4Z7UA

S13 complex
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
182
structure length
182
Chain Sequence
DIVADHVASYGVNLYQSYGPSGQYSHEFDGDEEFYVDLERKETVWQLPLFRRFRRFDPQFALTNIAVLKHNLNIVIKRSNSTAATNEVPEVTVFSKSPVTLGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFLPSADEIYDCKVEHWGLDEPLLKHWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC class II HLA-DQ-alpha chain
publication title Determinants of Gliadin-Specific T Cell Selection in Celiac Disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 40
structure length 182
sequence length 182
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4z7uA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4z7uA01
3RWJB 3JUYA 1NC4B 4RBPH 1T04A 2ESVE 4G8GA 3REWA 4XTRC 4NC2B 3FO1B 2XG4A 2AJ3B 1IAII 4OB5H 5F9DC 3BZFA 3LIZH 5AZ2H 1MEXL 1FNSL 1WSST 4AENA 1IGTB 2D0HA 2J7LA 1TJIH 2R0WL 5F7UA 3OZ9H 5ESQA 3E6HA 3HAEG 4MNGB 4PJ8D 3V5KA 3AAZB 3FB7A 1BJ8A 5F93C 3NGBB 12E8L 5H35B 3PP3H 3RTQC 4YEEA 1QO3A 1XEDA 3D69B 2XRAH 3GSNA 3QJHA 1SJXA 4HUMB 5D1XD 2ZPKH 5ACLA 4G43A 3BRGC 2YPLD 5I73B 2VR4A 1EX0A 2L4OA 3FHQA 4MA3A 3BKMH 4U1JB 4LOUC 1CLOL 2NW2B 3IKKA 3THMH 3O8XC 2LU7A 4DVRL 5KVFL 1TVBA 1VADA 2R2HA 1YC7A 1NCDH 3CGTA 4EI5C 2XICA 3ULSB 1JUFB 3MCLH 1CZ8H 4KY1L 3S37L 4EOWL 1NAMH 4PG2A 2PUQT 2J2ZA 3ABZA 4YBLB 5ALBH 2AEQL 5SX4I 4TTDD 4HKBA 4ZG1A 5MP6H 4AT6B 1OQXA 2DB8A 1HK6A 4Z78A 1NUNB 1KFAH 3K46A 1HHHA 1J05B 2GJ6E 3EAKA 4O2FB 1FZKB 2FD6H 4UTBH 3KYNB 4HLZG 3EDFA 3VFGL 4CADA 1A6TA 4Q6IB 4PJBB 5CMAA 4TSAL 3S96A 4HZLB 3OKNA 1U95B 3QDGE 2Q20A 1MCEA 2EDRA 4XPTH 5HSFA 3L3HA 2F54D 2D7PA 2HFGL 2MJWA 4HX1B 4G5ZL 5EU3A 2X44D 15C8L 2LAGB 2Z9TA 3T0VA 4OZFA 4LNRB 1YEDB 2BXYA 4CDHA 1MUJB 4D9QD 4KJYB 3JUZA 3DETD 5EU6E 5GRWA 1G1CA 3ULVE 3V5HA 5IF0B 3OHXB 1DQDL 5FKPB 5GHWL 4OLEA 4F7CB 3VGHA 3OKEB 4GQ9H 4NKQB 1SJHB 2X05A 4NQEA 2ED7A 3DJ9A 5CILL 1FZJB 3C8KA 4N68A 4XNUL 4KXZI 2KZWA 2C3GA 5F44A 2G9HA 4M1CC 1XGTA 5DD3H 1DQTA 2ICWB 1AHWB 4MS8D 3H9HA 3VWJC 2D9QB 4ELMF 3O4LE 3ARRA 5D7JD 5IMMB 1EFXB 5GZOC 4FTVA 2D03L 5HHQA 3KGRA 5IV2B 5D7IA 1B0RA 3PWUB 5BV7B 5ACZA 4ZFGL 3RIFF 3AUVA 5BV7L 2L0DA 1KIPA 1YA5A 4X5WB 2X70A 3DOSA 3X17A 2XZAH 5F7NC 3MA7B 5CEZL 3RRQA 4ZQKA 2EDDA 43CAB 4OZ4A 3TNNB 4Z7QE 4M9OA 3U30B 2ORBL 2BSSB 4YDIH 3HG1E 1YMMB 3B5GA 4LCIL 3BIBX 3T2QA 5F7HA 4WJ5A 4LU5L 5BO1L 3LV3A 4AMKL 2EDTA 2Z8VC 3OGCB 1S7WA 1I9RL 4PV9B 5BOZG 5SV4A 1QLFB 3RUGE 2I07A 2ZOKA 2HTLC 5IG7B 4DKEL 5JNYB 2DLEA 3HR6A 3QSKB 5DO2D 3MRIA 1JVKA 3PWPE 1J87A 1UZ8B 1LK2B 5F88A 4AL8H 4AEEA 1ZS8A 2DLFL 2IBBA 3QIUA 2CGRL 3FQNA 2QBWA 4TUOB 5EO9A 2DICA 1KNOA 4OD2A 3RVVC 1EHXA 4GW1A 4OLXH 3T0EE 4XNXL 4KQ3H 3SDAD 5HPOA 3UAJC 5CEYA 4P4RA 3KR3L 1H3VA 2V9QA 4HIJB 2B20A 3DUUB 4P2CG 1FNFA 1WF5A 4NQDB 4PRHB 3TO4D 2J8UE 2ED8A 4D0CB 5F3BA 4LRIC 4UUJB 2F8XC 4I4WA 2P46B 3OTTA 4PRIA 3NGBC 1N0LA 5DFVD 5I9QB 3QUZD 3FCTB 5D7KE 2QSQA 4A2LA 4HUUB 2EXYC 3U9UA 5I73C 4D0DA 2FB4L 1F3DH 1DN0A 2MPAH 4PY8I 5DHVB 3NZ8B 4L4VD 3OXSA 1MY7A 1CFVL 1D6EB 1TVHB 4OF7A 2DQEL 1MFAL 3O41B 3WSQH 4S1DC 4KXZH 5A2FA 1AKJA 4LGSB 3ZKNC 1UJ3A 4ZAKB 4U1LA 4IDLA 2AK1H 2V7HA 3UTPE 4UDTA 2ZUUA 3QA3B 2AABH 4YBLC 4WTZG 4HC1H 4XP9L 2VLKE 4K9EH 4R2GD 2Z35A 5F6HI 1GXEA 1TZIA 1OTTC 4KKLC 3VH8A 4PGCB 1YPZF 1YQVH 1WCQA 1N8ZA 4NKIH 2R29L 4WFHE 1IL1A 4UT7H 4OV6F 1CN4A 1MCPH 1KCUL 3UDWA 4POZC 5EH1A 5C0AE 1AY1L 1YEIL 1A1OB 3MACH 3RZWA 4QRSA 5TQ0H 1P53A 4GMTL 5GRZA 1EHAA 4EN3D 2AI0L 4DEPB 3BP6B 3SE8H 4BSWA 1I75A 4ZUUB 5J12B 1E4WH 1X5LA 5IB4A 4NKDA 4M4PA 4YWGH 4N9GB 3NCEB 4F7EB 5KSAA 1B0GB 1R3KB 2A6DA 3QPXH 3O3AB 3WJJA 2NYYC 2XWBB 5IB1A 2XY1A 4CMMA 2NY0D 4HG4J 1N4XL 3O2VH 1UACL 2YXMA 3S36L 1HEZB 1U58A 4ENEC 4F7PA 1J86A 1UEYA 1UWXK 2EDBA 2VLMD 3CLEH 1RHFA 2AJUL 3AY4A 4PJGB 4GG6F 1J0IA 3K1DA 5HYSG 5TPWH 2ADFL 3G5XB 5F3HA 1S9VB 3ECBB 2EEBA 4JR9L 4QRTA 1H9VA 5I1IH 2Q8BL 5GS0L 2PYED 4X4XA 3QUYD 4HD9A 3C87A 2BERA 2FJFA 5DUML 3PV6B 1AHWC 5CJOL 1KJVB 5DK0A 6FABH 5ILTL 1HWHB 3GO1H 5HD8D 1RY7B 1A22B 1KYOJ 5FOJA 4KTEL 4Y2DA 5T1KA 5BV7C 2P47B 2BRRH 4RMRA 1BEYH 1T0MA 2ADGB 3CZFA 5F7FA 3CXHJ 2C3VB 1WK0A 4HS3A 1MQKL 3RVTC 1PSKL 5HI3C 2EE6A 1KCVH 1KC5L 3QIWB 1BIIA 1RUQL 1XIWD 3O6LL 4M8QB 5CBEB 3A6BL 1FC2D 1V7ML 1ROWA 3RNKB 2FO4A 3U30C 5HHVL 3LD8B 1FQ9C 2V2TA 3FFDA 3ZT7A 4OKDA 3WCYA 2WQRA 4WW1A 5FGBC 5C0CA 5EN2A 4MA1B 5AG9A 1SMAA 3TP4A 3RZCA 2X4RA 3EYOB 4QO1A 5TQ2L 1E4XI 1GZQA 3H0TB 1Q94A 1YEFL 3T4AB 2GTZB 5ICZB 35C8H 3HFML 3ARGA 4FQJL 3EOTH 2X6MA 5INCB 3WFBH 1ES0B 1KOAA 3BH8B 5C7XH 1A6ZB 4JAMB 3V0AC 4DOHB 4V1DD 3ULUL 1LO5B 1WZLA 4K7PL 5K33A 4YEFA 4G6AC 3LKOB 4HPOL 4RFEB 2AGJL 3P9LA 3QEHB 5CUSL 3GKWH 1SJEA 1KIUA 3GMOB 3IDXH 1ZT1A 5FA3B 5I1KL 3N1MC 1JTPA 4JM4L 4MNGE 4Q58C 5IHZB 1T20A 3LKRA 2LV4A 1T21B 4JO2L 3Q3GA 1HOCB 5C08B 4XNZB 5GGVY 3T3PF 2FJGA 2QLVB 4KDTA 4OLWH 3WL9A 1PFCA 3W0WA 4U1GB 1HNFA 3QQ4A 1EEZA 5DEZA 5I9QC 3UJTL 2ICES 2V7NB 2GITA 1Q1JL 1M7IB 2PKDA 4TVPH 4U31A 3JWNC 3ORJA 5DDHA 5ALCH 3QPQD 1MH5B 2F53B 4NIKB 1LD9B 3PE9A 4XXCC 3X14A 2FR4B 4RQQA 2F58L 4N0FB 3HB3C 3MV8A 2HT3D 3E6FB 4GBXB 1OSPL 1ZVSB 4NQVA 1J10A 3GSOB 5IOPA 3QHFH 