2MH4A

Solution structure of the big domain from leptospira interrogans
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
92
structure length
92
Chain Sequence
b'MPAALVSISVSPTNSTVAKGLQENFKATGIFTDNSNSDITDQVTWDSSNTDILSISNASDSHGLASTLNQGNVKVTASIGGIQGSTDFKVTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LigB-like protein
publication title Solution structure of the Big domain from Leptospira interrogans
rcsb
source organism Leptospira interrogans
molecule tags Unknown function
total genus 9
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2013-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02368 Big_2 Bacterial Ig-like domain (group 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2mh4A00
1F02I 1F00I 2N7SA 2ZWKA 1CWVA 3NCXA 4AQ1C 2ZQKA 2MH4A 2MOGA 2MQGA 4AQ1A 4HU8A 2L04A 1E5UI 3NCWA
chains in the Genus database with same CATH superfamily
1PZBA 1YEDB 4X8CA 3ZDZB 4ZD3H 3QISA 4MBOA 2I32A 2PCPB 4ONOA 1TQSA 2UZIH 3BZ5A 3O41A 3S4SA 4LSPH 3EO0A 4NQEA 4AEEA 3ZUNC 4B5EA 4NSKB 1LGVA 4QR7A 3LRSA 2YGVA 4KKBD 1ZAGA 2X28A 3S5YA 4YSQA 4RGNB 3CFQA 5T3XE 4JJ5B 4PAZA 2JB6A 2V17H 5DHXB 4I48B 1QR1B 5CHNB 1YN6A 3GMOB 1OP9A 1U8QB 3NJKA 1JNHB 5DJZA 1VKXA 2G2NA 4OLXH 1Z9NA 2YC1A 4JM0A 5BZDA 3KS0J 2W07B 4H1LB 2VDPB 1D7FA 4ZOBA 4N2LA 2H9GA 3KLKA 2EH7L 5LVEA 3DV4B 4RMUA 1LXMA 3D2UB 3I02A 5LLIC 1JZ7A 3WMPA 3D4ZA 2WN2A 1OGSA 5C0IA 2GT9A 3KWTA 3AB0C 3CLEH 5ICYB 1AQHA 1D6VH 4NCDA 1SM3H 1UM4H 5CXPA 3J8F7 4IGBA 4LSTH 3CZSA 3QQ4A 1RIUL 2IVFC 2NY4C 3O4OB 2CXGA 1R24B 5DMGC 3ERXA 4PS3A 1QWHA 4AZ8A 3B9KD 3CD4A 3LCYA 2ED9A 1FYTD 4MJIB 4UT7L 1DDHA 4EVNA 1CGXA 1KEGH 4C4BA 5E8PA 1HH6B 4DFHA 2FWSA 1L9PA 2JVUA 1B0RA 5FLUA 1ONQA 1XB6A 4NFBA 4HZAA 4ZTOH 3SY6A 1GHFH 2BDNL 1J1OL 1Q9OB 4WKZA 1PFCA 1NGZB 3F00A 3KVDD 4OJFH 5L8LB 2O61A 4RRPM 2DW5A 1SHMA 2RH0A 4JRYD 1M7DA 3KWUA 3REWB 2AJUH 2WD0A 2JIXB 2NY1C 4LAQH 2RIKA 1IGJB 3QORC 3UO8B 5EU4A 4WO4D 3HI1A 3EHBB 3NCYP 5DD0L 3BEWB 3SKNA 3AGWA 5A2JH 3HG1D 4JZNB 4HCRH 3I6LD 4S1SL 3ZPDA 3NSYA 4Z7NB 5I5RA 1R34A 2ZONA 3AUVA 4LPCA 3PWPD 1DJYA 2WO3B 1H3XA 4Y4FB 3LB6D 4RZKA 2CBPA 5A6MA 3FO0H 1UCBL 2O5ZL 3HRZA 4PJ8A 4LOUD 1LE5B 3Q13A 4I18A 4NQXB 2BNQA 4YAQB 1BZ7B 1HCYA 1F90H 4JFQB 3G6JF 3ALWA 3MA9L 3TPUB 4PJ5A 2OYMA 3RU8H 2WW8A 4LMQI 1INEL 1FYTE 3PWJB 1T1XB 1NPUA 1A2YA 1TVBA 1ZLEA 4GI6A 2UY6A 4L9LA 2WLKA 1YQ2A 4PTTB 3AMLA 4KROB 2BXZA 2H2SD 3GSRA 3KLLA 2IPTH 3VXNA 2ADGA 4QNPE 1JF6A 4WEMB 3CVCA 2AEIT 2X4PA 3ASWA 4JFFA 1EGJL 5DS8A 4GSDH 1OAZL 3HB3D 2GBTA 2FX8L 2NYYD 4JRYE 2F74A 1HHGB 4J4PD 2X4RA 3BH8B 5MHSD 4YDJB 3FT4A 4MCMA 32C2B 4LP4A 5C7XL 3C5ZC 2PWEA 3SD2A 3DETC 5I1CL 4FQCH 3FAWA 3DOSB 1VFAB 1MRDH 3GNML 2H6PA 4ZAKA 1Q9WB 3EJRA 4HUNB 3O0LA 3V0IA 1GIGH 4R8WL 4WHTB 3PWPE 2BWQA 1OCCB 1S5IH 1ZT4A 5IMOB 5IMMB 4E5XG 4NFDA 4IRJA 4TVSa 4PLOB 3WS3B 4HUWA 2P44B 3HNSH 4HCRA 3W56A 1DJZA 3NCBB 1MIEL 4OKDA 3VFGH 5FAAA 5CCGE 1QZ1A 1WS8A 1U3HB 4UTBH 3VGDA 5EIIA 4YHYC 3KPSA 3FTGB 2NW2A 1U93B 3TA4D 5B3SB 4Y89A 1QBMH 5JLZA 3WE6B 1KZYA 2QBWA 5GGTH 2ICWA 3STZB 3RWFA 4L5FL 2VO5A 5D5ME 4E9YA 1IV8A 1WUNT 2NX5A 2WBJD 4N8CL 3LHPL 4HG4J 4JFVA 2C4FT 4XAKD 1IEBA 2FT7A 4AQ8C 1RUML 5AAWC 5I1LB 1E50A 1AS7A 2FR4A 4AT6B 2NY0C 4ZSOA 2G75B 2YAHA 4U7MA 5BW7C 4UT9L 3NPSB 1RZGB 4AZUA 5CN3A 1S7XB 1UC6A 3FFCE 3IE4A 4TSCH 4U1KB 2ESVD 4JZJC 3QRGL 4XPHL 1AQDA 3CK0H 1QKZH 2LTQC 2R83A 1V3LA 3MMEA 4ZXBD 4NNPL 4O2FA 3V4VB 1A5FH 1S8DB 2ZWNA 4ANKA 2HVKB 5GXBB 1L7TH 3F7YA 4PRHA 2UXTA 2VERN 1LO4H 4WI4A 4Y9EA 4LLYB 1AZRA 4X0KA 2W81C 4MCZB 3QEGL 1FH5H 2JWYA 2JXMB 1QW8A 2YOCA 4DKDC 1T4KB 4JPKL 4L3EB 4QTHB 5CU9A 2NY2B 2C1OB 4LVOB 5E2VH 4F3FB 1NC2D 4PBDA 2WANA 1HQ4B 4FKHA 3L2LA 3WFDH 2IWKA 3GBDA 3BHBA 2AJZA 5TDPB 5B39B 1JUFB 3GXPA 1QSEB 1L5GA 3GZQA 3NIDE 1KIPA 4UTBA 4XAKE 3NP3A 4POZC 3FQTA 2R7EB 3HUJF 5C0AE 3UABA 5C70A 3CPLA 4RCAA 5FHAH 4G5ZH 1DLHB 4P4KD 5GGTA 4XOEA 4FQ1H 2ARJQ 4N0FB 2YD4A 1Z3RA 4S2SA 1CTMA 1ZS8A 3WLWD 3BLPX 3F7RA 1ETZB 2WWOA 3I9GL 2OMWA 4AJ0A 4DP5X 2ESVE 4EN2A 5L2KB 3E3QC 1I1FB 5KANG 1A4CA 2JK5B 3MRCB 3QORA 5ANME 3L5IA 1M4KA 2AXHA 3W3BA 1G7IB 5AL8A 2ATAA 2BRRH 4D9LL 3WLBB 2UVFA 3IYLW 4FX5A 3LNIA 5F7AA 3EH2A 4OD2A 1LWRA 1PZUB 1OXYA 3E6HB 4FL4C 4HLJA 2IQ9H 3QSKB 4TQ8A 1FHNA 5SV3A 2P24B 5MP6L 4Y16B 3P77A 1QYGH 1FNFA 4Q9RH 4O9HH 1ZGLB 3IMVA 4KRLB 3UBXI 3FB6A 5DJCB 3N0PB 4OGQC 4Q6YA 3ULAB 2QSQA 5SWSA 3OJDB 3VXUE 2GPZA 4PJFA 2VDLL 1A1MA 4MNGB 4Y9FA 3JVGC 2AQRA 3VG0H 1OM3L 3C6LB 3SE9H 4OLZH 5SX4I 4GS7B 1J5CA 5KWYC 3I2CH 3O11B 3VFSB 4B9ZA 1MLBB 5TPWL 4XBPA 4AYFA 3AVEA 4HCIA 1S7WB 4FQQA 3L5WA 1YAZA 4AEIL 3NQIA 1R3JB 2R2HA 1DJXA 2ZCKH 4OIIH 4F8OA 5C7ZA 5C8JA 3K2IA 4U3SB 3TVMD 1ORSA 1L7IH 2GG1A 1FSKC 1U4FA 2WXQA 3NJHA 2HH0H 3BFOA 1JG9A 4TF4A 3FRUA 2R69L 1MSPA 2Z91A 4FLSA 3OXRB 1JZ4A 1QG3A 4F91B 3LEVL 2EDFA 4LPWA 5IMKA 4XPTL 4WHYH 2A0LC 3II1A 2W65A 5F1NA 2E76C 1RZFH 3CHOA 2P9RA 5GZNC 3HKZA 2C1PB 4P4RB 1T22B 5AOJA 1IM3D 5BRZE 4BCZA 3MJ7B 1F4WL 1ZKAA 1A7BA 1HWGB 4W9HC 3Q3GA 3RUGF 1A3LL 1KSRA 5H4YA 3E80A 4QOKB 5EORL 5AB1A 2CUIA 4X8XA 4I0PB 1IL1A 1U8CA 3VXMB 3L5XL 3IN0A 3BVNB 1J0KA 2IXQA 3VB9A 3SQRA 1AR1C 