2MH4A

Solution structure of the big domain from leptospira interrogans
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
92
structure length
92
Chain Sequence
MPAALVSISVSPTNSTVAKGLQENFKATGIFTDNSNSDITDQVTWDSSNTDILSISNASDSHGLASTLNQGNVKVTASIGGIQGSTDFKVTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the Big domain from Leptospira interrogans
rcsb
source organism Leptospira interrogans
molecule tags Unknown function
molecule keywords LigB-like protein
total genus 9
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2013-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02368 Big_2 Bacterial Ig-like domain (group 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2mh4A00
3NCXA 2MH4A 4AQ1A 4HU8A 1F02I 3NCWA 1CWVA 1E5UI 2L04A 2MOGA 2MQGA 2N7SA 4AQ1C 2ZWKA 1F00I 2ZQKA
chains in the Genus database with same CATH superfamily
3WHE1 2KQNA 3GXDA 2BHFA 4W9DC 1KEMH 5D2NE 1MHCA 3OMNB 3RNQA 5B1BB 4FMVA 4V2BA 4XMZA 4OFDA 5KSBA 4JPKH 3U4EA 3IJ9A 3FO2A 4OBSA 5CNHA 4S2SA 5ENWB 1B2WL 4JM2B 4QXUH 4KZEH 1MLBB 1NMCC 4Y19A 1T0MB 2IWEA 1DBJH 3SE8H 3VXTA 8FABB 3OGOE 3CE1A 1E7VA 4D0CA 4JREB 4X6DB 1QFWM 1ETB1 3PGDB 4N2AA 1PKQB 2NY6B 3VTAA 2KHAA 5T5FL 3D05A 4LSVH 3GMPA 3OL2A 1QI5A 4ZPTB 3UBHA 4FMKA 4KKLC 2NYYD 5TFSH 2F5AL 1T0MA 8FABA 1XZWA 4XRCB 1CR9L 1WS8A 4WTZA 4JGUA 1G9NL 1BVOA 1S4IA 3ULSA 5DUPL 3LB6C 2R0WL 1TJXA 1V3JA 1XR9B 3CZEA 4LF3B 1FYTB 4DN3H 1I1RA 4N8PA 4KTEL 1N6VA 3BX7C 4UDUB 5IJVB 3ULUD 4TN9A 3Q06A 3S97C 3L1FA 2PO6A 1XBDA 5J3HD 1T2XA 3TIEA 1AE6L 1QHQA 1BZ7B 2A2QT 3C5ZB 2X1OA 4XVTH 1KBKA 4NPYB 5FYKH 5I6NA 5EOCH 2I9TA 2BVPA 5DJ8B 3QAZB 1VHPA 1MF2H 3WKYA 4K71C 1XO8A 3MXWH 4XC1L 4BRVA 2Y5TA 2CMRH 1G9MH 4ODSH 2F5BL 5BVJA 3I2CL 3S37L 1TQTA 3MGAA 2XN9B 4OZHE 3KJ6L 1XF1A 4HJUA 2AEOA 4FFTA 4Y88A 3ORJA 2Z0UA 2P52A 2X10A 1BQ5A 5I6XB 3F7YB 2ADJA 3Q5YA 1EHLL 1D9KD 5CU5A 3AACA 2WCPA 5GGTL 3NPSC 3CQPA 5DZJA 4MMZC 4HPHA 2MMXA 4TYUA 4N2DA 3RPBA 1FJ1B 1U8MB 1EZLA 2FH6A 2CDGA 2WGNB 2OQJA 2OTWB 3KVDD 3N1GC 4QRUB 4UT6A 5HHXH 1J0JA 1UATA 1G7JA 1CLYL 3QEQE 4QTIH 3NFNB 3QFJD 4W81A 4I13B 2J6EA 4MVBC 1WZMA 2DY2A 3DO4A 1EDYA 5SWSA 3SQBB 1DVXA 4OZIF 2VOTA 1MEXH 2Y6SC 3DRQB 4IMLB 5LGHH 1CLOL 1AKPA 5JW5B 2ZX6A 2CO7B 5M95B 2AAAA 2DD8H 2XU9A 4JJHA 4JCMA 1WCQA 5EB9A 5E9DA 3SBRA 1SY6A 3CFBB 1HHKA 3UBGA 2DM2A 4GMTL 2KPWA 5DD1H 4G7QB 2KQMA 3ALPA 4UM9D 1PG7H 3WJJA 2YD2A 4CVUA 3CLFL 3ZRFC 3KPRB 2HJKB 1P9MC 3L3GA 3PXHA 2R56L 4PJ7E 3VRLE 3WJLC 3F62A 1QBBA 1XIWC 1BVKB 2VL5A 2APTA 5C3IA 2EDTA 3E2HB 3NDYE 4HEMA 4PJCF 5IHHA 1ZT1B 5C9KA 3LZFL 4O02B 2NOYA 4X7TB 3AADB 1RUQL 4N4YB 3ISRA 2DKMA 4GRWH 4JUTA 2VLME 4R0LA 4O2CA 2DBLH 2R15A 4FI7A 5HHVH 3QZWG 1TYRA 2ZCKH 1OTUD 1AGEB 2D4DA 1E4WL 3LXUX 5E6IC 3CFTA 4PRNA 5CN2A 1O75A 4BKLB 1KCLA 2Z7YA 4IS6B 3NCWA 2VNCA 3D39D 1GJWA 2AXGA 3ZQXA 1HEHC 1S9YB 4GMSL 1N8ZB 1X6NA 3FH8A 2L0DA 2P8PA 3OF6D 1HNYA 3QQ9D 5BO0D 1FVDB 1BD2D 4QXWA 5EUKB 4P2OC 5EZLA 4ILDA 1U8LA 2P46B 2EIEA 2K8MA 3C75A 3QIUD 5E99L 2Q3XA 3ZN6A 1UWXH 4E9WA 1J18A 1SVZA 4CMMA 5BMFH 3HZKA 2WVUA 4NC2B 5FO9A 2EIZA 3QDME 3UPRA 3POCA 3UGUA 3NACH 2BIHA 3SDDC 5LGHL 2Y3NA 3BPCA 4Y5VA 5SWZA 4N6RB 1E3FA 3MNWB 1DJXA 1H5BC 3U2JA 2N3JA 1F00I 4EF3A 3QHFL 4O2CB 4NNPH 2BIOA 4JDZA 3VG9C 3PABB 1OAQL 2H6PA 3QNZA 1AQHA 2DEWX 1B0GB 4X9BA 1E8XA 1EHLH 1EJOH 1PG7L 1LHZA 4FFVD 4WWID 1H3WM 4NN7C 3EYUH 4WWKB 5KVGE 1ASQA 2E5EA 3QRLA 1MIMH 1NCAH 4CSSA 4TQEL 1U93B 1CGSH 3H2PA 4GG8A 4IU3B 4MXWL 3QNFA 4KKBD 3P2TA 1THCA 5KSBE 4IJTA 3OGCB 1PZDA 3SE9L 1O7SA 4QF1B 4KX7A 4JG1L 5IROD 2YC1A 3GHEL 4OW6A 1DO5A 3TCTA 4JFDA 1VGKA 2Y07L 3MKKA 1JRHL 2FATL 3QJTB 3ULVL 2CJUH 3VXPA 2AJUH 1MIEH 4GP8B 1G7HA 3LKOB 4FULA 3QWRD 5HI5D 1BYPA 3QRGH 1SOSA 1HHIA 3O6MH 4XNZC 5DC9B 2K8QA 5HJGA 2H0EA 3UTTA 4X4YA 1RY7B 4NKQB 5AFAA 3L3OC 1I8IA 4ZFGH 1ZA6A 1GJUA 4OZGE 1G7IA 2X3CA 3RJDA 1IJ9A 4YE0A 1HEJC 4P4KB 4Z7UE 2PR4H 2OW7A 4U6XA 1K6QL 3VGEA 5F3BB 4BE6A 1XH0A 3ARBD 2CQVA 3GJEA 1E9QB 5E95B 1E8ZA 2H32A 3WFHB 5I0YA 1PLCA 4P07A 2XV6B 1ADQL 1BZOA 4Y5XC 2FBOJ 1KT2B 4HIXL 4ZNEA 3BCDA 4LPWA 4A68A 1WCBB 3V0DA 3TM6A 3LRKA 1H8LA 4WFHD 2GJRA 3U36B 4FAAB 1G7LB 3CFCH 2DMCA 1JPGA 1BM3H 1MI5A 2Z1KA 3DGGB 4N0CD 4A7UA 5MENE 2QZ5A 7FABL 2F19H 4AG4L 1UQSA 1LQBC 1UXMA 4HFWB 1BZ7A 2WLZA 3C5ZA 4XR8C 3TVMC 5IQ9B 1YNTB 1Y6NR 5DUPH 2CKBL 1ZANL 4YHYB 3WIHA 3VI4B 4H1LH 2A4ZA 1ZTXE 3RP1A 5AW2B 4EN3D 4KY2A 1FIGH 3QCTH 3NIDE 3ZQWA 4C4KO 3L2NA 3H6AA 4L29A 4OV6F 5F9JB 1OANA 1AGDB 2V17H 1A4JA 4O5LL 2MHAB 3VTTA 3G5ZB 3MHZA 5K59E 3HW7A 1OARH 4U1MA 2NY3D 4HF5L 3S8GB 3NSYA 4NQDB 3STZA 2MKLC 3PXJA 4H25A 5IOPB 4HIEB 4KUCF 2MIZA 4A7GF 3G5YB 4KHTL 2OTPA 2BCKB 4M61B 5LAXA 3OPZH 4U2YA 4A7TA 5DMYA 2Q3AA 1RK1B 2HP4A 3ESNA 4C59B 2XHNA 3C5SA 4FCAA 2KKQA 4HJ0C 3SY0B 5C0AA 3TNMA 1M3JA 1R3KA 1QQDB 4Z23A 1TDQA 4WTWA 1QNIA 3QFGA 3W56A 2CGRL 4YFLI 1DLHA 4JKMA 4JFZH 1QHPA 5T1KA 3NOIA 3OZLA 1TZIB 2C3VA 1KYFA 5ANME 4Z78B 4KO7A 4ZO9A 1SXNA 4IYKA 4XAKE 4QJ4B 1OGAB 2Y1VA 3K7UA 1DVFD 2MQ0A 4UNVA 3LV3A 2WLLA 3WLBB 3VM5A 1YJDC 2HFEB 5HDBB 1CB4A 5EU5A 4L48A 5F9OL 2EH7L 2BHZA 2AJYH 3VFWB 5GJTL 2F54D 3BESR 3P3TA 4DGUA 3MRMA 