2MH4A

Solution structure of the big domain from leptospira interrogans
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
92
structure length
92
Chain Sequence
MPAALVSISVSPTNSTVAKGLQENFKATGIFTDNSNSDITDQVTWDSSNTDILSISNASDSHGLASTLNQGNVKVTASIGGIQGSTDFKVTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords LigB-like protein
publication title Solution structure of the Big domain from Leptospira interrogans
rcsb
source organism Leptospira interrogans
total genus 9
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2013-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02368 Big_2 Bacterial Ig-like domain (group 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2mh4A00
4HU8A 2ZWKA 2ZQKA 4AQ1A 2MQGA 1F02I 2L04A 1CWVA 3NCXA 1E5UI 2MH4A 1F00I 2MOGA 4AQ1C 3NCWA 2N7SA
chains in the Genus database with same CATH superfamily
5JIHA 2BXZA 4CVWA 2IANB 2WANA 1JYWA 5E0FA 4GG6E 1BZ9B 2ARJA 4N5ED 1YNKH 5K1JA 1WGOA 5J9PB 3B37A 2HFGH 5LNEA 1E7VA 2XY2A 3HMXA 3LEYH 4NOFA 2AK4A 4FLRA 5BCAA 5DVMA 1F2QA 1CXLA 4Z3EA 4LHQB 3DVNA 2M1KA 4EQ2A 1BQKA 1S7SA 2OMZA 2R8SH 2ERJC 4NKIL 3MRLB 4QYOA 3HI5L 4XAWL 2XIDA 2WXOA 1VIWA 4F8QA 1HS6A 2NY2B 2IPKB 4N0CC 4XVTL 2ZKWA 4ELMB 2XETA 1A5FH 5D72L 3IGFA 5LG6A 2HH0H 2UZPA 1E28A 3GHPA 4WSKA 2ZYHA 1CF1A 3VXUA 3VW3L 4ZTPH 3BWUF 1EXUA 2QV4A 1E65A 1HEHC 3TNMB 1X5GA 5DYOB 3QEHA 5IFJA 4PJDB 1NAKL 4M61A 4R7VA 5K9OA 4FNRA 4QD2E 3A4DA 4F8LA 1EFXD 3F8UB 3QR0A 4HW6A 3O6MH 1GGCH 1A14H 1SHMA 3BZDA 2Q7YA 3AVEA 3O6FA 5E4OA 5A2AA 3S5ZA 3WO3B 1ZWIB 2BZ7A 3SBPA 1QYGL 1S78D 4FP8H 1KSRA 5E2UH 1MJ8L 1IC4L 3DX6A 2HJFA 1EVTC 1XCQA 4IBLT 1NAMB 5A2KH 2MTPA 2OSYA 3ARFB 3ZGIA 4AYEC 1A47A 1QO3A 3GSVA 2K6YA 3U30C 5AZ2H 2A77H 3WHE1 1Z7JA 2YRLA 3NJIA 1HZKA 3O8XC 5MP6L 3UC0L 5IQOA 3SQRA 4QXUL 4U6XA 5E9DA 5ICXB 4WDIA 3HE7B 1A0QH 1CTMA 1ZEAL 2CBTA 2V17H 4UMSA 3K4DA 4L9LB 4AKQA 1GS6X 5A2JH 3PY9A 2W91A 2NNFA 2IGFL 4OCWL 4XMKH 4PWIA 4DK3A 3DX3A 3K81A 3UBXI 3TP4A 1NQBA 2D7TH 4JRXB 1FNSL 1OF2A 1XDTT 4PS4H 3SIKA 1E4KA 3F3HA 1MAJA 5DURD 2LR4A 1HYSC 3ZRSA 3SEPA 3EGSB 4DGIH 2FE0A 2Q6WB 4DIXA 2HN7A 2PYED 1ED3A 5F9OH 2IGLA 2ZYSA 2C9SA 1LLAA 1PYWB 2N1TE 5ANMA 1EDYA 4GYBA 4HH8A 4YNYA 5I8CA 3MLYH 5C6WH 5DMGD 1OEZW 1SXCA 1X5FA 1ZK5A 2DKSA 2UVFA 4YLCA 2N01B 1OGSA 2DM2A 1AKJA 3KLSA 4MSWB 1DSWA 4UV4H 4ZFZA 5EEZA 2GBAA 1YMME 3A3YB 1X5AA 1GJIA 4HAGA 3NK4A 2Z4QB 2BSDA 1AY1H 4N2DA 3OSVA 1WFMA 1U8JA 2D7OA 5D7HA 5EWIL 4JPSA 1VJSA 2DTSA 4Q97A 4ZMZA 2R0ZL 3P11H 1CQYA 3U4BH 1JOIA 1GZPA 3IDIB 4UQ2A 4G5ZL 1DLFH 4JO3H 1A9EA 1DQJB 2CDGA 3CE1A 1CXFA 2VM3A 5HHVH 1CZ8L 2P24A 3ZDWA 4ALAH 1JHLL 4DKAA 5IG7A 4LNRA 3C60C 2PCPB 5HI3D 1IKNA 1AZRA 4W9CC 1EXHA 4V33A 2J7LA 4F9PA 5JHLA 2B14A 4AENA 3TZVC 4L4TB 5CLYA 2Z92B 4L3CA 1KIQA 3MLSH 3C60A 3FB6A 3QPQC 1KYOK 1E6JL 4PGBB 5DRNB 3SQBA 1CICA 3VNYA 5G55A 2DMHA 4KK6C 1P7KA 4MAUH 4I88A 1RZPA 2AS5M 1OT4A 5K9QI 3TZVA 4UT9H 1WC7B 5LCVL 2ADGB 3QRGL 2YBRB 1JZFA 3B2VL 2A74C 3HZYB 4PJ8C 5BZDB 3R1GL 1J0ZA 1MLCB 4M1CC 4AQ1C 3GGWA 1WZAA 2ZG1A 1PZBA 3FQUA 2CDEA 3HVNA 4OZFA 5JLZB 3OKYA 4A6YA 2C1OA 2VGLM 4P2OD 5E4AA 1YPZE 2D0FA 4EDXB 5IJKA 5G4OA 4K3DH 1QKZH 3W1ZA 2BIPA 4Q2ZB 2XACC 1IBFA 1M6OA 1RZ7H 3LZPA 4OLZH 3DO7A 3QNYA 4GP8B 3Q3GA 4CBPA 2VXSL 4NKDB 3U2IA 4V1DD 5D96C 4KK9D 3Q1SL 4W9HC 4ADJA 3C5ZD 1LP9A 2KQNA 4FULA 3KPMB 1G6RB 2X6AA 4NAJA 3EO0A 1U95B 3LZFL 5I5MA 3A22A 4UOW0 4GW1B 2WBJB 3JWOC 4WCYH 3T0BA 2YOCA 3WS3A 2DN7A 2AXGA 1Q8MA 4JFOA 4XPGH 3FTXA 3GJEB 4A63A 3BT2L 4KVNL 2FO8A 4KNSA 4OLVH 4JFFD 3HOGA 3ULUD 1TTGA 4Q58C 5EDXA 3L08A 1BHGA 5E2WH 4JJOA 3BUDA 2IANE 2MFNA 5C86A 1T1ZB 2AERT 1BPLB 4J7RA 3KVDD 3MLVH 3QZOA 5GJTH 4ZQTA 3MUZ1 3CV5A 1BYOA 4KK8C 2MMXA 4UDTB 2FIKA 2CBPA 5DZPA 3DPBB 3LN4A 1MUJB 4BZYA 5G5DA 2N0MA 2VUKA 4L18A 3WO4B 2PTUA 1XV8A 5EOQH 5I0VA 2ED7A 4AUUA 4XO4A 4HZ1A 5DZOA 5M7QA 3J7HA 3QUZA 3K8MA 4Y8AA 4AY0A 1HYRC 1R3JB 5F6HI 1YNLH 2H32H 3BD4A 3SYAA 2UY7B 4X9FA 5ES4B 2BHZA 2ICWJ 2AI0L 5FX3A 3EKCA 1QBMH 2W60A 3G6DH 4KQ4L 5C8JB 2HX7A 4E9WA 2QT6A 1OW0C 3SDXA 3QYMA 3PQYA 5LXVA 3B6SB 2ICWB 3LCYA 5E5RB 3HG1D 2D9CA 3QIBB 1ORQA 5J1AA 5I1DB 4WKZA 4K8RD 4AZ8A 1P5UC 3LHPH 5GS1C 1OW0A 4L3EA 5J56B 4OQTH 2YUVA 2WTRB 3I6LE 4LLMB 1F4XL 4AUJA 1IQWL 3I02A 4YXHL 4JHWH 3BH9B 3TBBA 5GS1A 4WUKL 3FT2B 4IJ3B 1MI5D 3C2SA 2E7BA 3AS3A 4IGBD 3UG5A 4EQ3A 1X7QB 3QFDB 5FKAB 2CNZA 4ZUVB 3QGVA 4PWGA 1I82A 3A6OA 3JSSA 3QJZA 2Z93B 4PRNA 4QO1A 5DO8A 2LLNA 5DVNA 4LBAA 1NUNB 5ISZE 3CFBB 5F21B 5CEZH 4OIBA 4P2QA 3Q8CA 4AM0A 3WMSA 1G1KA 3QC6X 2YGVA 2BSRB 1I1AB 4HKJB 2YWZA 2BOBA 2DJSA 1NOFA 1WG3A 4F5CE 1GH7A 1TJIH 3MA7B 3SJVB 3JV4B 4N9OB 4ZNCD 3P9LB 3Q2VA 4PGDB 4XB8A 2JKRM 4FERA 1J0KA 3OZ9H 5JHMA 1HT6A 3QFJD 2J1ZA 1MJUL 5TH2A 5F89B 2F53A 2MCAA 4F8NA 1SYVA 3BQUB 4OCSL 3RKDC 3U2SA 3VSVA 4W9LC 1RFDH 4XMWA 3SO3C 5HHQB 1N4XH 4PYGA 3LVEA 4PREB 3GM0A 4RBPK 1EEYB 3BP6B 3QA3B 4LSUH 5KVDH 1J5IA 4QAWA 4JVPA 1JFQL 4PGEB 3S5LA 4EN3B 3MKGA 1P7QD 2VDOB 3MTXA 1HCVA 1RJZB 3ES6B 4MGXA 4AYGA 1U2YA 1VEPA 4ZOAA 5BRQA 4NO5A 2AQ1A 1XSIA 2NY4D 2BNRB 3LEVL 1RUMH 3V9EA 2QGDA 3TCTA 2EIZB 1NCJA 4XPTH 1RKRA 4HC1L 1IFGA 2TSBA 3H9SB 