4QI3A 2GITB 3FQ4A 2DMKA 5CGMA 1KGUA 4MFHA 2Y7QA 3QRBA 4HA1A 3CJJA 5D6CB 4AQ8A 3QDJD 3ZY7A 2WYHA 1CYGA 2RFXA 3FPYA 1FVDA 4NQDB 4OLWL 2CO4A 3H0TA 3BO8B 3OMIB 4DCQA 4DTGL 1I3GL 4JY5H 2YPVH 5IHBA 1RH8A 1H8OA 3O81A 2IBZX 3K4AA 3WUWA 3P3TA 3IRPX 4PJGA 5FA4B 4AIEA 4RGMC 2D4FA 4AYDC 3S4SG 1RP9A 1JRHH 4JZJA 3IF1A 5F9OL 3RJOA 1FC2D 3MLUL 2EC8A 4N3UA 3BWAB 3B9DA 2WWKO 4XMLL 5G4MA 4AM0Q 5ITFA 1R3IH 2FD6L 4K9EL 4KX7A 4IOSA 2R1XA 3A23A 2P5ED 2I26N 1DP0A 1W72B 1XO8A 4P5MB 4QHLB 2DQFB 5DS2A 1PY4A 1BD2B 3CZNA 1QABA 1DVFC 1KNOB 1KB3A 3U36B 1CXFA 1NGQL 3A24A 4XP1H 4KTDL 2XICA 4S10A 3UBGA 1PL3A 5DVMA 2Z65C 5I0YA 5A2LH 3RWGA 4IJ3C 2ITCA 4DGYH 1SUJA 2IGLA 1AQKH 2E27H 5BUPA 4XNXH 2K70A 2D7OA 2Y6SD 4ES9A 3FTXA 2IANB 3SYQA 1PX3A 2EQDA 3KPOA 5D1ZD 3DX0A 4JPIA 2NOYA 2CLZA 3TP4A 1XD0A 4G9FB 4UU9B 4EF3A 4XH2B 4ODSL 4N25A 2BC4A 3FYIB 1DVSA 3WJMB 4MB4A 3EO9H 3RGHA 5C0RH 5B3NA 1KXTA 1CZ8H 2W0FA 4BZ1H 3QNZB 3ZE2F 2FUTA 1BQHA 1JWSB 2H1XA 4JFEE 1CD1B 2Y7SA 1CL7L 1OE3A 1OWWA 1T04B 1CS6A 5ALCL 2FUQA 2HG0A 5I6KA 2YPVA 2J1ZA 2AK1H 5GJSH 1U91B 1JF5A 1G94A 2QELA 4WVRA 1WCQA 4A37A 4HIQA 4R4FL 2YGQA 3CXHK 4XZUB 4PB9L 5IV2B 5C0JA 3G04A 4XXWC 1NEZA 3DK2A 3GHBH 4JE0A 1S9VA 1AIFB 4QEGA 2XETA 3Q5TA 4MRCA 2DWTA 2MQCA 5B1JC 4EI6A 2DQEL 2Q8AL 5CIPB 5I74C 3BZFA 4D7BA 2ARJB 2R4RL 1FAIL 3QR1A 3V5HB 1LMKA 3QUKA 3EZ8A 3KGSA 3SCMC 2B1AH 3VWJB 3WG7B 4L0PB 3WNPA 4A6YL 4M6OL 2HUHA 2H0FA 2WBXA 2W9LA 3JVGA 1R3KA 3EOTH 3E8UL 5TH2A 1QR4A 3HS9A 1RZIB 3II3A 1DCEA 2OPCA 3ZDYB 3BISA 4JFZL 1PLGL 4AL8C 4Z7UF 2WTRA 4H4NA 1RJCA 2K7QA 5AW3B 4NKIL 1HXMA 5GGSA 3IPBA 2APVA 2ZICA 2R8SL 5C1MB 3NIDB 2QQLL 4JZOA 2CNZA 4M8RA 4MXWL 4XNQA 5C0AB 3LRKA 3GMLB 4NKDA 3VXTA 3BUPA 1PYWA 3LRLA 1INDL 3WV0A 4Q89A 1NCUA 2UZXA 3UBXA 1KCLA 3HJEA 2NSMA 4MNHA 3DRTB 4XC3L 4BWUA 4PFEA 4BZ1A 1MRFH 2F68X 4MJ4A 1HESA 4P49A 3EYOA 1HL8A 4L8SC 4LCUB 3TCTA 1CGSL 3D85A 4RGOL 4Y1TA 1V7NH 2HJFB 4PJXF 4AKPA 5GZNA 5E4EC 2BSRA 4DZBB 5IB4B 4H0HB 4AVHA 4JAMB 2VR9A 3CHXA 3Q1EA 4JRFA 3UYPA 1BZDA 4JVUA 4NWUL 2VRQA 5DJ2A 1O5PA 1PZAA 2IPKA 4J1UA 4B6ZA 5ITBL 4S1RL 3RPBA 2BO0A 3SDAD 2EADA 3D0LA 3RB7A 3VD2A 4Y4HB 3T08A 3BZEB 1YMMA 4RWHA 4XOAA 1FFOA 1NBVH 1SF3A 1F4XH 1ES0B 3Q2VA 4NQCA 4P5TD 1G1OA 1NMBL 1I9IH 4IRZL 1L9QA 3TBYA 4E2OA 1IGTB 1R5IA 3G5VB 4QCIA 4PJ6A 2JKJA 2EYTB 4DK3A 5EIIG 1MF2H 1NINA 5DRWB 1YYLL 3QZWA 4XI5D 5IHUL 4OH2A 6CGTA 1XEUA 1QRND 2CE6A 3X13B 4LKXB 1NICA 4GH7B 3TJHD 2FATL 1LO5B 4NENB 3H3PL 4RAVA 1S5HB 5JXAH 1CCZA 4CVZB 1A65A 3COOA 1IAOA 5JO5B 2OCCB 4NS0A 3MGTB 1OV8A 1TPXC 4OLVL 4QRQB 2D0FA 5C08A 4N0YH 1WFIA 2BZ7A 4M7LH 4QRTA 3GIVB 2N3JA 4FQLH 5D7LD 5D93B 4N2OA 5AVSB 1KYUA 1TJMA 2MKWA 4JFDA 1WBYA 2VXTH 3ZZSA 1KFGA 1NJ9B 3QZOA 4HD5A 3UTSA 1JF1A 2J8UB 1ZLVH 3BLBA 1KGJA 3B3BA 5IVXA 1DVFA 4DN4H 4ECNA 3HMXL 1K6QH 3F01A 2CCVA 2VAAB 2X4SB 3SGKC 4L1HA 4Z95L 4PJAA 3LS5L 4Y88A 3FN0H 1ZLWH 2XCMC 4AL8H 4HCGA 4LIQE 4ES8A 4YFLI 3SOBL 1H9VA 2GB2A 2EZ0D 4UANA 2DLTA 1YO4A 5BRZB 2V0AA 1W8NA 4LCCC 3WEXA 5EC1B 2RJMA 3V95A 3BAWA 3WKPA 2VR8A 4WCYL 1K9TA 4LLUA 4PW4A 4JO2L 2A6DA 1KCRH 1CDUA 4AM0B 1QRNE 4HFUL 2ZXWB 1KXQE 3PV6B 4NRZA 4F2ME 3A67H 5J11B 3GQFA 4N0UA 4R5XA 1KENL 2BPBA 2FX9H 5ADOL 3B9EA 3OMAB 5GS1B 3PQYA 5T1DL 2EIEA 3FH8A 1ETA1 2Y06L 3PIQA 2Z31D 1TJHL 2DEWX 3SE8H 3G6AB 3UTTD 4TSBL 3CSFA 4E9VA 3WGVB 1YECL 1KGIA 4KJYB 4G3YL 1RIVH 4KKQA 2EIKB 2BIIA 3L48A 4ZW3A 2N1TE 2WN3A 3POCA 4QRPD 3QFDA 1I82A 4QRBA 1R3HB 3WNLA 2YMXH 3CC1A 4KKPA 2HLFC 3FW6A 4HPOH 2UWEA 4NXSA 4EI5D 2GJZA 2YD3A 5B1JA 1SN0A 4UV4L 2ROXA 2HB0A 4HUMB 2EKSB 4NRYB 2F18A 3GM8A 3W11D 1T0MA 2D7QA 4E9SA 3KGTA 3QK0A 4CMHC 3VXRD 1GY2A 4AENA 4XVUC 1I9JH 3G9VA 2IG2H 4L4TD 3IB4A 4KK8D 3VYOA 3E1F1 4GRLD 3S37X 3BKMH 2NY5C 5HYSA 1BAWA 2WOYA 3HMWL 4OZGB 2G4GA 1X7SA 1MG2C 2X88A 4L1TA 2BSSA 4ZI8A 5HHVH 1OOAA 1HHHA 4ZFOL 1N3NB 5D2NC 3UTTE 4PP1D 1W6WA 3AS0A 1PEZA 4K5MA 1TSHA 4ZDHA 1HDMB 5KBDA 2E7DA 4MZIA 2VDRH 4M8UA 5F9DC 3QUXD 1P84J 2MPAH 2Z8SA 4BQCA 1AHMA 5F7HA 5CBAA 4UOZA 5EBGA 5K5YA 1R4XA 1ZHKB 5C86A 3QPXL 4PV9B 3MNWA 4CU8A 5I16B 1WA2X 2AAVA 4L8SA 3LX9A 3TA3D 1AQMA 1CLZH 4GKNB 2C4FU 5EUOF 2ENSA 5MEPA 2EDEA 2D9QB 5LBGA 4HAKA 3KJ4C 1BZEA 3MRNB 1ZV9A 3QH3A 2C3HA 1RURH 3PU7A 3T0ED 8FABB 4TVPL 3QCUL 3QI9D 4NQSB 3ARZA 3VXRE 5KVMC 3I3DA 1BPVA 2TRYA 1BEYL 4L4TE 5EOTB 4HUVB 3HNVH 3ISWA 1GS7A 2AQSA 4U6XB 2A6IA 2J56A 2DWEB 5CEXA 3HLAA 1NLBL 2XZCL 2VLRD 2Q6WA 3HE7D 1RL1A 2RACA 2EVHA 3MYJB 1T5WA 3A5VA 4I8DA 1BSIA 3QAQA 4WWKC 2MOQA 3OXSB 5ACLA 2J7LA 5C0BA 4KZ0A 5AUMB 3DNKA 2V37A 1NLDH 5IEHA 1NMAL 5L4FA 1CMOA 4H2AA 3HHRB 3ULUC 4IDLA 3OHXC 4KVCL 5AW2B 5IWLC 3NIFE 3WFHA 2VN5A 5K69A 3LPGA 4EOWL 1OTSD 1ZANH 4NLAA 3RL2B 1BIHA 2EYSA 2H6UA 4O2EA 1W0VA 4HS6A 1KPUA 3O6KH 1ERNA 2YFOA 5F7DB 3LJ3A 4W9ZA 4G1EA 4U1SA 1AJ7L 1BVKB 3BZ4B 3RWIA 3WUWG 3L4XA 3HR5B 5HI3C 1NFDF 3GO1L 5IQOA 2GK0B 3C08H 4RZCA 5C0CE 1OALA 2KZKA 4HGWA 3RIKA 4MMXA 2DRUA 1OTUC 1X6NA 3QDMA 1LP9F 2FJGA 5BMFL 2NY5H 4QWWD 4JG0H 3KPQB 3SGKA 2P43B 5ECGA 4WFED 4I1NB 4B9YA 1SDYA 2KLTA 4LCCA 1TYEB 2VABB 3D3VB 4XTRC 4U1NA 1HEHC 5DWUL 2OK0H 3RL1B 2IAAC 4OIAA 4XBMA 1BMWA 4NQQA 2VTFA 2UX6A 5ABDE 