4Z7UA

S13 complex
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
182
structure length
182
Chain Sequence
DIVADHVASYGVNLYQSYGPSGQYSHEFDGDEEFYVDLERKETVWQLPLFRRFRRFDPQFALTNIAVLKHNLNIVIKRSNSTAATNEVPEVTVFSKSPVTLGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFLPSADEIYDCKVEHWGLDEPLLKHWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC class II HLA-DQ-alpha chain
publication title Determinants of Gliadin-Specific T Cell Selection in Celiac Disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 40
structure length 182
sequence length 182
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4z7uA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4z7uA01
1HI6A 4NO2A 4DVRL 3LS4L 4G8GE 1AC0A 2BVQA 4YBLC 5HDBE 4HS3B 1A9BA 4PJDE 3OB8A 1A4KB 3H42L 4ERSL 1I9IL 3GSNA 4PLNC 1AXTH 1YEJL 3B9DA 1ZS8A 1CVRA 2JJUA 3CZFA 4K9EH 4WTZA 2J88L 2VZTA 2W59A 4HEPG 1DBAL 4ZO6A 5FKAB 5DJYB 3BE1L 1IM3A 5IB2B 3MRBB 1DE4B 4FQJH 3VD9A 3RHWK 4TTDD 3NAAH 2HFGL 5HHPA 3STZA 3TZVB 1NSNL 2DM2A 2ZZUT 3ARPA 1FSKC 2DQIL 2P8MA 4WJ5B 4D2NA 4KKAC 3L3IB 3UBXA 5T33L 2FDBP 1A9EA 3WFHA 2YA1A 3MRMB 1KF9B 1G0DA 4JN2A 5BRZD 4NQEB 4JB9L 1U95B 3MYJB 1GGYA 2A6KB 1NDMB 4XPTL 1S7UB 5DMYA 3RPIA 4X7SH 3FTGA 3ZT7A 3G6JE 3MR9B 4UOW1 1SJHB 4XX1E 3BJ91 3LKNA 4OQTA 3ZDYF 4M6ML 1S7RB 3PG2A 4QHUB 5T5NG 1TCRB 2PYFB 1MCDA 2Y5TA 3EDDA 4DGIH 1FRGH 5DQJB 3SGDI 5IBUG 3VH8G 3STLB 1TETH 5I8KL 5I71B 2CLRB 2YUVA 1OAQH 3QIWB 1KCSH 5J3HD 2D4DA 1E4KC 2V5MA 8CGTA 3HAEB 4Z7WE 5INDB 1IT9H 1D5BB 2VNCA 4JFDD 5JOPE 3G5ZA 3NGBB 2NQCA 3L7EB 5DUMH 1WWWX 1NL0L 2P48B 2X4PA 1EJOH 2WW8A 4X6FA 1QA9A 3PGCA 5KANI 5EA0H 2QQLH 3SY0A 4JDZA 3TA3C 2DQHH 4L4VB 4NFDA 5SWQA 3CVHL 3MV8E 1OW0C 4L9LB 1E4WL 1KJ2L 3H9HB 1J11A 5D1QB 4Z78A 4E9LA 5F7WC 5EU4A 3VXNA 2H1PH 2V2TB 5F89A 1FYTE 3MZGB 5HYJB 1XR9A 5DUPL 5A2IH 5KVFL 3QBTB 2JB5H 2QLVB 4PP1C 1CDIA 3O2DA 4LVOC 3ARGB 4NKMA 3VDBA 5KAQF 5IFJB 1GZQA 2IANE 2J6EL 1HDMA 2FHCA 5H35A 2X1WL 1MCQA 3SGJA 1VPOL 1JBJA 2ED7A 3SCMC 1ROWA 1HINL 5IWLC 1SY6H 1TZHB 4PJFE 1MY7A 1EFXA 4RRPA 1AGFA 3GHBH 2YD8A 4LSVH 1P4BH 3S37H 1Q9LB 4AEFA 4WWKA 2MKLC 3B3IA 2DMBA 4J3XA 5DMGC 