5F3BA 4YHLL 5IW1A 1CD8A 3UPCA 5C0GB 1HESA 3RL1B 3AMLA 1JCVA 3B5HA 5DC4B 4MB5A 4OZHE 4GMSL 1YN7A 2I26N 3AB0B 4Z76A 1XGYL 1QPXA 3OX8B 2P8PB 5DEGA 4FLHA 3UDWC 5MEQA 1ODUA 3BHBA 4MZ3A 2ZYIA 3SKMA 1Q1JH 5BO1L 1PDKA 4FHBD 3U6RB 4JM2B 2QADB 2YQ3A 1BQLL 2YS4A 4U1LA 5ESVA 4IBYA 1WBXA 3QJSB 2LTQC 3VNZA 1KIUA 1LDSA 1WSST 1OZUA 4N85A 4TNWK 3UDWA 4GRWB 5IHHA 2CPCA 5GZOA 3RYMA 4PWFA 5EHFA 5ECGA 3EF7A 3HMWL 4R0LC 1A7OL 43C9A 2LVEA 1UFGA 2CKNA 3DGGA 4CMMA 2QQLL 4D8PA 2KHAA 5A2FA 3ZYOA 1GGBL 5KSVB 5DHVH 2A5UA 1W0YT 2XQYK 4GSUA 4MQ7A 3HBGA 4MXQC 2GJPA 2DEWX 4R0LA 4OIIL 1G9HA 3I3BA 4UTCA 4IRJB 3K2KA 3BSZH 3FO0L 2O5XL 1EHKB 3I9PA 4NRYA 4XPAL 3ECQA 3X14B 4N1EA 4OF3A 4NNYA 2MCPH 3F64A 3QC5X 4LSVL 2E74C 3CSYB 5J6GA 4XGZB 5D2LB 3RNKA 4JZNB 4LCUB 1QFUL 1ZLUK 2Z3FA 2VDQH 1CLCA 4IKLA 4HWBH 2LT9A 1DSYA 1UWYA 2NYKA 4MZRA 4PBWD 3CMGA 4JFDD 4K9EH 5I1HL 4FA8A 2D3NA 2F74B 2WQAA 5JQ6H 1R24A 1JF1B 1JNLH 4LVHB 4PJ9A 4AG4L 2WLKA 5GISH 5EORH 3CVHH 3GIVA 3AG2B 3FU8A 3KH4A 4R7XA 3ULVF 2X2JA 2PP8A 1NBYB 5GS0H 4L8SC 1MXDA 1HXMA 1FC2D 2NY7L 4ANXA 2R0WH 2DWDA 3B9VA 4Y19D 1OGAB 2KZWA 2D9QB 2R1WB 3FXIC 2RIKA 4RSYA 3QJQB 5BOZG 2C9QA 5T5FH 3TEXA 1JZ3A 5KZCB 5AVUB 3SE4A 4L8SA 1UJ3C 2QPSA 2XFXB 5B38B 4OJDH 3GPEA 1XIWA 3TA3B 2CGRH 2FJGB 5GRYA 3H3KA 3MNDA 4G8FA 1NBQA 2B5IB 1TQCC 4FTVE 4GRLA 3K6IA 3KS0J 1BGXL 1WHOA 2K45A 1H3XA 3CSBA 4UQ3B 2CBQA 1QRNE 1TU2A 4JFQB 4NYLA 5DD0H 2PUQT 4H13C 3RA7L 3DHMA 3THML 4DKFH 3E7JA 1DQTA 1RMFH 4IEFB 1A8ZA 4FNSA 1ZLDA 2ROYA 3FHQA 2R56L 3LRHA 4KK5C 1JPTL 4Q0XH 5D71L 3SY6A 4PB9H 2GEQA 1YCSA 4HLZH 2QR0B 3BAEH 1D5ZB 4KAQH 4J39A 4PJAF 1JN6B 1FNAA 5ICYB 3KCWA 4DP8X 2H0EA 1K3ZA 3O2DH 2VXVL 2XXFA 5E7FA 4IM8A 1NBVL 1HOCB 1LWJA 1K8IB 3ILDA 4AIZB 1NC2D 1SOSA 3SYQA 1QWNA 3CFJB 5B22A 2Y7MA 2Q86A 1OTTC 5CHNB 3V4PA 3L13A 2W92A 1R4XA 1A6TB 2EO9A 2G60H 4TV3A 5D7SL 2WVTA 1IRAY 5BUGA 5F8RC 4FQIH 1X5HA 5L6YH 2OMTA 5EU6D 4XX1G 2YJQA 1I8IB 1OK0A 3L1OL 2C7UB 3OV6A 3VCLB 3KMDA 5GGRY 1IAMA 3OC8A 2F8IA 2WLIB 4LVEA 2JI3A 2CU9A 3MLTA 1KCRH 1OAUH 2ZX5A 4ISVA 4NPKA 2X4PB 3JWNH 3N91A 1ML0A 3VFMB 2A4EA 1U9KA 1JGEB 4DN3L 2OI9B 1CWVA 2GT9B 3SDAD 5AFAA 4YBLC 2FJFA 1KJ3L 3KDPB 1QOKA 2ZKXA 1MIEL 1JRHI 2E9IA 5MI0B 1QW8A 2N59A 1KIRB 2B1AL 3C5SB 4PS7A 2YAOA 1IM3D 4PJFF 1WS7A 1MWAL 3AROA 2XZQL 5AW4B 1FIGL 3BC9A 3M8OL 3SJVE 4WI0B 2M8XA 3OKDB 4RFOH 3NCFB 1VACA 3VGAC 4Y9BA 2IG2H 3CAFA 3MV8A 1OCWH 4BUHA 3VFWA 3ATDA 2VXQH 5H35A 4M1DL 3V52L 1ULVA 3K6FA 3GM8A 1BQRA 1JZ2A 3O3BB 3RPIB 5C0DB 5I8KL 4EXKA 1HC1A 4GKSA 4GY4A 3MOBL 4FOMA 4CSSA 2I60H 3HC0A 2CXKA 4CN6A 2H9GA 2FWSA 2CR3A 2J6EA 4L5FL 5PCYA 2WAHA 4IU2B 3PDOB 1ETA1 2PWFA 1RZ8A 5CM1A 2FYYA 5BMFH 2UWEE 2A6IB 3KR3L 4EI5C 1A4JB 1NLBH 4OCYL 2Z0UA 2ATPA 1AR1D 1PF3A 4NENB 4KXDA 5I15L 4YHKL 2JJTA 3L4UA 3ZKMC 3UROR 5L88H 2YHGA 4FQLL 4KUZL 4MKMA 3MRDA 3PWUA 4OLUH 4Y2NA 4WAFA 5D70L 1P1ZB 5EZJA 1PZCA 1XWVA 1GMEA 1IC1A 4JPVH 1E5BA 1ZAGA 5EIIG 3V7AG 2ENSA 3HCVB 4ZOBA 4BA0A 4L8DB 5CGYC 2BVQB 4H1LG 1CGWA 1GHFH 2F19H 3NJVA 5DHDA 1CURA 3LAFA 5TDNA 2XZCL 3VGFA 2G5RA 2GTZB 3ME0A 4FFZH 4JY5L 5JW4Q 1ZT4A 1A6UL 2WM0A 1DJWA 3GXFA 5AZUA 2CO6B 4QIRA 4XOBA 2DBJA 4ZFFA 3BVNA 1XGTB 4HWZB 3ZDYB 2AC0A 3NJNA 1NBZB 4X7CC 3MBEB 2FL5A 1SDDB 1TJGH 3ARDD 3FT3B 1E50A 4OZGA 3MLRH 2YPLB 3OAZH 4G6AC 4DCQB 1TKWA 3O4LE 1XZ0A 5E6IC 2L7EA 4TKWA 5A6LA 3UCQA 3UAFA 2B7DT 4MA7L 4I2XB 1HE8A 4TULH 2WVVB 2MSPA 2BW5A 1D5IL 1F11B 3X3FL 4Y5VA 3ZZLA 5CILL 4GI9A 1SY6A 3Q13A 4AQAA 3GMNB 3VE0B 2ZP9A 1ZV5A 4FQXD 4QCIA 2YSSB 1TZIB 3PYCA 4RIRB 3RAJL 4A67A 1DN0A 3WMQA 4QRSA 4XWOD 1XBDA 3NFPA 5D2LE 3AWFA 3CTTA 5JPMA 2WVSA 2X3CA 4XCEB 4R83A 4TUJB 4IOIB 3W0WD 5IJCC 5I1JL 2QGCA 1RHFA 3HUJE 3KPSE 3VRJB 3OB0K 1X9UA 2PYEA 3H7BA 3TONA 1JD7A 3BUPA 3DOSA 5F1NA 2EVFA 5DT1L 1JVKA 4APQB 3REVA 3PUCA 4M7ZC 1GC1L 2D2OA 2IPTL 4DVRL 3WNKA 2BC4B 2J2ZB 4JGMA 4GQPH 1OGAE 1SFDA 2PP7A 2YEQA 2EKSB 3C08L 4X6FA 1XL4A 1C1EL 2BJMH 5EUKB 1A25A 1NCAH 2JK5A 4YEFA 5C71A 4PJ7A 2L04A 4YSSA 4EDWL 4HPHA 4C57C 5A2IH 3CN1A 2K70A 5DC2A 4WFFD 4AT6A 4ANKA 3EBGA 3JZYA 3MJGX 3RIAF 2ARJB 2NNXA 3BJ91 2B1OA 1TTBA 4APXA 4QXGH 4DFIA 1WBYB 5AAMA 2TAAA 3B8SA 1AYRA 1CYGA 4CL7A 2CPUA 2QQKH 1UUSA 4ZX4A 3VXOA 1ZE3C 4G2AA 3BPLC 4YJZL 3K8KA 4MXWH 4A7GA 1UYWL 1FCGA 1S9VA 4LF3A 5HP5A 2Y6SC 1XF2A 5K5YA 2OMZB 3ARBC 4DEUA 1JRHH 4QYOB 2ENQA 3BESR 3H8NA 3PJSB 2EE0A 2WTOA 5HDQL 1THAA 2ZSWA 5F7LB 4KJYA 3MRMA 3L1FA 3VH8G 3NSFA 1U3NA 3GSRA 2BHFA 1GCFA 1TZOA 2VDRB 4ENEC 1TLKA 2A4CA 1EXUB 4LKCA 2HLAA 5KVFH 4EPSA 3GRWL 3UFIA 5EEXA 1KJ2B 4Z8FH 1U3YA 5DQ9A 1PY0A 2J44A 3QEHB 4F80A 1L9PA 2WXGA 4ZS6D 4M61B 2VQ1A 5K9OB 4P2OA 1QI5A 3N2JA 2MQGA 4MXVE 1PSKH 4KK9C 1DBAH 4G7SB 3P9MA 1LEIB 1F3DH 2CJUL 1JIBA 4MB4A 2Q7YB 2AF2A 3O6FB 4HIJB 3L3OA 4V1DA 1HTYA 3AGWA 4JHUA 5T3XH 4N2IA 4PG9A 1NLDH 2X05A 1XCQB 3C5ZA 4JKKA 2OR7A 3GQFA 3MUGB 1KFAH 4Z7UF 1QO3B 1EZLA 4WFHD 4XCYA 3GSVB 1BJMA 4DERA 4TQEH 4MDRA 3QQ4B 2Z9TA 1QP1A 1DQVA 1KGIA 2CM5A 4YVNA 4WI6A 2ZF9A 1T6VN 1XF1A 4CJ1A 2EXYD 4U6XB 5E9DB 3SQOH 4XC1L 4JFFA 3FTSA 5F72S 2FD6H 3HE6C 4KX7A 2A73A 4XWGH 3P30H 3PGDB 2RA1A 4JR9L 3T4YA 1OF2B 1RIHH 3HAEH 1SHXA 5L2KA 1W91A 