3HNTL

Cs-35 fab complex with a linear, terminal oligoarabinofuranosyl tetrasaccharide from lipoarabinomannan
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
214
structure length
214
Chain Sequence
DIQMTQTTSSLSASLGDRVTIGCRASQDIGSYLNWYQQKPDGAVRLLIYYTSRLHSGVPSRFSGSGSGTHFSLTISNLEQEDIGTYFCHQDTKPPYTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CS-35 Fab Heavy Chain
publication title Structural insights into antibody recognition of mycobacterial polysaccharides.
pubmed doi rcsb
molecule tags Immune system
total genus 55
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2009-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hntL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hntL01
1YEKH 4NDMB 3P0YL 4J23A 3O0RL 1ZA6A 4JPVH 5D7LD 2K7PA 1A1MA 3MODH 5IMMB 1CXKA 2YS4A 4WO4A 5E2WL 2VLRA 3ZLQC 4OFPA 1CLOL 4GBXB 3NH7H 4MD5A 3FO1A 4ENED 4GAJH 2NY4B 2YXFA 5C0DA 4WCYH 2V5YA 3HC0B 2Z35B 2ADGB 5JHDB 5FDYA 5FYLE 1MRCH 1QOKA 1IGJB 5DHYB 2AJUH 2YD4A 4G7VL 4NFDA 3JV6B 3V9FA 3Q3GA 1WAAE 2IH3A 2F8XC 4NIKB 3JXAA 3VXUD 3NN8A 3A67L 1UZ6E 1QD0A 1CGTA 1Q9WA 1F4AA 5K9KA 2MPAH 4R26H 2BXZA 2ARJB 2VDNH 1MJ8L 3Q6GL 5JQ6L 1T21A 3D2UB 1JYWA 1JGVH 1RZ7H 2I5YH 5GQBA 1ZHKA 2VABA 2D9QB 5EBGA 1JMXA 1LDPL 2GTWB 2Y9RT 3ARFD 1XF4A 4UTAL 5D96C 1ZGLB 1QRNA 4X9IA 4OZGB 2MOVA 4UUJA 1EEUA 5LBSL 5BRZD 1MNUL 3RDTA 2IC2A 4QHLA 2EKSA 2RBLA 5TF1H 4OZHA 2DI9A 4YUEL 4DGIL 4OLEA 1G9NC 4QRUA 4ESKA 4HLZH 4KKCD 4UIKL 3GM0A 4M7JH 4PREA 4WEBL 1YMMA 3MV8B 5I76A 1U8KA 3BIAX 3N1PC 4QXGL 2YRLA 4KROD 3VH8A 1G0DA 4B5EA 5GGUA 3EYVB 3IJSB 4F9LA 3GHBH 4HS8L 5TE7L 4MAYA 1OTUC 3NAAH 3GK8H 5F7EH 2B5IB 5EPMA 2PXYC 5CBAB 2OR9H 1RK0A 4Z95L 2Z31C 3VWJC 1EMTH 1KJ2A 1KC5L 1OAYH 1MFAL 1QRKA 3TYFA 4ODHH 3QDGA 3H9SD 5ID1A 3O6KH 2X4QB 1QO3B 4Z77A 1U93B 3SCMB 1YMHA 4CVXB 2JB5L 3T77A 1MFBL 4MD4B 3H3PL 2EEAA 4MZ3A 3R1GH 4IRZH 4LIQL 3UC0H 4FQXB 5BVPL 4EIGB 3QPQD 3CLFH 1K5NB 2H8PA 1L6ZA 4Z7OF 3OB0K 5I1GH 1T1XB 5IESL 3E1F1 5IFAL 4RMQA 3U9PL 2E6JA 1T6WA 4NQCB 5IB1B 1FHGA 1I1AC 3DURA 4YBQD 5I17A 3DV4A 3ARBC 3PABA 5LGHH 2DI7A 43CAA 4Y16A 4PJBE 5MP6H 2QQLH 1NGPH 3T65A 1VFAB 1WBXB 1F02I 3O8XD 5I2IA 3FQNA 2GQHA 2R4RL 4NWTL 1S9VB 5JOFB 4KKBD 3F5WB 4UAOB 4N0FA 1IT9L 4APQB 4JRXE 4Y5VC 2ZUWA 3CVHL 1X4YA 2R4SL 4JQVC 3DX8B 1BFVL 4HPOL 1OT1A 4HS6B 3SKNB 3QZWG 5KSBA 4AL8L 5IHLB 2AEPH 1QP1A 3RZCD 4KGLA 4JG0L 4Y4FC 1F90H 2OBGA 2GHWB 4XPTL 3QXDB 3ZYOA 5MEPB 4LCCC 1B2WH 1ACZA 4JGUA 1U8LA 1FFOA 2E3VA 3KPRB 1OL0A 1T66D 3TA3C 4TNVK 4EN3A 3TIDA 2OMBA 3PWJB 3VXQA 3T0WA 1RZJH 4R7DB 3GEWB 2V2TA 3T4AB 4KGJA 3GMRA 4BK5A 4ZFOA 4ELKA 5HHVL 3WIFA 1N5YH 3CFIC 5ENWA 3GHEH 3UYRH 2CDFB 4QYOB 5GRYA 1KLFA 2DKSA 1LO2L 4OCNC 5BV7L 1M4KA 4OLUH 3SDAC 4XBGB 1DANU 5IEKB 4JKWA 4F9PC 1MPAL 4X6CA 3BP5B 4U6TA 3C9NB 5SX4I 3C08L 4MSWB 3G5XB 3EGSB 5JHLH 3RKPA 4LSPH 2P5ED 5DDHB 4ZG1A 3L7FA 4WI5A 1NBZA 3RWHA 2AV7B 5FYJE 3PGDB 3H6JA 2IAND 4JN2B 3UJTL 4KH2A 4WGWB 2ICWB 3TEUA 3HRZB 4LHUG 2HG5A 3RY5A 3U1SL 3MRKA 4KK9C 1Z6JT 4PGBB 3HI1A 1FL3A 5HDLA 2HJFB 4HWZA 4OZFA 5JW4R 1QACA 4ZYKA 3O2DH 4ZPVA 4BFIB 3VWKB 5J6HA 1YEHH 1MCCA 2YPLE 1RQ5A 2G60L 5KW9L 4BFBD 5FHBH 5JMOC 3UO1H 3LKRB 4OLXL 2H9GB 3QUKB 4DK6A 2X05A 3KYOA 3MZGB 4RDQG 3UROR 5BV7C 5I1IH 5F71A 1OP3H 2GT9B 2NX5A 4FZ8L 4GW1B 3IDXL 3NA9L 5EUOA 4X7TA 1ZLSH 2CRZA 4HJGA 5DQ9B 1ZT7B 4DUXA 4JRYB 4OFYD 1KXTB 1RFDL 4OQTA 2NYYC 1LK2B 1X3DA 2BC4B 4PGEA 5EBLA 4UOW1 4PB9L 1IVLA 4HWUA 1IL1A 3L1OH 4P46A 4Y4HC 4OJFL 3SDXB 3DX9B 1L4IA 2PF6A 5I9QB 3SHSA 4KY1L 3EHBC 1UEYA 1I9JL 2I26N 4ELMA 5SX5K 2ZPKH 1E4XH 5E4IA 4PUBL 5D1ZA 5GRJL 4OD3L 3PL6C 4KUZL 1CDHA 4WVRA 1NAMA 1U42A 1B0RA 4MNQA 1W0WB 3ILQC 5E8NA 5E2WH 1VERA 4FQ2H 4URTB 3WE6B 3BZFA 1FJ1A 4XPGL 1LMKA 4P23A 1XGRB 1A7BA 5DRNB 3D39A 1D5IL 3OAUL 3V6FB 3O11B 1U3ZA 1F11B 2BNRB 3VDAA 1JZ7A 1S7QB 4QWWD 3SE4C 3GJEB 1HHGB 4YC2C 5IT2L 4E42B 2E8ZA 2A6KA 4LLMA 4Y5YA 4R9HA 4Z7VE 1PGRB 4LEOB 1BIIB 5F7DA 1B4JH 4QHNA 2PETA 1KCSL 5EB9A 3KPMA 1AQDB 1F13A 4LF3B 1KB9K 2VISB 3AS3A 1YEFL 5FYKE 4HS3A 1T5XA 4Z76B 2ENSA 2NTSP 5GS0D 2IALA 1YDPB 2XY1A 2PYFB 5FKAA 5JPMA 1NGQH 3BP7B 5JDSB 5KG9B 1Y6NR 4DOHE 3PV7A 5JQ6H 3Q6GH 2Z4QA 3MRGB 1YPZA 4ZUUA 1HH6A 3CSYA 4Q6IC 1Z9MA 2DJSA 1BPVA 4UTAH 3S5LB 3VXSB 3QWOB 1J11A 4U6YA 5LBSH 4W4OA 5HYJA 5J9PB 1NCBH 4LKCA 3CLEL 1JNNL 4P2YA 5TGBB 4C56E 3P2TA 1UM6L 3ULVD 1FFRA 4JFZH 5HYQA 1FFPB 3DMMD 5FA4A 4G9FA 3WKNA 5IMLB 2HTKD 5IVXE 3DIFA 4QXGH 4J3UA 1TZGL 1XR8A 4UQ2A 4ZQKA 3LH2L 4IRJA 2X89A 5IOPB 4HS8H 2ZSWB 5HHOB 2MHAA 4U49A 2VXQH 5DUML 5T1KA 5GRZA 5EU6D 5K9JL 5EORL 3RHWF 1V3KA 4PGDA 2RB8A 3L3HB 2VZUA 2C4XA 4XZUA 4Q0XH 2E27L 2QQKH 4YHOH 4R8WL 2APXA 4YO0B 3MBEC 3QDMB 5FO7A 1JHTA 1S7VA 2WP3O 2IQ9L 3KWWB 3TT3H 3V52H 3ULUL 2ZOLA 4N8VA 2YUVA 3QQNA 1F4WL 4S0TD 1FSKB 3QT2A 3P0VL 3V0VB 1WITA 2RIKA 4M1GL 4PJCE 3WIHH 2JB5H 3GMMA 1MFBH 3KPSE 1N3NA 3BAEH 4XPAL 1IC4L 5HPOA 3TH4T 4PB0H 4L29A 4WI7A 4I4WB 2LU4A 3SE3A 3QXTA 4PG2C 3WUWG 4GRMA 5EBWB 4WWKA 4NPYB 3DECA 1IFHL 2EYSB 3QXVA 4LLWA 1TJGH 2MCPL 3AM8A 2UYLA 1JVKA 4Y8AA 5F9OH 1MAMH 4MHHG 3LKPA 4M62L 3V5KA 3U4BL 1D5XA 2E6PA 4L8SA 1MY5A 