2MH4A

Solution structure of the big domain from leptospira interrogans
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
92
structure length
92
Chain Sequence
MPAALVSISVSPTNSTVAKGLQENFKATGIFTDNSNSDITDQVTWDSSNTDILSISNASDSHGLASTLNQGNVKVTASIGGIQGSTDFKVTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the Big domain from Leptospira interrogans
rcsb
source organism Leptospira interrogans
molecule tags Unknown function
molecule keywords LigB-like protein
total genus 9
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2013-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02368 Big_2 Bacterial Ig-like domain (group 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2mh4A00
2MQGA 1E5UI 2N7SA 2MOGA 2L04A 3NCWA 1F02I 2MH4A 4AQ1C 4HU8A 1CWVA 2ZWKA 4AQ1A 2ZQKA 1F00I 3NCXA
chains in the Genus database with same CATH superfamily
2ILLA 4IHOB 4L8DA 4LL1A 4NKQB 5BVPL 4HCRA 2ZX8A 3DDGA 4LAQH 4NUGL 1BREA 2XTJB 3NRQA 1CD9B 3GRWH 3D0AA 3D9AH 4TNWF 5BUPA 5IVXF 1QPPA 4BINA 4J3OF 2XA8H 2EDHA 5L4FA 3ASNB 3TESA 2FECI 4YC2C 1E6JH 3LRLA 1OAZH 3SE8L 2COVD 5CJ8A 2AK4D 5I5RA 4O58L 3QW9A 3TA3D 2YD1A 1A7RH 1FVDB 4XMWA 2XG5B 4MXQD 2D31B 1QLRA 3UROR 1YNTB 2XA3A 3S3BB 3T3MF 1A47A 1I8AA 3LVEA 2MKWA 1MVUA 4AEHL 3MBEA 4AQ1A 3MZTA 1MIML 5BW7C 1RUQH 3O2WL 2UZXA 1FLRH 1U93B 1WFTA 3AWFA 1A9EA 4ELKB 4EI5C 4OJYA 4CSTA 4HS6B 3K72B 3DDFA 2JLLA 1JPST 5E95B 5TFSL 7CGTA 1KLUA 1QHQA 2M2DA 1DEDA 4XP5H 1GGTA 1QPKA 2V5SA 3S5ZA 1MJ8L 3QDAA 3DO7B 2NPLX 4OI8A 5C09B 3U4AA 1XMEB 3AGVA 3I85A 2VWEC 1E9PB 4N9GB 3G5ZA 4NKDB 3GDCA 3BLPX 3LNIA 3TVMC 2VE6B 4OV5A 1B2WL 1S9WB 3ZQ9A 3L5IA 4DPRA 4PV8A 1KIQA 4OZIE 3C5ZC 3GXIA 2PPAA 3F64A 4RBPK 1OP5H 3UXFA 3ULUD 5EBMB 2Q76A 3V52H 3UCRA 4KZDH 4EO5A 1PGRB 1Q0XL 3ARSA 3HN8A 4FG0A 4J3SA 4O51B 3FCSB 4H8WL 5LNDA 4KJQD 3FU5A 3H0TB 2FL5B 1AFVL 1UM5L 2VR5A 2VDKH 1WBXB 1JZDC 4IKKA 4OFYA 3QH3A 3WDIA 4MA8H 1F41A 1I8KB 3OKLB 3AUWB 5F1IB 1J1PH 4XMTA 3CHPA 5C0GB 4UM8A 1I7RA 3ULUH 2OZ4H 3T8XB 1PCSA 4MMXC 2BVPB 1OSPL 3RWJA 5L9DH 4WWKA 4WU7B 3FO2A 2DMHA 4JKLA 5HTSA 2GSIA 2H6PB 3V8CA 4EE2A 4Q9BA 1S3KL 1UACL 3BFWA 3QQDA 5HPMA 2AEPH 2ODIA 5C0BD 1I9IH 2DJSA 2R29H 3IN0A 5E8OA 1QI4A 2QDWA 1T1XB 5GISL 4A6YB 4DF9A 4R90L 5ADPH 5M94B 2V17H 1ETJA 3L8QA 2BSCA 3VB8A 4XNYH 2LFEA 5I71C 1NGWB 3HC3L 3WV0A 4UZUA 4BRVA 1BFVL 5C07B 3ABKB 5TDPB 2Q8AH 1N0LA 4WEMB 5H2BB 5FOBB 1CTNA 1QO3A 4JJHA 3TPUB 2H3XC 3U0WH 3ZGHA 3T3PF 5I1EL 3DUUA 4UMSA 1T5XB 3FQ2A 3GMRA 5H35A 3ZYZA 5T1MA 3DETD 1JWUA 5CM1A 4Z77B 4NGHL 3P77B 1XCQA 4I3RH 3TEWA 3DK2A 2Y6TE 2HAZA 4ISVA 5FYJE 2GVYA 3TIEB 5E6RB 1U4EA 3MACH 3QJRB 1IC4H 3F58L 2AW2A 2JCCE 3EO9L 4M7KH 2G4GA 3CZNA 4Y16D 2HFEB 3BAWA 1VSCA 2BIMA 2CO7B 3BISA 2EYTB 4N2GA 3RI5K 4TSAH 2GQHA 1F18A 3DIVA 1NICA 4K23H 4B50A 1JUFA 2I60H 2UYLA 4ZW8A 3Q6FB 3KW8A 4G11A 4GRLC 4H25A 4DTGH 3RTLA 5L4IA 4PCKA 3RGVB 4KGJA 1IE5A 1JSYA 3BXNB 1FAIL 4XPBH 1CD1B 1HSAB 3W9EB 3VXSB 3H3BC 4ZXBA 2BSDA 1C08A 1UJ3B 3O3BA 3UBXB 2N56A 4WSKA 2X4SA 5KG9A 4X9GA 4OLXL 1H8NA 3PJSA 3BLKA 4M1GH 3VFMB 4XMZA 1JGUH 5GZNA 4ZRGA 3OB0H 4UIKH 2AKRA 3VA2C 1QLRB 3S2CA 2AXGB 3D0VB 4IK7A 5G55A 1XGTB 4A2MA 5CXPA 1LDPH 4ODXB 5A7BA 1XB8A 3V95A 1QEWA 3J07A 4S1SL 1REIA 3JWNH 3IGKA 4S10A 5ICZB 3RFZC 2JH2A 3LH8A 1R5VA 3V0HA 2A6DA 1SY6A 4RDBA 4QF1A 4S0TD 5D1XA 4UQ2B 5F8RC 1QKZL 5IJVA 4Y5VC 3H6AA 3NFNA 4KHXH 1X5KA 1DQKA 2QVKA 3VWKD 4FQPA 2NDFA 1ZEAH 2LTQC 3KEDA 4Q6IA 3SYPA 1LK3L 3L7FA 2Z7ZA 1NMBL 3G9AB 3H0TA 1TLMA 3EYOB 1EXGA 3EJTA 5F7DA 2NXZC 4HPOL 4OM1H 1Z0NA 1MWAB 3LZLA 3TBWA 1MJUH 2H26B 1XH3A 4QRUB 4HJUA 4A7GF 4NGHH 2BERA 3TX4A 5FYLH 3TVMA 1FZMB 2NRDA 4XVTH 3P0YH 5B22A 1RIVL 4PYHA 3S34H 2R2EA 3UEZA 5A2AA 12E8H 5CR8A 2PTUA 2ADFL 4ZO7A 1ZRUA 1KBBA 5FEBA 4GKOA 4JG9A 2HRPL 3FF8A 1H6FA 3BWUC 1ZT7A 3MCG1 3QWOB 4Z7NE 1TU2B 2EJ1A 2CO6A 2GG1A 4UU9B 3ZTDC 5F1NB 5I18L 5BO1L 5GRXG 2CLRA 2WKOF 4FHKA 5AAMC 2F8VA 3F7YA 4IRSD 3R0MA 4BE6A 3L2MA 4NDMB 3JV0A 5MP6L 1LO0L 5HGBA 1M6OB 1WA0X 1J0YA 1OCOB 3CDGB 4B96A 4LVOC 4JAMA 3VFUA 4BE5A 4QRSB 1G6VK 1OSEA 4R7NB 1CN4A 1EJOH 4PJAA 3ZPDA 3LKRB 1AACA 2H7WA 2WP3T 3D87B 4UMGA 4F7MA 4TLTA 4BH8B 3SDDC 2NTFB 4M4RB 5AVWB 2ZWLT 2B4CH 2HVBA 3DVGA 4AXWB 5E08L 4AY0A 3LZFH 3UTPD 1QHOA 3DRTA 3O45B 3QISA 1J7VR 1Z2KA 1URIA 1ZA6B 2CIKB 3KPRA 3L3DB 4NHUA 5DWUL 5EU6B 5K1JA 4D0CB 4HXBL 5FYJL 2ZXBA 3MUZ1 4K94L 4X6BB 1AKJA 5EH1A 5FW8A 1EAQA 1GYCA 1VFAB 3T77A 2H0PA 1UH3A 3KYAA 5IKCB 2BPBA 4NZRL 3VXMB 4UM9A 3O41A 4KRMB 3WNMA 3MC0A 5LN4A 4P46D 3ULVC 4Y4HB 1KJ2A 3WU1A 1NC2A 1WTLA 3MLZL 1P4LB 1WCBB 3MHZA 4K8RH 4NAJA 5IB4A 5DHDA 3EYQD 3S3DB 1Y18A 2Q7YB 2NY2B 3PHSA 4OCYL 4PJ5E 4M1GL 3BKYH 3E8UL 1L9TA 4OGXH 4XVTL 4D0DB 3RWFA 1HYSC 3HPJA 4L1BA 1PLGL 1TYEB 3MTXA 3EBHA 4M62H 3HLAB 1KPVA 5HSFA 3QEUB 4CU8A 4LSTL 4LNVA 4XTRC 5IEKA 4KJPC 5J6HB 5E5LA 3MQIA 1IC5L 3F00A 4TQ8A 1JG9A 1A1NB 4AC4A 5F3FA 1BF2A 4OZIF 2W88A 1JS4A 4OB5H 3KPLB 4BFIA 4F9PA 1HNGA 1UM5H 2QVTA 1GTFA 1ZGLM 5J57B 1P6FA 2BY0A 3SBWC 2P1YA 3TA3A 2X4NB 4FQXB 5SWZA 4GRWE 3MJ8A 4LIQH 4MAYC 2K4AA 3MXWH 1NGYB 1J1XH 1K3ZA 2YBGA 3EUDA 1IBHA 3LKOB 1MW3A 5AALA 4X4XB 4KK6C 1EUTA 