4L3EB 2BY1A 2JJTA 4QRRE 1G9NH 5EU7E 2W65B 5DWUL 4ODHH 4BELD 1DBML 1IZKA 3O3EB 5DUBB 1OD9A 4ALAL 1MCKA 1MFEL 5E94B 3WUWG 3BN9C 4LLWA 2HFEA 4PRBB 2A83A 3QI9A 5KSUB 2UVFA 4KKCC 2Q3AA 1BIHA 5E6IA 2IEPA 1JV5B 2DQHL 3MFFA 5I8KH 1K4CA 3WYRA 4BQ6A 3CMGA 4U1SA 1U9KA 2JCCA 1U91A 3GHBH 3OJVC 4DEPC 2P24A 3VXNB 3QWQB 2H2PD 3VFSB 4DKFL 5J12C 2B1AL 4N1CA 2IAMB 5HI5C 4UTAH 2XIDA 3EYQC 4S1QL 4LCYA 2APTA 2BFVH 4AIXA 3U2SA 4MDJA 1E4XH 5IEHA 1IEBB 1N59A 3QUXD 4AH2B 2VLRB 4KPHH 1HHGB 1F11B 3QG6A 1EO8H 5DEGB 3STZA 2O5XL 3AXLA 3HE7A 1C5CL 1K3IA 5JR1H 2ID5A 3MRQA 4MAYB 1FFNB 4XHJC 1WAAE 3VXUA 3SDDD 3U48A 5BMFL 1KEMH 5EZOL 5I19H 2EYTA 3DBXA 2G5RA 5GS0C 3BHBB 1QR4A 4GAJL 1KTDB 3VWKB 4JGMA 3NABH 3LN4A 3R4DA 5IB5A 4WW2B 2IJ0C 1GSMA 4YGVA 3QP3A 4LCUA 4PJAA 3IDNB 2DJ4A 2QQNH 3G5VA 3IAQA 2X4PA 2CQVA 3TESA 3VRIB 4P4KB 4RISL 1OTSC 1AGBB 4J6RH 1IKNC 3QIWC 1GGCH 1HDMB 5IB3A 1WWCA 1OPGH 3P30H 2OTUB 4JRYE 4HJGA 1U8NA 2DQFA 1JGUL 4XXDB 4YE4H 3TN0A 3C6SA 4WFEE 4KMLB 5F9AC 4J23A 1OT1A 1KG0B 2CJUL 4PR5A 5DA0B 4MA1C 4L29A 4GKNB 4KKNA 2O61B 3S4SA 4G7VH 1CG9B 1G0DA 1OW0C 4TPRH 2EICA 5TE7L 2AKRA 5E99L 1UB6B 2JIXB 5IBUG 4QWWC 2CDGB 3UTZB 5IMLB 3CLFL 2X9YA 4JCMA 1LO2L 1NQBA 4KQ4L 4MXWH 2W60B 3MRFB 5GJTL 4MCYA 5E5MB 3ULUC 1XGRB 3WLWC 4XX1E 4RAVB 4HV8A 5E2TH 4LEOA 3WS3A 4NUJB 5EUKA 2IH3B 5DJ0A 4BYHA 1C5DA 3C9NA 1MCLA 3T3ME 4D9RE 5HHXL 3O9WD 5C0IA 3VXOA 4FQIH 3NZHL 4G80B 3MMEB 4XNZC 3PHQA 3T2NL 1U8JB 1NDGA 4XCEB 3VDBA 1NFKA 3JXAA 4AY0A 4JFFA 4KKBD 1RUKL 3RWEB 5K9QI 2OR9L 4DFHA 4U1GC 2R2EA 2UYLA 2EC9U 2VISA 4KJPD 2PCPA 4N0CD 3G5YB 2FBOJ 3NH7L 5HGBA 4K23H 2EXWC 1RJLB 2WUBL 1C1EL 1JWSB 4JFEB 1FPTH 5HHME 4WHTB 3NMEA 1KPUB 4HGMA 2HJLB 1OLZA 1P5VA 4X7FC 4JPKH 4K55A 1ZHLA 1M05A 1T04B 3QRFM 4G8GB 4HK3N 3AGVA 3REWB 4DKDC 4X0KA 4AIZA 2XWTA 1EA9C 2MMXA 5J11B 1U2CA 2DQCL 3BZFB 4GLRH 4AENB 3MNWA 3ARWA 5ESQB 4MZ2A 3E6HB 1AI1L 2IPKA 2VUOA 4OFYA 1GGUA 3V5KB 3CFKA 3FB7B 5I8EA 2AERT 1UB5A 3V6OA 4YZFE 3KPSA 1QO3B 3GSNB 3QJHB 1GGIH 2ZNXA 2VDKH 4Z8FH 4G43B 2X40A 2DMCA 4AEIL 4MA3B 1A7OL 3DRQA 1KEGL 3MLZH 2XZQH 4LPVA 4XAKE 5EOCL 5KSBF 4Z95L 2AQ1A 3RHWK 4LHQB 5J13B 3UBXA 5DGQA 1TVBB 1VADB 2R2HB 4PJGE 4YPGA 2GUOA 4P5TD 1E6OH 4PD4K 5DC4B 2I26N 3G6JE 3IXTA 3F7VA 3SKMA 3HS0A 1G7IA 4P2RD 3IAPA 3QEQA 4EI5D 4XWOC 4HKBB 4Y7MA 3BT2L 4IIQC 3LEVL 4AIOA 1HHHB 3JWOL 1IGIL 1RURL 3NFSL 5F9OH 3QISA 1GC1L 3VWKC 3EOYG 4CADB 4HIEA 1A6TB 3S96B 4JDZA 3OAUH 3P4OA 3OKNB 43C9A 1A6WH 4WW2C 1TFHA 4BQBA 1VEOA 4OIBA 5EIQA 4M5YH 2BNQD 2D7OA 1I7RA 2KL6A 3L3HB 5B8CC 3QFJA 4U4BA 3C8HA 1HYSD 1G6RA 4M7KH 4QTHA 4P4KC 2W0KA 1A3LH 4OZFB 3HTLX 5BRZA 3RI5K 1MAKA 2VQUA 5HYQA 1RFDH 2BRQA 1V3JA 2RIKA 5K93A 3V5HB 5FFLA 4RGOL 4TTGA 1A6UL 4XI5D 1A64A 1LVEA 1T1WA 4NQEB 2J88L 3L1OL 4YH6A 1QRND 3C8KB 5HHPA 1CR9H 2A1WH 1ZOXA 1OAQH 2G9HB 1Y6KR 4PJ7E 1XGTB 5BOPA 3WNLA 2EECA 1CGSL 1OP9A 4U3CA 4DOHE 3K2MC 4DKAA 1GL4B 3H9HB 5IW1A 4ORZC 2CDFA 3BPOB 1JZ7A 5I1CH 2XA8H 5CGTA 4FTVB 1TITA 4PB0H 5HHQB 4UBDD 5D7IB 1B0RB 3IJSA 1HCVA 1IQWL 2VLLA 4OSUH 4XBGA 5ACZB 3VWJD 2NXZB 3BP4A 4KK6D 2X70B 5GZOD 2VC2H 5GISH 3MJGX 4P23A 1RZJL 4G8IA 4ZQKB 4XVTH 25C8H 3GGWA 1QSEA 1XF2A 4OZ4B 2WUCL 1WIOA 4H8WL 4EQ2A 5GZNC 1JNJA 5HYJD 3KVQA 4M1DH 1YEGL 2F53E 3IETA 4WJ5B 5D7LD 4PJDA 3LV3B 4Z7VA 1DLHA 3H9YA 1S7WB 5FYKD 3MUHL 3QDJD 3N1GC 4X4MA 4X5XA 4R26H 2V9RA 5ENWA 1C7SA 1ADQA 2I07B 2ZOKB 3GSXA 3UTTD 3ZKMD 3LS4L 4LEXH 3ZT6A 2I5YL 5LXGH 2J6EH 1QOKA 3MRIB 4JM2A 5I0DA 3CH8A 1DLFH 3WXWL 4XP1H 3CX5K 2HTLD 5F88B 3OXRA 5IFJB 2FX8L 1ZS8B 4I5BA 3QIUB 5DVMA 3FQNB 2WIMA 1L7IL 1OAUH 5EO9B 4JPVL 1KNOB 4OD2B 5H37H 3WXVL 4MJ5A 3BP5A 4GW1B 1NC4D 5MERA 5J11C 1LEKA 4QHLB 2HVJA 4X7DC 5CEYB 3CH1A 4P4RB 3P0YL 1KELL 5JPNA 3AREA 5GGVL 4L9LA 4RCAA 5HVWA 1W2KT 4ZXBD 3MNZB 5F3BB 1CTOA 4BM7A 2ARJA 1P69B 4JFHE 4OJFH 1QFWL 4I4WB 4PRIB 5GJSH 2EDXA 2VXSL 2PNDA 3LDBB 2W0FA 4R8WL 1FLRH 3DXAE 2D7QA 3RBGA 3U9UB 3MRGA 4D0DB 1WT5A 1MCFA 1DN0B 2JK5A 1RZKH 1WIPA 4PJFA 1FYTA 2XRAL 2VLRE 1VFOA 2EXYD 3OXSB 5J13C 2EDEA 3C2SA 1AKJB 1EO7A 4PG2C 1UJ3B 4Y4FD 4U1LB 5DEFA 4UDTB 3D48R 2QR0A 4XHQA 3EYFA 1QSFD 1AGEA 1DEEA 2Z35B 2CLZA 1N5YH 1XFPA 4MQ7A 1TZIB 4YBQC 3SKUD 3VH8B 3JWOC 4NZRH 1CZ8L 2VH5L 1UM4L 2ZUYA 3QCTL 5DR5L 4EKXA 4DUWA 1GC1C 5T33H 2BY3A 1N8ZB 5HJ3A 3F7QA 4NDMA 5ADOL 1IL1B 1V05A 1OTTD 3B9KA 1P2CA 4YFLF 3D85A 1IAMA 5MENA 4QRSB 4GOSA 5I1DA 2W9DL 5JDJA 1P84J 1ZHNA 1DQLL 3VRJA 4XX1G 4BSWB 3GI8L 5M94B 1YNTA 1T03H 3QNXA 5IB4B 4NKDB 4WWID 3GRWA 3N0PB 3VFRA 1ITBB 2BSRA 1A7QH 5KSAB 4FXGA 2A6DB 4FQ1L 1MFNA 4WO4A 3QDME 1UWGL 5IB1B 4CMMB 3DVIA 2G75A 2HMIC 4ODXA 1NCBH 4JG0L 2VQ1B 1UEMA 1U58B 3BESR 1SBBA 5DMIH 4F7PB 4M7LH 5LQBL 2B0SH 1WBYA 2E3VA 3D39A 4KJQD 5C0BD 4QOKA 2OR8A 3KYKL 4BUGA 5F3HB 3ISWA 4TYUA 4K94H 3CVHH 3SQOL 4RWYL 4X4XB 4NM4H 3ALXA 2FJFB 2GAZA 2IGFL 3BD3A 1NGPL 3BPOC 5DJXA 3T0AA 4OLZL 5DK0B 4LAQH 4TUJA 1I3VA 4F33A 5T1KB 4Y2DB 4L4TE 4C56D 2NXZC 1T0MB 3CZFB 4L9DA 1F6AA 1MLBA 3MLRH 1NEZA 3SJVA 4JFDA 5KSVA 4HS3B 4XB8A 3LN9A 3PGDA 2NY3B 1RZJC 1IAIM 1BIIB 4QXUL 5IQ9A 1LK3H 4Y19E 5JMOC 4H8WC 1CIUA 2FO4B 5CEZD 4X99A 2V2TB 3FFDB 3CCHA 