1PQZB 4Q0XH 4FZ8H 1BQLL 4AVJA 4EN3C 1HSAB 4KVNH 4U1JB 4JVWA 1MFMA 4PJHE 5DO8A 5FCUH 3SPGA 5A7EA 4PM1A 1U0QA 2QL1A 1QA9B 3EBIA 3IJSA 4G80A 4HAGA 1UGKA 1X5KA 2DM2A 3V6ZB 4HS8H 2W0LA 1CJYA 2P80A 3HBZA 4XBGA 3RIAF 1KTLA 1PJ9A 1QI5A 1R46A 4P2RD 5GS0L 2M26A 2E59A 3QFJA 3CPUA 4ADIA 4IK7A 1U95B 5EO1B 5BVPL 2QPFA 5A43C 4HIHA 4IJTA 2MQ3A 1B0WA 1BQHG 1JHLL 1N5AA 3O3UN 2ED7A 2HPOA 5HJ3B 1JTOA 4P2AA 1LO0H 4RMVA 2AAAA 5CGBA 5JNYA 4CVXA 1KCSH 2HRPL 5D6DC 1NEZG 4B9JA 2DH3A 4S11A 5HI4C 1BLNB 4MXQC 1J18A 4XVJL 5FKAB 4F80A 2GQHA 2X4NA 1MNNA 1N2RA 2YAQA 1WTGT 4MS6A 3WS6A 4DPCX 2CRZA 2C9VA 4QHPA 2BSCA 1TQBC 1MJ7H 4BE6A 4FHKA 3O2VH 1JD7A 3ULUH 3G5YB 2CD0A 5GQBA 5FOBA 2HFEA 3GINA 3N55A 4HSAC 2ZX8A 1DBML 3V79C 1KLFB 4PWKA 2G4EA 1P4BH 4MDIB 5D2NA 5IOPA 5PCYA 3G6JB 1FCGA 1COBA 1R0AH 5F7MC 5EA0H 1AI1L 2YD1A 4FG6D 4H7VA 5CD3B 2V2TB 3IVKA 3DV6B 4TULL 2HFGL 2X7LA 4OJCA 2F54A 4UQCA 1UKTA 2HTLD 1FH2A 3GMPB 4MJ6B 3I75A 1A14H 5J56B 1TVHB 4KGLA 5DQDH 1AGFA 1HH9A 4JDTL 3SSGA 1WYJA 3HG0A 1M7XA 3UBXG 3FOLB 5HDWA 4HQQL 5GRUL 4OKVA 1DSFL 3FCSB 3V4PH 3C6SB 2V5TA 3GSXA 4NX0A 4HJTA 3U79A 1ZK9A 4KKLC 2RMNA 3WO3B 2WLIA 3NH7L 5FYLE 1NC4B 5IBTL 4DNLA 4F92B 1S6NA 2APTA 2R29L 1GYAA 2PWDA 5LBVA 1P7QB 3MOBL 4QMEA 2MJWA 4A66A 4Q2ZB 4EDXA 1N0XL 2PW1A 4PV8B 3BD3A 5E8OB 4YSSA 1KJ3L 1UXSA 1LHZA 3WFZA 2NUPB 4M4RB 4WWKA 5LXGH 4P99A 5I73C 2NMSA 1T66C 2GJJA 2A99A 2E8ZA 2P5WB 4MQ7A 4S1DC 4WTQA 5IWLA 2Q7AA 2X4UB 4RA3A 5IKCB 4UIKH 5ESAA 3ZKXB 5IMLA 3QZWG 5FOJA 1BJ1H 3GC3A 4Q74A 4DQOH 2VDMH 2CBOA 4IIZA 3OR7B 3D2UD 5B3JF 5EFIB 5EEZA 3TT1H 1KPRA 1SDDA 1CGYA 3DC0A 4UB0L 4X50A 3VMOA 4D0BA 2VDLB 4YK4C 2XKUA 3IPEA 4P23D 5E95B 3LSOA 3DVNB 2CLVB 3WIAA 5TF1L 1EMTH 5BUGA 5E1HB 5ICZA 1NMCC 4AGLA 3IM1A 3GGWB 1YA5A 1KB9J 1S3KL 1XF3B 4ZUSB 3VMNA 5CZXD 3DX7A 4OCMC 4XNDA 3IJYA 4BSWB 1U8PA 1CG9B 2AK4D 2XLLA 3GXFA 5IQ9B 5F21B 4MJID 1V10A 4DEPC 2XRAH 2IDSA 4E42A 2JKLA 3V4PA 3EXJA 1S7RA 3M17A 4BKLA 1PAMA 2Q20A 3L81A 4WI2A 2VDOL 4O4YL 1VFOA 3DROA 4FNQA 1TVDA 1TQVA 4M5TA 1BW8A 1JPGB 4B9GA 1HJCA 3BVWA 4FXKC 2ZWLT 4XHJD 4XCCL 4APXB 1SFDA 2B59A 2IDUA 3HC0A 2JIXD 3MRGA 3ZTEA 3HHSA 3LPPA 4HIJB 4EN3A 3LIUA 4WSKA 3EHBD 2EDBA 3M46A 4FKKA 4FFVD 3QO1A 4AE0A 1AY1L 1KBPA 1F4YH 2XQYK 4E9WA 3ATFA 2XY2A 3P3YA 1Z5LA 3KYKL 3ME0B 1ZLUH 5KYNA 5DD3H 1MDAA 5CCKL 3MRIB 2P49B 4MAYB 5LCVL 5TE7L 1M6OB 1UH2A 5D96C 1AC0A 2XWJA 1ANUA 3HUJB 3QUZC 4Y2LA 3DSFL 4BM7A 4XP6L 3AREB 3KNBA 2NW3A 5FO8B 3LKQA 3NG5A 3BWZA 3ZSTA 2Q9OA 3NCJH 3BH9B 4XN1A 2YPLA 3IFNL 3UYRH 1D5XA 3T65B 3O6FC 4NC2B 2VXQH 3D12B 4FXGB 1RJZA 1S78D 2VUKA 5FHBL 5KJRL 1OAYL 43C9B 4JO1L 2EXWD 1WIUA 1MFBH 4ACPA 3DK0A 3PGDA 1Z6JT 4ZD3L 1PPIA 4LPYA 5L8JB 1BVLA 4PS4H 3Q6GL 5EZPA 3KPRD 3TO4C 4Z7WF 3QEUB 5D1XB 4LSPL 4Q14A 4AH2B 4NJ9H 1I8AA 1F11A 1YY8B 4B41A 3VD0A 3DUSB 5JZ7C 3M1BA 2V17L 3HNTH 5J13B 3SKJH 2J5LB 4PRNA 4WK0B 5HYSG 1IM9B 3T3MF 4XGZA 1QLRB 4NBZB 2A1WH 3P9LA 4OLXL 3AS1A 1XR8A 4YHKH 4JGJA 3OJ2C 2JH2A 2H7WA 4Y4KD 2Z6FA 2NZIA 4ZMYA 2XTJC 4PRPE 4PJDE 1Z9SA 5SWZD 4YPGB 5LN8A 1BX2B 3BLKA 4PWIA 2EAEA 4RQQB 4DHLA 3CLEL 4WTWA 3VVVA 1D6VL 2XZQH 1SM3L 4XNZC 4F58H 4LSTL 3S34H 3KXFD 1MFUA 5KJ4A 3ARWA 3TZVB 4K7FA 2NNAB 4Z7IA 2X1OA 4ODXB 3CZEA 1MJJB 1TEFA 1EJ6A 5T3ZH 3UG3A 3JWNC 3FXIC 1S7UA 3VFOB 3U30C 2PF6A 3ARPA 3KPRE 3PL6B 5IJVA 1RULH 3LKRB 4DP6X 4JUSA 1JXGA 4KUCD 3OKOB 4LHQB 2VXQA 1S7VA 1U3YA 1H8LA 3MLSL 3OX8B 4L8BA 4PGEA 4ZO8A 3TCLB 4YHPA 2YHGA 5D7SH 4ELKA 4IK6A 4ZTOL 4MMYA 1J1XH 1GHFL 4N8PA 4ZUVB 3WCYA 3TBTA 3L5HA 2XPYA 2AI0H 4NO3A 1KXVA 4KY1H 1XF4A 2LQRA 4GLRH 2AJUL 1SJEA 4LAQL 3RUGB 1AMYA 1S7SB 4L29B 4D0CA 3O45A 4WI5A 2K7PA 3MSPA 4ENED 3HE6B 4OZIE 3FU3A 3C5SB 1OP5H 5GSVA 3FUDA 2EO1A 1Q1JH 4K94C 1GZQB 4L2YA 3VXOA 4HWEL 2B5IC 3VX0A 2AW2A 2NY3C 3MJGX 1F8TL 4H88H 4PRDA 1OT2A 4V1DE 5DLMH 5IP4A 5SWZE 3W0WA 3QZPA 4Z7VA 3NCXA 2CIKA 3VRLE 1P5UB 1G7PB 2ZQKA 2NY2D 1GVIA 2WXJA 5JIHA 4J39A 4KMLB 4H8WL 1F90L 3QS2A 3KXFE 3L13A 1CDGA 3DMMC 3IETB 4K7PH 5HHXH 4MX7A 2ZE0A 4N8VB 3HN3A 3KPNB 4LARH 3RU8L 4I5BB 2YPKB 4PLKD 4V11A 2AXFA 5I26A 3ZZQA 15C8L 4FQPA 2UY7A 2Q7YB 4PJ9C 4TL5A 5AYUH 1FV1A 1RLBA 2WXNA 1XIWD 4ZQTA 2CM5A 3BEVA 1SZNA 4XCNB 4AITA 1C8QA 2IPTL 3CUPA 1HS6A 4RSYA 4MD4A 4HFWB 3FU7B 1KYAA 1PY0A 2FIKA 1SN2A 4N9GB 4GSDL 1BZQK 1J8KA 2GIMA 4FXKA 3BQUB 1JXJA 1TCMA 5T1KA 5E4IA 3P0VL 5DMJB 3MBED 4DGWC 2RA1A 3VGAB 4KKAD 3OKDB 5DF0A 3HZYA 1F4HA 4KZCA 4ZMQA 5FK9A 2VLKE 4Y7MA 3B5HA 3EGXA 1MRDL 5HI5D 1YPZA 3KYMA 2E56A 2QVKA 3RTQB 3MV8B 3WKML 1U21A 1HTYA 4YE4H 4IW4C 4XMZA 5I6MA 3IDUA 4JG9A 3CN2A 1GIGL 3U7WH 5GJTL 3SO3C 1OWRM 3DXAD 4LRNH 1S5IL 4JDEA 5LNGA 3O8XD 2VISA 2K1MA 3MRLB 2D7TH 4MXVF 1NANH 2YOAA 3HNSL 3QIBC 3FQ2A 4RSVA 3X2QB 3W5NA 3WY2A 4L3CB 4KXZH 3VFGL 5BZWA 2XXFA 3JWNH 4UTBL 1CB4A 2Q0ZX 1SMAA 2P8LB 3HAEB 4JY4B 1ODUA 3EJUA 2BRQA 3O6FA 2BVTA 1MUJA 4TUOB 2OKMA 4BDVB 5FUCC 5GGTL 3ZE2B 4AUUA 4M7JL 3K8KA 4A63A 1ND0B 5SWQB 1J5DA 5LO7A 4GXVL 5D1QB 1ECZA 1FIGH 1WO2A 4GG8B 3VFNA 3ARGC 3EGDB 4Q58C 4ZUTB 3TO4A 4W9FC 2SEBB 2Y1YA 3NA9H 4FGMA 4KJQC 1HOEA 2P8MB 2V7HB 1HT6A 5C0FA 3FTVA 4RA0C 1RIHH 4KK9D 2WCGA 4UM8A 4K73A 1CLYH 5CLXA 4X5WA 5CZRA 