2MH4A

Solution structure of the big domain from leptospira interrogans
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
92
structure length
92
Chain Sequence
MPAALVSISVSPTNSTVAKGLQENFKATGIFTDNSNSDITDQVTWDSSNTDILSISNASDSHGLASTLNQGNVKVTASIGGIQGSTDFKVTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LigB-like protein
publication title Solution structure of the Big domain from Leptospira interrogans
rcsb
source organism Leptospira interrogans
molecule tags Unknown function
total genus 9
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2013-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02368 Big_2 Bacterial Ig-like domain (group 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2mh4A00
2ZWKA 4AQ1A 1E5UI 2N7SA 2ZQKA 2MQGA 3NCXA 1F02I 2L04A 3NCWA 2MH4A 1CWVA 1F00I 4AQ1C 2MOGA 4HU8A
chains in the Genus database with same CATH superfamily
5EIIA 1EK3A 3BP7A 4TQIA 2Q3XA 1G7LB 3FU6A 1LGVA 1UH4A 4ZW5A 3WTUA 3KPPA 3B56A 2MOGA 4KI5C 4KKPA 4F15B 4L9LC 1DQVA 1HZKA 3E6HA 3BP6B 3NFSH 1KCSH 4QKTA 4OCYL 3RVWD 3RZCA 5EULV 4IKIA 3VXRB 5AOLA 4LHUA 5D96B 4J7RA 5CEYA 1G94A 3N1PC 3V5KA 3IJ9A 3GXMA 4UIMA 4QOKB 4E9TA 3QJFB 4AE1A 3OLEA 5KSAA 4NQDD 1GGIH 1D9KD 3OHMB 1VFAB 1KGIA 4FMKA 5BV7B 4RMVA 1BEYH 1ET8A 2BCKA 2H26B 1MCBA 2KLTA 3CHRA 4PJ9D 3THML 1ORSA 2RHEA 4FJYA 4KUCF 1JGEA 3S37L 3VYOA 5FAAA 3RIFK 4X4XA 3ZOAA 2VABA 2JELH 1NCJA 3K6IA 4F9PC 1BQSA 4EBQL 3IXTB 2X2JA 1NM9A 1UXLA 2Q0ZX 2R0LH 2WLJA 3T77B 1WE5A 4LF3A 2LV4A 3LH9A 5A7BA 2WSKA 2I32A 3OAWA 1U3HB 3GBLA 4GSDL 3TJEL 4IEFB 5B3JF 4G8GA 2NY5H 4OJYA 2EQDA 3P0VL 1Q1PA 3B5TA 1G6RA 1RUML 4N2HA 4FLHA 3WNMA 4NENA 2OXHA 3BPCB 3DTXB 3Q8BA 4H4NA 3WE6A 5DYOB 3CFDA 1I1FA 1B6DA 3DRQA 5EOCH 2ARJQ 2B0SL 3GRWA 3LX9A 4JUTA 3T3MB 3VYNA 4ZTOL 5IEKA 1AOZA 2VUYA 1YY9D 1CK0L 4PJ7A 1FIGL 1U4EA 3PWLB 5DRWB 5TGBB 3RA7L 2CD0A 4PJ7F 4BZ2L 1KJ2L 4HMDA 4HWBA 3VXTB 3DYPA 1CT8B 2FATL 2GY5A 5C08D 3Q3GB 4WIQA 5LBSL 1TFPA 3MV7A 3BVVA 5TDPB 2W0PA 3IKCA 5FV2A 4TOYH 1MWAB 2NZ1A 3FT9A 3D0AA 4KTEL 5A16B 2JJSC 1NEUA 1YDPB 4FXTA 3FHQA 4GT7A 1TO4A 4JFDD 4I48B 3CLWA 3LPOA 4KK8D 1PLBA 4O58H 5DURD 4X5WA 4AK2A 3VFWB 3D34A 2ENYA 4PJAF 3FUKA 3HKFA 5HGAA 1IGJB 1ZSHA 3JT2A 3QRBA 3GTTA 5ID1B 2EXTA 2XFXA 3V7AG 2NY4C 4MXQC 4A2MA 3MV8B 4YZFE 2QQLL 1TJIH 4KWUA 1BLNB 5AW9B 1EHXA 4DEPB 3IETB 5CZRA 3LXAA 2DLIA 2OCJA 5DJ8A 5C7XH 3J7HA 2J8HA 4FTVB 3AUVA 2PO6D 3FRPA 4KNTA 2E76C 3MRIA 2VN4A 4DN4L 4OV5B 2XN2A 5CAYB 4IBZA 4QY8A 1KB9K 2QDVA 4BFJA 1A4KA 1HIML 3EBAA 2EDHA 1M1XB 2WSPA 5E99L 2X9ZA 2FQEA 2GUYA 3D07A 4XBMA 1E5UI 3MNVA 3VDAA 4Z23A 4IGBB 4PTTA 1CLZH 1Q9KB 4KTDH 1W8EA 1B2WL 1HEJC 2LAGB 5K9QG 3KZ8A 5IW6B 1U8PB 4LCWB 4NKDB 1N3NA 3RU8L 2JH2A 1EBAA 1U3JA 3HS0B 2YD6A 2BSED 3Q2LA 3EF4A 3HE7B 1T21A 2EAEA 3QIUA 1O9WA 1SMAA 2H2PD 3DV6A 3NK4A 4PLOB 5T5FL 2FEEI 3WFEH 4PU2A 4YXKH 1IE5A 1IGYA 3ARWA 2R59A 3QEQB 1INDL 2Y7SA 5E8NB 3BAJA 4POUB 1F11B 5KVDL 3OJDB 3VWJD 2VE6A 4WI9A 4AMWA 5F6HJ 3U6RB 4KAQH 4MNGE 1N2RB 2D9CA 1MXDA 3VXSA 5IMOA 1MCOL 1SFDA 1BG1A 5D7IB 3OAZK 2ICWJ 4M6ML 4PG9A 5CJXA 2Y6TE 2XACC 3ARTA 3DIDA 3PQYA 4L8DA 1JD7A 4EN3B 4QXUL 2FUTA 4MX7A 1PZBA 3P0GB 2EIZB 1NUFA 2NT0A 5EF2A 3VTTA 5FB8B 1WWAX 1KYUA 4MSWA 4AQAA 3RDJA 3S34H 3ZKNC 1MCRA 4LOFA 4P9ML 3S96A 2WO4A 4Z0BL 3MRPB 1F5WA 3VSQA 3ARSA 4AC4A 5CCGE 5ICZA 1F4WL 2WBJD 2LR4A 4P3WA 3ARED 3O2DA 4HK0B 3OGOE 1FAKT 5DD6A 5EZJB 4EIGB 1G5GA 2MRYA 3E3QC 5IB2A 3CFKA 5FX3A 2J21A 5FO8A 5HI3C 5CLWA 2EH7L 4NC1C 2HRLA 3SKNB 1NZRA 3SO3C 2DQMA 1CD1A 2XV6B 3EJUA 3UBXI 2MQGA 2NQ3A 2ICWA 3PP4L 3CMOL 4NCC2 4RBPK 3HMWL 4W9FC 1JYXA 1JZ5A 4LAQH 1V7NL 4LLVA 1DR9A 5KW9L 3MACL 4JFEA 3RWJB 2X4TB 1FF5A 2Z7YA 2I27N 4H8VA 3TA3D 4LQFH 1X44A 3BUQA 1HCVA 3KPOA 4TTDD 5AAMA 2YPKB 1BWWA 1DBAH 2GITA 2Q86B 4QRBA 4KZDL 4JMXA 1UATA 3SHSA 3CHPA 4I1NB 1QQDA 2QPEB 3KWUA 3DJ9A 1ACYH 2V4LA 4RGNC 3ARBA 1BBDL 4U3CA 1UM5L 3KYAA 5AOIA 4TNVK 3T71A 1OT4A 4FI6A 4FF9A 2CHWA 3EG9A 4X5QA 5I26A 4EKXA 3UBXA 1E27A 5IT2L 4HC1H 2XN9A 3T08A 1USZA 4KZCA 4QXGH 3BKYL 1AY1H 4FOMA 1ZE3H 5F3HB 4HZ1A 5T5NG 4NRYA 3F7QA 2HKAA 2CRIA 2J71A 2PXYB 4XTRC 2J20A 5C0JB 1AYRA 1HHJB 1XBDA 3D87B 1V7ML 1ZRUA 3MNWA 4XMZA 3WGVB 3L16A 3RWHA 2V5TA 3V4PL 3ZE0E 2BIHA 3O0RL 3H54A 4XNBA 3VFNB 2NNXA 4U7MA 5D6CB 5E03A 2KZ1B 1RZJC 3GMRB 2NY7L 4M7JH 2XSKA 4XOAA 3IMSA 4N8UA 4XVTL 3BEVB 4LCIH 4HJTA 1DDHB 1PYWB 3KWWA 4L37A 3KCPB 1M3IA 3COOA 4M7LT 3HE6A 4BK8A 3TWCL 4M00A 1EANA 1TETH 1SYVA 1ZHBA 5E70A 5LCVH 4GW1A 4JKWA 4DPRA 1ETZA 1KBWA 1KIRA 4X7DC 3KGSA 1BIHA 3QO1B 5JR1L 4UTBH 3GSRA 5G2NA 3BUPA 1JRHH 5D5MA 1EZLA 1JWMB 2YPVH 1DJIA 1D3CA 5F0JB 2IMMA 4I7ZC 3BRDA 4XXWC 1IQWL 1VZHA 2VL5B 1E4XL 3D3VA 3MA9H 2O5YL 4R7LA 3VU1A 1EAOA 3GZQA 3N0AA 1F6LL 4PBVC 2CDEA 5JQ6L 5T3XD 4KRNA 4OF7A 1ZLDA 12E8L 4KU1A 5EN2B 4EI6A 4KRPC 3N44F 4YVUA 3CPLB 5J6HA 5AVRB 4BJLA 1IIIA 4P59H 3GXPA 2J6WA 4UDTB 5F3FA 1HWHB 2JWYA 3G6AA 3O4LE 2EIDA 3CSYB 3FQNB 1QSEE 1INEH 5IJBC 1W72L 1COBA 5DWPA 3MR9B 4AYSA 4OJEH 4Z7UA 1AHKA 1A6ZB 4G42A 3W57A 4WWKB 1F4HA 3OXSA 1UJ3C 1CLCA 2BX5A 2EDMA 4Z7UF 1BLIA 3JWDH 1ZLUK 4TV3A 5EC2A 4OH2A 3GMMA 1UTDA 4JY4A 1ADWA 