2MCMA 1J8KA 1URLA 2BP0A 4K2UL 5HDQH 2APWA 1MAMH 3WKPA 4NQUA 5F89B 2O5ZL 3Q8AA 5LQBH 1D9KC 5JHDD 3FT2B 4EZMA 3FFCB 4B9CA 1EDHA 1T7ZA 2VDNL 4N8VA 5IVXF 1ZLVK 2GJJA 4P4RA 4ZUUA 2R56H 1KWGA 5GS1B 2HVKB 1FZJA 3JWOL 4LCIL 4ZFFA 2YMXH 5E2WL 1KIPB 3G04B 3QI9A 2OYLA 2W0FB 4M56A 3S8WA 4IBQA 4OKVA 4E5XG 3D4CA 5KANG 3TA3A 3TBSA 5IW6B 4Z0BH 4Z7OF 1MEXL 4PGJA 2BJMH 3K71B 2J44A 1QO3A 3ZHFA 1MG2C 4XVUD 1MREH 4PIBA 2I07B 3ZX1A 1RXLA 2XJKA 2XTJD 3AT0A 4HHAB 4NRXA 5B38A 1G5GA 1JZ2A 4UAOB 2Z7UA 5LGKA 1L9NA 4YDVB 3FQRB 1MAJA 2HLEB 3ZW3A 1OTSC 3EGSB 1DJSA 1YYML 3PWPA 4RLDA 1KGUA 5CD5C 3MZGB 2LLNA 1T1WA 4GRLA 4FABH 5E4IA 2VYRE 3IN0A 3HN3A 3VXMA 5B7FA 1YRKA 3U6RA 3AU1A 2CIKB 3R1GL 3QORB 3HE6C 3N5AA 1J8HD 5FHBL 4RWYL 3QWOA 3DVIA 3KVPA 4WLCA 3QT2A 2YA2A 1U6AL 2X1XR 1RZ7L 3X14B 2D0GA 1GYWA 3PWPB 1U8JB 1DEEB 1WFMA 3MBWA 5IBTL 3F8UB 5HI3C 4FTDA 4YXLH 1TKWB 3WTUA 4MWFB 5KVGL 1FFPA 4Q9QH 1M7IA 2B3IA 2PPAA 3ULUL 1NGQL 3KLSA 5I6PA 4E9VA 1F86A 4NAQA 4F58L 5CSZA 1RLWA 1IBZA 1ZWIB 3GSOB 3VXUA 2NXZD 4XPGH 4U49A 4KTEH 5GGTA 4O4YL 4HH8A 1R6VA 1IQDB 3NRFA 3ZHDA 2DQUH 3S4SB 4E36A 4Z7VA 3AB0B 3VMOA 1F6LL 3WMQA 1G9NH 1MG3C 2F58L 3ZO9A 3FQ4A 4QLWA 3MV7E 3BIAX 3CVHL 1S7VA 5GZOA 1F4YH 5H35A 3BP7B 4PJGA 3UEQA 4EAEA 2J88L 3SDDA 5C0IA 2OX5B 2IEPA 4DGVL 3AY4C 5HGBA 1U8KA 2IPTH 5IQNA 5GZNA 2B08A 3PP3K 1QX1A 2IH3B 3NEOA 3E3QC 2LLLA 1OZTG 2ENQA 5I19H 3TZVA 4HWUA 4Z5RB 1OO2A 4OLVH 5FDWA 4G82A 2BNQE 4JFYB 1NGXA 3D9AL 3IDUA 1W6LA 1F8TL 3Q8BA 1DVZA 3QJFB 3L5WB 5IROC 3EF7A 4J3XA 4AZ8A 4B96A 3RX5A 1B2WH 5F1OB 3NIFF 5B39B 4HCRH 4GXUN 5BPPA 5C0RL 3VGAB 1JPSH 2BY3A 4Q89A 1SN0A 1GOFA 1CICA 4DGYL 3SDCD 2OMXB 4YBLB 1XT5A 1FPTL 3K5RA 3MFFB 1VENA 1L6PA 4G7YH 3WAJA 4TNEA 1C1EH 2AF2A 5EU4A 3DJZA 3VFVA 1IM3B 1E7UA 3BD3A 3K2KA 4NCDA 1MH5B 1E8YA 2P24A 1G84A 2IBGA 2JKLA 4ZUWB 4ABWA 3BZ4B 2DQ6A 3HRZA 3TV3H 5DMIL 4KVPA 2ZXBA 4WFFD 4AEHL 5I1GL 1USQA 4XMXA 1G1OA 1KGJA 2EACA 2MJWA 3CMOL 5TD4A 4XCFH 5J11C 1WFJA 3V7AE 1MJ8L 3OX8B 2G5UA 4Y4FA 4ZUVA 3IJYB 2XPGA 1LEIA 1WD9A 4HJIA 4OCSL 1S9VA 1RZFH 3QH3A 2ZP0T 1F02I 2XQBH 3LN4A 3TV3L 1YNLL 4L8CA 2FUQA 1G0DA 4K3EL 1OSPH 3CFJA 2FYVA 3DO7A 1QUNB 1XTMA 4V11A 3G7TA 3KYMA 4FERA 4XX5A 4HOXA 3TYFB 3KDMA 2QSCL 2ITFA 1BVNP 2JELH 4JFEE 3ZYZA 3F7RA 1J11A 3QQ4A 4KY1H 1XQ4A 4EI5D 5CFHA 5AB0A 5DMKB 2A6DA 2YD7A 3F04A 4JFHD 2V9TA 1N64L 2FEEI 1E6JH 1NUDA 3JSSA 3GB7A 2VQUA 3LRSB 3WKMH 3EBIA 4IDLA 5F6HJ 3I6KA 3M6DA 4PB0L 4ZOAA 5EF2A 1MCKA 4N3UA 4I1RA 1CXIA 2R0ZH 1P84K 1JXGA 1MFAL 1S7XB 2WLLB 2K9FB 5I6XC 1X5AA 5ILTH 1BXUA 3NJIA 4XP9H 3LJ3A 5ABZA 5DUBB 3HZMB 1UWFA 2BK8A 4P5TD 4FQLL 3IMRA 4X98B 4DGVH 3A4FA 2YARA 3F7VB 4U1JB 4ENEC 3PDGA 3C9NB 5J89A 2AXGB 1M9WA 4IK7A 4WCYH 5EIIB 4DKEH 4HJ0D 3PUCA 4PQXA 3QS2A 4GW1A 3VVVA 1KULA 4NDMB 5FIEA 3JV4B 3VD2A 4J7RA 4IRSB 1GMEA 4XMLL 5E2TL 4BK5C 2AEIT 5GGSA 5DWUL 3ZE1B 3ECQA 4APQD 2K6ZA 1KFGA 2C9RA 3ARSA 3IDJB 3REWA 4YSOA 1HVXA 1KEGH 3SZKC 4QRTB 1YDPB 2A74C 2FH8A 3IE4A 2Z7ZA 3O6LL 4H0GA 3HE7B 4LOEA 4UIKL 1JUFA 5FYKE 1C08B 1UM5L 4XH2A 1F41A 3NIGF 3QRFM 4S1QL 1NINA 1KYUA 1QI3A 2Y5EA 4ORGA 4JFFA 5L88H 1WYJA 2VSCA 4NPKA 4ENZA 3C5XA 5IMLA 2E75C 2B1HH 4KROD 3OM3B 2CAKA 2DL9A 4YUEL 3Q13A 3UBXI 3HC4L 4CMHB 4CBPA 1LILA 3DK0A 2DMBA 1UEMA 2G3MA 4Y19D 5E94A 5FM8A 2H2SC 4F3FA 3LH9A 4KMQA 3CDGA 4QMEA 1QFPA 4RRPA 4E9SA 2GFBA 4HZLB 3D5OF 4L1BA 4S1QH 3SKMB 5CLYA 9CGTA 3SBPA 2X9XA 3BKJL 3HI6H 1JD7A 1R24B 4WGKA 2DQFB 4HH9A 4YSEA 5ES4B 3VXOB 5JHLL 1BYOA 5EWIH 1AHWA 1ZHLA 1F1AA 2X12A 2LTQC 1A3RH 4PJCE 2ENSA 4K3GA 5CBEB 5IJVA 3QPXH 4ZNEE 3ZBMA 3FF7A 5JOFA 4RESB 1J5IA 3B3IB 3IU4L 4BJLA 2C1OB 1FBIL 3QUYC 4Z0BL 3AT9A 5TTRA 3MV8A 3BQUA 3ESMA 4ACPA 1EJ8A 3O4LD 1FWXA 2ZOTA 3BCFA 4WW2A 4BCYA 4XMLH 4XMUA 3CLEH 4LAQH 1KMGA 2JI3A 4OCMC 4XTRD 3STLB 4YBQD 4UU9B 1NC4B 5K1NA 3WUWA 1NIBA 1TLKA 5BZDB 3MJGX 1CDUA 4AZUA 1B0GA 1XD1A 1B4LA 1NKGA 4FXGA 1JPFA 3CCHA 3TBVA 4QLRA 4HK0B 2WBJA 2C9AA 4HWEL 4PH8A 4RAHA 4DEPC 1TENA 4JHVA 1KYOJ 3DGDA 3T0EC 4P9HL 4Y5VC 2OSLB 4CKVX 5GXBB 3DETC 5DZVA 1FUNA 5EF1A 5IQ7L 4XP1H 3MRFB 3LEXA 3MUUA 1JVKA 1WIUA 3MRNA 1LP9E 2OMWB 2EEFA 3ARQA 1FF5A 2BIIA 4KJYB 3WKML 5CM1A 1JPEA 4XP5H 4APQB 3RTQD 2ZX8A 1KJ2B 3MBEB 1I7UB 1UQSB 5LKNA 3V0GA 3BO8A 5C08B 2VB5A 1XF4B 1BZ9B 1N18A 3GMLA 1T0NA 3ZMRA 4WJ5A 2CE6A 1GYVA 3I3BA 1A47A 3GXFA 1MPAL 3TH4T 1SHSA 2AK1L 3BZ5A 1NFIA 4PGBA 1Y18A 4HETA 4OF8A 4JM2C 3U1PA 4LB8A 1Z3RA 1FZOB 4U1HB 1AZUA 2LHAA 5D7HA 5DF0A 3ZE0B 1MHHA 5HVHC 5IFAL 4Y9GA 1MCBA 5L0QB 3FNKA 1NC2D 4N9OB 4PY8J 4L9DA 3SPGA 1KG0A 2C9UA 2A7BA 3TCLA 4DZBA 2J12B 5BS0E 2BP3A 1CGXA 3BKML 5DHDA 3WXVH 1KJVB 1I75A 2I5YL 3CPLA 4C56B 4X7TA 2BZCA 1TJGH 4R4FH 3H85A 3CN3A 1IGJB 1MQ8A 3L95B 2B9AA 2EIZB 2HWZH 3ALWA 1BQLL 2JCWA 4O00A 5IHBA 1TO5A 4APQA 2IPTL 3GMOA 2WWMC 1F3JB 5DEGA 3ZYJA 4YVUA 4PN6A 2RR3A 2V5TA 3MLSH 1KJVA 2IMMA 4APXB 1CIUA 1KCUL 3ES6A 1TZIA 2C3VB 1CDJA 4R96B 4EI5A 1N7MH 1UOVA 4Z7WE 5F93C 4KKLD 3QEGL 4K5OA 3VYNA 3TT3L 3B7TA 2I27N 5HDOA 1BPLB 4A6YL 3LN9A 4ZXBB 5TF0A 3QG7L 3SQOH 5IHZB 4TS6A 3HC2A 1EA9C 2VDKL 3VWJD 3H7LA 4AQOA 1OXYA 3JT0A 2ZOKB 5AYUL 1ORSA 5KOMC 1WDAA 2VDRB 2NZIA 4K7PH 4B9GA 