3BRDA 4KKNA 1ACYH 4JO1L 4XAWH 5JDSB 1UCBH 2RFXA 2GK0B 5GGSA 4P2RB 5CZVL 3IKCA 1F02I 4LNRA 1F58L 5DMJB 4GAFB 4PJDA 5JXAL 2BZDA 5A43C 4B5EA 5CSBA 5CILH 1FCCA 3RWJA 1I8LA 3SKNA 2XKNB 4QOKD 3NCBB 1GC1H 3K8LA 3UTZB 2OL3A 2OXHA 2OLDA 5HI5D 3NIGF 1KTDB 2BERA 5F1SA 3S88H 3QUKB 2HVJB 5KN5A 3H0TB 1GGIH 3V52H 5EC2A 2R0ZH 4PJAE 2X42A 5ICYB 1MLCB 1JWSA 1X5ZA 4YR6A 4PJEB 1JHKL 1QYGL 2AXHA 1JP5A 3GSWB 1MHEB 3L3JA 2VZUA 3ARXA 4OCXL 3PWNB 1QLEL 4MSWB 4S0TD 4YDKH 4R96B 2YEZA 3QFJA 5LBSH 3QB7C 4I4WB 4FFWC 3QZWA 4WHTA 1DQML 1MIMH 1A6VL 1XMWA 5KG9B 3UYRH 3L3HB 4HWBL 4L8SA 4DKEH 4EUPH 3RZWA 5DJZB 2R23B 5ISZE 3FOLA 1MCPL 2BOCB 4V2CB 5C0FB 4O00A 1MWAL 3EDKA 1I7RB 5F9JA 2BJML 3VD4A 4JPWL 1DUYB 1NDGA 1NUFA 4Z8FL 4L3ED 3VFPA 4E5XA 1MRCH 4KMTL 5BO1H 2VZOA 5F1OB 1DBBH 4IIQA 1I7TA 2KH2B 1OT1A 4OM1L 4X4MA 1MFBL 4JY6A 4JREC 1ZA6A 5EUOA 5HGDA 2YRZA 1NEZA 1MFAL 3LPFA 4JQIH 1BLNA 1JGLH 4OZ4A 4MD0A 5GSVA 3MV9A 12E8H 5DRNA 5EU6E 1YDPB 1FZKA 5FECB 4KZDL 3MMEB 3ARBC 5TDPA 3P0YH 4PB9H 5IVZB 1NAMH 3L6FB 5FKPB 2F5AH 4LCIL 4AQOA 1R3JB 4NOBA 4C56E 1K2DA 4LOUD 4BK4A 3MRKA 4HZAA 4KK5D 3DUUA 5E03A 3MCLH 3U7YL 1BREA 2RQ8A 4YDVA 2CUIA 4M00A 1B6UA 1FYTA 4JO4L 2P44B 4X8JA 4QHLA 4HS6A 4P5TD 4L4JA 4F7PA 2DQJL 3OKEA 3GBML 4CVUA 3JV6B 5EU7E 1M7DA 2ED9A 3TCLA 2Y7QA 5GGRA 2IANA 4LVNC 3V5HA 1VA9A 1IZJA 2ZP0T 4F9LC 3QWOB 3DX9B 1MHPH 3RX7A 3GMRA 1NUGA 1X3DA 4MCZA 5BXFA 2AKRB 4TRPH 4Y5XC 2UWEB 3LIZH 3GMPB 1VFBB 4ODSL 4GMSH 1JTOA 5ESAA 5HXMA 3E3QE 1MY5A 1NBQA 3HB3C 3P2TA 3PE9A 4PY7A 3BMWA 4X99A 3VGDA 5D5MF 2V5YA 4I13B 5T1LA 2BVTA 1FFPB 4FXGA 4OLVL 4YAQB 5FYJU 3W9DA 1VENA 3WHE1 3PWVA 1DJSA 5CSGA 4XC3H 4FQCH 3QO1B 4MA7L 5I1HL 1TJHH 3PHQA 4U1SB 2CMRH 4XC1L 1T7XA 3O4LA 5I16A 5GXBB 3EOAA 3KPNA 2HT3D 5AG9A 2DI7A 4G42B 3TO2A 4ZTOL 3FT3A 2W60B 5CJQL 3TN0B 2W91A 1MH5B 1J0KA 1RZ7H 4KGLA 3TIDA 4JR9H 1IGYB 4S2SA 1I9JL 3KJ4C 5ALBL 3VXRB 3C8DA 4TSBH 1U2CA 4J6RL 1NGWB 4FMFA 4G5ZL 1JYXA 4H0IA 4XH2A 5IVXE 5C09A 2IBZX 2PCPA 3TWCL 5IW3A 4YHZH 4JZOA 3GSVB 1H8OA 1QLRA 3PHSA 4F58L 1ZANL 5DC9B 4NJAH 5HHOB 3O6FA 3ZL4L 1I1FB 1YPZE 3SE4A 4MJ6A 3HE6D 3BP7A 4H1LB 4ZUWB 2WZPD 5C7XH 2VN4A 3TPKA 5C0DA 1OB1B 