2YXWA 1E8YA 1D5BA 3D12B 2Y06H 3G6JA 2HZHA 1KCBA 1VGEH 4AM0A 1SEQL 1MCFA 4J28A 1FCGA 4F7CA 4UV4H 3EFDL 4Y4FC 5T1DL 2X38A 2DTSA 1ZXKA 2C5DC 2VXQH 1RVFL 4APQA 3RGBA 3QULB 2VXTL 4YSPA 3L45A 3INOA 3GBML 1T6WA 4IBUA 5KVEH 1E9PB 4XNQB 1IEHA 2HKFH 1E90A 2QMKA 4NKIH 4X6FB 1BQ5A 1VDGA 2GJ6E 5FGCE 4B0MM 1G43A 3K2MC 4X83A 4GKNB 1CGWA 4H88H 2D31A 3JVFC 4X50A 5IMMB 2P28B 4QTIH 5F2FA 3RVVC 3BKMH 1CGTA 1A6VH 4QGYA 4TVPE 4F7PB 6PAZA 5L8JB 3VWKB 4K7PL 3NRFA 4YDVA 1Q94B 3AVEA 3VD9A 3BC9A 3BQUA 1H15B 1TEGA 4JFSA 4U6YB 5DC4B 3P02A 3QUYA 4UU9A 1W9XA 2GT9A 1J18A 2AQQA 2JLLA 3IJ8A 2FZ3A 2PWDA 3ZZSA 4CJ0A 5I18L 5D55A 2PCFB 2BOBA 3B1TA 2OX5A 1Z7JA 3MROB 3KNBA 1AE6H 4NAMA 5D9SA 4KZ0A 3CGTA 3WXVH 4P2AA 4ZX5A 1I1RA 4LCUA 1BFVH 1O6SA 1KPUA 1VHPA 3MLWH 3NEEA 3SBPA 5IZ7A 5HDWA 4F8LA 1U8LA 3N43F 1F3DJ 3O41B 3Q0HA 1RXLA 3Q2WA 1WRFA 4HUUB 4DKAA 1TZHB 4AC2A 4K2UL 2WQ8A 1SPDA 4F37F 2R2HA 2AJZA 3BKCL 4ZUUB 5AD0B 2WM0A 3CFMA 2ED9A 4JAMA 4F1ZA 4J2XA 2NYYC 1NCAH 1MEXL 2X4UB 5B1KA 3EH1A 3NZ8A 5E2WH 1YN6A 2ALWA 4HEPG 3D0LA 4ZPVB 5K33A 1RIUH 4Z7NF 1G87A 5ACMA 5L2KA 3PWUB 1TJIL 4RCAA 5IB5B 5FCUH 1I85A 1C12A 2A3TA 3BIBX 1NBYB 2CR0A 1RERA 3C60B 2P47B 3KPMB 4FXKA 5C7XL 3OMNB 3EZJB 4HKXA 2XIDA 1O75A 5EF0A 1XR9A 1OGSA 1VPOH 3GSVB 1A9EB 2XYCA 1XGPA 3BGAA 3EFFB 4GG8B 4K3EL 3L4CA 2CKBH 1BREA 3EO1A 2ITDB 2YSTA 1A7QH 1KMGA 1ILSA 4DP7X 4N2DA 1S5HB 1YVLA 2AJSL 3L3KB 1N68A 4G71B 4IBYA 3FCTB 2VZ1A 1S3RA 3MCKB 3QXUA 1MCKA 1CLZL 4KTDL 1ZS8A 1D9KB 3R7RA 2F0CA 5EC1B 4XZUB 1QLEH 2CO1A 5EF3A 4WUUA 3KPQB 1QACA 1OSEA 5I30H 5FYLH 1FH5H 5IQ9A 2DYPB 1CDUA 4Q8BA 5CJOH 2DMKA 3O2WL 4HV8A 3GHEH 3OLGA 3QQ9C 2P5ED 1PKOA 1CFBA 2FSEB 3JTSA 2ZYHA 3AY4A 3QIWC 4M5YH 3PGCB 4ZAKB 1IAMA 4Z3IA 4BCYA 1E9QA 2B14A 1T83A 3DSFL 1S7QA 3QCTL 1OSPH 4G8FB 1JNHB 4RX4D 4NOBA 3QQ3A 1KCWA 1WA2X 3ZHKA 1NGPL 1VADA 2MPAH 3DA0A 3APCA 1EV2E 1Q1JH 4GQ9L 1DEDA 4M5SA 3SDYH 2ZX6A 1EFQA 4Y4KD 3WY1A 4AMKH 4KAQL 2WTOA 4EUPG 3GO1H 3QZWA 3UACA 2H41A 4D7PA 2B4CL 2GJZB 3RP1A 5K9JL 4QJ4B 1QBBA 1DBBH 2ICEA 1BVKB 1UD6A 2MCPH 3ZT5A 2JMRA 4LSQH 3P9LA 1LWJA 4DW2H 2AEOA 2F15A 2IIJA 3B2DC 4PJCA 4F5CE 3PIQA 4R4BA 1NCTA 4PJCF 2D3JA 1NMAH 4ORGB 1UEYA 5GZOD 1A02N 1JSYA 4JFDB 4MNQE 4I1PA 3WLWC 1N12A 5EIVA 3HC2A 4XGZB 3E2HB 5DMGD 3P4MA 3J2PA 3LS4H 5IHWA 5DD1H 3H6AA 4PY7B 5FOJA 4LKXA 4ICWA 1RHFA 1XTLA 5M95B 3FQUA 3MGTA 3JZ7A 4F91B 4OQTL 1RJYB 3EF7A 1T0NB 2PO6B 1E2WA 1OL0A 1V5JA 1PG7X 1RZ7L 4PYHA 1L5GA 3CN4A 4HSQA 1LD9B 2R1WB 3CFJB 5DU7A 4EPSA 1ZGLA 2WLIB 4AXWB 3W11C 3GXUB 3U30C 2VO5A 4LCYB 3NGBC 4X5PA 4B9KC 5AKVA 1OZUA 4M6OH 3FFDA 5DUBB 1ZVYA 3VXRA 2EDOA 3D85B 1JDCA 1HYSD 4K5PA 3B9EA 3N6YA 3CZJA 4LQFL 2IFFL 4QOKA 1XF4B 1XMEB 4EUPB 2DY2A 3TYGH 3QJFA 3DBXB 4YBQC 4NM8H 1DBAL 3LNEA 4W9HC 4CU7A 3CH1B 5AW5B 4XB8A 4DKTA 3H2QA 4HHGA 2IPKA 4LEBA 1VFAA 8FABA 2WKLA 1JP5A 3ELAT 4JFFE 4R2GC 2ADGB 3L5JA 4UOQA 2H26A 4YFEA 2F7QA 3UTTB 4Y4HD 4F58L 3SBWC 3FH5A 1UB6B 1N64L 1VFBA 4JB9L 3O8XC 4OF8A 1X5HA 4R7NB 2G2RB 4AQ1B 4H20H 3IXTA 1AY1L 3HI6H 4EZLA 3FUJA 2ZKHH 1SOXA 4HK3N 1S5IH 3MAWA 2BM3A 2A0LD 2X5PA 3BKJL 2EO9A 4Q6IB 3TGXA 3QJQB 3VWJB 4IEFA 2DLFH 3IJHB 4JCWA 3MXWL 3DO4A 4GOSA 5HYSG 4KKCC 3VJ6B 5KBDA 1J5OL 4F92B 4E9LA 3BPCA 2WVUA 2FHFA 3DTXA 5KJ7E 5DGRA 2BFVH 2DJMA 2BP3A 1YEDB 4JJ5B 4B5EA 5BCAA 2B5IC 4IRJC 1FSKB 3GT6A 1ZT7B 5DZNA 4UT7H 2AFNA 4P3DB 2D0GA 2V0AA 3T3MF 4R4FH 3QS3A 4KVCH 25C8L 5DRWA 5TGBA 3UZEA 2OK0H 5D2NB 2HFEA 3T2OA 4CADB 2QVIA 1PZSA 1R17A 3OAUH 1I1YB 1IVLA 3DMMC 2CJ3A 2BSTB 2DMCA 7FABL 1S7UB 3GIZH 3NIGE 1ZT4A 2X87A 4PJBE 5I1DA 4YHYB 5D1ZI 5TDPA 3ZYIA 1AHWB 3ZN6A 5AENA 5B39A 2D7TH 1YDPA 2FNWA 4NNPL 2WJ7A 4GG6A 3AREB 4I48A 1WG3A 1XF1A 4CBPA 3OHXA 2AANA 1ILUA 2EZ0C 2GI0A 3VFWA 2J1ZA 4XNXL 4OLVL 4D8OA 3QCUH 1SVCP 1IGJA 4F8OA 3E7JA 4EI0A 4U1GC 3BWSA 5ID1A 4M6NH 3VD3A 4A39A 3MV8A 1KELL 2NSMA 5FM5M 1QPKA 5JIPA 1BLNA 3T0EA 3K1DA 1JFQL 2DLTA 3P2DA 4U3HA 3AQZA 2V5MA 5MP6H 3RNKB 2PYEE 1CO1A 4FTVA 4IBQA 3O3EB 4KFMA 2JJWA 4XMKL 4XHJD 3R18A 4OV5A 1MOEA 4Z3HA 3RB7A 5D1ZA 4HCRA 4DPCX 3S6CA 2J73A 3EOBB 2AK1L 3QIBC 4QNPE 4ZW6A 1INEL 3ZE2B 4K7PY 3IMUA 3TA3B 1J11A 3B8SA 3R1GL 2VLLB 2WB1A 2C26A 1AKPA 5HYSB 1PZ2A 4LLMB 1ZLSL 4IGBA 3KDMB 1Q9KA 4QHKI 3QWOA 3T8XB 4HJSA 4WFED 5DJYB 4AYFB 5IW6A 1KGJA 4NKMB 1U8PA 2Y06L 2IBZY 4LCWA 3BUDA 4NKDA 5D8JH 2Q7AA 4LKCA 5IOKA 1C08B 4KUZL 4AYMC 1NWPA 4XOBA 3HS0A 4I0PC 4UV4L 4H2AA 2VXQL 2DBLL 3QNYA 2GJ6D 3FUIA 4JO3H 4X4KA 5KVEL 4KOBA 5GS1C 5CBEB 3DJRA 4NKIL 3DGDA 1G1KA 4CMMB 5TE7L 1NLBH 1WHPA 4EO5A 1CVSC 4JFOB 3GTVA 4H88L 1JZIA 4PRIE 3QEQA 4TVPD 4KY1L 1IGTA 5F9DC 3B6SB 3LRMA 2W9DH 5E8NA 1A6VL 1F11A 4M1DL 3OJDA 4NN5C 2QQQA 1KEGH 3N41F 4KK6C 4HCIA 4RISH 5DJDB 1KCUH 2R9HC 4PWKA 3F6IA 4AGOA 1TJGL 1Q9LB 1FN4B 1PCSA 2AJYH 5CZXD 4NP4H 3G5XB 3A21A 1HESA 1RZJH 4NWTH 5C0BD 2Q10A 2D9QB 5JQHC 3V5HB 1Z9PA 1QPXA 1X5MA 3PY9A 5D7IF 3NJJA 3U7YH 4BXSV 3IDXL 4EN3A 5CILL 3BUTA 3CFIC 2EIZA 3OXRB 5JDSB 2NLJB 2VISB 3HRPA 5FB8A 1QNZH 2CIKB 3B5HA 1DE4B 1BFVL 4OTXH 4F2MB 1U8OB 4QRRB 3C8KB 3VNYA 2IAMB 4WW1B 2R2EB 3MLWL 1TQBC 2C3VB 5F7NC 3D51A 4GP4B 1FCCA 2ZCLH 5F96L 3HZMA 4ANUA 1WFMA 2V7NB 3MRPA 