3GJFA 1X6LA 4PJFE 1NKRA 1ZIBA 3KPRE 3PGCB 3BAXA 4D9RD 5J3HC 4F24A 4MDIB 1CTMA 2VLKA 4L4VA 5D1ZI 1Q0YL 4MXQC 1HL5A 2A74A 5E94B 1KJ3H 4BSWA 1AIFA 4AYID 1HL9A 3X3GL 4C57C 1ZT4A 4M4PA 1IFHL 1NMBH 2DQEH 2X4SA 4M9PA 1YYLH 3VSVA 3W2DL 3MRFA 2J8UA 3MLPA 2UZYA 3EW3B 5C0EA 5ALCL 4GKNA 5IK3A 4U4BA 1DFBH 5AVXB 3P73B 5K9QG 3ZDXB 3MOAL 5I5RA 4Q4IA 3B34A 5DO2C 5J13B 3O6ML 4IBWA 3B2UC 2QVKA 3LX9A 4HKJB 1T0NB 5TQ2L 3K6OA 4J4PC 2GB2A 4HP5A 4TQHA 1RIVL 4WEBL 4YPJA 3CPUA 3UTSB 1XHHA 5CJ5A 1U8LB 1ZLDA 5HGHA 1GGIL 4AQ1B 5AW7B 2XVKA 2XBDA 3E6HA 3KL5A 4Y2DC 5D71L 3P9MA 3GJFB 5BRQA 2DI9A 2JTDA 5BZXA 2YXMA 4OLEA 3UZQA 3BAWA 5FHBH 4MXWH 4EUPG 1RPKA 2LW3A 4UDTB 4HCFA 2NY5C 3R0NA 5DFTA 2F53E 3UPAA 3RJQB 1RULH 2XRAL 2Y5TB 5ALBL 3PIQA 4HUVA 4WK2B 5DEJA 2SEBA 2I9LB 5F3BA 2WMPA 4ZDHB 5E4OA 4P4KA 2NY7H 2BVUA 2MCPH 3IDNB 1REIA 1FVEA 2JCCB 2NSQA 3RUGB 3T8XA 3BQVA 4BUHA 1W16A 3OR6A 5C07A 3O8XA 4KAQH 1IBYA 5TDPB 2X87A 2V3EA 3LRLA 3NIFE 1K5NB 2ZXEB 2ICWJ 1T66C 2APFA 3BO8B 4ZTOH 3SO3B 1UB5A 2VDQL 5ILTL 4L3CA 1I1CA 2UZXB 3MN8A 4UM8A 2R0ZL 4WFEE 2X53A 1LE5B 3B9DA 3F58H 2BXYA 3GLEA 2PXYA 4IS6A 2OJZL 5GS0L 5LB1A 1PSKL 5FLVA 3TJEL 2DJ4A 3HR5A 1XWVA 5DT1H 3O3BB 1RZJL 4UV7H 1BZEA 3A4EA 3C60C 2VISB 3Q5OA 2D7QA 4DVBA 4FQCH 4JZOA 3VD5A 2AAVA 4YDLC 3CIQA 5AG9A 3W38A 4RH4A 1WC7A 4LQFH 2XWEA 3NP3A 4Z7WB 2VE6A 3AXLA 1S9XB 4XHJD 2X2UA 1AOZA 2DLFH 2W88A 5GHWH 3PV6A 3AU0A 32C2A 2EH7H 1U8CA 4Q6IB 4QRPE 2KS0A 5DD6A 5DJYB 3TN0B 3ZL1A 3RTLA 5T3ZD 5I1LB 1HIMH 1JXKA 4Y4HB 1X5IA 1UA7A 4PY8I 5DGRA 1A6VH 4QRRB 1Y7VA 3H6JA 5D1QC 5BJTA 2VLKD 4O5LH 2HJFB 1WHOA 2HVJA 2OMXA 2W9LA 1WBXB 2V5YA 2JV6A 5CCGE 4OF3A 5DHVB 1HE8A 3CZSA 1A7QL 4X8CA 1P4LA 4HS8H 4H5SB 2DD8L 3KWWA 2VR9A 3HRZB 4HLEA 1J8RA 3OPZL 5F97E 1S7SA 1QSZA 4UTBL 3GO1L 4G1EB 3FUFA 3QFJE 4G5ZH 3MLXL 5FXCH 2W38A 4YDZA 1DQLH 2H6OA 1J5OH 3A5VA 1N5YH 4XMWA 2WV3A 3L3KB 3O4OC 4JLRA 1JHKH 3U2SB 1U8HA 1HWHB 3DX8B 4L8CB 1PG7W 2IXQA 3E7JA 3NFPB 4TQIA 4ZYKA 3MJ7A 4PGCB 5J4MA 1JL8A 4FNSA 2HX8A 4W4OA 1BEXA 4LNRB 1F4YL 4AKOA 1ORQB 4KQ4L 4OF6A 4HKJA 3J2PA 1ADQA 1LO5B 1J1PL 1L9RA 4EVNA 5IIEB 1U92A 1J88A 4FFZH 5J6GA 4OQTA 3F6JA 1EHAA 4AC4A 4YSAA 1EXGA 1QFWH 1U42A 2Y0SA 3R19A 2K7QA 1VGEL 3DUSA 4P5MA 5AUMB 4M7LL 4APXA 1BWWA 3TTSA 1LO4H 1ZA3A 1AQ8A 1TZGH 2OJEB 4XPHH 1RUAH 2J6WA 1NCTA 1TIUA 2JJUA 3BH4A 4GSRA 2VUKA 3MI6A 1LO5A 2VN6A 3D08A 5IIEA 1QO3B 2GTWA 2PYFA 3GNMH 3M1OA 2EEBA 2F54A 3OJVC 4RETB 3K71A 1Z6JT 1RERA 3QDJE 4IOFC 2JI2A 4LVHB 5IJKC 1DUYB 1WZ1H 5HHQB 4EOWH 5EG6C 4AGMA 4ZPTA 1E6OH 3VWKA 2J56A 4CGTA 4XPFL 3U2SA 4XHQA 4MCYB 4P23C 2ADJB 5B1JA 3QA3A 1FFPB 1KB9K 3TLRA 1YJDH 1MLCA 4PJHA 2F5AH 3T4AB 3FU7B 4AYFB 1KLFB 3CN1A 5FGSA 4S10A 1WBZB 5F7DB 3B5TA 5TE7L 4WUUB 3FFCA 3GEWB 1OHQA 1FNEB 3TYFA 5AVTB 1JZ7A 1XXFC 4LCUA 4Z3EA 4NQED 3FRPG 2FNWA 5D4QA 4XB3A 4OIBA 4IBSA 1J5OL 3D85A 3OKYA 4EKJA 3TESA 2WWNA 4KNQA 4KK6D 4PJCA 3MCKB 4RDQF 3SE9H 3WSQL 3FCUB 1UOWA 3D34A 4UTBH 1OAZH 4G8FA 2VN7A 2YLHA 2GG1A 2E9GA 2WIIB 3DX9B 2AMGA 1SZNA 2A6KB 2QZQA 4Y5YB 1CGSL 4QYOB 1IZKA 3L8QA 3CHRA 1IM9A 4WU5A 2COQA 3LSOB 1QEXA 1MH5A 2N1TE 4KDTA 5DS2A 2J4WL 1JDAA 4URTB 3MACH 3S3CB 1CGYA 4GI9A 4PJEF 3VW3H 1XGPA 4UQEA 1S9XA 1UGKA 2R7EB 4DPBX 4Z7VF 3D50A 4PJ7B 4DGWC 5EOCJ 2E74C 2Z6FA 4ZUTB 3JWNH 1IFGA 1D9KB 3S88H 4QI3A 4XXWA 1FVEB 2JCCA 3OXRA 4OD3L 2GIXA 3SEPA 3P3UA 4GS7C 4HUWA 3DVGA 3QNXA 4F1SA 1KB5A 3K6FA 1DVQA 4JO4H 2V0AA 5DJAA 2EDEA 2ZKHL 3FS9A 1ACXA 2YR3A 1X5XA 4N26A 3RWDA 5KVDE 2YQGA 4JDVA 1WGVA 3P0VH 3IRZA 5DO2D 2CWRA 2ZG2A 1XIWD 4HSCX 4U1KB 3IFLL 1CU4H 2NY5H 3GPEA 5IMOA 1LE5A 2B4CC 3II1A 4LVEA 4XB7A 1R3KB 4UOJA 4FLSA 2OL3L 2BSSB 4WDIA 4FF9A 1E90A 2Y7LA 3EOAA 1DUYA 2HH0H 3GSQB 3V7MA 4GQ9L 1FC1A 4JY6A 1JPFB 1CD1B 5D1XE 3T0DA 4Z3JA 3TA3B 3TBSB 4C4KT 3PAZA 4L3ED 4BYHA 3NPZB 4WJKB 2VRKA 2RHEA 1SEBB 2AKRB 2IPUG 1W8NA 2IQAA 1XGZA 2Z4TA 4JQIH 4R0LC 4UNUA 4Y4HD 4QOKA 2ZXQA 4JO4L 3GLDA 2Y2YA 5I30H 4TNGA 1QSEE 2Z35A 2CHZA 1RUQH 3VA2C 4OFQA 1FNGA 3ZO0A 5BS0A 1FIEA 2IGTA 1N3NA 1T66D 2PKDA 2QHRH 3NEXA 3QUKA 3WS3B 3RDTB 4N2FA 4EE2A 4FTVB 3U4KA 1J0ZA 1UXLA 4UTAH 1NLDH 1OAJA 2XIDA 3G3LA 4M1CC 1X4ZA 4JN2B 4G7SB 5I2IB 2MCPL 4LOUD 1YPZE 2IVFC 3NG5A 1MJ7L 1NCUA 1QA9B 1BP3B 3ARFA 4MNQB 1F56A 3ILQC 4XC3L 1ZLWH 3SDYL 3CQFA 2DL2A 2WSKA 3VH8G 5B39A 5C0CE 2EE2A 1RV6X 1ZV9A 2DW5A 1IGYA 2YD0A 1IAKA 3DNKA 3I3DA 5IKCB 2X89A 4UOW0 4XCNB 2OMTA 1VCBC 1QR4A 1GGCL 5C0BD 3GSVA 1CN4A 1X4XA 4YAQB 5IVXA 4LLMA 1Z9SA 4GW1B 1YMMD 1CXLA 2R29H 2R2HB 2J1WA 2YSSB 4W9LC 5F7YC 2CHDA 5KBLA 5LGYA 2YPLE 5AVVB 2OP4H 3O3AB 5F1IA 4QRSA 5DTFB 3IAPA 5AWNH 1D5MA 3DMMB 4GAFB 2EYSA 4EZKA 2F7OA 2YGNA 2CUMA 5IKCA 1P1ZA 2CK2A 4J6RH 5DUBA 2Q0ZX 3TURA 2IOOA 2ZNXA 1UD6A 5GRVL 1AD0A 4JRYA 5CJBA 2IG2H 5GRUH 2IGFL 5F3HA 4Z76B 1PZSA 1NM9A 4JN2A 4L8SA 4WWKA 4QIRA 1MCNA 1IFHH 3DX1A 2XY2A 3FTVA 2D7PA 3PHSA 1AQDB 5DFWH 4NM8H 4B7IA 3P4OB 3PPSA 3M8OL 4NO2A 2ZKWA 4JDVB 1JERA 1ES0B 4HS6B 3MSPA 5FGCE 2A83B 4B5EA 4MNHB 1BF2A 3LPPA 1CGTA 2YC1B 5KS9F 4U1HA 3PGFH 4PU2A 2ODIA 4XVTL 1PPIA 3K1KC 3GMRA 4MCZA 1PCXA 5DHYA 5AWNL 3GSNH 5DURD 4WENB 1DE4A 1OKEA 4A7GA 2YFNA 3S36H 1DQLL 3SDCA 3GK8L 