1N26A 3UTSD 1BD2D 1YY8B 4L8CA 3ZL4L 5FDWA 1E4KC 1CICB 4PJEB 3VRJA 1FL5A 1NSNH 3NZHH 2DI8A 4PRBA 5CHNA 2VRAA 4MZ2A 4HIIA 5FCSH 4H20L 1X5LA 1KLUB 4QOKD 4HPYL 1Q8MA 2APWA 4GW5A 3ULUC 4CVZA 3V8CA 1CL7I 4JFOA 3WLBA 4XP9L 2R4SH 2VZ3A 3I75B 3RTQD 4AL8H 3ARXA 3HZVB 5ADOL 3DTXB 4PD4K 3M1BA 1EGJA 5B3NA 5KS9E 2X4UA 5CILH 3NCBB 4IOFC 1T0NA 1T3FB 5I19L 4PJHF 1QR4A 3ARDB 1T83A 2X9XA 4QKXB 5FM8A 3DROA 3S36L 3O6FB 3O4LD 1MCSA 4PFEA 4UNUA 4D9QE 2B2XH 2YD8A 4O9HH 2IJ0C 4EIZC 3VXRE 1MJJA 4R2GB 1EA9C 5HHVH 3BIKB 4H1LB 2E6QA 4KJQC 4LPYA 4N0YH 4LVHC 3UXFA 4R96B 3JTTA 5D1QD 2PO6C 5IB3A 3C6LD 3G5VB 3KJ6H 1P7QD 2NY3D 4FFWD 2HFEB 5DJDB 4UNVA 2DICA 1QLEL 3DYMA 2DQEL 1MLBB 2DB8A 2ICWJ 3HG1D 4PRAB 5AZ2H 1A47A 3RX5A 3OF6D 3QEQD 1OAXL 4OLVL 2I9TA 4KV5F 4GLRI 2GAZA 2HT4C 4N9GA 5GGTL 3QYCA 4NOFA 4XC1L 4HWNA 4LQFH 3L3IA 2EEDA 3IDJA 4MQXC 3TH3T 3ZDYF 4TOYL 3OL2A 3QUXC 4O2FB 4L9LC 4UB0H 5B8CA 5HI5C 2A6IA 1P4LB 4G43A 2YK1L 1ORQA 2VITA 4RZCB 2EDFA 3EDKA 4Z7QE 3QIUC 4QXTA 4C4KO 1BGXL 1TNNA 2OTUA 2BVOB 2VE6B 4JFFB 1B88A 1TVHA 4ERSL 3D0VA 3QNYB 5KW9H 2HAZA 1AH1A 1YNKL 1SVZA 2GIYA 2NXYD 1KYOK 4OLXH 3ARED 4TUOA 1UYWL 5INCA 4W6WB 2FNBA 1UWGH 5IR1A 1JZ6A 1TPXB 4KKNA 4Q9RL 1G1YA 4QTHA 1A3QA 4JHAH 1DBAL 3HPJB 3EO9L 1RFDH 2B7DT 4ZAKB 3O3UN 3K4DA 4PTUA 4B41A 4OB5L 3H7BA 2CDGA 4GRWE 1CQKA 3PWNB 5CCKL 4HSQA 1OAZH 4G8GE 4JHWH 3WFEL 2NY0B 1AP2A 2GY5A 2B8OT 3Q6FB 4MYWB 4X0KB 4Z5RB 4RMVA 1FPTL 3HE6C 4L4TA 3FB5A 4X99B 4LHUD 1C5DB 4PUBH 1BBJA 2VDRL 1N59A 2XRAH 2R39A 4ALAH 2WBJA 3X3GL 1FYTD 4P3DB 5CWSB 3EFFA 3A6CL 1NJ9B 2CDEB 3WFDH 1P2CB 2J8HA 4BH7A 1GC1L 1P7HL 3UTTD 2BSSB 4NO0A 5T1MB 1D3CA 5JUEL 4ZOAA 2YMXL 1D5IH 4JDTH 2FHBA 2R1WB 3AAZB 3OAUH 4G9DB 4LSUL 4UILL 4NP4H 4HXBH 2VDMH 5C09E 4W68A 3RGVD 2APTA 4NZJA 2O93L 2Y25A 4JFPA 5F3BB 3BO8B 3H7LA 4XH2B 3CDYA 3AXLB 4F33B 1Y18A 2R0LL 3G6AA 4S1SH 5SX4H 3VFRA 6CGTA 4O4YL 1KCSH 3V6OE 1NCDL 2V2XB 3W11D 3SDCC 3T09A 1WAAF 4KQ3L 1N6UA 5KOMC 3LKNA 1UCBH 1XR9B 2J12B 1WZ1H 2BMKA 2F54E 2ICWI 4HJ0C 1A7RH 2OQJB 4PRPE 2UWEA 2FEDC 1VFBB 4I2XA 4OUUB 3MNVB 4JDVB 5I71B 3KR3H 2ZCHH 1U8HB 3SKMA 2R2EA 1GOFA 2EXYC 2NY1C 2R9HC 2JK5A 3OSKA 1EDQA 1U91A 3D48R 1CXLA 3D69B 5I16B 1BBDL 1DEEA 1GC1C 1U95B 5I15H 1MI5A 1D5BA 3DVGA 1S3KL 3ESUF 1AO7D 3IRPX 1QA9B 2V5RA 3HR5B 4BSJA 1X5AA 3NBNA 1CU4L 5KSVA 2GJ6B 4F7PA 3MLYL 4BQCA 4IDJL 4HIHA 5B38B 1P84K 1BOGB 4PJAA 2WWMC 3BP4A 1BJ1J 2JJSC 3WFCL 1PY4A 4BQBA 1G0YR 2PYED 1JN6B 1WWWX 3PDOB 2QLVB 3CZFA 3VXNA 1IGTA 4XPHL 4JFXB 4CN4A 5L7XL 3W39A 3C5SA 1TQCC 3MBXL 1JTTA 1BQSA 4A6YA 3EDDA 4ONFH 3EFDH 4YHZL 4KQ4H 1MCEA 4WHDA 4NKOA 2R56H 3GGWB 2Y6SD 5EOTA 3VFTB 4HIEB 3T3PE 2WNGA 4JCLA 4M1GH 5HPMB 5JMRA 1U8NA 1H3PL 5D7IB 4GT7A 4L4VB 2ZKHL 1A1OB 4ONOA 3NTCL 1QEWB 1DN0B 5D2NC 4U1MA 1JL8A 4PLKD 2Z92A 4CBPA 1DQQB 2D31B 2VL5A 3MV11 4NFBA 3O9WD 5F1IB 3ARPA 2MCPH 4FXKB 5CUSL 3QG7L 1QLRB 5CLTA 3W9DA 4LSDA 3B83A 3ARSA 4ENEC 2FX8L 4RFNB 3UBXI 5KSAB 4G6JL 1PG7H 3H9HB 4YDVB 3TP4A 4TQEL 4RGOL 5GGVY 4LCUB 1OQXA 3L6FA 2OTWA 3INUH 5DK2B 3ZL4H 4R6UA 1MAKA 4E41E 1Q9LB 4MA3A 4YAQB 1QSFB 2ADJA 2PW1A 4MQ7B 3BFOA 3O6LL 3QCVL 2G9HA 5I8EA 1A9BB 1T7WA 4BELD 4EDXA 2DKMA 3IFNL 3VMPA 3N1GC 4HPYH 1Y6MR 3JWOL 4RX4D 3H2WA 1QSEA 3OKDB 3FQRB 4QRSA 2DYPD 1KB5A 1SYSB 4QRQA 5KSBF 4R4BB 2ESVA 2WIIB 2CUMA 2IMMA 3QUMB 1L7IL 3BPCB 4J12A 5JIHA 4HLJA 3ARFC 4M8QB 5HGBA 2Q7NA 2ICEA 4RISH 3BN9D 5FO9B 5I19H 5HHXH 4CNIB 1NDGB 5DJ0A 3E6FB 4LQ1A 5SWSE 3BZEA 1RJZB 3QAZC 2DF3A 4Y4KC 5CEYA 4NHCL 3VGFA 4ZPTB 4KKCC 2JJTA 4RFEB 5CKGA 4Z0BL 1VFUA 4KROC 1U8MB 2I60H 1OWWA 3FHAA 1BJMA 2HT2D 1SJXA 3MLTB 4PRID 1FLRL 4HHAB 2EH7H 2NTFB 4EZMA 4ZUSA 4EI6A 3EOBB 1WC7A 5ITFB 4P4KA 2P42B 3LKOA 4G6KH 2PKDA 1TTFA 2F74A 2ITCB 4QCIB 1HE7A 3QXWA 2YBRA 4OLVH 4MJ2A 3VH8G 1Z9SA 2IQAA 1QPPA 2FH6A 3FFCD 5F1NB 1A1NB 5C0CE 2X70B 4XC1H 2FX9H 1ZSDB 3MV9B 4ZMAT 2YPVL 2CLVA 4D9RD 1ZEAL 3BP6B 2HKFL 2YK1H 1T20A 3OXRA 5ADPL 1JTPA 1JPGA 2FL5A 5E8PB 4K3GA 3KXFA 1YN6A 1BGXH 3MFGB 3QPQC 2A73A 5IFHH 1XF3A 1FL6A 2XFXB 3FOMA 4JM4L 1FO0B 2J8UB 2JIXA 4OAWA 4XWOD 4EOWH 1L7TL 1RPQA 5T3XH 2PTTB 4NBXB 1UYWH 2OS7A 4NRXB 3T0ED 2AK4D 1VGEL 2NZ9D 1WBZB 4YBQC 4BH8A 2MTPA 5EUOF 4WFED 1BREA 1A3RL 1HI6A 4GG6F 1C5CL 4Z18A 5C70A 5AEAA 3MRQA 5H35B 3O8XC 1RIUH 4CJ1A 4CU7A 1JHKL 4KKBC 1P53A 1HQ4B 3UBXG 1CL7H 1JP5A 1TMCB 3L95B 3FRUA 5HVHB 1JPSL 4PRHB 3GSNB 5C0AD 4OCLC 1FPTH 3K46A 3LN9A 3DUUA 2DQTH 5LAXA 4ZOBA 1GGBH 3LKSB 3RZCC 4JHBA 3T4YB 2YD2A 2Q6WB 1QFWM 2KDGA 3A6CH 4GS7C 5DJXA 5FECB 3EJJX 3DGCR 1T66C 3HUJE 1FCGA 4HBCH 1RJYA 3CFJB 5HHMB 4U1NB 3IKKA 3PHQB 5TDPA 2VKXA 3JTSB 4WRLA 3NFSH 3KPOA 4G6AD 3S5LG 4NNXB 3UZEA 1IM9B 4YGVA 5HYSA 1WBYA 3VMNA 4YWGH 3KG5A 1TNMA 5JPNA 2HRPL 3OR7B 1NCDH 4HF5L 4NN6B 3W0WA 1OPGL 1X5YA 4KQ3H 5KAQF 1J8HA 1YN7A 2NY4D 3GRWA 1ZVYA 2XPGB 2Y5TA 5F8QC 2IBZY 4PJ8A 4GLRH 2F19L 2IGFL 4XCEB 1MUJA 3FQXB 2A74A 3WNLA 1G7QB 5JA9A 1R5VB 5MENE 1HDMB 4FP8L 4QTIL 2HJKB 3L7EB 2EDBA 3D3VA 2FJHB 3OKMA 1W8NA 3NIDF 4HMDA 2G5BB 3U7WH 1BBDH 3MXWH 4PJFE 3BPNB 2BOCB 5E6YA 1S3KH 3LIZH 3VA2C 3S35H 1YEIL 1LEKA 1AD0A 1SVCP 4Q2ZB 1Q9OB 3CFEB 1I1AA 4JY5H 1MCKA 4RWHA 2VLKA 5C08B 