1SYVB 3X17A 2X4NB 4OLWH 4Y0GA 3O2VL 2DBLH 3C6LB 1CBVH 1OTUD 4QYOA 5L2KE 5FGBC 1NGYA 1JPGB 3S3JA 3SO3C 3K3QA 3IDJA 2DS4A 1ZA3A 5HVWA 1MIEH 4ZDHA 3B2VH 4ZUSA 3NH7H 1BJ1J 4M6OH 1R5VB 4DVRH 1T5WB 5EU6A 1YMMD 3LS4H 1HH9B 1L9MA 3GMLB 3H42H 4MNHB 1H3PL 1I1YB 4ERSH 1I9IH 5JUEL 1YEJH 4RMVA 1RJZB 2NY2C 2J88H 1T0MB 4C56A 1MI5D 1DBAH 3U82B 4ALAL 4L8CA 1ZXQA 3GRWA 1U8PB 4XVUC 3BE1H 1KXQE 2GAZB 4JM2C 2OSLB 5H37G 4H8WC 4Y1AB 3VDAA 5J1SC 5IP4A 3VGGA 2HFGH 3TH2T 4P46B 1EVTC 1NSNH 4PLOB 2DQIH 2XZCL 4XBEL 1EK3A 4OFYA 1ZHNB 1UXSB 4GRLA 4OZGB 3GSOA 5B3NA 1CFQA 5T33H 4LLWB 1S3KL 1U42A 3X3FL 4JB9H 3CXHK 4JRXA 4OV6F 3IDNB 1F90L 4MXQD 3W0WD 4XPTH 2EKJA 4XMKL 3BW9B 5KSVB 3X13B 4Z7UA 2Q3ZA 4ZYKB 3JVGC 4YHML 4M6MH 5C3LD 5IF0A 1BP3B 3V5DB 3IU3B 3BWAA 1W0VB 3G5VB 3MCKB 5IBUB 2FJFB 3VH8B 5EZIL 5JW4M 4MQXD 5DO2C 1F2QA 2F74B 5D1XA 3UZQA 5I8KH 2UY7A 2XTJD 4XXDA 4HUVB 4LMQE 1FZMB 4MLIA 4PRIB 2OR7A 1J8KA 3TFKD 3P4MB 1QSFE 3NCMA 2EDNA 4Y4HC 4Y7MA 1CICB 5ALCL 4HT1L 1J8HB 1Q0YL 2ZG2A 2XN9D 2OJEB 1GJIA 3L1OL 1NL0H 4BFEA 2HKFL 1URLA 4Q2ZB 4L4VE 3NTCL 1EAPB 1IEBB 2ATPB 1U0QA 1PG7W 3CVHH 3G9VA 2HFEA 1DVFD 1E4WH 1KJ2H 3DGGA 4JFEB 4U6XB 4KVNL 4HC1L 5EIIA 2EC8A 2FCBA 2R2EA 4YDIL 1RZIA 1K85A 3C60B 3U0TB 3IFNL 4XAKE 5J3HC 4CADB 5AUMB 5KZCB 2XY1A 4MMZC 5EZJB 5DUPH 5KVFH 1JGEB 1YPZA 4HKXA 5DVMA 3TVMA 4P23A 2IAMC 4MDIB 2VRAA 3BN9C 2F8OA 3O8XD 2BK8A 3VFSA 5DK0B 3UZVB 2NR6D 2J6EH 4K55A 3WL9A 1VFOA 1VPOH 5DWUL 1OSPL 1HINH 3DTXA 4LBEA 2W38A 5L2KA 1LO2L 1TENA 2DKUA 4PRDB 1I1AC 1F97A 3CDFA 2MWCA 1I3RA 3OJVC 4P2RE 4ZTPL 1KLFA 2ID5A 3MBEC 2BHYA 3D5OF 4HLZG 5E2VL 1MCCA 4JO1H 3RTQB 4D94A 1WISA 4ZD3L 5KANG 4HS3A 5CZVH 3O9WB 4G7YL 5C6WH 1S5IL 1F58H 5JXAH 5SWZB 2XWJB 3QEGL 4FQLL 4CVWA 4HULB 3INUL 1BZ7B 5FKAA 5DJYA 2K7PA 5L0QC 4JQXC 1DBKL 2QADB 2JJSA 1OM3L 1DLHB 1DE4A 4FS0A 4XCCL 3EOYG 4R90L 5CEYB 3TZVA 2J5LB 4DN3L 1V5JA 1NH6A 4GG6E 4WJ5A 1ZLUH 3T0AA 3KWWB 4GAJL 1LP9E 5FGRA 3L3IA 5F9AC 3MJ7B 5TDOB 3MRMA 1JHKH 1QYGH 3OJDB 1FNGB 1N59A 4NQEA 1Y6NR 4L4TB 1U95A 3MYJA 3T0EB 4OCXH 1QFUL 1QLEH 3NIDF 1NDMA 1S7UA 2H2PC 2EEDA 2AP2A 5KSAB 3MR9A 5DGQA 4L8BB 1GL4B 1QRND 1SJHA 3EYSL 1DQMH 1S7RA 