5J5EA 2BWDA 2UZPA 1HYRC 1AGBB 2JLPA 3A6CL 1QNZH 4FQXA 5EZIH 3FN0H 1DQVA 2HFGH 3NJNA 2R7EA 1IGJA 3Q1EA 3S96B 3CZFB 2IALB 5EBLB 3DLQR 4FQ2L 3FQUA 1HJBC 1NOAA 2F9BT 2GBTA 2NNXA 1L6ZA 3VYPA 4DFHA 4M48H 4YFDB 4B60A 2NUTA 1T0PB 1K3IA 1J05B 1R3LA 2VDOB 5GGUB 1U3HC 5AD0A 2XTLA 1WFIA 4RZCA 3CZFA 4HWBA 2BCKA 4M61A 3WFEH 4K15A 4OM0L 3PXLA 3DURA 5ECGA 4CJ1A 1SLUA 3C5SB 2QHRL 2IFFH 3MLXH 1NGPH 43C9B 3DGGA 2GEEA 3BSHA 1WS7A 2HCZX 4EN3C 5EBWA 1Q0XH 3FQYA 3GMLB 4JKNA 3EOAB 1R1CA 2Y5QA 5EUKA 3C6LA 4HIQA 3GRWA 3KS0J 3GIZL 4OLZH 1B88A 3LRMA 4DERA 3MRNB 4GAGH 5D2LB 2MEJB 1DQQA 2QEJA 4YL9A 5EC1A 3FQUB 1ZSHA 4LLDB 4NJ9H 2ZUQB 4J23A 3C5JA 2F1AA 3QULA 4ELKA 4ODBD 4X6DF 1RZGB 3UZEA 1RUKH 4Z0XA 1Q72H 3V0JA 1G7IB 3FT4A 2HPOA 3F58L 1I9EA 4Y1AE 3MCLH 3QR2A 1YMMA 3JTTB 4S1SH 1E27B 3ARRA 3MV01 2F1BA 3SKJL 1BFTA 3VE0B 2BIMA 4BH7B 5ESQB 3MX0B 5JNYB 3V4PL 2J25A 4A7QA 2O5XH 5KSBF 3V0EA 2BNRD 3GKWH 3QVAA 1PG7X 2XXCB 4LLMB 5DT1L 4WFGE 2VN3A 4HWZB 2FEEL 3FFDA 2GHZA 1DBMH 2GK0A 4Y5XB 1FZMB 2FIKB 3TZVC 1XB3A 3WO3B 2Z0BA 3OF6A 4NUPA 1EWHA 2NDFA 1NFDA 7PAZA 3B43A 1A1NA 1H9DA 4YZWA 2CZNA 2R4SH 1CFSA 1V3KA 3QUXB 1ND0B 1I9JH 4NPYA 4JFHE 4N6QA 3UERA 2WXGA 3LEVH 3MRCA 4FQ1H 4MZIA 3LZQA 4CSZA 3RNKA 3FB6A 3FCBA 3BVNA 3U83A 5IGXL 4XT1C 2VLLB 1LMKA 3MNWA 3V6FA 1Q9WA 2VJXA 2QGCA 1LK3L 3B2PA 3AW5A 4X7SH 3VRLF 4ZMWA 4DP2X 1OGAE 3GUFA 4LQ1A 3UBXG 2ZXCA 4G8GD 4QF1A 1UUNA 3BEVB 4OQ1A 5FV2A 1R4XA 4RDQG 2H32B 3BWAA 1KCVL 2YBGA 4RFEA 5HVFB 3ZKMC 3UJIL 4JHAL 4E9TA 5HPMB 3ABGA 1XF3B 1E2ZA 4DN4L 2DB8A 2EE9A 4ZODA 4F2ME 4WZ9A 3GMMB 5F70A 4HWZA 1GPOL 3Q1SL 5D6CB 3ZDYE 4OZIB 1KWKA 4Z77B 4JJOA 5ISZA 5CZXD 4M5SA 4A66A 3QXTA 4J1UB 1HQRA 4JG9A 4MVBD 3EO1A 1UXWA 4U1NB 1QRNA 2N1KA 3KCPB 4IEFB 1KEGL 1VZHA 4PWHA 5LBSH 3IDMA 1TJMA 4PJ5B 4PVBA 2DQHH 3MRDA 4OLXL 1UURA 2E46A 3K46A 3QDJA 4WHDA 2JCCF 2ED8A 2IANA 4JRLA 3RY5A 5AAWA 3P54A 2IDTA 2ZF8A 3PDOB 3OKOA 4UT9L 2H26A 1IKNC 1TUPA 2I7SA 3KLAB 4EBQH 2EKJA 3U6XS 5FO9B 3VD7A 3L4XA 2HLFC 4FFZL 1FI8C 3DX7B 5CGYD 4ADIA 4HV8A 5E1GA 4FQHB 5CN1A 1TTFA 4M9OA 5IFJB 4KQ4H 4E42B 2ZOLB 2PR9A 4U6TA 3HLKA 4PWFA 1BEYL 3UTSE 1KTDB 4UOW1 5LHDA 1HXKA 2PCPB 4NHUA 2AJ3A 1X7SA 1IARB 1AR1C 4FFWD 3ZDWA 3TO4C 1AS6A 2BMKB 2EZ0C 2CLVB 2UZXA 3QUMB 3IYLW 1TQWA 3FCTB 4ZUUB 4NWUH 2X6BA 3RWFA 1I31A 1OGSA 1PDKB 3L1OH 3V0WL 2ZE0A 3I6SA 1NCIA 1P4IL 2GPZA 3PWUB 4KX8A 3NJMA 4G42A 1GZPA 4C47A 2AEWA 4NB7A 4HDIA 3X13A 3EYFA 1GGUA 3BOVA 4AL8H 4A6YH 3AGWA 3O3DB 1M3IA 3DMMD 3IDIB 3ZT5A 1MNUL 3QZWA 1N7ML 2WLKA 3SO5A 3UC2A 2Y23A 5I1JL 1MCCA 3MLSL 4HUVB 4KDWA 4RAVB 3FU8A 3IGLA 3LV3B 4I88A 4UT6H 3OHXB 1C8QA 5F7DA 3U82B 3LDBB 5I75C 2FB4H 4NQDD 1E0OB 3EJSA 1B0IA 2Q1EA 5JPNC 4B9ZA 3CSTA 4I77H 5HPOA 4BFGA 2WXPA 1IZJA 1PBYA 3RFZB 2ZPKH 5C0BE 3D0AA 1W0VA 2FQDA 2F0CA 2ADFL 4D0BB 5IQMA 1N4XH 3CVCA 2YEVB 1GIGL 2B2XH 3HHMA 3PE9A 4F7TB 1MJ8H 4MJ6A 3VXSD 4UAOC 1FCGA 3GM8A 4MA8L 3DJRA 3H3PH 1CMOA 2C9PA 4I3SL 3ZTCC 2QDWA 3L7FB 5HD8C 4MTMA 1R75A 2EDLA 5TGBB 4JNXA 3ZMNA 4OJCA 2GBUA 3QUHA 3PAVA 3HUJF 3CDZB 4G9FD 4R83A 5FO7A 4AYGA 2XA3A 3X1FA 5CEXA 2AEPH 5IG7B 1E9OB 5EZPA 4PV1C 3Q0HA 2VXTH 2WB7A 3OAUL 4PEEA 3MLZL 5EU7C 5LBSA 4YWGL 1M56B 1JPSL 4G1EA 4X50A 3BAKA 4LDOB 3FU7A 4XPAL 5DVKA 1H0DB 1ED3B 3THMH 1W72B 1YN7B 1XF2A 1EERB 1Q94B 2Z31C 2YQBA 1H6UA 4XPBL 5KJ4A 1F8TH 2DH3A 2F7QA 1WIPA 2G3XA 2DQIL 1N0XL 2ZXGA 4UT7H 4QOKE 3BZEB 1KTCA 1U8HB 3NZUA 1ROCA 4Q9CA 3WIHH 3S0PA 4NZJA 4EXKA 4G43A 1UADC 2MKWA 3DUUB 2X2IA 5BS0D 4JPVL 1U2CA 1SMDA 1H3PL 3FQNB 4WKXA 4AIEA 1IL1A 5MENA 5L4IA 1YN7A 2MPAH 4QJ5B 1UH4A 4LLWB 3SGKA 3RL2A 1JWMB 3DJTA 4Y4HA 3EHBC 5A2KH 2R69L 5INCB 5JA8B 1LEGB 4XNQB 2PYEE 3D69A 1UJTA 3CD4A 5IP4A 5FYJE 1UJ3A 3PU7A 2APVA 5FO7B 2VDOH 1RL1A 5D4JA 4H0HB 2FTAA 4PV8B 4JDEB 1NWOA 5D93C 3P0YH 3QIWA 2OL3A 2ZWNA 1NFDE 1DDTA 3SIKA 3VVWA 3MO1A 1YECL 2CBTA 4KTYA 1F42A 5J06A 3O45B 4XMKH 3N06B 1XSJA 5EN2A 5LWYL 12E8L 2OZ4H 4UINH 2R8SL 1QR1B 1T1WB 1BIHA 5DQ9A 1E4HA 4UNIA 1QASA 1NAMB 1LO0L 3UYPA 4M1GH 1T5XA 1E9OA 4NP4H 4ZW5A 2RCSL 1D5IH 4I2XA 1NBYA 4FFYL 4EDXB 2YHGA 1N5AA 3BDYH 4H44C 3FQRA 1WA0X 3BW9A 4KK8D 5DRNB 2FL5B 1DJWA 2DDQL 5A2CA 2Q8AL 3CJJA 1JSYA 3KGUA 3OAZH 4Z5RA 4BFKA 2X38A 4JFFD 4YDNA 1HZKA 1PAZA 3KE0A 2ED6A 1NTDA 2DKSA 3S48A 2EVFA 5HDLA 5BVPH 4BSVB 5G4NA 3TBWA 4HWBH 5INDA 2ZUSA 2ZSWB 1E30A 3TX4A 1NQBA 4TLTA 3X3GH 1OAXH 2BSSA 1NPJA 1PZ3A 1ODUA 1WBXA 2X4TB 1I8KB 1FV1A 2EUZA 3BP4A 2J55A 4JPVH 5JPNB 5EV7A 1QZ1A 1IEHA 3K4DA 4LCWE 1CTOA 4XP9L 2IPUK 2BJML 3KPQA 3HZ3A 3SPVB 5ACLA 2AFNA 3MOBH 1NGZB 1WTLA 1FDLL 5LN4A 6PCYA 3RBGA 2ZYSA 1JZ6A 5CJQH 1DBML 4BFJA 3SQOL 5D1XC 3RAJH 3O81A 4FN0A 1OE3A 2AVGA 2C3XA 1JZJA 2AK4D 5JW4Q 4PB9L 5DFVC 2JELL 3O3BA 2VXTL 4L1HA 4UWQB 3KCWA 2VLJE 3N41F 4H88H 4PJ7A 5KYYA 4H8VA 4FNPA 1PZ2A 4LO9A 4AZ8B 1I8MB 2FE0A 1TO4A 3B37A 3ML9A 4HXBH 5C08D 3C8KA 2AABL 3AC0A 5EU5B 3TBBA 5DEFB 1DL7L 3RI5K 2IH3A 2XQBL 4K9EH 5E1QA 2WQSA 4WI0A 2NUPB 2FBJH 3PNRB 3X11A 1T7WA 4TVUA 4PBVC 3H3BC 5JPNA 1AKJB 4Y9EA 1PD1A 3VDAA 2C9SA 2WLYA 2VDLH 1UKSA 1YSOA 5LO7A 3VX0A 3VSTA 1KZYA 1JRHI 4Q2ZB 1BG1A 4GUPB 4L23A 4ABVA 4UB0L 5TDNB 3M88A 4YHIA 3U6XA 3OV6A 