1EFXA 1A5FL 5F7WC 1WCQA 2WUBL 4R4FL 1J0HA 3ARZA 5TQ0H 4OD2B 4XPHH 2XZQL 4XNUL 5L7XH 4HWBL 4ISVA 4FQCL 1F4XL 4OZFG 1WGOA 2MSPA 2FX7L 3MNZB 2Q8AL 3VJ6B 3MLWL 4HKZA 1KEGH 1GVIA 3BRFA 3VD4A 3NFPA 5EC1A 4Y8DC 1ND0B 2EIZA 4YHZH 4YXLL 1NUNB 5HGDB 3X3FH 1TETL 1HHHA 3FTGA 4Y5VA 4UT6H 5GS0L 1G7LB 3ZZ1A 1KUMA 1S7SB 1DE4A 8FABB 3VRIA 1H3PH 4LFHG 4Y4FA 5FA3B 2ZKHH 3V4PL 1R6VA 4AG4L 4LKXA 4LCCA 2RQ8A 1PY9A 4LIQE 5DJZA 3QQ3A 4YPJA 3GJFK 3TA3A 4O2EB 1ES0A 5JO5B 4ZDHB 3KYKL 4OTXH 4PR5B 3KJ4B 4KTYA 5CUSH 3FQTA 2A1WH 2OP4H 2CJUL 2QSVA 2PR4L 3BSZL 3GNMH 1JYVA 3GSRB 5BS0E 1ZVHA 3DX7B 4I5BB 1G7PB 3CMOL 4G6JH 4TQEH 3SPVB 3MACL 3G04B 4GUPA 4QWWC 3SDAA 2WINB 3MLRL 5EO9B 3ZYZA 1KCRH 3IU3B 1YEJL 5KANI 3D85B 2I07A 4WUKH 1RU9H 2P8LB 1U9KA 1UB6A 2VSDA 1MCRA 4TVSa 3IFNH 1NUDA 1KJVB 1CFTB 5FIEA 2L7UA 4UTBL 3VE0B 4NO3B 3OBAA 4LSSL 4H1LG 3JWOH 5EZIL 4JFDD 5JA8B 1T5WB 4O00A 3QDJE 5GS0C 1FN4B 4RQQA 4KKAD 3WFHB 1KJMA 5JW5B 4W6YB 2OYPA 3MCLL 3QCUL 1UZ8B 3P9MB 5C92A 4D0DB 4YHIA 4I0PB 4XVTH 4IEFB 5D9SB 4X98A 1J87A 5KS9F 1I3UA 1MEXH 3QEHB 5I1JL 4H0GA 3WEXB 2NY6D 4DWHA 3ARQA 1SJHA 4NNYA 5AWNL 1SYVA 3VCLA 1V3JA 2IH1B 2VDQH 1UJ3B 3CH1A 4IRSD 4NHCH 3ULVC 1IKNC 3P9LB 3DMMC 4U1HB 2UY6A 2ZNWA 2HTKC 4Z0BH 3B2VL 3VXMA 1W72B 4JLRB 3VFMA 5BW7C 4PJXE 4JZNA 3MV7A 4A2LA 1A7OL 2XTJB 3G5ZA 3WMSA 4WO4D 4XCCL 5EC2A 4LAJH 2HVKA 4RMWA 4GOSA 1FNAA 4JY4A 1ORSA 3CK0L 3HB3D 1PKQA 3DUHA 2WW8A 1I7TB 3LN5B 3D1MC 1LNUB 1F6AB 5HHQB 4KJYA 4Y5XB 3LEYL 1AGCB 3BQUB 4NCC1 4S1RL 2YPVH 4G8IA 3MLXL 3MV01 4LOUC 5ADPH 4QRTA 3WJLC 2X7LB 3RL1B 4E5XB 4V2CB 2VL4A 5TH2A 1PG7X 1PYWA 1P9MC 1BQLL 2XQYK 4X4YB 4RAHA 1UB5B 1XMWA 4C57C 1L7TH 2X4OB 3GMLB 1HIMH 2OZ4L 4N0UB 4D0CA 5KJRL 3CFCL 3MX0A 1IEAA 1KXQE 1VGEH 1BFTA 4MCZA 3NIGF 2J8OA 1B9ZA 1UKTA 1QPXA 4GO6B 4HGWB 3UDWC 5T5FL 5H37H 1QRND 1A3RH 2HWZL 3PE9A 4F7MA 4TNVF 4XMPL 5ERWA 3RDTD 1TZHA 2IBBA 3WIIL 4LNRA 4OKDA 3OJDA 1MHEB 5C6TH 2DQHL 4GRWF 3DXAE 3IDMA 5J13C 1D7FA 4P2RE 2ZUYA 4QRPA 4BQ6A 4OFIA 1MIML 1YMMD 1AR2A 1J0IA 1DQDL 1NFDE 3MLVH 3QIBB 5HHPB 5E2UH 4U33A 1G9ML 2O5YL 3AFLA 5LVEA 4GKOA 3RTQC 3SJVE 5F7UA 5EU5B 3BPLB 4LCIH 3GM8A 4Q6IA 5KANG 4PJBA 3P11L 4RGNB 4MAYD 1WCBB 4I18C 1I8IA 3RUGF 2IWGA 1EBPA 1KN4H 4NZRL 4NKQB 2AEIT 5DJYB 3CCHA 1X5XA 4JJ5A 1CGXA 1HXMB 5FM4A 2BZDA 5TDOA 5BZDA 4YDLC 3BXNA 1OCWH 3PV6B 1RK1A 1VB9A 2B4CC 5D1QC 1FZJB 4F3FB 3C6LC 2AXGB 1BJ1H 5DT1L 5I1LB 3P4MA 5E2TL 4FFWC 1ADQL 3TPUB 2YD9A 3L3GA 4R4ND 1TCRA 4HUWA 2NY5L 5I66A 3KPPA 1NEZA 4Z0XA 2VLRB 3AUVA 4U2YA 4X9GA 3HZYA 3MYZA 5DWUL 5DMIH 1J0JA 1FBIL 1K2DB 2FJGB 2F19H 3PP3H 1PSKH 3HCVB 4Y1AE 3P4NB 4IS6A 1NLDH 1W8OA 1RIVL 4Y16D 1BZQK 4GKZA 2AV1A 4FP8H 4QTIH 2X4PB 4NM8H 5J1SC 4NUGL 2VQ1A 2WV3A 1NAKL 2VXTH 2IMNA 4XP5L 5CIPA 2OLDA 2IFFL 1M71B 2WWKO 1XF5A 1ED3B 1ZT4B 3AREC 4ZNEA 1H15B 1S9WA 5C0GA 4LSVL 1MH5B 2R0WL 3TVMB 4XNUH 3MYJA 1FV1A 1F4XH 2DL9A 5T1LB 3TBYB 1IGIL 1VACA 2FLRT 1EHAA 3MLWH 4EN3D 2I24N 4V1DA 2NY5C 4PJDE 5CEXA 1T4KA 5E94B 1LE9B 1TETH 1ZK9A 3ULUE 1H5BC 1BAFL 2DM2A 1XZ0A 1CD0A 2X9YA 4JO2L 5AUMB 3RWEB 1NC4B 2ZUTA 3EUUA 5EWIH 3MRRA 5BO1L 1IQWL 4I9WE 3ES6B 5GGUB 3F7YB 5FM5M 2FEEL 3B43A 32C2B 2DQDL 3QWQB 3TO4A 5E8OB 4M61B 3IF1A 5IQ9B 5KN5B 4G42A 4M5ZL 1J1OL 3UPRA 2D0GA 1NGWA 3HS0A 3KYKH 2NY7L 4LLUB 4ZUWB 4HH9A 1BECA 2F53A 2RAMA 3EYSH 4H1LH 3ZKSD 3CMOH 3NPZB 1NEUA 3C8DA 5EU4B 3B6SA 3SGJA 3QDGB 2PO6A 4MNGB 2X2YA 3RGVC 3QULA 3MLRH 4YDIL 3U0PB 3NCYP 1MIEL 4H8WH 1D9KA 3LMJH 1XGYL 2ED9A 5DRWA 5ETUA 4GMSL 2PW2B 4PJGE 4D2NA 5E00A 5GXBB 1FLTX 1LP9F 5FXCH 4LAQH 3W11C 2HLAA 2IG2L 4M6MH 2GSGB 4LSSH 4WJ5A 3QQ4B 1LDSA 1JFQH 1YYMH 2XN9E 2DD8L 4N90E 3RFZC 3MCLH 4OUOA 3QCUH 1F58L 3QG6B 3LQAL 2CLZB 1CICD 3U82B 4XI5D 3DURB 5C1MB 3QUXA 5I17B 2APBA 4LFHD 1M6OA 3S35X 5D72L 1AGBA 3BZ4B 43CAB 3B3IA 1EUTA 3U36B 5SWQA 3SQBA 2HP4A 3QIUA 1DQJB 5ID0B 1M1SA 1G6RB 3HLAA 1OLLA 3UJJL 1DJSA 1MCIA 2OR8A 1FO0L 4P46D 3CDGB 4QT5A 5CJQL 3AU1A 2DM7A 3CDCA 1R0AH 4JRXB 4IIQC 15C8H 1P1ZA 3QJFB 2Y06L 1RJLA 3IAQA 3HAEB 4M7LT 1RY7B 1YNLL 3KLDA 5D1ZD 4OF3A 1QBML 5B3JF 4GRLA 2K9UA 3A6OA 1JGEB 4CW1A 4IOIA 1A7OH 4LVOB 4MD0B 3RWIA 5DRXA 2GYSA 4XCCH 5CEZH 3O6FD 3AMKA 5LCVL 1CGSH 4P23D 3D39D 3QO0A 5DUBA 3GSNL 3SY0A 1MREH 4HKJA 4ZFOB 2H32B 4K8RH 1TVBA 3OKLA 2Y6SC 4J3VA 3LEYH 3HE6A 1MQKL 3LQAC 5TDNB 1CLZH 4UDUB 1K9TA 3MLXH 3HC4L 5D2LA 5TQ2L 3UZQA 3NPSC 3D0LB 2C26A 2A6DA 3VDCA 3H0TA 3GMOB 2P8PB 5IIEA 2W0LA 1BQLH 1F8TL 4PLKC 2G2RA 3AS0A 3O9WC 4POZD 1TJHL 3DJ9A 4HKBB 1CCZA 4MJ5A 1P7KA 3O2VH 1A4KA 3VW3L 2OZ4H 5T3XE 4FQJL 5JW4Q 4JZJC 5KJRH 1M05A 1UACL 1PQZA 4FTVB 2NMSA 1I85A 3BH8B 1ZHLB 2R69H 4PJCA 3FO9B 4YXKL 1S5IL 1BFOB 4X9HA 1RHHB 5L2KA 2LAGB 1OGAA 1T03L 4F15C 3EZ8A 4AENA 2ENYA 3HI1B 2DQHH 2EICA 4DGVL 1CFVH 3BYTA 1R3KB 1IGCL 2YPLB 4G9FD 1DQDH 1FFQA 1AHWB 5AD0A 2HH0L 4U3XA 4Z8FH 1G9MH 1KTDA 2O5YH 4IRJD 2X89D 3IVKA 2DIBA 3CAFA 5K33A 3B9KB 5F89B 4BUGA 5JOEA 3P11H 2OL3L 2FJFB 4NQEA 5T1KD 4Y88A 4GG6B 4M1DL 3ZKQD 2FIRT 2AJ3A 1I8MA 3FN0H 3HI6L 3UZVB 3SKJH 4I77H 1CD1B 1Y6KR 1V7NL 1BQUA 3MV8E 4ONGL 1S7UB 2FO4B 3U7YL 3FMGL 1QLFB 1YJDH 5D6CB 1HILA 1U8QA 5JLZB 1FVCB 2HJLA 5IW3A 