2OKMA 2WN2A 4JB9H 1TDQA 1YUKB 3IPEA 1HHIA 1DJHA 5HGBA 3RI5F 2OSXA 2ZP8A 3VRLE 4Y9EA 2KQMA 5K69A 1ED3B 1YHPA 4S0HA 3ECVA 4M29A 1ZHNB 1KY7A 4PBXA 5ANMB 3SDYL 1E8WA 3ZKND 4YNYB 1HHKB 3QAZC 4G42A 3CK0H 3NJMA 5TE7L 5I8CB 3RZWA 2NYYD 4UCFA 3IFPB 4WHDA 3EJQA 3NCEB 2X6CA 4M5TA 5EBLA 2IOIA 4X83A 5CD5D 1A7PL 1NIBA 3AAZB 4NJAL 4ZFZB 1IL1A 5ACZA 4HJ0C 3KJ6L 4KXCA 1U8JB 3P40A 3KGSA 5DC0A 1ZIBA 1A66A 4I3SL 4PY8I 2ENJA 2O61A 2DQFA 3IPFA 4WFED 1GZPB 3BUYB 4BQBA 1JGLL 4QLRA 2OBGA 3FUJA 5CIPA 5TK4A 4FABH 1A9EB 2CDGB 5F7WC 1QPPA 2BX5A 2P24B 4LIQL 4R97B 5IG7B 3BD3A 5LGYA 4E9TA 2ZAHA 4X5WA 1MI5A 3MAWA 4IGBA 4U3CA 4B50A 5I16A 2YPLE 1IAIM 1ZA6A 3IDYB 4AENB 4NN5C 3ZO9A 4Y5XB 3DOIA 1CVSC 2R23A 1JWMB 1KIQB 4L3CB 4U05A 1JDCA 1EA9C 3V9FA 2M83A 3ARXA 3QUML 4JN1L 3SQBB 1CICB 3CQFA 1I7RA 4MCMA 1P7KB 1ZJBA 2P43B 4OCXL 1NOLA 2H6UA 3FB7A 1GYCA 1A3QA 3HNSL 4X98A 4DUXA 5C0NC 5EF0A 5C07D 1OPOA 2CDEB 4OZFB 3UAJC 3GXDA 4A6YB 3QFJA 1FNLA 1QASA 4FZ8L 3PGFH 1ZD6A 3RVVD 3W2DL 4L9DA 2YUXA 1KTJA 3B7RL 3BLBA 3L6FA 1FE8H 4MNHB 2H8PA 4GP5B 4NWUH 1M6OB 3DO7B 1UM5H 3FFDA 4A37A 1UQSA 3QNYB 3B2PA 3Q3GB 3QUKA 4FG6C 5FB8A 3VWKC 5IT2L 1HJCA 4KZ0A 3DUUB 2ZXAA 4XCCL 4ZW7A 3GS7A 1DYZA 3O0RL 1WFJA 1Q9LA 4KI5E 4PWKA 4I0PD 1LP9B 1P7QA 4JFTA 2ALWA 1I8LA 1L7TH 1OTSC 2F1BA 3GSQA 4WHYH 4NZUH 4ZZKA 4UIKL 1XTMA 2JKLA 3SGJC 3ESUF 2CG9X 3WS3B 4JFOB 2AXGB 2ZUVA 2NZ1A 3BGAA 2CIKB 2F2HA 4Z3JA 3FK3A 3AG1B 4JHAH 4OV5A 4WW2A 4PMEA 3N41B 2PW1A 1H3UA 3RUGE 3RTQB 5LNDA 4DEPB 4DJMA 4CBZA 3MOQA 1WGVA 4N3TA 2FX7L 4LVOC 5EIQA 1NEZA 5I5RA 1KEGH 2ESVE 2W0FB 2EDQA 2VABB 4ODUA 4TNGA 2FIKB 4LP8A 4X99A 2LV4A 3U6XS 4G6FD 3LN4B 5T33H 3T5WA 5JMRA 5G5DB 1S5HA 2EP6A 3DURA 5GS3A 2OAAA 4XPFH 3S35H 1X7SA 5BRPA 4EUPG 4KTEH 4KO7A 5JIIA 1LYQA 4KKAC 4RX4D 5LAXA 5J12C 1HU8A 3QUZB 3CH1B 4Z95H 5HVHC 4G9DA 5GGVL 4PRIA 2VAJA 4BKSC 5J13C 3W56A 2J25A 2FRGP 2TRHA 3BCDA 1PFOA 2UXGA 3QULB 5DHMC 3PQYB 3AJ7A 3B56A 3WY4A 4ZYKA 2HMIC 2HUEA 4IRJC 5HHXL 5J1AB 4FXTA 2NXZD 4AZ8B 2JCCA 4LLQB 2MQ3A 3CZSA 1G7JB 1OF0A 5FDYA 5C6TL 1DJSA 2B2XH 1WCBA 1S7XB 4NZRL 4X42A 3X1GA 4JZJA 5KVGE 3WL9B 4UV7H 4HSCX 1KTBA 1LL1A 1OSYA 4JO4H 5EOCH 1RHHA 1RZQA 3I2CH 2A1WH 1F00I 2WD0A 1RUAH 3A4AA 4XI5D 1EHLL 3VXTA 2FX9L 2F1EA 4G1MA 4QXTA 3GMQA 4QO1B 4P5KA 1RZKH 1EO7A 1NFIA 4KTGA 4KWUA 1MFUA 2IMNA 4P2QB 4AM0B 4Z7IA 1E9QA 3MGTA 5IJDC 1DVYA 4OUUA 4WK2B 4D9RE 1EERB 4YFLF 2BOBB 4Y19A 2IH3A 5HGDB 4Z0XA 4OCMC 1LK3L 4RBPH 5FYLD 4K0OA 5IV2A 4LSQL 4XB3A 4L4VD 3TA3C 4RDQF 1WZ1H 1DBML 2Y2WA 4M00A 5TH2B 1G9NL 1YRKA 2VRQA 2F53B 1J8SA 5T3ZD 2BWIA 3EJYC 1M1SA 4M8QA 5IMMA 3U2SB 1UA7A 5ILTH 5FGBC 4KQ3L 2WXQA 3CXDH 2BRRH 5EIIA 1WWWX 2QTEA 1SN0A 3HRZB 3EHBC 4CSPA 1W0VA 3OG6B 3L5XL 4H1LA 3S5LB 2CSPA 3K3QA 5C08E 5DHXB 4PM1A 5AVXB 4TOYH 1R3LA 2GAZA 3DJRA 4UANA 2WO2B 4PTUA 4F1SA 1ZPUA 3CQPA 4NO5B 1QSZA 1AOHA 5KG9A 1IO4C 1KCBA 2DM4A 5HDBF 1NC2A 5IIEA 1YQVL 4JM2F 1B9KA 1IKFL 4Y1TA 4PIBA 5F3BB 1JTOA 4DKTA 4OGXL 5B7EA 4UZGA 5EU6A 4GRWF 4M6MH 4XNXH 3NZSA 2BCKA 1EZVY 3BKCH 3TURA 1YN7B 4ZNEA 1DLHB 4NP4L 4FXGC 5BVJA 2EDTA 1FORL 5C0CD 4X4YA 3WNLA 2IDUA 3BRFA 3U82B 1I9IL 3PHSA 5T8IA 5MEQB 2VSCA 3BHBB 3SKMB 3NT0A 3OKOB 3KPOB 5K1VA 3O45A 3LZQA 1PDKB 1IFHH 1MIML 4PS3A 2HLFC 2DAVA 4P9HH 5IVXA 4U1LB 1EAOA 1XSJA 3SDAA 4X0NA 1KIUB 4NHCH 1EX0A 2BWQA 3FQ2A 3P77A 2HKAA 2QVIA 4EZMA 1IC5H 2YQGA 1LE5A 5I6XC 2OL3A 43C9B 4D8PB 4LRNH 3DGGB 5D7KD 4WJKB 3RDTC 1YNKL 1BBDL 2V33A 2XC8A 1H0DB 2OYLA 4MQ7B 1IM3A 2HFGL 2YAFA 2A4ZA 4WQOA 3LEYL 1MCPH 1E3XA 5EBMA 4Z23A 1ZLUH 4TLKA 1SVCP 3VO0A 3IGKA 2UVEA 1E67A 5KYXA 3QISA 3U83A 4U1MA 4NRYB 2CMRH 1O0VA 4LRIA 4UQCA 2VO8A 3IU4L 2PPAA 4ORGA 5IK3A 4HZLA 2R8SL 2KH2B 2FCBA 1B9ZA 2ADFH 1IEAB 1B2WH 2QFRA 5DHYB 4GKLA 5F9JB 2Z91A 3COOA 2BIQA 2DDQL 1E43A 4N2NA 4FA7B 5LGKA 2AGJH 2VDNB 1A5FL 2H45A 4NNXA 2HH0L 4PLOB 1JZ6A 1DQKA 1GAFH 3AZUA 1DTUA 2NXYB 1CGXA 3KLHC 1L9MA 4HQQL 4ZTPL 4OZIA 2WXFA 1R24B 4PJ9B 2ZUXA 3LH9A 4PLKD 2ROXA 4QRUB 5LWYH 5PAZA 1CFMA 3DMMD 3GIVB 2JKNA 3HLAB 3TH3T 1HWGB 1ACXA 2FEDC 1U3HB 3VI4A 4YSOA 1CTOA 2EXWC 4PJXB 1HXMB 2E9BA 4PCKA 1KCSH 4KMTH 4Z7VA 4OGYH 3O6ML 2XRAH 5DO2C 2AVFA 1GGCL 2FUTA 3QS3A 4XTRD 4MBRA 4J3BA 4UBDC 5E8NA 3PUUA 1UD4A 1XIWB 3VH8A 4BV1A 3ZBMA 4GRLB 2PCFA 5DJ2B 4GO9A 4NQCE 1TU2B 4NYLB 2HWZL 5DJZA 3RWDB 1QLEB 1BBJA 1V05A 1H3GA 5EMYA 5AZ2L 2A77L 3D08A 4FQ1H 4EAEA 3PHAA 4B53A 2AQTA 2OMUA 1RY7B 2WLMA 1A0QL 1R17A 3C75A 4XXCA 2V17L 3ARDA 3FZUC 3OPZH 5H94A 3V6OE 1AE6H 1U8MA 1QTPA 4XMKL 2ICEA 3IJHA 1PG7X 2D7TL 4PS4L 4OKDA 1E40A 2AXHA 3V4PB 4YHYB 2KZ1B 4LU5H 1I1YA 2OMTB 1X7TA 2UUDK 4HCGA 1T22A 4NJ9H 4P4KC 4ZO8A 2NSXA 1MHHA 2HPTA 5AOJA 4GS7B 2ZXDA 3KEDA 1SUJA 3BFQG 2PPCA 4EN2A 5FO8A 1HI6A 4FQXA 3FYEB 1TOXA 3MLTB 4ISVB 1GGUA 1PGRB 1THCA 1Z5HA 3GRBA 4PW4A 3N1FC 3AQZA 3MLYL 1TR7A 3NCWA 3TPUA 3TFKC 1KCVH 4MAYC 1T04B 3X3GH 2A6JA 3W0WA 3WAJA 1U0QA 3EFDH 4KO6A 2FJFB 4UV4L 1HK6A 4N8UA 1AY1L 1B0GA 4P3CH 4HKBA 4P2QE 3ZRFC 5DFVC 3L7FB 1G0DA 2I7OA 3P11L 1NM4A 3U4BL 1RURH 3LDBB 4R84A 5IKCB 3DXAD 4QRAA 1OANA 1DLFL 4JO3L 5EUOF 3T09A 1B4LA 1VACB 4ABVA 3RWHB 2X7LA 5ALBH 5HHVL 1W72L 2IDCA 3MV8B 4M43H 3VFWB 