2A73B 3IN0A 5D1XE 2HVJB 4XC1H 4XCYB 2CK0L 1CYWA 1XH3A 4GAGH 5CP3A 5FO9B 4HK0A 4N6RB 2HT2D 1XXDC 5EZJA 3RYMA 1QA9B 2HX8A 3UCRA 3QRFM 3A4FA 3QI9D 1DVTA 2E4TA 2R0WH 3EGXB 4Y5XB 1DQIA 2ZP0T 3T4AB 4URKA 2JKTM 4EKJA 1NBCA 3SKNA 2A2QT 4KJYA 3J8F7 2R29H 3FQXB 3VFPB 4DGIH 5FCUL 4XBPB 1CGSL 2MWCA 4AMXA 3UMNA 1WZAA 2EINB 1SLWA 1Z9NA 1GAFH 2NYKA 5JHMA 1VSCA 4MQ7B 4L5FE 5GGTH 5C6PB 2RFXB 3C09B 3RWJA 1DLHB 2P5WE 3SOBH 2X4TA 1KXQA 2D3VA 4XXDA 1OZTG 2P3YA 1XL6A 2HMID 3MLZL 1FLRH 2BZCA 4FRWA 1OD7A 3HMXH 1A7QL 4K07A 3U36B 2YPKA 4G7VL 3UAJC 1RKRA 2Q86A 4FFTA 3ZY7A 2FX7L 2FBJH 1N4XH 3EHBD 5ECJE 5EZIH 2X41A 4ODBD 1QLEL 4Y1SA 4DUWA 5LDSA 2XV3A 1HEZB 4ODUB 3SQOL 5I30L 5FYLL 3S4SG 5K1NA 4UT6L 4W9GC 3GBNH 5CJOL 4JGNA 4DVBB 5F3HA 5CLXA 2XIBA 1BZDA 1L3WA 1NUDA 4P57B 2ZUQB 4M5YL 4GAJH 4LMQI 5C0JA 2P8LB 2ARJB 3ZMNA 5CR8A 4A38A 1LO3H 5GRUH 1KIPB 3C5ZC 2HP4A 5IESH 4OFVA 4FXLA 3VFNA 3TVMD 2LTQB 5BZXA 2JKJA 3ZR5A 4DSYA 5D6CA 3GMRA 1FBIL 4HZAA 5BQ7B 1IAOB 3P77B 3SODB 5D4HA 1Z3RA 3BEVA 4X4MA 5A6IA 5GZNA 1PYWA 5L8LB 3KLHD 1MVFA 3KCPA 2OZ4A 3L2LA 3TM6A 4HWUA 1QSFE 1EHLH 4U1JA 1FFPB 3QQXA 3FQ1A 1UZ8B 3H4FA 4PBWD 1DBBL 4RFNC 5FWQA 4E5XG 4AEHL 4YSUA 3MN8A 3QO0B 4HOMA 5LGJB 2MCPL 3WIFB 4MKMA 4HEME 4QF1A 4EE2A 2R2BA 4PY8I 4J4PD 3ZO9A 5E23A 3V0WL 5H2BB 2I9LB 3WNPA 5JHDB 1EEYB 1JPTH 1OP3H 2IQ9L 5FGBA 1ZOXA 1QI5A 3IU4L 4QXTB 1I53A 3DUUB 3E1F1 3O3UN 1JWMA 4N5ED 3ZYZA 2XV0A 3OF6D 3RVUC 5GRVL 2VL5A 3GLZA 4E9SA 1D5IH 5J13B 2FK9A 3LS4L 5EOTB 3N2JA 4NZFA 1OCOB 4FL4C 5CGYC 3SDXE 3S4SB 5BS0D 3VRLE 5DHEA 3D06A 5EN2A 1HL4A 3EUDA 5AAWC 3CPLA 2XCMC 3L5WB 1CGUA 1FLTX 1GJUA 1RJCA 2A4EA 4P2RB 5DVKA 3MHZA 1EXGA 2HLFC 5E08H 4MMXC 4A2HA 1MQ8A 4WTQA 3CSYA 4LSDA 1R3KA 1U8HB 4U6TA 3FQNA 4H2CA 5T5NF 4JFWA 2FE0A 3EKCA 1UD3A 3MR9A 4RA0C 4G9FE 1A6ZA 2UZIH 4WWKA 4CVUA 3HPJB 4BK5C 3G3LA 3LXCA 3CLFH 5AL0A 2CZNA 3QWNA 3B9DA 3BYTA 3WNOA 3KL5A 4QHLB 3VCLB 1XB3A 4M6OL 3CE1A 2DQCL 4WI6A 5I8KL 1YC7A 1U30A 3U1QA 2F08A 3FT4B 3LH2H 1HQRB 2OMVB 1DL7H 1G6RL 4YE0A 4BGLA 1WH0A 4LNRB 4E5XB 3IFNL 4ZW3A 2DF3A 1B0RB 2BNRB 2YN5A 1KBGL 1H3WM 3GMOB 5GS3A 3T09A 2PP8A 3GRWL 3ULSA 1E9PA 2HRGA 4G3YH 4XNQA 1TQCC 1M7UA 1AGFB 1MCNA 4Z7OE 1NDGB 4H0GA 4XNZB 4GKNA 2F1EA 3CX5K 4A2LA 5IMMA 2XTJC 2J25A 1UZ6E 1F4YH 1LP9F 3BLBA 4HWBL 3HI6L 4NM4H 4P23C 2LVCA 4BGDA 4E41E 1AZCA 1VACB 4F7PA 2A74A 5F9OL 1CXLA 3K71B 1HH9B 4MNGB 3ZO0A 1Q94A 2DLFL 2I60H 1LO2H 4P9HC 1EDYA 2X2YA 4Y4KB 3BP4A 1SDDB 1RY7B 4U6YA 5I8CB 1QLFA 4NI6A 5FA3A 3BIKB 4X7TB 2FO8A 2PCFA 1MJUL 2X28A 3RUGA 1AO7B 3SE3C 2CLZB 3MROA 2Z0UA 4XMLH 5EU6E 2BVUA 3FYIB 1M2OA 2VXUH 2E7LC 3V0FA 1YN7B 1WUZA 1E30A 4YC2B 3EO9H 2BP5M 2OK0L 1TQVA 5HHVH 3OAUL 2FEJA 1CBJA 2W92A 1TFHA 5FGRA 3O41A 1P6FA 5CZKA 3H9YA 4M9PA 1CLYL 1TZHA 4Z3FA 3P3YA 4K8RL 3O6ML 3QG6B 2D7TL 3IDJB 4IHOB 2R0KL 3M17B 1CF1A 1SOQA 4ZUUA 3RWIB 4JN2A 2CRZA 3IFPB 3W82A 4ELME 3EZ8A 4JMNA 1U3YA 4ZYKB 1OTTD 2X4UA 1L6XA 5TFSL 4PIRF 4W9DC 1NQBA 3WS3B 4R97B 4ZRGA 2PYED 1QWHA 3PWUA 1GZHC 3VM5A 1CF8H 5IB5A 5JW4N 3KPMA 4J3OH 2PUQT 1NBYA 5MP6L 2P24A 4LASH 4A7SA 5I0ZA 1HHIB 1CR9H 5GGSB 3BMVA 2ENPA 1OOWA 4APXB 3GSVA 4GG8A 3EFFA 1KCRH 1IBYA 1R34A 4JFHE 1L0YA 3AWEA 4X98A 3Q6GH 4KKLD 2VDMH 4GKLA 1QFWM 5KYWA 3HBPA 5E2JA 1YEWA 1XF5A 4GRLC 1WBXA 2P8MA 5JHAA 1T22B 1XCXA 2EACA 1WSST 2W0LA 4NQDA 3MCKA 1NMCC 3G5WA 4M8QA 1BZQK 1YYCA 3FTWA 3Q2NA 4QHPA 1D9KA 5EC1A 3APDA 4XZUA 5IBUG 3RQ3A 2OMUB 3KPQA 1ONQA 3RVTD 4PJ9A 3T2PA 1ET7A 3QRGH 4Y4HB 5KVGL 1SJHA 3UJIH 2DYPA 4K9JA 1WEJL 2IDSA 2EDYA 1NGXB 4M29A 3G5ZB 2Y36H 2FIKB 4N0FB 2FSEA 4JQVC 4BINA 3NG5A 4I77H 4JO2H 1EFXD 4FFYA 4WEUD 4IHBA 1FO0H 4PRID 1HHGB 4N2LA 1FDLH 1Y1UA 3ZE0B 3HAEH 1JNHA 4G8FA 4CU8A 2YGNA 4LPYA 5ID0B 4XP5H 2BVPB 3HS9A 2B08A 3BGFB 1D5MB 4UMGA 3SKJH 4FKKA 3FL7A 1WO2A 1YY8B 5KVMC 1KEGL 4HEPA 4OCRL 3O6FD 3O2DL 4NQVB 3KCWA 2CCLA 2V3DA 1TYRA 3QJHA 5A3IC 2V33A 2XZCH 2P43B 5ESQB 2OJ1A 5DFTA 1BAWA 1TQWA 3U7YL 2DQHL 2AXHA 1BPVA 5IOPB 2XWRA 4G6AC 3L4UA 3ZL4H 5HVHC 3MCLL 4QRTA 1GTFA 5BXFB 4X9HA 5I0YA 4XMPH 2DDQL 5I1EL 4TXVB 1QNZL 4ORGA 2XC8A 2GBTA 4QI3A 3QPXH 4JFDA 4PM1A 2NCEA 5D1XD 4KKZA 1J9RA 4XGZA 5CGMA 1NUGA 1ZS2A 4YDZA 2HRHA 5IBUB 3S35L 2IFGA 1LO0H 5A6MA 1ID2A 3NH7L 4XWOC 3C87A 4GAGL 4N90E 1RUAH 2G5BB 5C3LD 3AG3B 4H0HB 3LYRA 3O4LB 1RJYA 1MLBB 4Z78B 2PO6A 1RHHB 2XPYA 3BW9B 3F7YB 5IP4A 3F2LA 5FO7B 1QSEB 3SJVE 1R33A 1FWXA 2R1WA 2D03H 2QTVA 3AROA 3CFJA 3VG9B 3APNA 4AXWA 4PLKD 1NLDH 1QEXA 4DFIA 1A2YB 2H0JA 4F8TA 4LCYA 2YD1A 3GJFB 2P5WD 2FQFA 4MVBD 5CFAA 1GAFL 4MZ2A 4YSDA 1SY6A 4G6JH 5DUBA 3D33A 2YRBA 1AXIB 4XNYH 4A68A 5KSBE 2QTEA 3H3BC 3UC0H 1BM3L 1MJJB 2CWRA 3C5JB 2BW5A 2V8LA 3BD5A 4IIQA 1UQSB 5DS2A 2J44A 1XF4A 2UXTA 1JNLL 1GHFH 3ESOA 1BYOA 4EUPA 1TPXC 3CH1A 3GSQB 1CU4L 2BSEA 2FBJL 1N4XL 4I89A 4HMEA 5EZIL 1N9PA 1HKFA 5JHLA 1N0XH 3KYMB 1F4XH 5C2UB 2VDPH 3VXUE 3O11B 1UB6A 3QISA 1O0VA 4Y2NA 4R7NA 3TH4T 4AQ1A 5IMLB 5F7WC 5A7EA 4N2BA 1YEKH 4R4ND 1UXSB 1EJFA 3UYPB 4JHWL 5FHAH 1R9FA 3I3EA 3VWJA 3VH8G 1X5ZA 4WJKB 3LZQA 3WSQH 3H9HA 1LO3L 3H2WA 1OP5K 1Q9OB 3VJ6A 2QLYA 3VUAA 2DKUA 2XQYG 2CDGA 3MLPA 1IFRA 1RJZB 1FNEB 3WEOA 3NP3A 4JW3A 5IQ7L 