5A2FA 2EDRA 1HNFA 4K23L 5E2TH 5CD3B 4WWKD 5IBTL 1JE6A 2ZOKB 1GAFL 4OGXL 5JIKA 2Q20A 3ULSB 1XGTB 3JBG7 1RZIA 2RCSL 5IB2A 3QFJA 5D7SL 3X14A 3VXRA 1T89A 5E6ZA 1F2XK 1OB1A 5IVOA 2VLJE 4WHTA 4OKVB 2XYCA 4HX1A 4FQIH 1R24A 1TTGA 2C3XA 2FECL 2P47B 3RY6C 4DKAA 5CFHA 1IAIL 5DJ2B 1PBYA 1OTTD 4Z7VB 3WJJA 5D6DA 1NAKH 1JNLH 1NMCC 2J5LC 2O61A 5D2NE 5D7LE 4AEFA 4PJFF 5CAYB 1MCOH 1RUQH 1H3XA 2J1KA 5L8JB 2NXZD 4I0KA 4S1QH 4NQCE 3JV4A 2BVQB 4DCQB 4XMKH 4XWOC 3ZT6A 4J3TA 3K81A 1YEDA 1YQVL 3T0EC 2NZ9C 4DOHB 2KKQA 5DQDL 3BVNA 2DDQH 2R0WH 4FQ1L 3MRPB 4X4XA 1HH6B 3FB6A 4ZTOL 4M6AA 4GG8B 1MHPL 1PLGH 3RBSA 2RJMA 3T0VA 3MCKA 1U58B 1T1WA 4JANA 1RHFA 2AP2A 1AQKL 2GJ6D 4ACPA 3VXUA 1RUMH 3MRLB 2XQBL 5L6YL 1KSRA 4HKXA 1KIQB 4JO2H 4YPGB 4DVBA 4KRMB 4XBPB 2IPUK 4DN3H 1HOCB 3FT4B 5A16B 5D71L 3QUMH 5IHUH 5IVXB 2CKBA 2VYRE 5BO1H 5IKCA 4UQ2B 2F5AL 3EOYG 2CIKB 5LWYH 1C8PA 1JYXA 2GK2A 5T33L 3KPRE 3BPOB 4XVUC 3EOAA 4DVRH 5D7KD 3MROB 2P5WB 4HC1A 3TJEL 1A6AB 5KSUB 1C16A 2NY7H 5BRZE 3DGGB 3JV5A 2CIIB 4Y4KA 1LEIB 1KNOB 3NCFB 4EDWL 4ZTPH 1UA6H 2DQFB 3WNMA 5DD5L 4L4VD 1M7DA 4R0LB 5HYEA 4G6AC 3VG9B 5K9QI 4MLSA 4O58H 5CBEA 5E2VL 3KPSB 1XGYH 3QEUB 1RAMA 3PHSA 2W0FA 1CE6A 1XGQA 1ZA3A 2OJEA 43C9A 2YHGA 3G6JA 4QXUL 3BGMA 1FQ9C 4HJJL 4UT7L 4YDKL 4TSAH 1DVFB 3N0PB 4S1DC 4LLWB 2NY4C 5GGVH 5IB5A 2R0ZL 2DQGL 2DD8H 2UZXB 4UV7L 1ZT1A 5C07A 1RULH 4TTDD 5ACMA 2VN7A 4ODXA 1F45A 5C0EB 1ZS8B 3H9SE 2FO1A 4U7MA 3DX6A 5D72H 2BRRH 1X6NA 2ZSVB 4FS0A 5ESVA 3MRHA 3MXVL 1G9EA 3U0TA 1KIPA 1PG7W 3QUYD 4MB3A 1RUPL 4HIIB 5ISZA 5I18H 1ZMYA 1FO0H 4IHOB 2C1PA 4WI8A 3BKCL 2R1XB 3E2HC 2DS4A 4Q7DA 3MOAH 4PBVC 3BKYL 3GIZH 1FNSL 2ZCKH 3WLBB 3REVA 2G75B 3P73A 1KPVB 5E8DL 5IB4A 2NY2B 4DW2H 4YQXL 1YNLH 3V5HB 5FM5O 2WBJD 4QHMA 1QBMH 4AIZB 1UM4H 3NGBC 3NIFE 4UU9A 5KS9B 1Q0XL 3WN5C 3MOQA 5LCVH 2Z8WC 4OZ4A 1L0YA 1NUGA 3RWFA 1WUNT 4HG4J 3SDXE 4TVPH 1MFCL 4Y2DA 3GSNH 4X8XA 5DI8A 4KJWD 2A9MH 1D6EB 3D87B 4IOSD 4ODSL 1W0VB 4RIRB 1DL7H 3RGHA 4EBQL 3O3DB 3DOSA 5E03A 5F1SA 3I6KA 4X6DE 3RZCA 1VADA 4U1GB 4WHYH 3HC4H 3I84A 4K3DL 1XCTA 5BQ7B 5KTEH 3LDBC 1MF2L 1S7XA 2HFGH 3BUYB 5ACZB 4TULL 2HFFA 1S7RB 4JFYB 3RWCA 4K55A 3ZKXC 3F7VA 2FWOA 1U3HA 5F1OB 1A22B 2KBGA 1LE5B 4KHXL 1RJCA 1CFQB 1TJHH 3ECBA 1FGNL 3L3JA 3QHFH 3QI9B 4WV1C 3L3OB 1S9XA 3LOWA 4U1JB 3CUPA 2VAAB 4TSCL 1JRHI 3KLAA 1BVLB 3F65A 1JK8A 3K4ZA 2XXCB 1S5IH 5DLML 3OKNA 4YHYB 3MJ7A 5INDA 4LLQA 5EH1A 1MWAB 4AJ0A 4PJ5B 1INEH 3LSOA 4DN4H 1HHIA 2P5EE 4DGVH 5EN2B 4YXHH 3WXVL 1T1ZA 5AG9A 2XICA 3DVIA 5SWZA 1CGWA 1DUYA 3K7UA 3ZTJH 4CN1A 2IANE 4KKAC 4DZ8B 5F7HA 4HGKC 5K9QG 5CJ8A 1U8JB 2NQCA 3P4OB 2X4TB 1KTKE 4NM4L 1ZLWK 1FE8H 4YZFE 1BJ8A 3VXSE 2VKWA 5IGXL 4Z7NE 4YBHA 1IJ9A 2IAMA 4M1DH 2D4FA 3ORJA 3MLUH 4X7FC 1MFDL 2NY6C 2VH5L 4UAOC 3HI6H 4OFDA 1JIBA 2O5XL 4OSUL 4GRWB 3H7BB 4XWGL 4GFTB 1FIEA 3D25A 1YEGH 5I8CA 4JVPA 4MDJB 4XRCA 2VQUA 1G7IB 2D2OA 4ZUVA 2N4IA 4G8GB 4ODWB 1IKFH 4X7SL 3ZTNL 3CU7A 4NHUB 3U7YH 1CFSA 4F8TA 1EO8H 1VFOA 2CR6A 4BZ2L 3RX8A 1E6JH 5HHOE 2E7LC 4MXWL 4RWYH 5DEGA 4P2QE 5B4MC 5IBTH 2Q1EA 1DQLL 5FGRA 4WO4C 3RUGB 4KI5E 3QDME 5J3HD 2YUWA 5ANME 4KJPC 2RCSH 4KTEH 3CX5J 1I3GL 2DQIL 3V7MA 3HB3C 2OSLB 3TWCL 5J12B 3OR6A 4PJ9A 2VZSA 2X9WA 2VIRA 3HZKA 5CJXC 3E6HB 1S9KC 5KBNC 1I3RB 1ONQA 2WMPA 3NZ8B 1AGDB 5FAAA 3Q1SH 1KJ2L 4Y19E 4PRPB 3RKDD 3RVUC 1GHFL 2DM3A 1Z0MA 3ILPA 2A9NL 5DQDH 1REIA 4CADB 1GZPA 2P44B 1GZQB 3MNWB 4HT1L 2JE8A 1U91B 5IMOB 5IBUB 3HA0A 4ONHA 3TCLA 2W60A 2I27N 3O2DA 5TE6H 1XEDA 1DEEB 3TT1H 5I75C 2VXUL 3ULUF 5I74B 2X10A 1JWUA 2Q7YB 5L6YH 2P45B 3QCTL 3X12B 4KDTC 3RRQA 5E95B 1SEQL 3DRTA 3MJ8A 5D71H 3Q48A 4HIHB 3ROOB 2Y36L 3H42L 5FV1L 4K3EH 4M93C 1X5JA 4AEHH 1KELL 1OP9A 5C0BA 5C9KA 1V5JA 1UFUA 4Y0GA 3L5WB 4N5UA 3ZSTA 3TO2B 1LO4L 1UG9A 2A6JA 2WUCH 3G9VA 4RMSA 4P4KD 4MAYC 5T33H 1IGTB 3RWDB 3D9AL 3W39B 3C5SB 4MJ6A 1QFOA 3KYMA 5JW4N 2QSQA 2Z0BA 4PRDB 2BSTA 1MVFA 3F58L 1AKJA 2C3GA 2APVA 2JCCE 3M8OL 5D8JH 3C60A 4ZO9A 3QUZB 3MCG1 1MFEH 1C1EH 4EDWH 4OI8A 3U46A 1WEJL 3C5JA 4ODTL 4U1LB 3OKEA 5DD5H 1OP5H 1NBYA 2LVCA 2V9QA 4JJHA 2H2PD 3CXDL 4LASL 5BW7A 3O41A 4GXUM 2DBLH 4KFZC 4J1UB 1JPFA 5EU7C 4BZYA 3ZHDA 4PJGF 3QH3A 3ROLB 1SQ2N 1GIGL 4QXUH 4OLWH 5EU6E 4UT7H 4YDKH 1OSPL 2XWBA 3ISWA 4U1MB 1XGUB 1IQDB 1HH9A 4X8JA 4PG9A 4X5XA 4R4NC 1CZ8H 2JIXD 3PWVA 5E1AB 1H3WM 5AAWA 4ZFOL 3LRSA 3SO3C 4DZBB 1C08A 5CP7A 1AIFA 5JIPA 2H3NA 4P99A 1S7WA 1E4WH 3FB8B 5GJTL 5FF6B 2COQA 1TVDA 1KOAA 1IGML 4DKFL 2OK0H 3FONB 5GGSA 3MLSL 4Y16C 3QRGL 3WS3B 2XWTA 5E5MB 4P5TB 3ARVA 3L3DB 3MXVH 4N1HB 5DK0A 3RVTD 4E41B 3VXTA 3QFDB 3LN4B 5DUPL 4PTTA 5B39B 4JFFE 1LP9B 3BKCH 3K2UH 4L3AA 5GZOC 3TPKA 5LJYH 2ZJSL 4XXDA 1NL0L 1UQSA 2C1OA 4LPXA 3BKMH 1EEZA 1QSEB 4I0PD 3IJYA 4F7EB 2IPTL 3ZT5A 4JREB 4QNPF 5GGRB 4LVNC 4WGVB 1Q0XH 2WIMA 1AGEA 4QOKA 4EN3C 5E4EC 4M3JA 2GUOB 1MFCH 4IM8A 5SWSB 5FK9A 3TNMA 4CVUA 1B6UA 1U8OA 2MWCA 5IEHB 4LCWA 4H0HB 2WK2A 4ODSH 3CPLA 4LDEB 3MGAA 3TN0A 2BNQB 4NWUL 4EBQH 5ESQB 3GSUB 1U8IA 5IJVB 1HINL 3IDNA 4K3DH 4HFWB 1AGFA 3KNBA 5DD1L 1AXTL 1EXUB 4JDZA 4OQTL 1AJ7H 4PV9B 4TULH 3HI5L 4MXVE 5IK3B 4YHPB 4P9ML 1J8HD 5DZLA 4K3JH 