2VZUA 3CH8A 3CFMA 5EU7C 4TSCL 4PJGF 1DBJH 2H32H 2WKGA 1XGTB 5TFSH 5ACMA 5J4MA 4ADJA 3CQFA 3ZXAC 1JFQH 2YD9A 3CK0L 2CJTA 1JV2A 4MAZA 5A1AA 1JCKA 2GY5A 2E9BA 3T0WA 3VG9C 1M3IA 1A5FL 3OD3A 3PDOA 3ML9A 2COQA 5LGYA 5TE6H 4ZYKA 3BUYA 1L7TL 2D2OA 4WI9A 4XN7A 1LO4L 1VADA 4I9WD 3L16A 2ZUXA 2L8AA 1IUZA 2AJXH 3NP4A 4ZO7A 2XN9D 1FH5L 1UHVA 1OKEA 2WYZA 5DJ8A 2JKRM 1TYJA 3AC0A 3MBWA 4ODWA 3EH4B 4G83A 3H9HB 1IGYB 1SOKA 4F5CE 5A3IC 4Y2OA 3VXMD 5F8QC 1YNTA 2XDHA 4JFXB 4QRSB 3U0WH 3GSOA 5TD4A 2YEZB 2NDFA 3OKEA 2PYFB 3GTTA 3EJZD 2JLLA 2X70B 2BSTA 1EHKB 1RUQH 2FL5B 3FQUB 3SKMA 5JQIB 3IGUA 4U4BA 4N2CA 3RKDD 3HG4A 3V0GA 3S36L 3JTBA 1FNEA 1WBXB 3MV11 3PHOA 1UKSA 4Y1SA 1KB5H 2QDVA 4MJ2A 2E86A 4PJIF 4PJXB 4PRIB 3UIZA 5F3HB 2WLJA 1MN4A 2J25A 1KLGB 4H44C 3MVSA 4MMZC 5FGSA 5I15H 3J27A 3VCLB 2ZYRA 2X4OA 3GJFK 2BRRL 2E7MA 4CU6A 3L3IA 3MCLH 4ZT1A 1XMEB 2W8CA 2PXYC 2H32A 4AC4A 4L0YA 1HAWA 4I9WE 5ESVA 4GYBA 3RP1A 3U0PA 2IQ9L 1T1ZB 4FEMA 3ARFC 1G0YR 4NM4H 2XN9E 3HI5H 4MA3A 5KUKA 1H3PH 1P2CA 2YD6A 1QYGL 3N1QC 1GJUA 5JYLA 4N0CC 4O9HL 4U6YB 3FO2B 3CDZA 2VW7A 4NDMB 2B39A 3MOAH 1CLOH 3GSUB 3TJEH 3SN6N 1W0WB 3P4MB 3QIUD 4NO0B 5EN3A 3DMMA 5GRVK 3S3PA 1OT4A 4MAUH 2PP8A 1O6SB 5I1DA 3VG0L 2B08A 2OR8A 3ECVA 4JDVA 4HXAL 4PJ9A 3I3BA 3F7VA 3FOMB 2IAND 2IV9A 3I2CL 3CV5A 3TIDA 1NCCH 4ZFOB 3ILEA 3CC5A 5CCHE 2H4EA 4LASH 1WICA 5C6PB 3P40A 2GSIB 4CVUA 1E9PA 4P46B 5AVYB 1IFHH 3OGOE 4X0NA 3ULVC 2H8PA 2ZCKL 2OXHB 4OIIL 5HHOB 3BFWA 1MHEA 1U92A 2QV4A 4IOFD 5D4IA 4XOCA 3CFDB 5CINH 1KTJA 3PPSA 2W60A 2EH8H 3MHZA 3T4AC 2WINB 4F8PA 1WA0X 3MA7B 1L7IL 3D05A 2DWYA 4BHUI 1KB5A 1AZNA 4H0GA 1UJ3C 1LEIA 1DLFL 3CAFA 3AM8C 2MPVA 1VZGA 2DQ6A 3QEQE 4ODTH 3NRQA 5LBSH 2CGYA 1QSFE 1QMUA 4MD5B 1CFSB 4OUOA 1PZCA 4KZDH 1RZFL 2Q3ZA 4OUUA 4PP2B 1M42A 4HEME 3GXTA 3GSVA 2YWZA 2LFGA 4G71B 3QIBA 2F9BT 1U8OB 2YQGA 2CGRH 3LN9A 3OAWA 5EMYA 5HYQA 3VWJD 3AG2B 3QBTB 3QNFA 4UWQB 1GZHC 4V1DB 5DRZB 1IZJA 3FC8A 3CDGB 3FUJA 3RX5A 1NCWH 3MUUA 2XWDA 3ROOB 4E5XB 4OI7A 4U1IA 3W57A 3RJQB 3BN3B 2DAVA 4IDJH 2PCFA 3ROLB 4L1BA 3MUY1 2D0HA 4K3GA 2G5BA 2IH3A 1XDTT 3VTTA 3Q2CA 3L95A 3K1KC 4POUB 4NC1C 3KPPA 4OIFA 3DSNA 4MCNA 3ARGA 3IK2A 2H2PD 1EEYB 1WAAA 4JY5L 1TETH 1W6LA 5ICXB 3NEXA 1LO2L 2JI2A 2EDWA 4DZ8B 1JGUH 1TLMA 5ESQA 3A6CH 5KBMA 4QRUA 3V7AE 4BQBA 3PWVB 4OM0H 1JRHL 5DHYB 5HHNA 3F8UB 4MDJB 4D9RE 1CGVA 1M05B 4ZPTB 3VI3A 2E8YA 5BV7B 4OIBA 4X8GA 5FB8B 4RFNC 5TK4A 3QG6B 1C16B 5DHVB 1ZHLB 3TN0D 3KPTA 3EH1A 3UO1H 2R0ZL 2D03L 2EVIA 3A6BH 5D9SA 1AKJA 5HPMA 4W81A 4WW1B 3EFFB 2DKUA 4ONHA 2DL2A 1HHJA 3ABGA 5LBSA 1HEZA 5IVXF 4L23A 5KTEH 5KVEL 2V5MA 3MRDA 4XP1L 4EKJA 5HGBB 3M86A 1NFKA 4NWTH 4PJAF 4NZTH 5IK3B 3QJFA 5KS9F 1EO7A 2YAMA 4X98A 2AABH 1TXKA 3ULVH 4DGYL 4ZTPH 3DIFB 3VM5A 4XNXL 2ATKB 4HP5A 1T21A 4XB7A 3KCPB 3RA7H 4RMRA 3ULSB 2GFBB 2WP3T 4MB1A 4U1MB 2YEQA 1OD7A 2YAPA 5KSBE 4FI6A 1O6TA 5EUOB 3TPKA 5C0RL 1DQQA 3MREA 1UXWA 1CZ8L 4ZNEE 4ZFFA 1KOAA 4GAGL 2VSKB 4M7ZB 1CD8A 4EMZA 4WQOA 2VLLA 4MMZA 4UAHA 4QJ4B 2AK1L 5AKTA 5GJSL 1DL7H 4PRAB 3TFKD 4EPSA 5DK0B 4WNSA 1JGVH 2G2RB 3HZMB 3MZGB 1YEDA 4FNRA 4YSCA 2JJVA 3GHBL 4M5YL 4Q4IA 2UWEF 3P4OA 5E2JA 3ARFA 3LAFA 3SKUD 3SBQA 4RMBA 1KDIA 2IF7A 2AMGA 4JHWH 1M1XB 2CO6B 4PCYA 2CGZA 3FQNA 3N1PC 3IS1X 4YXLH 4J28A 4R4NC 3ECWA 1HXKA 4I13B 4I48A 2B1AL 4G43A 4HJIA 4XX1E 3V0FA 4Z0XA 4RIRA 3ZE1F 1U8QA 2CRMA 3HS8A 1AD9B 4G6KH 2W07A 1FFNA 4JE4B 4DGIH 4U3CA 3FQRB 4CN1A 1NAMB 5AZEH 2JLPA 1B3JA 5CEYB 4N2DA 1L9SA 2RALA 2B20A 1KBVA 1EO5A 5D4HA 3U4AA 3BPOB 1NCOA 4IRSB 3KWWA 1NFDB 3ASNB 2XX0A 4MD0A 2QJDA 3V4UH 2XBZA 25C8H 4U0QB 4N22A 4QIRA 3WE1A 4DVBB 1KT2A 4CMMB 1LP9B 2H1LM 2PWFA 5EIVA 1A1OB 1UJ3A 1A6TB 3TIEA 3ATBA 5JOFA 1NWPA 3HR6A 1AHWB 4LSRH 2A7BA 3AM8A 1MRFL 3RFRA 2QPDB 1MWOA 1HH6A 1M2OA 4S0TD 3ZHDA 1UWEH 5K59E 5E94B 5AB2A 2YXWA 5KYXA 2EYRA 2VXSH 1Z0MA 4IBYA 1CF1A 3V5KA 2AV1A 5FO9A 2E46A 2WNXA 3ATDA 2JI1A 4FFTA 1ZCRA 3D39D 4EKXA 1CVSC 4X6FB 2VB5A 1GZHA 3REWA 4PIBA 5F7EH 1II4E 1TZAA 3G3LA 3VH8A 4L05A 3EBGA 2MCPH 5KG9A 1NBVL 4GAYB 1F4XL 3QJHB 4WGVB 2EACA 1I9IL 4P07A 3T3PF 4K07A 2NLJA 1VACA 3BEWA 4LF3B 4NN5B 1L6ZA 2XY1A 4R2GC 5EOCJ 4HV8A 4ZRGA 1MF2L 5C07E 3JV0A 5C0GA 3GIZL 5L2JA 4ODUB 2I7SA 3V6FB 3Q0HA 5HHQB 2HYMA 2E9JA 1XF5A 3QHFL 3EYVB 2O5YH 2P8PB 4TNWF 5F1KC 1MCBA 4JFQA 5JXAL 3D0AA 2AJVH 1FJ1B 2V3DA 2HWZH 1EXUB 5CR1A 1CE6B 2CLRB 1J1PH 3W37A 2Y22A 2J55A 1BBJA 3AAZB 1OVZA 1SPDA 4N0YL 5ICUA 1UB6A 4M7LL 1F42A 2ED6A 4PTTA 4DETA 3WJJC 4FG0A 5JHDD 4YZFF 3Q6FB 2VXTL 4ELME 5IVZA 2WQSA 2XYBA 1CE1L 3EH5B 3MACL 2MQGA 3EO0B 3CBJB 4NQEB 5CZVH 3LRSB 3SBPA 3ZIMA 5KEZA 4ZX5A 4DN4L 2XOTA 3BH8A 5DJAB 4YDJA 5K1VA 32C2A 1K6QL 2JB6B 2PCXA 4IHOA 3T9WA 4HZ1A 1UA3A 1LNUA 1YN6B 4G7VH 3V6OE 3VI4A 1X5MA 4KKBC 3FN0L 4AL8L 5JHLH 5AW7B 1J5OL 2H26B 4W9GC 3WFCH 5A6IA 3S7GA 5ECJE 4PREB 2YC1B 5CU5A 1EFXA 1UJTA 2VN7A 4X99B 4YHNA 2H9GB 1BF8A 1GYVA 1OCWH 3L9YA 1JDDA 3T2NH 5F1IB 3D0VB 1NBYA 2OJ1A 2JCCE 3VSUA 4JBSA 4M7KH 5F9JA 3A67L 3I02B 4X2UA 5IMMA 2VR4A 2PYED 1T03H 3EDEA 5C0IB 4KPHL 2FX9L 3BP6A 2GT9B 3JWNG 2ICEC 35C8H 2JF1A 3GXMA 1BVNP 4TTDD 4WFFD 3HZKA 4LLVB 3SE8L 1RERA 1KYOJ 