2OM5A 4QHUA 1DQJA 1TCRA 1A6VH 3ARDD 3EFFB 2FX7L 4HWBH 1RIVL 1ONQB 1ZLUK 5DQJA 4G7VL 3HTLX 2QQNL 3IF1B 3STLA 3DNKA 1KLGB 5HI5C 1MCPH 3Q5OA 1N3NB 4DKFL 1MWAH 2CLRA 1P6AB 3N1MC 3KYNB 2BJMH 3QIWA 4JPWH 1J1PL 4NC1C 3MUGB 2DICA 1WT5C 4Z8FH 2GJ6B 4KMTH 3HAEA 3MRGB 4YDJB 3VG9B 1N6VA 5INDA 1D5BA 4OM1H 1MFBH 3RVXC 4HQQL 4ZUTB 1GVIA 3QUYD 2G60L 3L7EA 2FD6L 3IDMA 1EHAA 3ARFD 1MFAH 3TO4B 1F3JB 3I3EA 1UQSB 4TQEL 1G9NC 1I3VA 2BNUB 1IEHA 1CYGA 4L4VA 1FNHA 1ZLVH 3PDOB 4HKJA 4KZDH 4L9LA 2VUYA 1YQ2A 5D1QA 3K4AA 4HKZB 4N90E 4LCIH 3CFJB 5ANMB 3T4YB 4MAYB 3SPVB 4EKXA 2V2TA 4K8RL 3DYOA 3JBG7 5A16B 1JL8A 5HYJA 3U7YH 4OSUL 1KB5L 2F53D 4G8IB 4JO4H 4BK5A 1R0AL 2AK4B 1WIUA 3ARGA 2DQJH 4RGMB 5IFJA 3GBMH 2H45A 1RZKC 5CJBA 4PJ5E 3HMXA 3WNNA 1MUJB 4UOJA 4I3GA 1JE6A 3DV4B 4U6VL 4MDJB 4NN6C 1NGPL 5C08D 2DMKA 3FN3A 4LVHC 4WFEE 1UZ6E 4HK3J 3MGTB 1Q9LA 3EBAA 3NMEA 3I50L 5IEHB 2CH8A 4ODSH 4HXAL 3TLRA 4KRPC 2IFGA 4P2RA 4LOUC 1A0QL 4YGVB 4KK5C 1JMXA 3GFUA 1FNSL 5DVOA 3T08A 4F3FB 4RX4A 3KYKL 2YMXL 4U1NB 4OLVH 4MXWL 3DYMA 5HYFA 1PQZA 2X9XA 2XKNA 4MA7H 3G9AB 3UTZA 5I1HH 1G9EA 1X5IA 2GJJA 4GRMB 4F15C 4XC1H 1KTDA 5GRVK 3QUKA 2HVJA 3MJ9A 3H0TA 3PV7A 3LKQB 3EDJA 1RV6X 2P5ED 5ICYA 1MLCA 4ZTOH 4PJEA 5CJQH 3GSWA 1MHEA 3PQYB 3VXRE 1PVHA 4BQ6A 1I9JH 4U3CA 3PWNA 4MSWA 3O3AB 3QUZB 5ALBH 3QH3B 4DUXA 4HGWB 3HE7C 4R96A 5TDNB 4H0GA 1CDJA 3VXQB 4RQQB 4J6RH 2WLZA 4I4WA 4G5ZH 1UKTA 2XRAL 1LO0L 5KG9A 4TPRL 3L3HA 5I17B 2MHAB 5HHOE 3TWCH 4LLDA 3QCVL 5DC0A 5DJZA 1VADA 1F4WL 2R23A 3IDYB 4F58H 1ZANH 4IOFD 3WE6B 1BIIB 3PDGA 2BOCA 3ZL4H 5C0FA 3T2NL 1I7RA 2IMMA 4PG9B 1DUYA 1UACL 2HT3C 2D9QB 3KAAA 4R2GB 5IUSA 3AS0A 3UROR 2E9WA 4ZXBB 2ZSWB 3WEXB 3O2VH 3IT8D 2CKBL 2QSQA 1SEBB 5AWNL 4HIIB 2EE3A 5I74C 4C59B 5FOJA 3K4ZA 3D18B 1P9MA 4PRNB 4P4RB 4MGXA 1WWBX 1YDPA 5FECA 3MMEA 1HHIB 1BD2D 2XKUA 3G6JF 3H3PL 5IVZA 1WBZB 5FKPA 3QNXB 1R3JA 2VDPL 4YHLL 3Q5TA 5EZLB 1H3PH 1JPTL 5JUEH 2XG5A 1R5IB 5E8NB 4NN7B 2DYPD 2EE6A 4Y4FB 4KKLC 3QIBB 4NWUL 5EG6C 4ALAH 4BSVB 4Y1AE 4N1CA 4LASL 3VCLB 5B8CC 5CHNA 3QP3A 1MCKA 2D7QA 1OTUC 4Y19D 5F7YC 1AGEA 5E4IA 4Z7OE 4KROD 3JV6A 4LP4A 4OZGE 3WHE0 4Z7WF 1KTRL 3D3VB 4WW2B 