1RZQA 4MNGA 3H4FA 3RURA 1BVOA 4OFQA 5TDNA 4YHLL 1DZBA 1CC3A 5DJ6A 3VYNA 3NA4A 1KYAA 5B1JA 3S36L 1DBKL 1UHVA 4OFYD 3G6JB 2QZ5A 2EO1A 4PRPE 3TZVA 5CD3B 1AD0B 4E2OA 1ILSA 5F7DB 4XHQA 1WBZB 5M95B 4LCWA 4PJXA 3L4UA 5FW6A 3VD4A 4Z0XB 3EF4A 4HAKA 1X3DA 4NLHA 2VIRB 5INDA 1GOGA 5FUOH 4I5BB 1OSZA 2L8AA 4BGDA 1KZYA 2X9ZA 5FKAB 2YN5A 1I1FB 4JHVA 2NW3A 4PS3A 4X7SL 3BWSA 3ENEA 3K1KC 1QZ1A 1ZLSH 5K59F 2IVFC 3BKML 4D0DA 3MV8A 1ZVYA 2CQVA 1JNNH 4DP4X 1TG8A 2A6DB 3BESR 1SGKA 4XWGL 3LIZA 4G1MB 3NK3A 2LVCA 3QR2A 1A0QH 4HZLB 2W07A 1EHLH 1C5BH 2IG2H 4RMWA 1BECA 1NA8A 3JVFC 3BZFB 2YWYA 1VKXA 4KKBC 4PD4J 5EZIL 5I30H 5EIQA 4M6ML 2VJXA 1JPEA 3PGDA 4N3UA 2IMNA 5I9QB 4FFVC 3VFRA 3O2DH 4PJFF 3ASOB 1F58L 4OCRH 5D7LD 4DQOH 3QIWB 3RJQB 1T20A 4AV4A 5IW1B 5IGXH 1I9RL 4YSQA 4LASH 4PJCA 4PJDB 1Z9NA 2VN3A 5IOKA 2I32A 5HDQH 1Z5HA 4WJ5A 4HQQH 1A6WL 1MI5A 2APFA 1ETB1 2D9QB 2NSXA 5BJTB 5CHNA 3GINA 2FO8A 5DI8A 1FYTA 3L45A 2WN2A 1I8LA 4F37K 3ARDA 3M45A 1OW0C 1ZV5A 2VMFA 4M93B 3DOHA 1CFTB 4PS8A 3LKOA 1CFQA 5DQDH 1KTDB 1SYVA 4OLYH 5AKSA 5B39B 2HG5A 2N0MA 1M7IA 2GK2A 1TNMA 3QUZB 3VH8A 1LP9B 1JJUA 1TVDA 2Q1EA 3FBQA 4XO8A 1SEBB 3QDMA 5HDBB 2IANA 3ABMB 4P3CL 1EEQA 3DUUB 1W80A 3D25A 4Y19B 5ICYB 4AEIL 5DUPH 1JGEB 1NANI 2XV0A 4JKWA 4A2LA 2WK2A 1QWUA 3D09A 5B3JF 2WQXA 3QZWG 3M17B 3X11B 4FRWA 4XBPA 1DBAH 2C7UA 1AR1C 4AH2B 4MVBD 5EDXA 3G5XA 1CL7L 4LCUA 5IROC 3SD5A 3L3OB 3FDWA 1BIIB 3VXUE 4IGBA 2QEJA 3HPJB 4GAGL 1ZKAA 3II3A 5I1JL 4K2UH 2F7QA 2XG5A 3AXLA 4ZI8A 3LRSB 1GH7A 2JSFA 2OI9C 2WLNA 2CGZA 1KN4H 4KY1L 3UERA 5BS0D 4XPAL 5BCAA 1WHPA 3T4AA 1G7QA 3VXME 1JWSA 2Q7NA 2V2WB 1NFDA 2B7DT 4EVNA 1K5NB 4PH8A 1A65A 4MD5A 3O3DA 5DJZA 1YQ2A 4JFFD 1P4IL 1QBLL 4LPUA 2GAZB 5BZDA 1LILA 3GZQA 1XXDC 5EZPA 1RZKH 3WNJA 3QH3B 4OJAA 2XN1A 5ADOH 2BNUB 3QHZL 2HYMA 3OAZH 1AI1L 4HGMA 3RPKA 4EI5A 1QWHA 1NDMB 3DXAB 3G04B 2HCZX 2K70A 2CBOA 1HWHB 3DRTB 3OHXA 2A73A 1IQDB 5F7MC 5CEYA 1TETL 2HWZL 3BP5A 1PDKB 3BP7A 4JO3L 2FQDA 2ATKB 2OPCA 3TF4A 3NJFA 4FXKC 4WZ9A 5IY5B 4KO7A 2Y23A 3NTCL 4XO3A 5DRZB 4APXA 4ZW3A 4PW9A 3PL6D 5I5IA 3B1TA 3MRMB 3Q3GB 4V1DD 1D3CA 4L3FA 4UTAA 1OAYL 3BW9A 4PRPD 3VE0A 1S7RA 2PR4L 4GRWB 2CUAA 2X87A 1RZ8B 3RX8A 4WEEA 4AL8C 1CYGA 4JHWL 3AW5A 1OL0A 4K5MA 3EHBB 3NSYA 3CSPA 2Y3NA 2NUPA 3FQRB 3GJFA 4KK9C 2PWHA 3GSRB 2LE9A 5F1NA 4ABWA 1YPZF 2XICA 5CO1A 1UA3A 4POZC 2PPEA 4RDQF 2NXZD 1SBBA 3H1ZA 2P5WB 2ZSWB 5J12B 5EIIG 4CC1A 5T3ZL 2JI1A 5ISZB 4Y4FC 1DQVA 4YE4L 1AKJD 4ZMVA 5KSUA 2DYPD 4OCNC 1N70A 1CFBA 2VR9A 4ES8A 4PLNC 1UACH 4BWTA 3RTQC 1AHMA 5JXEC 5IP4A 1AGEA 1Y7VA 1ZSDA 4OIFA 2GJ6D 3RZCD 2EE6A 3GS7A 5DHEA 4QCIA 4U1LA 3GF8A 2WXRA 4NLAA 4P04A 5EBGA 2YAFA 3CG8A 4FNLH 4HV8B 3A24A 1BQHB 3NJNA 4OTXH 1I7TB 1XDTT 3WFBH 2BOCB 5DR5H 5TDPA 3NESA 2XU9A 2ZCKH 3EG9A 4Q9RL 3ECWA 1A4JA 4QXVA 3T04D 1AIFB 4EMZA 1R3IH 1LHZA 2HUEA 4OT1L 1DFBH 1TTFA 4Q0XH 1FZJA 2W38A 2DEXX 2XIIA 2Y1ZA 2AJYL 1F4XH 3FFDA 3KH3A 2O1AA 3G7TA 4RRPG 4WFHE 3B2PA 3PDOA 4JM0A 4LOVA 2NY3C 1RZ7L 1NKOA 4MLIA 3QQ4B 4LCIL 4NKMA 4BFJA 1HQ4B 2WLLB 1A7QL 2NQCA 3OAYH 4UB0L 5LBSH 1MWAL 5IEHB 4AK2A 5C9JA 1OCZB 1SEBA 4MJIA 4QXUH 1LXMA 5I0WA 1VPOH 2E86A 3HZ3A 4MZIA 3T0BA 5KS9A 3K4DA 1QTYT 3CPUA 3IFPB 1XIWD 4HH8A 1UVQA 4KX8A 1EEYB 3VGBA 4LSRH 4RA3A 3FHAA 2EUWA 2WLIB 2X89A 3EO0B 2EVIA 4LAQL 4NUGH 2OR7A 3QUZD 3NJHA 3MJ7A 5I8OL 4A38A 4UIMB 2O93L 4TVSa 4EI6B 3DV6A 1QABA 3U2SB 3NDYE 3CUPA 3NYKA 1RZIA 3EYUL 4KQ3H 3THMH 3VFNA 5E4AA 3F12B 1S2EA 4ZTPH 3V7AE 5IHWA 1NDMA 3DXAA 4PLKD 4YHZH 5HDBE 5DTFA 2YXVA 1QSZA 3CXDH 2DI8A 1I85A 2XWDA 1AI1H 5I17B 3SKOA 2BOBA 2J72A 2VN7A 4FULA 2WAHA 3UTSB 4IU3A 2OCJA 3CZSA 3D4ZA 4HKZB 4TVPH 2XLLA 4HIJB 2V5TA 5F7NC 3IAQA 1T7YA 1A8JH 5IHUH 4YSUA 3DO7A 1BAFL 1BCIA 4JFDE 1U8OB 2VITA 2Q86B 5CSZB 5C6PB 2K9UA 3CV5A 3CZUB 5C0RH 4Q2ZB 4P5SA 5L2KD 4KUCF 2J8UB 4BZ1L 2ZONA 3V5HA 4FC3E 4ODXA 2WYZA 2CHDA 1ZDSA 1A25A 2IH8A 5CWSA 1IBFA 1O7DE 3L7EA 1QQDB 3OKEA 4K9EL 3C5SB 5EOCJ 2R9HC 1RJYA 4DSYA 5DRWA 1I9RH 1AGDB 2F9BT 5JIDA 4N2EA 2PPDA 4LASL 2J8HA 5I23A 3EYQC 1ZE3C 5EC1A 3RX7A 3S34L 1NCUA 3O3AA 1JXFA 1FNHA 3LSOB 3PWVB 3EH5B 3TZVB 1OLZA 2GPZA 4XGZB 3ARWA 3EBAA 2AV1B 3FN0H 3NMEA 5DK2B 5HHMD 3ZHKA 4AENA 4GG6F 1F8TL 2QHRL 4H8VA 2NLJB 1N6QL 4MLSA 4KHTH 3SGKA 4ODTL 5I1GH 2V7HB 1LP9A 4R4BA 2IEPA 4GRMB 4PJBE 3ROOA 2GITA 5EU5A 1CGXA 2DTMH 3UAEA 3TFBA 3PQYD 2MRYA 3K0WA 4AGLA 1VDGA 1Z3GL 4P2OA 2FYYA 3FU6A 3DVFA 3G5YB 1GXEA 3AY2A 2GBVA 1JN6B 1A21A 5E6ID 1CF1A 5C8JA 1KYOK 1KGIA 1NBYA 3OGCB 1NUNB 1U33A 4NQCE 3OF6D 4XCCH 2MHAB 1TZHA 2PW1B 1OAJA 4UBDD 1HH9A 3I02B 2IGLA 2ZAGA 3GHEL 3QT2A 2J6WA 3TZVC 5PAZA 4XCFH 1ZLWK 4HOZA 4M5SA 3IFOB 3L95B 4C83B 4X0KA 4UV7L 4DFIA 3ARGD 1LWRA 1NGXA 3CVBA 2HT4D 3WD5H 5DRNA 1T1XA 3OM3B 5HJ3B 3I9AA 2F53E 3KYOB 1WIOA 1CICC 1O6VA 2YUWA 4GW5B 4Z7WE 4AQ1C 1QSFB 1UADC 4FFYA 1R47A 4UIKL 4AL8L 1YO4A 2W81C 4KY2A 1DJHA 2AV1A 2GEEA 4HMDA 4XXWC 4AENB 3ATFA 2YUVA 3G6JE 4K9EC 4PJ9B 3V0VB 4BZ2A 1DDHA 2XYBA 3LQAH 1OM9A 3ABLB 4LHUB 1B3JA 4XC1H 3O3UN 3CZGA 5HHQB 3B9VA 3C60A 5C0AA 3GSNA 1MCOL 1EVTC 1IEAA 4N1CA 1OSZB 3GLDA 4KJWC 3S3CB 3DPDA 3NEXA 1YDPA 3N3EA 1ETA1 1SM3H 3SODB 2DKSA 