1G7LA 4I0PC 3FTGA 4OFYD 3UAJC 4Q9QH 3SE6A 4FI8A 3P2TA 4XNUH 1MAJA 4EAEA 2NTSP 4UTAH 5IJKC 1PIGA 1ROCA 3WBDA 3NN8B 3STZA 2CQVA 4BINA 1JI2A 5A40E 3N41F 5JHDE 3QO0A 1WIOA 1DDHB 4LRIC 5G4OA 2F0CA 1NUGA 3N06B 4HPOL 2AANA 4YFLF 3OPUA 4M56A 2Z64C 3JZYA 4L18A 1ZTXE 3T4YA 2O61B 2G75A 4R7VA 1IAMA 1MWAB 2HMIC 2VZSA 3FH5A 1M7DB 4K23L 3MUZ1 3ECBB 2EEBA 4NUJA 3PP3K 2NXZC 5T3XH 3WSQL 2VR6A 3CDFA 2UUDK 4NPJA 4Y0GA 3M88A 3AY4C 1I9JL 2CDEB 4LCVA 2IG2L 1E7UA 3QQ9D 4OSUH 1M2VA 5AOZA 3L4YA 3HI1B 5FGRA 5ILTH 3BKML 3PNWA 4FCHA 1S8DA 3SKNB 2ADJA 2DN7A 5JHLA 2AJSH 1MPAL 2PYEE 4WO4C 2X9XA 4MCZA 1IC7H 2OCFD 2Y72A 3HRZB 2CO7A 4PJ8B 2JXMA 5HHVL 4A7TA 4BH8A 4I18B 4ETYA 5CP7A 2BNQB 5AVUB 4QTHA 2CJ3A 1HIMH 1FO0H 3RWEB 2C1OA 4JKKA 4F3FA 4LOUC 2VDRL 1NM4A 2XIIA 1DQVA 4ALAL 1M57B 2MPAL 3SIKA 2AXWA 4DP2X 1ODAA 1Q0YL 1Y6KR 4LL1A 5FW6A 1TVBB 4L9LB 3L1FA 4KRPB 4WWOA 3AU0A 1D5MB 1CFTA 2DDQH 3W82A 4N6QA 2PETA 3EW3B 4OTXH 3VXNB 2ADGB 3LV3A 4UTAA 1CLZL 5C2BL 4J27A 4U49A 5I1EH 3BDYL 4JFFB 2QGBA 4N0FA 1URZA 5DS8B 5D2LE 2H2SC 1KIUA 1RURL 5IFHH 2JKWA 1U8NA 1YY9D 2X4RB 2E7LC 3FT4B 5TF0A 3QAZB 5CP3H 3OAZH 4JM2D 2JJTA 1AACA 3HB3C 5EEXA 4DK5A 1U2HA 3HNVL 3MRCA 4MKMA 4KC3B 4Z9KB 4RDBA 1G7IA 2XFGB 1E4KC 3GMNB 3M07A 1PZSA 4ZAKB 1ZSDA 5EWIL 2W0PA 1WGVA 3WLBA 4D8PA 3E6HA 3UERA 1JZEA 2F7OA 2P24A 4JFTA 1JNNL 2JJWA 3GBNH 4D3CH 3NA4A 4RBPH 1BCIA 1LK3H 4XCYA 5I5JA 3ULUF 3OL2A 3MLZL 4CC0A 1A6ZA 3U4EB 3D33A 2EDMA 4MNQE 4YHZH 5EIIB 4EE2A 3KPSB 3D48R 3V0VA 2NW2B 2DQGL 4IM8A 2TAAA 3GSWA 2WZ5A 5JLZB 2KUTA 1PZ5B 3KMDA 1FO0A 3O6KL 3S5ZA 3C6LA 3HPJA 2LU4A 3RWFB 5EV7A 2GW5A 4PMEA 3VFSA 5AKVA 4L5FE 1ESOA 1PDKB 4GQZA 4PJBE 1S7WA 4Z7WB 2DQJL 1R3JA 3C08L 3N2JA 4KMTH 4FMVA 2AFNA 2WBJC 5J7CC 3ZIYA 1F3DJ 2YBRA 1DYZA 4ZSOB 2Y69B 1I7TA 4U3SA 1UZ8B 3WOVA 2E6PA 7FABH 2QFPA 2NY5L 3QHTC 2VQTA 2V2WA 4JG0L 1BQRA 5F96H 1OP3H 1P7QD 1TMCB 3T3MB 1AQDB 2BSBA 1I7ZA 4PJCE 2F1EA 2WLLA 3MMEB 4C4UA 1OF0A 4O2FB 3BAEH 5CP3A 5ES4B 2F8XC 4EO5A 1I1AC 2WXFA 2LFEA 3DHJA 5AW5B 2OK0L 1OTTD 3F7YB 2B1OA 4PRHB 5DGQA 4A2GA 4KITB 4EZLA 2AZAA 4L1DA 4X5RA 4X0KB 2PO6C 1EDQA 4QHKI 4GAAA 4Q0XL 1HE7A 4PWFA 4TLKA 3F7QA 1E65A 4FZ8L 1KPVA 5BZZA 3DX9A 4ZX4A 1EBPA 1SEQL 3AB0B 5FCUL 5IREA 3VXSE 1QATA 3HLKA 4I0PA 5C0ND 3B7SA 3UAJA 4X5LA 2NY4B 4V33A 3BHBB 2EE2A 4BZYA 5I8EB 1QSVA 5IJKA 3L6FB 3QWRA 3CFIC 1L5GB 5BO0D 3RLSA 4ZX3A 4GBXD 1KIPB 4OF3A 1N4XH 3JWOH 3FQTB 4GQ9L 4J12A 4LRIA 5KUMA 4PCTA 3CPLB 5A6LA 1MXGA 1WA1X 1RI8A 4AGPA 2GTWB 4G6AD 2Q3XA 3ARSA 1S7TB 3DX3A 3QGVA 4NQDA 1LO0L 2WXKA 3O6LH 4RMWA 4S2SB 2Z1KA 1ZS8B 3WUZA 2EICA 3AFLA 1JZHA 4GP5B 2PTTA 2X89D 1KCSL 3CFEA 1MJ8H 4FTVD 4P4KC 5FIEA 3DBXA 5FA4A 5JPNC 2YUZA 4AGOA 1UATA 4AUYA 2NY1B 3QORB 3AY4A 1NCGA 5GS2D 4A38A 3GSNB 4JRYA 5ETUA 3V4LA 4DVRH 2WKOA 3SBRA 4HK3J 4LFHG 1P7HL 5J3HC 4OD2B 1MJ7L 1D9KC 2YFNA 3I9AA 4AIXA 3O2VL 2MSPA 3ARBD 3FCBA 1UT1A 5MI0C 2JTDA 4WO4A 2FCBA 4WI6A 1W72A 2GTZA 1XXFC 3FB6B 5DZVA 3U36A 1KNOA 2QTEA 1P5VB 4F2EA 3F5WA 5K1JA 5LN4A 3KLAB 5SWSB 4XPGH 4K55A 3UPCA 2LHAA 1R0AL 1A1MB 3X1FA 4M1CD 4MAYD 1OGAB 1FYHB 3IU3B 2CALA 4GO9A 2FECL 1A14L 3V9EA 3WIFB 4FABH 5IM7A 4XBPB 1PVHA 3L5WB 3OKKA 4G9FA 3L3JA 2R2HB 3OMNB 3KHOA 3OWRA 4GSXA 3GRWH 1PZ2A 5AVWB 2WLZA 3KH4A 3V4PL 4JMXA 5D5MA 4FTVE 1GGBH 1WJ3A 3NQKA 2WY3B 1A0QH 5JR1L 5CN1A 1DZ0A 1UCTA 1L0YA 5B1AB 3C5ZB 3QPKA 1ORSB 1XV8A 2FJHA 5T1LA 3R7QA 3U0TB 4J3OD 2HRGA 1E8ZA 1U91A 4GFTB 5D1XD 2ZPKH 3ZVVA 1E4KA 1SXCA 4P2QB 3TVMC 3OC8A 4H20L 4XZUA 5IV2A 3CSBA 1O9ZA 5IMKB 3FFCA 1B4LA 3VGEA 3VH8G 2W65B 5FFGA 5F1NB 5TGBA 3NIGE 3DDGA 5LXGL 3VA6A 5BS0D 4KJWD 4DKEH 1TQWA 4MJ5B 2Q2EB 4P2YA 5BOZG 3F6JA 3Q3GB 3VDAA 2WNKA 4G6JH 4UIKL 1IFRA 1QPXA 3RVUD 3PPEA 4YHYB 4G72B 4ZO6A 5JQHC 1IL1B 1QFUL 2EIDA 1U8CB 2VDML 5D8JH 3UTQA 4DQOL 1DSYA 4N4YB 2YUVA 3V0JA 5CJ8A 4DGUA 4LQFH 4PVBA 4Z7VF 3VFWA 1QW9A 2Y7QB 2ZKHL 5L4MA 2WWNA 1EMTL 2QV2A 2J44A 4HKBB 2JKXA 3ECQA 2RFXB 3DJZA 1E5BA 5HYJD 4GB9A 3WNJA 2FB4H 2NY0B 3H0TB 4GO8A 4LSQL 5BXFB 2ZCZA 4OT1L 4AWJC 3KE0A 1XH3A 5C0AA 4NZJA 3GMLA 4KAQH 3WUWB 4W9CC 3GRWA 4PJGB 2FIRT 1B90A 1KYOK 1QHPA 2XRAL 5FUZH 3TWYA 4JZJB 4ZW8A 4LLWA 3VD9A 2WBKA 3IF1B 2LTQB 4M9OA 1CU4H 3QJRB 3C8DA 3NDZE 1RV6X 1I1AA 2XI9A 4MQXD 5D1ZI 4LKCA 5IIEB 2ESVA 3MXWH 2EP6A 3MLTB 4NOFA 4W68A 5BS0E 2R1XB 5ANMA 5JIIA 3UACA 2O5XL 4HGMA 2PO6A 1T0PB 2VOTA 5IB4A 4HT1L 3FQWA 4KKRA 3HE6D 2YAEA 2HT2D 2UZYA 4FQ2H 1DJSA 3MNZB 4D0DA 1J5IA 1DDTA 3LKSA 2VMDA 4Z6AT 3ZX1A 4Y4HA 4ISVA 1OAJA 4W6XB 1ES0A 1NFIB 2QADC 3RWGB 4HWBH 1IGTA 2DJSA 3DRQB 2ITCB 2VZTA 3N85H 3VXUA 1MI5D 3KPOB 4MNQB 4JPIB 5FDYA 1WVZA 5EDSA 3M7OA 5DRWA 1YN7A 2FQEA 5HYJE 2BC4B 3NOIA 3RVVD 4XR8C 3X13A 3NCJL 1PF3A 4LKXA 3P0YH 3JT2A 3WTSA 1V3JA 3UYRL 4PJIB 1LO5A 4NENA 1MCCA 1S5HA 1T6BX 1KXTB 3GD1C 1BQHB 4MVBD 4NZUH 3MV7E 1FA4A 4KX9A 3E9TA 4QRQA 2V5YA 1QLFB 1YRKA 3U2IA 1TFHA 4N90D 1TO5A 4HJJH 1TQUA 4JM4H 5FM5O 3BQUD 5DUPH 5C0JB 3G04B 1U2CA 1AC6A 1D9KA 5JPMC 1NEZB 4NJ9L 4FL4B 1S9VB 4HBCH 5DJXB 3BGMA 3NEEA 3CZFA 2J8UA 5HGDB 4AGMA 4LDLB 4GKOA 4EI6B 2YWYA 3SKJL 2EE6A 4WENB 4WKXA 3BZFB 4GUPB 5KSAD 4GW4B 1OW0C 2R0KH 1N10A 2A1WL 3HA0A 4ZPVB 4GT7A 3WFBH 