1YEDA 4JJ5A 3PJLA 3WD5H 3ECUA 3AT8A 1TTCA 1F2QA 3FZUC 4P3DA 3ZDXE 1T03L 1QSFD 5HP5A 5IFJB 3SDCD 3VGAB 1ZV2A 1LK3H 5D2NA 5AKRA 1O7VA 1T0MB 3IBOA 3LPWA 1DLFH 3RJQB 1ZDSA 1E65A 1I1YA 3D7PA 4UT9A 5ABDE 2BSTA 3ILQD 1QBLL 5KANI 1S7UA 4FD0A 5GJSL 4WO4C 2P46B 3CQQA 3TEYA 3UP6A 2FD6H 1AHWA 3T8MA 2IPTH 2VDRB 4MD0B 3X3FH 1JPTL 3QE5A 2HWZL 2WBJA 4X6DE 1YAZA 4I18B 4OM1L 3AREA 4RBPH 3UJJH 1MVUB 4FLOA 5BMFH 3QI9B 4KKAC 5DUPL 2LU7A 4N1HB 3TNNB 4JDTL 1DVZA 2N0MA 1Z32X 4WI8A 1E4JA 2MKLC 4DF9A 4PJGE 4ZDHB 2PPCA 2UY7A 4K71B 1SBBA 3GJFK 3RNKA 4BZ1A 3VI4E 3O3EA 3WFZA 2E27H 3DO3A 1KB5B 1SLUA 3MLVH 3IDYB 3O6KH 4IBTA 1JF1B 4XXCC 2G2NA 1W6WA 3VH8B 3DVFA 2BJMH 1LXMA 3TA3A 2VLLA 1X9QA 1T20B 2ZONA 5HYSA 2I69A 3ZE2F 4LLMA 3FBQA 1WGVA 2EDBA 1E5AA 1I4FB 4M93B 3KDMA 5AFAA 1ZT1B 3T8XA 5FLVA 5DJYA 5ADPL 3CN2A 1ZHLA 4AYFA 1OWWA 4JVWA 4KKBC 4NKMA 3C6LD 2DQUL 3IDUA 4G9DB 4HK3J 5FR3A 3RZCC 3M7OA 7PCYA 2PLTA 1CXHA 1DJYA 2V2WA 3F00A 2W95A 2E59A 2VJ8A 1C08A 1EHAA 4MA3B 3C5XA 2J1WA 4XPHH 1C7TA 1DL7L 3FCUB 4X2UA 3DRTA 5E8EA 1FZKA 3FN0L 5KSAC 4DQAA 4OJFL 1DQTA 4FQJH 1NCHA 1HDMB 3H7BB 5D72H 3GBEA 4P4KB 2Z8RA 5I5MA 3WHE0 4CMMA 2A4ZA 3TJPA 3BZEB 2AXFA 2ZOLA 4JKKA 3G9VA 1RUPH 2QSQA 2QQNH 3T65B 4JFOA 3MRKA 3V8CA 4PJFA 4PRHE 4E41D 3IFOA 4HFWA 4PRAB 4UQIM 1YSOA 5G5DB 2PTVA 3II3A 4CL7A 1VA9A 3VGDA 3B6SA 1DVUA 4MTMA 1WWCA 3TVMB 4U1IB 2ZYSA 2AHIA 1F1DA 1F90H 5DJDA 4GSUA 1OF2B 2I60L 1LO2L 1KPVA 1KJ3H 5AVQB 3RPBA 1FN4A 3ZHNA 3G5XA 1XIWB 3MBWB 1MIMH 2IPUG 4NBZB 3P30H 3ULVH 3V5HA 4I3GA 5EU6D 1ANUA 2J5WA 2AGJL 3CZLA 3PHAA 4BKLB 1FHGA 1U91B 4XMLL 2P49B 4BHUI 3OXRA 1W15A 2G4EA 5DQ9B 3SGEH 4BQ8A 2VISA 4AZ8B 4RGOL 5LDUA 2C1OB 4I0KA 2CIKA 4P46D 5ESVA 1DE4A 4MNQB 1M7XA 4F2MA 3NFNB 1SN5A 4WW1A 2R2EA 4FZEL 3WJJA 2JKIS 1MFBL 4XCFH 2W59A 1CE1H 2VQ1B 4V1DE 1E3XA 3ARFD 2V7NA 2A73A 3IGUA 4RAHA 2HVJA 1Z6JT 1ACCA 4HFUH 1MHPH 4F2EA 4FG6D 2UV3A 4YHZL 3MRGA 4N6RA 2VJ0A 3QEHA 3MLXL 4NUGH 1MI5E 3ME0B 1J0KA 1ROCA 4Y5XA 2MOQA 5IVNA 4YFLI 3T4AA 2MNUA 4I3RH 4ODTL 4DO4A 1YNLL 3CK0L 3G04B 3JV6B 3EOAB 1GYCA 3IYLW 4PSPA 3FQXA 4S1RL 3VFPA 4H44C 4XBPA 5JW4R 1EDQA 3NACH 4G5AA 2HA1A 3UROR 4JFHD 4LASL 4GKSB 2GIXA 2JB6B 1L9SA 3BDYH 4DAGH 2W9EL 2QADC 2P26A 3S36H 4MQ7A 4NKOB 3IAGC 4R0LC 2RFXA 3KHQA 3ULUC 3QUHA 1DLHA 3Q6GL 5DJAB 1NGYB 4F20A 5ICXB 3U36A 3P11H 4Z95H 3L48A 4EVNB 4J5VA 3NZUA 5LN4A 4CDHA 4DWHA 4JFFB 3RWFA 1IC1A 4XHQA 1AZRA 2VRKA 3R0MA 3S48A 1FZOB 3LZFL 2IOIA 1HEZA 1U4FA 4ODUA 3HW7A 4AEIL 3HG0A 3QRGL 5F70A 1TJHH 1M53A 1FE8H 3DETD 5J1TC 2K7QA 4DVBA 3N42B 4JZOB 5F9WB 1KLGB 2DI9A 2HVKA 2Y3NA 2O6DA 3WBDA 2P8LA 2ARJA 3ZJAA 4I77L 1GGYA 3GNMH 1INQB 1FO0L 3QIUC 3ABKB 4HJ0C 2KS0A 3F5WB 1HKLL 1SZNA 4QAWA 5DFVC 4C56E 3QYNA 1A9VA 2WAQA 3CSTA 1JMZA 2GCYB 4N2KA 5BQ7A 1R24A 1D2PA 1IKFL 1IAOA 1MW1A 3F65A 3P77A 4N25A 1O5PA 3AACA 3WOVA 4LEOB 4P9HH 5HGGS 3MOQA 4ETQB 2JJVA 2YAQA 2ADFL 4GINA 5I1HH 2XZCL 3OKYA 1FFPA 2VXVH 1UZ8A 3MCYA 4QJ3B 1RPKA 3NIGB 5LGJA 1R3IL 2HXAA 3QO0A 4PJBB 4C57C 2OYMA 5DO8A 3MXVH 1SYSB 3V0HA 4YO0A 1IGFL 5H2BA 1XQ4A 3CLEL 3PAVA 4KJPC 1G0XA 2FT7A 3K6FA 4XMPL 5ACZB 4AIOA 4L0PB 3SE4C 4OLWL 3VXOA 1G4MA 2VT0A 3DUUA 1S9YB 2VDLB 3QPXL 3GUFA 1LMKA 3OC8A 5GRXG 3AADB 1UXWB 1EJOL 2NX5E 2IANE 2QSVA 4N90D 5EOTA 3NZHH 4MMZB 3TPUB 2M26A 2WD0A 2ZWZA 5LAPA 1TU2B 3AB0C 3KLAB 1CDIA 4R8WL 4X9BA 4YZFF 3RVXD 2PYEB 3L5WA 5SV4A 3SJVD 2R1XA 3VSUA 5BV7L 5DSCB 4Y2DD 2OPCA 1X9RA 1U8HA 5BZWB 3CVHB 3FTZA 2Q1EA 1Q4NX 3HKZA 5GGUA 4NLHA 3IBEA 1NLDL 4WY7L 1IT9L 3ELQA 3MZTA 4LLQA 2BIPA 4YHMH 3VB9A 4BFBD 5FFGA 4DP1X 2C9SA 2BZDA 2CIIB 4QHLA 3VCLA 5D7LE 3IJSB 3UC0L 1AS8A 5A2AA 2OMNA 1KN2H 3JUYA 3FT4A 5INDB 1HQRA 3NVQA 1GHFL 2OMVA 4XR8C 1EVTC 2BRQA 4GUCA 2ZUWA 4LNRA 3LKPB 1BQLH 2Y6SC 3ZMRA 1B0RA 3VXUD 4UQ3B 3GMOA 2H8PB 3ARDD 1N0XL 3LEXB 3T6XA 2Z6FA 1AGFA 4OF5A 1EFXB 2VDPL 1LO5B 1NDGA 2AC0A 4X6BA 5KVEE 3MV01 4PRIB 4UWQB 2AJVL 1N8OE 1MHCB 3ZXAC 4RX4A 3R4DA 4MQSB 2VLJE 1SLVA 4NQQA 1VACA 1EQWA 5FHAL 1VZIA 1HH9A 4JN1H 4MNGA 4TNGA 3TCLB 2J2ZB 4WW2B 3WSQL 4Y4KA 5I8CA 1KNOB 1SDDA 1XGZA 3O6FB 3BFWA 2Z1PA 1CDGA 3QDME 2DIAA 5D7EA 1ZHKA 4X7TA 4GXFA 3NRQA 1JXDA 1OALA 3IAQA 2F7RA 2CLZA 2N4IA 1PGRB 1OP4A 3ESPA 3QXVA 1UWYA 3VGBA 5GRYA 4UAOC 2GEEA 1PS3A 1A6PA 2WYZA 1TLMA 1BJ8A 3K6SA 1YN7A 1XGUB 2IWFA 3ABMB 5T33H 2RAMA 5I6XB 3H0TB 2YAPA 5CUSL 2YARA 1IRAY 5L9DH 1T5WB 4WJG3 5GZOA 3IGLA 3L4TA 5E1IA 3SKMB 2V9UA 4HCRL 4HUMB 5JUEH 5B1AB 3A0OA 4ONGL 3SCMC 1ND0A 3FQYA 2K78A 4WNSA 1ASPA 1BOYA 1XF2A 5FV1L 5I1JH 2NNAB 2IPTL 5IF0B 3S5LB 4LAJH 1PTZA 4LOVA 3CFQA 1SUJA 3IDJA 2AVGA 4IHOA 1U41A 5EOQH 1GRWA 1UWXK 3QBTB 4U7KA 3D05A 1A6WH 2VERA 2X3CA 4LLAA 3JWNC 5C6TH 3E8UL 4OB5H 2H9GB 3UBHA 4ZYKA 2DQIL 1JXJA 1S9XB 2E7DA 4JKNA 2WQUA 3KWXA 2X6MA 3LKSB 4WU5B 1NPJA 1CTNA 1DO6A 5DZPA 2VDQH 3E80A 3GB7B 4JPVL 4BUHA 1SEBB 2Y1AA 1HHIA 4KOCA 5GGSA 3TP4A 3U9PH 2Z7UA 2FGWL 2EVJA 2JTDA 2P5WB 4APXA 3O6KL 5H37G 2X89D 1H0DB 1ZVSB 2ILLA 3ZKMD 4ORZC 4LGRB 3S0PA 3DPBA 4BWUA 2BHFA 2ZSVB 3P3SA 5AKSA 1T22A 1DHKA 1QMUA 4PCTA 1JTPA 1M7IB 5I16B 2JKWA 3S98A 3QDAA 4I3SH 1R46A 2DBJA 1BVLB 2K4AA 4KI5E 4S1SH 3MJ8A 4ODVH 3ARXA 3D9AH 3E9UA 