4HBCL 1KB9J 2XZAL 1RIUL 4WW1B 3UYOD 1MJJA 5C0CB 5E08H 5EN2B 3MUJA 1AQKH 1G7LA 4QHNA 3RZCB 2X4RB 2P7TA 1GZQB 4OFVA 1Q94B 1JI2A 3PDOA 1HKLH 1UYWH 2R15A 2R8SL 1NPUA 3TFKC 3ARGB 3OJMB 5F1NA 2OBGA 5GGUA 3FFCD 1EJOH 2ZJSL 3S98A 4R96A 3QIUC 4PJBF 1TLKA 3HI6L 3P9LB 1E4JA 5JW3L 1SJEB 3WIHH 3QQNA 1I8MA 2LU4A 1ZT1B 4DWHA 3L5HA 3PHSA 1T20B 3LKRB 3Q3GB 4JKWA 1RUMH 3M1BA 2DQUH 5JIIA 2XXMB 3SDXE 2FJGB 1YEEL 3WL9B 3QIBA 5CZVH 4N0UE 4R7NA 1D6VL 4XB7A 4MJ6A 5DMKA 1EGJH 3W0WB 2A6KA 3QQ4B 1EEZB 3FT3A 2GITB 5I8OH 4NQDD 4PRHD 3LDBC 4KVCH 5DDHB 4JANA 2J8HA 1YYML 2L7JA 4L8BA 3MRDA 3OWEA 3X14B 1NCTA 4RQQB 3GEWB 3HNVL 5DQJA 5JOPD 4N8CL 3MV8B 1BBDH 4R4FL 4NP4H 4NQVB 4ODVH 3RU8H 4HIXL 1KLUA 5IOPB 3CVIL 3MLPA 1RZFL 1UJ3C 2MPAL 2JF1A 2OP4H 3IFLL 3PP4H 1LQSR 1UZ6E 1CE1H 3DMMC 5H94A 1H3TA 3UTOA 1HYRC 1REIA 4ZAKD 2EH7L 5DHXB 2EH8H 3AFLA 4E9LA 3O2WL 3UEZA 4LQ1A 1OAZL 3H9SE 4LLWB 2HFEB 1TXKA 4Y8DC 3WE6A 3VXME 2A83B 3QI9B 4K9EL 4QXGH 3UDWC 4XNYH 4HJJL 4Z9KB 5FCSH 3RY6C 5E6IB 3FT4A 3NTCL 3MFFB 3T2PA 1K4CB 4U1SB 2JCCB 1U91B 4JREB 2P24B 2YK1H 3D3VE 4MA7L 1MI5D 4Z7OE 5C07D 1KGCE 2OCFD 1YEKL 4X8JA 5KSAC 3MACL 1IE5A 3IS0X 4LCYB 3EDDA 3U2SB 3WJJC 4JPIA 4MDJB 2DL9A 1B6UA 4XCFL 5IEHB 3SE8L 1N59B 2AXFA 4TOYL 3EYQD 3U9PL 4M5ZL 4YWGL 3U0PA 3NACH 1MCJA 3C60D 3AY4C 3QG6B 3NA9L 1LO0H 2Q86A 5FYLL 3STZB 3AXLB 3HE7B 4MCZA 5E1AA 3MRQB 1R0AH 3VXUB 2FEEI 2ENSA 4NOFA 2EYTB 2R4RL 3DBXB 4FTVE 2Y07H 4LLUA 5D7IE 3LN4B 1BX2A 4WEBL 5IB5B 4YGVB 3P4MA 3F58H 4LCUB 4NPYA 4PJAB 2LE9A 2RGSA 4HDIA 1F4XH 3G5VB 2P4AB 4MXQD 4GXUM 4D9LL 2IG2L 4Y2DC 5GS2H 2X4PB 4LCCA 1VFMA 2B39A 4MD0A 1I4FA 5LKNA 4ZNCD 1D5IL 4CVUA 3TBWA 32C2A 5IB3B 1PG7L 3GO1L 4JO1H 5D8JH 2V17L 4F80A 1KN2H 2BRRL 4HJGB 1U8NB 2DQFB 3HAEH 3TN0B 3C6SB 4KH2A 1DBJH 4KRNA 1XR8A 4YXLL 4PR5B 2VDNH 5DJYA 4L29B 3RZCC 2RCSL 2QSTA 4CW1A 2OR7A 1V3LA 1EV2E 3S4SB 5TE6H 1SHMA 4JFZL 2AKRB 3CFJA 3BQUA 2BDNL 2X7LA 3QG7L 4EUPA 3IAGC 4OCSH 1J0ZA 3N06B 5JOEA 3QUMA 1Q38A 4P59L 1JPSL 1JWMA 5CS7A 4WTWA 5B39A 1CGVA 4MCYB 1HSAA 1HILA 3UROR 5SX5H 3EHBD 3BX7C 4HV8B 3WS3B 4LEOB 1N0XH 2N1KA 5EUKB 5DJ0B 3OQ3B 4IHOA 3WFBL 1C5DB 2QSCL 3C9NB 2UZYB 3OL2A 1YECH 2ZCKL 2DOCA 5C0IB 3VXOB 1K2DA 1W72H 1ZAGA 5JHLH 3PHQB 1NDGB 5F1OB 1RMFH 1TMCB 1DSFH 4KDTC 4JFFB 3AS3A 4B7IA 4HBQA 2R2EB 2UYLB 2VISB 2VXVH 3MJ8A 5C08D 2PCPB 5E00A 4ONHA 5HGBB 5DJCA 5JHDA 3TBSA 5C09E 4YIQA 5B3JE 3S88H 4K7FA 3TJEL 1IGYA 1KTKE 2QL1A 1JF6A 3KPQA 3Q5TA 3MODH 3IFOA 5I66A 5CP7A 1J1XH 2GK2A 4W68A 2FSEA 3BGAA 4KK8D 3TYGL 4FQXA 1KPVA 3MV7D 3WFCL 1ZHLB 3QULA 1M05B 2FBJH 2DRUA 3C09B 2UWEF 4X0KB 4AIZB 2XWTB 3CD4A 4WI2A 5C6TL 4NRZA 4LFHG 4YHNA 4XNQA 2JJTC 2FIKA 3N1PC 4GBXD 4ELMA 5DK3A 4X6FA 4YHLL 4DZ8A 1CGXA 3MNWB 2BC4A 3T65A 3MXVL 4L3ED 4N90E 4XPFL 5DS8A 2IPKB 3UYRH 2LU3A 4RMVA 3QHFL 3CFKB 1J7VR 1D5BA 1S5IL 3HRZA 1DANU 5F1KC 5I8EB 3VW3L 3ZDZE 1G7JA 2R69H 1UB5B 3Q5YA 4K9EC 3KPSB 1VEMA 3JWDH 3PL6A 3QI9C 3HMXH 5FAAA 5EWIL 4LDEB 3KPLA 1AXTL 2OXGA 4TSBH 2HYMA 1BAFH 4XP5L 3H7BA 4JREC 2CO6B 4U6TA 2CD0A 3FB5A 1Z9MA 3DRQB 4GAGH 1NFDE 2XFXA 1S9KC 4GG8A 1MF2L 4PBWD 3S34H 3UBXB 4YPGB 2GUOB 3GHBL 2IAMD 3IDMA 3F7VB 3IXTB 4Z5RA 1BREA 3SKMB 3U1SH 3HS0B 1G7IB 1EHNA 1H3PH 2NXYB 1QSVA 3QEQB 5CGMA 3ULUF 1JWUA 3GM0A 3HE7C 3OMZA 3CFIC 1KT2A 4KK5C 4H1LA 1E27A 3N1FC 2IPTL 4QRPE 4WHCA 5FUCC 4MWFA 1WICA 1JMXA 4UB0H 4LMQE 3I3EA 1EHLL 4HIEB 2VDLH 2C4XA 4JDZB 4MAYD 3P4OB 43C9B 4KRLB 2ENYA 1T5WA 2KQMA 1HQRA 3V9FA 5I19L 1I7RB 4X9HA 2NY2D 3VE0A 1ACZA 2HLFD 4APQA 1FNAA 3QFJB 5BS0E 1G6RB 4YC2B 5CP3H 1B88A 2EIEA 1G6RL 4MQXC 3CDYA 4QTHB 5F7KC 4QNPE 1OP5H 1CT8A 5BRZB 4U3XA 4X7SH 1B4RA 4KI5C 4YHKL 3UYPA 3EBAA 5HYQB 1JPFB 3WHE0 5IROA 2JJSA 3EO1A 2F5BL 4P4KD 2CKBH 4OLYH 3X3FH 4YHPA 3TN0C 4OIIH 2D0FA 1T1WB 5D7JA 2JELL 1F8TH 1QFHA 4NZUL 2Z91A 5HHPB 1VPOH 2DIAA 4POYA 2F19H 1U36A 4NZTH 5IW1B 1F5WA 3D0LA 2CDFB 3L95A 3O3DA 4KRPC 4G6FB 4ZPTA 4G7VL 4TPRL 3IJSB 2VLLB 3FQUA 3BP4B 1U42A 4NRXA 5C2UB 2C7UA 3QT2A 2VZ3A 4N1EA 3MLVL 4G8IB 3GGWB 1QSEB 3UX9B 3W0WE 1XF2B 2HLAB 5EFIA 5DT1L 2NY1C 2DWEA 3ZDXF 5FDYA 1KENH 3NFNA 3IETB 3B5HA 4GXVH 4PJDB 3OBAA 3MLUL 4Z7VB 1DLHB 2AJVH 3MRHA 4GRWB 3F7RA 4FFYH 5ENWB 4OZFG 5BCAA 3BZ4A 3GSXB 3L5WA 1UM6L 3ZTNL 2JB5L 4FQLL 3SDAA 4JM2B 5BVPL 4YQXH 1W0VA 4WWKA 2P8PA 4JFED 4NWUH 4NHUA 3OXRB 4F8QA 3SN6N 3TO4A 2MCPH 4I5BB 3C09C 1YYLH 5DHYA 4WW2F 3PXHA 3QCVH 5F9WB 1FIGL 3DSFH 2X4SA 4MJ5B 3LPGA 3BP5B 3QUZA 5MERB 4JPKL 1LEKB 4G8GD 2DWDA 2HVJB 1KJ3L 1IT9L 3CH1B 2BVUA 5JPNB 4PJ9A 3AREB 5KAQF 2Z4QA 4L9LB 3CFEA 1ZLVH 5F96H 1QFUL 1FG9C 1NAKH 3X3GL 2ARJB 1R3HA 1IKFL 3AC0A 4FHBD 1K8DA 1OAKH 2A77L 3V6OC 4L4VA 5CHNA 4ERSL 2W0FB 3VRLE 4I77L 5IP4A 4U1KA 1OGAE 3VXRD 3MLSH 4H26B 4P2QA 4UI2A 5FUZH 1DJSA 3MRGB 3PWLA 3L7FA 2Y7QA 5HDQL 2Q8AH 4NQCE 4DGIL 3I02A 2JK5B 3VGBA 4PJFB 1X3DA 5D1ZA 3FRUA 1FYTB 3HZKA 4X6CE 1KJMA 2HJKA 5DI8A 4Q74A 4DGYH 4F9LA 1PJ9A 3K2UH 3LQMA 4UNUA 1UENA 2NXYC 5CLTA 5DEFB 5FUCE 2AEPH 3SPVA 1CE6A 2QR0B 3VG0L 3EYFB 1AGEB 1DEEB 2CLZB 4O2EA 1E6OL 1I1AD 4JFYA 3U36A 4OCYL 4EN3A 5JW4N 2X1XR 4FZEH 4P5MA 3WKMH 5L9DL 3MGTA 4Q9RL 5HJ3B 4NDMB 1MCCA 4Z0XA 