5BZDA 1XF2B 3O6FD 3X13B 5D7LB 2XWXA 2E7MA 1BQHB 2F7PA 4MYWB 1C12B 4M8VA 4OZGF 5KZCB 4F7EB 2GT9A 3KD4A 4DQOL 3WOVA 1NBYB 3SPVA 3HLAA 1DZ0A 3PWNA 5I5IA 2FGWH 4U0RC 4AL8L 1GKOA 4QNPF 3TOPA 4V1DA 4EI6B 1BLNB 4JG5A 1P9MA 1BG9A 4CVXB 2IFFL 4ZSOE 1TTUA 3DX3A 2HJLA 1BQHA 5AAMA 2VRAA 2OA9A 2JWYA 3HTLX 3WFBH 1BMWA 5CEYA 1SY6H 2VDML 3S7GA 1SF3A 3V8OA 2Z91B 3K2MC 1CG9A 1XR8B 4RA3A 4NBZB 4MSWA 1HYSD 3EBHA 4JPWL 4Q4EA 5CUSL 3FTGB 1JWUA 5F1NA 5GRJH 3MRBB 3MRHB 4K55A 1LEKB 3L3DB 3UBFA 5E9AA 4QRUA 4WWPA 1OT2A 3UBXB 1KJMA 1LLAA 2QJDA 4JFSA 2VL4A 2FJHB 2IPKA 2DYSB 4TVPH 6CGTA 5IW1B 3OTTA 4LEXL 2Q86A 3UYRH 4J3OF 1Z1WA 1L0QA 3B8YA 4K5MA 4P2OB 3RAJL 4OZ4A 5GRXG 4I0PC 1RKRA 2NXYD 4X98A 4XNBA 3WNOA 2RTTA 5IG7A 3MBWB 3WFDH 3QR1A 1RZPA 2LU3A 4MYPA 4JE4B 4IIQC 3FYIB 2EIKB 3O2VH 2FO1A 1M6OB 3EG9B 4NWUL 4P2QE 1XV8A 3LD8C 4BSWB 3MOBL 1FA4A 3UYOD 3JTTA 4GRMA 3L95A 4MNGE 3IMTA 2RJMA 3UCQA 1I3GL 2YD3A 1I3RA 1U0QA 3O9WA 2ITEA 4GRLB 1JZGA 3DXAB 2I7OA 4WK4B 4L3EB 4M5YL 4PLKD 4KKCC 2VJ0A 5F9WB 1U6AH 1F3DH 3GBNL 4U7SA 2D2CC 1EEQA 4OCYL 1OP4A 5HYIA 3MRLB 2WCGA 5ADOH 4A2FA 1J5HA 2GTZA 4LKCA 5E2UH 4KMTL 3VWJC 4F15C 4TTDD 4NKMA 3T04D 4PRHD 1E42A 3MLVH 4PJBF 1I7ZA 4EN3B 5EEUA 1E8WA 3HFML 3IWUA 5G4OA 4NQEA 3DYOA 4QRQB 1AIZA 4GFTB 1JI2A 2YJLA 5FHAH 5A2LH 4I18A 1JNNL 2V7NA 5FKPA 2OMTB 3V6ZB 1UCTA 5L2JB 3ME0A 3ZJAA 1BF5A 1TCRA 2VUYA 4HULB 5F6IC 4NQSB 4OU3A 1MJJA 5ADPH 4PJ6A 5SWQA 3W5MA 2BSRA 4JO3L 2VR8A 3X17A 5KSVB 4UIKH 3IB4A 2KMWA 1HSAA 3U0WH 3RYMA 4KZ0A 1NCNA 3AITA 5FYLE 2J7LA 3GMRB 3PAYA 4N2GA 4IDJL 4U1LA 1WVZA 1A7BA 4MD4A 5A2JH 1GS6X 5C0GB 1WFUA 4FKKA 1HHJA 5EUOF 1OP5K 2YD9A 4EDWH 4FFYA 1J10A 4HLZH 3TT1H 3GS4A 3L3OA 2D3JA 1BLIA 4XO9A 4N0YH 1AQDA 5D9SA 1XL6A 4DP4X 3FPXA 2D31A 4UQIM 2Y6TE 2Y7SA 3MLWL 3QHFH 3QUYA 4UTAL 2MPAL 3OX8A 4GSXA 3RWIA 2XPZA 1I9IL 1CXFA 3EFDH 1UZGA 3KLQA 3ELQA 4Y9BA 2OMWA 3TBWB 4YQXL 1P7QA 1UD8A 4OFPA 5BNXD 4GBXB 3UMNA 3IMUA 1IKNA 3BWUC 4RBPH 3SDXE 4B9FA 1NGYA 3IDMB 1KXHA 1R9FA 1PGRB 3NJLA 4NKDB 4I3RH 4TVPE 1CQKA 2DLEA 3MDJA 1OP9A 4FHKA 4JRYE 5HVGB 4H8UA 5IQOA 5DJ2A 4LSQL 4MMZA 1KYDA 1U8IB 4BFNA 3QFDA 3WUWB 2E7BA 1A6ZB 1ZY9A 4X6BA 3JVGC 2YWZA 3UAJC 3E1ZA 4DIXA 2N7BA 1CCZA 3IS0X 4YSTA 1A7OH 3P0VL 4HA1A 1DVFB 2NTFB 3PYCA 4YHOL 1U8PB 3HBQA 2UVEA 4HYTB 3EUDA 1KY7A 1QRND 5CP7B 4FE9A 3AG1B 3V0IA 5F8QC 2WXHA 5C0BA 3TBYA 4OCSH 2EDXA 2BNUB 1NGPL 4UQDA 5A2IH 4BH7A 1Z2KA 4FTVA 1ETZA 5ITBH 3G6AA 2WBWB 4H13C 1BBJA 3QBTB 1II4E 1JF1A 4HF5H 3KM2A 2NTFA 4DK3A 2X4QA 1V8HA 3ARFD 3NJFA 5IW1A 2C1PA 4XOEA 4N5EC 4A2DA 4G72B 4PD4K 3EKCA 2BVPB 4YHKH 1HX0A 4PFEA 2UY6B 1TQVA 3EDKA 1MCPH 1P84J 4CILA 4DPCX 4X4YB 2J4WH 3FO0L 4N1EA 1KGIA 2OZ4A 1G7JB 4OLZL 3B2VL 3AG2B 25C8H 3L1GA 4G7YL 4ZFOA 4NO5B 1EO7A 4RAUB 3SCMD 2EDHA 4K23H 4LSRH 3QHZH 2NW3A 4WDIB 5FYJL 2C1PB 1G7PB 4MLSA 2WQXA 1Q0XL 1XAKA 4WW1B 1GMIA 3B9AA 4LEOB 3UIYA 4TVSa 5DHMC 1F4XH 2PUQT 1BVZA 1ZJAA 3GEFA 3T0ED 1E40A 4NFDA 3DTUB 4XNUL 2WB1A 2NY1C 5C97A 1AIFB 1DP0A 3CXDH 4TNWF 4KH9A 2J2ZA 2A74B 2P1YA 5DVLA 3MNVB 2NNAA 2B0SH 3MOQA 3IFPA 5CLZA 3QUMH 1Q9LB 3NQIA 3HEIB 4PJXE 1NCGA 5T1LB 5MHSE 1JYXA 5CIPH 4QHKJ 5E8DH 5TGBA 1ADQH 5CGBA 1AVAA 1PTZA 1GZPB 1ORSB 5GJSH 3HCVB 4I4WA 5JA9A 4FKEA 3O6KH 2Z65C 1ZVNA 2BRQA 3F7LA 5C6WH 3HG5A 4G8GE 3SKNB 1EANA 2BRRH 3AREB 5FUCE 3ZKNC 1NGYB 5ELIA 2XQYK 5BO1L 1QPKA 3M07A 3LQAH 4TL4A 4U0QB 4IBTA 2ZWKA 3ZKQD 4JY5H 4AK2A 2OCFD 4I0CC 5GGRA 5HYJE 4X8JA 3BE1L 5MEOA 3UPRB 1VADA 2NRDA 5FYKL 2A4EA 5T3XD 1P7KA 3SB3A 2BNRA 3WL9A 3NSXA 1I1FA 2FCBA 4BWWA 1AE6H 3RWHB 4Q9QL 1N0LA 3MR9A 2FATH 1ZT7A 3CV5A 3ULVH 1SFHA 3ECWA 4QTHB 4XZUA 5AOKA 3IXAA 1AGBA 5IBTH 4GBXC 2PW1B 1OALA 5L8KB 3OAYK 2R29L 4PD4J 2NY0D 5CAYB 4D7PA 2V2TB 4W9CC 4GB9A 4Q0XH 4PRIA 2GUOA 1X44A 4WHYG 4XE5B 3AG3B 4NC0B 1JYVA 3RQ3A 3D87B 4YSUA 3A6OA 4J6IA 3ASWA 5F89A 3ZTJG 2DV6A 1MJ7H 4PG9B 3QXDB 1ZS8A 3QHTC 3FT2A 4NZRL 4OLUL 3EYQD 4J6RL 3CVHB 2XV3A 1M7XA 3IE9A 1JHLL 5DUML 2V9RA 5E7BA 3SGDI 3CXDL 3G5XA 3G6JF 4H20H 4PS4L 2PETA 3DX0A 5KOVC 4AE1A 4AMKH 1QTSA 5I8CA 3FQ1A 1R3IL 4LDEB 1TG8A 4ZI8A 2VXQA 4IJ3B 5KWYC 3GHBL 5BQ7B 3EGDA 3MBEC 3VSQA 2OS7A 4YO0A 1WAAE 1E4XI 3BVNB 3FO0H 4D7BA 5I1AB 2MCG1 3EGXA 2W5PA 1P7HL 2B16A 5J8OA 1IM9D 2FJSA 2IALA 4OZHF 5FGRA 5K93A 1OW0A 4Z7WA 1G5AA 3ARVA 2XIBA 2JIXD 3HC3H 3QWQB 2AJXL 1KDIA 1K8DB 1S5IL 1WJ3A 2YPLD 3QGVA 4Y4FD 1KC5L 5DJZA 3QB7C 4KUZH 3M1BB 3ROLA 4ZPVB 2OL3B 5IT2H 5JOPD 2ORBL 3IU3A 3TVMD 1AGDA 3NACL 2ADIB 4AENA 2ERJB 4Z7OE 3QCVH 3CLWA 5EO9B 1IIKA 4TUJA 1MZZA 4MAYC 3RY6A 3TBTB 2IANE 3VRJB 5IVZA 3LMJH 5JNYA 2PXYB 4ONHB 4LL9A 2Y72A 4K3JH 1BAFH 3VFRA 3N2JA 1DVUA 2YKLH 3MGOB 3MACL 3QZBA 2A9ML 5TPWL 1GVIA 4LHQB 3KGRA 4LRIA 4NKOA 4ODWA 1AG6A 1HOEA 4XWOD 2GJ6A 3TPUB 5EHFA 5E6ID 5F9DC 4HEPG 4P57A 2Q10A 1Q9LA 2DBLL 2V8MA 2HJFA 3O2DA 4OSUL 5JIKA 1DQDH 3GD1C 4NO3A 1SQ2N 3UEZA 4YDVA 3WSQH 4XOAA 1OPOA 3UO8B 2FT8A 4NSKB 4MMYA 3LZFH 3VI3A 1JXJA 4Z95L 3RWDB 3MNZA 1FNFA 5FCSH 1RCYA 3T0WA 3QIUB 2ADIA 1OARL 3OKMA 4M7LT 1MI5D 1S7QB 2BDNL 3QXUA 4B3VA 2XKNB 1MFUA 2IADA 3N1QC 1TZOA 3PWPE 4JMXA 3SJVB 4C83A 3MC0A 2ZUYA 3BHBA 1M6UA 1PIGA 1Z5LB 3PQYD 5EPMA 2O6EA 