4FX5A 4JM2D 2NR6D 4JQIA 2JTDA 1IM9A 1QFWH 2R1XB 1TUPA 4XAKD 1EEZA 2H45A 3KPSE 2AGJL 3CK0L 5JPNB 3ULVF 3S48A 5H4ZA 4JDEB 1O9VA 2XZAH 1UG9A 1UZ6E 1R3HA 5EA0L 3HC4L 2X41A 4B3EA 2LT9A 3NFPA 1EX0A 1MHEB 4JFSA 4KQ0A 1UFUA 3CSYB 3I6GB 4IRJC 4QMEA 2CR0A 4N85A 3LHPH 2WBWB 3TBTA 4P23B 3QBTB 3QUYC 3BT0A 2V8LA 1VERA 1PG7X 3PAUA 2BM3A 5E24E 3WENA 5IFHL 1KIPB 2CJUL 2X9XA 2ADFH 1TZAA 1UOVA 2JKJA 3ISYA 4NQVA 4F93B 2W9EL 2Z8RA 3A23A 3FPYA 4YGAB 3FUNA 4S11A 3K6DA 1N8OE 3BPLB 2YJQA 5ID1B 2NW2B 2VYRE 1QA9B 5H4YA 1JZ6A 1QRNE 1KCWA 3HC0B 4ABVA 1NINA 1BMZA 4RFOL 3N1PC 3QJHB 4BDVB 3MBEB 1GL4B 2Y24A 3WY4A 1OTUD 3BSHA 3KPMB 3VRJB 1NIEA 1SHSA 1ND0A 2RHEA 4PJ7E 1XBRA 2IFFL 5SWQA 1T2XA 4JEGB 2NY6C 2UX6A 1BSIA 1LK2A 2R56H 1U8NB 3HRZC 5KVEE 2PO6A 1BVKB 2PUQT 2VABA 3IFLH 3FYEB 5HYJD 2FB4L 4C57C 3AU0A 2XN9A 2VXUL 3GZKA 3S9DB 4JREB 4MJIE 5GGQH 1AR1D 2L7QA 3SCMA 5HDWA 4Y4HA 2P28B 5I6XB 4WUKL 3ZVVA 2VUKA 3O41B 4MB3A 4U2YA 2Y5TB 4XNXL 2DIJA 1HOCA 3ILPA 4YBLB 1DO5A 4K7PL 4GIPD 1AS8A 3UAJD 4W9DC 2UWEF 4OF6A 4PV9A 1MW2A 1SF5A 3W37A 1R46A 1WWAX 2NZ9D 3WKPA 1GGYA 1PZBA 2BMKB 2FEDC 4PVMA 1E5YA 3BUBA 1IAIM 2DBLL 3VG9B 5KYUB 5C0AE 1KIRA 2IAMC 2R15A 2Q2EB 2IOMA 2ESVE 5L6YH 5GRUL 4XP9H 5HHOA 3POHA 5GJTH 5ETUA 3S4SA 4DP5X 4Z3TA 2LU7A 2K6YA 1CWVA 3D4CA 1ZXQA 4ZFFA 1ADQH 1CDJA 1YN6A 3BIBX 3HNSL 2AKRB 1RIUH 4PJEA 4HWZB 5C6WH 3LZRA 4NM4H 2ROXA 4PR5A 3IS0X 5D5MA 2VDNB 4X4KA 3FH5A 5K69A 1AYOA 1Z5YD 1Y07A 4HIIA 1HHKA 3TJEH 5EF3A 3FTZA 5DQDL 2BHZA 3L9RB 1VEMA 5I1HL 3QRGH 4PJAE 2BIHA 3M6DA 5B1BB 1KIUA 4LMQI 4OCWL 3EH4B 4WI7A 5DSCB 4XH2B 1WISA 5BS0B 5D70H 2C1PA 3EDKA 3H2WA 4I0PA 1G9NL 3BDYL 3UGXA 2WO3B 1IGJA 3FOMB 1R3LB 4I7ZC 4NXKA 5D1XC 5E9AA 5AD0B 1E5CA 4WUUB 1A64A 4W9IC 2J6EL 4GPVA 1KTDA 1O7SA 1SYVB 2VR4A 4YX2L 43C9A 1NGXB 1MSPA 1ZD6A 2BVQA 3M1BB 2XTLA 4ZS6D 3K6IA 3FQ1A 3ZE2E 4P57B 4CC4C 5KVGL 3ZDYE 3JWDH 3JWNE 1J9RA 2P8MA 2WOYA 3BJLA 1E2VA 3DTDA 4B95C 4R0LA 4K2UL 2QVMA 3S35L 3TV3H 4J3BA 3P69A 4BFNA 3US0A 2YHGA 5F97E 2EDTA 3TT3H 3EGXA 3TL5A 2HP4A 1N5YL 3MROB 5DLMH 3OGOE 4ZJ9A 4N90D 4N5UA 4DW2H 3QFJE 2UVEA 4GRLA 1ORSA 4ZAKB 3P40A 1J1PL 1MCWM 1RP8A 2P5WE 2OA9A 5L2JA 3FCTA 3EJPA 4OZ4B 3SKMB 1FDLH 2NMSA 1QVOA 5DJCA 2B5IB 2KYIA 5KJ7E 2D3NA 4TQEH 1F3RB 2H6PA 5HBBA 4N8VB 5I6LA 4U1MA 3S5LB 1TITA 3OAWA 1BFOB 4WENB 4F7KA 3OJMB 5GJTL 2YGPA 4P2QE 4YHML 1AY1L 1TZIA 1PKOA 1QG3A 2P44B 4U6TA 5DZPA 5GGTH 3MYJA 5I28A 1K72A 4KDTC 2QADC 4MCNA 1UOKA 1S5HB 4WFED 1FVCB 1RFDH 4JFYA 5TK2A 4Y5VA 4OBRA 3AITA 4UAHA 5LAPA 5KZCB 3HB3D 1K8IA 5AWNH 2YEZA 5LO7A 3PWPD 1M2VA 1FJ1A 2HTLD 1P4BL 1UWFA 3GHEH 1TJXA 1A3QA 3G6JA 5LAXB 2VXSL 2KPWA 4A2EA 3DNKA 4APQA 5E6IA 4NB7A 1GZHA 3DC0A 3MRPA 4FQCL 4X9HA 1PNDA 4UDTA 4EIUA 1AD9A 2W95A 1U3NA 4HIJA 4UTCA 4F2MA 4ZTEA 3D48R 3QUZC 5F7KC 3T1WA 3N42F 3IXTA 4HUVB 3MV9E 2D0FA 2I27N 3WNPA 2MFNA 1G7HB 4XPHL 2O6PA 3ZDZB 2PCPB 5E4OA 2VW6A 2PETA 3K8MA 3RP1A 4K7PX 5F96H 1A7OL 3U6RB 3L5WA 1CFMA 1E50A 2ZUSA 3MR9B 3IJ8A 1N6UA 1XFPA 4G8FA 4AIEA 2J8UE 5LDSA 1ADQL 4TULL 5JQHC 2X70A 3AS3A 4G6FD 2AK1H 5LQBL 5IBUG 2J5WA 2E7LC 3LIUA 4I0PC 4N0UB 4Y9GA 1JHKL 5CJXA 4XP6L 2P48B 3B3IA 1LDPL 5DT1L 1G7LB 1ODAA 3SGJC 3HKFA 3QIWC 4AM0A 3L7EB 1E90A 1RJLB 5D7KD 2D7OA 1OV8A 5EEVA 3QXUA 2D3JA 3OF6A 2O72A 2VWEE 4OZGF 3P3UA 4K3DH 4GRWH 4AGPA 4O4YL 4L4JA 4UT7H 2PWFA 2GFBA 1NUDA 1FGVH 2GJRA 3PDOB 3S35X 3OR7B 3VXOB 2P8LB 4H1LH 2BVOA 4I18C 3NAAL 4J3OC 1X9RA 3CCHB 4UQ9A 1S9YB 3FL7A 4XNQA 5FHAH 4OZGE 5DA0B 3WJJA 5GRJH 3WFDL 4KTEL 1EHKB 3HS8A 4AYID 4AWJC 3UMNA 4JFOA 4K8RC 4XVJH 4F7CA 1Z9SA 4DW2L 3HHSA 2WN3A 1UWXH 4RWHA 2ZUQB 4EF3A 5I2IB 4WUUD 2P5EB 2VABB 2OR9L 1FNEB 2AQQA 2VDRH 3IMUA 35C8H 1URZA 4WEBL 3HTLX 4UQCA 4OV5B 4ONOA 5MEND 3CSFA 4YHKL 1IC7H 1P5UC 3AREA 2FD6L 3Q2VA 4Q89A 5EU4A 5MENE 2AF2A 4DCQA 4YHNA 4N20A 3DX7A 4DKAA 5A43C 3AQYA 2DAVA 3JTBA 2GIYA 3CD4A 4JN2B 4NRYA 5E0QA 5KAQF 2VW7A 5IHUL 3ZTNH 1JZIA 1Z1WA 4MXQC 4L48A 4J12A 5K1VA 3SYQA 3PV7A 5HYJA 4M3HA 3VQ2C 5D1ZA 4K3EH 4WO0A 4Z7UE 1UASA 1UOWA 4W9ZA 1IAMA 1TTCA 2H6OA 2IQ9L 4MHHI 3R06B 1LWHA 4HS8H 3BEWB 4NENB 4IRSA 5DHVH 2YMTA 1JPFA 4M9PA 4A6YH 4Q7DA 4R83A 3ZKMD 2KC0A 4X9FA 2H0FA 1JVLA 5CGTA 4JDEA 4JO4L 4ZUTA 2ZQKA 3CFCL 3NJGA 1X5ZA 3MOBH 2BINA 1O7DC 4HAGA 1ZVSB 1NKGA 5DUBB 3ZYIA 2FX9L 1F3DH 1FGVL 2MJWA 4JO3H 3JV4A 1HQRB 4M6OH 4PJHF 3N43B 4IW4C 4X6CE 2QGBA 5JW5B 2X4RB 5DO8A 4J39A 3R7QA 5ID0B 3VI4B 4Y4KB 2IH1A 3PXHA 4BSVB 2AI0H 4XOAA 5EOCH 2WAQA 1F4YH 3C60B 4Z7VA 5DEFA 3VI4A 1NAMB 4WJKB 4K8RL 5K39B 4YDLC 3D5OF 4XMVA 3V6ZB 4FFYH 4XN8A 4OCYH 1AQDB 2Z92B 1QFHA 4P3DA 5JHLA 2QTEA 3D52A 3UZEC 4X7TB 1G7QB 3GSRA 4LP8A 1W0YT 3D05A 3ARRA 3PXJA 1J5OL 1FHNA 3I50L 4PGZA 3QDGE 1J05A 4WO4A 2AP2A 4CW1A 4TUJA 3DXAE 5ANHA 4Z1PA 5EPMA 4IKLA 4PCSA 1BXAA 5IHHA 1I7UB 4EZKA 1MH5A 4HF5L 3EJZD 2ITDA 5IROA 1PYWB 3Q2WA 2VLLB 3UABA 3CWGA 2RR3A 2OXGA 3IU4H 4MYPA 1PNCA 5IK3B 2EEAA 2JVUA 1YCSA 4WIQA 3E9TA 3RPIB 2ZX7A 2HT3D 1AXSB 5TQ2H 4P23D 4LDLB 1OB0A 3O4LA 5KYWB 4IBYA 4NQVB 3HAEB 3OTTA 4X9BA 1RH8A 2Q20A 1KEMH 3L5HA 4R5XA 3VI3F 5DQJA 3HBPA 4JJ5A 2RCSL 4G1EB 1II4E 3BP6A 2BP0B 2OMUB 4P9ML 5FOJA 2PCFB 2HKAA 1V7NL 2VXQA 