3B9KB 2J4WL 2F8OA 1P2CB 5FF6A 5HXMA 2NY5L 3MGOA 2B2XL 4WUKL 1JBJA 3D85B 5MENB 4EIGB 1EBPA 5I1DB 2L7UA 5E7FA 1FBIL 5LCVL 1ZHNB 3BDBA 1URLA 3VRJB 3AMKA 4X6BA 2A0LD 4JDTL 1YNTB 3MOAH 3QNXB 4BKLA 2BVQA 1N26A 3HI5L 4FG6D 4UZGA 3VFRB 3GRWL 2BSRB 3ZHDA 4FXGB 3X11A 4WO4B 5I18H 5C0EA 1TPXB 1KPRA 1TJHL 2G75B 2H41A 4ODXB 4WEUD 2PYEA 3REVA 4LVOB 4JCLA 4Z7NF 4YHOL 3RHWF 4K8RH 1WBYB 3D39B 4QOKB 1DN2A 3SOBH 2BK8A 1RFDL 2E9WA 3VCLA 2VZ1A 3UPRA 2Y9RT 4LPTA 1MCOL 2GAZB 4NQED 4J3XA 4D2NA 4WU5A 4P3CH 5AZEL 2FGWL 2Y36H 5DJXB 5H2BA 1IFHL 4PRPA 4TUJB 3RJQB 2XY2A 1NGQH 4YDKL 4S1RH 2A1WL 1N7ML 4F33B 1OAQL 3IU4L 4BZ1L 2JKXA 1Z6JT 1F6AB 1MLBB 3EJZC 5K59F 3ULVH 1NEZB 1BGXL 4JFDB 3SJVB 4WI3A 5JXEA 3PGDB 2XA8L 4JFFE 5ADPL 2YD1A 4P23C 2VDQH 1OOAA 5IQ9B 2BOBA 2ITDA 1QA9A 3OKOA 1JNNL 4OZGA 4YHZL 4X99B 3P9WB 2CRIA 1K9TA 3CCHB 5DJ8A 1RUAH 1BFOA 1MJJB 1ZGLP 4JHWH 1G7LB 4XVTL 4QHNB 3CFBA 2P7TB 4RA0C 1BD2D 3MJ7A 4V1DA 4P2YA 4KZEL 3PDOB 3D87B 4G7YL 4TVPE 1A7PH 1DBKH 5JPMA 4P9MH 1YN6A 1S5HA 1PZ5A 4PIRF 5F1NB 5AWNH 5SWSE 4IDJL 5GGUB 4JM2C 1CGYA 4X6DE 4HUVA 1E6JH 3F8UB 4R96B 2E7LC 1B90A 1ACYH 1YQ2A 5F9WC 4LEXL 4B41A 1I8MB 2YKLH 3ZL4H 5JA8B 1IGFH 1FVEA 4GH7B 5JW4Q 1S9WA 1MAJA 4UMGA 3M1BB 3AREC 4L9LC 3QIBB 3WFDL 1JGLH 4R7NB 3IU3A 5L7XH 1AE6L 1NUDA 2D7TL 2VB5A 3HNTL 4G42A 4L8DA 4G3YH 4MJ6B 3RY4A 5DMKB 2A6KB 4N8VB 1U8PA 5F7YC 3DURA 3FT3B 3LAFA 4MJ4A 5L2KE 3SDCD 4JANB 5KS9A 5KVGH 1RJCA 4M6NL 3VGFA 4L8BB 3MRDB 4PJIA 4OJFL 1WT5C 2V9TA 5GJSL 3FQWA 2IADA 5DQJB 5KVDH 4MDIA 1GGBH 5CKAA 3UC0L 1GAFL 5DRNA 5IUSA 3MXWH 1CK0L 4RMUA 3G5ZA 3ZT5A 1CGTA 5CZXC 1KLUB 2NLJB 3OG6B 5B38A 4KHTH 3HC0A 4JQVA 3MOBH 1JRHI 3I85A 2WLYA 2HTKC 4KROB 4OT1L 3NCYS 5D7IF 3RVUC 5H94B 4Y5XC 1AKJD 1RZ7L 4XVSH 4YBHA 4NC0B 4TULL 4G9FE 5GGRA 3WD5H 3UO1H 3P11H 4NWTH 1J8HE 1DBBL 3UJIH 4LKXA 3WE6B 4JY6A 5CJQH 1AR1C 3B9KC 4ONOA 3T0ED 4PJXB 4R0LC 3QFJE 3FT4B 4ZO6A 3V52H 1T66C 4NZRL 1T2JA 3W11C 5BRZE 3QUXA 1LEGA 4FN0A 4ZD3L 1G7PA 2VLJD 3D2UA 4ZOBA 1G0XA 1MIML 5CKGA 5T5NG 3V4UL 1HZHH 1BP3B 1MJUH 1CXKA 3LHPH 4JFXA 3U4BL 4X8JB 1CTNA 1ZVYA 4WO4C 3ESUF 1TIUA 4OBRA 4JPIB 2JE8A 3MJ9H 4AQ1B 2AXFB 4HWBH 3V0WH 1T03L 4LVOC 1MREL 3NAAH 3U0PB 3L5XH 4F9PA 2Q86B 2CK0H 5E1AB 3HKFA 4OTXH 5T3ZL 1QZ1A 1NCBL 1A1MA 3WFEH 4H5SA 4IRSD 1NCWH 3I6KA 4LLUB 1BX2B 5CIPA 4IJ3B 3P4MB 4NPYB 1EUUA 1LWRA 5LG1A 5JO5A 1SBSL 3TH2T 5CSGA 4HDIB 5IVXF 3PGFL 1YNLL 1YEJH 4LCCB 3RGVA 3LB6C 1QSEE 3GM8A 1E0OB 4MD0B 5EOQH 1I4FB 4NN6B 3TBWB 5ELIA 32C2B 4BK4A 4W70A 3EJYC 5GRXG 1ETZA 1INDL 5D7SH 3BGFC 4HXAH 4Z7VE 2NY3D 5IGXL 4X4ME 1XR8B 3IVKA 5ANMB 3BPLB 5DJYB 2DIJA 5IWLA 4CW1B 4LSPL 1R3IH 4M48H 2P8LA 1FHGA 1BWWA 3CFJB 1OTUC 5C0RL 3BQUB 2X7LB 4NO0D 5C0CD 1YEHL 4EUPB 4PGJA 1YNKL 5E08L 3TYFA 1JRHH 3O9WA 3QUMB 2QQLL 3QUML 1JWMB 3FN9A 2F9BT 5B39B 1HSAB 1HILB 1BQHA 3IJHA 3ARGD 3CJJA 5TFSL 4GKZA 1K3ZA 5EBMB 2EIBA 2GW5A 4IHOB 1KXTB 2GFBA 2OL3H 1I1CA 4PUBH 2HT4C 1AH1A 1K2DB 5HGAA 2Z31A 1CU4L 1ZA6A 5EUOA 2R0KH 3U79A 2DKMA 3FHAA 2IQ9L 5IW3A 3QIBC 5IMKA 1X5ZA 3I6LE 5EDXA 4KHXH 1RV6X 1J0YA 4A2MA 1PEWA 2DDQL 3MJ8B 1LP9E 5E00B 3LMJL 4ONHB 4ZOEA 5DJCB 5JHDB 3TBSB 1VEPA 1WUNT 4PJFE 4YIQB 1JYWA 3QDHA 1ZT7A 4MYWB 2ICWI 4K7FB 1FYTE 1IGYB 2ZG2A 2CKNA 1EAJA 3KPQB 1MEXH 3RIAK 1FNSH 3IFOB 5I66B 4K3DH 5CP7B 4TNWK 1LO3L 3BD5A 2FSEB 4MNQE 3U83A 4FQXB 1KPVB 4H20L 3WMSA 3QULB 1CD0A 3EFFA 1X5IA 1PLGL 12E8H 3D25A 1T1YA 4NRZB 4YHNB 4XNQB 1RJYA 2FIKB 4EVNA 4ELMB 1HQ4A 3GMLA 4X6FB 4DZ8B 4KROC 2N4IA 5D93B 3S4SG 1D3CA 2BC4B 3T65B 5HHOD 3HR5A 1WZ1L 4XVJH 4HIHA 2AJZA 1J0JA 3RWCA 3L3JA 1Z9OA 5DS8B 1X6LA 2WSKA 4ZFZA 1CLOH 3KJ6L 4O9HL 1D5BB 1Z5LA 3HRZB 2CXGA 5GGRY 5IFAL 1G7JB 5HI4C 2NNAA 4DVRH 5KVFH 1UH2A 3PL6B 2GY5A 4YXHL 1OY3B 3S37H 4KY1H 3QQ9D 4EOWH 1JYXA 4P5TA 3KPLB 3QUKA 4Y16D 2NPLX 3VJ6A 3H7BB 2AEQH 4P2RA 4M6OH 3O11A 4JQIL 3FB5B 5MHSD 2RFXA 4BSVA 5E6ID 5FXCH 2XFXB 3RWHA 1TQBB 4GG8B 3O6MH 2VDML 5L6YL 3DYMA 1IZJA 5CZKA 4Y89A 2HVKA 3IDMB 5FECA 4Z5RB 4ODSL 4TSAH 4I1NB 1FJ1A 5C86A 4RMTA 4NNPL 4N0YL 4DUXA 4HHAA 3KLHD 3H8NA 4HXBL 1QPXA 1KT2B 2HFGH 4H1LB 4G5ZH 5I8CA 5E7BA 1E27B 3TT1L 1MFBL 4MWFB 2PETA 3DIFA 4M43L 1N6VA 4QRRD 1S3KL 3VXUD 4ZS7L 4Q6YA 1SY6A 4IJ3C 5I1HH 1T5WB 5FGCB 2D4DA 1HQRB 3IJYA 3HZYA 1DQDH 5GHWH 1U6AH 3EYVA 3VE0B 4WI6A 4APQB 1CS6A 3PP3K 1CT8B 3UTSD 4OZIA 2AQ3A 4XNUH 4NN6C 1B0WA 4B50A 3M17A 1WFUA 2YD7A 2HH0L 3EO1B 3U6RA 4YHPB 2YUXA 2KUTA 1MVFA 5AD0A 2D03H 4IRJA 3O2DA 1LE9A 4QXTA 2HRPL 5D7JB 2FL5A 3BPLC 1YMHA 1PYWA 2CH8A 4ZFGH 5I17A 1C8PA 3HLAA 5BV7H 4LSVL 7FABH 2Z91B 4PJEA 4Z76A 1C12A 4R90L 4UNVA 1S7SA 2VOTA 4KZDL 5CEZH 1FNHA 1KJ2A 3NIFE 4HJ0C 3D0LB 4ZTPL 3L95B 2XTJB 2VDNL 3O3DB 2DAVA 2YS4A 1IM9D 1F42A 2ORBH 3DLQR 3CFCL 4ZPTB 4LCIH 1L6ZA 1FN4A 1GYAA 2EO1A 3FQUB 3F6IA 1PW3A 4NRXB 5HYJA 4LU5H 3QBTB 1EJ6A 5DXWA 3TPUA 5BO1H 4AMKH 1ZV5A 2C7UB 5JXAL 2XWJA 3DX7A 5D7LA 3MV9D 1P7HL 4X9IA 3NA4A 1CLYL 1I9RH 4MSWA 5A3IC 1KIQA 2JCCF 5HHNA 5EFIB 4DKEH 1N0XL 2DQGL 5J4MA 4WHYG 3UTTA 1NMCB 4CVWA 2DWEB 3CDFA 1CVRA 5GPRA 3NFNB 1MCWW 3ARFC 4OF0A 1A0QL 1XR9A 2JTDA 1TQCB 3Q6GL 2DLFH 3MRHB 2CGRH 4OQTA 3KPNB 3ILPA 5DFTA 