2VDQB 5F7FA 3PHSA 4CBPA 2J88H 4GKLA 1R3KB 5TH2B 4H26B 3NEOA 4MJHA 4V2CB 5BRZA 2WWMD 4YNYA 2CK0H 2BIQA 2GHZA 1MI5E 3F6IA 3Q8EA 4WY7H 2NRDA 2WTRB 4KUZL 3UC2A 3WI9A 1NZRA 4AM0A 5F2FA 5HHMB 1Z5YD 3DGDA 1MCQA 4M6NH 3RILA 1QI4A 2XZQL 4HWBA 5DHDA 1HXMB 5GGSB 4NRXB 4F58L 3S34L 3D07A 1YNTF 4N2BA 5GS1A 3LY6A 4XNQB 3ABKB 2FH8A 4UTCA 3QRLA 2W94A 2F61A 3O3EB 5T3ZL 3VXTB 4KJYA 3BP5A 3N04A 3BSGA 3UBXB 4N90E 4AKOA 1UD6A 4MNHB 5C0DA 3TVMA 4WUUE 4E41E 5LAPA 4OF0A 1KYFA 2QGDA 5D7SL 5T1MA 3EYOB 2DYPA 2CO3A 2AI0L 3BX7C 4NO2A 2BSRB 2XIDA 5CM1A 3OQRA 4XP9H 4Z5RA 1CTOA 1JAEA 2EKSA 4I88A 1ZV5A 2E4TA 1ZJBA 3DURA 4J1UB 2IPKB 3AU1B 3RY6C 4LT7A 2M83A 3WMQA 1NFAA 3D0LB 5MEOA 1IM3A 4ZMWA 3EDKA 4NGHH 1YMMB 4OLEA 4QGTA 2D0GA 4ZMVA 1EX0A 1TITA 3CWGA 3TBYB 5DLML 1RZKC 3B2UD 3SDAC 4HIIB 1E3ZA 1S9WB 5MENE 1R5IB 4QCIB 4ENZA 1AR1B 2CHXA 4HETA 1DVYA 5LUMA 2CPCA 5HYFA 2C34A 3C60B 4R26H 1FHGA 1L0XA 4JO4H 2YGPA 3JV4A 2B77A 4GW1B 4UQ3A 4K7PL 5HHXL 1N3NA 4RETB 4LARL 4XI5C 4RAVB 3ES6A 2BP8B 3LKOA 1CPUA 5AYUL 1R47A 2XVLA 3QVAA 4RGMB 1F56A 1G0XA 3D4CA 1XGPB 3TJHC 5MEQB 4KZEL 3VXPA 3S35H 4QHKJ 5C08B 4UI2A 4U6VH 1NPJA 4QRTB 4PV9A 3AG4B 1TKWB 5I16A 3Q48A 4JFDB 4JFEA 1WBYB 4PRID 5J89A 4B9IA 2QEJA 2XNAB 1E6OH 3UTSB 4PLJD 4NZFA 4D9QE 1JF1B 4EJ1C 3EDDA 2QGEA 3CZUB 3LDBC 3EG9A 3MRNA 5IVXB 3PHQA 1DVFB 3OKNA 2N0KA 5DZAA 4HUCA 4NQSA 2EVFA 1RMFL 4MDRA 1GJIA 4PJEE 3WU1A 4PJAB 3TONA 3ET9F 4U6XA 5F97E 3RAJH 5KS9B 1OAKH 3WEXB 4IJ3B 1MZYA 1Q90A 1AQ8A 2XXMB 4LLUB 3MYJA 5FFLA 5FXCH 2D7TL 2EZ0C 4BFIA 4R7XA 1FVEB 1WWAX 4MHHG 4JMNA 2CH8A 4NO0D 3OXSA 4NRZB 5EBLA 5F7KC 1IBYA 1P6WA 4N0UB 4AJVA 3RNKA 1KTRL 1KTDA 1VZIA 1A7QH 3PQYB 1UD5A 1OHZA 4MLSA 5F1SA 4DP1X 4KTEH 3VFRA 4XO5A 3ZDXE 1W8EA 2GIXA 4Y8AA 4WFHE 4DAGL 3P3SA 5TQ2H 2BHFA 1B0GA 5F7DA 3PFUA 3QFDB 5HHOD 3H42H 1QO3A 3CSPA 4TYUA 3MV9D 5AALA 4Z78A 5J6HA 5I71C 3NA9L 5KYWB 1WAAF 1NM9A 2UWEB 3AT8A 5DZJA 4W93A 2CZNA 4U1LB 2APWA 3C8HA 5FYJL 3CXFA 4P3DB 5DUMH 5TFSL 3M8OH 5I74B 1JFQL 1FGVH 4EI5C 4MJ5A 2FE0A 3VI3F 1RZKH 4MLIA 5C3TA 4TL4A 3SCMB 3ZE1B 4AENB 4TVPD 3U6RA 5JOPD 2PR9A 3HC3H 1OSZA 4LIQH 4KHXH 4BEIA 3W11C 5CEZE 5DDHA 2HRHA 4G6FB 5HYSB 3D3VA 2ODIA 2AJXL 4NUMA 3KWVA 4KK8C 5HBBA 1YEKL 2C3XA 4GRLC 5CUSH 1SJXA 2BSSB 1URIA 2JKSA 3Q5OA 2W80C 3U0WL 4YX2H 1UWFA 4GMSH 1N6QH 1N64H 4ZDHB 4O51A 4BELD 5GGSY 3V6ZA 2H3KA 4XCEA 2AJYL 3ZKND 3WIHH 4L4VE 4XB8A 3SGEI 5F1OB 1RUQL 2KZWA 5GRZA 1UM5H 5CBAB 3B2VH 1I3VA 2KLSA 3MV9E 2ZKYA 4NQUA 2BNRD 3EJSA 4HIXH 4OB5H 3MNWB 3U4KA 5EO1A 1ID5I 1YNKH 2KI6A 4L8SB 5EOQH 3M7FB 5DQ9B 5L88L 1WD9A 2VE6A 3HZVA 4KDVA 3N42F 1OANA 5E4EB 3LQMA 5HJ3A 4AVIA 3QH3B 2D3LA 3BRDA 4PSRA 4GPVA 2DWSA 1EAOA 3RY6A 2X9WA 2OP4L 1XBDA 3IMRA 4TVPE 5JOPE 3MCLL 3WTTA 2EEXA 2W88A 1RUKH 4IOIB 3LZNA 5CEXB 4DERA 3HLAB 3QI9C 2LAGB 3T3PB 4DP7X 2Q6WB 3LNDA 3HI5L 3SDAA 1H3PL 4DESA 1IT9H 4HC1H 2ZIDA 4QXWA 3IJ7A 4HJ0D 3FO1A 4UT6H 2I24N 1OK0A 3G5YA 1FFPA 4ZMNA 2PPEA 1CLOL 3TJEL 2A4CA 2WPGA 3HE7C 4XNYH 5ID1B 2Z93A 5CO1A 5EDXA 2FWOB 2VIRA 1E5AA 1J0JA 3SJVD 1SHWA 3ARDD 2Y23A 2IQAB 2N4IA 1KXQA 5FW8A 4F2MA 4PY7B 3AGVA 1MVUA 1QFWM 3DV6A 4G70B 1IJNA 2BNRE 2EYSB 3LXUX 1TPXB 1UT9A 1W0VB 1IFGA 4HS6B 5CMAA 4U05A 1UWYA 1HWHB 1IFHL 2OL3L 1E3XA 1LO3L 3QDGD 4G1EB 4MJ6A 2VDRB 4X5QA 3RWIB 3ULVF 3PXHA 3APMA 3IFPA 3WIHA 5GS0D 1KGXA 3TT3H 1DANT 4RZCB 1PAZA 3FOLA 4Z8FH 4ATWA 1WIPA 2EH8L 3H3KA 1X5HA 3FCSA 1A7NH 3C6SA 3H7BB 4WUUB 3V55A 4E41B 1IZKA 2Y7MA 4CN6A 2GC7C 3OG4B 3QDMB 4G8GD 2FJGB 5ENWA 1NC4A 1PY9A 5F6IC 3OC5A 4QPEA 2ZXEB 3UH8A 4DOHE 3ZTNL 5CKGA 5DZOA 3W81A 4LCCB 4KZDL 1RUAL 4QWWC 3ALPA 4PV8A 4U1NB 3KLHD 1RP8A 4OI8A 2YMTA 2ZOTA 1VCBC 2NUPA 4GT0A 1FG2A 1JZ3A 1E9OA 4WSJA 2MOVA 3ZKMD 4Q6IC 1BEXA 3ZMRA 3G08A 4HC1A 3SJVE 2DLFH 3WTUA 1DVXA 2P5WA 5EEVA 2EDHA 4UT6A 1NCWL 1G84A 3RZCC 1GC1C 3LS4H 3CX5K 2X4UA 1BDYA 3IJSB 4G80B 4PCSA 4JHBA 3SDXE 3PDDA 4OFDA 5IKCA 4PR5A 4JB9H 4WDIA 3LXBA 4GXUN 8PAZA 2NZ1A 1ET5A 2XVKA 5HDBE 1V7MH 2EO7A 3QCTH 1I85A 4XBGB 2EDOA 3GHEH 5EFIA 2VYRE 3NJXA 3QDGE 1QACA 1KCVH 3ZO0A 5L8KB 4HEPA 4KI5D 4TNWK 4JO3H 2ZP8A 3N41B 3UTTA 4YHLL 1Q72H 4F7MA 3SDDD 1FNSH 1LQBC 4CILA 3DVNA 4HIHB 4IKNA 5H4ZA 2ZNWA 4NPKA 2D7MA 1TETL 1VLXA 2QPUA 2ZUYA 2BINA 3LRHA 4XMKH 4E0RA 4ZUSA 2FJFA 4KFZC 3WN5C 3A6CL 4DPAX 4MTMA 1EJFA 4PG2C 4YHMH 5EZIL 5IZ7A 4OM0L 2E6JA 4X7SL 2LVCA 5EB9A 2V2XA 4CVXB 4EI5A 1P4IH 4HAFA 1H0DA 1IQDA 1KN4H 3FZUD 3MLVH 4CMHB 3HPLB 3A22A 3VNZA 3PUCA 2X4NB 3UO1L 1N2RB 1NIBA 1KCWA 3ESOA 3A6BL 4QXUH 5KVGH 1JPGA 3APNA 3VXRA 2V8LA 1CBVH 3NK3A 4MBRA 2Z0UA 4C56D 4YWGL 4GRLA 4APXA 2HFEB 3ELQA 5FOBB 2X0UA 5KTEL 1FZJA 5KW9H 3S36X 1E5YA 3BE1H 3NGBC 4HIJA 3VI4F 4NWTL 3K6SB 2HA1A 5D2NB 2B15A 1D3CA 4G82A 4X5PA 2ENJA 5DC9B 3SODB 1AH1A 3ULVL 1BLIA 3DYMA 3GWJA 5DMYA 4ZTPL 1MXDA 4TMPA 1B4JH 3U2SA 4KI5E 2X7LB 1H8SA 2KBGA 3ZGIA 2J1KA 2FX7H 3JQOB 4QTIH 1AFVH 2G9HB 1LE9A 3I75B 3HUJA 3T77A 3RA7L 1WV7T 2RCSH 1AGFB 4WF7A 3H56A 1HH9B 3AREA 3WNNA 5A2KH 5DUBA 1LMIA 5FO8A 2FJSA 1PMYA 2VXVH 1AO7B 1QUNB 2FYYA 5EHFA 3KJ4B 1B9ZA 4M1DH 3GSXB 2GUYA 2KZ1B 3T65A 4CADA 5DT1H 2WLIB 5AOLA 2CBQA 1DL7L 1EIBA 3BQVA 4JHVA 4GMTH 1CFVL 1JGVL 