2XZCL 3O6LH 5CINH 4LB8A 3QJUB 2RQEA 2LGNA 3WJLC 1W8EA 1E28B 3VO0A 2QMJA 1EIBA 3OR7A 2EVFA 2QR0A 2YPLA 1EERB 1D5BA 4U3XA 3RY6A 1HESA 4PRHB 5ABZA 3KS0J 5EU6E 3RL2B 2FBOJ 1D2PA 4OGYH 4JPVL 4NIYE 3WHXB 5C6TL 4TNFA 3C75A 2NY3D 4FXTA 1RURH 5IMOB 5LNGA 3STBA 1IJNA 5D4IA 4XOEA 3N1QC 5SWSE 3H9SD 1DQJA 4FJZA 1I8UA 3GKWL 5H94B 4O02L 4BZ1H 5KTEL 3RDTB 3BZ4A 3VRLF 5IB5B 2PYEB 1XGZA 4MA1C 2IBBA 1X9LA 1BPLB 2YRZA 5DC2A 5DCCA 4JPWL 1LO5B 1ZJAA 2QPFA 2YC1A 4HCGA 4N90E 4PJ5B 5F0PB 1G7PB 1TTBA 3O81A 4U31A 5E8PA 4NZDA 4L1TA 2ZYSA 4LPVA 1MHPH 1OSYA 5TGBA 1WF5A 3FH8A 4JDZA 2DM2A 2BHUA 2Y0SA 3UIYA 4AYGA 2O4EA 3L5XL 3FNKA 5AUMB 2OQJB 3T4YB 2SODB 2EEDA 3CZLA 4YUEL 4LLYB 3ESVF 1J10A 3UTTB 2ZF9A 4FZEL 4AG4L 4QOKD 4AQZA 1YUHA 3GQFA 3H7BA 2BOBB 4M5YL 4OCXH 3T2LA 3T3PE 1QUNB 3F84A 4O2FB 5FHBL 5DTFB 4L1LA 5IESL 2F5AL 1G5AA 3MI6A 2ATAA 3F7VB 4ZXBC 5J3HC 4LEBA 3D9AL 4OD1H 4QHNA 3RGVC 1HDMA 4LKXB 4DVRL 1GIGH 3QIUB 4QY8B 3WIHA 4YK4B 2XKNA 4UNIA 4GAYA 5GGQL 2GUOA 5CCJA 1SUHA 4CDGC 5ESVB 1KTRL 1OF0A 2OTPA 43C9B 2WVSA 3L16A 3H54A 4F5CA 5B38G 1T6VN 4AQEB 4HH9A 5KYYB 1JWUB 3L3OC 5DUPL 2V7HA 3N06B 4R4BB 2XG4B 1W0VA 3JV6B 1OF2A 2C9XA 3BFQG 1WO2A 4OZHE 4XCNA 3FU3A 1WFIA 5IVNA 3U46A 2JB6A 4ZX4A 3LCYA 4NNXB 2PN5A 3D69B 2LVEA 2YD0A 1BFTA 4KHTL 3HS9A 3RUGF 2R0WH 3D3VD 2WKOA 3FH7A 5C7ZA 2J88H 2VDQL 1ED3B 2PYEA 5JHLH 3GSQA 4Y2DB 4XBPB 4JFEB 5D2LA 5A2LH 4B9YA 4LQFH 1KBPA 5C0EB 4JFFA 2V6HA 2J8UA 5LG6A 3UTSD 3ZT5A 2O6EA 1OOWA 1I7RB 2MIZA 5K5YA 3G5VA 3NFSL 1DSWA 2R83A 2W60A 2N01B 5DS2A 3MRGB 4LHJB 3P9MA 3KNBB 4BCYA 2WMPB 3FAWA 1NIBA 2EAEA 1UB6A 4O2CB 5DF0A 1G9NH 2E6JA 2CG9X 3HUJE 4NBYB 1EJ8A 3JWNC 4OH2A 4U6XB 3HBGA 3SJVE 3WO3B 2FJGA 1NGYA 2F2HA 2WQSA 4ZO8A 1CXFA 3L3GA 4XNMA 1R3LA 4ELMB 5BRPA 4ZMWA 5MI0C 2WXMA 4G43A 1U95A 4AW4A 2KQMA 1FLRL 1BQRA 2WXPA 4JFTA 4RNRB 3E1ZA 3QSKB 3UAJC 1BXXA 2OFQA 1INQB 2ICWB 3DX8B 3QEQD 4XRCB 2X3CA 1Y1UA 4O2EA 3MRLA 4X6EA 3ZR5A 5KSAB 1S9WA 1NDTA 3TV3L 4YJZL 1GC1H 4EQ2A 4WHTA 1TQVA 3DROB 1I1YA 1UA6H 1X7TA 3HE6B 3QIBC 5AYUL 3IFPA 5F9OL 4WHTB 3NIFB 3WIAA 2QQNL 3PNWB 1MI5E 2XA8L 3BDXA 3VGAB 1YY9D 2WIIA 2H47C 3CXHJ 3UCQA 4WU5A 3LXBA 1N59B 3TO2B 3U25A 5IEHA 1JV5B 2Y7MA 1IQDA 1FL3A 3QG7L 5GS1B 1JV2B 4X8JA 2DYSB 2F53B 3HAEH 2WNXA 4LOUD 4CJ0A 3MRRA 1XSKA 2VO5A 2Z93A 4KOCA 3MV7A 4KQ4H 4HJEA 5MENA 1DVFC 4N0UE 3G6DL 5D7SH 1JTOA 2RJMA 4LLAA 3RWGA 5DUMH 3LNGA 1QFWM 1HHJB 2BSRA 3EJJX 4YR6B 5IMOA 1KB5L 3WN5B 1FH2A 3EH1A 2NNAA 4U1LB 2ZICA 3ZE0B 4YHZL 1QFUL 4FYRA 1UM4L 4WWPA 3QRLA 4FFWC 4XC1L 3RVVC 1U8NA 3RWIB 4BBWA 3TIDA 1FRGL 1OM3H 1RUMH 3D50A 1W8OA 4FGMA 3IRZA 3Q6GL 2GCYB 3VRJA 2ESVD 2UUDK 1RP9A 4QIRA 1G0YR 1M42A 4KRPD 2WVVA 4BXSV 4JJ5B 3SBPA 3V4PA 4EQ3A 1BFVH 1TQTA 1ZWIA 2EIZB 1DBML 1T0PB 1SHXA 5A3IC 3RA7L 4BV1A 2Y1AA 5ICZA 5DMGC 3TO2A 2PLTA 1JF1A 5SWSA 3FHEA 4KFMA 1PY0A 2ZJSL 5FC9A 4HZAA 2Z8WC 2WBJC 2Z35A 1RULH 1PG7H 2WB7A 2XPGA 4HFUH 4QWWD 2OSLA 4P23A 3IDUA 2IDUA 3ATDA 1ZPLA 2BWQA 2OX5A 3C60C 3RVUD 3DURB 4OLVH 5FCSH 4ZW5A 3ARBD 4X0KB 4MJID 1W0WB 4PGEB 4PGDB 2MCMA 1DYZA 3MLVH 1PAMA 1JHKH 1NJ9A 4UQ3B 3RWFB 4IBWA 3VXSA 3IJYB 4I2XB 3OXSA 5ENWB 3K4AA 2VLJD 3M88A 3IVKB 1Z9SB 3ASWA 3P3RA 3TBWB 5EF1A 2FVNA 2AERT 1ZHLA 3C08L 3IMBA 2E7LA 4DTGL 4KKBD 4A63A 5AW1B 1SY6H 2O5ZL 4ESKA 2FQEA 1H3WM 4HKBB 4GW1B 1S7QB 4ZMNA 4X4YA 3ZIMA 3U0PA 1HKLH 3OHMB 3U83A 4DZ8B 3B2UC 4I1NB 5JW4M 3NZ8A 3BIAX 4QRRB 3AUVA 4W9KC 1BAWA 4D0CA 3IDMB 2JTYA 1CGSH 4QTIH 2GW5A 5T3ZE 3I3BA 3VRLE 3OL2A 4Z95L 3E38A 2YAOA 5JXAH 1AQHA 2HTKD 4EKXA 1MQ8A 2NTSP 1BZEA 1WUNT 3FQNA 1IM9B 5HJBA 1M1SA 4PS7A 1A9VA 1H8SA 2J8OA 3GMMA 5CBAA 3K46A 2C9VA 4LVNB 5F9WC 2L4OA 5HGDB 3Q06A 1NGWA 3KYMB 5FHBH 1JOIA 1UGNA 2VDRL 5C0AB 4E5XA 3ARGC 5I8KL 5EZLA 1IFHL 3PFQA 1H9DA 5J4MA 1E9OB 3QJTB 3HRPA 4J4PD 3UPRB 2I60L 2NYYC 3QXAA 3CSTA 2WZ6A 1U8KA 5J5EA 1J1OL 1NFIA 1PKQA 3FUIA 2EEXA 5D1XE 4Y19A 5ICYA 1MJUL 4KRNA 3UG3A 4R5TA 5JDJA 1UH2A 1WQVT 2YA0A 3TTYA 1NBYB 1WWWX 3O6KL 1T7XA 3BQUC 1MCWW 1OB1B 1FZOA 4YHIA 3V6OE 2J5LB 3J2PA 4QHUA 1GAFL 5EU4B 3ARBC 1IILE 2YFOA 2VDML 1EO8L 2FX8L 5AYTA 5IM7B 1FZOB 1ZAGA 4RLDA 4K7FA 4M8VA 2VRQA 1KF9B 2A9MH 5FK9B 4JZOB 5DA4A 5EO1B 4Q6YA 1FPTL 3MREB 1TO4A 3C87A 1FGNL 3MV11 1QWNA 5B1AB 4XVUC 5LKNA 4PQXA 4XWOC 1CZ8H 4BHUA 5IR1B 3A0OA 4KPHH 1HK6A 4QHNB 3NIDF 2DM3A 4PJ7F 3N1MC 5DJ8B 3CX5K 3KPLA 2F6AA 3OJ2C 4URTB 3SYOA 1HYSD 3CN1A 3JTSB 3EXJA 5CP7A 3LEYL 2IADA 3ULUC 1I1AB 2OMYB 4JLRA 5E51A 4ZD3H 2H2SC 2D2CC 4Q6IB 3ALWA 1I7UA 2B77A 1E65A 4JFDB 4ZMLA 4M6OL 1KGXA 5JQ6H 1SLXA 3CZJA 3LKNA 2VQ1A 2P8LA 4NWUH 4JFXB 4NPYA 2GI7A 3IF1B 2GY7B 4MXWH 4MQXC 2NLJA 3ARGA 2MWCA 3SDCC 2OAAA 4PRIE 3UACA 3QO0B 2DQJL 3FRPA 5HHVH 4NFCA 1R5IB 1R1CA 2B4CL 4LLQB 2BVTA 4NRZA 1U8LA 2E8YA 3GNML 1ZWIB 3FQWB 2A3TA 4JG0H 2M8XA 4TL5A 5HDLA 3DJSA 1ZV9A 3CBRA 1FDLL 4Z7VB 2WNWA 3VSVA 5C0FA 4CL7A 1M57B 3R1GH 4DUXA 1KBWA 3DTXA 5I6MA 3W81A 3NSDA 2IBGA 4LSUL 3CJJA 5J13C 1A66A 2YXWA 4HKBA 3UTQA 5IUSA 2HN7A 3AT8A 4JHBA 3FTGA 1AP2A 1GOHA 1JVOA 4FZ8L 4QRBA 2NYYD 4HP5A 2VR6A 5T33H 3WXWL 4PD4K 3WEOA 4DEUA 1Z9LA 4WO4C 2X2UA 4GUCA 3PPEA 3D39E 3B43A 2GTQA 4HEPG 4JZOA 4KRPC 4XXDA 2NXYC 