4MB3A 4XNXH 4JRXD 4R4ND 3BZ4B 3L5WB 3WNMA 4X4YA 3KR3H 3LS5L 3SDYL 1W0VB 4WWKB 4Y4KA 1A7NL 1YDPA 4NHUB 4LSRL 3TO4B 4ZXBA 3BRDA 3VXSA 3LH2L 5C0ND 4GSDL 4PJ8C 5DHYB 1YJDL 2JLLA 2X4SB 1T0NA 4PJAF 3QUZB 3QR2A 4LLMA 2KDGA 2DWDB 1CDIA 2CK2A 5D93C 3T77A 2YD3A 4PJ9B 5D1XC 4CVXA 1I8IA 2Z4QB 3CFEB 2FB4H 3KLDA 4NYLA 1R3HB 4KI5F 5DHVH 2OM5A 1K8DB 1QRKA 1OWWA 2A74A 4KV5E 3GUTA 4L4VB 1CFVH 2R0ZL 2DQEH 1MFAH 5CHNB 3PL6C 2VDPL 1AO7A 3OAZK 4OFYD 4U1KB 5C9KA 4URTB 4P3WA 4P2QB 3PWLB 3L7FB 4Y4FA 2Y7QB 3ZE1E 3I02B 3KPSD 4XP9H 3IB4A 5D1ZB 2ATPA 3MA9L 2R0LH 1HINH 1QSFA 3FRUB 3HZKB 1U3YA 4R2GB 1KJMB 1TQBC 1X4XA 2XQYG 4BA8A 5DI8B 5TDOA 1BAFL 2R29H 1PEZA 1KCUH 5HHMD 1YEIH 1G1YA 3F12A 3SPVB 1CE6B 4GMTH 4ZTOL 1ERNA 4O2EB 3GFUA 2AI0H 1ZTXL 2E8ZA 4JFYB 3U36B 1F3RB 2NXYD 2AJSH 3QEQD 2WP3T 5DQDL 3SGKA 4P5MB 3MGTB 4Z0XB 2F5AL 1QYGL 3I9GL 5FF6B 3MGOB 1RULL 3KYMA 3CUPA 2R23A 1UACH 3S36H 2NY0B 5TF0A 2YD4A 2NR6D 1FO0A 4X6BB 3TV3L 4APQC 4BKLB 2ADFH 2BVQB 5C0BA 4JR9H 3EDJA 4HWZA 2BVPA 3X11B 2OTWA 2Q8BH 5GS0H 3JZ7A 1KPRB 5IROC 2JJSC 5DUMH 5FYJD 2PYEB 3REVB 2DD8H 5CJOH 4PLNC 5T3XD 4MS8C 4UOW1 4XVUD 2BNUA 5ILTH 4N5EC 5D7JC 1L6XA 1WQVT 1B2WL 4RAHA 5HTSA 3VCLB 3S3SA 3UPRB 4C56A 1FZOA 1G9ML 1MQKH 1PSKH 4OIIL 1KC5H 1RUQH 2XNAA 4WU5B 1T7YA 2AXJA 1V7MH 5H2BB 4PRPB 5HHVH 2ERJB 4L1HA 4PGDA 5FIEA 1KN4L 4ELKA 3DRTA 3OF6D 1FORL 1HXYA 4UILL 3BKJH 3LRSA 5TQ2H 3T0DA 3W39A 4JE4B 5E2VL 4PTUA 2BOBB 2ITDB 1QA9B 1NGWA 3OKOB 4OZGB 4FQJH 3BKYL 2D7NA 3OSKA 5DJ8B 4WFFD 1BFOB 4I0PD 5DO2C 4F57L 3FFCA 3GNML 3ULUH 4K7PH 3CFBB 2VR9A 1TQCC 1RZ8A 3MJ7B 4V1DB 1YZZA 4HPOH 4H0HB 2AGJH 5CUSH 4FS0A 4GS7B 5F9JA 5I1KH 4JM4H 5JPMB 1YN6B 1S5HB 1PZ5B 4JO2H 2JJVA 2GCYA 4FQHA 3SDAC 3C5ZD 2ADIA 1VA9A 2FX9L 1MSPA 5J1AA 4HUVB 4O5LL 3WDJA 4WWKC 4DAGL 4ELME 3MLXL 3TO4C 1KCSL 1IRAY 3LN5A 3T04D 1YJDC 3UJTH 4JM2D 3ROLA 4AQOA 4NHCL 5DFVC 1Q1JH 1F90L 4LRNL 2YPLE 3QUZC 1IEAA 5IHLB 4GO6B 1P4IL 1FVEB 1G9EA 1S9WB 4W4NA 2A73A 3BVNA 3BMWA 4XRCA 2P5WD 1YYLL 3UZEA 2F58H 3IU3B 1QNZL 1T4KA 4L8DB 4G42B 3C08L 1U8PB 1CFTA 4OF6A 1JZ4A 1HN1A 1OSPH 3DURB 4HIIB 5I1GL 2W07A 3PQYA 5DQ9A 5AAMA 4YDJA 5KS9B 2OQJA 1EVTC 1XAUA 2NTFA 4PJIB 4H0IA 5DWUH 4C58B 5CGYD 1DBMH 3FQWB 1EEUA 1KTLA 4E41A 2IADB 5D1ZC 5LGKA 4MDIB 4ALAH 1A6VL 4R2GC 1NLDL 1MFEH 1U8QA 5DRNB 1AXSA 3G5ZB 1VGKA 4OIAA 3ARQA 2Q8AL 4F9LC 5B38B 1VERA 3HC0B 4JHZA 1QFPA 1J12A 2DQHH 2F54E 3ZE0F 4XBEL 2R56L 4KWUA 3FL7A 3FONA 4A6YA 5C9JA 4DKFH 3A6CH 2B1AH 4EN3C 4D9QE 5GGRB 3K2UL 3LCYA 5FGCE 5KOVC 1MI5A 4EDWL 4S1QH 5C07A 3ZKXB 4LKXB 4JY6B 1UKQA 2ICCA 1E28A 4YUEL 5ISZD 1JCKA 4LSQL 2OYPA 3H3PH 4PJCA 2NY0C 5JIPA 3QUXB 3WKML 1LEGB 1G7PB 1OAYL 3D2UB 5E03A 2O5XH 4PJDF 4JO3L 3C60A 3OX8A 4TVSa 4P0DA 1UH4A 2OZ4A 5BMFH 4JFXB 4GRWF 5EZOH 3MOQA 3V79C 4GAJH 5H37G 3FAWA 4OI9A 1VDGA 3DXAD 1Z9SA 4JM2F 3TH3T 2ARWA 2GHWB 1WIUA 4HZAA 5I1AA 5I18L 3CSPA 4RGMB 3MRPA 3EGSA 1A1MB 1ONQA 2UWEA 1G9MC 3D39D 4H5SB 4QOKD 3DECA 3TBYA 1YPZE 2KH2B 3I6KB 5CIPB 1XGPA 1CDYA 1XIWC 4OCLC 5IT2H 5DD5L 2Z0BA 5JO5B 5GQBA 2ERJC 3B5TA 3RGVB 3TNMA 5JA9A 2CJUH 4P3CL 5EG6C 3LKNA 1FCGA 2XN9B 3KXFA 5TE7H 5E99H 3SJVD 4BSJA 1ETZB 3CLFH 1CBVL 1H3WM 4KQ4H 1NDMA 2MQ0A 1GRWA 5D71H 3WN5A 3IVKB 5GJTH 2DTSA 2QHRL 4GG6E 2BNRA 2H26A 3QDMD 3Q1SL 1KBGL 2P8LB 2YA0A 4GS7C 1UC6A 4RZCA 5HHXH 4PFEA 4HUKB 3P73A 4JHWL 3TYFB 2K9UA 5EIVA 3O9WB 3T2NH 5DZLA 1YC8A 1RUKH 4UNTA 1XMWA 1BQHB 3IJHB 4OM0H 3QXUA 4GKZB 1JPTL 3MR9B 1DL7H 5KVMC 3NN8A 4MA8L 3SGJA 3NH7H 2GFBB 4EI6A 2A9NH 2E6JA 3BZEA 3G6DL 2WUBH 4IMKC 5HGAB 1C1EH 2Z31B 1ZA6B 5EUOB 3T1FA 3L3DA 2VXQL 3S5LB 2P43B 5DJ2A 5IMKB 1FFPA 4L4TD 4ZS6D 2H1PL 1BFTA 2V7NA 1OQOA 3RKPA 2H8PA 4OLVL 4AEHH 2QQQA 1GHFL 2CLVA 4HMEA 1MHEA 2HT3C 3MV7A 3QIBD 4PLJC 4QGYA 5A2IH 1CFBA 4LGPB 4M03A 1ZT7B 1MFCL 4Y19D 1DUYA 5JORA 2EC8A 3VG9B 4G3YL 2DQCH 5IIEA 3DSNA 3BZDA 2EE2A 5J9PA 5D9SA 3RA7H 3GSVA 3MRCA 4ZYKA 4G8EA 3L3OA 1AI1H 1ORQA 4RMSA 5BXFA 3BWAA 3EFFB 4NNYA 4PLOB 3ALPA 3D25B 1T1YB 1KXVC 3TGXA 1RJYB 4EVNB 1NL0L 1H3XA 1HQ4B 3GMLB 3GSNH 3MLWL 3Q5OA 3BDYL 1I7ZA 3HR5B 4ODTH 4IOFD 3D18A 3I50L 2AJZB 4HIHB 3TWCL 3RWCB 4AEIH 3L3JB 1A7OH 4EUPG 2ICEA 4ZFZB 3DX8A 1KEGH 3BD4A 3OB0H 1Z5LB 5C70A 2H2PC 3FZUD 5EOCH 4Z95H 3T3PE 3RL1A 4L8CA 2N7AA 3ARXA 2NNAB 1BJ1H 6CGTA 2VLME 4HWNA 4P5TB 3VFSA 5IR1A 2CUMA 1IAKA 3QUKB 3WD5L 3R06A 3QUXC 4ZUWA 3VJ6B 3O11B 3TJHC 4NNXA 2RFXB 4BSVB 3KPPA 3BT2H 1P6AB 2PYEE 3RWHB 3LEVH 4PP1D 3JWOH 1IGIH 2BOCA 3NFSH 3GKZA 3SDDC 1GC1H 2HVKB 5FECB 1FJ1B 4B0MM 1QD0A 3DUHA 4HHAB 3SHSA 2YUVA 5DC0A 3KPRA 2PW2A 4F9PC 1NGZA 5GS1C 2E7BA 1W8OA 2YD5A 3S35L 2ZSWA 2FHCA 5FM8A 4FQPA 1Z3GH 3LKQA 4Y8AA 3MJ9L 4NOBA 1QFWI 4RGMC 5I8CB 1INEL 4PJHF 5CJXA 2X9XA 4M61A 4P48A 5LBSL 1A02N 2I9TA 3KHOA 4HKZA 3DIFB 3L5XL 2P45B 4OZFH 1OVZA 2EDNA 3RDTA 1L4IA 4OTXL 4H25A 1SY6L 3IJYB 3QB7C 4G6ML 4ODBD 2DIBA 4RGOH 3EYVB 4ONGL 1A6UH 3DVFA 3WIIL 4ZMAT 5I0ZA 1G6VK 5E95B 3H9SD 2J88H 4UAOB 2BJML 4OZGE 4OZIB 2KPNA 4CKVX 1B3JA 5HDLA 3M17B 4PJ5E 1T7XA 1H3UA 1U41A 3U6RB 3OV6A 2H32A 4Q0XL 4DQOL 5DC9B 5EOQL 4LDLB 4V1DE 3PUCA 2CR6A 5AD0B 4IRJB 5DURD 1LE9B 4QXTB 4FQCL 2FL5B 3L3IA 