1ZKAA 2CO6A 1M71B 2OMUA 3F12B 5F0LB 4YFDB 2WBKA 4UDUB 3A47A 4Y4HA 3FC8A 3AS1A 1VCBC 2BVOB 2CK2A 2DTMH 1EUUA 3VA6A 1NGXA 3VNZA 5FYLE 3DIFB 3V6OC 5KN5B 2FIKA 5GGVH 4IU3B 4OV6F 2KLSA 3WEXB 5FYJH 5HHNA 3H42H 3KPNB 4PRHD 4P0DA 5AVYB 5LLIC 1HHGA 4A6YB 5DEFA 4TSBL 2QQNL 2V17H 3MJ6A 3ZE0F 5ID0A 4XT1C 2BVPA 3LB6D 2QVMA 4DKDC 4NLAA 2XN0A 5EIQA 3KYNB 4TRPH 5JXAL 3SDAD 3O9WD 1AKJD 1L9RA 4NQVA 1GVIA 4LQ1A 5ITBH 5HVFB 2ZAGA 3LEYL 2IQAB 2DD8L 4L8CB 1E3ZA 1QSFB 2EP6A 4HPOL 2EVIA 3BMWA 2JB5L 3BQUC 1I9RH 3HZVA 4JHAL 4NZ8A 2RA1A 5HDBE 3T0DA 3EDFA 1X5JA 2O5XH 1PBYA 3ULVL 1S7WB 5ESQA 3FOMB 1QW9A 4IBWA 3UTSE 1KJ2B 4OGAD 2WANA 4YSOA 5L88L 1OT1A 1B4JL 5IOPA 4W9JC 2ENQA 2UYLA 3DIVA 4HW6A 4TQEH 4TVUA 3VFUA 1FORL 2HX7A 3EYSL 3NUKA 1EEZB 1UKTA 4V1DD 4PGCB 2WWNA 5ANMB 1DZBA 3UH8A 4I5BB 1I8MB 1KFAL 5E5LA 4YGAB 3QDGE 4Y1AE 5LXGL 1IB5A 1NCDH 4QRPB 5DI8B 5AEAA 3BPOB 2G5BA 1Q0EA 4ZMLA 2ZQKA 4P2QE 1MJ8H 3VGFA 3O4LA 4OUUB 3GK8L 1P4UA 1GJWA 1MLBA 3PWPE 4Z78A 3BW9A 1RHHA 3MNZB 3F7YA 5MHSE 1N70A 5IEHB 4N28A 5FO7A 5FS5A 1QSEA 4NUMA 1A4JB 4KK9C 2B16A 1H3GA 4G9FB 4LGSB 3SGKC 1KLFB 1W2KT 5ADOH 4GKZA 4PJIE 2YAEA 5AVVB 5KZCD 4A2GA 1A2YA 4FHKA 4OD2B 5AW6B 3GJFA 3LKOA 5IREA 2OQJB 2WP3O 5EPMB 1I85C 2R2CA 4FXKC 4DAGL 4XBEL 3PGFH 1FYHB 1VENA 4YDLC 1URZA 3KLLA 4LOUC 1MJJA 3C5JA 3HNTH 4XVSL 1DUYB 5CSZB 5E8DL 1UQSA 3RHWK 1SGKA 4FLSA 3WMPA 4XPGH 2RIKA 2IV8A 4PG2C 3D4YA 5E7BA 3OQRA 4MJ5B 1DVFD 3ETBJ 3GSQA 4OD1L 1HJCA 1DJHA 4DGUA 2BHUA 3KPLA 1D6EB 1OD9A 5SWSB 1DVYA 5JPMB 5LNDA 4JDEB 5F1SA 4M43H 4TUUA 3HB3C 2GJ6A 3KYMA 4HIPA 4Z7OB 3IDNB 4HKZB 1SXNA 1P5UA 2J1KA 3BH8B 1MKFA 1N6UA 4KKNA 4ZOBA 5IMLA 1FE8L 4UT9H 3V4VH 4LVOB 1CGXA 1ZV9A 4E41B 5BO0D 2NTSP 3LCYA 3UTZA 2MQ0A 1UXSA 3UYPA 5J4MA 2D4FA 1EHNA 4OKVB 3V0JA 2PTUA 2GYSA 3GNML 3LH8A 3CZEA 4C56D 5C0DB 1NOLA 4K3JH 4GT0A 1QKZH 1Q9OA 3WS6A 2H32A 4H13C 1EX0A 5DZ9A 2VN7A 1FQ9C 3P54A 1RJZA 1FNEA 1N6VA 1TT6A 3TJHC 3V10A 3DYOA 5I8EB 2ZICA 3DUSA 3ATEA 3WELA 4JCMA 2ZCKL 1WZ1L 5I82A 4W9CC 2F54E 4MA8H 3MOAL 4MDIB 3ZRSA 1BGXH 4RAVB 1OE1A 1T0MA 1YPZB 4P46B 5I1HL 3ETBF 2A9BA 3S8FB 2D7PA 3WXWL 3ILEA 4XNMB 1FFOA 4ES8A 2ICEC 5EO9B 5LQBH 2I26N 3GM0A 4IKKA 1JHTA 3CIQA 4MD0A 1TTUA 1A14L 1CICD 3MODH 4I18A 3TU6A 2BWDA 2DYSB 2F6AA 2NX5D 3FFOA 4YXLL 3QI9A 1LNUB 4G6MH 5I1AB 4FX5A 5FYKH 1L9QA 2WXGA 3TNNA 5C0ND 1MXGA 1II4E 5SWZE 5T1JA 1X5AA 3I3DA 5MEQB 4ZDHA 1BQKA 3FB7B 1R5IB 3LY6A 3FQRB 5K5YA 3OWRA 4Q97A 4PI0A 4LSUH 5I1CH 3I74A 1KB5A 4G83A 1ET5A 1JF1A 1K6QL 3EADA 4FQIL 5HD8C 1GPOL 4NC1E 2VCOA 5HHME 3LN5B 4MLSA 4Y16C 1SHXA 1E4WL 1T20A 4PRBB 1ZLVH 4FFWC 4MWFB 2RCSL 5JPNB 5D7LD 2EC9U 4YHML 2XQYA 2UXFA 4AGNA 3HJEA 3WFHB 1OAKL 1NGQL 1ZT1A 3ULUH 4C4KO 2CAKA 3I9AA 5FXCH 4GO6B 2GIYA 2F58H 3C8DA 3EJQA 1FIEA 1HL8A 1YEEH 4NUQA 1GS7A 5D96C 4AEFA 2IMNA 1UGNA 3MLTB 4ALAC 2JKRM 1BQLL 1L0XA 2QSCL 2YJQA 1K5NB 3RWEB 5H8DA 4JM4H 2FR4B 1DCEA 3A67L 3BN9C 3GPEA 4JKLA 1HDMA 3H7BA 2RALA 2WNKA 2IWGA 3DO7B 1OPGL 5H94B 4KK5D 2F7PA 1RZIB 4J12A 2VLJD 4GPVA 1OTUC 4I88A 2YUXA 2CR6A 4PRAA 3V4PB 4QHMB 4XP1H 4MJ2A 1GY1A 5I6PA 3TVMA 5F3BB 5KJRH 4U1IA 2A9CA 4U1MB 1ETA1 3QORD 2OSXA 4YDMA 3NJHA 3BPLB 4PD4K 1OF2A 5T3XH 3SQRA 1J87A 1WCBB 3QDMD 1U3HC 3BJLA 3K6DA 4BIKA 2WYHA 1GGBL 3X13B 3D09A 4UYQA 2YGQA 4YSEA 1MFAH 3HC3L 5HDOA 4ODHH 2FRGP 1HX0A 2FEDC 3TEWA 4F5CA 5IGXH 4N2OA 3RB5A 3BIAX 2AQNA 4DGYL 3DX9B 1U91A 1IM9D 4PS4L 3U9WA 5JOPE 5DQ9A 1CE6A 1JGLL 4QYOB 5E7FA 4AZ8A 2VDNB 2C1OA 2WXMA 4X6CE 5E2VH 5E4EB 4MNQA 5T33L 3U4BL 3WIAA 5JW4M 2DL2A 3NFNA 2EC9T 4LPVA 2DH2A 1NC4B 4ZMOA 2CU9A 1OAZL 4K5OA 3W0WE 4J39A 3SPVB 1IGCL 1KSRA 2VAJA 2VQ1A 3OF6A 2YFOA 3KMDA 1NCUA 2WLZA 5HYQB 3RTQB 3QFJE 3FTGB 1I82A 3OX8B 4LEXH 3ZLQC 2GK2A 2R56L 3ISRA 2HN7A 1CZ8H 4YIQB 5DWUL 2RQ8A 4YSQA 2R83A 4JM2D 2FJUB 4PSRA 1AR1D 3SJVB 1U8MA 1T66D 2ADYA 3G04A 3G5VA 4OB5L 1H19A 1NIDA 3JV6A 2DICA 4OLYL 4Y2DB 5AL8A 5GRZA 1G9EA 2OM5A 2D3LA 1HTYA 5CJ8A 3SE9H 3MSPA 4B9PA 1LE9B 1W72B 4LSTH 4XX5A 3GD1C 2VDQL 3OKMB 4GKSA 1LM8V 4DEPC 2JB6A 3QG7H 3RZWA 1J0YA 1TZOA 1RU9H 4AYDC 2J4WL 4NKOA 5KSBB 1I7ZB 1QNIA 4KQ3H 3K2UL 1E6OL 4FFYL 4JO5A 3A6OA 3N85H 4J3VA 4MDJB 4NZUL 3N06B 3OKOB 5EU5B 1UT1A 1SJMA 5DJAA 4ZD3L 4BFNA 1IJNA 1NGYA 5ICXA 1TJXA 3OVUB 2ZG3A 4KI5D 2WUBL 1OLLA 2MCAA 3WE1A 4EVNA 1J9SA 2XICA 4JFFA 4K5LA 5ICUA 5A40E 4LIQH 2QJDA 2G5RA 3NA9H 4IGBC 1FZOA 2OMTB 4CN4A 3ARDB 5CCKL 3ZTEA 1BAGA 5E9DE 4Q0XL 5F88B 2E6PA 5EA0H 1UASA 1F58L 3QHFH 1VCAA 1MFDL 3HS0C 4JZOA 3HE7C 1KLGA 3IU3B 1NIAA 2F9BT 2IH3B 4HCFA 4QHUB 4QLRA 4WI0B 3N42F 1OAJA 1PD6A 1KXVA 1GA2A 1C8QA 3H42L 5KJ4A 1W8NA 5IM7B 2I7SA 3FONB 3F5WA 2VN5A 2V17L 2BPBA 3T0BA 2GCYA 2K1MA 1XAKA 2OV0A 4G1MB 1A1NA 1QR1A 4TRPL 3SE8H 3ZDXB 3A4EA 4ETQA 3GI9H 2BS9A 3KPSE 3P3RA 4F27A 2OI9B 1KB3A 2NSXA 3UTSD 4UNIA 2BHZA 5EZLB 4PJBA 2OR9H 5DA0B 3B2PA 3MRDB 2NY0D 5DTFB 1DSYA 5AUMB 4AH2B 2GKIA 3NIGF 3SKOB 3BAYA 4PJBF 1KEMH 3F8UB 4J3UA 4X6DB 4FFZA 2CO2A 4EN3C 32C2B 5ACZA 1QFWI 4OCXH 5GGRY 2E9WA 3QB7C 2CGZA 1SY6L 4FP8H 3QHZH 1UXWA 3QDGD 4Y1AD 2EDJA 2QKIB 4JPKH 1AD0B 3PL6C 1PIGA 4R7XA 2AAAA 4MMZA 5DJ6B 1PZDA 3H56A 4PJGB 1AMXA 3QXDB 3TPUA 4TSCH 1TMCB 2XXCB 