2A7BA 3BZEA 3ULVH 1JZEA 2C3VA 3BSZA 4IU3B 2ZXQA 4NQCB 2MPVA 3AM8C 3Q8BA 2PYED 4LDOB 2ATPA 3V5DA 3TWCH 4KGLA 5L2KE 5MEOA 1S7QA 1OZUA 4L0ZA 4ZMPA 4FI6A 2Z0BA 3FT2A 4FOMA 1FGNH 3V6BR 1LP9E 4MASA 1A9BA 5SWZB 4LE8A 2W5PA 2EKSB 1UYWL 1SOXA 3QQ9C 4F1ZA 3FQUA 4ODUA 3BD4A 3IVKA 3DHJA 3K72A 3WHE0 4ENZA 2G5BA 2DKMA 4RX4D 2XY1A 2F74B 1V3KA 1Q72H 2PO6D 2AXFA 1MCLA 4R4NC 3UZVA 1EGJA 5BMFL 1E8YA 3KHOA 3VXTA 2RMNA 2A74B 1CGVA 2VDOB 1B4LA 3CFEB 3SJVA 4PUBH 5A40E 3B7RL 4RETB 4RQQA 3FMGL 2EZ0D 2J1WA 1S5IH 4W70A 2FO4A 1G87A 4LPTA 3DX8A 3EJZC 4AQAA 3BP5B 1Y18B 5JXEA 4Y5YA 1MREH 4NN5B 4MQXD 2J1YA 1JK8A 3QQ4A 3VM7A 4OGXL 4L5FL 3W9DA 2F1EA 5H8DA 4LSSH 3WIFB 5HDQL 4GH7B 1OKEA 2UXVA 2Y07L 4KROC 3MLYL 2L04A 3TA3C 2WO4A 1HL8A 2FD6H 2C9SA 4G5ZL 3KPSB 4E9SA 1Z66A 2FLBT 2JKXA 2ZSWA 3QDJD 3QUXB 1JFQL 4P2AA 3FUDA 4M5YH 4YLBA 4ZS6C 2L3BA 1CL7I 1J8HB 1T80A 5DO2C 3RFZA 1FNFA 2RBLA 3CVHL 5CJOL 4ACPA 1X4ZA 1FNAA 4PB0L 4Y1AB 5CNHA 2N7AA 3ES6B 3ARFB 3DWTA 3PNRB 4G5AA 4UYPA 2XV3A 4GFTB 1IFGA 1FH5H 4X5XA 1F3JB 2IG2L 3DX9A 1LEKB 4G9FE 3FONA 4QHMA 1IBBA 4J3TA 3D8MA 4HJ0C 3EDFA 4LCUB 3PV6B 3SPGA 3GMNB 3GZOA 3QUHA 5B8CA 4JZJA 5T5FA 1GJWA 1C5CH 3FOMA 4X5LA 2EUXA 1BOGB 2CBMA 1OP4A 2V2TA 3V4PH 2FEEI 3HNTL 4GUQA 3U0TB 3ZDWA 2EDMA 1F6AA 2YUZA 3WELA 4WTQA 2R2BB 2YQ3A 3GIZL 4DGYH 2A83B 2UXGA 2WIIB 1FFRA 1DL7H 5E00B 1XSIA 1NDGA 3RTQB 3C6SA 2CDFA 1M7IB 5ILTL 1T6WA 5ISZE 1RFDL 5D7LE 4BHUI 4NC1C 2B4CC 4NUQA 1R5WB 3O6FB 4U1HA 4GP8B 1GGBL 4HWZA 5EV7A 5IT2H 2ENPA 2G9HB 5E6YA 4N2LA 1QW9A 5AW2B 3E6FA 4L2YA 4P4KA 3GUFA 2A6KB 4BA8A 5JHLL 1IEHA 4LOUC 1X5HA 2H26A 3H8NA 1PAZA 2V9RA 1CF8H 1G4RA 1U8MA 4RFEB 5EBWA 1A14H 2WUBL 4ABUA 3UJIL 1SRDA 1BQ5A 3GO1L 1QD0A 3HE7B 3PL6C 4V1DE 2EC9U 4G8EA 5DJ0B 1PZUB 5A3ID 1KBGL 1A7PH 5IBTH 1MCJA 3V55A 5DURB 4KI5F 3GSOA 3FU7B 3NCBB 3NQKA 1EMTH 5JORA 1A7OH 3D85D 4I3SL 4U6VH 1PPIA 3Q2LA 1GCFA 3VXUA 3DPBA 1MF2H 2G3MA 1P7BA 2OQJA 4X9YA 3T4YA 1UM6L 2XWJA 3KPOA 4KO5A 5DMYA 3SQOH 1E3ZA 5BQ7B 2ZCHL 4HG4J 2J25A 1L9OA 4IIQA 1MHCB 5FDWA 2WIMA 1IGTA 4QO1B 3E8UH 3NZHH 1JD7A 4HWUA 4NJAL 4NI3A 5DDHB 3S8WA 1KNOA 3O6MH 3JZ7A 3A6OA 3WCYA 2OJEA 4EIZC 4KKRA 2HMID 2WWMC 1IBGH 3QHFL 3WFHA 1BF8A 1N6VA 1AJ7L 3ORJA 5DT1H 5JR1H 1X7QA 3HOGA 2X3AA 4CGTA 1P2CA 1D6EB 5INDB 3HS0B 2WUCL 3RAJH 4X6EB 5BS0E 3B9KD 5KSAA 1Z5LA 1ZV2A 2CXGA 3HC2A 5HHNA 1IAKA 4ERSH 3VWJB 1JMZA 2DLHA 2Z0UA 1RZJL 1I3RB 4LOFA 1MQKL 3GIZH 4KDTA 1FC1A 4PWEA 3U1PA 3ECVA 4GMSH 1D5BB 1OK0A 4JCMA 2CO7A 1J1XL 4FQIH 2DLIA 4PW4A 4HH9B 4X9IA 4RWYL 3KPNB 4KXDA 1CTMA 2ATPB 4OTXL 1OE2A 5E9NA 1XSOA 4P46C 4HF5H 1R5WA 3O6FA 3L1FA 3UTSE 3DYMA 1R19A 5HJGA 4APQD 3QQ9D 4WV1B 2RFXB 2XETA 3GSXA 5GS2D 2AV7A 4FN0A 1OOAA 5E2WL 5DI8B 1M53A 2VLKE 4JHZA 3H3PH 5TD4A 2LOEA 3KWWB 4PJCF 4YWGH 3S0PA 2ZXAA 3BAYA 1QR4A 3C5ZD 1GSMA 3UTZA 1G7MB 5IV2B 2DQDH 5ESQA 5FWQA 2YMOA 2ZYHA 2V2XA 3WTTA 2R1WA 4H8WC 1AZRA 5D2LB 2DQUH 5IFJA 4R2GB 4HD9A 2J6EA 5FKAA 3DRQA 4LU5L 5AW9B 2XTSA 3IRCA 1K4DA 4GT7A 3V5KA 2FECL 3LKQA 3F7RA 3QAZB 1B9KA 1BD2A 4ZFFB 4FLRA 4HOMA 3ZHDA 1WZAA 3HA0A 4O00A 1P7QB 4OGYL 4LKCB 1VENA 3TBCA 3FO2B 4GEIA 2OTUB 5EUKB 3GRWA 3OKDB 2VSCA 1JXGA 4N2IA 3CH8A 2B39A 4R5VA 4JFVA 2VLJB 2WWKT 5DEJA 5DZVA 4F57L 4KI5C 5DFVC 3N6YA 3SYAA 5KYYA 2FEEL 4IJ3B 4I9XA 4TSBL 5A7EA 4TPRL 1BLNA 1ACYL 1UXSB 4EOWH 3QB7C 4W9GC 3GZPA 3F05A 4JRYE 4PRDA 3UBHA 4BSVA 1CGYA 1COBA 4EIBA 4IGBD 5ECGA 4ENEC 3GI9L 4GAYB 4LLUB 1NMCC 3CFCH 5INCB 4RSYA 2LLLA 1DO6A 2CO3A 5EU3A 1WAEA 1RK7A 3FCUB 4Y4FD 2PWEA 4M7ZB 3WMSA 4KUZL 3ABZA 4YEFA 2DWDB 5F9AC 3ZMEA 2AJZB 4HYTB 1IGFH 3DIDA 5GGSY 1V27A 1ZLWH 4AZUA 3S8GB 3M86A 4QRPB 3ULSA 4U1JB 2K4WA 4QHUB 4OKDA 3AABA 3HLAA 4JFZL 3RGBA 5AW7B 3VD2A 2XPGB 2NZ9C 2VXVL 2XVKA 2KUTA 2HT2C 4OF7A 1R9FA 1EBAA 1HEZA 2IPKB 5DJXB 4KKAD 3CFIC 2FT6A 3HRZB 3MRQB 4P8QA 4FP8H 4KKNA 2W1NA 3BFOA 1W72B 2FSEB 4M6MH 1U93A 2BS71 3LRKA 4L5FE 1EFXD 4PJ5A 5KS9E 2BS8A 1JP5A 2I9LB 4LLWB 1BA9A 1XCTB 4N68A 4Q0XL 1JHLH 1N4XH 4MA3B 2V7NB 3FTWA 1BJMA 1L7TH 1JGLL 1FFQA 2FEJA 3MOBL 1HNYA 3O8XC 3KGRA 4OFIA 3KPRB 4NHUB 1LEKA 4E9XA 1H3XA 3WTSA 3IFNL 1RU9L 1S8DA 2XWBA 2CH8A 2X42A 1FH5L 4P4RB 1O6SB 4JQXC 3DOIA 2P9RA 4N0FB 4F9PC 2VRKA 1XB3A 1QUPA 4P23C 1F3DJ 1VADB 4UQEA 2MTAA 3RVWC 4DNLA 5K59E 2IAMB 2B1HL 3MLPA 3V0FA 4E9YA 2JKSA 1SBSL 2DYPA 3FSVA 2YSTA 4J3OH 4XCFL 2CDGB 4EDXB 1WPCA 3VU2A 3NCJL 4Z7VE 4RGMC 3OMZA 5ID0A 4F8PA 4GG6E 5D6DA 4IM8A 1IV8A 1ZLDA 2DWYA 2XACC 2CD0A 2DJ4A 3A47A 3UH8A 5M7QA 4Y4HC 4B9FA 3RU8H 5DWPA 5AAWA 4ZFOB 4BCXA 3NCMA 5ENWA 1BOYA 4NQQA 4JG1L 5IROD 5FA3B 3DXAD 5T1JA 5E4EC 1QW8A 3ZKND 5C71A 1UKTA 2L7UA 1T1WA 4Z0BH 1B6UA 2JJVA 4LSVL 2B08A 4OQ1A 4WTZG 4TVPL 3KYKH 1MFAL 4XP4L 1DUZB 1E7UA 4A2DA 3FRUA 2NR6C 4N0UA 5TQ2L 5JMOC 4U1GB 1OAKH 4FNQA 1FZMA 4QHKI 5C08B 3IDGA 2ZP8A 4L0YA 1UATA 4NM4L 2HX7A 2PW2A 2ID5A 5I1LB 1RUPH 2CKBB 4UANA 2E0PA 4IBZA 1KB5A 5FCUL 3VD7A 4X7TA 4TSBH 1I8IA 4M1CC 3NIFE 1ZHBB 3PAYA 3GB7A 5J7CC 2B1AL 5EC2A 1MCIA 1V3LA 2BNUA 4GKNB 3CCHA 1U3HC 3TBTB 5C0BE 5JW3L 4IDJH 2LFGA 2D2OA 1TXKA 3K81A 3ME0A 2X89D 3WLWD 3MKKA 3Q1SL 4Z77A 3C6EA 3DJZA 1HQRA 2ZWYA 1BMWA 3K6FA 3H9SA 4QJ4B 4JR9H 4P9HH 