1Q9WB 2XZCH 4FQ1L 4XBEH 4Z7QE 5FM5O 3DX9A 4IM8A 5JW3L 2EZ0C 1P6FA 1IILE 1S3KH 3ULUL 4LSSL 3X3FH 5JW4N 2AKRA 4YFLI 3EYQD 2UWEA 3TBYB 3GMPA 1VFBA 3QEQB 5DS8B 1F90H 5HVHC 4XMKH 5A3ID 5LXGL 1NC2D 3HI1B 3ISWA 2XZAL 3K8KA 3UMTA 4YHMH 1K5NB 3AMKA 5ENWB 4X9BA 4YAQA 4E41B 3VFMB 2F15A 5EZIH 1EO7A 2VN7A 3KS0J 3PWPE 2B0SL 2VAJA 4IDLA 4K9EC 4U1SA 2DTSA 2CRMA 3U30C 3CFEB 4S1DD 1AC6A 3MJGX 4ZS6D 2UVFA 4G42A 5ALCH 2W60A 4HT1H 5CP7B 1Q0YH 3TN0A 1D5MB 2J8UB 4N8PA 3KGRA 1MH5A 3L1OH 2Y72A 1QFPA 3GJFB 1IGYA 1L9NA 2YXMA 2HKFH 3NTCH 2J8HA 4K71B 3VXRA 1RMFL 1X5XA 2OR9L 1NGWA 1GXEA 2X89A 3BZ4B 3ULUE 4KVNH 1EO5A 4HC1H 4KJPD 1HHGB 3P77B 4YDIH 5HGHB 2YPVL 3GSVA 4Q97A 4OD1L 4UV4L 3IFNH 5HHOA 1L6XA 1I1FA 4XCYA 3TFKC 4H1LA 4ZUWA 4CRPA 2VLRB 1DQDL 2DLHA 3BKJL 5CLWA 4XPHL 2QSTA 3TYGL 1OB1A 1SYVA 4XB7A 4DTGL 5TQ2L 3P40A 3TBWB 3U1SL 3UTPD 1CLZL 3C6LA 1OWWA 1QSZA 4Z5RA 1W2KT 4PJAF 4JDVB 5DWUH 5ESVA 1OSPH 4X9HA 1JPGA 2DM7A 1WK0A 4AL8L 3M1BA 2XIDA 3L3OB 3QDGA 3B9AA 1LO2H 4RGNE 3FFCB 1DVFC 2J4WL 2DLEA 2AXJA 5GS0D 5D2LE 4ZTPH 4N0YL 1INDL 2B4CL 5E2VH 3CLEL 1T5WA 1DFBL 5D70L 4ZODA 4ZD3H 1HH9A 1U8QB 4PJ9C 4QF1B 4G7YH 1I1YA 3R06B 1S5IH 4J4PA 4RMQA 5KOVC 5I73B 1RJZA 5FYKE 2RJMA 1G7IB 1T0MA 3QEGH 4FQLH 1Q8MA 4JGUA 1CD1B 4MB4A 3INUH 3MLUL 1JRHL 1U8PA 2NR6C 4NWTL 1DBKH 2CPCA 4JFYB 2GAZA 2OSLA 1OM3H 4XCCH 3ULVD 3LHPL 4R90H 4Q74A 4UT6L 4P46A 4DN3H 3TT1L 3CX5J 4Y5VC 4GAJH 4OZGA 1ZHNA 1UXSA 2XQYK 5A2KH 4L4TE 2VMFA 1JZ8A 3T0EE 1UGNA 4LLWA 5BMFL 4FA8A 3QO0B 3IDNA 1QFUH 3VI3E 5DHVB 4JRWA 1A3RL 1X6LA 3BW9A 5KSVA 2P43B 2KPNA 3X13A 2EH8L 4NCC2 4ZYKA 4HMCA 1XT5A 3EYSH 2WWMC 3HHRB 3V5DA 5FYJD 4EZMA 2FX7H 5C70A 1W0VA 3G5VA 1RIVH 3MCKA 4YBLB 2FJFA 4G7VH 3VH8A 5K9KB 2QQNH 3LRHA 2F74A 5ID1B 3VWJD 4WI5A 4DKFH 2VOTA 4LLYA 1S5HB 1FZMA 1J1PH 5CKGA 5KSUB 2VXUL 4PRIA 2ICWB 4WI2A 5I0ZA 3P4MA 3GSQB 1V7ML 1CICA 1HWGB 4HQQH 1J8HA 1EO8L 2A2QT 4R4ND 5IB5B 2G60H 1J1XL 4LPVA 2FD6H 2OJEA 1H3VA 1DTUA 4Q2ZA 2NY1D 4EI5C 2BY0A 5JORB 1EAPA 4TQEH 1NCDL 4M61B 2ATPA 3EO9H 1CXEA 1TTGA 5JA9A 4GSDL 2FO4B 4MZ2A 4U6XA 4JFEA 2DJUA 5ANME 2UYLB 2X40A 4WW1B 7FABL 1XF4B 3WDHA 1RZ8B 3VFUB 2YWZA 4O2FB 5GRZA 3U0TA 