5DZLA 3Q1EA 3MN8A 3MXWH 1L0YA 2OSLA 4GW4A 1F8TH 1GIGL 2JLPA 1I9JH 4R8WH 3TV8A 2EIDA 3I9IA 1BQUA 5HYIA 3MLSL 3HC0B 4LQFH 1E3ZA 3OGOE 1ILUA 3F62A 4MAUL 5DK2B 3BPNB 4Z7QE 4WI9A 4HD5A 1KFGA 4TXVB 2VZOA 3ZL1A 4A55A 5DTFA 4P5RA 1LO2H 3SSGA 4DKEH 3FU5A 1PQZB 3FCGA 4FEIA 2ATPB 2CH8A 4JO1H 1CXEA 1AFVH 1ET8A 3EFFA 4K3DL 1QKZL 1WZMA 3OKNA 3PP4H 3BEVB 3DX9A 2EABA 5ACLA 3PWUB 5HYJE 3EDKA 1RQ5A 1RZ7L 2RGSA 5EZJB 4LCYA 1Q9WA 6PCYA 4FL4C 5IQ9B 4WSGA 3RTLA 2ZXQA 1IT9H 1YEFH 2CDFA 5TDNB 3ZE2E 3CFCH 3NYKA 1HSAA 3ME0B 4PW3A 5I75B 1EFXB 3P0VH 4WCYL 4ORZC 4GLRI 4LGSB 1N8OE 3RX8A 4XPGL 1KXHA 3C2AL 4Q8BA 1KUMA 4L2YA 4W9FC 4HS3B 1FVEA 4OLVL 4HLJA 4OY9A 1ZLSL 3RY4A 1VFMA 5KANG 4ZFFB 2C4FT 4UT6L 2FL5B 2N1KA 4AOFA 1WICA 5E2WL 4NFBA 4OZGB 2MPVA 4KH9A 5IMOA 2EQDA 3APDA 2R39A 2IDTA 2WXPA 1XZ0B 3MLVL 3PGCB 2F1AA 4HUVA 1SBSL 3HNTH 3NFNB 5E8DH 4TVPD 1PAMA 4I4WA 4Y5VB 2CUMA 1P6WA 4ZUSB 4H88H 4KXBA 5EOQL 4DN4H 3QRLA 1L6XA 3VU1A 4NN6C 1OARH 1IARB 1S5IH 4QCIB 3JTSA 5GSVB 1DN0B 4CILA 2Y7QB 1TT6A 1MCDA 2N7AA 4QRSB 4QWWD 1YNLL 1RP9A 4QTFA 1WLHA 5JPMB 2YRPA 2R2EA 1QBML 5C7XH 3G6DL 2DJMA 5DURB 4FFYA 4DUVA 2OMXA 1D7BA 5L2JB 3W57A 3H7BB 2N0KA 3QQ3B 3A23A 2ZKHH 1HJBC 3DOSB 3CHSA 1WIUA 4U7SA 1BOGA 3QCTH 4OIAA 4PI0A 3REVB 3LHPL 4H2AA 4PJXE 4YIQA 1A3ZA 4FDWA 4EUPA 4KY1H 4OQTL 2XI9A 4YHPB 1TNNA 2Q2EB 5TK2A 4IOSD 4X6FB 2XSKA 3WFCH 4JHWL 4A2FA 3L17A 4KDVA 4M5SA 1F0LA 3ZW3A 2IQ9L 3EGDA 3SHSA 1PX4A 3EFOB 1TZ8A 4F15B 3PL6C 3BUQA 4BUQA 1IFRA 4C4UA 2WQRA 2WWOA 4AT6B 1DHKA 4P23C 5E2TH 4WGVB 1WISA 3QWOA 1V3KA 4APXB 2CHXA 5TGBA 4XC3L 5CEZL 2EIMB 3SKUD 2NQ3A 4G8IA 4C47A 1KG0A 1NAMH 2NY3D 2OYMA 1MNNA 3BWAA 2VJ0A 3IJ7A 3MLZH 2VDLH 4GSDH 1TJIL 4LF3B 4N1HB 4O5LH 1XF2B 2CQVA 2FGWL 5FO7A 5DJXA 3OZ9L 1KZYA 1XF3A 1NJ9A 2ZSWB 4KJYB 4U33A 3FPYA 3MRMB 2IGTA 1HNYA 4Y9CA 4U1IB 1RFDL 4MKTA 3APMA 2R83A 2WQUA 4LPCA 3GWJA 3FF7A 5H4ZA 4LKCB 1NCOA 4LSUL 1MCEA 3PIQB 5D1XC 5KVDL 5ID0B 2DQUL 2ZCHH 1LWRA 5DQ9B 2Q8BH 4XAKE 5C07A 3ILPA 2B08A 5DS1A 3DX8A 3INUL 2VQ1B 4YQXH 4P2OB 1WPCA 4HKZA 2OJZH 1F90H 2ZYRA 1Z9SB 4HK3J 4QTHA 3ZPDA 1TQBB 2UXTA 4FTDA 3UBHA 3H9HA 1JFHA 3O81A 4GG8A 4DZ8A 1RUML 4MJID 4V1DB 1WAAA 4XPTL 3DUSA 1PW3A 4IKKA 2V0AA 3N42B 3DI3B 3C5ZB 4H8WH 4I0PA 4YC2C 5DQJB 3ZZQA 4GO6B 1ZHBA 1JZEA 1LEKB 1CDGA 3WELA 4XCFL 4NIYE 1WJ3A 4R7DB 5SX4I 4WU5A 5AAWA 1MCIA 4PJCA 3IRZA 1R9FA 5ABZA 4JFFB 3BDYH 3R4RA 2EE3A 1Q1JL 5I1IH 1J9TA 3ET9F 1IZKA 3DYMA 4JFZH 2G75A 3QUXD 4F2EA 1KY6A 2K1MA 2QMKA 2A73B 3FOLA 2WWNA 5HHQA 2R29L 1BD2D 4Q9RL 4YFLI 3T4YB 4ZO6A 3E2HC 1DEDA 3FUMA 5ID1A 1HQ4A 2X4RA 4D8OA 2WOBA 3JV6A 2LHAA 1H3PH 4GLRH 5CUSH 5I8OH 1HHIB 5HGBB 9PCYA 4ZPTA 1A6ZB 4HHWA 1FNEA 1O6TA 1A3LH 4AGMA 1LE9A 3UZEA 4QHKJ 4OCRL 3GJFH 3WUWG 1INDH 3BSZL 4G42B 2EXTA 5AWNH 3ZIYA 2G4EA 5F6IB 4QR7A 1UWEH 5EBLB 3SYOA 3FU3A 2MCPL 3QORC 1IL1B 3AUWB 3VD3A 5ACZB 4PCYA 4U6YB 4BDVA 1D9KC 4K7PH 2VDQL 2WZ0A 5E0QA 1RUPH 4HWBL 3HG1B 3NP4A 2IOOA 1CB4A 5E99H 4K9EL 2EZ0D 5JQ6L 3UADA 2PTTA 5KJRL 1JNLL 4R2GC 5GISL 3PWVA 2R1XA 3CVHL 1N64H 2VKWA 2YSTA 1FVCA 2YPKB 4PJHA 1J8HD 3BP7A 2PWGA 4LPUA 2Q20A 4A2MA 5CIPB 5GS0L 5IWLC 4YVUA 5F1KC 5AKSA 1G6RH 1P84J 1SMOA 2G2RB 2R0WL 3H3PH 4X5WB 3VFGH 1MI5B 5EF2A 2QJDA 4IGBB 5CINH 5EO0A 4MVBC 4ZUWB 5T5FL 2OR8A 3KLAB 5I16B 4OZGE 1ZA6B 3EJUA 1DQLH 2DICA 3MC0A 3IFLH 2BW4A 1EVUA 2CGRL 2R23B 2R4SH 1WH0A 5I28A 4KKLD 1I7RB 1Y18A 5DD3H 4Y4FD 4ZXBC 2C3WA 4FQCH 1I7TA 4DKFL 3FB7B 2QHRH 5C0BD 3TJHC 1RMFL 2W9DH 4X98B 4FGMA 1F4HA 4Q0XL 3QWRD 3QWQB 4PB9L 2HT2C 3VD1A 4ZXBA 3BAEL 4GBXD 4KAQL 4WJG3 4X4MA 4XR8C 5F3HA 3ZT7A 1E4XI 1AR2A 3NRFA 1HFUA 1J5CA 2NUTA 4XXWA 2VE6B 3O2DL 5KS9A 2H8PB 1AGEA 2VNCA 3FYIB 4YDVA 3FFDB 3ETBF 3QUKB 2GK0A 5FB8B 1P4BH 2H5UA 5CP7A 1PKQA 5CLZA 5ERWA 4MQXC 1Q9LB 4FG2A 3DSNA 3QUHA 1P7QB 3WAKA 3EZ8A 1TFPA 5E24E 1G7HA 5D7LE 4U6VL 4H8QA 3GXMA 3T77A 1QEWB 4E41A 3J8F7 1U8HA 4N6RA 3FB8A 2NY4B 3T3ME 1OAUL 1NIAA 3CXHJ 3FUDA 5IB1A 4F37F 4OV5B 2KMWA 4HFWB 2PW1B 3NPZB 3Q8FA 4XNZB 4X9GA 2OMYA 4RMVA 3M7OA 3SN6N 3RLSA 1ZT7A 1SQ2N 1NEZB 1RULH 2DIEA 2WKGA 4ETQB 1KYUA 2HJKA 2WO3B 4ODUB 4UDUA 5DZJA 4ZSOB 4ELDA 3DVFA 2PCXA 3IXTA 1U6AL 1SEQH 5C0CA 1JZJA 3BISA 4ZX5A 4F58H 3WXVL 3U1PA 3SDXF 2WKOA 4BFNA 2V5RA 1H6EA 1FO0A 1UTDA 5DVPA 2BIOA 4RFOL 4R26H 1HE7A 2C4XA 5D5MA 3G6JE 5LAXB 1DUYA 5D2NA 5I71B 1NIFA 1OCWL 1H8NA 2H3XC 5DRZA 4G9DB 3U46A 1KB9J 2VXQL 1U33A 5E1GA 3GMRA 5D7JD 2I07A 1GYVA 4O2EB 5SX4H 3BPCA 2E6JA 4QRRB 2Q10A 2EDXA 2OTUB 2EEAA 1TJHH 2I60L 1XXFC 3KPPA 1AGDA 3LIUA 4TPRH 4I18C 2FHFA 4MNGA 1FBIL 1Q0EA 1V7NH 3KHQA 1NFDA 3VACA 2CAKA 2Y6TE 1M53A 2JCCB 1S46A 4OI8A 3K6DA 2NLJA 1OGTA 4HUWA 1CXKA 2I85A 1WCBB 4EI6B 3NBNA 3LNFA 5BMFL 1M2VA 3I9GH 4JZJB 3G5YA 3QCUH 4UNIA 2LU3A 3PWPD 1NLBL 1PJWA 3NSCA 5CR8A 4HU2A 1RHHB 5L88L 1TSHA 2L3BA 3FQYA 4OLUL 5EO1A 4D9QD 4JFDB 2BNQE 2B16A 1CFBA 2EE9A 3VXTB 2V2TA 4G1MB 4QXTB 2ZXEB 2VZTA 4JPVL 4P5KB 4M1GL 3ABMB 3DMMA 1FLRH 4PJ5E 1VCAA 4IU3A 4LLYA 2F19L 1E9QB 1HX0A 3BPOC 3MGTB 3T0WA 4FZEL 3T2OA 1FYTD 1T4KB 3SOTA 1PZ3A 2BP8B 3FMGH 3NMEA 3FOMA 1FH5H 4FFZL 2IH3B 4Y19B 3PHOB 4XP6H 3BD5A 3KHOA 5HYSG 4EVNB 2QGBA 4DO6A 2O6CA 