3C2SA 2DYRB 3RX7A 1NGWB 1TU2A 1U92B 2X09A 4P2QD 2PYEA 1NCDL 1NC2B 3HNVL 3PWPD 3VI4B 2PR4H 2X70B 2GTZB 5MHSD 4BQ6A 3QZMA 3ATBA 3K72B 5C6WH 2CPUA 5DSCA 5JHLL 3LDBB 3NCCB 4YHIA 4RRPG 5BZWA 2NY4D 3CVHA 4W70A 3CPUA 4QNPF 3S3BB 2Q9OA 1MY5A 3II1A 2FQDA 1MJ7L 3LJ3A 3ESUF 43CAB 3ALXA 5EU3B 2FQGA 2UUDK 4Z3EA 1AC6A 4OIAA 1TEFA 3KGRA 5AZUA 1TKWB 5AW1B 1EAJA 4GJTB 4ABQA 2CIIA 2AABL 3IJSA 5HDQL 2W81C 3IJ7A 2E0PA 2ZUXA 4D3CH 4PCYA 5C0GB 1MNNA 1MHHB 4H8PA 1K4DB 4RFOH 5INDA 2OZNA 4HISA 2R8SH 4R5XA 3SIKA 2AEQH 4YWGH 5DMJB 1C16B 3GBDA 1ZV5A 2H8PA 1JZ4A 3U2JA 5HYJE 1E5ZA 2VTFA 3LEXA 1EFXA 4FZ8H 4HQQL 4ZMTA 1LO5A 5JMOC 1DQJB 1KJVB 1KDIA 2F53E 2FH6A 4PRHB 5A2BA 1U2CA 1AS7A 4PRIA 2EH8L 4NO2B 3TT3H 4UT9L 4NHUB 1I8UA 2OBGA 1EXHA 3PNWB 4TQPA 3VACA 4ILDA 4ZOAA 4GI8A 1RULL 4WI4A 2PXYC 2H1PH 2ZX5A 3TCLA 1ULVA 4PJHB 4QJ5B 2J2ZA 3W5MA 1I7UB 1RIHL 1Z2KA 3O9WB 1OY3B 1AKJB 3O6FA 4WW2F 4K3JL 4Y7MA 3SDDB 1XGYL 5IG7B 5A2IH 3PFUA 4ACTA 4L0ZA 2DKSA 2J55A 1MFEH 2C3GA 1YYLL 2DM7A 2F54D 1KV3A 2EEFA 2J1YA 2QGDA 4FG4A 3WNLA 1XGUA 3TV3H 4BZ1L 2XLLA 4WVRA 3H0TA 5B7FA 1KYOJ 5B7MA 2CMRH 2CXKA 5D71L 5DEZA 4DKEH 1EMTH 1HXMB 3SKMA 3BD3A 3DVIA 1G7IB 1OK0A 1IKOP 5MENB 5D1XA 3B9AA 3HZYB 4XOCA 5LQBL 4W9IC 5E6SB 1U8JB 2NNAA 4WGKA 5IF0A 4KX7A 3S5LA 1H5BB 3TT1L 4NERA 2BC4B 2ZWKA 5TD4A 1D2OA 4ZO7A 1MI5B 4LFHD 3ZKND 3A6BH 4YBLB 2K8QA 3CTTA 5FGBC 1OGPA 1OAUH 4O02H 5E6IC 5E1GA 4P5RA 2VIRB 1WWWX 5SWZD 3WN5B 4G6ML 2NXYC 5FYKL 2JQZA 1MAKA 4UIKH 5I2IB 1SXZA 4FEIA 5JA9A 3GMNA 5IHBA 2JXMB 4AY0A 2QZQA 3LSOB 2L7UA 3DJTA 5KZCB 3GB7A 4MZ3A 5I0XA 1IC4H 1WFIA 5HI3D 5I1CL 3MRJB 3DDFA 2P5WA 1RUQH 3DECA 4LP8A 5HHMD 5TE6L 4YS4A 3GLDA 1H0DA 1ZVSA 2FJGB 4JO4H 1UJTA 2Z7WA 1ZPUA 1NAMH 1CXIA 2DB8A 2ZSVA 5LJYH 1HJBC 3PAZA 1M7IA 4WWKC 1ZTXL 4LRNH 1IAIM 1PQZA 1Z3GH 3BEWB 2LLNA 2ZOOA 4JREB 3T1FB 2MQCA 4PAZA 1M71A 2WZPD 3F12A 3HBQA 1VEPA 4Z7QF 3SD5A 2F58L 4Z7WF 2CJSA 2X1OA 4UDUA 2Q8AL 2DM3A 4BXVA 2BVOA 4UQDA 4RQQB 2FX8L 3MTXA 1J5HA 1D6VH 1RQ5A 4P2OB 3DIFA 4TKWA 1UKQA 3O3AB 1F3DH 4HBCH 4RGND 4IU3A 4JY5H 4L4VB 2GTQA 3S3CB 4PLJD 1ACXA 3U46B 2PP7A 4QT5B 4A6YA 1TQTA 5TF1L 2A9MH 4C56B 1WV7T 1ZHNB 1ZWIB 4NQEB 3SBQA 1FG2B 3OSVA 3D4GA 2CHDA 5F0PB 2B1AH 3LQAL 5B1CA 4XTRD 2J7LA 4JDVA 1KPRB 3VDBA 3CDGB 5T1MB 1QYGH 1DQLH 1OAQL 4U33A 2DM4A 1L9TA 3VWKC 1P7KB 5T3XL 4H26B 4L8CA 3E6FA 1QSFA 4OM0H 1THAA 2BOCB 3BT2H 4ERSH 2NCMA 1JI2A 4PUBL 3NZSA 1QAWA 1AZUA 1S7WA 4HEMA 2F19L 4J27A 2I5YL 3ES6B 3FOMA 4ODHL 4X8XA 4WI5A 5H37A 4PV8B 5JOPD 5TTRA 3PDDA 4RWYH 1XSKA 1X9LA 4U6VL 4JRXE 4MJIE 3CC5B 4ZTPH 4AUJA 1E2ZA 3W0WD 1MF2H 2K0RA 2AK4B 2O5ZH 4PGCA 4XNDA 4QHNB 2R4RH 3IWUA 3BDBA 4ZPTB 2NX5B 3VD1A 2IANB 3FF8A 3QFJD 3V7MA 1I8MA 1JF6A 4PN6A 3SDXA 5F1IB 5EBWB 3A23A 5IVXE 3S3PA 4XO3A 5JOFB 1J8HB 5KBKA 5D7JB 4QRPA 5DI8A 2CLRB 4LEXL 1I9IH 4F7MA 5DQJB 1BFOB 1ZK5A 3N1GC 3BE1H 4OUUA 2XI9A 3US0A 3MNZA 1BVZA 4JQXA 1YLBB 4PB9H 3MRFB 5IEHA 4PJ8B 2AEIT 35C8L 3NSJA 4G9FA 1KLFA 1MFNA 3HR6A 3MJ7B 1THCA 4KRPD 1TITA 1RIVH 3D2UD 5EPMA 3VW3H 4S1QH 5D7LB 1KTJA 2EIKB 2HAZA 2VXSL 3C60C 3ILPB 3QG7L 4MAYC 5FUCC 3T9WA 4ZZKA 4LARH 3LHPH 2K45A 4O2FB 1RZ8B 4DP0X 4G8AC 5IV2B 2QHLA 4XH2B 5CSZA 3MDJA 3LKRB 4OIIL 2YEQA 1CLOL 4JQIA 4ZFFB 2H32H 2V2TB 1N26A 4EZKA 1HI6B 4MJ5A 2OYKA 3D39E 2YGOA 2YXMA 4CSZA 2EUVA 5JPMA 5AW2B 1TXKA 4JDEA 2XOTA 3S97C 5JW3L 3IPFA 3KYKH 1MCEA 3MYJB 3Q8CA 3Q05A 2W5PA 3IDNA 4HKZA 3HC0B 3BH8A 4HUCA 2RACA 4GLRI 4Z7OF 1KCVH 4Y4FD 1AIFA 4XX1G 2VLJB 2XVKA 4E41A 1UZ6F 3T2NH 1BJ1J 3CH8A 3O3DB 1NBZB 4UINL 3CG8A 3WV0A 2AJ3A 3ZTJH 2E7MA 4OKVA 3FQ2A 3QORB 1ZSDB 4H0LC 4ZAKC 3TA4D 4H7VA 5C0DA 3WKYA 1ODUA 1CL7I 1X5FA 3QDMB 1J1OL 1FI8C 1S8DB 3D08A 3I6SA 1HFUA 1SLXA 5TPWH 2CHNA 3UC2A 4CVWA 5T1LD 1MRFL 2Z92A 4LEEA 3WTVA 1T7VA 5EU6A 2OMYA 4FG0A 2MCG1 3BT0A 2MIZA 4OZFA 4R3SB 4YVNA 5I8EA 3KPSD 5DZLA 3SE8L 1BVNT 1IM9B 2WY3B 3M1CA 1JPEA 4W9KC 5FK9B 4AJWA 5I73B 3Q2VA 4MDIA 4RAVA 4TNWF 4Y5VC 5J6GA 3S8WA 4XNUL 3L13A 4P46A 3FAWA 1X5KA 4JG5A 4NGHH 2Z31B 2A7BA 4OBSA 3KEDA 4XNMA 4Z8FH 4FQXD 1YPZF 5D6DC 4P5MB 3NOIA 1F02I 4NZJA 4PI2A 5EO9A 5HXMA 3ARFA 4HCGA 1BW8A 4XPBH 3Q8FA 2CJUL 1UKSA 4MMYB 4JHUA 1IBBA 4PWIA 5EEZA 3FQTB 2GY7B 4Q74A 2RQEA 4ELMA 1J05B 2AV7B 2IWKA 2LHAA 5GJTL 1LNUA 2EILB 5I1AA 3QHZL 1MUJB 1I31A 5AZ2L 4KK8C 4G6KL 5T1KD 1AR1B 1A0QH 4FS0A 1YYMH 3E2HC 2APTA 4MD5B 3RLSA 1OF0A 5MEQA 1MWAH 3FB7A 1IKNA 1R5IA 3HRZB 1XCWA 4NBXB 5I1KL 5LN8A 1ESOA 1RZFH 3FQRA 1SJEB 3QDJD 2PR4L 3WJMB 4BH8B 4KV5E 4F57H 5BO1L 4U7SA 2NYYD 4HJIA 4AG4L 2XBDA 1PD1A 2D3NA 1CLVA 3L3GB 1NICA 3LN5A 4FQCL 4AX3A 2Y1ZA 4MXVE 4PRBA 3WIIH 4PRDA 2CKBB 2QT6A 4Q6KA 5EV7A 4ZZFA 1OB1B 5JPNA 4XBGB 5C09E 4PWEA 2WXFA 3TTSA 1BAFH 4RVBA 1VESA 1KBVA 1P84J 4ZMVA 2VITB 4L4TD 4LHUG 1YC8A 1QLEB 2PKDA 2YWZA 1UA6H 4LBEB 2QPSA 4GUOA 1KT2B 1XB6A 3VU2A 3F7KA 5HYJD 4P3CL 3VD0A 1JHKH 1AJ7H 3ARYA 4FGMA 5CLTA 4YWGL 3WUZA 2FR4A 3QUZC 2F53D 1VEOA 2P45B 2UWEE 5E0FA 3DO7A 1QSVA 1CPUA 4G59C 4XPFL 1UWGL 3VD2A 2OR7A 4FZ8L 4Q9RL 5H94A 1RZIA 3FXIC 4RMRA 2EYSB 2OJEA 3TT3L 2H2PC 4GO8A 3VSTA 1R0AL 1FGNH 2DLGA 5FDYA 5F3BA 3QIWD 3P69A 4XE5B 4RETB 4A66A 3TBTB 4LBAA 1YEJH 4BV1A 