3VFNB 2F74B 3O4LA 4MA8L 1FGNH 4PJ8D 3FFDA 4M7KL 5E99H 4OD1L 1EEYA 2EDKA 2YBRB 3BQUD 2QEJA 1CDIA 1R5IA 4TSCH 2QKIB 5CGTA 1R3JA 3RU8L 4F37K 4TTGA 2IQAB 3SDDA 5C0CB 5EZLA 3C6LA 1NC2A 4PJIA 5EUKA 1VENA 3WIHA 5C6WH 5DLMH 3D3VD 1PVHA 1JHLL 2VUOA 5JORB 4GW4B 1NAML 3QNZB 2I9LA 2KQNA 1EPFA 4NSKA 4MNHB 3KXFB 4ZFFB 1UGNA 1HSAA 4YE4H 3TYGL 4NQDA 3RJDA 3QIWA 5BS0A 1MVUB 3HG1E 3CVIL 2Y5EA 3QEQE 4EEEA 5ICZB 1I1AD 5LQBH 5IJKC 1BLNB 5E5RB 2VLKD 4GQPH 1EFXD 4NM4H 3U48A 3OKOA 3QZWA 1CICC 1JGDA 4XI5C 2MNUA 4PRNA 1QVOA 1HI6B 1OHQA 4XVSL 3GB7B 5DYOB 1XCQA 3QWRA 3FT2A 1MFDH 1UVQA 3V95A 4RA3A 2Q86B 2O5XH 3RJQB 2FBJL 1H3TA 4XWGH 1A9EB 3K4AA 4JPIB 4P46C 5GHWL 4PPTA 1CDUA 1JWSB 5GGQH 1DUZB 4MDIA 4NRYB 3PIQA 3OHXA 3AREA 1J1XL 4LHQB 4WFGE 1KENL 3VFPB 3C87A 4KK5D 4BZ2H 3V7AE 4K07A 1UWXK 3DUUB 5D1ZC 2R2BA 4FFYL 4MXWH 4OGYL 3IDGB 4P3CH 2R2HB 1FZOA 3SKUD 5D96B 1DQLH 1CGYA 2XNAB 1Q1JL 4LRNH 5EO0B 3O6FC 1TQBC 1OD9A 3HUJB 2J4WL 4YFEA 5F9DC 5J1AB 4YHKH 1RJYB 2FATL 3FCTA 2DQIH 3PDGA 4ZFGL 4XP4L 2DQCL 3TWCH 1OAQL 1T04A 5C0JA 3PHOB 3HE7A 3OAZH 3VFSB 3S98A 4M7LH 4LHUA 4HUKB 5EZJA 4PJXA 4Y5YC 3V4VH 3TV3L 2OI9B 1X44A 2EH8L 1X7QA 3MGOA 2V7NB 1IGYA 3JSSA 5I8KH 2LAAA 2PXYB 4LCYB 2DIAA 4Y7MA 4BZ1L 4OM0L 1URLA 5LGJA 1KJ2H 2Z31B 4Z7UA 3VWJB 4POZC 3EOTH 4YIQB 5FYLD 4BM7A 1VKXA 1BVKB 1GHFH 2A9NH 1T1YA 3RGVA 3MRBB 1A3LL 5MENB 4J6RL 2VERN 3MA7B 2W65B 3CFDB 1FIGH 5ALBL 3S37L 5T3ZL 1BMGA 4MB4A 1QQDB 2HA1A 3OKMB 4NQXB 4PJFB 3RI5K 3DARA 4QO1A 4BSWB 4F2MB 4PJ7A 1SJEB 5C0RL 3MRJA 2ERJC 2L0DA 4JM2D 3VXMD 1KTRL 5E8EA 1ZTXH 1TPXC 3NFNB 4IRJC 5T1LD 3TF7C 2L7JA 4EUPB 1K6QL 3B9DA 3EYFA 3ARBB 4NO5A 4GAYB 2GTZA 1G6RH 4ISVB 1F00I 4KHTL 1FNFA 4ETQB 1TZIA 2WZPD 3M8OH 4YK4C 4P2RA 4XNMA 4R7NB 3IXTB 2BHYA 5DVMA 4FFZL 1HHHB 1JUFA 2X4RB 1NFDA 1G7JA 1WEJH 2GFBB 3PXJA 3IFPA 3HAEH 4ODTH 4PV8A 4Y5VB 4YNYA 4MB5A 5EZOL 4XPFH 1HZHH 5E08L 1Q72L 4OCXL 3MRFA 3SJVA 1KB9J 3RP1A 2PYEA 3WDIA 4C59B 1EGJL 1DBKL 4F7TA 1VPOL 4H88L 3CJJA 4P3WA 1R3IL 3LKQA 3WHXA 3G6JF 4WWKC 3GMQA 3I3DA 1OSPH 5DJZB 3QQ3B 5EOQL 4JO3L 3HNVL 4JCMA 1ES0B 3AM8C 3IRZA 3U4EA 1HKFA 2H32H 4YLQT 2NW3A 2YA2A 4B7IA 4NQVA 3UTOA 2UV3A 5J8OA 3JWDL 1C7SA 5I73B 3C6SB 5E7BA 4NRZB 5CZVL 3MV9E 1V05A 4L8SC 2PCPA 2IBZX 4LLDB 1A7QL 1GYAA 3MLSH 4H0IA 4NO2B 5DA0B 3SDAB 3MJ6A 3QRGH 3S3JA 4MGXA 3QNXA 2FYYB 1KCUL 2X4NA 3B5TA 3N85H 1C5BH 3E0GA 4NYLA 1UB6B 3VXOA 3QSKB 2XG4A 2P7TB 2NNAA 3IDIA 4O2CB 4LPWA 2NXZC 1DFBH 3BE1L 2EDJA 1YY9C 3WFZA 3ZSSA 4P5MB 1DEDA 4JZJA 3PWLA 3QDJB 5DMJB 3VGGA 2GEEA 5I71C 1KTLB 2IPTH 4JY6B 3CVHB 4KZDL 1KJMB 3T8XB 5IW6A 5ICXA 3HPLA 3PQYE 1HKLH 1YEEL 3TZVA 3V5DA 2DN7A 3NIFF 5GSRA 2DKUA 1EVUA 4Z78A 3SGEH 5DHVB 1DBBH 3L3KB 1FZMA 4PP1D 5C8JB 5FFLA 1T83C 2HKHH 1IM3B 3L9RA 3DBXA 4CMMA 2ICCA 4KRPD 4OCWL 4UINL 1WZLA 3UJIL 4PRHE 5CMAA 3VFUB 1I9RH 1CIDA 2ORBH 3F12A 4KMQA 5HHNA 3JWDC 2G5RA 5KVDH 4NWUH 1HHJA 5FCUH 1B4RA 1S7TB 5BV7B 2HFTA 4X6DF 3UMTA 2QSCH 1I7ZB 1HINH 5DSCA 2ADIA 2ZWLT 3PXHA 4JZNB 5MI0C 3MV7B 4NCC2 1YYLL 4FN0A 3MUGA 1QR1A 1O5DT 3WUWA 5HHME 2HVJA 4F58L 4XGZA 2HVKB 2V17H 5GSVB 3TLRA 1OGTB 3TNNB 4WW1B 4LU5H 1AY1H 4OD1H 1ORSB 4Y4HB 1PKQB 3RU8H 2W9DL 4JPKH 2YC1A 4N5ED 1Z0NA 3RWJB 3ZYIA 5B8CC 1GGIH 5EFIA 3RVXD 4PRIA 4AT6B 4MWFB 1V3MA 3PL6B 2QSTA 4HFUH 3HMWH 4QRTB 4H25B 5FYJD 1AXSB 1IC7L 1TJIH 1A14L 5DJ8A 1A2YA 3MLZL 3R06A 5DFTA 1XIWD 4PD4J 2BFVH 1BEYL 3DVNA 1RURL 4TTDC 3FFCA 4D9LL 4DAGL 4YZFF 1UWEL 4M43H 3RY6A 5HI4D 4YC2B 5DJ6B 3EDJA 7FABL 2ATKB 3S96A 4F7MB 2Q8BH 3QUYC 5FYKH 4LNRB 3DXAB 2YPLD 2XZAH 4U1SB 5HGAA 4FQQA 2YUXA 2D7TH 5BXFA 2RFXA 1KLGA 2D03L 4L3CA 4QRPB 1N2RB 1S8DB 2YKLL 1DQML 5C08E 1J1XH 1FVEB 1KENH 4HXAH 5EA0H 3T0EE 3GSXA 5EIIB 2AERT 1FNHA 2WBJC 1UKQA 5TPWL 3TO4D 1T22A 4XMLL 5E9DA 4OGYH 3WLWD 3CH8A 1OSZA 4I3GA 4WFEE 2RR3A 1J10A 1MRDH 1GGTA 1Q1JH 2V7HB 2F53D 3RVVD 5GS1C 1D5MB 3NABH 3GSVB 4QRRA 1EJ6A 1RVFH 4JJ5B 5JTWA 5L88L 3GO1H 5DEFA 4JQIH 4P2OA 4XP4H 5JXED 2DQCH 3EYUL 4HUXA 4F8QA 3FQWA 3IYLW 1G7HA 4F7CB 3BXNB 5DJCA 5C0AE 5FEBA 4AMKH 1D9KD 1PKOA 3Q0HA 3C5ZD 4OV5B 3TV3H 1KT2B 4P57A 5HSFA 1FGVH 2DMBA 5DQJA 3VFWA 4U6HA 3QBTB 4XTRD 3RWGB 4A6YL 3ARGB 4QF1A 4OM0H 3DHMA 3IS0X 4HUWB 3RIFK 4HLZG 3MBEB 2D7OA 4Z0XB 4YDJB 2VDPL 4LMQE 4U31A 3LQZA 4MLIA 1NCWH 3S88L 4X6EA 4Z7WF 4R97C 3KPLA 1IAKB 1FC2D 5F3HB 3X13A 2FIKA 4D8PA 3A0OA 5AAMA 4Y1AB 2UUDK 3STLA 1QFWL 4NDMA 1A3LH 4M5YH 4I3SH 2ZCLH 2K1MA 4A2MA 3QIUD 4M1CD 5IMMA 5ALBH 3S37H 3NACL 5T3ZH 2B1HH 3QHTC 4GBXA 1LWRA 5CSBA 1UH2A 1ZVSB 5H8DA 1EAPB 1FNGB 3UTZB 4E9LA 1FFNB 2HLFC 3HC0A 2ADGA 3GKWH 5JHDA 4L3EE 1D5ZB 2B39A 5ELIA 3UCRA 3HTLX 5DHYA 4GRLD 4LSQL 1DN2A 1K6QH 4G6ML 1N6VA 2QHRH 3P4LA 1P6FA 1RUKL 4EXKA 2AJZB 4NKDA 4KHTH 2DTML 2P46B 4WI4A 4C56D 2JCCF 3OGCA 4PJDB 1T2QL 4X80L 4WW2B 4WUUB 3PWPB 3ULVF 1RIHH 1KB5L 1DTUA 2ARJA 2Q76B 3D2UA 4HAFA 1BZ7B 3UAJD 2XA3A 3RVWD 5ALCH 4BQ9A 2GTWA 3G6DH 3LEXB 3HZMB 1T80A 4OZGA 1EGJH 1DBKH 5DGRA 4YX2H 4H26B 2BY0A 1R3IH 3Q5TA 2ZUUA 4KRNA 3ZO0A 1NGZA 3KDMB 4PJHE 5EOQH 2EC9T 4U1IB 5J3HC 3HS0B 3T2OA 5BVJB 2LU3A 3QJHB 1I8LA 2BHUA 2AJYL 3I2CH 3MV8A 1KEML 2FSEB 4FNLL 4L8BB 3RQ3A 1RMFL 5CZVH 