3D4ZA 2CRIA 2Y1VA 3HFML 5I5IA 4RVBA 5IROD 2E8YA 1J0IA 2K7QA 2AABH 4MLSA 3I6KB 4NKMA 1U93B 3S9DB 1TJGL 1I8UA 2WP3O 1PVHA 3MLRL 3AWGA 3LN9A 5BS0D 4PV1C 2W95A 1VGEH 1XGRA 3ULVD 5IQLA 5I1CH 3T2LA 4GRWH 4BWUA 3S5YA 1SJMA 5IBTH 3I75A 2PABA 3C5JA 3D51A 4TULL 5F7FA 1AACA 1CLYH 3IEAA 1R3LB 3Q9PA 4AQZA 4U1SA 2GAZB 4YSQA 3BP4B 1ZHLA 4OLWH 4PTUB 1YO4A 1A6AA 3EO9H 4MBOA 4QKXB 4ZAKC 1HDMB 3VVWA 3ZTJG 5KG9B 4NKOB 3H0TA 1NC2B 1WWAX 2Q8AH 3NJFA 2JWYA 4P2RA 1F41A 1QFWM 3F12A 1U41A 4RQQA 2MOGA 5E03A 5I18H 3HG1E 1HH9A 3GKWH 4DHLA 1K3IA 4G6MH 4JG9A 2FYVA 3UOAB 4BA8A 5F7MC 2NY0D 3VMOA 4D9LL 4KNTA 1CO1A 1E4XH 4IDLA 3WY2A 3WLWD 5BVJB 3ESOA 3H3BC 1JYVA 1T6BX 3HC2A 4ZFOL 3O45B 1AHWC 2V8MA 2ZOLA 4MYWB 5IVXB 4K23H 1T5KA 3MRFA 1EJOH 3SDAB 2FLRT 1XTLA 1NCAL 2XICA 4RRPG 1U92A 2J8HA 3P77B 3RBSA 4DUWA 1XMEB 1LE5B 2OL3B 3QJOA 1EDHA 4AQ8C 5L7XH 1SJEA 1CN4A 4WI2A 1MCCA 3L54A 1IM3B 4QXGL 4Y5YA 3HFFA 5ITFA 3DXAA 3PS6A 4E2OA 3D9AH 5EBMB 2O5ZH 3IAPA 5LXGH 4PJEB 2QQKL 2Y5TA 3NFSH 4WTZG 5KSBE 1G7PA 3ZKXC 3Q2NA 3MLWH 4MXWL 5C09D 4ORGB 5IK3B 3H42H 4HZLB 3V0FA 3OJVC 4N90D 2APBA 3KS0H 3S37H 3S97C 2Z91B 2D0GA 5LDSA 2I5YH 4X5LA 2J57A 2IXQA 3CJJA 4NNXB 3K2IA 2H41A 4KKRA 4OZIB 4Y2OA 3F7VB 3FCTB 1J86A 1IBHA 5K33A 3X12A 1LQSR 5KVFL 1T0PB 1T5WA 2K6ZA 3WN6A 3QDMD 4Z8FL 1RZIA 4QKTA 3DTXA 5D8JL 3VI4B 5FFGA 1J5HA 1WFUA 5CP3H 2DQGH 3I84A 1AR1B 4P3DA 2EIBA 4K5OA 1I85C 1PSKL 3ZN6A 1TSRA 5IM7A 4Z7VB 1DBAL 5JOFB 5IHUH 4LOEA 4G6JH 1GY1A 1LEGB 4KXZI 3E38A 5E8NB 1EDQA 4LIQE 3KYKH 5CS7A 1I85A 5T3XL 2LVCA 5GGTA 5KBDA 4ZSOE 4NUQA 2NMSA 1NLDL 2PCFB 2YD7A 4JCMA 4ONHA 5DJZB 4PMFA 4MHHG 2B20A 5C1MB 3EUUA 4XO3A 3VXRE 4DO5A 1WITA 4L1BA 1FP5A 3BN3B 4LL1A 4OAWA 4CC4C 3SQOL 5BXFB 2OMUB 2GTWA 4HCIA 3RB7A 1A7QH 3UEZA 3VI3F 2UUDH 3ARDB 3KPTA 5I74B 5CKGA 2XXGA 5H94B 4Y2LA 2AJSH 3P30L 2HT4C 4KU1A 3BIKB 2ICEB 4IRSB 1UATA 1VADA 4OLXH 4QRRE 2JTYA 4Z77A 3VYNA 5C0EB 3PABB 1BVNP 1BX2A 3FU9A 3ZT5A 5D1QD 4GI6A 2DYPD 1WBZA 1SEBA 2E9WA 5B1CA 1Z0NA 1I1YB 4MQSB 1T22B 4GUCA 1DE4A 1MHHB 4MCYA 2A6DA 3KGRA 4HJJL 1HHHA 3GO1H 3FT9A 4URTB 1ETZA 5FO8B 1NCWH 2VITA 4FQXB 4EIZC 4ZI8A 4W9GC 4XN4A 3P73A 3FDWA 4PSPA 1P2CA 3OF6D 2H0PA 5F2FA 2Y5QA 4WO0A 4UQBA 5GRZA 4UZSA 4BFFA 3PNWA 2A6JB 3BE1H 4WI8A 3W0WB 3DROA 4JFDE 1YMHA 3OLDA 4HGWA 3AU1A 1ACCA 1TZAA 2H0JA 3BCFA 4HKBB 2XV2A 3EYQC 1G7IB 2R0LL 4A7VA 3DNKA 4CGTA 2AJXH 2ZXGA 1B4RA 2YO3A 1UOWA 1IVLA 2YXFA 4HF5L 2DH2A 3QG6A 3WUWA 1U8LA 1U8IB 4FABL 2V7NB 2X7LB 1BQ5A 5B39G 2SEBA 4QUOA 5LBGA 2DM7A 4QJ3B 1LDPH 2ZOTA 3RY5A 1P6FA 4MMZC 4GW4B 2OSLB 3TC9A 3M17B 3PJNA 4DTGL 4OB5H 4P59H 3E1F1 1XQ4A 1JPST 2GG1A 4MMZA 1NCGA 1VLXA 2HG5A 3QIUB 3T1FA 4UAOC 3FFOA 1NTDA 1OO2A 2BRQA 3CDCA 5DTFB 3E8UH 5KN5A 2NX5B 2OJEA 1RSYA 3BKJH 3IKCB 3KG5A 3EFFB 4HEPG 4B27A 1JNJA 1FE8L 1U91B 3DX9B 4NWUL 4RAVA 5EORL 3L4WA 1UM5L 4JPIA 1E8ZA 2JB5H 5I1EH 3KJ4B 1Q9WB 5KYUB 2IFFH 3DK2A 3JVGC 3D0VA 3MJ6A 3FC8A 2ZWYA 1FH2A 1JP5A 3IAGC 4GB9A 2AQ2A 4I1NB 4CSZA 1TO4A 1YEJL 1L7TL 2C8NA 3IFNH 4RGMB 4NZUL 1HSAB 3U9WA 3S7GA 5GHWH 3CFNA 4FFVC 1UZ8B 1GC1C 1K8DB 5IVXE 1ET7A 4QY8A 4JHAL 1P9MA 3RVXC 4J4PD 4MJIA 3STZB 4EJ1C 4F7MB 3NQKA 5HI5C 1J88A 3DO3A 1NCTA 2Z8WC 2R51A 5L9DH 1NCHA 1JZIA 5IMOB 3GI9H 3ZMRA 4OT1H 4CU6A 2VWEE 1OTUD 4HUVB 3SE3C 1BYNA 3WSQH 1MCWW 2EDOA 3SPIA 4IBVA 3BAIA 4LO9A 5T33L 3DC0A 4ZUTA 4PJEE 2GCYA 1LJMA 3C09B 3D25A 5EBWB 4I4WB 4PJ6A 4KXZH 1CDJA 3HKFA 2VDKB 3S35L 4AE1A 1BFVH 4KHTH 3RGHA 4ACTA 4BFOA 4GMTH 1T03H 3QUXA 2AVGA 2DBLH 4WFGD 1YA5A 4FXLA 4N8VG 1EAQA 1YC8A 1V27A 1KTLB 1UWXK 1L6ZA 1CC3A 1ITBB 3L4XA 3ROLA 3VWJC 1BD2A 3JTSB 4LL4A 2CHZA 3MRGA 4Y16C 4K5NA 2Z7UA 2R2EB 1K4DA 1JZDC 1BM7A 2W65A 3PF2A 1A7RH 1SLWA 2BP3A 4PJ7F 3VWJA 4IJTA 1D7DA 1PG7W 5A3IC 3LKNA 4Y16A 4JZOA 1AQKH 4FC3E 3H2WA 1T21A 4MCNA 4RWYH 1BOGB 3ABGA 4XP5H 3GUFA 2QQNH 1ASQA 3GXIA 3M86A 4YIQB 5ICZA 4EUPB 3T0AA 2ZCLH 5LBVA 3UTPE 2B2XL 3VJ6A 2WCGA 2CK0H 1M71A 2R69A 2VIRA 4KROC 4E5XG 5DR5L 3NH7H 2IAMD 3WENA 4KKCD 4G8AC 4UV7L 2VN6A 8CGTA 4M7JH 4QHMA 2WP3T 1JUFA 4YPJA 3EGDB 2CLZA 4P46C 5EOCL 4A7GF 4FF9A 4PD4J 3O3AA 2NY5H 3OAWA 2F68X 3O9WD 4LPXA 4PP1C 3VXNA 1R33A 1MPAH 1RUAL 4ES9A 4ZFOA 1AO7A 1IGJA 1XL6A 3QWOB 2VLMD 3KEHA 3JWDH 1B0WA 1M7DA 1RZKL 1J8HA 5TGBB 4JFVA 1OCRB 1MREL 1DSFH 4M3JA 3RVUD 3QBTB 1K2DA 5JW4M 3MRKA 1KG0B 3U7YH 3BWAB 3FH5A 5DU7A 3US1A 4JREB 1PS3A 2JIXA 1G94A 3PWNA 3UPAA 4W70A 5B4MC 4DP5X 3N0PB 5DFWH 1D6VH 1WZ1L 1SBBA 2GITB 2OM5A 5DJXB 5FO7B 1XF3B 1NJ9B 3SDDC 3W11D 3BH8A 2R2HA 1ESOA 3P3TA 3KBPA 3PV7A 4OVVA 5F1IA 4Y1SA 5D55A 2MKLC 5ILTL 3ZUNC 1CGYA 3FQWA 3CXDL 4G8EA 2BRRL 4Y4FA 1NUFA 3KM2A 4WZ9A 5F9AC 3GSUA 5C0BA 4ZMNA 3HG4A 3MRHA 3O6LH 3BRDA 1Z32X 1FZKA 2ZX8A 4QRQA 3CSFA 5C07B 3ILPB 3QWRA 1NUDA 2MPAH 3DX8B 2K78A 3H6JA 1PU0A 2LFGA 4HOMA 4GBXA 3TOPA 2DQJH 2FSDA 5E8OA 3UTTD 3ULSA 5HYSA 4QTHB 3FO1A 3D07A 2XN2A 1X4XA 5G4MA 2EUVA 3MCKB 3S88H 3SPCA 4EZKA 4GG8B 1QABA 3ULUF 4OFDA 4GH7B 1EO5A 1A7BA 3IE4A 1YVLA 1BDYA 5DD1H 1Q94A 5L4IA 3DUSB 1UB5A 4HXBH 4H8HA 6CGTA 1S7VB 4I0PB 4M6ML 1ZHBB 1FV1A 3IMRA 1DVFD 3BKCL 2B0SH 1H5BC 1OM9A 2XTJD 3ZLQC 2CLVA 4PRPD 5EU5A 2VTFA 4P5TC 4WU5B 4BCZA 