3ZMRA 1YMHB 1PYWB 1A1NA 1IQWH 5I17B 1TVDA 1H3GA 1UVQB 3HLAB 4OCWL 5IWLC 4PJEB 1MPAL 4Z76B 2PW1A 5IMLA 1C12B 1IARB 4HXAL 1S7SB 2VJXA 4I3RL 1RZJH 5F6IC 1KJ2B 2M2DA 1U8LA 3LEXA 1KJ2L 1FGVL 1B6DA 2WUCH 3DHJA 4I0KA 3O9WC 4H8WH 4FFWD 1X4YA 4D3CL 3BQUD 1KV3A 3ZTJH 5F7WC 1FN4B 4HJ0D 2VABA 4QHKJ 3HN3A 1YEGH 3ET9F 5HYJB 4PJXF 2J3SA 3TPUB 4YX2L 2XWJB 3DX7B 5D7LB 4KJPC 3G08A 4N0CC 1NJ9A 4H1LG 5AEAA 5DRXA 4MSWB 1A47A 4KV5F 2KZ1B 2H45A 1KIQB 5HHNB 3DVNA 5FYKL 3BUTA 4HFUL 3LS4H 4KDVA 5HYFA 2I5YH 3DUSA 3G5YA 1FP5A 3NCJL 3TA3A 2PR4L 4WTZA 3OAYH 3WXWH 3OKKA 1XR9B 2FX8H 4ZOAA 1XT5A 4RGNB 1MHPL 2ITCA 4K2UL 1L7IH 3ILPB 4OQTL 4JPVH 1LE5A 3WXVH 3W81A 4L3AA 3NIDF 4PGEA 5IFHL 3VG9C 4X4YB 1CDGA 4LMQI 1OD7A 2Y4SA 3RNQA 5JHDD 3P0YH 1KELH 2JJUA 4G8FA 4X7CC 5GGVH 1FNGA 2BSED 2EIDA 4OZHF 3C6LA 1WISA 4Y4KB 1BLNA 4NFCA 5DMGD 1YDPB 2E7HA 4WFGE 4ZXBB 1QFWH 3BAEL 2YMXL 2FNBA 3VXSB 2N7BA 1T5XA 2VXSH 1U92A 1T0NB 4K3DL 1MRDL 5DJZA 5IBLD 4FQXD 4R8WH 5B21A 4LLMB 3BXNA 3T77B 1NBYA 2IMNA 4KKAC 1MJ8L 3VFVB 4CVXB 1I8IB 3VXRA 4X9FA 2DYPA 4NYLB 2MKWA 3QNZA 1WTGT 2A74B 4I18A 3GUTB 1NANI 4OQ1A 2XACC 1HI6A 4XVJL 3FMGL 5B3NA 1AO7B 2APXA 5A2LH 2FWOA 4P5TC 4C4KO 4Y4FB 4LARH 2WM0A 3PL6D 5C6PB 2ATPB 5CJBA 1LMKA 1QSFB 2VH5H 5IW6A 1UM4H 3QCTH 2PO6A 1I1AA 5C1MB 5DR5H 3RIAF 1DQJA 1VSCA 5TDOB 3B6SA 2FJHA 5ADOH 4TNWF 1U8HA 1N6QL 2DLTA 4M6OL 2HP4A 1TENA 1RK1A 4LSUL 3F12B 1GIGL 2AEIT 2W9DH 3O6ML 2DM7A 1DQLH 3JBG7 3CX5J 4XAWL 3GI8H 1S9XA 3P77A 3SQBA 3FRPA 1I9JL 4DN3H 3ARBA 3QAZB 1BOYA 1HYSC 3NOIA 2BVTA 1R6VA 4FQ1H 3FQRA 1Q72L 3MCKA 1UWGH 1NUFA 3KYMB 4GAYA 3CUPB 2R23B 1NSNL 4JG0H 4JQXA 2P49B 1FO0B 4N90D 3BIAX 5LQBH 1FO0L 3R8BB 5M7QA 1ZGLM 2M1KA 1FVDA 3KYKH 4X6EA 5D70L 5C0BB 4XI5C 3H7LA 4UAOC 2AJXL 5I1HL 4HWZB 2BVPB 2OTWB 3O6FD 3O3UN 4X7TA 3K4DA 4APQD 3SQOH 4RWYH 3RVWD 1U6AL 5KSBE 2BMKA 2DN7A 2MTPA 1MY5A 2FYYA 2IGFH 1NGPH 2CRZA 5J06A 4YHML 4OLZH 2GKIA 4IOSD 4LVEA 4IRJC 2BNUB 2IH1A 1AFVL 3MZTA 4UBDC 1X4ZA 2GJ6A 4C56B 1FZOB 2XZZA 4LVNB 1OT2A 4KK6C 5ITBL 4N5ED 1QLEL 5B4MD 2FX7L 2XNAB 4QXUH 1G7QA 1G7HA 3QRGH 4HWUA 5F97E 3SKJL 7FABL 4JDVA 1J8KA 5A40E 4PGDB 4PLKD 3SE9L 3NPSC 4FMFA 3QHZL 4HBCH 4OGZA 1PGRB 4GW5A 4HCRA 4ELKB 4I9WE 1RIUH 2XTJD 4LKCA 5J89A 2BXZA 3DRTB 1KCRH 4Y4HA 1HXYB 4PYGA 3SO3B 3K4ZA 3LRSB 5IMOA 1OM3L 3W39B 4X9GA 3CSGA 1BD2A 3CX2A 1NANH 4MJIE 3H42L 4PTUB 4S0TD 4R6UA 5K9KA 4FP8L 2R8SH 3IF1A 1NGWB 4FFVD 2VMFA 2YD2A 4XNMA 2NCMA 1P7QD 3RX7A 2EZ0D 1FSKB 4XP6L 1S7VA 2DLHA 3ZKMC 2O26U 3QYCA 1NMBL 4CAGA 2ZJSH 3FFCB 3QWRD 5E6ZA 1UH3A 4RGNC 1RZ8B 2R2CA 3DHMA 1KUMA 3HI6H 4M02A 3VMPA 5DD1L 3WUWA 5JW3H 3FN0L 1T22A 2FZ3A 5F9JB 1QEWA 1K5NA 1FGNH 2GCYB 4FQHB 5IFJA 1J1OL 2ADIB 5ICXA 1YEEH 1HH9A 5J1AB 4F37K 2WP3O 4Y4KC 1D6VH 4X9BA 4ZUSA 1RI8A 1DCLA 4ZXBC 3LN5B 4QHLA 1A14L 1EO5A 3ROLB 1OHQA 2EKSA 4WWKD 1IEAB 1YYMH 2MKLC 3MNZA 3WNKA 2A73B 5EA0L 3SDCA 1MLCA 3BVNB 1OP3K 3SY0A 4QYOA 5IVXA 1EAPA 4XRCB 1JF5A 4HW6A 4TRPL 1T4KB 5I30L 3HNVH 3CU7A 3BE1H 4KTDL 4N8CH 3ZDYF 1CFTB 4R4FH 4PJ9D 4WV1A 4HIXH 4P2RE 3E3QC 2B1HL 1L7TL 4DGVL 4JHBA 3PQYB 5DQ9B 4YDJB 3MSPA 3QXDA 3CVIH 2OQJB 1RZFH 2NTFB 4PB9L 4LLVA 3RUGA 4DW2L 4B53A 4Y4FC 3IFLH 4BUHA 1MCWM 3D9AL 5ESVA 1KTLB 4E41B 3PWPA 4JZNA 2D0GA 2EH7H 4P2QD 1U8QB 2ZOLA 1WZMA 3O2WH 4JN1L 1AXSB 2QTEA 1OAZH 4JRWA 4RNRB 1BZ7A 1VGKB 5D1ZD 1HWGB 3B2UD 2BNQE 4R7DA 1JN6A 4HJJH 1FLTX 2R0LL 1HINL 3T0EA 5GGTA 3NTCH 3VDAA 1S78D 3FONB 2VQTA 4A6YB 2X4QA 5C9JB 3V4PH 4A6YL 2CIKA 4U3HA 5GRJL 4MA7H 1OARL 2J8UA 2VLJA 4Q6IC 3SGKC 1UA6L 4N8PA 4OGYH 1FC1A 1MI5B 1TZHA 4OGAC 1YEKH 1WCBA 5C07B 3DYOA 5CSBA 5EBLA 1E28B 1FV1A 4XCFH 4PJCB 4TOYH 3U9PH 2AJSL 2EDHA 4M5ZH 3ARSA 3C2AL 4BFIA 3NA9H 3UZQA 3O8XA 3DV4A 1QRNE 5FYLH 3C60B 3OX8B 2E9IA 4KJQC 2OZ4L 4HWEH 2R4RH 2IPUK 2VQ1A 4XCCL 3BP7A 2WINA 3HNSL 2Y5EA 1OGAD 3DO7A 1PKQA 4WEBH 1JHTA 4IRSA 3L3KA 4QLRA 3PWNA 1RIHL 3F6LA 5DFWH 5D96B 1TZGL 5I1AB 4D9LH 3BN3B 2IG2H 3MRPB 3EGSB 4Y5VA 3RWIA 2HJFA 1ONQB 2UWEB 2DD8L 1Z0MA 4LVNC 1D5IH 1C16A 5E70A 3TBYB 1UWEL 3GK8L 1PG7H 8CGTA 2V17H 1XGPB 4PGZA 1FFOA 5C0AA 2PXYD 2YSSA 1X44A 2VAAA 1ZHBA 2VZTA 4ONFL 4UINL 5B38G 3BW9A 2JJWA 5D7LE 4M7JL 1HE7A 2WBJD 3DI2B 1U2HA 3WIFA 3EOAA 4YXLH 2YUZA 3PABA 5FYKE 1CDHA 3TNMB 5C3TA 4PRPD 3QDJE 4RWHA 2J8OA 1ZLWH 3UBXI 1QKZH 2RCSH 3LKNB 3SO3C 3W5NA 3KXFB 4OGXL 3UTTE 5GRYA 4JFZH 5C8JA 5T1DL 2BDNH 3QG7H 1ZHKA 3L9RA 5JXED 1ED3A 4NO0A 4EDXA 3D1MC 3IGAA 2EDJA 4P59H 1JPSH 1NDMB 3BKJL 3O0RL 2R9HC 4U49A 3WN5B 1M7XA 1H8NA 4TN9A 3PWVA 2X42A 2BNRB 2H26B 3NCFB 3LRGA 5GGQL 5I1LA 4KRMB 2ATKA 2QSCH 3GSQA 4PS4L 2ZCKH 4RZCB 3IKCA 1J0HA 1QTYT 3AM8A 3P73B 4FABL 4LHUD 3MO1A 4U1HA 5CLWA 3QHTC 4MVBD 4DK3A 5HVFB 3NN8B 3HC4H 4EI6B 3WUZA 2Q6WA 4M3KB 4NN7B 4WY7H 3KLAA 3BZEB 4DTGL 2WIIA 4UU9A 3TJEH 3T1FB 3L3DB 3ARDD 4XZUA 4AG4L 4RAUA 4N9OB 1A7BA 5DJ2B 3E3QE 1FFPB 3GJFA 2FGZA 4RDQF 2WLZA 3QEGL 3U7WL 2H8PB 5GXBB 3TYGH 4QHMA 1MCSA 3WFCH 4G6JL 2CLVB 3KWWA 1I8KA 1MHEB 3MV7B 2PTUA 5JOFA 2C1PA 5FCUH 5C6TH 3SBWA 1BFVL 1DUYB 1QSFE 1RIVH 5JORB 5IIEB 4YHLH 5DRZA 4PLJD 5EORH 5J9PB 3FO9A 5D9SB 1IGCL 3MXVH 3GSVB 3MRCB 4ZYKB 4G8EB 3L3OB 