4JPQA 4ZYKA 3GI8L 3CX5J 3QJFB 5CZKA 2BSED 1IGFL 3D34A 5AVQB 1VFMA 4YSEA 3EJUA 3L48A 1OTUC 3IU3B 2RGSA 1TKWB 3BN9C 4XNQB 2QGDA 3LKQB 5T1LA 4QPEA 1UXSA 4LGSB 1ED3A 1MCOH 3QJSB 1NEPA 2WXQA 5EFIB 3RNQB 4KKQA 3GYRA 4G6JH 1NFDF 3KDMB 3EJQA 3LVTA 2EP6A 3ULVE 4IIZA 1PSKH 1OAQL 2JB6B 4U49A 1RHHB 5IW3A 4PGCA 4TM9A 3E3QE 4HDIA 3TYGH 1JUFB 4TNGA 1A7RL 2BDNL 2UX7A 3F7LA 4Y1AE 1XGTA 3D3VB 2WINB 3IDMA 1P7KB 2CCVA 4AM0B 1AFVH 1FSKB 1CE1H 1U2HA 3NZ8B 1NMAH 2X4TB 1BGXL 4RRPA 4DKEH 1LO0H 4MCYB 4RGOH 5E9DD 4XPTH 1ACCA 4A7SA 4GW1A 1OE1A 3RGHA 1EZSA 1DVYA 3CLWA 3DV4B 3RA7H 1WUZA 4I88A 4MHHG 5E99L 4L4VD 5CLYA 1VACA 2WXOA 4G59C 2A73B 1YYCA 3F7VA 5JTWA 1EJ6A 4JZNB 4KJWD 4OZHA 5FWRA 4BFKA 3WXVL 1CGTA 4ZMTA 1P2CB 2V8MA 3VFSA 5E1AA 4NPKA 1A6TB 3X3GH 4ECNA 2ZUTA 3GMOA 1L7IH 4NAQA 3UGUA 1QR1B 4XAWH 1B0RB 4U7MA 4NZUH 5A16B 1G7JA 1KWGA 1KNOB 1J8RA 1OARL 1AIZA 4MJ5A 1T66C 1NFIB 1PKQB 3OPUA 3C08H 1D7BA 1FF5A 3VAEA 4P2QB 1QSEA 1SJMA 3DPBB 3S5LA 4EOWL 2XQ0A 5IQ9B 3RBSA 2VXTL 3HS0A 5TF1L 1K8DA 3B2MA 3LN4A 5D4QA 1CUOA 4S2SA 2HPTA 3L3OA 4JRLA 2OMVA 4NCC1 5E1QA 4LLMB 2NDGA 4ZAKA 5IFHH 2OJEB 2EXYD 4Z5RA 3KVPA 1U8IA 2Y5EA 2X1PA 3OG4B 1FVDA 2ZF8A 4ANXA 4N1HB 1G7MA 1XL4A 1LD9A 3HMWH 3WSQH 2KH2B 2NY5H 3WNOA 2B59B 3QGVA 1NEZA 3UTTE 1YLBB 2HA1A 2VC2B 2Q5BA 6PCYA 4UM8B 1DTUA 4FLHA 5L4MA 3X14A 5DC9B 3V6OC 3ECBA 1ZSDB 5D7JB 2DL9A 1CE1L 1UXMA 2UZPA 3EBGA 5C0AD 5JA9A 3SKMA 4XNZC 5D71H 4LIQL 4M93C 1DQLL 3VFSB 1XZWA 5I75C 4NZ8A 3F83A 4FYSA 3BP6B 2FHBA 3C6SB 1E2ZA 3NPSC 3IEAA 4I87A 1JIBA 3VFOB 3MLXL 4MCMA 3RZWA 3KLSA 2YD7A 4PJFB 3L6FA 3HIZA 4I8DA 2E7MA 4MMYA 4RBPH 1BFSA 5E2TL 4A2FA 3OXSB 3N50A 2V2TB 1YYMH 3UDWC 1XZ0B 5ALBH 1L0PA 4HKJA 2DD8L 4PJEE 3T2QA 4H8PA 1IT9L 1PLGH 4AYFB 5DFWH 2EO7A 3ESUF 5J0BA 4X7FC 1KC5H 3RY4A 1WGOA 1CFVH 4P4KC 1GGCH 2R4SL 5D7IF 5AD0A 4HWEH 3GBEA 1QA9A 2Q6WA 3QG7H 5GS0D 2WGXA 3P4OB 3OZ9L 3JWDL 4C4UA 2C8NA 2XRAH 4U0QB 2XJKA 1L5GB 2DQFB 3GXTA 2NXYB 4FNRA 2F19L 1P4LA 1WCBA 2KDGA 4FZ8H 3RFZB 1PX4A 3LEYH 5E8PB 3VXUB 1FNSH 3N41B 3B5HA 3CFTA 4DKEL 1TF4A 3QA3B 1E30A 3VGGA 3I74A 3GIVB 4FKHA 4LOEA 5FYLL 4BIKA 3FT9A 4U6XA 3FU7A 4TSCH 4UOW1 5E94A 2D3LA 3I75A 5CCGE 4P0DA 4LXFA 3SGDH 1QZNA 2DI7A 3WJLA 1CBJA 4YDVA 3LS5L 3MPCA 4KI5D 5ETUB 1F1GA 3DSFH 1NCBH 2TSAA 5CSBA 3WFEL 4ES9A 5KVDE 3VWKC 1O6SA 2EO9A 4X83A 4F7EA 1MFVA 4I0PD 4ODVL 5BXFA 2A4EA 3VXPB 1MFAH 4IBQA 2OL3H 3RI5F 3P4MB 4P9HC 3WOVA 4EAEA 2DWEB 2YGOA 2CHNA 5MENB 1X44A 3MGTB 4PBXA 5E4IA 2QKIC 3U30C 2OK0H 4PEEA 3OR6B 1DDHB 2DJUA 3P9WB 2WQUA 4LSPH 5A2JH 2UWEA 4Z7WA 4MQ7B 4TLSA 3O2DA 5K9QG 3I84A 5GS1A 1A4BA 1AQMA 3U46B 1KENH 4P48A 3MJ9H 1PG7L 3JSSA 2H3NB 2P8PB 4EBQH 2AMGA 2E4TA 1X5IA 3PUUA 2DQ6A 4X2UA 2X12A 1RCYA 2XG4A 2FO4B 1HIML 3L9YA 4Z7AA 2NZ1A 1D5IL 3UAAA 1OY3B 4Z7UB 1ASPA 3MJ6A 2HRLA 1EZLA 4K94H 1MXDA 5E1AB 4GIOA 1PZSA 4BGLA 4Q56A 5I19H 3JT0A 4JKPH 3NFPB 5ISZD 5DRZA 4APXB 3SQRA 3V7MA 2FX7L 3HUJA 3HFML 1DJYA 2NT1A 4ICXA 2XFGB 4Y1AA 4PY8J 4XCYB 2J21A 2JXMB 3QNZA 1OGAE 4UUJA 3LPPA 5KUKA 3CN4A 1QLEB 4PV1C 4HUMB 4YEEA 1H8LA 4TSCL 5IQMA 1AGCA 5T1LD 1X7SA 4G8GB 3BRFA 3GO1H 4M62L 1IKNC 1XD0A 1MELA 1YPZB 3EOTL 4G7YL 5JOPE 4L4VE 4E36A 4PN6A 4YDKL 3HZVA 3CSYA 3I6GA 4KXBA 5LNEA 4YO0B 2PP7A 3OKKB 5KVFE 2G5UA 4FTVD 5IJVB 1HXYA 1E4XI 1MIEH 3QZLA 3MRJB 3QXDB 3UC0H 3ZTCC 3H9YA 2Z1PA 5BRZB 4DVBB 3RVTD 4C47A 2B59A 3LMJH 3NSXA 5I76B 4GSRA 4BK8A 4M7LH 4F7MB 4Y2NA 1I9IL 2R29L 1HCYA 4MNHB 2ERJC 4RA0C 4A7GA 4ZD3L 3MDJA 3IRPX 4GRLD 4KAQL 1TQSA 5KANG 3TFKD 1YEJL 1NBQA 5DVMA 3BZ4B 2AJ3A 5HHME 4EKJA 1N2RA 2WYTA 1EBPA 4Y19D 1NCAH 1HILA 1U91B 3AQZA 4WHYH 2EICA 1MCNA 3LPFA 1FNLA 2AQ3A 5I1HH 1CICA 1DQQB 2EIMB 3RHWK 4G9FB 5F88A 3BUYA 2XN9E 2JQMA 4H25B 4IK6A 3U82B 3D25B 4FLQA 1IQWH 2ALAA 1UZ6F 4PVLA 4NQXA 2E74C 3DX7B 1L7IL 2RFXA 3EO9H 3GSXB 3HB3B 3IMWA 3K1DA 4M7KL 1KCVL 4OLEA 4BRJA 4GMSL 4P99A 5E8EA 1CFQB 5DD1L 3DSFL 3WFEH 3GEFA 1OB1A 1B4TA 4YHIB 2ROYA 4HG4K 5JO5A 4PCYA 4G1EA 2ENSA 3N44F 3IAPA 4UDTB 1WD8A 1THAA 4XR8C 2EIKB 4HCIA 1XGQB 1QSVA 1PD0A 2V37A 5CMAB 4K73A 1XF2A 1VACB 5CD5D 3B2DC 1X5GA 1DL7L 5IK3A 1N0LB 2ZP9A 1MCKA 1JZ3A 3QDHA 3KM1A 2XQBL 1HC1A 3GUTA 4R3SA 4P46A 4QTFA 2EDBA 2PTTA 3TGXA 4ONHA 3QS2A 3GHBL 3BGFB 1RVFH 3FKUS 3QAZC 4NUMA 4YE0A 4YDKH 4YSCA 4AYMC 4U0RB 3QUMA 2VAAA 4ONGH 1I8MB 3NIGB 4NZFA 4P59H 3FQWA 2CDEB 4XXWA 2AEQH 3L9EA 1E4XH 4CSSA 1PJWA 4HBCL 4NKMB 3BN9D 4Y2DC 2PMZA 3SDXB 5FB8B 2CNZA 4TNVF 2AXWA 5EOQL 3UO8B 2VH5L 3TO4C 1DCLA 5IBTL 2ALWA 4X80L 4ETYA 2APSA 2Q9OA 4H0IA 1NCDL 3W38A 3FBKA 4I1RA 1XCXA 3VQLA 2RA1A 2CDGA 2VSMB 3IMRA 4EDXA 1L3NA 4P06A 3LDBC 5AOZA 4R9HA 3EXLA 5KG9B 2X4RA 1T83C 3BGAA 1P4BH 5CWSB 5FM5O 3N40F 1T04A 2BIPA 3ARPA 4H5SA 5ESQB 2XXMB 1CLZH 3NH7L 1D9KA 2CSPA 5DJ8A 4B27A 4GBXC 1YG9A 4PJGF 1D5ZB 1C1EH 2ZWNA 3QCUH 5FLVA 3BVNB 2XWCA 3IDNB 3ROLA 4HXAL 4YDLB 2NY4B 1YEEL 3PJNA 5CJQH 1N9PA 4YBLC 1YMMB 1G6RL 3CN2A 4JFHD 5AENA 1AJ7H 2FT7A 3STLA 2NY1B 5JMRA 3UOAB 5DHXB 1ORQA 2UVFA 2C7FA 3QCVH 2APWA 3QFDB 1G84A 2XV6B 4DUWA 2I9LA 3O9WA 4LLWA 2MEJB 5IJBC 4P5KA 1ECZA 3VWJD 1KG0A 5I1JH 2XDHA 4XNDA 2EE0A 4YFLI 5FYLD 1W72A 2FSEA 4F8NA 5E8NB 1ZHLB 4CKQA 