3EXJA 1M57B 3C8KB 4PJCB 2E6QA 4NO2A 5FECA 2YMXH 1ACZA 2V37A 2V9UA 4XMPL 1KDJA 6PAZA 3NCYS 5KSAD 4B9GA 3WFEL 4PRDB 4P9HL 4G7RB 2JELH 1YEGH 2QVKA 5IBLC 1BQSA 2VR3A 3LKRA 1CD1A 3IF1A 2EDJA 4NHCL 1MHEA 2DM3A 4Y4HB 5JUEH 2KLTA 3QH3A 4UWQB 1CLZH 1HQ4B 1BMZA 2X4RB 4J6IA 3JV6B 4LRNL 1T7YA 4G6FB 4NNPL 3G08A 2G2PA 3K5SA 3P3YA 4NBYB 5JHLH 3B9EA 4XNMA 4ZPTB 4ZMVA 1XHHA 3ABKB 2VR4A 1O5PA 3ZYZA 1LE9B 2WGNB 4PCSA 2ZICA 4J3XA 2AEPH 2OLDA 3TM6A 5IUCA 4I7ZC 2NX5E 4YGVA 2CMRL 4RESB 3ZL2A 2FEEL 1KGYE 4XNAA 5D7JA 1N6VA 2KPNA 1KXTA 1BM3H 1JS4A 1B2WL 4U6HA 4RRPA 5IVZA 4OZFH 1P84K 4A6YH 1GOGA 1V3LA 5TQ2H 2AGJL 3AFLA 4MA3B 1MDTA 4H8PA 3QK0A 1GAFL 3EJZD 2NXZB 4Z6AT 4HX1A 3DSFH 4J28A 2PTTB 2N4IA 3V4LA 5LWYL 3HG0A 3PWVB 2R1XB 4PJHB 5B3NA 1N0XH 1FVCB 4RGNC 2DQCH 3SCMD 2Z1KA 3GLZA 5EU7C 2BZCA 4WTZA 3PWPA 4HAFA 5FGCB 4PV8A 1KCSL 3L5WA 5BQ7A 4KMTL 5EO0B 4L23A 1BCIA 4OGYL 4IOFD 1Z6JT 3SD2A 1L9OA 5I23A 3MLXH 2VN7A 1FNHA 4QRPD 1WIPA 1OPGH 3ENEA 3IGAA 1X5ZA 2I32A 2WNGA 4H40A 5I1LA 1Y18B 3C87A 1BSIA 2NQDA 1FYTA 3ATAA 4KUCD 4ZMOA 1I7TB 2ATKA 1QSED 4FQ1L 4L4VB 4YHMH 4N26A 5IROA 5ADOL 4R96B 4X0KB 3TVMD 5DLLA 3H55A 2Y72A 3HIZA 3HZVB 3TNNB 3UJTH 2ETWA 1MCRA 1FFNA 1GS8A 1QAWA 3OQRA 5KS9B 1AGEB 2P45B 3SGKC 4YDVB 3E3QE 1EUUA 3FNKA 4MAZA 4WW2F 2GK0B 1Q72H 1EO8L 2CO3A 4QNPF 4TLUA 3WD5H 5CP7B 5ERWB 1NDTA 3P54A 4F3FA 5CSBA 2BSED 5FFLA 3K5RA 4NEHB 4N0UE 4LU5L 1ROCA 3INOA 4NJ9L 3C12A 1LILA 2X9ZA 5F6HJ 4OD1H 1G7HB 3TCLA 2VLKD 1AHKA 3ASNB 3P3SA 3JVFC 3K0YA 4LOUD 4GP4B 3T77B 4I1RA 3WXWH 4BRJA 4MA1C 1U8HB 4E9LA 1MZZA 3FB8B 2VLRD 5FYKH 5DEJA 5IB1B 1F02I 3IMSA 4DQOL 1FJ1B 4E42A 5DLMH 2QMJA 2PETA 2OMYB 1EAJA 3WLWC 1ZT7B 1JF5A 1F18A 3H54A 1A6VH 1B4JH 4JM0A 4NUGH 3EFDL 1N7MH 2AQRA 3O11A 1VESA 2MCG1 3HEIB 1URZA 1KB9K 1NWOA 4ZG1A 3ZE1B 5KBPA 3F7PC 1C5DA 2HJKB 4P3CL 4WFEE 4PRHA 3IXTB 4A7UA 3SPGA 4GUOA 5C0CB 5DJ0B 4NUPA 4WNSA 4DVBA 2JE8A 3RILA 1QHQA 1B6UA 3U6XA 1FO0B 5E23A 2QKIA 4N2BA 2YMTA 4DKDC 3B9DA 2JCCF 3OKMA 1U8CB 5D2NB 4CKQA 2GBUA 3MV7D 1MCFA 4ETYA 4M43L 5DRZB 2VQUA 3LH2L 4WW1A 1A6PA 1ZCRA 4GPVA 3QO0A 3MXWL 3GMRB 4OD3H 3RL2A 3WY1A 4R8WL 1F8TL 2I07B 3MX0A 4PJGE 4UZUA 1G9NC 3QJFA 1ZVNA 1KGCE 2VLJE 1NBCA 4HOWA 1RERA 2GIMA 4HETA 2JB6A 1Z9MA 3KPPB 1AGDB 3AT9A 4MNGB 2BY1A 3DETD 3KNBB 1NFDB 1GL4B 1IGMH 4N1CA 3BUIA 1OB0A 2WZAA 1S9XA 4ZX3A 1OGTB 3L4YA 4HUWB 5E6RB 4QRTB 5IB5A 1I8KA 1WT5A 4ODWA 3FAXA 4MRBA 4BGDA 2ZG3A 1LO2L 3G5YB 5B39A 1RH8A 3BWSA 4DKEL 5GS2D 3WIAA 2ORBH 4JO1L 3IDMA 1AFVL 3KD4A 2B3IA 4FNPA 1J0HA 3PP4L 2OULB 3GZPA 5EO1B 1XT5A 2GHWB 4LCCA 5KYYA 3Q8BA 4IS6A 1MFAH 2A9NH 4XRCA 1EFQA 1O7DE 3DMMB 2AXFA 3DJ9A 3QDMA 4IU3B 4TTDD 2BY2A 4ES8A 1KN4L 3RPBA 5KEZA 3MDJA 1YEFL 3EJTA 3TBYA 2ZX6A 3FOMB 4H25B 3FHAA 3CFQA 3P0VL 3H53A 3FQTA 4M8UA 5CEZE 1USZA 4LEOB 3DX4A 2RTTA 1E6OH 1QHPA 5HDLA 2Z0BA 3BUBA 2WQWA 1X5MA 2C9PA 3II1A 3L2MA 4HEPA 3L4ZA 3NIDE 1NANI 1Y6NR 2WXLA 5I19H 1P4IH 1XGRB 5JW3H 4FEMA 2GSGA 4GUQA 4AYMC 2P5WD 4PRAA 5FGRA 3VTMA 4QOKD 4U3HA 3I75B 3C5JB 1DDHB 3MBWB 5KAQF 2K6WA 3HNTL 1BIHA 3AMKA 2B4CH 3PDGA 3ZGHA 5E8DL 1FZOA 4LKXA 2XVGA 4AVKA 4U1SB 4H88L 1KXVA 2GKIA 3L9BA 4DN4L 2PLTA 4CUCA 1A6AB 3CFUA 4E9VA 4IRSC 3SO5A 5KVDE 1NCIA 3CSPA 1S5IL 4N4YB 4FQHA 3BZFB 2IO5A 4M02A 2FJSA 1PZ2A 2D3JA 2OX5A 4HD9A 5C7XL 3WTXA 4RQQB 5D1QA 2ZUQB 2DYPA 3D34A 1HH9B 4PJBA 4Y2DD 4XZ4A 2R27A 4AJYV 4N2LA 1REIA 4WV1C 4ODXA 2VDNH 2WIIA 3BEWA 3BI9X 3WS6A 5FO2A 4ODBD 2ZOUA 3P02A 5BVPL 2R9HD 3LD8B 2EXSA 1CU4H 3OC5A 3QCTL 4JFHD 1RZFH 3L9RA 4XNDA 4MJ6A 1KGWA 3RIFF 1CLVA 2Q1EA 3MLUL 3OF6A 4RMSA 2O6EA 2ZOLB 2F7IA 4LMQI 4N8VA 4PGCA 5F9WC 4ZMAT 3MRRA 3MRFB 3MHZA 3K72A 3WFCL 5JHDD 1NPJA 1ADWA 1U92B 5D7IE 2ZUYA 3ZZ1A 5CAYB 5LDUA 1OM3H 3IDJB 3NIFB 2EACA 3B9KD 1R34A 1SJEB 5E2TL 5AVVB 3UAAA 4AVIA 2C9XA 1TQWA 4DZBB 3N40P 4YK4C 3KPRD 4D3CH 1IJNA 5ITFB 1OLLA 3DXAB 1PZUB 1N9PA 4L1DA 3WNJA 4L4VE 1NAML 2A6KA 1CUOA 2Y5TB 4OZIF 4YHIA 1MY5A 1QLEH 1G7PB 4GQ9H 3MLZL 3DHJA 1T1XA 2ITCA 3KBEA 4X4ME 4YPGB 5IHLB 3A21A 1ADQH 4E5XA 3NACH 5T3ZE 1T0NB 2GI0A 4ZOEA 3VI4F 4XOAA 5KS9E 4IBTA 2A38A 1JXGA 1KGUA 4Z7VF 2OXHB 12E8H 2IXQB 2P8MA 5D7EA 2GY5A 2JF1A 4P5SA 4Y2OB 3GT6A 3O4OC 2Z34A 3BVDB 3FAWA 1WQVT 4UQIM 1OALA 1T5WB 1TNMA 2ZUWA 3UTSD 3V4PH 2E0PA 3VYOA 3N04A 2AQSA 2Q8BL 3DTXB 3P2BA 4WNQA 2MNWA 1RK0A 3QDGD 4DPBX 4F24A 1IM9D 4P3DB 2ZTBA 2OJZL 1F90L 4PUBH 5IM7B 1WZKA 5CJ5A 2A9BA 2AJUL 2J5LC 3EH5B 1XH3B 1H19A 4TQHA 3F05A 2IWKA 4JPKH 3TN0C 1XF5A 3QIWC 2P5PA 4F20A 1AQDB 2OTWB 2AJZA 3ARWA 2Q3ZA 4Q6IA 2NY1D 4KMLB 2QZQA 3HHSB 4ONHB 4KMQA 2DL9A 3B2UC 4H8WL 3TX4A 2CIIA 5C0CE 2AFNA 1QI3A 3L1EA 2JQAA 2X4SA 2QLYA 3S36X 4OAWB 2IH9A 2CJTA 3T8XA 2FQFA 1HEZA 3E6HA 4DSYA 4J4PA 3BDYL 2GTWB 2O93L 5I1IL 1NFAA 4JFZL 4JCLA 3L2LA 1QNIA 1S3RA 3OR6A 4XOCA 1F13A 3CVIH 4XNBA 1JAEA 1QR4A 1QWHA 2EH7H 2OPCA 4ADGA 4M7LH 1VADB 2PN5A 2BY0A 1H3PL 1W72A 2H3NA 1WBZB 4X6CA 1SEBB 5I8OL 1CE1H 5C9KA 5JA8B 5DJDA 3RWFA 1VKXA 1KB5A 1DE4B 4MCYB 1YNTA 2A6DB 3LB6C 1A3LL 4GXVH 3ILQC 4U1GB 3ZY7A 4NN7C 4PJIE 2ODIA 1ETZB 4QF1A 1F4YH 1INDL 1NANH 4DP6X 2J6EH 3P73B 4NP9A 4TUOA 1P2CB 3B83A 4Z7UA 2F8XC 5AWNL 1W15A 2J6WA 3RZCD 