3GSNA 3FSVA 4Q6IC 4OSUH 3F64A 2ZJSH 1B4RA 1ERNA 2H3XC 1Q72H 3N04A 5FYJU 3UTSB 3T1WA 3L3IB 5C0AB 4WFGE 5D4JA 3HNSL 3WFDH 4B41A 2JJTA 4UI2A 4LP4A 2NY0B 4HKJB 5DT1H 3UGEA 3ULVE 4O4YL 2BSBA 3MJ9H 4QYOA 3TV3L 3VFVB 4KXDA 4XO5A 5E1HB 3VSVA 5D2NC 3CXHK 3SPVA 3K2IA 1MCLA 4FQQB 3BZ5A 3SPGA 3WI9A 1IIKA 4Y1AB 4WGVB 5HYQA 1JDDA 4ABUA 4LHUB 3FTGA 3OX8A 3PDOB 4BCXA 4YHYC 3V5KB 2DI7A 1HSAB 4J6RL 5IHHA 4P2QB 5JYLA 15C8H 1P4BH 3F6LA 4YIQA 3PWPB 4JR9H 3SJVA 3MTRA 1U36A 5CSBA 4Y2DA 4I4WA 1G9NC 1M9SA 2BCKB 3Q1SH 4PJIB 5IHUH 4LXFA 1ORSB 3W1ZA 4FI8A 1JGEB 2CBMA 1IC5L 3FHAA 1LE9A 5KUMA 2VABB 4AQEB 5HJBA 4NZTH 5F8RC 4PGZA 3WKQA 4S11A 5DQDH 3FRPG 3MUGB 5KSBA 3SQBB 1I7ZA 4HVBA 3K3QA 5KSBF 3OKOA 1NAKL 5EU5A 3LKNA 1KACB 4JO4L 4W4NA 4CUCA 3JV0A 3W11D 1WA1X 2YOCA 1F0LA 1G1OA 2VGLM 4YLQT 5CS7A 4L4JA 4NRXB 5F7FA 2EE3A 2UXGA 3ZHDA 1R1CA 4LRNL 1A3QA 1BM7A 4HIXL 2EEDA 4UB0H 1CDCA 2JCCE 1I1FB 3VXUA 1PZCA 2OMTA 1N6QH 1CTOA 3ARDA 1OTSC 3AG1B 1K72A 3Q5TA 5L7XH 2D2OA 3NJLA 4YBQD 3KPRE 4NQTA 1D6VL 1FL3B 4HZLB 2NY6D 3TIDA 3SPIA 3GMLB 4R2GD 1GSMA 3AMLA 1OANA 3IU3A 4G6FD 4HBCL 4JZJB 1TQUA 1IAKB 3KLQA 2K6WA 2IH3A 2IG2H 3MV7B 4QHUA 3IXAB 1PL3A 4WI0A 2X4SB 4FFZH 3ASWA 5JORB 3CVIL 2ZPKH 2AERT 1C1EL 3O8XD 5IM7A 2JKXA 4XP9H 1E28B 3FONA 1YEGH 1BYPA 3RL1A 4A7VA 2PWFA 4HX1A 4XWGL 1B3IA 2L04A 3QEUB 3KPTA 4N87A 1KGWA 4ZODA 3VFTA 3S36X 1DQLL 2DZEA 4HHWA 1E7VA 1P5VB 3ZDXF 4KKCD 1P1VA 1CGVA 4MCZB 4DCQA 5I6OA 2G3ZA 4H0IA 1UWXH 5E6UB 4BQBA 1A7OH 1G9MC 3V6ZB 4I87A 5BPPA 2XQBH 4KHTL 4XVJH 3MRIB 4JRXD 3EDEA 2EUWA 2WXNA 3MRDA 4IRJD 5DTFA 3GEFA 4AH2A 5E2TL 3RJDA 4GKOA 3IE9A 3X17A 1LEIB 3SKOA 1C5BL 4QY8B 1F8TH 3II2A 1QFWH 2B1HL 1GIGH 1HZHH 4X6DA 3V4UH 5EORH 5DS8B 4WI7A 1MF2L 4X6DF 3TN0C 5E8PA 3DMMD 4JRWA 1NCBH 4NC0B 4IBSA 2IAMC 5SWZB 2J6EH 1AD0A 5DJ6A 5CBAB 3FCBA 4PJGA 3QXDA 5ISZE 2DJ4A 1XCTB 3LQAC 1LO4L 5EZPA 1D7DA 1NGWA 1FVCA 1U92A 2H3KA 4PJGF 3L17A 1NC2A 2MEJB 3ZIMA 3TASA 3VI4A 1MCPH 1MZZA 2GTZA 1BEXA 4X8CA 2EZ0D 5GS0H 3K72A 3X3GH 5TQ0L 2WOBA 2OLDA 3LKQA 5CJQH 4AQ8C 5HHMB 3T4AC 2X89A 2ZF8A 1QVOB 2APBA 3L5XH 4HLJA 4UBDC 43CAA 1SF5A 3ZDWA 5FYKU 4TVPL 3VW3L 1HYRC 2P52A 2YZ8A 4GW5A 4M3KB 4S1QL 1AGCB 4LARL 1HVXA 1EVUA 2NXZD 3C09C 1WFJA 1CJYA 2GAZA 2X1XR 5T8IA 2BY0A 2A9NL 1MHHA 2FJFB 2HH0L 3D39D 2ZF9A 4EMZA 4JFXB 1RK1A 2JNZA 4PG9B 1C16A 4HPHA 1ZEAL 3V6BR 4BA8A 4TSAL 4EDWL 3BSHA 1LVEA 4GFTB 3K71A 4IOSD 4MX7B 5C0EB 1KJVA 4PRHA 5IJKC 3P4NA 3UBXG 2EVFA 1DBMH 3NCYS 3OR7B 4I0PD 5FM4A 3PV7A 4FHBD 2W07A 2YBGA 4H1LH 3EBHA 1BX2B 1EZSA 4NHUA 4QMEA 1FPTH 1UCTA 3PNWA 2CM6A 3T2NL 4CSSA 1PKQE 2XA8L 3L1EA 2YMXH 5KTEH 2O26U 4PMFA 3PXLA 1I7UA 3BSZH 1WITA 5T3ZH 4LVEA 3OKNB 3SDAA 5ICZB 4Q89A 4LLYB 3O9WA 3UTQA 2LOEA 1AKJA 4J3TA 2V5SA 4PJHF 4RMTA 2O61B 4KPHH 4HUKB 3JV4B 1GR7A 2OTWA 5IG7A 2FBRA 1AXTL 2WINA 3FMGL 1JZ6A 4U1KA 2PR9A 5TPWL 2ETWA 2OAAA 2FLRT 4KK6D 4RRPA 5EO0B 5HGBB 2NY3C 1C5CL 3GSWA 2R9HD 3MOBH 5C1MB 5HI5D 3ARZA 3GLEA 2GW5A 4X6CB 4F8NA 3WO3B 4KVNH 1U8IB 1E4HA 5GRJH 3FU8A 5C9KA 4Y7OC 2AJXL 1KB5L 2H1XA 3W0WB 5EEUA 4GQRA 4LLWA 4V1DA 4MA7H 4NGHL 1G7IA 4HH9A 4XPTL 3QFJB 4DVRH 3HZYA 3W37A 5HI4C 2BW4A 4FN0A 2Q20A 4IDJL 1U8JA 4R83A 2X53A 2EUZA 1PW3A 1H5BA 1QZ1A 5GSVB 3PGDB 4JPIB 1TVDA 3BUIA 4H8WH 1MI5A 3A24A 5C0CD 3OMZA 2PCYA 2VIRA 3WN5A 4NCDA 4GXUN 2ZUUA 5I2IA 1YYML 4RMUA 4KRLB 4DQOH 1EJ8A 3CN3A 3EG9B 4WFFE 4U3XA 3M46A 5PAZA 4HJGB 2NNCA 3LSOA 2G75B 4KRPB 3S5YA 3E9TA 3KXFE 1I9EA 3F01A 4PYGA 3U83A 2F8XC 4NCC1 1W16A 1M7DB 3FFCE 5E51A 1UA3A 2FJGA 1NFKA 1NWOA 1R3HB 2BIOA 2C3XA 3UBFA 3FQ4A 2Y7MA 5C09D 5E4AA 3TCXA 4U1HB 3BAKA 4XC3H 3V0EA 1PG7L 4JPWH 1JHLH 4GMTL 1DVFA 3BEWA 2YA0A 5HTSA 4KMTL 3T1FA 4GP8B 5E9DB 2F7OA 1P6AB 4ZUWB 1S2EA 1FRGH 5FW7A 1JGUH 1RK7A 4NIYE 1X9UA 4MNHA 3UAJD 1QTPA 2IALA 4RQQA 4HC1A 5JW5A 4JPSA 4DGVH 3O3AA 2P8PB 3PHQB 1ETZB 1AXSB 2CGYA 4A04A 2X40A 3U46A 5FWRA 3EJSA 4N0UE 5IQNA 4NDMB 2VKXA 4QTFA 5C08E 3GHPA 4QT5A 3OQ3B 3GSRB 1BXUA 4R90L 4C56A 4WFHE 5FYJE 5IFAL 1ZWIA 5DGQA 2B1OA 1FG2A 2K6ZA 4RMSA 4XNZC 4BFGA 4LSVH 4QYAA 5EBGA 5ENWA 4N4YB 2YLHA 3OTTA 3CDGA 1EBPA 5E56A 5T1LB 5T1MA 4Y88A 1OAXH 1I7TB 5CR1A 1YEJL 2WYIA 4K94C 3KPSB 3C5ZD 4H26A 4EI6B 1QI4A 3L1FA 4ENEC 3QZBA 3RG1C 2BOCA 2GSGB 2ZJSL 4WFGD 5K39B 3PCYA 1M6OA 2BSCA 3WN6A 1Q72L 4C4KT 3ES6A 3B9KC 4E2OA 3HI5H 5LCVA 1E8WA 4FQXB 2Y23A 4RIRB 3TL5A 5DUJA 3EGDB 3P0YH 4UTBA 5EWIH 1CICA 2G3MA 1WP6A 3UJTH 1KC5H 4HU2A 1YMMD 4QHNA 4NN7C 3FU7A 4YC2C 3T6VA 3GMMB 2NX5A 4XCCH 2IANA 2X3BA 2YPVA 3BXNB 3REWB 4ATTA 3G6JB 2AEPH 5F1IA 5EBWA 3L7FB 3QRLA 3TEXA 2XWJB 5JOFA 3BVTA 5D7JA 4F7CB 5C9JB 15C8L 2AITA 1P4BL 5DQJA 4UILL 4IRZH 4TUKL 3W5NA 1EAQA 2FWOB 4YDIH 4FMVA 3RVUD 4XO9A 2OSLB 3AC0A 4J3SA 3C9NB 2WCSA 2BSRB 5CGYD 1CIUA 2AMGA 1JPGA 4HIEB 4HOWA 3FQWA 4ONFL 1MPAH 1T2QL 4R97C 2ZAIA 3CU1A 3B2VH 1AS6A 2Z34A 5A2LH 4HT1H 5D7LA 5DQDL 3ILPA 5HGDA 1G0DA 3DX3A 3F62A 4G7YH 4O2FA 4E9VA 5IV2A 1FVDB 4XH2A 3S88H 3LKRA 4GSXA 2V2TA 1DN0A 9CGTA 3QUYB 4RZKA 5IWLC 3NP4A 1TVBA 1CXEA 1HI6A 2GT9B 4UU9B 1F6AB 1YMHB 1Q0YH 3CUPB 1N0LA 3JWOH 4HD9A 1NBVH 4LDCA 4UB0L 2VXQA 5DC9B 3LRSB 2VH5H 4U2ZA 5HYJB 5LAXB 5DMIH 1O9ZA 