5C0CA 1W2KT 3A47A 4Z7QE 5H94A 3L17A 4P0DA 4BCXA 4J2XA 3QI9A 1UM6L 4YUEH 1RPQA 2WSPA 2EIZA 3QEUA 2Q86B 2MNJB 2PW1B 5CSGA 3V0WH 4C56E 4EDXB 1B4RA 1Y0LA 4AH2A 3EFDH 3WKQA 1UXSB 4JHWL 5D7KD 1GC1H 1B6DA 2A83B 3MLRL 4TVUA 5KSUB 1C08B 4LNRA 4GI9A 5M95B 4WWKB 1N6UA 3H7LA 4V2BA 1G4RA 3U1SH 5SX5K 4HK3N 3B34A 3G5XA 4YQXH 4MQ7B 2IIJA 3T6VA 3RI5F 5A2IH 1IM9A 4YS4A 4WWID 3OG6B 3OHXB 4IIQC 1QLRA 2FNWA 2IH9A 4G6KL 1XWVA 1GCYA 1RPKA 3P3RA 5IMLB 4F7TB 4L8CB 5AZEL 1E4XH 2GEEA 1KPRB 1E28B 1ZE3C 3Q9QA 4PJHA 5DEGB 3FU8A 3BKCH 4UIMA 4UQIM 1BMGA 3K3QA 2AJ3A 5J06A 4YPGA 5FGCE 4RQQA 3V4UL 1HOCA 4PMFA 1WQVT 2MHAB 4IGBD 5ICZB 4L4VB 3IDGA 2HTKC 1GGCL 2NNCA 1N18A 2NXYD 25C8L 4P23C 4XB3A 3RTLA 2GSMB 3DX7B 4Q8BA 3IJYB 3TZVA 4XP5H 1A4KA 4PI0A 2NNAA 4XN5A 3R8BB 3VFUA 3VD7A 5KJ7E 1NBCA 1M71A 3N50A 1H6TA 5DRXB 1B2WL 2VC2H 2D9CA 2IGTA 5CZXC 3PAUA 4Y19D 5FYLH 1NGWA 3V4PB 4E42B 4E9XA 1S7RB 1TZOA 3M17B 2BLFA 3PL6A 2GY7B 3LZFH 4BKLB 3CGTA 4F37K 1I8KA 2AQ3A 3IMSA 1UWEL 2F7IA 5L7XH 5D7KE 3DX4A 2VXSL 4X80H 4Z7AA 4RMTA 2EVGA 2B59B 3ARQA 3HC0B 3DTDA 3MRGB 4Q6IA 4WJ5B 3HHSB 1YUHA 3RUGA 1V27A 1S7SA 2WGXA 4XHJC 4PGCA 3RZCA 5CILH 3RBSA 2IOMA 3HBGA 3QO1B 1HYSC 1VEMA 4AK2A 1GZQA 1Z5LB 5EEUA 5E6ID 4FFVC 2C9AA 1FL5A 4NBXB 5DHMC 2XWRA 2C9UA 2H5UA 2BNQD 3GBMH 2VZ1A 2XWJB 3P11H 1B0IA 1G7PA 2IFFH 2VDMB 1JGDA 4G8FB 3TEXA 2DBLH 3C2AL 4Z76A 4KO7A 4YXHH 1E0OB 2WCPA 3LKQB 4PJ5D 3WN5A 2ZNXA 2HWZL 4UNTA 4PG2A 3ZKSD 2KDYA 3KPNA 1XL6A 2YPLB 3P30H 3GMRA 5IGXH 3LPFA 1RJZB 4Y19E 2OI9C 2YJLA 4QKXB 4UQ9A 5J6SA 4BIKA 1WC7B 3DYPA 2HT3D 5E56A 5INDA 3PRZA 3STLA 3PGDB 5BRPA 2WVTA 5CSZB 3VQ1C 1BVLB 1S78C 3F64A 4HFWA 2F8VA 2WQXA 3FU7A 5KYUA 2HP4A 3T8VA 4N9GA 5CKAA 2WUBH 5CZVL 1F6AA 1TQBB 4XN2A 4M7LT 1N70A 2OZ4H 1GYWA 3ZUCA 1F11B 2VL5A 2CIIA 4QJ3B 3M1BB 2MMXA 3E6FA 1BFVH 5C71A 5IQ7L 4G7VL 5CJBA 3OKDA 2DYRB 5DMIL 2GEQA 4ZAKD 1JTTA 3P02A 4XGZB 3WFCL 2J8HA 1MFVA 5GGQH 1ZE3H 3P9LB 5EF1A 2EXYD 2O4EA 4JRLA 3RTQA 4CC4C 5JIMA 1D2PA 1HU8A 1FNAA 2EDTA 3AXLA 4IRJD 4R5TA 4M7KL 1OCOB 4Y4KC 5CJQH 3SDXB 1Z9SB 1T03L 3MRLA 4LP5A 4PGBB 3VDCA 1NIFA 4G59C 4PJ5E 2QLYA 2ZOLA 4CKQA 3IMTA 1OAXH 3K71B 3OSVA 4ODBD 1ORQA 1F3JA 1LD9A 1JGIA 4Q9QL 5ID0A 4JVPA 4NQTA 2LLLA 3NT0A 3BVXA 3KGUA 4UTAL 4X9BA 3SYCA 2NX5D 3UZVB 5IFJA 1ND0A 3VFMA 1FRGH 4JFSA 5IJVB 1KCUL 2KZBA 4NEHB 3U9PL 4HJGA 2KT6A 1S7VB 4PGEB 4L8BB 3WYRA 3TO2B 1BF5A 1PG7X 4MMYB 2V7HA 3TBTB 3C8KA 2YQ2A 1IAIL 1TO4A 2JE8A 4WI8A 1V3MA 4NO3B 4FYTA 3TYGH 5JORB 1IIKA 5I73B 5T3XL 1XF4B 4LVNC 3QARA 4QNPF 3NAAH 1SJEB 1XGTA 2WK2A 2OZ4A 3K46A 5E5UB 4D0CB 5DK3A 4IIQA 4OSUL 1UQSB 3MLYH 5GSVB 5IB2A 5ILTL 2LV4A 2WKOF 1A8JH 4IBZA 3VXOB 4NUGH 1F1DA 3PABA 4I3SH 4XAWH 5C09B 5E8EA 1S9YA 2D4DA 4PRDB 2F7PA 3US9A 3W0WB 4Z7VB 4YK4B 2CIKB 1LJMA 3WY3A 2APBA 1HN1A 4FOMA 4NYLB 3U6XA 3TEYA 4UINH 3ESNA 1HIML 1NMCB 4F2FA 5E2UL 3EOYG 8CGTA 3H9HA 3FRPA 1GGUA 2FEEI 3G7TA 4MX7B 4QRSA 1SJVA 4NI3A 1EJOH 2NX5E 2AXFB 5GGVY 2YEZA 3R06B 1ZLUK 4RISL 2VL4A 3VVWA 4DEPB 1FV1B 3ESUF 1S46A 2BSEA 1YEJH 2X12A 3QRFM 3BEVB 3FQUA 3S37H 1MCDA 4PLKC 2VSDA 3CUPB 2C9XA 4Z3EA 3LEYH 1MG3C 3AJ7A 4P57A 1J8HE 4FA7B 1XIWC 1DFXA 2FIKB 1EQWA 4FXKB 5D5MF 4BK8A 4NBYB 5HDLA 1N9PA 2X1WL 2NY1D 3P73B 1SLXA 2O6FA 4OM1L 1IGIH 1E4JA 1YJDC 3OSKA 3RWCB 1ZPUA 2F6AA 4LHJB 5FK9B 3EGXB 1KC5H 3MBEC 3KYMB 5J6GB 3IDXL 4KKAC 4AX3A 1SYVA 1IBDA 3FFDB 2ZX7A 2GKIA 2TSAA 1XZ0A 3DIDA 4JDEB 1T3FA 2K8QA 4QTFA 3TBVA 4CRPA 1IC4H 2OMNA 5D96B 3GBNL 4U6YA 3QUZB 4MA8H 2VLJE 1LK3L 1ZY9A 5SWSD 5AVTB 1DUZA 4LHUA 4D2NA 3MV01 4GRMA 4IS6A 4OGZA 1W0WA 2XU9A 1AS8A 3P4MA 3O8XC 4Q52A 3ZL1A 1WFTA 4DPBX 2DKMA 3PJNA 4PRPA 4YHZL 1X5YA 1G1YA 3HVNA 4HEPG 4XBEH 4PJDA 1JE6A 2X9ZA 5FGCB 3O6FB 4I85A 4QKTA 3FOMA 3LZQA 1JXKA 1A9BA 4TUJB 3UJIH 2HUEA 3ARUA 4DF9A 2GSIA 1U3NA 4P46A 3VFNB 3GKWH 3K0YA 3TO4B 2K4WA 4OGYH 5DD1L 1YNLH 2PN5A 3TWCH 3NIDF 1WZ1H 3GZPA 1CDBA 7FABL 3CFDA 3KPRA 3TOPA 4E9QA 5BV7H 4NT6A 3UTZA 3UDWA 4RMQA 2XWCA 2ENQA 1NEPA 2VM3A 3LZPA 4IMLA 5GGRB 4KK9C 1KCBA 5I1KH 1J0ZA 1BF2A 5DCCA 2EXSA 1W72L 2JQZA 4CC4A 3PDOB 4B60A 3EJPA 4FERA 3FTSA 3CU7A 1ZA6A 5CD5D 3IGAB 2XTJB 3VSVA 3MKKA 5I5MA 1OT1A 4OZIA 2OV0A 4MCYA 2F8OA 3LQAC 4OJAA 1UOVA 5T5FH 2B14A 4PJFE 3TV3H 5EULV 2GBAA 1U8OA 2QFRA 3MBWB 4ODWB 4PV1C 4ESKA 1K3ZA 4G8AC 4XNZB 3VD4A 1GH7A 4U1GB 4V1DA 4HDIB 1YNTB 5SWZA 3WD5H 3UROR 1T7ZA 3GSOB 4OCRL 3ROOA 3DX6B 5FCSH 3NSCA 3OKEB 1FNHA 2NZ9C 3U30B 1N4XL 3JWOL 4DO4A 1MIML 4HVBA 5EU6D 2ZXDA 2JFCA 3B8SA 3JBG7 3MCG1 3EF4A 5I8CB 1FNEB 4YEFA 3O6LL 3PHOB 4KTYA 1YJDH 4L3FA 4A7QA 1CXEA 1QBLH 1ZD6A 5FUOH 1MJ8L 3MQIA 4F8QA 1DANU 4ELDA 2ZOKA 5DURD 1Q0XL 3V10A 4JPSA 3CVHB 4TKWA 5DHYA 1MZZA 1J10A 2Z8RA 4M4PA 2C3VB 3WHE0 1BP3B 4QD2E 3L3IB 5FB8A 2RTTA 3FCTA 1DJIA 4W70A 4R90H 4IOSD 1BQSA 2B5IB 2X6AA 1KGWA 4UOW1 1WAPA 2NY3B 4K71B 3DVFA 4P9HC 4MA3B 4WW1A 2OSLA 5AFAA 1P2CB 3JV5A 2VLKA 3N43F 3KS0H 2JKNA 3CDZB 3VE0A 5K9KA 1ZS2A 1D7CA 4I3RL 4XPGL 1OP4A 3DMMB 5HGBA 3LH9A 5AENA 3HN8A 5T5FA 1BXVA 2EIMB 1IB5A 1D5BB 2HAZA 5I1DB 4X7FC 4JDVB 1OEZW 4AK1A 3QIUC 3FHEA 3F7VB 4PJ9B 4CN4A 4P3WA 5EU6E 4QDGA 4M3KB 3DIFA 2MEJB 2DM4A 4S1QH 5DS1A 3UAEA 4FABL 