3E3QC 4DP0X 2O6PA 3HN8A 1MELA 4FA6A 1J05B 2NSQA 2NUPA 3PNWB 1F6AB 4W6WB 3CDGA 3W9DA 4HHGA 3DROB 2VDMB 1BREA 2ZAGA 3P0YH 3U9UA 5JO5A 4FQQA 3JWNE 4PHXA 2NR6D 4B0MB 1HL5A 1F4AA 3DI2B 4QEGA 1RUPL 2IAMC 2COVD 1ZGLA 3RUGF 4RH4A 5E99L 2XVBA 2FECL 4W4OC 1BG1A 2JV6A 4LFHD 5HHOE 2D03H 1N64L 1BVKA 1N12A 4HPYH 3JYCA 4J6RH 1T0MA 1U8LB 2IAMA 3WUWB 1M56B 3CMOH 2SEBB 3HPLA 1EXGA 1G6RL 1JWSB 3FTVA 2X12A 1JG9A 4W4OA 3SODB 3VFGL 1U30A 3DJTA 3O6KH 3O9WA 5CINL 35C8H 2IBGA 3G5XA 3RVUC 4AW4A 1QUNA 2VN3A 1DQLL 3IFLL 4YL9A 5FW6A 5MEND 4OF6A 2MQCA 5IJVB 3BAXA 2GY7B 2P80D 2NY3B 1N70A 4XE5B 4A7TA 4UT6A 4WRLA 2HG5B 4FQCL 1OCZB 2QHRL 3T1FB 5H4YA 4AKOA 3EYOA 1G1CA 1T7ZA 1ZTXE 2W9DL 1JTPA 2NPLX 2A3TA 4M93B 1XH0A 3D3VD 1FAIH 5KN5B 1G5GA 2OJEB 3B34A 1ZXKA 1H3TA 4WO4B 3U25A 4LARH 3D2UD 1SY6H 1RZGA 3GTNA 4RAVB 3ZYJA 4JPIB 3VSQA 1CT8A 3GBNL 3HZKA 1YQ2A 1P4BL 4N0CD 1SXSA 3D0VB 1KJVA 3CUPA 1UZGA 2F61A 3QXDA 3ALWA 2I7SA 2H32A 2YN3A 2BVYA 2XWRA 3UTTA 4TSBH 1EGJL 4JG5A 4RNRA 4BCYA 5IJBC 3QEQE 1KYOJ 3B3IA 5JW4R 3N1MC 4TLSA 1CLOH 4MJIB 3B9AA 3RGVC 1UASA 3UBGA 1E5CA 1BP3B 1NMAH 3O2WH 3EG9A 3F7RA 1O7DC 5DS2A 4YZFE 1MXGA 4OQTA 1RULL 4NQDE 4WENB 1UWXH 5EA0H 3RGVA 1DVFA 2ITDA 1ETJA 5AG9A 3B43A 4PRPA 4RFNB 4HIQA 4HK0A 4BZ1L 1SEQL 2GCYB 3D25B 4YDKL 1AD0B 3CIAA 4U1NB 4I1PA 2ITEA 3WKNA 2IV8A 4LESA 5KSAA 3QUXB 1OT2A 3LXUX 3OJMB 4G7VH 1BEXA 1N2RA 4Y4HC 4K55A 3H1ZA 4YHNA 5AYQA 1H6UA 4XMTA 3O8XD 2NY6C 4LVNB 4G7YH 1BD2B 3FQ1A 2WV3A 1HILA 3MRGB 3CBRA 1D5BB 4IKJA 3VGGA 4HMDA 2FATH 5D93B 1OAYH 2J43A 2W65B 5J5EA 4A1RA 3RWCA 4DWHA 3QJHA 4PD4K 4LFHG 4F92B 3LKNB 2IWGA 1TJHL 3A6BH 1F1AA 4JZOB 4JPWH 4TPRL 5B21A 3REWA 1T21B 3F7YB 1V7NL 5DS8A 4I9WE 3LXCA 1HYSD 4FCAA 4GIAA 4L1HA 4BCXA 3S3BB 5ICZB 3T08A 2WWMC 2BP0A 3MTRA 3VJ6B 1M71B 4JE0A 2DW5A 3I9GL 2HAZA 3QCUL 2EO1A 2VDOL 1UFUA 2W07A 1AZVA 3O3AB 3WIHA 2WOYA 3VXNB 1RZJH 3RFZC 1KLGA 4RGOH 4AWJC 2C3XA 2DIAA 4POUB 3CVDA 3K6OA 4PYHA 4XHJC 4UQEA 3PREA 3WU1A 1UGKA 1FLRL 4Z7OF 4Q74A 1J8HB 4Y4KB 3SCMA 2Z31C 1S7TA 2H0FA 5C9JB 5GXBB 4E36A 1K2DB 1S7WB 3ZMEA 2PKDA 5TFSH 5AW0B 1FH5L 5AOIA 3MCG1 4XP6L 2A99A 5HYQB 2MH4A 4XBGA 4JEGB 3VD4A 3FUFA 2P3YA 2Z31A 1INEL 3PWNB 5F7KC 3WY3A 4ONFH 1R3KA 5H8DA 2FQGA 1U8NA 2AABL 3EO1A 4QRPA 3ULUH 3BH8B 4YFDB 1Z3RA 2X3AA 3TJEH 1CYWA 4TLTA 3FT4A 2JMRA 3SKOA 4MNQD 4AV0A 3HG5A 4G8EB 4MA8H 4Y4FB 5I1CL 2WK2A 2WVUA 3GSUB 4LHJB 1QSEA 4XMXA 5C0BB 2VDPH 5SV4A 1WAAF 3MRHB 5DJ6A 5IBTL 3TZVD 4LLDA 3NGBB 2WLNA 3QPQD 5I6MA 3CX5J 2R29A 1FZKB 2HG0A 4QRQB 1FFPA 1CLYL 4X8JA 3TVMA 3TIEA 1DJZA 1Q90A 1TZHB 4KK6D 1N10A 3WEBA 4GBXB 3UBFA 3TEYA 4OLWL 5E8OB 3ZSTA 4NQEE 3ULSB 2ZOKA 3D39E 3FO1B 3EO9L 5KVFE 5GZNC 1EJ8A 4PJ8D 4M1CD 4KRPC 4PJCF 4LPYA 3VQLA 1RUKL 5IQ7H 3ABLB 5I73B 4I0CC 4JAMA 2WW8A 5EOCJ 1SDYA 5DWUH 4ZO9A 1Q94B 1VHPA 3QR1A 1UB5B 2BSEA 2OSWA 3SBQA 5I18L 3GKWL 3UC2A 1YEIH 3GHBL 1C5BH 4C54A 3VU2A 1FV1B 5TPWH 3HW7A 4O2FA 2XKNA 2GUOA 2YXWA 1Z5LA 2VLKA 4K9EC 4MCZB 2CLVB 4RMBA 3APNA 4K8RH 2R4RH 2VLRA 2XNAB 4UYQA 3K2UH 5ABAA 6TAAA 1F5WA 3RJOA 2RACA 4WTXA 3RDJA 3ZHDA 1SMAA 4HWBA 3SPJA 4OM1H 4XN9A 5JR1H 5GS0C 4BK4A 2G5BA 3LKRB 5CIPH 1CD1B 1EJOL 3IF1B 1DZBA 4BSJA 1KCLA 3CVHA 3QH3B 1HOEA 1L0XA 4PY8J 5FHBH 1PCSA 4CNIB 5INDA 4HKXA 1TF4A 3D7PA 1VPOL 3G08B 3KPQA 3CDZA 3A6CH 4NBXB 4XNMB 4RRPM 5J57B 4IDJL 1T83C 1VCBC 2BCMA 1RSFA 1KENH 3M88A 1ACYH 2AEQH 3D9AL 2O5ZL 5LXGL 4Z1PA 1BEYH 1A4KB 1DANU 3VD2A 3NFSL 1KCUH 3VG9B 3MV7A 4YGVB 2G3MA 3MLWL 1KIPA 1PCXA 4DK6A 4F1ZA 3H42L 4U1JA 1JF6A 5T1KD 3Q01A 4TL5A 5D7JB 4LBEA 2PO6C 3GTTA 1KXTB 1FGVH 3HA0A 4U6HB 4WHYG 5IVZB 3BIBX 3IS1X 2ILLA 3KYOB 1NMCB 4BFKA 5HHPA 1BYPA 4GQRA 3RWEB 1M7IA 4ZFGH 1I9RH 2I5YL 3IM1A 5I2IB 3KYMA 1VERA 2F54D 4FNLH 4HX1B 4XN5A 3T4AC 1E8YA 4OLYL 2G2NA 3UZQB 1QFWI 4ODHH 4L3ED 5I0YA 2VN4A 1JGDA 4WI5A 1TPXB 2K7PA 1TJMA 2DQGL 1NKGA 1WRFA 3PWPB 5CSZB 4G7QB 4PV8B 1BVOA 1TYJA 3FQNA 3CPUA 3L5WB 3SPHA 1CFSB 2WXNA 3U4EA 5IHUL 3BKMH 4OD2A 4K3JH 3AXIA 3JWNC 2PCYA 4G6JL 3UPRB 1QNZL 3BZ4A 4BD4A 4J3UA 2EC9T 1DVZA 2RBLA 1NCCH 3IGAB 1BG9A 3KYKL 5I1LB 1M05A 1ZS8B 2VR6A 4AXWA 4BE6A 4OI9A 3BGFB 1R3IH 1FYTB 4G43A 4X6EA 5D1ZC 2VB5A 5E9NA 1E27A 2ATKB 3P69A 2R7EB 3WOVA 1AGCA 4MMXA 3T6QC 4UILH 1K4CA 1QR1A 2PPEA 4WJ5A 3C8DA 1KT2A 5D1ZA 1A7QL 5J11C 4LHUD 1OB1A 4H20H 3UJJH 5AZEH 5LGHH 1FFNB 1E2WA 3MJWA 4Z7QF 5BS0B 2AJSL 2IDQA 3GINA 3IFOB 2ID5A 2EJ1A 4YSCA 3NDYE 5B8CC 4OLXL 2P5WA 3IVKB 4QOKA 1AP2A 4GJTB 5AW2B 5LGJA 4F3FB 1G7QB 3MRCA 5AUMA 1UOLA 3RKDD 2KC0A 3UTZA 2J55A 2W9LA 4FXKC 3LRLA 4XN2A 5B8CA 6FABL 3L9YA 3LS4H 3ZE1F 2XWXA 3TCLB 3GO1L 2A9DA 1NCWL 3QI9C 5CLWA 4WWKC 2CCWA 2W80C 4E42B 4DETA 2YXVA 4ZMLA 2G9HA 5CU9A 4BSVA 5HYEA 4P4RA 2C7FA 4JMNA 5F7UA 3MOAH 1SXAA 2XBZA 5D5MF 2P52A 3OHMB 3QI9A 3BE1L 3CZGA 4RMQA 1GJUA 4JHVA 1VSCA 3DVGA 2NY0B 3U7WH 3O11B 1S7RA 4MYPA 2VW6A 4Z78A 5DZNA 1C5DB 5DRWA 3QPKA 1J8HE 1YZZA 3GZQA 3KYAA 4WK4B 1GVIA 4HIHA 5DZ9A 2AJXL 4F33B 1T66D 3MNVA 2J8OA 4L8BA 4LLUA 4WEEA 5JDJA 4C4KO 1GZQB 3CLWA 4MJ5B 4Q56A 1QBBA 3DDFA 4Q9QH 5DD5H 2QKIB 2ZX9A 1NFDF 2JLLA 1FDLH 1URIA 1XGUA 3V4UL 4P05A 5JHDA 1DUZB 5BV7B 5JOEA 4N87A 4TMPA 4PHZA 1GKOA 