3EYVA 1MJ7L 3QXAB 3GMPB 4FZEL 2PO6B 4NOBA 5L2KD 2VXSL 1OGAD 3MUHL 4OIIH 3ABZA 4X5WB 3OB0H 1FRGL 1KCUH 4PJGB 5CBAA 2AJSH 1P84J 4MJIB 3S3PA 3MUY1 5IMKB 4MS8D 4G7YL 1QHPA 4UBDD 2FEDD 3BE1H 4WFHE 3GZKA 2VR4A 4KV5E 4CMHB 5BOPA 2R23B 2GSIB 2XN9B 3RKDC 1QO3A 1T7ZA 5I8OL 1U93A 3DSNA 3S4SB 3SCMA 4CVXA 4KZDH 4UV4L 4MD4A 1KN2H 2R9HD 1YEEH 1NMBL 3HFMH 3EO0B 3VI4E 1MCNA 1MWAH 4OZIF 1EK3A 3QUXB 4FQXA 4BQ8A 4L9LB 3WNOA 4K7FB 3B3IB 1K5NA 1FDLH 3MMEB 4KC3B 1T1XA 4LARL 4XNXH 5IW1B 2J6EH 4UINH 3UJIH 5IB1A 4MMZC 4JFDE 3K0WA 2JJTC 2WSKA 4RNRB 2LE9A 3DV6B 5EU3B 4AZ8A 4RGNE 3MREB 2Y07H 1NGYB 1VFAA 1WBXA 4LK4A 1I7RB 4P4KC 3GJFB 5FO8B 4AM0B 1S9VA 2R29L 4GRWH 4KUCD 4XP1H 3F5WA 5MERB 3IETB 1EEQA 4F58H 4APQA 4X6BB 4D9QD 3DUSB 5D70L 3B5HA 3VXRD 3LS5L 1WF5A 4OLYL 5A3ID 1RZ8B 1JF1B 3SKNA 4RBPK 4HS6A 5I1HH 1E28A 4W81A 4JZOB 3O3AA 3QXDA 4PJIF 5MEQB 2W9LA 3MRDB 4JR9L 3KPRA 4HQQL 5CSZB 2W9EL 3GDBA 1CLYL 3PWJA 2PN5A 5HD8D 4R7DA 2VLRE 3RIAK 5KVFH 5J4MA 1MHHB 5A1AA 4W6XB 5CGYD 3WCYA 3T4AA 5L9DH 1B0GA 2JJWA 1IC7H 1G9NL 2CMRL 2CDFA 4MJ5B 2ARWA 1BEYH 1WT5A 1AC0A 1PQZB 4XBGA 1XF1A 2OXGA 4DAGH 3BP5A 1UWEH 1ZLUK 5CJXA 3C9NA 4PGJA 4MSWA 4M02A 4ZSOB 3G5XA 2APFA 3RAJL 5HI3C 5DDHA 3RVTC 5H2BB 1H3VA 3MJ9H 4YEEA 4AENB 3SDCB 2NLJB 2AV7A 3GRWL 2DLEA 2DMKA 3PGDA 4JN2A 1NFKA 2FGWH 2ICWA 1QFUL 4YR6B 2NW2B 3HRZA 4GJTB 3OG4B 2DIJA 2H6PA 4I0PC 2PNDA 1IC5L 4TRPH 5TPWH 4XMLH 3BWAB 1Z9OA 4PGBA 5M94B 2NY1B 1QRNE 2FD6H 3ZDZE 1Q0YL 4JG1L 2DMCA 3VWKA 4HUMB 3T1FB 2YEZB 2AJ3B 4Y4KD 4OZHE 3PNWB 2CR3A 3LKRA 2EECA 2H9GA 3BT2H 3QUKA 4K94C 5SX5H 4KDTA 5A2JH 5GS2D 1YMME 2Z93B 3WYRA 2GT9A 4NKIL 4FG6D 4GW1A 4GKNB 3PP4L 5D1XD 1UKSA 1U8QB 4OF7A 5DQ9A 1ZT7A 1OM3H 3V2AR 4JRYA 2B0SH 2C7UA 3U0WH 1CXFA 1LK2A 2BC4A 3T2NH 4I8DA 1TQCB 2XI9A 2V2WB 1HK6A 3DX9A 4Z7UF 1RZIB 4PJ8C 3ME0A 5C07D 5C09D 3QDGE 4MNGE 3I50H 3BQUC 4F80A 4JFEB 2BY3A 2AI0L 3S34L 1K3ZA 2VLJB 35C8L 4ZS7L 2EXWD 4RDQF 1RZKL 4JB9H 1K8DA 2BDNH 3LHPL 2AS5M 1R24B 5L8KB 5IV2B 1MLCB 1CFNB 1W0WA 3NACH 5F6HJ 2CRMA 2J88L 5ISZD 3EDFA 2HMID 5D2NB 3LV3B 5D7LB 2VTFA 4LDOB 3J7HA 1XGRA 5D5MF 1SBSH 2F54D 4HUUB 4PRPD 5DRNA 4NN7C 1SY6L 3BI9X 3V6FA 3O11A 1F11A 1U36A 2BNRA 2DQJL 5DFVD 3OXSB 3UBXA 1S7QA 3JV4B 4G8FB 3GJEA 1HHGA 1X5KA 3O3EB 4E42A 2BSRB 3I6GB 2CLRB 4HZLB 3ESVF 4G6MH 1BIIA 4LEOA 5I30H 3KPQB 1AQDA 3VFOB 2DRUA 2B1AH 1K85A 4OT1L 2VISA 3FB6B 5DRZB 1Z3GH 3BEVB 2DTMH 1MCBA 4Y2DD 4Z76A 3RPIB 5MEOB 1YDPA 1T1WB 2PYFA 1W2KT 1XH3A 4PY7B 3BP7A 5JDSA 5KG9A 3GFUA 4V2BA 5F7FA 1EBAA 1HXYB 5F9JB 1I7UB 4X6FB 5KSBE 3MRGA 2C4FT 1RZKC 2VDOH 4KK5C 5CSGA 3S5LA 1VDGA 3VXSA 3QWOA 1XGPB 5J9PA 2OXHA 1SHMA 4Y89A 3ARFB 2IF7A 3JV0A 1U3HD 2QR0B 5TGBA 1GCFA 2A2QT 3QUZD 5E1HB 1DBJL 5BRZB 3O6ML 1FFPA 2AJYH 1N8ZB 4IJ3C 4POUB 5GRXG 1MJUL 1QKZH 5IMLA 1DDHB 5F44A 1GXEA 4CRPA 5HY9B 1RMFH 1EERB 5F9WC 1MJ7H 3BUTA 4DEPB 5FGBC 5IOPA 4FHBD 4JFQB 3I3BA 5C2BH 2FH8A 2ZSWA 5HHOA 4KROB 1N0XL 2VXSH 4LBEB 4X6CE 5CBEB 1PJ9A 5I1DB 3RNKB 2F58L 3L3HA 1FRGH 1P6AB 4YO0A 3G6JB 3QDMA 3KWWA 5IFJB 1ZHNB 4D3CL 1YC7A 5SWZD 2GW5A 1P5VA 5CINH 4FTVE 3V0VA 3DRQB 5I8OH 3EYQC 4XVJL 3JWNC 4UV4H 1L6XA 4P5TD 4W4NA 3H9SB 1CXEA 4KTDH 2VXVH 4I4WA 2IAMD 2I25N 4NZUH 1XF2B 4MA7L 4NPYA 1A0QH 2EYSA 5F6HI 4LARH 3VGDA 3RA7L 4G80B 5IHZB 3MR9B 3MFFA 1N4XL 4XNYH 1E27B 4OLZH 3KYNA 5IJKA 1JBJA 4ETYA 3VG0H 5L2JB 4JM2C 5I6XB 1YY8A 1MAJA 2NX5E 1ETZB 1CICA 3NOIA 4PJEA 5EUOE 3QDHA 5T1DH 4GG6E 4EI5B 2OX5A 3IS1X 1KLUA 2R1YA 3BZDA 5LXGH 2R29H 1WFUA 5ITBH 1TITA 3O8XB 1EZVY 1K4CB 4X7DC 4F57L 5D70H 4J3WA 3LS5H 2DQUH 4OLYH 4BK4A 2WBKA 4NQSA 3MRMB 1JGLL 3QPXH 1KXVC 3I75A 1D6VH 4PJ9D 1PDKA 5E7FA 3DTXA 1Z2KA 1KFAL 3OJVC 3ETBF 4H5SB 3P0YH 4X6DB 3O0RH 3OG6B 4HQQH 1T3FA 1CLYH 3ARDA 5K59F 4MNQE 4TYUA 5FHAL 2EC8A 1CLOH 3O6FA 3F7VB 5C0IB 2XIDA 3D39E 3BIKA 4H1LA 2DM4A 4R96A 5E6ID 4TUKL 1KJ3L 3G5VA 3CUPB 1JF6A 3FAXA 3FT3B 2FCBA 3HNSL 4P9HL 5TJWK 5JZ7D 4G7VH 2HFEA 5DJDA 2AQ1A 3EDEA 5FUZL 3RAJH 1XT5A 2XWJB 5C0FB 4LLQB 1MLBA 1S9YB 4PRAA 1EO7A 3GRWH 2EO9A 2P5EB 5JDJA 1HHIB 3A67H 1WK0A 1J1PL 2BP3A 1K8IB 1QFUH 5H94A 1V7ML 1MJ8H 1LILA 2IANB 4XNZB 1MHCB 5DD0L 5C0BD 3KLSA 3GIVB 4O2FA 3K80A 4U0QB 1I4FB 3BMVA 1FG2B 1P4LA 3LB6C 4M6NL 1LDPH 1MCJA 2UZIL 1Q0YH 1IAOB 3NIDE 4TPRL 2OJZL 1MNUH 2BVOA 1AKJD 2VE6A 4JFFA 3VI3F 5HYJE 3U30B 2M1KA 4PP1C 2XOTA 3C60D 4YUEH 4DGIH 4RAUB 4KRPC 4UIKH 4GKSB 4JVWA 4F37F 1WJ3A 3TC9A 4WEBH 3BHBB 4UDTB 4P4RA 4EUPH 1PD6A 2VWEE 1FAIL 4WY7L 1KPUA 1INQB 1NQBA 4P9HC 4D94A 4QY8B 5TE7H 3HPJA 1CF8L 5EO1B 4ZAKA 2VLLB 4P2QB 2P5WE 2EDNA 2BCKA 2BXYA 2E9BA 3GI8L 3OAYK 4Z95H 1KULA 2RGSA 1LHZA 5ANMB 3OKYA 3D5OF 4HUVB 1KC5H 1ROWA 3Q6FA 3SN6N 1MFAH 1R3LB 1OW0C 2VLMD 3CFBB 4X0KA 4Z5RA 5C7XL 1ODAA 2QADD 2AI0H 4X99A 3S34H 1C5DA 5L0QC 1A6ZB 3OJMB 3V6ZB 3I3EA 3FO0L 4UIMB 3K8MA 4N5EC 4LOUD 3H3PH 3UTPD 5CWSA 1NJ9A 2CDEA 1LO0L 4OCSL 4LIQH 3RVXC 5BVPH 1P2CA 2BSSA 5JOPE 5T3ZE 5T1MA 5I1EL 2M2DA 2XG5A 5IESH 1G7MB 5IFAH 1CXHA 2R1WA 3AAZA 1SY6H 3U9PH 5ILTL 1M7IB 3RL2B 1H8NA 2DQJH 4Y19B 3P0GB 1ZHBA 4Z7WB 1XIWC 3BO8A 4XH2A 5BJTB 3U79A 3AXLA 2IPKB 3MQIA 3BN3B 4F33A 5HI4C 1HN1A 4P5KB 1A6WL 2ZUVA 3KS0J 3C8KB 