3I85A 4XX1G 5D7SH 3GHBH 4D9LH 3I9PA 1HINH 5F1IB 2H41A 3D39E 3I02A 3LRHA 3WLBA 4KQ3L 4AXWA 2X4OA 1EXUB 2J1XA 3GJFH 1T1YB 3NCJL 4WU5B 3GLAA 4W68A 3GSRA 1XXDC 5E4EC 3JWDL 2D03L 2Q6WB 3W0WA 1A6WL 2YPLB 2GITA 2ZKYA 2ZG1A 2E6QA 3WFHA 4YSQA 1XGRA 1RUPL 3QG6A 2VR6A 4X5LA 1JMZA 3LXCA 3QI9C 2GAZA 3AY4A 3BUPA 5IB5A 4M43H 2KDYA 4FA8A 1CD0A 3G5YA 1IEBA 4JDZB 3KJ6H 3N40F 2HVKA 3V52L 4XCYA 2VITB 2JJTA 4ODSL 2YEQA 2RA1A 3FYEB 4JFXA 5TFSL 1AH1A 4XOBA 1MFCL 1CE1H 2P8MB 5I9QB 3ZHKA 4ZFGL 5CINL 3SN6N 2VGLM 3GIVB 3V10A 3DX6B 3QDGD 1AJ7H 5CSBA 2CD0A 1KCRL 2G5RA 4N8VB 3QA3B 4RSYA 1NGZA 1UB6B 3S35L 5BQ7A 4XCYB 3GT6A 1TZGL 2MH4A 2VDKH 3Q2NA 1BAWA 2C9VA 1YEKH 3ARWA 2ERJC 3SKOB 3MRMB 3IJYA 1F4HA 1LEIB 1F0LA 3KW7A 3JV5A 1MW3A 3IETB 3IK2A 4A2HA 3TO2A 4PJ8B 4LEXH 3UYRL 5L2KA 3IVKA 4XAWL 4G9DA 4GUOA 4ZTPL 3RZCD 4MAYA 1KTBA 2KI6A 1NBVH 3BW9B 3OKOB 4TVPL 1X7QB 1MUJB 1NC4D 3TBCA 1UEYA 5KN5B 5AAPA 4QEGA 4CMHC 1BOYA 1XX9C 4NQEB 1X5FA 3KBEA 2CM5A 2E8YA 4LLWA 3BAIA 1R47A 3TP4A 2IAMB 5EORL 3CFEA 3AAZA 2GSIB 4HUWB 1TZHA 4GIAA 43CAB 2AJVH 2H3XC 4WUUD 4FQPA 3MV9E 1SY6L 1QSEA 2YZ1A 3KG5A 3ZTDC 1FAIH 4JGMA 4ALAH 3HS9A 4ODXA 4ZMNA 5EPMB 4J28A 4WFED 4E9XA 3LZOA 1PVHA 4WI3A 1SUHA 2YUZA 2OFQA 4IOFD 3VXRB 3MROB 3GGWB 2WINA 5EZJB 2X9WA 1XDTT 5PAZA 1PNDA 1AI1L 5DC0A 5G55A 1IM9B 4PR5A 1KJ2L 1MPAH 2HH0L 1P7QD 2Q6WA 2OJEA 2WVVA 3W0WB 5CEXB 1S9KC 1T80A 4OCXL 3VFSA 2E59A 1MRFH 3BH8A 3LXBA 2ENJA 4DJMA 1UUSA 2NY5L 2QGEA 1RJYB 3GM0A 4K7FA 1WAEA 1BFVH 2OJZH 5GS0H 2ZUVA 4FXKB 4I3RL 4XCEA 2WVTA 3S4SG 1ZLWK 1MQKL 2HUHA 1A7RH 4Z7QB 3HRPA 3FTGA 1A1OB 3OXSA 4YQXH 3IKKA 1INQB 2Z31A 1M1XB 1HI6A 5C71A 4MWFA 4L3FA 5T1DH 5E5UB 2WLNA 5K39A 4FC3E 1EBPA 1U92B 4HUUA 1T6BX 3RGHA 4PB9H 2EYRB 2FHCA 2XN9A 3B9KB 1I7RB 2FDBP 3CDZA 2YAPA 3H9SB 4XNMB 4JM2F 1QLEB 1S7UA 3MREB 5FEBA 2BP8B 2Y2TA 4MZ3A 4A1RA 4A7VA 1CFQA 1G4MA 4LSUH 4P46D 5EEVA 1OV8A 3GI9L 3T3PB 4NZTH 5F7BA 1PKQA 5F88B 3VQ1C 3UP6A 3C5ZC 4BH8A 2KBGA 4JZNA 5ICZA 3T71A 2FNBA 4PJDF 3UP1A 1F6AB 4MA7L 1EEUA 1JTOA 1TQSA 4S1DC 4HQQH 5L7XL 2WXRA 5SWZE 2FX8L 4QTIL 2Y3AA 5B7MA 4Y19E 3ZY7A 4PCKA 1UKTA 5ETUB 1P5VA 5HHXL 5KAQG 1XGTB 4XBGA 3GBLA 4FYQA 2V6HA 4MS8C 1XEUA 2WQ8A 4BK4A 4AGNA 2XBTA 4PJXA 1X5GA 3NJHA 2APSA 1DCLA 3MPCA 5A16B 3TEWA 3S5LG 3GF8A 1A6TA 1YEEH 5L8LB 3VFUB 1IVLA 4YNYA 1J12A 2VZ3A 4N1HB 4BSVA 3W2DH 3DBXA 3GMNB 1EIBA 4KJPC 1KIPA 1KY6A 3TNNA 5I18H 1S5HB 2P5EB 4MA3A 1MF2L 2JJTC 1J5DA 4XPTH 3QNYB 4TLSA 4PUBH 1JNLL 2C4FT 1LP9F 4ZFZA 5HYJA 4X99B 2QR0A 4FLQA 4KO5A 3KYMB 3VXTB 3QDJD 1OP3K 3SD2A 3W82A 1RIVH 4PJHB 5FM4A 3FOMB 1KBBA 2VZVA 4GIOA 1BM7A 3BE1H 1G6RA 3HNVH 3MV8E 3UTTE 1YNKH 5BZZA 4PY7B 3QC5X 1H19A 5CBEA 1E28A 4TLUA 1U8NB 2JKJA 4OAWA 5DK3A 4HU8A 3VD9A 3MBEA 1KENH 3QG6B 4ZJ9A 2BRRL 1RU9L 2XTJE 4APQC 4MKTA 1JHTA 2BNQD 3LS5H 3QO1A 3SDCB 1ODAA 2DLGA 2OQJB 1C7TA 2IH9A 2OTWA 1AHMA 5DR5L 4TSCL 2EEDA 3NTCL 1T2QL 1Y07A 3RWFB 2XWTA 2B1AH 2YOAA 1H6TA 2GJZA 4ELMF 1MW1A 5C86A 3WIHL 2Y06H 5IZ7A 5K1VA 3ZXAC 1X5HA 4Z7IA 1Q9KB 2WO3B 4YVNA 5D1QD 4MZ2A 1TU2B 4ZFZB 2Z3FA 5L0QC 1FFTB 4PTTA 1L7IL 3M45A 1UZ8A 5CEZH 1ZHBA 1BJ8A 4WHTB 4BDVB 1OM3H 4IBLT 4LHUG 2YAQA 4LHUD 4Q52A 5KSVA 4JPKL 3OMZA 1HU8A 4LSTL 4PGEB 4N25A 4W1TA 5IUSA 2NYKA 3IFPB 1DQIA 2WZPD 5HHOB 4G71B 4QWWC 4C54A 5CCJA 1RP9A 1Q9OA 2AANA 1USZA 4JO1H 4ISVB 3TO4D 4JRYD 3L3HB 4KV5E 2H47C 2F6AA 1AY1H 1P5VB 1AD9B 2WANA 3B8SA 3NIDB 2VLLA 1NCJA 5DYOA 1XGYH 4QRSB 1TQCC 1UM6H 2V9QA 4D3CH 4AMWA 1BQLH 4LRIC 2XTSA 5D5MA 4ORGB 1YEFL 3QZOA 2ZAGA 3NCEB 2W9DH 2DQFA 4F37F 1BZQK 5TQ0L 4XP5L 4RRPM 5I26A 2YPKB 4PMEA 1FL6B 3BPOB 4OD2B 3SOBH 1QZNA 3IRCA 4LCWA 4ZUSA 4F7KA 1TETL 3R8QA 4IHOA 4MNQD 1A9BB 1NEUA 3H56A 5I8OL 3FUMA 2IQ9L 3X2QB 3VU2A 7TAAA 4WI7A 1SQMA 3B9KA 1DANT 4D3CL 2GI7A 4M3HA 5C8JA 2AW2A 3MREA 1IC4H 1L9MA 3MBED 4BDVA 3B83A 3JBG7 4XP4L 1NEZA 5L9DH 1W72A 2HZHA 3BVUA 1DDHA 5D2LA 3VGHA 1BOGA 4ODHL 2ZOWA 2WZ0A 4AT6A 1H3GA 1QWNA 4R5VA 4LSQH 3LPWA 1RP8A 4ZS6D 1PEZA 2ESVD 1PSKH 1JGDA 3C87A 1C12A 3N44B 1U30A 1P1VA 3FB6B 1H3VA 4PRAB 1J9TA 3IGKA 4QTFA 3TEYA 5DCCA 5HD8D 5E6IA 2CO3A 2F74A 4QDGA 4X5RA 3UZVA 1Z66A 5SX5H 4HJEA 4XVJL 4F8QA 1FCCA 2C4XA 4JO2L 3R7QA 3V4VL 3MUJA 3Q48A 5JDSB 4JKKA 1RK0A 4PGDB 4Y4KC 2C8NA 3OAWA 4YGVB 2CDGB 4KJYA 3LNHA 3O4LB 3QWNA 1ZKAA 1QABA 1HHHA 2W80C 2X4QB 1NC2A 5IV2A 1BPVA 1MAKA 4LSPH 2XZCL 4POYA 4R8WH 3MLWH 1HXMB 4PSRA 3ZYIA 5TE6H 2OSLA 4L0ZA 1ZLVH 4AWJC 2L8AA 1RU9H 4GSDL 2FR4B 2BC4B 3M46A 4KKCD 4ABQA 4J2QA 2R2BA 4S1RL 3CLEL 2WYIA 4LAQL 4PVLA 4EMZA 3ARUA 4M6MH 4IJ3C 3GMOB 4PP2B 2PABA 1MVFA 2ZCHH 4ZO8A 2V33A 2XETA 4KK6C 5F96H 3DXAD 3T5WA 4BGLA 4ZQKB 3EYFB 3SDCC 1J48A 2D7TL 2RIKA 4HMCA 1SXZA 4NO0B 5EO1A 5E0QA 1KPUB 1NMCB 5K69A 1LQSR 2DYPD 2LVCA 2HRPH 2YXFA 4OF0A 4XNMA 1D6VH 1A6ZA 1CYWA 5LNDA 4JFOA 4LNVA 5FF6B 1LO0H 4HU2A 4A2LA 1I8UA 3D3VD 4Y19B 2R0KH 2CO6A 1FG9C 2P3YA 4FTVE 1SDYA 4JFDE 2EH8L 3PGDA 1TITA 3IGFA 3ALXA 2YXVA 1OIOA 2O61B 3KPOA 2YD4A 4NCC1 1BQUA 3R1GH 3ZMEA 1A7NL 2WQWA 3D09A 1IU1A 3H1ZA 4WF7A 5JR1H 1JZ4A 4FABL 2V4LA 1I82A 4FQHA 2VR5A 4P2RE 4U1SA 3SPHA 5IFJA 2KZBA 1ET8A 4FNTA 3WJLA 2A4CA 3WUZA 1OAYH 2L7QA 2NY2B 2GJ6D 