2P8PA 1KLUB 5ESAA 3O8XB 1Y0LB 2NY3B 4ICWA 4AIZA 5LQBH 4PHXA 2R4RL 2CZNA 1CLYH 2CLZA 2YQGA 4HIXL 3RVVD 1EPFA 3Q8EA 3WJMB 4Z7OF 3SDAA 5JZ7C 5C07A 4RWYH 5L0QC 2AQRA 3F8UB 3JTTB 4JDTL 2VQTA 5TJWK 1WAPA 4KNSA 3RWDB 4WK2B 5GS2H 3ARED 3LV3A 4OUUA 1T7WA 1OP3H 4KI1A 3PFUA 4POUB 3JQOB 4X99A 2AEQL 2P43B 1Y1DA 1DBJH 3FQNB 3CVCA 4OKVA 4HUWB 4AT6B 1GC1C 4XN2A 1I1RA 1BQUA 3AC0A 1R3JB 5FM8A 3PP4L 1NIDA 3GWJA 4MWFB 4X6CA 3SN6N 2ZT9C 3GGWA 4U3SA 4PY7B 3P73B 3SGEH 3A21A 32C2A 4WKXA 5I6XC 4NNPH 3V7AG 3TEXA 1EO5A 5KVEH 1DQMH 3T3MB 4NRXA 4X5QA 3VXQB 4BH7B 1V7ML 2ZAHA 1SBSH 1CLZL 5HY9A 3V10A 5FGRA 4ZUSB 2WJ5A 2V2WA 3GBMH 5SX5K 2VMDA 4L1HA 2Y7NA 4YN3A 5F3HB 3IDJB 3U1SH 4NNYA 3GBLA 4OAWB 4ONFL 3JWDC 2B9AA 1MEXH 1HHJA 2BSRB 2AXGA 3QEQE 4K3JL 4PV8B 1U30A 2Z31A 4KXAA 4YIQB 1ET8A 1G1KA 3OKOA 5B3NA 3VXMD 3BWUF 3VNZA 2IBZX 1UVQB 1EMTL 4UAOC 1M6OA 3SO3C 3DGGA 1DQTA 5ISZA 4HKJB 1P0SE 5E70A 3TT1L 1IGJB 4NO5A 2F74A 4QT5B 5DHYA 5IMLB 4YXHL 1QRNB 5LGJB 3HMXA 2CLRB 3ZTNL 2GJZA 3LRMA 3O2VH 3VVVA 3NJVA 4OD1L 2GY5A 1HCZA 3FO1B 1KIPA 4P4KD 3SQBA 2HG0A 3EHBC 2VMEA 3RIFF 2HVKB 5B7MA 4ORGA 1YEGH 3QUXC 5GS0H 5HYSG 4Y5XC 2KL6A 1C16B 3NFSH 4N2BA 4MNQB 4NQEA 5I26A 1HCFX 2IGFL 2VLKD 1CK0L 4GI8A 2AJYH 3BCFA 3C9NB 1A6AB 1A22B 1DBJL 4HK0A 3IJSA 4GUPB 2ADIA 4UTBH 1NCCL 1JNLL 1TNNA 1EEZB 3LS4L 2I5YL 5G4OA 1T4KB 1N64L 5F72S 1N8ZB 4JMNA 3DOSB 4R97B 1XF3B 3DX6A 3LD8C 5DD5L 1EDQA 4OF8A 1A3ZA 1U8IB 2BC4A 1U36A 4Y4KC 1USQA 4OIAA 4A7VA 1JHLL 5IJKA 2QSTA 5ITFB 4F2EA 2VM3A 4NHCH 3STZB 4LLMA 4EIGB 1BG9A 1J8HE 2O5ZH 3IE9A 3G5XB 4GSQA 2NCEA 4RISH 3RY5A 4AEHH 2CU9A 1BZ8A 1VESA 1ZANH 2WPGA 4J5VA 1U6AL 1EZVX 1KPUB 2JE8A 5CGMA 2ZUUA 4FQJH 2D0GA 3HB3C 4WEUD 3RWJB 3BQUA 5IB3A 2CJUH 3OKDA 2VLRE 3PDGA 2XWJB 3KPOB 3VG0H 3WIHL 5D9SA 4I4WA 4PJIF 1MPAL 4DK5A 1BJ8A 1YEDA 4PM1A 1NLDL 2GB2A 4JY5L 4LU5H 1HI6A 2CIIB 3V5KB 4J3OG 3POCA 4D0BB 5I73C 4HCRL 3NCJH 5C3IA 1T3FA 3RKPA 2CKNA 5GHWH 1WK0A 3ARDB 4R3SB 3UBXA 3BD5A 1T7ZA 4MVBC 1JGIA 1BGXH 4W9EC 2WO2B 1SJHB 5EUOB 1NH6A 2G5BB 4QOKE 1KY7A 2AZAA 1XB6A 4MMYB 1RZFH 5F7LB 4C4KT 5CEYB 1GVIA 1OP3K 3AG1B 1ZT4A 3WFCL 1MFCH 3NSCA 4G43B 2ZKMX 5D8JH 5I8CB 5E8DL 4WWKC 3F85A 3EFFA 3L1OH 1ACYH 2FJFB 3K3QA 2Y1YA 1G7HA 1ML0A 4LNRB 3JUZA 5FF6A 3SKNB 2GK0A 4QRRE 2ZG1A 1E9PA 4N9GA 3GTTA 4HMCA 4HGKC 1R24B 4I3RL 4WW1B 3AU1B 3QEGL 4PWGA 4F2MB 3UL4A 4QTHB 3VDAA 2EH7L 2XKNB 1VCAA 1UWGH 4C56B 3ZOAA 2YA2A 1CICD 4E41B 5K9OA 4I1PA 3TN0A 3VSUA 5DJ2A 2WXFA 3GRBA 2P3YA 3NCWA 4RMBA 5FM4A 3T4AB 4X98B 4PGCB 3TLRA 4Z7QE 5GZND 1I3RA 1EK3A 3UP6A 2ED6A 5CJXC 3BWZA 4PLOB 1P7QA 4XN1A 4ZS7L 2CNYA 4MRBA 1JCVA 4JFEA 3BN3B 3IWUA 3VH8G 1BIIA 5F70A 2OW7A 3ATBA 2EDWA 4UF7C 3H7BB 3TXAA 1WFMA 5ADPL 3K74B 5IFJB 4DFHA 2Y4SA 2IDTA 2GT9A 5F8QC 5T1DL 2ARJQ 3MRKA 4NP9A 4OUOA 1ZGLA 4DGUA 3FULA 4BFBD 1RSYA 3JWOC 4QKXB 1TSRA 1ADWA 1XIWA 2IH3A 5IF0B 1EAJA 3VD5A 1XVSA 4XPFH 1W0VB 2IANB 1KXHA 1W8NA 2YLKA 4AW7A 5BOJA 2QADD 4LSDA 4N8VA 5F7FA 3OLGA 5TDNB 5CU9A 5GZOC 4M7ZC 4TUKL 1B0RA 5DQ9A 1IM9D 5FGBC 2X7LA 1AZCA 2HJLB 2HLAB 2VAAB 3MLUH 3P0VH 4BZ2H 1G9MC 1YNLL 1I8MA 4OGQC 3FB6B 2VAJA 4CBZA 1TQWA 4G6JL 2ARJB 3FB5B 2QLVB 4FQXC 4LLDB 3WDJA 3GB7B 4BD4A 4M7JH 1CLYL 1DQLH 3W9DB 2XT1B 4M8RA 1UWXK 5SX4H 2DYRB 1DDTA 3D2UD 2DQTH 3BT2L 4ZMQA 5BRZD 1PTZA 4HK0B 5HHNB 1QNIA 4KQ4L 4FL4B 3GBNH 5E5MA 1S9VA 4FFZL 1YC8A 2P45B 5EDSA 1QFPA 4GY4A 2JKRM 2MPAL 2G3XA 4HC1L 1A3LH 2XNAB 4FJYA 5AB0A 1D2OA 5K9KA 4PJAF 5FECA 3N40P 3BZFA 2XX1A 4YHPA 3VYPA 3DO3A 5IVZB 1VFBA 1MHCA 1ZCRA 2HRPH 3P30L 4KFZC 4BQCA 4ZZKA 3ZDZF 4RIRB 1EZUA 2AJSL 4OCWH 1E43A 1D5RA 5AKRA 3QRFM 4OJCA 3AS0A 5HVHC 3BHBA 5I16B 3KDMA 3HR6A 2VLLA 1LL1A 2CGYA 3NPSB 3QVAA 5G4NA 4JY6A 3ISRA 1SDDA 1XO8A 3O0RH 5F0LB 1TKWA 1JTPA 1AZBA 1MHEA 1GAFH 3WKMH 2DICA 3GMMB 4XXCA 2OMXA 1HHGA 4ABQA 4HV8A 4DPAX 2A6JB 5D8JL 2RH0A 1ZVSA 5DUBA 3WBDA 3FXIC 3EZ8A 3JWNG 5KYUA 1Q90A 1NBZA 3WUWG 3WHXA 2F08A 2F8OA 3QZWA 5DFAA 3LS5H 3S35H 5JLZB 1ZS8A 3S98A 4WI9A 3JBG7 4N3TA 1QRKA 3HG0A 3P9LB 1FZKB 1SXBA 3BGMA 5C0IB 1IIKA 4L2LA 3VFUB 3NCYP 4HJGA 1OD7A 4U1NA 1ZLUH 2FJUB 4TUUA 5A2KH 3EFFB 5JW5A 1KN2L 1I53A 3KPRD 1FWXA 5LBSL 1Q9WA 1G94A 4MNGE 3L3KB 3MRNA 4QGYA 4IRJB 4B5ZA 3LIZH 2OK0L 1JK8B 3W5MA 2W8CA 5CCHE 2P80A 3UJTH 5D72H 2BW4A 4M02A 4OVVA 1FFNB 4HJJH 5DZAA 3CHRA 3BPOC 2Q6WB 3IDGB 1TEFA 4YHMH 1GC1L 3LX9A 3FQTB 2X9YA 5FKPB 4MJ4A 5TE4L 1WIUA 3EO0A 4R96A 3U2IA 3BW9B 5J6HA 5GGSB 1YMME 1Q1JH 3VFMA 3PIQA 4JG0L 2DDQL 1BEYL 4XB7A 1JZ2A 5AFAA 3UZVB 1JPTH 3OAUL 3O3BB 4R97C 1N64H 3EJRA 4NP4L 5D7IB 5D9SB 4IDLA 4OAWA 1IGIL 1VEPA 4ZOEA 3ARFA 5FPIA 1FORH 2PW1A 1AHWC 4N2CA 1WFUA 2J2ZA 3HE7C 3PL6B 4OB5L 2JJTC 3SGDI 3VD3A 2A77L 3MREA 2NUTB 3MCLL 5TH2B 4C56E 2WTRA 4TN9A 5EBLA 4HUXA 4QAWA 1SMAA 3JYBA 4WY7L 4N2KA 2V17L 4MCZA 2DWEA 1E3FA 4JR9L 4P9HL 2WMPA 4H4NA 3MGOA 4BA0A 32C2B 1SMDA 3VXPA 4J23A 3X14B 1LO2H 3NJIA 3QDGD 1U8QA 4U1IA 3HG4A 4N8CH 3NOIA 5DZNA 3ESPA 1WT5C 4JFOB 4F7CB 2NTFA 1ZE3H 1Z9OA 1MCRA 1P5VB 3L3IA 5HYQA 1T04B 4H5SB 1VF5C 4AX3A 5EZLB 1M2OA 3VGAC 1G4MA 4NQEB 2VXQL 3KJ6L 4Y5XB 2APTA 4BQ6A 4EDWH 2E3VA 1WDAA 2AQ1A 4S2SB 3G6AA 3QK0A 3ZDXE 4PJHB 2AJXH 