4Y88A 5E2WL 2OYPA 5IKCB 4X9FA 1U8IB 4CADA 5AUMA 4K8RH 2VH5L 1CGXA 3SN6N 2AK4E 1B0GB 1JGEA 1QTYT 4OSUH 1KB5H 2BSSB 4P9ML 2FZ3A 1AFVL 1R0AH 4GKNB 4MDIA 1KCKA 4R7NA 2A73B 5DK0A 4N0CD 1W72L 3KPRD 3ARFC 4HAGA 1YYLL 4OZHB 4U6VH 4XHJD 5JOEA 4PLJC 1NGPH 3QXTA 4CU6A 4LFHD 4PRDA 3S5LG 2XOTA 3I50H 4C57C 3HLAB 4UBDD 4HXAH 1H5BB 3O11B 3RTQA 3BPOC 1HXYB 1WZKA 1H3WM 1A0QH 5D7SL 5A2JH 2G5BB 2GQHA 4ESKA 1FNSH 1KCLA 4LRIA 4X6BA 4YO0A 5SWZA 2XWJA 3KYKH 2YMXH 5BVJB 1NCWL 3QDJB 1KT2B 2YKLL 4MXWH 3VFVB 3O4OB 5GJSL 4YHPB 4JAMB 1T1YB 1DLHA 4NKQB 3SE3A 5CEYA 5EORL 1GOGA 4R0LC 3RVWC 4U1IB 2G9HB 3KWWA 4LVOB 4JJ5B 2P46B 2HH0L 3MJ7A 4D0CB 4KDTA 2NXYC 1C1EL 2V2WB 3OJDA 1FNGA 1BMGA 4OFDA 1ERNA 3SCMB 2D03L 4L4TA 3ZHKA 3T0EA 1G0XA 5DK2B 3WIHA 1D9KD 1CQYA 5DFTA 5KSAA 3QIUD 3VW3L 1T0PB 2EYRB 4L8BA 1ZGLB 2VR9A 3H7LA 3RVUD 5AAWA 1MCEA 5TE6L 2XRAH 4GMTL 1LO0H 3EFFA 4TPRH 3L5XL 1CN4A 2IPKB 3QCVH 3F6LA 5IW1B 3IF1A 2PYEB 1F4WH 3LN5B 4HH9B 1XF2B 1P7HL 1N3NA 1J0YA 3T2NH 5A40E 2NX5D 5BS0B 2BFVL 3KYNA 4OZIE 1UACH 3MUGA 1QSVA 2QV2A 5IR1B 9CGTA 2GJ6A 3MRGA 5FO7B 2BCKB 5KAQG 5I8EB 5CIPB 2DB8A 4R26L 4ZUTA 4YEEA 2CKBH 4U3XA 5AWNH 2CO7B 3VU2A 2H41A 3TO4A 1F3JA 4I2XE 3FB6B 1IAIM 3O3UN 2YUZA 1UQSA 2BNUA 2DL9A 5DD3L 2HMID 4M48L 4ODUA 1BWWA 3NIFE 3PDOA 5DI8B 1CD9B 3H9SE 1FAKT 3LD8B 1LO4L 4OKVB 1NMCC 2FX8L 3H3PH 3IS1X 4HKZA 3LV3B 4BZ2L 2AEQL 5GGSY 3K1KC 4GT7A 1A22B 2VDPH 3CFJA 4YHLH 4RSVA 3T4YA 4MAYA 1JPTH 3SPVA 4TVPL 3FQUB 4CUCA 5A16A 1V05A 4ZNEE 4NWUH 3CMOL 3UDWA 1R3IL 3KJ6L 4LASH 5ICXB 4G8IA 2V2XB 3CDGB 4YE4L 2AK4A 4P2QB 3UBXI 3D3VE 1HCVA 2WINB 4QRRD 3NZHL 2NZ9D 1OARL 4GW5B 1XEDA 2L7JA 3DV4A 3VJ6B 4FQ1H 4MDJA 3RY5A 1QSFD 5J9PB 5KVMC 3K7UA 3VRLE 1BIHA 1RY7B 4IJ3B 5JW3H 3DARA 2A83B 4W6XB 2G75B 3ULUH 2X10A 4LSSH 3C9NB 3MGTA 5D1ZD 3T0XA 1GOHA 5AD0B 5IEHA 2EDKA 3MPCA 4D9LL 3E1F1 4XNYL 5LXGH 3LDBC 1EDQA 5DMKB 4YGVA 2XZAH 1S8DA 3ARBB 4XXCA 5KOMC 1S9XB 4F3FA 1XGUB 1KLUB 1AHWC 1HILB 4U1NA 4QRPE 2ICCA 4WUUB 5T3XL 4EVNB 3GB7B 2AGJL 4LU5L 1CD0A 2C7UB 1NLBL 3WS6A 1B0RB 3V7AE 5DUBB 2IFFL 3BZFB 1CR9L 4G9FB 1G6RB 4XAKD 4BQ9A 3K2UL 2B0SH 4IMKA 2L4OA 4GRMA 2DAVA 3UTSD 2VLJB 4S10A 