4XPFH 1RD6A 5HHOA 1ORQB 4O02L 2CLRB 2PF6A 5BXFB 3BWAB 1BQUA 4NNYB 1S5IH 4ZAKC 1AP2A 1F58L 1BJMA 3CIQA 4W81A 3VW3H 1N64H 4XPAL 4PJBE 5EWIH 1RHHA 1Z2KA 1V3KA 1AXTH 1I7ZB 4HS8L 3MUZ1 4XP5H 3D18B 4Y16A 1Q9OA 2ICEB 2Z92A 3DX8B 1H8OA 3OKLA 1MF2H 1MCQA 2CUIA 3RL1B 4L8CB 3VFWA 1D5XA 3CMOL 2KBGA 4I3SL 5HVGB 4P49A 2OXHA 4OZGF 5C0BE 1WITA 3A6CL 1VGEL 3GIVA 2EDKA 5IR1B 1IAKB 3R06B 4ZUWB 1ZEAL 2WQ8A 3UPAA 3TLRA 4NNXB 1AR2A 3C60C 4Y0GA 2X1OA 3KPPB 3ES6A 4QF1A 5F7DA 1XZ0A 3GBLA 3H3PL 2IPTH 2BOCB 2B5IB 4NQXA 3TJHD 3D2UD 4KJWD 4JFQA 2H3NA 4AYFA 1EHLH 3DARA 3BGMA 4LSSL 1HCFX 4ODUA 2AJYH 4WHYH 4QRRA 2ZZUT 5I1JL 3KPRB 2PW2B 3DTXB 1NGZB 2OTPA 3DYPA 2ZSWB 5D96C 3SGEI 3LKQB 5M95B 4HKXA 2ZUXA 2ZWLT 3W2DL 2NY2B 4MXQC 1G6RH 5MEQA 4GLRI 4M61B 2I9TB 4HKZB 4QCIA 1Q9LA 8FABA 4YHKH 3RDTB 3UTSA 5E56A 2X41A 5CEZE 4H25B 1ZGLA 2F5BH 3B9EA 5E8DH 2AP2A 2BY2A 1DQML 1YMME 2JELH 1J8HD 1JF1A 3P2TA 2DQJL 4NZUH 5KS9F 5E8OA 3S37X 5IT2L 5MI0B 3LD8C 1WWAX 4PJIF 1NBQA 3RGVD 2EIZA 2VDRL 3FFCE 5DA4A 2H32B 4KMTH 1A5FL 4P99A 4NSKA 2XN9D 4O2CA 1YY9D 3ZSTA 2P8MA 3WN5C 3L3IB 4AM0A 3HC3L 1IM9A 3ALWA 1A1NB 3MQIA 4KK9D 2PW1B 2W38A 3EHBC 4H88L 3OG4B 5FOBA 3MLVH 5D71L 2VSCA 3BKCL 4ZO7A 1U8LB 3LEXB 1P4LA 3MV9A 5TDNA 3MYJA 3ZHKA 1A4JA 2VE6A 5DT1H 3OPZL 4G6KL 4GQPH 1HHJA 3HE6D 1L9NA 3EKCA 2VABB 3FQXA 2MNUA 4GRLA 4NQDE 4PRHE 3MLUH 1UKSA 3SGJC 3G08B 1NJ9B 3BIKA 4NN7C 3VFMA 5DRXB 4GRWH 4MLIA 3DVNB 1ND0A 1UM6H 1ADQH 4GKSA 4OM0L 4JRYA 3ZTNH 5JOPE 2JB5H 4FQLH 4JRXA 3DUSB 1DL7L 3RP1A 1OP5K 5BVPH 4PREA 3TA3B 4OV5A 3BYTA 2Z31D 1IC4L 2A9NL 3FOLA 4MGXA 3PHOA 3OKKB 5TF1H 4KK8C 1IQDA 4QKXB 2ITCB 5AUMA 5I16A 1FDLL 1LE5B 1FIGH 3FB8A 3I3BA 2ARJQ 4PGEB 4WUUD 3VGGA 5J3HD 4JZJA 4AEHL 1LILA 1KJ3H 1IT9H 3RNQB 4GBXC 4G8FB 4Z18A 1FNGB 4PY7A 5ERWA 3C6LB 4XMKL 1QFUH 3F7YA 4MHHG 1BLNB 1IC5L 3X3GH 3SGEH 5CSZA 1IKFH 2CDEA 5IQ7L 2A77H 2VZVA 4NBXB 4ZPVA 1T5XB 4KAQL 1U92B 3RA7L 2W1NA 5DJZB 4ERSH 3RQ3A 4I77H 3BXNB 1I9EA 1NBYB 3H3BC 5HYEA 4XC3H 3KNBA 5C07E 4BH7B 3STLA 5HDQH 4JZOA 3VXRB 1AXIB 1QBBA 4DGIH 5FB8A 1JNLH 4Q9BA 4W6YB 1XCQA 2DYPB 3VFUA 3QNZB 2K7QA 4UQ3A 4AZ8A 4KKAD 1U3HD 3GMPA 5FUOL 3GSNL 4I18B 5I1EL 4ODTL 1HI6B 4JKPH 2FWOB 2A6JA 1U8MA 2IAMC 2NX5D 3VG0H 4HT1L 1EVUA 1KB5A 2V5TA 2HN7A 4HKJA 4HLJA 3ZYIA 3VI3F 1H15A 4MB5A 4OCYH 1LDPL 3S7GA 1FL3A 5IW6B 1T7ZA 1I1AB 2PO6B 4GMSL 4YXKL 2B5IC 1DQJB 5L9DH 3B6SB 2FJHB 4I3GA 4Q9RH 3EDEA 3K8MA 1U8HB 2J4WH 3D6GA 2NY5H 3INUL 4WUKH 2B2XH 1RK1B 5T1MA 4MAYC 2UWEE 2NY4D 4MMZC 2DKUA 1FBIH 5LCVH 1FFQA 1S9XB 3P77B 4JDTH 1JJUA 2NY2C 3ARBB 4OFIA 2HLFC 3HI5H 5CJXC 4NO3A 3GRWH 1F4AA 3HUJF 2X4NA 3FQRB 3IRZA 3RDTC 3MCKB 5EUOF 1CYGA 5J1TC 2YA2A 4OCMC 4RFOL 1AIFA 1TJHH 1Z3GL 4GAYB 4YHOH 1Z0NA 1DUZA 1VFBA 4RMWA 2H2SD 4YHYB 1FVDB 4XPBL 2BY0A 4X6EB 3LZFL 1JPFA 2R4SL 5T1LD 3RKDD 3GMMA 1G7MA 1RVFL 4UT9L 1BQLL 2F8VA 5D6DA 4HUWA 4X7TB 5MI0C 4JPWL 5HVHB 1JHLL 1MCOH 2BMKB 3G6JA 1YY8A 2ZKHL 2FYYB 5AZEH 4C83A 2FGWH 1NLBL 1PD6A 1IFHH 2AW2A 3P0GB 4L8SA 5CJ5A 5D1QD 4YDKH 4HMCA 3EYUL 2IH1B 2MQCA 1N7MH 3IU4H 4BZ1H 1EMTH 1YN7A 3ULUE 4UV4L 2GJ6B 1BGXH 4LDOB 3F5WA 4IRJD 1F13A 2WWMC 2HFTA 3OF6A 5ADPH 3MBED 4U0QB 2HKFL 2P1YA 1DVFD 1G7QB 5D5MA 1ZLUH 1G7HB 1GPOL 3I6GA 1C08A 4KC3B 4JFPA 1JNNH 2IFFL 4U7KA 4JDVB 4YHZH 5C08E 3VDCA 3CFDA 1LO4L 4ZFOA 4MJ2A 1RJZA 4GW5B 1IKNA 9CGTA 5I15L 4LKCB 4HCRL 4Y4HB 4I0PA 2HLAA 5IMOB 1IEHA 4KZEH 4HEPG 5INDA 4HGKC 1BD2B 4G7YH 5DUPL 5LWYL 1MCDA 5K9KB 2D31A 3IF1B 5DD0L 4NCC1 4XNMB 1DZBA 1R5VA 2W9EL 1A7RH 4WDIA 3MV7E 1MWAA 4IDJH 1S7VB 3TA3C 4CVZA 1JTOA 3C5ZA 1NBVL 4XPHL 2VNCA 2FO1A 4M93B 3O3BA 3MUGA 1EIBA 1Q8MA 3WUWB 4P46D 4PG9A 1T22B 2BHYA 2FZ3B 4JVPA 4PJ7A 1QEWB 2VYRE 1K5NB 4JVWA 2YZ1A 4L3EE 3ZLQC 4RGND 5DLML 5ICXB 1HH9B 3WFDH 1AE6H 2D7TH 2P5WA 3HNTH 4ZUSB 4DCQA 4WNQA 5CCKL 4MLSA 4PTTA 4ZNEA 4XBPA 2EEDA 2EKSB 4Y4KD 5IVNA 3RFZC 4M6NH 4TQEL 3P0VL 1SM3L 3SDCB 3VGAB 1MLCB 3VXSD 3SY0B 4QYOB 5IVXB 2OK0L 1EAPB 4OZIF 1WJ3A 2I24N 1MRFL 2GK0A 3UC0H 4WV1B 1GAFH 4ODWA 1BF8A 3NVQA 4I18C 1EZVX 2NY6B 1LNUA 1CK0H 4H26A 4K71B 4M6MH 2ZCLL 3ZDXE 5C0JA 3QXDB 4WCYL 4LLVB 3RUGB 4OT1H 5ESVB 3Q48A 4OUOA 1AO7D 2D9CA 1RZ7H 4PJEF 3PWPB 4JZNB 2VKXA 3IS1X 4TULH 4YGAB 2ZOLB 2PO6C 1I1AC 2X4TA 4Q97A 5BQ7A 2WAHA 3BOVA 1CDCA 2DMBA 1BZ7B 4F7TA 1DBBH 4OBSA 4LARL 4X4ZA 3AROA 5J6HA 1WEJH 4R7DB 1JN6B 1JMZA 4L4JA 3T0EB 5ISZA 5GGTL 3LEYH 5IK3A 2GT9A 4Y88A 2EDLA 2X4QB 4ZD3H 2CIKB 2XKNA 2FEDD 1MIMH 4LSTL 3V4UH 4U1MA 2J8UB 3MBXL 2VLJB 2MWCA 3ARBC 3U0WL 1YUHA 2A0LC 5KZCB 1TZHB 3GSUA 3U4BH 1WCBB 2VL4A 3UXFA 4FG6C 1CXEA 3VI4F 5EBLB 4ESKA 5FM5M 1FV1B 1W8NA 5J0BA 5I6XB 1Q9KB 4JQXC 3DXAA 4OGAD 4DN3L 1MREH 3BJLA 2O5YL 5IBUB 4BFIB 3O8XB 3DV4B 2CMRL 2Q76A 2VUYA 4LL9A 5E24E 3MRMA 1PVHA 5T3ZH 4M00A 4LPWA 3GMQA 3CU1A 3BP7B 2WINB 2Q3ZA 5HVHC 3ZE2E 3DO7B 1PKQB 1IILE 1JHTB 4IRSB 3L3KB 1VENA 4IIQA 1FG2A 1NC2A 3PWNB 1J9CT 1CD1A 1GJIA 1CFNA 5HDBF 1SBSH 2RR3A 2VLKB 3PGFH 1YNLH 3QQ3A 5FM4A 2EDYA 5EO1A 4Y5VB 3RWIB 2HJFB 2OMBA 3IRPX 5IBTL 3EO0A 1C16B 4YAQA 5ECJE 4HMDA 5B8CA 1FFOB 5C0AB 3DGCR 2YSSB 3LKSA 4P9HH 2VAAB 1ZHBB 1INDH 4I13B 4HULB 5SWZD 3BW9B 4L5FL 