1UXWB 1A1MB 1WJ3A 2FCBA 5H37H 4C58B 4K23L 2DN7A 3U7WH 5F7UA 5LHDA 4NZJA 4WWKB 2EDYA 2H9GA 1JV2A 2X40A 3WS3A 2W92A 4IU2B 4PTUB 3JWOL 5DGRA 4UU9A 5GRUH 3X3FL 4HPHA 4PJDF 5DYFA 4GBXA 4E42A 5J11B 1U8OA 2F5BL 3LD8B 5IMLA 4O4YH 2GTWA 3HKZA 3QWOA 1JPSH 2K3HA 2VT0A 2YJLA 4XCEA 4CUCA 3AMKA 3C2AH 2IOIA 1QAWA 2XN9D 3L13A 3TONA 3O4LE 5TQ0L 3QFDA 4PREB 3WYRA 2DQEH 5DVOA 4Y9BA 3ZX1A 5KW9L 1T1ZA 3SKOB 1CQYA 3NSFA 4Z7UF 3DI2B 2HUHA 5IJCC 3MLYH 2WB1A 4WI5A 4WNJA 3HMWL 4AIOA 4HBQA 5CCKH 1HH9B 3I02A 5LGHH 3Q01A 4WJ5B 2YN3A 4OQTA 5HI4D 1KTKE 1DJGA 3FC8A 3GXFA 3BDYH 3LEXA 1P7QD 4XNMB 4P2RE 1H6TA 3FB5A 4LLDA 1PFCA 1TYRA 4TS6A 4LL9A 4U1KB 3R1GL 1BLNB 1QBMH 2BVOB 5F9WB 3ULUF 5I1KL 3I6LD 4WI6A 3MYJB 2Z35B 1CE6B 4PY7A 4U33A 3QQNA 4OM1L 3ARDD 5T1MB 1EJOL 1OO2A 1JF1B 5SWSB 4X7DC 1R3JA 1MDAA 3PWJB 4KDVA 4UINH 3NZSA 2X1WL 1FV1A 4OQTL 3VWJC 3WS3B 2BNQA 1Z9PA 4K71B 1E4XL 4G8IA 2K8MA 5LJYH 3DX4A 1I1FA 1KBKA 2HTKC 1RKRA 2ZCLL 4HEPA 5DJCB 5BW7A 3MLVL 3K2MC 2NY4C 3PGFL 2VDPH 2XXGA 3STZA 4I5BA 3EZJB 1ILUA 1QSED 3LN4B 1ORSB 5KSVB 4OFPA 3V52L 4G3YL 2V2XB 1UZ8A 2R59A 1QP1A 4FL4C 4BKSC 1JGEA 3CE1A 3EYVA 3I9IA 2F19H 2QVFB 1OD9A 2KZ1B 1XF2B 1MJJB 4RX4A 1AY1H 1EDYA 4J4PC 5HHMB 3T2NH 2EE2A 2V3FA 2J20A 4AK1A 4XPAH 4Y8AA 1AGEB 3AU1A 1M05B 1KULA 1ULVA 3HZVB 3A6BL 1XGRB 1KXVA 3A67L 3QIUD 3VRIA 1KEML 5D1ZI 1H15B 5AZEH 1NGPL 4JS7A 1VEOA 3HEIB 1I9EA 1T21A 3Q5TA 4MNQD 1YEFL 3SDDB 2XHNA 3GI9H 5CBEB 1EAPB 4XN7A 1FC2D 5EUOE 4HLEA 4JCLA 2CALA 3UPRA 3ZRFC 2Z1KA 4PFEA 1A1MA 4Z3EA 3MUY1 4XWOD 3HNVH 4P57A 1K8IB 4Z7OE 1CFNB 3KR3L 3QI9A 4OCSH 3EFDH 4KI5E 4K94C 4QNPE 4ALAL 2XN0A 5E0FA 5J89A 2R27A 2TRHA 5F7YC 1TPXB 3X13B 3OB0K 1QLEL 3DLQR 3L9BA 3HE7D 3LH2L 4OLWH 1CIDA 3FUFA 3V79C 4H8UA 1MVFA 1KB9K 3CU7A 4HX1A 2FUQA 2DMBA 4LCCC 4JL2A 3ES6A 1KIRB 3NZUA 5CJBA 1QYGH 4JDZB 5DD6B 1CLVA 4MKMA 1DLFH 3O11B 3A22A 3MRJA 3QXDA 5DC4B 3NIGE 2OSXA 2PR9A 5C3LD 1SN2A 4HSCX 3CVIH 2J7LA 2GJ6A 2HB0A 3HZMB 2P49B 3SDXF 4JKMA 1DVFB 3BH4A 4XO9A 1OWRM 3ELAT 4GEJA 3DA0A 4KRLB 4PP2A 1UUSA 5HYJE 2X6VA 1C5CL 4IS6A 1GZPB 3IDXH 4PI2A 5D2NA 3GJFH 4JO5A 5BZDB 3TH4T 3QUXD 2IWEA 3N0PB 2X2YA 4NSKB 2AFNA 4FS0A 4LCCB 3P3SA 1SN0A 4P4RA 2EDFA 3HI6H 4DESA 5I0VA 4ADGA 2HWZH 1S6NA 4PRHA 2BSBA 3VTTA 4ELME 3L4ZA 2QELA 3K6OA 4G42A 4ATWA 1SOSA 1H6EA 4LESA 5TE6L 3CFBA 2FT8A 3RB7A 5DJYB 1P6WA 5KSBA 4ORGB 3MLZH 1F97A 5CGYC 1QTSA 4WGVB 1F1AA 5BS0A 3IPEA 2EQDA 1WAAE 4KTDH 1JNHB 2R1YA 2HFGL 4XCNB 2OL3A 3MFFB 4LVNC 5KBPA 2UXFA 4EZMA 4NS0A 4WY7H 4ELMF 5BOZG 1E2WA 5D93C 3RILA 4OCMC 4TVUA 3ECQA 4JM2F 4GKSB 2ZZUT 4JPIB 4YC2B 1T1YB 3KWTA 4LSUH 2J73A 3ERXA 1T0MA 2WYIA 5E2VL 4F8LA 4LFHD 4TQIA 4A39A 2HKFL 2PO6C 4DETA 2X10A 1H19A 1YN6B 4QHMB 1IVLA 4WO4B 1R3HB 3AADB 4MD0B 3S96A 3TNMB 3GS4A 5E2WH 3DBXB 2WKLA 4ZFOA 1MFMA 1DUYB 1GMEA 1BWWA 1X5JA 2ZUVA 3L3JB 4HIXH 4QR7A 4KK8C 3BP4A 3SKUD 2OCFD 4LARH 3T6XA 1NBCA 2Y36H 2DLEA 4ONFH 2FSDA 1EHXA 3BH8B 4KV5E 1DVTA 4PRPB 4WW2A 1KTBA 4AM0Q 1H8OA 1IKFL 3F3HA 1AGCB 1WV7T 1TQUA 1HZHL 3G9VA 5D7JA 2C3HA 1WZKA 3BGMB 3D7PA 1B9ZA 2EC9T 2D73A 3O3DB 3O9WC 3HCVA 5AVTB 4CVXB 2I9TA 4OIIH 4QUOA 5IF0A 2NZIA 3PP4H 2VXVH 5I74B 1F90H 5LXGL 2XWBB 2C9QA 2GSGA 3EADA 3MUJA 3MO1A 1M1XA 4E0RB 1UZGA 4ALAH 4APQC 4FTVA 2XIDA 2FIKB 4KX9A 4YHOL 2A2QT 1E9QA 5C1MB 5GZNC 4IYKA 4Y89A 4P9MH 1R3KB 4PP1C 2J88L 2VDQH 4NQCD 1V7NH 5F9JA 2OMWA 4I89A 4ZSOE 2VDPB 1PLAA 3MRCB 4WCYH 5IVXA 4MSWB 1HU8A 1WBZA 3LZFL 5D7IE 2K8QA 1INQA 2ICWA 2KBGA 4NOFA 4XRCA 2PTVA 5DWUH 4G8FB 3UMTA 4QRPD 1GY2A 4MJ5B 4E68A 4KROD 3IFNH 1TETH 1CI3M 4JQVA 5LGKA 5L8KB 2HH0L 3DECA 5DD5H 1E4KA 2ZP0T 2AQTA 2QHRH 1I75A 4Y0GA 2PCPA 3EDJA 2FYYB 4H1LB 5C0BB 4JKKA 2C3VB 2W9DH 1XCQB 4JG5A 1UTDA 1F56A 1S9VB 3P9MB 1S9XA 2OYPA 2CHXA 4WFFE 5GRZA 2XV2A 2P52A 2ERJB 3MBXL 2QSVA 3BKYL 3GRWL 3HAEA 3K8LA 4H0GA 5C08E 4BK4A 5ANME 2FZ3A 3C5ZB 3QO1B 3SE3C 5I71B 1HAWA 1YEEH 4X5RA 5CJQL 3MTRA 3D06A 1A2YA 4PG2C 1PLBA 4MX7B 2YEVB 1PYWA 4YFDB 3LEVH 1RUKH 2BCMA 4PRDB 4PMFA 3VDCA 4FZEH 1OTSC 4JFDD 1HX0A 3MRFA 5ALCH 2QPSA 2B0SH 1RUML 3MNDA 2ORBH 3T08A 2A6IA 2PWGA 2R0KL 1HT6A 2QQNH 4AEIH 4M5ZH 5K93A 1JF5A 5FDWB 3VFWA 2D4FA 1TFPA 2JELH 4AQOA 2H8PB 4NZUL 3EGDA 4R2GD 3PWVA 1EXUB 2F15A 3QDME 3NTCH 4YDJB 1TSHA 3O4OC 1JE6A 1Y6NR 2VC2H 3UBGA 5A16A 1N6QH 3PWPB 5MEPA 1DVZA 4EUPA 1JYWA 5IHZA 2XVLA 2LQRA 4PWJA 1VGKB 3LKPA 2VISA 4E5XG 1CTOA 3T77B 3K6NA 2QQQA 3N04A 1Q9OB 4Z3HA 1CD8A 1YEKL 4E9TA 1XF1A 1OCRB 7FABH 4S1QH 3T6QC 1AH1A 4OI7A 1O9ZA 2A38A 3MA9L 1AD0A 4RMQA 1WWBX 3EUUA 3DOSA 5DZOA 4GB9A 4ZNEE 5B7FA 2Y3AA 5L2KA 1A6UH 1IRAY 4X98A 6TAAA 1XGUB 4J3WA 5EUOF 1MCCA 1AGFA 4X8GA 1ZHNA 2EDKA 4RCAA 2ADGB 3PHAA 1SNRA 3EOYG 2NY5L 3MJ7B 1JZ8A 4Z3GA 1GZHC 2IAAC 3APDA 3VI3A 4K7FB 4UZSA 3BQVA 3MU3A 1ES0A 1U58A 4H0LC 4CSZA 1QLEH 1W16A 2DI9A 1UKQA 1B4JH 3AT0A 4OJDH 4YSDA 1N7ML 2PPCA 4OIIL 3Q6GH 5J8OA 2HVKA 3SQOL 1IGYA 4K7PY 4NQXB 1RU9H 3H3PL 4MMZB 2VERN 3U7YH 1ZHBA 1L9QA 3C8KB 3P4NB 3FT4B 3T5WA 2WTPA 2G2PA 1RUPL 1JDDA 4KXZI 8PAZA 5EZIH 5I30L 4X6DF 1VFUA 5GJSH 1MEXL 2KZKA 1Q9LA 3VWJA 1OAQH 2H3KA 3WN6A 3L1OL 3CFJB 2IQ9H 4B0MB 5SX4I 4DUVA 2XYCA 1EO7A 1T3FB 2ZX9A 3V9FA