1LDPL 4WHTB 1P5VA 3VFNA 2MHAA 4WW1B 2HVKA 1B2YA 4NM4H 5I6PA 1TUPA 3LEXB 3RL2B 2X4QB 2J1XA 1JTTA 3CLEL 3MX0B 3B9KA 5FC9A 2GSIB 3QJFB 3QZWG 4OB5L 1DVUA 4P59L 3Q06A 2JB6B 3KPRA 3ARGC 1GS7A 1MFCH 5E6UB 3UABA 2OFQA 3BFWA 4LNVA 2LFEA 5C09B 4F2ME 1S9XB 4YR6B 1RAMA 3NSJA 1TTAA 1FFOA 4MXQD 2OZ4A 4ODWB 4H1LH 3E8UL 5B39B 2KZKA 3M6DA 3WEOA 4WUUE 5AVWB 3BKJL 5EOTA 1ES0A 3IDMB 3IMBA 2IBBA 1OT1A 3V0WH 1Y07A 2EDEA 3T0EE 4CA4A 4QT5A 5KSUA 5GGRA 3AG3B 1QRKA 4BQ9A 1HZLA 4LCCB 3T04D 2JB5L 4X7DC 5I1EL 1IGFH 5KYYB 2XQYG 3I74A 2DLHA 4IS6B 4A68A 4K71B 4XRCB 1DCEA 3NCXA 2AXFB 4X5RA 3QDMB 4EXPX 4H26A 3FPXA 2HRGA 3QARA 2OCJA 4XX5A 1IM9A 3IFNL 4XBPA 3FF8A 3TBYB 2CBMA 3G9VA 1GW0A 4L29A 4Y8DC 3VXSE 4L1SA 3FFCA 3FQTB 3N43F 3MV9E 5C0RH 4NHUB 2NTSP 2XWZA 2OCCB 1TJXA 1PEWA 4AUYA 3WTYA 1QFWH 3DIDA 3UO1H 5L9DL 1RIUL 1YMMD 3BO8B 3UIZA 2DQDH 1L9QA 3GI9L 4JN2A 4OT1L 3GLEA 1MAML 1Q4NX 4PRAB 4N2EA 5KYNA 3WSQL 1JV2A 3US0A 1G9MH 4KHXH 2OL3H 2YBGA 4BK5C 1MQKH 1FZOB 1XAKA 4LKXB 2NW3B 4J3OD 1GCYA 4KHTL 1T03L 2RCSH 1C12A 2ENPA 3JT0A 4I5BA 3TPKA 2DBLL 4F8PA 2X53A 5D4HA 1TCMA 3OZKA 1CFQB 1JGUH 4FQHB 1SDAB 3D69B 2WTPA 4KK5D 1WEJH 3CZNA 1QUPA 1FAKT 1MFDL 4QPEA 1N6QH 2E75C 3ELAT 4G6KH 3WMPA 5D1QB 2DYPB 3TWYA 3K71B 5INCA 2CLRA 2Z35B 3CLFH 4ODXB 2YD3A 4HMEA 1AQKL 3OAZK 2ED9A 1OTTD 1FA4A 4XP5L 2WC7A 1CXIA 2VDRL 1J0JA 4F9LC 2QQNL 2EUZA 1GTNA 3J2PA 3T0VA 3RZCA 2ZCLL 1MAKA 2DLTA 4NPYA 1EV2E 2ZP0T 2EDLA 4N8VB 4PGCB 1KJ2L 3RBGA 3MRRB 3NH7L 4YAQA 2KDYA 4Z7WA 1D5MB 3K72B 5EU4A 3S6CA 4D9QE 3LQAH 5E51A 2NNRA 4M7JL 3QHFH 2YGNA 3ML8A 4X7SH 2NR6A 2NY5L 3S4SG 5L8KB 4FJYA 2NZ9C 5AW8B 3GNMH 2DD8H 3E1ZA 4FE9A 4IHOA 5FPIA 2ENYA 1ZV2A 4KJQC 2GABA 4P5MA 1T2QH 1X9RA 3SKNA 4U0RB 4NZDA 1A65A 3M1CA 3JWDL 3ARUA 1MVFA 3QJXA 3DWTA 4ELKA 5FW8A 1KWGA 3L5JA 2E7LC 4IHBA 4X6DA 3U7YL 3HB3C 4GQQA 4YHIB 2BHYA 2LU4A 2V9QA 4UT7H 1T1XB 4IRZL 1MH5A 4PQXA 3Q2WA 4OJYA 4Q14A 2DWEA 4K3EH 2Y36L 2J8UE 1I8MA 1D6VL 3LQMA 2NTFA 4U1HB 5BS0E 5DMYA 3CFIC 5CF3A 1MCQA 5DRXA 5MENA 2IAND 3O3DA 1H8SA 3QQXA 1VA9A 4X9BA 5F70A 1L0QA 2J1KA 1UH4A 2P80A 4X80H 4AKPA 4D0DA 3QEUA 2CZNA 4KRMB 4P57A 1QLFA 3DTUB 2L7QA 3O6LL 2XHNA 3TV3H 1ZKAA 5E1IA 1OAJA 4LE8A 2X4NB 3FRPA 3HZMA 2X4UB 3ZR5A 2MPAL 3D3VA 4FD0A 1XSOA 1OE1A 1XVSA 1MF2L 2DQJL 2V5MA 3D2UA 3N9GH 1ECYA 4AIEA 2WWKO 3A67H 1S7QA 3S88L 2VISA 2BS71 3IJSA 5ENWA 1XF5B 2D4FA 4EI5D 2IVFC 5I9QB 1AI1H 1OSPH 2AJZB 5DD1L 4L2LA 1Q9OA 4N0YH 4PJAE 4Q6IB 4ADIA 5LVEA 4HXBL 3EDEA 3ZKMD 4OSUL 2CIIB 2ZF8A 5E94A 4J3OG 1X5IA 2B0SL 3LOWA 1XCTB 1UCBH 5DK3A 2X4SB 5B3SB 5CGYD 3E8VA 2DLEA 1TVBA 3T8XB 4DAGH 1HEZB 2DS4A 3E6HB 4CW1B 1GJWA 2EYTA 3I6LD 3FL7A 4Z5RA 3WDIA 3OR6B 1P4LA 5HPOA 2I9TA 2JELL 1YEGL 1WP6A 3GMPB 3Q05A 5SWZE 1KYFA 3EDFA 5JUEL 5IMKA 2PF6A 2VDLB 3MO1A 4J2QA 4K5LA 3Q2LA 2ZOWA 1KYAA 4MDJA 4D0CA 2GIYA 2VH5H 1KPRA 3L95A 4AMWA 1H3WM 4G6AD 4EBQH 2BS9A 5JHLL 5ISZD 3JBG7 5DJDB 4M9PA 3RWFB 1RVFL 3RU8H 1KB5B 3TBCA 1YNTB 3ZOAA 1J7VR 4JY4A 1QSFD 5E6ID 5C09E 1RJYA 2WQVA 5FYJD 3TXAA 1E5YA 4QF1B 4N90E 1ITCA 3O8XA 2AEPL 3MXVH 3VM5A 1ZGLM 4AVHA 4Z7UB 5DGRA 3ECBA 3UP6A 3FJTA 4BFGA 2AEWA 4MMYB 1BAGA 1UWFA 2EYRA 2NUPB 4PJFE 3WJJC 1BM3L 3CDGB 3W9DB 5CBEA 4A6YL 3LKSA 1OVZA 5TQ2L 3T3MF 1LMKA 5FO9A 1L9TA 4FI7A 4JFEB 3FCBA 1ZGLB 3W39A 2NT0A 4JX0A 3DSFL 2VCOA 3Q48A 3IWUA 1T3FA 2H1PH 3IU3A 4MD0B 4XVSH 2DQCL 1BVKB 1HKFA 1CVRA 4N2HA 1EAPA 2P1YA 3HPLB 1PX3A 3BSGA 3MRPA 3UYPA 1IILE 2P46B 2Q2LA 3O9WB 1CR9H 4HHAB 4F7PA 1GTFA 3G5XB 2R0KH 1FRGL 3LQZA 2BVTA 3KXFB 3MLXL 4LDOB 5ADPH 1QUNB 1X4YA 2GFBA 1KBKA 3ESMA 4Y4KC 3TJPA 4B7LA 1L3NA 5KOMC 5LBSA 4ZFQA 1EZSA 1R5WB 5C3IA 2FR4A 1OV8A 1KPUA 2QVMA 1AXTH 3MACH 1E30A 4HPOL 3EOYG 5C0FB 3L3IA 3EYOB 2B39A 1DEEA 1JHTB 3VXME 4Y1AA 4YHML 4Z7AA 4O4YL 2DY2A 2XT1B 3I6GA 4GOSA 4ZTOL 1JJUA 2VDKH 1LK2A 5FUCE 3UACA 43CAA 4AGPA 3ZX1A 3VQ1C 2G9KA 4JQIA 1RZGB 4WI3A 2Y6SD 3GJFB 5CFHA 3ARBD 5C0AD 4MNQA 4NRZB 3CHPA 1CT8B 1Q72L 4N9GA 3UP1A 4IBSA 3CUPB 4H0IA 1PKOA 4QXVA 1UH3A 2WMPA 3QUYC 2ZCZA 4C4KT 3QXDB 4FFYH 1T1WA 1UOVA 3OHXC 5JIDA 4ENED 1DO6A 4W9DC 1YEDA 1PZ5A 4U0QB 3NRPA 4B9CA 1T89C 4OD1L 2ARWA 3UTTB 4EOWH 2W38A 1AZUA 4XAWH 5J1TC 2A74A 3B2MA 3B3IB 4PJ8A 4GW5A 4AQ1A 5FYKL 4G8GA 1TLMA 3T0EC 4DGVL 2X6MA 5D72H 4YUEH 3HPJA 3V6FB 1E90A 4EUPH 3ZTEA 1XAUA 4KDTC 4KNQA 3EG9B 4NUGL 3R06A 4EO5A 1A6VL 3EIFA 5GRVK 3MRBA 1N7ML 2VOTA 3CDFA 3BDXA 2X88A 1MFEH 1A9BA 1Z9NA 3IMWA 2WY3B 4OFIA 1U4FA 4PS8A 5DA4A 2XTJB 4AV4A 4KDTA 4PRPB 4YHZH 4HK0B 4HUCA 1N5AA 1V8HA 2BIMA 4YH6A 1RZKC 1B4TA 2AHIA 1MHCA 4Q9CA 5KSAB 1H15B 5KJ4A 5IGXH 5E9AA 3VFTA 1N2RB 2UYLA 4NBZB 4RETB 4ZMPA 2MWCA 4CMHB 5JPNC 4HUNB 3O3EA 1HILB 1QYGH 3SKJH 4OJFH 1CGTA 4ZJ9A 1IU1A 5DEFA 3LV3A 5L2KD 3HE6D 1ZHKB 4O51A 4OD3L 5C0IB 5E1QA 3V0HA 4NCDA 4IBQA 2X0WA 1N8ZA 4U2YA 3QJHB 1XB6A 4FTVD 2EDKA 5MERB 3REWB 3L3HB 4FS0A 3B5GA 1QRND 4QXUH 2Z7YA 5SWQA 1H8OA 3QXVA 1MCJA 3IRPX 4NDMA 5FYKU 2C9AA 4XT1C 2XY1A 2FO4B 3STLA 2GVYA 2YAEA 2AV7A 4P2CG 2BP0B 3SDCB 4ELME 5T1KA 2XZZA 2XWCA 4OCWH 1UD8A 3CN3A 1RJLB 1ZLVK 4BFIB 2ORBL 2W07B 3GB7A 3AY2A 1NMBH 3MMEA 2YD8A 1PFCA 1UVQB 3H7LA 1JL8A 1KLGB 3L16A 25C8L 2F54A 3QJRB