1NAML 3GZPA 1U3JA 2LQRA 4U6HB 1D5IL 1QSED 3QUYB 4FNUA 3KPPB 4K8RL 4GEIA 4GSUA 4KTDL 4N9GB 1FORH 4P46C 1U3HB 1HSBB 4HQQL 1IGMH 4R4BB 3L9RA 2FX9L 4HAKA 5AB1A 1EGJH 1T5XB 4DTGH 4H1LA 2K1MA 3AM8A 3HI1B 4HIHA 4K7PL 4NZTL 3GI9H 3K1DA 1ECYA 1G94A 5JOEA 4XH2B 4FNLL 3EH4B 2J3SA 5L8JB 4KPHH 4HK0A 3MJ6A 3EJYC 2E8ZA 3PDDA 3F7QA 3SDAA 3U46A 5CHNB 4I5BA 3VD0A 2GUOB 5IB5B 3C5ZD 4ES9A 4MS8D 4S1RH 1NFDB 3A4DA 3BKYL 5KG9B 1IC5L 1D5RA 5J12C 4Z7AA 1T5WB 1BVKA 1QSFE 2VL5B 1XBRA 1BX2B 4J5VA 3ZKMD 4JVWA 4L8SC 5L9DL 2XZCH 3P77B 3NZSA 2Z92B 2VMFA 4HZ1A 2J5WA 5KVEL 3FFOA 1QFHA 3L3IB 4MB1A 4WRLA 3T65B 4M7JL 3JT2A 3FTWA 1QW8A 5E2VH 2H32H 4PWIA 3ESVF 3I74A 3D0VA 3CIAA 4L5FH 1B0RB 3NIFB 4QR7A 4F8NA 2UZYB 4M29A 5AZ2L 5C0EB 1OAKL 3AB0C 2VWEE 4ERSL 4E0RB 2ADFH 2I07A 4HFWA 1HXYB 4B9IA 2UXVA 4WEEA 1LWJA 3EOYG 4WHYH 2C9XA 3O3UN 4KY1L 4QKTA 1IAOB 1L4IA 1NJ9A 2HAZA 4ZPVA 1A14L 4ETYA 2QSCH 3P0GB 1WAPA 1OLZA 1WTGT 3KJ4C 4G59C 1ZXQA 1T3FA 4ZYKB 3HZYA 4GAGL 1P6FA 1ET5A 2VERN 4JKWA 4X9IA 1SEQH 1MCFA 5H2BB 1JV2B 4KJQD 1EZUA 1JGIA 1Y6MR 5E8OB 2P26A 3F01A 2PWDA 3G5ZA 5AZEL 4EUPB 3RTQC 2UYLA 2JB6A 3E0GA 3NABL 4BHUI 1ZOXA 1FO0B 4JFXB 1GOGA 2MFNA 3VI3B 1K4DA 2CA3A 4YSRA 2Y7QA 2VAAA 2J1KA 4JL1A 1H8SA 4QT5B 1KJMB 1HEZA 3MRGA 1ECZA 2E27L 1DL7H 1MCDA 1NMAL 4AQEA 4E68A 1J9CT 2R0LL 4PJIB 3G5XB 1EEZB 4NQCD 1QSVA 1BEYH 3C60D 4W9FC 2YUVA 3VMPA 1P5UA 3S5LB 3MLUH 3PQYB 4JO1L 5DS1A 2VAAB 2PPDA 3OKMB 4L9LA 2CUHA 3BYTA 2HRLA 4B41A 2CNZA 2KZ1B 3PL6B 1HZLA 3DV6A 3VWKC 3WTYA 3VCLB 1GYUA 1MUJA 1FYTD 3NIGB 3QJRB 1X5KA 4YPGA 4A2GA 1P4IH 2R1YB 1XCTB 3N04A 2FJFA 4QRPB 5FFGA 4GG6E 2ADGB 5FYJU 2WWMD 5AKVA 4DP6X 1O9ZA 2W0LA 3U30C 4J8RA 5F72S 3RGVD 1OGTB 2H0FA 3O4LE 2AQ1A 3LN4B 4JFPA 4ZRGA 2X88A 4O2EB 2Q7AA 1ZA6B 2B4CH 1OQXA 3L5WA 1FORL 1SXAA 3QISA 4CNIB 4HIEA 3DIFB 4PRPD 3OC8A 5LBGA 3T08A 3D51A 4NI6A 4IKKA 2NXYC 3I75A 4PSPA 4U4IA 4NQVB 1A66A 4LPCA 5CGYC 4Y5YA 4I89A 4KOCA 4D9QD 3BFOA 2CDEA 4M43L 4AM0A 2MTPA 4X4KA 3BP4B 1PFOA 2WSPA 5E6RB 5TDOA 1DSWA 4KXCA 1SHXA 2QFPA 5I66B 1JFQL 5DK2B 1OQOA 2XN1A 3I02B 3Q6GL 4NRZB 2GC4C 4NP4L 4PW9A 1G9MC 2V37A 4KRMB 4YXHL 1LK3H 4DOHB 2IMNA 4BFRA 3RWJA 4ZMOA 1NCWL 3U7AA 5CF3A 3T2LA 3NJVA 2X6CA 3LNGA 4FQ1L 3KXFE 3R7RA 2R4SL 2K78A 4B9KC 3ERXA 5HYSG 3JV0A 1PZ5A 3ZKSD 1KXTB 2VR3A 2ZONA 2XV0A 4PJEA 3VCLA 5GGVH 1LXMA 1UYWH 4U3CA 4UIMB 2YZ8A 4W9IC 1BQHG 5GS2D 5C08E 1QBLH 5J6SA 4DPAX 4HAFA 3QORA 4AJYV 4BUGA 1R5IA 1YA5A 3UTSD 2NYZA 2WWOA 3WTVA 3NCYP 4N2OA 4NZ8A 1YEDA 4OI8A 5TE6L 4DW2L 1KGCE 1PZBA 4U6VH 1NLDL 4F80A 3STZB 1BD2A 1NCCL 4RMWA 1MJJB 3WD5H 1NSNH 2BW4A 1HE7A 3IFOB 2AQNA 1MAML 5T1JA 3QZNA 1FGVH 1MFAH 1OSYA 4ZOBA 1LEGA 1RH8A 3CG8A 4XVJH 2Q86B 5DD5H 3C6LD 5E2JA 4GW5A 4XCCL 2JKRM 2NXZB 3VFVB 4R4BA 2FQGA 3DUSB 2BS71 4HXAL 1X9LA 2AQ3A 1AR2A 3TZVD 3KYKL 5KYUB 3T2QA 5KW9L 2ZWLT 4NQXA 1U8PA 3C6EA 3FU6A 1E50A 4GMSH 5EN2B 1I7TB 6PAZA 4S0TD 1E4JA 2YOCA 3MV9B 3US0A 3JTSA 2CGRH 5C7ZA 4A63A 2HJLB 2Z64C 5L4FA 3CNKA 1D2PA 1A3ZA 2WZAA 4FZEL 1ZVHA 5IMOB 3CHPA 1CFBA 3G6AB 1NCHA 3NPSB 4P2QA 4NEHB 1KGXA 2VXUH 2J5LB 1OCWH 3BPLB 4X5QA 5E08L 3OKDB 2AJSL 4WU7A 1OP5H 4GSQA 4X5XB 4NSKA 3C60B 3N0AA 2HTKC 2CUAA 2H8PB 2I25N 4J3TA 4NFBA 3VXUD 5CJXA 5MP6L 3MRKB 4YSSA 1SBBA 2GT9B 1URIA 3SYCA 1X5YA 4IOIB 4H7VA 3U30B 5ITFB 1Z3GL 2FJHA 2IPKB 4GY4A 2AJVL 5FFLA 5I1HH 2IDSA 2VERA 5D70H 1M9SA 3VW3L 5LXGH 2WQUA 3EJYD 2LR4A 3VQMA 2CH8A 4ADJA 3HC0B 1YMHA 3GSNB 3VD1A 1INDL 5IEHA 2YAEA 2Z91A 3A22A 4H2CA 4JZJC 1MCIA 4U1KA 5DJ0A 5GGQL 3SYPA 1E65A 2PCFA 5I2IA 3PNWA 2BINA 4LBEA 1XH3B 2QQLL 4KHTH 1SM3H 3CH1A 1OCCB 3DSFL 4PRPA 4AMXA 5GISL 1CLYH 1Q0EA 4M3JA 1CL7L 3DV4A 4AH2A 2P49B 1HFUA 2R27A 4M1DL 4R5TA 5K9JL 2FWSA 4JKPL 4N2KA 3FQXA 3RA7L 2FX7L 3DPBB 5I6LA 1FVCB 4PW3A 4KFMA 5JO5A 4PTTB 2A1WH 4JM0A 1OD7A 3REVA 3ATDA 3VYOA 3CHSA 4JPIB 5L6YL 5JW3H 1NBVL 1U4FA 2WUCH 4LLAA 5T3ZE 5L2JA 3I2CH 5AOLA 2UX7A 2V7NB 3FH5A 1U8OB 1K6QH 4G8GB 4YOKA 1MFBH 4K8RC 2RB8A 3LSOA 3PWJB 2CMRL 3NCCB 4V1DD 4PJXB 1LM8V 3OKEB 3AVEA 3QJVB 1QNZL 4WNJA 4AJ0A 4K5PA 4OV5B 1DANU 3QC6X 4M4RB 4ZUWA 5J6HA 2O1AA 3FUIA 4GT7A 4H8WC 4PTUB 2ZWSA 4N87A 2EILB 4B53A 1JE6A 4JB9H 4Y4KD 3PWVA 2BH0A 2ZSVA 4MJ4A 5B8CC 1U36A 4P2YA 1I3RB 3GDBA 2WOYA 4IGBC 1G9NC 4BFIA 3HB3B 4I18B 4HPYH 2VUOA 4OFYD 3RRQA 1HHJB 2RQ8A 3FQXB 2XNAB 1RJZA 2Q7YB 3OLEA 4AIZA 3DPBA 4PG9A 3TWYA 1I9RL 1CFMA 5AW1B 3VG9B 3WDIA 4D8PA 4KGJA 1MFMA 5FOJA 5AD0B 5JYLA 4P2RA 1WWCA 2X6UA 2D3VA 3ARDA 2A9AA 2F8XC 5K39B 1FL3A 3OR7B 5F21B 3MRJB 3OB0K 5JOFB 1DDHB 4WY7L 3SOTA 2G5BB 5CLTA 3CDYA 2OPCA 3KDPB 4HBQA 2NY2D 3K6SA 2OW6A 1A6WH 2WQAA 1CL7H 2A9NH 4P23D 1YN6B 1JZHA 4I48B 4F9LA 4MD5B 1ZHBB 3UTTB 3T2PA 2G9HB 3EO9L 3ETTA 5DJ8A 1MWAH 3NH7L 4ZNCD 4AEEA 1SM3L 2F74B 4XVSH 2L7EA 2FWUA 4L4TD 1IEAA 1MDTA 3E9UA 4HIJA 4GXUM 4IRJA 2IOIA 1LL1A 2X4SB 4NYLB 3E1F1 5BV7C 2OMNA 3UZEC 2F68X 2WXNA 4MD4B 4KV5F 3U9UA 1D7CA 3G08B 3ATAA 3RWGA 4L5FE 3TYGH 4JK0D 2XWBA 2VW6A 3WNJA 4WU7B 1MFVA 1B6UA 2D9QB 1O9WA 3P4OA 2LLGA 2M26A 5MI0C 5F8RC 1GGBH 1FE8H 5KVDL 1VZIA 4UV4H 4XO4A 4PG2C 2UXTA 1PW3A 2VJ8A 3RVWC 4B0MB 4GFXA 1FZMA 2O5ZH 4B97A 3KW8A 5CEYB 4G8AC 1E4WH 3SPCA 