2V2XA 3FKUS 1OY3B 2ID5A 2R4RH 3VXPB 4NWTH 4YHLL 3PWUB 2VC2L 4U0RC 1XR9A 4E0RB 1IT9H 2W60B 3HC3L 2OQJA 1QBLL 2M8XA 1VFBA 4LSRL 4UQ3B 4LCWD 1X9QA 3CVHH 4JDVA 3WNKA 1U8HA 3TN0D 1BFVH 4HPOH 3VFVA 4NJ9L 4JG0H 1W0YT 4XPTH 4FXGB 5DHVH 3TO4C 3D69A 1YUHB 3WLWC 1CGUA 5I16A 1GL4B 1TCMA 1U95A 1GH7A 3HR5A 3W2DL 3KYMB 2XKUA 4MX7B 3RVVC 4HW6A 2GJ6A 2JCCB 3PDDA 3S4SG 5B38A 4GMTL 1BOGA 4TN9A 2P24A 3X11B 1MCPL 1CXIA 5JXEC 4AQOA 3SDDD 2JLLA 3SGJC 1LO2H 2GCYB 5BV7H 4K9EL 1JN6A 1NC2D 3PDOA 3DMMB 1FAKT 4JFXA 2YRPA 1MPAH 1JJUA 1D9KC 1N0XH 3DI3B 3C5ZC 3C08H 1BM3L 3REWB 4ZO6A 2P4AB 3RI5F 3IGAB 4OFKA 3QH3B 3O2WL 1KPRB 4XTRC 5EU6B 4NQDD 1GOHA 3QIWD 1JTOA 4NJAL 5BS0D 3GGWA 3PWVB 5I1AB 3VFTA 3UJTH 4HIEA 1I1YB 5HPMA 4NNPL 5D7IA 3T0AA 1QFHA 3EJZD 4L4VA 2GJZB 3OGOE 2OTPA 2AK1L 3VI4F 3CZJA 4WTWA 1HHKA 2WBWB 3U1SH 4LLAA 3TIEB 4OGZA 4DGYL 5GGSB 1V3LA 1DN0A 3MRCB 3QWRD 2XWTB 3K1KC 4M1CC 1DQQA 2D31A 2EYTB 5F1IA 4PJ5E 4ORGB 4JAMB 4FXKA 2H41A 1QLRA 4OM1L 5KSAA 1N4XH 2G60H 1Q9KB 1LO3L 5IQ7L 3H9HA 1NMAL 4YDVA 1N64L 1H8OA 3MRNA 5HVGB 1HCFX 1EEZB 4LCUA 3NIGE 3WD5L 4K9EC 4FZ8H 3IDXH 4L8DB 5DK2A 3NA9H 3EBAA 4RFOL 4GRLC 1Q9LA 4YAQA 2YXMA 1QSFA 2EYRA 4PGZA 1ZWIB 4MQ7A 4OZIB 3UTSB 1BD2B 4RGMB 4ZNCD 1A9BA 5EOCJ 4HWEL 2YD1A 2XACC 5ACLA 4PB9H 3QUYA 5JR1L 1AGEB 4J3XA 5J13B 1GGYA 3NCMA 3FQRA 4OJFH 5E2JA 5M7QA 3MO1B 1SYSA 3AS2A 4KY1H 2BHZA 1I9JH 3HE7D 1I1FB 5GRUL 4R4BA 2YSSB 3QUMA 4L4TE 3UAJC 4TSBL 3O81A 3RVWC 3BPCA 1KFAH 3O3BB 5GRJH 4KMTL 4OD3H 3RTQB 4M8QA 4KUZH 2FDBP 2Z91B 2P43B 4I18B 4O51B 5FO9A 4J8RB 3RUGE 4CNIA 3E8UL 1NDGA 5FHAH 3GSWA 3P30L 1RJZA 4EVNB 5GS1A 4XPGH 1JCKA 1Q94B 1EO5A 4ZPTA 5J06A 1X5FA 4RFEA 3GMNB 2CUHA 1E6OL 3ZMRA 1J5OL 4TUKH 3VG9C 1I85C 1KJ3H 2X4SB 1U8MA 4JFHE 2VNCA 1A4JB 4YDLB 5IT2H 3MLTA 2CKNA 4XHQA 3WSQL 5D1QB 3SQOL 2NTFA 2R0KL 1CR9L 3C6LB 1TDQA 3EOBA 4R3SB 5FUZH 4CAGA 5BCAA 1P7QB 3WKML 2NY3B 3PGCB 4QCIA 5IM7A 1UJTA 3SGKA 1TIUA 4FQHB 1YEFH 1SJVA 3BISA 4MS8C 4M03A 4UT9L 1HSAB 4UBDC 2YPKB 3HG1B 4XBEL 5F1NA 3QEQB 2X70A 3BKJL 2CGRL 5DD0H 1ZSDA 3MV9A 3BP6A 4HEPG 2EDOA 2BY2A 2E9IA 1F3JA 5KZCD 1I9IL 2XQYG 5E8PA 3ZDZF 4AEIL 5EBMB 4PRNB 2UZIH 2OJZH 5K9OB 2O5ZL 5F6IC 1JZ2A 2XFXA 4MMXC 3CLEH 1JNNH 1MI5E 1U6AL 1SEBB 2J8UA 3I6LE 4P2RD 1UVQB 4OZHF 3EO1B 4M7ZC 1UM6H 2PTTA 2CD0A 5JQHC 2EDQA 4U6VL 3BIBX 1F2QA 3BH9B 4NRXA 1LK3L 1MFNA 1WBZA 4YHML 2NXYB 1TZGH 3P9WB 3SJVD 1FAIH 4MDIB 3LH2H 3VU2A 4YHNB 2CK0L 1BWMA 4NFCA 5HTSA 2AJVL 2R8SL 1UXSB 1FNLA 5DUMH 5K9JH 5EORH 5H35A 1BX2B 1FNEA 2E27H 2YA1A 3GI8H 3MA9L 3BMWA 4R8WH 4IMLB 3C8HA 4CDGC 4DKEL 1HQ4A 2IQ9H 3ULUH 3L95A 1A6VL 1NGXB 1T89C 3GSNA 1F4WH 5A3IC 1H5BB 3P0VH 3GSQB 1RZFL 3M07A 4N8CL 3MOBL 3BDYL 4XCFL 1T04B 3LKSA 3UTQB 4KI1A 1TTUA 4U1GC 3A6BL 4XPAH 1IC4H 3OWEA 4EKXA 3T0DA 1FZKA 1EHLL 3T4YA 2Q6WA 4LHUB 4S2SB 3WJJC 4L1DA 5IWLA 1LO0H 4OCSH 5D6DC 3ARGD 1FYTB 5FECA 4HC1L 1IFHH 1NPUA 3CFJA 4U1NA 3PHQA 5HD8C 1UCTA 3UTTB 1QYGL 5CGYC 3JTSA 4ZUTB 4RRPG 5TFSL 4M62H 5IF0B 4NNXA 1I1RA 1IM9A 3U4BH 5KVGL 4ODVL 5GZND 3TZVD 2Z9TA 1ZKAA 3GSOB 1T1YB 1EHXA 1MRFL 2Y4SA 5C86A 1A6WH 1YEKL 3OR7A 4G5ZL 3WNNA 4JPVL 4H20H 1S78C 1VEMA 2BVTA 1LP9E 3MODL 4YHLH 1BVZA 3I02B 1UXWB 4W70A 4DQOL 2XPGA 4WU5B 3HC3H 3NH7L 1QBLH 5D5MB 4LSRH 4XCEA 1QSEE 3FQXA 4WCYL 4LNVA 4XP9H 1I8KB 1G7QA 1RUAL 3DSFL 1R5VA 3MRJB 3VGEA 2AXFB 1MRCL 3CFKB 1HDMA 5ADOH 2ESVE 1EJOL 4WI2A 3L7EA 2NCMA 4X4ME 4PLOB 4ZXBB 2AJUL 2AXHA 4Q97A 4Q9QL 5CGMA 2G5BA 4M4PA 2BOCA 3DYOA 3RIFF 1BOYA 1KACB 1X4XA 3S36H 5HJ3B 1AC6A 2W0KA 3QP3A 3U9UB 1AO7B 1Q9OA 3CFEA 3T04D 1MCPH 4IIQB 4U3HA 3BD5A 2BNQE 2MPAL 4R26L 1YNTB 4WDIB 2VDNL 1QNZL 4FG6C 25C8L 1JGVL 1RZ7L 4OD2A 2XKNB 1L9MA 5D1XC 1IEBB 4LLYB 5B3JE 4X6CF 3MNZA 3VJ6A 3GJFH 4LPVA 5FOBB 4U1KB 1BM3H 2ATPB 1ND0A 1QLEH 5DO2D 5EOCL 3WHXB 3NCEB 5D7JD 2DQEH 5HGDA 3FOLB 4AIXA 3MZTA 3O45B 1HQRB 3DO7B 5TF1L 1CK0L 1OAXH 1G7LA 3MGTB 4ZFZB 4M48L 4M7JL 5GGTH 4NNPH 4LPCA 1S7SA 2J3SA 5HGHB 8FABA 3GBML 3CU1A 5FA3A 4TOYH 2EXWC 5JNYB 3GHBL 3KYAA 3NAAL 4XAKD 3V6OC 4O2EA 3KXFE 5JO5A 4U3CA 1LO5B 5DZNA 2HT3D 1H0DA 4PR5A 4KK8D 4ZDHA 2HMIC 2X4NB 4YFLI 2OR9L 4OM1H 4ERSH 4NYLB 1EMTL 1G7PA 3O9WB 1YNKH 5IQ7H 2H26A 1OAYL 3SPVA 2W0PA 3B2UD 1N64H 5DFVC 3G04A 5CZKA 2HTLD 3D6GA 3O6KL 3PWLB 3L5IA 2WINA 5EO9A 3IU3A 5DVNA 5E9DD 1KG0B 4PJEF 3MRIB 3PQYB 3D85A 4Q9RH 2BNUA 1ZANL 3E3QC 1DBAH 2P8LA 4LLVB 4K7PL 4IRZL 4HMEA 3EO9H 4NZTL 4XX1E 5HBBA 1KJVA 4OB5H 3VE0A 4NO3A 3CLFL 3W9EB 5F88B 2FZ3B 5JR1H 3BW9B 2C9AA 2LTQC 4QRRD 5I1GL 5CCKH 1T5WA 4Y2DC 4U6XB 5DJAB 4P2OD 3BGFB 1FN4A 3WFHA 3WFEH 1CBVL 5JW5A 2E7BA 4I0CC 1UZ8A 3P9MA 5CJOL 4D0DA 2MQ0A 4I0PA 4HK3J 4ELMF 2DYPB 3KVQA 5H37G 3IDYC 4D0BB 4TSBH 5D9SA 3ZDXF 2VDRH 2HN7B 5LGHL 1FVDB 3X3GH 2P8MB 5GRWA 5JXAL 3QEHA 3WEXA 5MP6L 2QQLL 1NGPL 5DTFA 4XVUD 2V5TA 3T1WA 4Z6AT 1GC1H 4OCYL 1QR1B 3P30H 1U3HC 2IH1A 3RY4A 1P5UA 1UJ3A 1TLKA 5JUEH 2DWDB 3KLHD 3QUZC 1LD9A 2YMXH 3BJ91 4CL7A 3P9LA 3VGHA 4LSUH 4U1HA 4UILH 2A83B 4BA8A 5ESAB 1J5OH 4X83A 1W72A 2IADB 4JLRA 1OOAA 1JV5B 2BOBB 2AEPL 5CP3A 2MJWA 3SQOH 2YC1B 2R0LH 1JF5A 3EIFA 2D0FA 4O4YH 2BVEA 3QEGL 1T0MB 4GBXD 3VD3A 3W0WE 3RPKA 2AKRB 