1ZT1B 3LKQA 2J8UE 5I6XB 3Q1SL 3DRTB 3IFPB 4BQBA 2D7OA 3JUZA 3DVFA 4LVNB 3FN9A 3PQYA 4D9QD 5IV2B 1H0DA 2H2SD 3U0PB 4PRPE 3QUZA 5E94B 3QH3A 1BECA 4HGWA 5CD5C 1RMFH 5FM4A 5TDNA 1U3JA 3RL2B 3HNSL 2OR9H 4Y5XB 1IM9B 2FL5B 5F93C 1AD0B 4RQQA 3VXQA 4ISVB 5B38G 4YX2L 1JVKA 3IDGB 5I17A 4ZFFB 3O3DB 2MHAA 4ZUUB 2YPVH 1AI1L 3SDDC 4OD1H 3S34L 3SGEH 4UV4H 3WE6A 1BIIA 2VLRE 4IRSD 2VR4A 1REIA 4Y4KA 2CGRL 4PG9A 3AREC 3V0AC 4IRJD 4OF5A 1DQDH 3BKJH 3QDMD 4XPHH 3TYGH 5DA0B 3NFNB 4DTGH 2X2YA 5TQ2H 4TNVK 4HUUB 3WEXA 2ZSWA 4ZXBA 3U1SH 1CLZH 1MHHB 2IALB 4XBGB 4GG6F 1SEBA 3QI9D 4HIIA 2EDYA 1LP9F 3VWKB 3B8SA 4UNTA 4AL8H 5F3HB 4PRNA 4P4RA 2J4WH 1YNLL 5EOTB 4KJPC 3O81A 4Z7VE 4JVWA 5DLML 1IGJB 4N0YH 1HHIA 4Y2DB 1INDH 2APTA 2B4CH 3CLEH 1DFBH 5D70H 1RHFA 1WBZA 3QNXA 2CRIA 1NMBL 5EZLA 2X70B 1R5IA 5E8NA 1TQBC 5J0BA 4Y4FA 3WFZA 3QIBA 1FNLA 3QG7L 4BSVA 3MLUH 4Y8DC 4PJXB 1JRHH 3QPXL 1SEQL 1JZ2A 2VQUA 4NWTH 1FLTX 1HYSD 3LHPH 1E4XL 3WJLA 4UT6H 3TT1H 4WW2A 3DRQB 1Q9WA 3BI9X 3QRGL 4KK8D 2J7LA 3T77A 5DRWB 1UM4L 5GZOC 1CLOL 5BMFH 3TBYA 3OTTA 2MCG1 2DI9A 3QEQA 5DS8A 3RWCB 5HBBA 3SO3B 2VDRL 4KQ4L 2IPUG 1QSEB 5JW4R 5F6HJ 1A3RH 3BEVB 3HI1A 5FDWB 2ADGB 2EH8H 1HSAB 3QUMB 4Y5YC 4IOIB 3LQZB 1K5NA 2BVYA 1IE5A 5ENWA 5B22A 2EXWC 4E41A 3QEHB 2DMCA 3VFMA 2DLGA 3VD3A 5K9QI 3HC3L 1EUTA 1BWMA 3REWA 2NY2B 4Z7NE 4HJGB 2VXUH 3CFEA 2DIBA 2Q87A 2FATL 3DO3A 3MV01 2EE2A 1V7MH 2XI9A 2Z31D 5CP7A 2R2BB 1EO8H 35C8L 2ERJC 4UUJB 1D5MA 2J8UA 2ZWLT 1J1XH 3GJFA 1J9CT 3GSUB 2VLKD 4MA3B 1UZ6F 2CJUL 2H8PB 3DPBA 1NCDH 2V7NB 2XV6B 3BZ4A 4GSDH 2R0KL 3THML 3VXUB 1HHGA 3P77A 7FABH 1H3UA 2EDJA 5HGHA 4Z77B 2X05A 3PHOB 4QGYA 3BPLB 4ZAKD 4LRNL 2LE9A 5FAAA 1AE6L 5E2WH 1KG0B 2RGSA 2C4FT 1S7XB 5ERWB 3KPLB 2VH5H 1QLFB 3F62A 1WVZA 2VLRA 5C1MB 4P9MH 1AFVH 1MFCL 5BV7B 4GRLC 3T2OA 1W72H 4OZHE 1MOEA 1KIQB 3TBWA 5HDLA 4L3AA 1RAMA 1YYLH 4HK3N 3ZKMD 4KJWC 4QHNB 2HP4A 2HT2C 4K8RD 4JDVA 1OVZA 4Y4HB 3L3OA 3AS2A 5BRZB 4WI8A 3WIFB 3IJHB 3FFCA 4W6YB 3LSOB 3S5LB 2I07B 4HPYL 1SBBA 4FTVE 4AK1A 3B8YA 3E3QC 2A6DB 2ILLA 5J6HB 4D9RD 1C16B 1RU9L 1U8QA 1LNUB 5D7SH 5KW9L 3NA9L 4QF1A 3R06A 4XVJL 3B9KD 5E08L 1BFOB 1G7IA 3BDXA 2ARWA 