1T1YB 3ENEA 4YZWA 5BQDA 1OCCB 5D9SB 4Y9GA 2F53B 2XHNA 1BZ9B 3HC0A 2CCVA 3KPRD 5GPRA 4O9HH 2W80C 2MOVA 4LCUB 5DFAA 2JIXD 3NABH 2FO4B 1FAIL 2HB0A 2VLJA 4Y4HC 1AAJA 4EQ3A 5IQMA 4J3OG 3QJUB 1NKOA 3WCYA 3O3DA 1JXGA 1U8LB 2TSBA 1UWEH 4A7GA 5A2KH 5EZOL 2H0EA 4AVKA 1CL7H 1QHOA 2GVYA 3QORA 1PU0A 4FFZL 4A7GF 2ZPKL 4XP4L 3GZOA 1K4CB 2XTJD 3QDMA 4OJDH 1JZJA 3GMQB 4DKFH 1YEGL 2VDLL 1PEWA 4FNQA 4LRIA 3OL2A 4P23D 4X9IA 4JAMB 1F3RB 1YAIA 1OHZA 4KGJA 5HPMB 5KVFH 3U4EB 1QBMH 4JLRA 4QLWA 4HMCA 4ECNA 4XPAH 1IBGH 4R3SA 4LVHB 4BRVA 1AQ8A 3D0LB 3ZQXA 2MKWA 1IM9A 2X2IA 5B3JE 5FK9A 4Q2ZA 3AWFA 2YWYA 5DCCA 3DXAD 2Z31A 4HKXB 5IMKB 2ZXAA 1XR9B 1CDYA 4P5MA 1XGPB 3R19A 4DOHE 1RZKL 3G6DH 5CD3A 1QWNA 5LB1A 1F8TL 1QFWL 2DQDL 4NQCE 3CFEA 3V4UL 1XH2A 2V7HA 3GSUA 4MMYA 2VWEC 3C75A 2VSCA 3FQTA 3DVGB 2AV7A 1NCBL 4MD4B 4L1BA 1HCYA 5GXBB 1MUJA 4JM2A 5ISZD 1L7IL 4N24A 1DQKA 5D2LE 5FYKE 2OJZL 4XVUC 3HRZA 5E1AB 4X7SH 2HTKC 1E4KA 2WHVA 1SJEA 2A38A 4ZXBD 4BH8A 3SYQA 3WJMA 5LWYH 2NY1C 3GM8A 5I6LA 3CXDL 2A6KB 1J8SA 4HXBH 3X3GL 4AL8C 1G9NH 1S4IA 4PJAE 1TZGH 4OFIA 5CJQL 5IW1A 1YNKH 2NQCA 2GSIB 3S9DB 3L3GA 3L5XL 4JG1H 2VDMB 2E5EA 2CKBA 2DQEH 4UF7C 1OB1A 1SQMA 1WPCA 1U8QB 2F5BH 3VRJB 3NGBB 4L9LA 2BK8A 2WVTA 1A1MB 4WGWB 3NJGA 4KI5F 1Z9MA 2VITA 4IS6B 2X4PA 3ULUE 4GRLD 4U1LB 3NAAH 3K1KC 4N2GA 1OCWL 5E8OA 5B3NA 1S3KH 1KT2A 1WTLA 1PZ3A 1VFMA 4K73A 1TCRA 2NY6B 5BRPA 3QK0A 4E9XA 1AQKL 2YQBA 1LK2B 4L8BB 4AGPA 4G6FB 3AGVA 2EDXA 2B77A 2JF1A 4R4BB 4ZQTA 1G5AA 2XIIA 4QDGA 1CB4A 1FO0B 2RJMA 2EYSA 3UG5A 1DBML 3O8XB 5FGSA 3PAUA 1CQKA 2OMZB 4F9PA 1EJ6A 1GC1L 4HXAH 3KS0J 5IUSA 1X5IA 1X4YA 2YRLA 1AC0A 1UM6L 4MS8C 4U4BA 3MMEA 3TBTA 5KTEL 3BSZL 1A5FH 3CN0A 2E47A 4XMTA 3VGGA 1J5IA 1BZEA 3FQUB 2OFQA 2VN3A 2WC7A 2WN3A 1B6UA 3UTSA 4HKBB 3WS6C 3L3IA 3L7EA 4F24A 2FX9H 4EI5D 4MJIB 1G7PA 1NIEA 2B5IB 5CF3A 4HKJA 2A6IB 3NCFB 4E9WA 1RZPA 1KY6A 1XV8A 2EDDA 3Q8AA 4N6QA 5A3ID 4KVNL 1AZZC 3VFVA 3SEPA 2VR4A 1G9MH 4L5FL 5L0QC 1U93A 3VGAC 1KGYE 2FECI 4FQQA 3FFDB 4TL5A 4J6IA 4B9FA 2OMXB 4Y1AA 5IVXB 4I9WE 5F7UA 4G6AD 4X9FA 1W0VB 5HHXH 5JQIB 3PDOA 5B39G 1HSAA 2NNFA 1I8IB 2JJSA 3IKKA 3OKEA 3WDHA 3DDGA 4P2QA 2UUDH 4A55A 3PWPA 5IROD 3FU3A 4I18C 5E1QA 2ZXEB 4YHLL 2IPKB 8FABB 3NPSB 1BDYA 4TULL 4WFFD 4QRUB 1NCNA 2WXOA 2WN2A 3QI9C 3RKPA 1Z9LA 4NAJA 2AAVA 4PJIA 4U1GB 2ZG1A 3AAZB 3W9DB 4DQOL 4M56A 1DQMH 2AS5M 1VFBB 4AQEA 3KXFD 5JIDA 4CU6A 4KHXL 4K71C 2CHXA 2UY6B 3FFCD 3MUGA 2JK5A 2EDTA 1VGKB 4KJWC 3SQBA 1H6TA 1FJ1B 4F2FA 4Z5RA 4A6YL 1WVZA 2K9FB 2NXZB 2HFTA 4YHKH 1HSBB 4JFTA 2B59B 2CDFA 5F7EH 1CI5A 3EYQD 3FO2B 4GH7B 4NRXA 3D39B 3CZKA 2FLBT 4L3EE 4JPWL 2E86A 3CJJA 3IM1A 4A2DA 3GJEB 2EXWC 4M93C 1TSHA 1KIQB 4J3XA 1DSFL 2X9YA 2YD2A 4LIQE 5DEGB 1E8XA 2VDPB 1J1XH 3VVWA 5IW3A 2EEBA 3ESMA 1IZKA 1FL3A 2HFEB 4HZLA 4DEWA 4NO0D 4DZBB 3GXDA 3GMLA 4XAWH 5CM1A 5FCSH 2DWSA 4JZJA 2OW6A 2VLKE 1IAKA 1ZT4B 4FQLL 5I1DB 1SOKA 1ADQH 3IXAA 2X4SA 4WFHD 5FYJD 5JORA 2AQ2A 4DK3A 4Q9QH 2D7QA 3RPKA 1IBFA 3GC3A 5B39B 4H5SA 2JCWA 1E28A 4P4KC 5K9KB 4GG6B 4ZMYA 2XFGB 4E9QA 3OHXB 1A6UH 3OMAB 2JJUA 1FVEB 3CIAA 3QEUA 5J3HC 1QASA 4FQ1H 4P4RB 2DWEB 4XN7A 4I2XE 2F54A 4HP5A 2XY1A 4K9EC 1P5VA 3QUKA 1G0YR 3T0EB 4ZFOA 4MCZA 2YZ1A 4A67A 5E0QA 2W94A 4FXGB 1A3ZA 3V6ZA 4J3WA 4PCSA 3KL3A 1XIWC 2G3XA 1U58B 4EAEA 1L9NA 5D1ZB 1LEIA 1YJDC 4JO1L 3ESNA 3FZUD 3M1BB 4KJQD 4MB5A 3MLSH 1A21A 5DS8A 3P0YL 4M62L 3VGHA 1MG3C 3UMTA 1Z5LB 4LU5L 3GMPB 4ADGA 4EQ2A 1ED3B 3QSKB 4DT2A 4NNXA 3B7YA 1V3LA 1RMFH 4JL1A 3QWOB 4OGXH 5SWZA 1UYWH 1IAII 3F84A 5I75B 3G7TA 5CBAA 4E68A 1XCTA 1NSNH 4JQIL 4LKCB 2BCMA 3HUJE 3DTDA 3WFCL 4OGQC 4KKAD 1ECYA 4JRFA 3K74B 3Q48A 2H6UA 3QNYB 3D50A 3I9GL 4OF6A 2P5EE 1RURL 2WCGA 4YEFA 2EUXA 5F7LB 4ZW7A 1QVOA 2YEZB 3D3VE 1CFQA 2Q8BH 4TQ8A 4G11A 3WU1A 3O4OB 5C09B 3AJ7A 2PWGA 1IGTB 4TM9A 1YG9A 2C9QA 1F56A 3OC5A 1AGCA 4DP2X 1GH7A 3A6CH 5F72S 4PJ5E 1T3FA 2WZPA 1BZOA 3IS1X 3S88L 2FJFA 3UABA 3W2DH 4KDWA 4JFXA 3CWGA 4TNFA 4URTB 3QFDB 4XODA 5F6IB 4GP5B 1Q0YL 3AZUA 1UD2A 2Q7NA 1MCIA 2WGNB 3LZLA 1S7TA 3JWOL 2XG4B 5J8OA 3V0IA 2CHZA 4NWUH 3RAJL 3X14B 2YFNA 2AW2A 4R26H 5DMIL 1DCLA 3DI2B 4NAQA 4L3FA 5GISL 3RZCD 4MB1A 2DLEA 1JPSH 3NJVA 5C0EA 5CFHA 4LL4A 4LHQB 3AFLA 3OR7A 1WBYB 4E42A 2XPGB 5JO5B 1QHPA 2R0ZH 3NABL 1BX2A 2BIMA 4ODWB 2B7DT 3OKDA 3VG0H 4WK2B 1Q0XH 4N0YH 3V6OE 4HG4J 4QR7A 3X1GA 5C97A 2Y2WA 1H6UA 4CW1B 1UWEL 3HZMB 1H3XA 4YJZL 1F00I 2NZIA 2ZT9C 5F9WC 5D7KE 3OKNA 1XH3B 4LLYA 4N2IA 3DURB 2O61A 5IR1B 1I3UA 3ZGIA 1KXVC 1PJ9A 4M03A 3JV4A 5I28A 2FHCA 3HFML 1RP8A 4L3CB 1OW0A 1JZGA 4ZO8A 4ODSL 1ZANH 3KGUA 1QTSA 5KVFL 5EO0A 5CGTA 1CDHA 3H3PH 5HGBA 4XCNA 4XPAL 1IBGL 4K94H 4KJYB 2EIBA 4KXAA 4X6CA 1T2JA 3LD8C 1U8IA 4K4KA 3SPJA 3P4OB 4A7TA 4X6CF 1V8HA 3W0WA 1QWUA 3QWRD 1MFVA 1ETJA 2IDQA 4UOW0 4Y5YB 4WU7B 3MVSA 4WKXA 3QFJA 4NQCD 4LGPB 2P80D 3VX0A 4HIHB 4XXDB 2UXVA 2IDUA 1F6FB 4WLCA 4DN3L 1T1ZB 4L8SB 2JQAA 3DI3B 5GSVA 2DJSA 1CFVL 1YEIL 5AKTA 3PGDA 4JPIA 3UBGA 5DHMC 1WS7A 4CNIB 4BKTC 2YOAA 1WAPA 2V3EA 2WTPA 4HF5H 4U3SB 1DANU 4WCYL 4XMWA 4XXWA 4AKOA 5EF1A 3K4ZA 5FYKD 1Q9WB 5TH2B 5E24E 2EABA 5DJCB 2DMBA 2A77H 5KSVA 3ISWA 2R29A