2FGZA 4S1DD 1RZJL 1CWVA 3LZFL 5DMKB 5T3XD 1I7TA 3LN5A 5JHDD 5E56A 5IVZA 1LNUA 4HD9A 1F6AA 4HIJB 4XBEH 4ORZC 3PG2A 5HHQA 4Y5XA 4XCYB 5DJ8B 1AGCA 3BQUA 2F8OA 1N5YL 3GHEL 3KPNB 2D7NA 4OLUL 3G08B 3U2SB 3L5XL 1YPZF 4P5TC 5B21A 3QO1B 3ZKMD 1I9IH 4RMTA 2X7LA 3RL1A 2LU7A 2IAMC 4E5XA 2OL3B 4P0DA 5JHLL 4LSPL 2J5LB 2OM5A 4X4YA 4MJ4A 5A2IH 3GMLA 2X4OA 5IG7B 5ICYB 2N56A 3T3MF 1CU4H 3F7RA 4N0UA 3B4NA 1NFIB 3MLYH 4U6VH 4FQQB 4IDJH 1PX3A 5ABDE 3D2UD 1NH6A 2DWEB 1A64A 2BVPB 4YHMH 4JREC 4HGWA 3WFCH 2VLKE 2GITB 3T0EB 2AK4B 4AEEA 3MBXH 1K4DB 1I1CA 5T5NG 3RIAF 1MHEA 3S3SA 3KS0H 4BSVA 3O2DL 3G9AB 1YEHL 1RZJC 2V6HA 2N1KA 3MV8D 1IGFL 4CJ0A 5FHBL 1KIRB 3QIBA 3TBTB 3UO1L 5HHPA 4MCYA 3R8BB 3IU4L 4HV8B 3MOBH 5EU5A 4PJ9C 5I1IL 1G7HB 5C0AB 4JHZA 4XCNB 2EDEA 4NT6B 3NTCH 5DJYA 4HC1H 1S5HB 4HBQA 2BRQA 3BDXA 1BQHB 3QG7H 4YBLC 1HXMA 1QYGH 5C71A 4QF1B 3L1OL 4CN6A 2FX8H 1U8PB 3ULVL 4XPBL 5A2LH 2JJUA 4RGOH 3SCMD 1WFTA 3PV6A 5E6IC 4F3FA 1FZJA 3KPLB 4ODVH 5KVGH 5FGBA 2ZPKL 2AXGA 1E4XL 4D8PB 3OJ2C 4FQXD 3SGDI 5IBLD 1PW3A 5JZ7C 4G5ZH 3H3BC 3TPUA 1X5ZA 3O6LH 3QCVH 2ITDB 3R0NA 2LVEA 4FQ2L 4DQOH 3SO5A 1FYHB 4LP5A 4HCRA 4BFEA 4NQCD 1K2DA 2FJGA 4NN5C 3QR2A 4WNQA 3HCVA 3P4NA 1RUAH 3DSFH 4L3EB 1SBBA 2X4PA 1EJOH 3TBSB 1L7IH 3TH2T 3IKCB 4Q9QH 1ZLVK 4JGMA 1B4JL 1VEOA 2GK0B 3FB7B 4ODUB 1WAAA 4APQD 4J4PD 1F4HA 4NKDB 1M71A 4NUJB 3C60C 5J6GA 3OGCB 1PZ5B 3E2HB 3SKOB 4BYHA 1ED3A 2SEBB 1ZT4A 4WFFE 1BZ9B 1NGQL 4FXLA 1H15A 1NDMB 4JM2A 4Z9KB 1MH5A 1QNZH 2EE9A 3ZE0E 25C8H 3VXME 3L5JA 3TVMA 2CRIA 2EE2A 4EQ2A 3NMEA 1FLRH 5DF0A 5T1LA 3TBYA 3KPRD 3MV7E 5B4MD 2H2SD 3NGBB 1WV7T 2MKLC 2W59A 4L1HA 4XNQB 5EOCH 4LVEA 1NCBL 4KJPD 3QXUA 3WN5B 2CQVA 5E94A 3U6RB 4PJHB 1LE9A 2Y1VA 2IPUG 1NGZB 2YR3A 1CK0H 3IXAA 5AUMA 3RWEA 1PKQE 1U92B 1NC4A 4JFZL 4M48H 1HEZB 2A0LD 4I48B 3V4UL 1VGKA 3BESR 3GBMH 3ES6A 3LD8C 1ULVA 4G8EA 5KOVC 5D7IF 2QADC 3B9AA 3F7YA 4KVCL 32C2A 5FKPB 1ZEAH 1GGCL 2OI9C 2HKFH 5E8OA 4I1NB 4M61A 1CG9B 4U05A 5IQ9A 4P49A 5JIIA 5KN5A 3KAAA 3P40A 2ZZUT 2VXQL 2F15A 4WU7B 3LDBB 4N1EA 2WP3T 4TNWK 4LLUA 2X42A 4Q0XL 4ZUWA 4HK0B 2QQKL 4YHOL 1P4IL 3LQMA 3IJHB 3ZKXB 4JM4H 3TT3L 3V52L 3LEVL 1Y0LB 1MCQA 1JZ8A 5EU4A 5FYJU 1JZ4A 3RVUD 4Q9CA 5GIRB 4PP2B 4MNGA 4U7SA 4WV1B 3TBVB 3EAKA 2B4CL 3C09C 3CC5A 4OF0A 3U0PA 3WIHL 3K3QA 1SMOA 4HULB 3BAEL 2P1YA 4C58B 1ZANH 1C5CH 2PW2A 3GKZA 4HGMA 4NZTH 4PB0L 1NKOA 4K7PH 3VWKD 1JZ3A 4K3HA 5J89A 1HSBB 5DVLA 4OF6A 5F8RC 2GSGA 2Y72A 5KVEL 1JHKH 1TJGL 4KZEL 3QQ4A 1WSST 5FB8B 5J7CC 4QRPE 3MLPA 1CBVH 2FHFA 1FCCA 2Q87A 4WTZG 1JPSH 5F9OL 1MAML 4JFDB 5CJOH 3QG6A 4AH2B 1WFOA 2CLZA 4PYHA 3TN0C 4EI5D 2FEEI 3BZ4A 2WM0A 5FUCC 4JRYD 3S36X 3U36A 5JXAH 3PJSB 4CVWA 1DQJA 1NSNL 3NZHL 5GJSL 5K93A 1G6RA 3WL9B 5ID0A 1C12B 3STZB 2Y7QA 3M17A 4OCYH 3CDGA 2NY6B 3HHRB 4JRXA 2YRZA 2JB6B 1QZ1A 3FN9A 3QJFA 4IRSB 1JPTL 4RSVA 2YOCA 3HAEA 3TJHD 3SDDC 2ZUSA 4BKLB 1E28B 1TFHA 1JGEA 3RNQB 3MPCA 3J8F7 3O3AB 4MD0A 2M26A 1QG3A 5CILL 2HRPH 1VA9A 3QEGH 4HF5H 1ZA6B 5JW3L 1OPGH 4K71C 1A1MB 3JZ7A 3ZE1F 4WO4B 1UC6A 2MFNA 5B38G 4B0MM 3QIWC 1FORL 2BNRD 3LZFH 2B2XL 2UWEF 3FO1B 4MD5B 4O9HL 1B0GB 2H32A 5F70A 1OW0A 2IGFH 2W38A 5I73C 3O4OC 5C0DB 4N0YL 3WUZA 3V7AG 5KVMC 5TDNA 4UDUA 1B3JA 3EJZC 4NQTA 3L5XH 3KJ6L 3D0LA 4LL9A 2ZUQC 1N6QL 3GMOA 2P8PA 5GZOD 3Q3GB 3ZYJA 4HKBA 2J8UF 1CLCA 2IH3B 5AZ2L 5EIQA 1YEIH 3NN8B 5FYKU 4FQLL 3RZWA 1PEZA 4FTVA 3BH8A 4N0CD 1ZHLA 5E5UB 1XIWA 4PJAF 1YECL 1Q9WB 5K9KB 3FO9A 1WZMA 2PUQT 2H6PB 1A5FH 4ZNEE 3WDHA 1BFOA 1GRWA 2WUBH 1T21B 1RHHA 1ZOXA 4LQFL 4R4FH 3VXSD 4GXUN 1ZHKB 1AD9A 2VABB 2XZQH 4UB0L 2VUYA 4C4KT 4HWBH 4FQCH 2Q8AH 2FX7H 1XF4B 4BJLA 2VAJA 1QRNB 2AJXL 3BYYA 4UUJB 5MHSD 4V1DE 4YXLH 3RDTB 4FMFA 1R3KA 4QHLB 2EKSB 5D93B 2YPLA 4WUUE 3PWPE 4OZHB 5GS0H 1IGFH 5I75B 1AHWA 3HN3A 4QRUB 3IU4H 4G6FB 4PREB 2MQCA 1WFNA 1YMMB 3HE7C 5I76B 1U8KB 3B9KA 1UWGL 5EDXA 5F89A 5HHOD 3VH8B 3AMLA 2FJFA 1A7PL 2Q3AA 4M93B 3V4PH 4AG4H 4P2QD 4GG6A 4JHAL 2DAVA 2C7UB 4MAYB 4KI5D 3QDMD 5EPMB 2OR7A 2F8VA 1CD1A 2CJUH 3BSZH 2PR4H 2F53E 1RK0B 3WS6A 2D0HA 1S7UA 2FO4A 1OAZL 4XPBH 3ULVH 4JHWL 1KJ2B 3K8LA 1QLFA 5JXEA 5D6CA 3MACH 3TYFB 4WEUD 4MHHI 5ID1B 5JLZA 1FVCA 4BUHA 1MY7A 4Z77B 3VRLF 4HDIA 2XRAL 3K1DA 4ALAL 1YMHB 1YEJH 3F62A 3T77B 1LVEA 3C5ZA 1K8DB 5CD3A 2ZOKA 2WANA 2F9BT 4XXCA 2MCG1 3ULSA 4MJIE 3WFDL 1XGTA 3I85A 4UTBH 2H8PB 2DLIA 5EZIH 4Y19D 2X5PA 4JDTL 4OKVA 3SO3B 5ECJE 4PIRF 4NP4L 4HXBL 3UBXB 2VDML 1OARL 5DJ2A 3DV4B 4KVNL 4Z7VA 3PABB 3QA3A 4Y16B 4S1SL 5I1JH 3T65B 5AG8A 2YWZA 4IMKA 1WISA 3T0XA 1MCHA 2FRGP 5I2IB 3FQNB 1QBBA 5AWNH 3T08A 2BVQA 1OTSD 1UCBL 3TBWA 4N0FB 4DCQA 1WZ1L 3K2MC 1A7RL 4LPTA 1KGCD 1XH3B 2EEBA 2BSED 3B2VH 3KR3L 2ZCHL 1Z5LA 3MRPA 5KSBB 4QNPE 1DBML 4KDWA 1KCLA 4GG8A 3TCXA 3ARDD 1U58A 4LVNB 1U8LB 4B7LA 1FFOB 5I15L 1JNHA 4EN3B 3TIDB 4R2GD 4C56A 2WLYA 3MRLA 3VXQB 1X4ZA 3CK0H 5E4EB 5CZXC 1KIQA 4YPGA 2V2TB 4XBPA 1HOCA 2CSPA 3FT4A 3GMRB 4OIBA 5A16A 4ELKB 5IVXA 3V4UH 3WIFB 1EFQA 3RX7A 5ENWB 2FECI 4KVCH 4S1RH 2CIKA 3FJTA 3OKKA 1GGCH 1IAII 1IMHC 3LPWA 3OZ9L 2GJJA 5D2LE 1N7ML 4N0RA 2X41A 4X6CB 3MROA 2P5WA 1A6AA 5KSUA 4S10A 3ARGC 1P4IH 3DGGA <