID 3BAEL 3PABA 4WEBL 2PUQT 3GBMH 1MQKL 2XZQH 1ZA6A 1BGXL 1F58H 2OTPA 4O2EA 1T6VN 3U7WH 4PB9H 5CEZL 3FQXA 1I8LC 4HIXL 4RSVA 4OZHA 1FG9C 5FYKD 4LGSB 4NHUB 3ARFC 2EZ0C 3MBED 5J3HD 1C5DB 1YN6A 2NY6D 4QT5A 3PWUB 2X89D 5GS0D 5ITBH 1T03L 5TDOA 5DC4B 3GZKA 5LWYL 4JN2A 4MNGA 5BOPA 1BBDL 1L7TH 3EFFB 1DQQA 3HB3C 5SX5K 3ARBB 5HVHB 3AREC 1IAIL 4PJ9A 1XIWC 4XVTL 3TM6A 5TDNA 4Z7WF 4AM0B 1I1FA 5BVJB 4U1IB 3U2SB 2XWTB 3ULUF 3ILQD 4GKSB 1HK6A 4OF5A 1K8IA 2YUVA 4I0PA 4ORGA 5I1GH 1FNLA 2E7HA 3RX8A 1XF1A 3T1WA 1CICC 2X1PA 1TZGL 4G42B 3RGVC 2GUOB 2C3GA 2V5MA 1KYOJ 3HZVB 1QKZL 1R3LB 1K5NB 2VDKH 1RD6A 4MNHB 1UENA 1T7ZA 2X89A 5E5UB 2XZZA 1T0NB 4PLJD 4TSCL 4ZS7H 2PYEA 4JPVL 5D2LB 3CDGA 3BVNB 1U93A 1B2WH 2C3XA 1A6WH 5DWUL 2COQA 2IF7A 3VFPA 3ZSTA 5F1OB 4LL9A 5DUBB 1MHPH 2DQEH 1ZVSA 3WKMH 5DMIL 3U1SL 4HH9B 3DTXA 3BN3B 2A6DA 3SGKC 1SEBA 3S37H 4TPRL 2BSED 1A5FL 2W9EH 3SQOH 4APQC 4MHHI 5CJ5A 5K93A 2J8OA 3HZKB 5TF0A 1BM3H 3TCXA 2H2SD 2VDNL 3ARYA 4PJEB 3ABZA 3O4LB 4M1DL 3AB0C 1L4IA</