3IDIA 3IS0X 2F19H 2A77H 5DVNA 1PLBA 5FGBA 3KCPA 1EZVX 2DBJA 3GRWL 3FT3A 2GBVA 3CH1A 4U1MA 1MHEB 1U92B 5HDRA 4EZJA 1A0QL 1E43A 4JKPH 2ZUQB 4HLEA 4JFPB 1BIIA 2W60B 5EBWA 1JPSH 2XPGA 5E08L 1KB5B 4OCXL 3VAEA 1E9QA 1Q9KA 4LCWD 3MBEA 5D72H 1LL1A 5I0XA 4GUQA 1FE8H 3LQAH 1MNUL 5FM4A 1SOQA 4JGUA 2W9DH 1NCTA 3SO3B 2P46B 4QRRD 4N2NA 1ILSA 4OUUB 4QYAA 1AR2A 1CF8H 3QIWC 2FDBP 4DKEL 2IFGA 1UZ6E 2V3EA 3GSVB 5I1GL 1M1XA 3QIBB 4KWUA 5HYQB 4PJ7E 5BPPA 2HKFH 2KC0A 3NCMA 4IKIA 4ZJ9A 4G6JL 4EDWH 5IESH 3NDYE 1HQRA 2OJEA 1S7QA 1D7BA 5ACZA 5FECB 4UMGA 4Z77A 4U7SA 5D8JL 4ZUUA 4U1IB 1CLVA 3KL5A 1B9KA 2PCFB 4JFUA 5KVFE 3B1TA 3CIQA 1EVTC 3ETSA 3KM1A 3R18A 1MY5A 2G5BB 1VB9A 5CLYA 4LQFL 3SDYH 2QQNL 4X4XB 1YG9A 3LEXA 4F5CA 3GLAA 3QNXA 1QFPA 4HW6A 5CEYA 4KHTH 3DSNB 3B2MA 5I1AA 1ZXKA 1XSOA 1J9TA 3ARGB 4IBSA 1HI6A 1KELH 4K7PY 1ASPA 1XT5A 1EXHA 2FB4L 1G9NC 3CVBA 5AZUA 2FLMA 4IHBA 5F9AC 4EIGB 3ZHLA 3KBHE 4KAQL 2VNCA 2H2PC 5ESQB 4DVBA 2ZAHA 2GJ6B 4FHBD 2EKJA 1IBHA 4LCWE 5FUZL 1J8HB 3MGAA 3TESA 5HHNB 2LW3A 2AVFA 3VI3B 4NNYB 5I1HL 1A3RH 2A4EA 3QPQC 3VG9B 3U25A 4J5VA 3D85D 2IGFH 4QRRE 5GGRY 3BGFC 4FCAA 5GZND 1GMIA 1ED3B 1X5XA 4UCFA 1AKJB 5D9SB 2VJXA 4KY2A 4N5UA 3FQ1A 3V5DA 3WXWH 2YBGA 2I25N 5E94A 5HPMB 5I17B 5I0DA 4ONHB 1G5AA 1HHJB 2GI7A 3AS3A 3TN0C 3D87B 1HEZB 5LGHH 3B37A 1MJUH 4FQ2L 3ZU8A 3MRDB 1YMMD 4U0RC 5KVEE 5A2BA 4NQCD 1JTPA 1UOKA 3KAAA 5BJTA 4GAJH 2YRPA 3OAUH 2EIBA 3QQXA 4DGVH 1NCDH 4OGAC 2ZCLH 3QULA 4FD0A 3ZE0E 5EZOH 1BBDH 2K6WA 1T21B 3BP7B 4LZKA 2PTUA 4WFGE 4NKMA 3F62A 1ACYH 1N7MH 3L4UA 4P2OC 3EYVA 1MW2A 3RHWF 1BOYA 3N42B 2L7EA 3VFVA 3NJGA 1FJ1A 2DMGA 3CVIL 3QC6X 5LHDA 3S9DB 3DTUB 4NZUL 1MCPH 2VITA 3HOGA 5I2IA 4MMZB 1Z7JA 4TRPH 4JRXE 4HJJL 4JFDD 4JM4L 1EHAA 2BX5A 4HOWA 2PXYB 2XWBA 3RVXC 3F84A 5DUPL 3O4LB 1SBSL 3Q6FA 1MWAH 1EO8H 4HBCL 3P4OB 3TFKC 3ARFB 1TTGA 1DVFD 4K8RL 4G7YH 3MR9A 3BUBA 3FQNB 4MZ3A 1YYCA 4M8QA 3BPNC 3QEQA 2R0KL 2D2CC 1PNDA 5DJAA 1QSFA 1KBGH 1FG9C 3HBPA 4NQCE 5AWNL 2F53D 4G43B 4J6RL 3WFBL 7PCYA 1DBBH 2AV7A 4Z0XB 4RIRB 2L04A 4PWGA 2J88L 4HEMA 4HUKB 4MQSB 2H26A 5C92A 3QXDB 3KG5A 4PREA 1DJHA 1FZKB 4UYQA 2CK0L 1FFNB 1Z3GH 1IGCH 4X99A 4ZFQA 3FRPG 4TNFA 1G9NH 5GRYA 5F1IA 2P45B 3D0VA 4JFWA 4M6NL 3NUKA 4CSPA 1BA9A 3PXLA 3PQYD 4K3JH 1R5WA 3KWWB 4MD0B 2OW7A 4C4KO 5I5IA 2ATPB 5E4OA 2XA8H 4LLVA 4HHGA 3LKPB 3T71A 3T4AB 1KT2B 4Y1AD 1R75A 1BYPA 5JOFB 1MW1A 1XCQA 1UJ3B 3TIEB 3NN8A 1BJ8A 2P7TA 4AGNA 2X6CA 1UD4A 3ZZ1A 1T89C 4C55A 3D4GA 4A39A 5GRJL 3LN4A 2CR0A 2EDRA 2VDKH 1JZ6A 3PCYA 3KBPA 3GLEA 3ARRA 2J72A 3MRKB 4W6WB 1IRAY 1PCSA 4WEUD 1OAQH 3N44F 5L9DH 3INUH 4PRBB 3QIWA 3MRHB 2HXAA 4X7TA 5KYXB 2EYRB 1GKOA 4UOQA 4AQEA 3QYNA 4XP9L 2AV1B 3V5KB 4TN9A 5FO9B 1N26A 1GS6X 1MWAA 2F53E 2X09A 3BUIA 5E9DD 5INCA 4X4ME 4X9YA 1MAMH 4M00A 3ECBA 1O6VA 3MBXH 3W9DA 2BHYA 3VH8B 1K5NA 4NGHL 2CDEA 5KG9B 1E8XA 4G6FD 2ZWZA 3RPIA 4K5LA 1A1NA 4LHUG 1R9FA 3RDTC 5B7MA 2NLJB 1NCHA 1VACB 1AOZA 1N5YH 4D8OA 1TZ8A 2H47C 4HV8B 3V6OC 1Q38A 3WHE1 1Q4NX 2X6UA 4Z7OE 5C0GB 4R26L 4B96A 3AITA 5L2JB 4YPJA 4JO4L 1T1YA 1NCIA 5C6TH 3U9WA 4HK0A 2P52A 2V4LA 1UVQA 1XF5B 3BYTA 3TH2T 4N86A 4KJPD 4D94A 1IQWH 1G7HA 4NO5A 3RWEA 1AOHA 4Y1AE 4XN8A 1SXSA 2QSVA 4NUPA 4NXKA 3MJ8A 2BVQA 5JIQA 2B3IA 5E1GA 5L4JA 2OMVA 4DWHA 4DKTA 1BBJB 1EUUA 4N2HA 3S35L 1DN0A 1UADC 4FLQA 5C0EA 5KSBA 5IY5B 4ONGL 1UB6B 2DIEA 3CXHJ 4RFNB 5FM8A 1D5MA 2ETWA 4OQ1A 2NUTA 1FQ9C 2MQ0A 1ZLDA 4NJAL 4ZNEA 5DMKA 5IVZB 4LLQB 1E6OL 4KBPA 1YYMH 4B7LA 2YUXA 1NCAH 4ZS7L 5E9DE 3MYZA 4NN7C 1AZUA 2WMPA 4WUKH 2GAZB 4IHOB 3KLDA 4AV4A 3UP1A 3ZK0A 1LNUB 1XFPA 3VI4B 4IMKC 1WZMA 4FFYH 2CCWA 5IT2L 3RAJL 1X4XA 1EHLH 5DC4B 1OAKL 3P2DA 3GMNA 1WLHA 4Q7DA 1EFXB 1J9QA 4N6RA 2D3VA 1PLAA 1QLEH 3HG1E 4LQ1A 3I6LE 2O6DA 5IROA 2EDLA 4YHNB 1Y6MR 3QUYC 2ITDA 2D7NA 5C0BD 1NBYB 1VDGA 1YAIA 2NY6D 3O2WH 4PBWD 5F9JB 4H13C 4JL1A 1EUTA 3D50A 3BP6B 5CJOH 1IGFH 1IIIA 1A7QL 1HXYB 3NFSH 4P2OA 4JG5A 3K72A 3CBKB 3KYOB 2VDNH 3HZKB 3U4EA 4UDTA 4WW2C 4JCMA 1DJWA 1G7LB 3DHPA 4AQZA 4RAHA 4TOYH 3GK8L 4ZMOA 2FTAA 5TQ2L 2VM4A 2VT0A 1PZ5A 1UUSA 1XQ4A 4BH7A 2AXGB 3S2AA 3GS0A 4GXFA 2AEOA 2ZT9C 2DI7A 3H42L 4POYA 5JA9A 4LOVA 3O2DH 3QO0B 3CXDL 3ETBJ 3B3IA 1PDKA 4M6MH 1YVLA 2BHZA 3LIZH 1ZDSA 3BIKA 4Z7WA 2Q10A 2FGWH 3QJTB 5B4MC 1GOHA 3EH3B 4YVNA 3ESPA 3QDMD 3T4YB 5MHSE 3M8OL 3PP4H 1T0OA 1UZ8A 3GSNH 4FMFA 1ADQH 4J3BA 4NUJB 1Z1WA 4QRFA 1G87A 3H9SD 4CW1A 3GMMA 4K3DH 5BNXD 1SXBA 5DHEA 4AVKA 2WNGA 2H45A 4U7KA 1LDPH 1M2VB 3CN0A 4LIQL 4UM9A 1JWMA 3KW7A 1AKPA 3EYQD 4R6UA 3PNWB 4WO0A 5C0BE 1QTPA 2ADJB 1MKFA 4FFYA 1NUNB 2IH1A 5I30H 3QQ9C 4A7GA 3D69A 4M9PA 4J3VA 1AAJA 4BH8B 2CO7B 4ZW6A 2YD8A 1E8WA 4X6BA 4BFBD 2ZX9A 5CP7B 4APQC 5DA0B 3ZE0B 3LZRA 4YEEA 3CSYB 3RIFK 3VD5A 4GMSL 1N6QL 1N64L 5JIKA 5C07A 2P80D 3LTVA 3QC5X 5FA3A 2DLIA 3WIHL 4CKVX 1XEDA 1UOWA 1YUKB 1U2YA 2UVEA 5I8EA 3L6FA 3QFJD 3R1GL 5JIPA 3DWTA 5IBUG 3BP4B 2CXKA 4IU3A 2XKNB 1T89A 4HIXL 3NIFF 4OVUA 4YDNA 3O3DB 2HLFD 5I8OL 1CFTB 3NMEA 2J57A 3P9WB 4R97C 2CHWA 3CNKA 5EOQL 1P4LA 3EJTA 3LV3B 3OVUB 2GTWA 4X6DE 1Q1PA 1S7TA 3F12A 1XGZA 3BJ91 3O2DA 5ISZD 3FNKA 1KIUB 1IE4A 3LIZA 4N87A 2G30A 1ZTXH