3OG6B 3TIDA 3QCVL 4F9PC 3EOBA 1JF1B 4OT1L 5B4MD 1VEOA 2FO4B 3QIBA 3WDHA 4AM0Q 1EX0A 2C4FU 5DRWA 3D8MA 4XN4A 3LKRB 1TU2A 3D1MC 3UAJA 5AQ0A 4UDUA 3WJJC 3IF1B 2LOEA 3AUWB 3V6FB 1ZDQA 4OFKA 5EBMB 3TEXA 3TVMB 1RZJH 3TJHC 1OL0A 3VJ6B 2BSEA 1U3HD 4RMTA 1FNSH 3CX5J 3JWNE 4I0PD 4GXVH 1RJLA 3F05A 1CFVH 4S11A 3I6GB 4XCCH 1IE4A 4GRLD 1V54B 4PJXF 3U1SL 5I0WA 2X0WA 4X8GA 4NUGH 3ATBA 4NC1E 3ZT7A 2ORBH 1J86A 1T0OA 5KSAD 2XTJB 3LEXB 4IMKA 3QNZB 1OTTD 3OAZK 1MWAL 1NOFA 3MGTA 1E3ZA 4WI2A 1M71B 5CGMA 3VI3F 1Z5HA 3P4MB 5A6MA 5DD0H 2GJZB 1GGBL 4AGLA 4GAJL 1ZVYA 1EHXA 4HC1H 1INQA 4N0YL 1N10A 1WWBX 2HFTA 4W6XB 1ZLEA 3P11H 3QXAB 3CFJB 4DP8X 1HOCA 1HESA 1JNJA 1RULL 5FOBB 2YKKA 4N68A 1UZ8B 3QO0A 4G42B 5KBMA 4LCYB 3TO4A 3EG9A 4ODTL 3GMNA 5BQDA 3EJPA 4OJYA 4RNRA 5EC2B 4X5WA 1A0QL 3TN0C 4X9YA 1G9ML 1CLOH 4ELKB 1TJIH 2BC4A 2W1NA 4N28A 4AQ1C 4L1DA 2HG0A 4J3UA 4LIQE 1HHKB 4NJAH 2Z93B 3DXAE 4O2FA 1SPDA 4BQ8A 2AI0H 2OAAA 3RU8L 3I84A 2RMNA 4HG4K 3NZ8A 3H2WA 4IU3A 1KLUA 2VRQA 1L9TA 2D3LA 4U3SB 3VFTA 1ACYH 4YGVA 3EYOA 1X9UA 3L6FB 5DU7A 1CIDA 4KNTA 1RK0B 1QWUA 1JNNH 2PTVA 3Q3GB 4XPHL 1S7TA 5EFIB 5TE7H 4ODUB 3QAQA 1VGEH 4X0KB 1UD4A 2CKBA 3V6ZA 1A65A 1UZ6E 3BHBB 5FC9A 1YPZF 2DQEL 2M2DA 2X1QA 4Z7WF 1J1PH 1VFAB 5GS1C 4WO0A 4JX0A 4ZMAT 4BXSV 4JDTH 2IGFH 2O30A 3EYOB 2HN7B 3S2CA 7CGTA 5J0BA 1IV8A 1E6OL 5EUOE 2MQGA 3CK0L 1KJ3L 4HLZG 4Y9CA 3QZMA 3ESOA 4FG4A 1WZ1L 4TKWA 4TV3A 4FD0A 1FNAA 1T7YA 4QRRD 4XN7A 1I3GH 4TTGA 5DRXB 3HAEB 3HE7C 5K5YA 1BAGA 4PI2A 2X0VA 1F18A 1BDYA 4G6FB 3GJEB 2DJSA 3WG7B 5EOQH 4LSDA 5HJBA 1L7TL 3JWDH 3QE5A 4IM8A 1GXEA 1RJLB 4BQ6A 2NX5E 5C0ND 2FYYA 2JB5L 2FAUA 3NCJH 4UYPA 4RGND 2CHWA 2XX1A 4LASL 2J1YA 4PJ5D 5GISH 1FNLA 4YEFA 1LMIA 1NC4A 3BEWB 2QSVA 4MXVF 3ZSSA 4AKQA 3QHZL 2HLAA 2OXHB 1AGCB 5CMAA 4CW1B 3AAZB 1NDGA 4BKLA 2EDDA 4FG2A 4OFIA 3LRGA 3QDJB 2YQ3A 1NBZA 4Z18A 3OKLA 1JOIA 4MMXC 2BY0A 3T1FB 1CBJA 5IHUL 4AEIL 1F90H 3RA7H 4XVOA 1FQ9C 2VC2H 3KWVA 3RX8A 1OSZA 2WBXA 5DVPA 5E5MA 1BX2A 4KKAC 1K5WA 3FRUB 4P5KA 1VJSA 3GGWA 5D2NC 3ARBA 3BYYA 4HUMB 1EFQA 3NA4A 4U6XB 4PV8A 1JV5B 3HN8A 3ZRCC 1IAOA 1NJ9B 3D0LA 3DETD 3DVNA 3FT3B 5GGRY 1AHWC 3HB3D 3QS3A 5GZOC 3VFRB 2ZYIA 1VPOH 4ZFQA 2XV2A 4PJEB 3A67H 3GXNA 4Z3IA 1FGNL 4NWTH 4X7CC 4GQ9H 4YX2H 1L0XA 3CFMA 1ZHNB 3WY1A 1TYJA 3EGXB 4NZUH 4BHUA 4XP6H 2FWOB 5FYKD 3KPMB 4BM7A 3WMSA 3QPQD 4LPUA 3QUZD 3SE6A 2O4EA 1V7MH 2EKSA 1LD9B 4PWKA 4JANA 1KELL 1BF8A 3LQZB 2VXVH 1KIQB 4X0KA 4ACTA 2DQDH 2GAZB 2XFGB 4HPOH 5BZWA 2Y24A 2A99A 1DQJB 1MFEL 4L5FL 2BNRE 4Z3HA 2FO8A 2P80A 3CZKA 3MO1B 3QUGA 5E2VL 2VDQH 1BVNT 1CK0L 2IADB 3D2TA 1AYRA 2C26A 4YHZL 4EQ3A 1JF6A 1TCMA 5IHWA 3EFDL 1FL5A 1HILB 1T20B 4FQCL 2G30A 4JG0H 2AABH 1FFQA 1GH7A 1ZS8B 4P3DA 3NAAH 5F0MB 1CGVA 1SLXA 3FULA 1M2VB 4UMGA 1YCSA 3C6LB 4H1LB 3NCBB 5DMJB 2OR8A 4YBLC 1JDDA 2CKNA 2FQFA 1WEJL 2VH5L 3SGEI 4XBPB 4HXAH 4WGWB 4PRHE 1MCOH 3NN8B 3O6FA 3JUYA 1D6EA 2YA0A 5I8CB 4ODWB 2MSPA 3BFWA 1GR7A 2OBGA 2XDHA 4YXKL 1U95B 4UNTA 3L6FA 4UF7C 4W93A 4ANVA 1NCBH 4AW4A 2ESVE 1FYTE 4FI8A 4OI9A 4Z0XB 5E8PB 1IGML 1VFMA 1GC1H 3EO9H 3NK3A 4DUVA 2EDWA 2QSQA 3BKJH 2AJ3B 1T22B 1ZXKA 4WEBH 3C8HA 1T89C 2OMBA 1OWRM 1TTRA 2ZOUA 2G60L 5J56B 3LKPA 4U6YA 4JHBA 5GSRB 3FONB 8CGTA 5ISZB 1XMWA 4AV4A 3T0VA 2CO1A 4C83B 4HDIB 5ICXB 3ROLB 1I3UA 1AP2B 4KMTH 3H54A 2JJSA 3CVHA 3DYPA 3MA7B 5JYMA 4ZW6A 1H0DA 3ZE2E 1RJCA 3NQKA 4EI0A 1A2YB 3WAKA 1G9HA 1VF5C 1Q0YH 2X4PA 4YPGB 4NAMA 3VXQA 3U48A 1CYGA 1SHMA 5TH2A 2V2XB 2VLRD 4M02A 4R2GD 4RMRA 3ZSTA 1XGTA 4XBGB 3IRPX 4L05A 3WHXA 5M7QA 4NGHH 3S3SA 5C0AE 2J5LC 3H9SE 2W65A 2OX5A 4GRLC 4OCNC 3VFNA 2JMRA 1NH6A 1DQTA 2BOBA 3DA0A 4QNPE 3VMNA 1DFXA 5ALCH 4PCYA 4Z3GA 4ZUVB 4H8PA 4R7NA 1A25A 2HB0A 2QKIC 1ZK9A 5ADOL 3BZEA 4F7CA 5KSUA 3PY9A 5LG1A 4I87A 2FL5A 4P2RD 2A1WL 3BPNC 4B7LA 2B4CL 5AUMA 1C8PA 5E8DL 4AUYA 5GRJL 3CZGA 4K7PY 3UGXA 5IB2B 3RL2B 1WRFA 3UH8A 1CBVH 1RI8A 1NANI 4ECNA 3HA0A 1TJGL 1M53A 1QR1A 4FLOA 2A6JB 3VRJA 2IDCA 3W9DB 3N91A 1A4AA 1IBHA 5HHOA 4CDHA 2PP8A 2ZJSL 4UMSA 5FGCB 2EJ1A 3ULAB 2CGYA 3NBNA 3QIWB 1HWGB 4ES8A 4Z7VB 2RFXB 4I7ZC 5E1HB 4JLRB 2PXYC 1QPXA 2AK4A 2ARJQ 1KCUH 2J8UE 3LKQB 4HIPA 1A7QH 2X2YA 1RIUL 5HVWA 2X4UA 4BEIA 4UIMA 4TUUA 5D1ZD 1FZKB 1OSEA 2AJZB 2DMGA 4CSTA 4GRWB 2J8UF 1F2XK 1QHOA 1JWMA 2HT4C 4L8DA 4JQIA 5CUSH 1B3JA 1T04B 4NO3B 1X5ZA 5C0CD 2BX5A 3W81A 3RPIA 5IVZB 2XJLA 2WZ6A 4UQBA 5G5DA 1EAJA 4N86A 3T3MF 3T0XA 1IILE 4PRHB 1PCSA 2BZ7A 2NQDA 3L54A 3WE6A 4DVRL 2W9DL 3X3FH 4Z7NB 2AJSH 3EFOB 5BJTB 1U58B 2FGWL 2CIKA 2BZDA 4QRAA 1IB5A 2CJSA 1KNOA 1OAUL 3T77B 4WUKH 3AWFA 1H8OA 4N0UE 4UI2A 1NCDH 3QEQB 1HCYA 4XN9A 3GIVA 3OLIA 4UV7L 1W91A 2V5MA 3VXME 1DJHA 1IC5H 1UD5A 4JPQA 1A14H 5D2NA 4WWOA 2XXFA 4MS6A 4OR1A 4JPSA 1N6QL 4LDLB 1KB9J 3OSVA 4BA0A 1E5UI 1QACA 4DVBB 4HCRL 1VAHA 3OZKA 5D1XA 2QTEA 3UG4A 4FNLH 1D9KA 2NY6D 5C9JB 1ZCRA 2H45A 4L4VD 3DOIA 3FUNA 3K3QA 1O6TA 4Q6IC 3DIDA 1TR7A 1VFBA 2WTRB 3MJ8B 4PRDA 5FYJD 3CSPA 5HHMB 1N12A 2E3VA 3G6JE 5EWIL 1PYWA 3IKCA 4H0IA 4HKXB 1AG0A 5T1MA 5AW6B 1PEWA 2KLRA 4GINA 4QRQA 3HKFA 5D7JD 4YEEA 4HWBL 1YHPA 4G8GA 4GBXA 4U33A 1TVBA 5EC1B 2Z31D 4J2XA 1HAWA 4TUKL