2FATL 5E2WL 3TH4T 3WIFB 5IGXH 1BFSA 3EOAB 3PABB 2P5ED 4PRDB 2NMSA 3QRGL 4M1GL 3CK0L 3KYOA 4PPTA 4LSPH 5EZJA 3TM6A 5C0RH 5C8JB 3QDMA 3P3YA 5GRVK 1YEHH 1ZHKB 4OKVA 3L9RB 1ED3B 4NO0B 1YNKH 4EUPH 4JFEE 1J1PL 4EDXB 1KCRL 3SE3A 3IGAB 4Y2OA 2QQLH 4W6XB 2X4OA 3QUMH 4OI8A 4LBEA 3NBNA 4Z7NE 3PWVB 4KI1A 4M93C 5TFSH 3QWOA 3RVXC 4O4YL 5EC2A 3O4OB 4G8GE 4J12A 2R9HD 5I1LB 5JQ6H 2ATKB 3GSQB 4BZYA 3IKCB 1CU4H 1CLZL 4F7MA 5IM7A 3SE4A 2IQ9H 4RIRA 1V3MA 1AQDB 3MO1B 4NO2A 3V95A 4PJHA 2J1KA 4U1HB 5L88L 3IDGA 4L4TA 2DDQH 1FGNL 1L0YA 4FXKA 3LMJH 1F2XK 2B4CH 2Q6WB 3KLAB 3QZWA 3DPBA 3PXJA 5K59E 2WIIB 4UU9B 2E27L 3U82B 3SDCC 1S7UA 4WIQA 4Y19A 4XZUB 4N8VA 4RAUB 4WRLA 3UPCA 2DTML 3GJFB 1LO3H 1W0WA 4QHMB 2D2OA 4H20H 4LPUA 4WV1C 2NY6C 1I8KB 3KWWB 3SCMD 1PLGH 3Q6FA 5JOFB 2C1PB 4DZBA 1T3FA 1DE4A 2VWEC 4ZO9A 1L0QA 3BE1L 1T80A 5DRZB 3N85L 1NFIA 3FO9B 4FXLA 3B83A 1WZ1H 1V7NL 3PQYD 5HHOB 5DJDA 3RL2A 2NLJA 4GW4A 3KJ6H 5DVNA 4FQQA 2JB6A 4O9HH 1BOGA 1AP2B 5IFAH 4FOMA 4E41D 3T2OA 2UZIL 4F37F 4YXHH 2G5BA 3T0EC 2P42B 1RHHB 4LPXA 3BEWA 4MD4A 1XF1A 3UJJL 5KG9A 4Z7WF 4Y16B 1Q9OB 3FKUS 3SDXA 1CQYA 4JQIH 2Z92B 4N5UA 4N0UA 2A9ML 4PJXA 3GJFK 3GSWA 3OKLB 2VDMH 5L6YH 3VFWB 1D5XB 2DM2A 2RQ8A 4Z7UF 5I6XC 3QCUL 5ITFA 3V4PL 3LKPA 3QH3A 5D6CA 4ODSH 4RX4A 1Q0YL 3GIVB 3QO0A 4NNPH 4N0YH 2OJEA 3RWGA 4OGYL 5KJRL 4UIKL 1I3GL 2FLRT 4HXBH 2BVYA 3ES6B 4QF1B 4NZJA 5F7DB 2D7MA 1XZ0B 3MC0A 2DL2A 1EBAA 4H1LH 3TT1H 1P9MA 1MFBH 4NQEE 4NQXB 5E5UB 4JFQB 1OF2A 2H3NB 3BDXA 2LFGA 4M43H 3BGMB 2VL5A 7CGTA 2XQBL 1XGYL 1S3KH 4ODUB 4IRSC 4ZS7H 1VCAA 4QRRB 5EBWA 5DSCA 2C3XA 1Y18A 1UCBL 4HWEL 4OZHA 3WDIA 1IVLA 4QRUA 1QBLL 3PV7A 3FOMA 4OF5A 4PP2B 4HKXB 1DTUA 4P3DA 4QTIH 5D72H 4Y5VC 2ZP0T 4OFKA 4EEEA 3EW3B 5FM5O 5MEQB 1TETL 4QCIB 1Q9LB 3H9SA 8FABB 4BQ8A 1JFQL 2V2XA 3UTSB 3VXMA 5D2LA 1ZGLB 2DI8A 2HH0H 5IHUH 4GRMA 2IAND 5F72S 2BZDA 1BD2E 3IFNL 2NY3C 2HRPH 2GYSA 1OGTA 3D3VA 3IDIA 1JF1B 2AAVA 5E9DD 3RAJL 4LSVH 5E8OB 4FFZL 1JP5A 4R90H 4PRAA 1X5AA 4KZDH 2EIZB 2YA1A 3GJEA 1F4WL 5ANMA 1GOGA 3VFOA 4ZTPH 4NSKB 4R3SA 4O2CB 1QKZL 3KXFD 2P8MB 3JV6A 5GS2D 4AM0B 3CFCH 1IM9B 3R8QA 4CJ1A 3X13A 3MZGB 3VFTA 5A16A 4NJ9L 3S97C 1CQKA 1IAIH 3M07A 1VHPA 3O4OC 3ARGC 5JXAH 3MRNB 5FOBB 2C5DC 1CLYH 4U2YA 4NQSB 4UV7L 3MV9B 1P4LB 1F4YL 1MCBA 3AM8C 2BNRD 3MYJB 5TDNB 1A4JB 2VE6B 1DQQA 2C1OA 4NM8L 2DQGH 3TCLA 1DDHA 1HHJB 1P4BH 2Z8RA 5EBMA 2HT2D 3FQXB 3PGCA 4X80L 4GRLB 3VXQA 1A3RL 1T2XA 1A0QH 3Q6GH 4GUPA 4PJCF 5IVXE 4PRIE 3OAZH 5FHAL 3BIKB 4ZUTA 3VFMB 1JYVA 3NCBB 3V7AE 3KHQA 1FE8H 2MCG1 1ND0B 4GXUN 4GKSB 4JRYB 1MJ7L 3P40A 4JRXB 1FVCA 1ZA3A 3LS5H 4CMHB 3HC4L 4PREB 4OV5B 3SDYH 4WY7L 5KAQG 5CINL 2VWEE 1A7NH 3DGGA 3FOLB 3PHOB 1PQZA 4LSRH 3VGEA 1IQDB 2OJZL 5AUMB 1I7UA 3LH2H 4GSDH 5I16B 1QACA 1YJDH 3SBWC 3FB8B 3TIEB 1NCCL 5SX4H 1A6AA 4WTXA 4I2XA 4JZJB 2HRLA 1DBAL 3OKYA 4NKOA 4IS6A 3GMNA 4PY7B 5ERWB 3F7YB 5FCUL 4P57A 4M7LT 5CSZB 1RUPH 3BEVA 3B4NA 1RIVL 2CDEB 5MEPA 5ID1B 4HS6A 4WI5A 4ZPVB 5EORL 2R0ZH 2VDPH 2YRPA 4C55A 2VLJE 1W0YT 3KNBB 3QQ9C 1U3ZA 3STLB 4JZOB 5FB8B 4Y16C 1NCAL 1XCQB 3VFUB 3MA9H 4X8XA 4UQ3B 1N64L 3GMPB 3MUY1 5E6IC 3N1QC 1Q0XL 5FO7A 2M26A 4XP4L 4HH9A 3AU1B 3M8OL 4YDVA 5C09A 2MQ3A 2A6JB 4XMLH 1U8MB 3I2CL 5HHMB 4QY8A 3V5DA 4ZTOH 1FL6A 1KB5B 3ZYOA 3KLHC 2HN7B 1KB5L 4HKJB 4KVNL 1ZTXH 4XPGL 1H15B 1PKQE 1XGUA 5T5FH 1FL3B 4M62H 3KPOA 5DQDH 1UGNA 4HQQL 1QLRA 2C3WA 2A38A 1AJ7L 2F5AH 2Y25A 1T89A 3DMMA 1MRCL 1QYGH 3I9GH 1RULH 5FYKU 1X9QA 1NAMA 5T1MB 1T83A 5EU7C 5ETUA 4IEFB 4Z6AT 5IVZA 3TV3H 5A1AA 4OI7A 2VXTL 2YN3A 2I9LA 3RY6A 3KPRD 3WNOA 4OCRH 4NO3B 2AJYL 4J4PA 1MNUL 2X4NB 4J1UA 1AIFB 3O6FA 4UQ2A 5FDWA 3PDGA 2QQKH 4IRZL 1DUZB 1VFBB 5FYJL 3DI3B 3RDTD 5I71B 1FNEA 5HGHA 5TE4L 4YO0A 5IESL 1BBJA 1HXMA 1JL8A 5T3XL 1NFDA 3HRPA 3GMMB 1G7MB 1B2WH 5C92A 4EXPX 5C0CE 5E5RB 4HUWB 1MHHA 1T7WA 4OCXL 1G9MH 4GKOA 5E8DL 3G6JB 3BPNB 1YY8B 4LCWD 4C83B 5KVEL 2AK4D 1I9IH 5EU4A 5GRUL 5EZIL 4L8SB 3ZKSD 1P7KA 1JGDA 1C7TA 2IC2A 4ZUVA 1TJGL 1KN4H 1YN7B 4QGTA 4KMTL 1IM3A 4QRPA 1OAXH 1FORH 3F5WB 4UILH 5F8QC 1X5JA 1ZLSL 1Y0LA 2APBA 5E2VH 5D5MB 4KUZL 2EDOA 4Y1AD 3I6GB 1C08B 5AYQA 4JFPB 2DLGA 2EYSA 4P2OD 2WWMD 3BKYH 3CFDB 1P7QA 2X10A 4ZFOB 1RJZB 4ZFOL 4GRLC 5BS0A 5KBNC 4F57H 2OLDA 3GNMH 3G6AA 2ZNWA 4I0PB 1T2QL 3V8CA 3QWRA 4MB4A 1UM5L 3FRPG 5INDB 5F71A 1I7TA 4OD3L 2D31B 2XPGA 1R5VB 4WDIB 1MWAB 4R4NC 5AYUL 4CMHC 1RPQA 1MWAL 3FQTA 2FX9H 3KPNA 4CVZB 4O5LH 3C5ZB 4DAGH 1EERB 4LK4A 3MLXH 3MV8E 3O3BB 3MUGB 1KCSH 2Y06L 1ZXQA 1S8DA 1ADQL 5L8JB 4PJ5D 3TA3D 4PG9B 4NHCH 5C0NC 1F90H 4LRNH 4PJ7B 1F3DJ 5HHOE 1P4IH 2EC9T 2FH8A 4JZJC 4DN4L 5TF1L 1PX3A 3C5JA 4NFDA 2YN5A 1XF5A 4MNHA 4OCNC 1QNZH 2P5WB 3C08H 4DCQB 5KOMC 3P9MA 4WNQB 4PTTB 5I1GH 4XBPB 3C6LD 2XV6B 2GTWA 5MHSE 1CXLA 4J3UA 4M7ZB 2ZCHL 2JCCE 3DV6A 4JG1L 4B5EA 2GK0B 4NRYA 1A6VH 5C0DA 1NLDH 4ODWB 1G84A 4ETYA 2XZCL 5E2UL 2G60L 1LNUB 4XC3L 2DYPD 5C0JB 5I75B 1F4HA 1JNLL 4JKMA 2VN7A 4HPYL 3B43A 5C6WH 4XBEH 2R56H 3ZE2F 3ZTJG 3ARZA 5FYLE 4HK0A 1FRGL 4JHAL 3TZVA 1DFBH 5E8EA 4Q2ZA 4JKPL 4X98A 2X4TB 5A2KH 1VACA 5BQ7B 5IJKA 3VXUE 5FHBL 3RPKA 4EDWH 4F7TB 2R1XA