4PS4L 1NANH 1NCWH 2GTZB 4RGOL 2JJTC 4FQIL 4G6ML 1CD1A 2YKLH 3C8KA 2CLZA 1OPGL 5GJSH 2AERT 2GY5A 2W1NA 3LY6A 4GBXA 5EORH 3S4SG 4JFDB 5FV2A 5LCVL 4LHUD 4CVZB 3REVB 2W9LA 4ZFOB 1PSKL 2HH0H 1AXSB 2NY6D 2R56L 4HWZB 5E1AB 1DBJL 5C6PB 4U2ZA 1C1EH 3L3DB 1KPUB 4R7DB 3LKOA 3QO0A 2D03H 1IAIL 2PETA 1V3JA 5DHVA 3MJ6A 3KNBA 1J0ZA 3MUZ1 1I1AB 3VW3H 1WGOA 3SKOB 3CCHB 4LCCC 3D69B 5K59F 3BD3A 5IQ7L 1B4RA 3MBEB 2LTQC 2PYEE 2Z8VC 4GMTH 4OZFH 4MD5B 5TE6H 3L5XH 4YHIB 3L3GB 3FRUB 3HR5B 5K9KA 1BJ1H 5HI4D 5BS0E 5KVDL 1BM3L 5ID1A 2BVOB 5IT2L 4NQCD 2XWBB 4WFGD 2BFVH 4GXUM 3BYTA 1S5HA 5KSUA 2ICWA 3D48R 5D71L 5JHDD 5L0QB 4ORGB 3CDYA 3AMLA 3GSQA 1N5AB 4Z7OF 5FGCB 3NVQA 5DVKA 1H3GA 1GOFA 5SV3A 4AIZB 3DSNA 4R26H 4JO3L 5IB5A 1EEQA 3V7MA 4Z7QF 1D9KC 3DBXB 5D7JD 3SBWC 1U36A 5DD3H 4M61A 3WXVL 4M48H 5BCAA 1R3LB 2FO4A 5T1KA 3PNWB 1NCUA 4ZOEA 2UYLA 1LO4H 1AKJD 3KXFD 2FX8H 1XF4A 3KR3L 4BZ2H 4U7KA 1RZ8A 1UWXH 3VFUA 2AEQH 1L4IA 2ZNXA 3GZKA 4O2FA 3OKNB 3QHFL 5IKCA 1U8IA 3UAJC 4TVPH 1ZLWH 1RK1A 1Y6KR 3I75B 4OM0L 3P4LA 1B0GA 3QA3B 1G7HB 1NMAL 3CMOH 3PL6C 4P4KD 1R3IH 2BSSA 3KJ6H 4F2MB 4PGCB 3W5MA 4YE4H 5DURB 4GKNA 3WIIL 2AJVL 2A73A 1DP0A 3OSKA 5CJXC 3NZHH 2MPAL 1OARH 1FZJB 2R9HD 3S35X 1E4KA 3EJYD 1P53A 4OZHA 5J13C 2EE9A 4GLRI 3ZSSA 1UWXK 4MJ5B 1T22B 5E5RB 3W11C 2D7PA 3KDMA 3SGKA 4OB5L 1ZLWK 1KV3A 1RHHB 5LKNA 3HLAA 4UB0L 1H5BA 4D9LH 1HXYA 1O5DT 3TA3A 4XNYH 5GISL 1YC7A 3T3PE 1JHTB 5K9JL 3GI9L 4WUUE 3ULUF 4YGAB 3R0NA 1FC1A 3EHBD 5BVJA 1S7QB 5T3XH 3QDJA 4LU5H 2AGJH 1KT2A 4OIAA 3VFVA 1NLBH 5J1AB 4YHPA 4JAMA 2IFFH 2VLJE 1CR9H 1T1YA 2NYYD 4L3EB 1K4DB 1Q9OB 3K2UH 3KPSB 1LWRA 2E9JA 3NGBC 4U1IA 2Y36L 4EUPG 3BH9B 2G9HA 3EGSB 5CBAB 5JR1L 1PFCA 4HIXL 3Q1SH 4JJ5A 4D0CA 2MSPA 2V2WA 3KPTA 2IH1B 3FO2B 3SCMA 2LV4A 2EDDA 4NN6B 5IWLA 4QXTB 2F54E 4QXWA 5J1TC 3P0VL 5D1QC 1MCOL 4LVHB 4NKOB 3RDTC 3HNSH 4R3SB 2EYRA 5D2LF 4NNYB 3BQUC 3SKJL 5FDYA 1ZGLA 2E27L 5DGRA 5B38B 2BRQA 4YX2H 2BXYA 3W81A 2V7HB 4KRPB 4BJLA 2IPKA 2E7LC 2GCYB 1FYHB 3ZT6A 1AI1H 2P24B 3LN5A 1VGKB 4HH9A 4TNVF 3S34H 1CDYA 4NQSB 1FO0L 2HT4C 4WFFE 3ARGC 5BS0A 2CGRH 4OKDA 1DUZA 5IHUL 3OAYH 4P5TB 5C2UB 3JWOC 5IR1A 4F7MB 2EO9A 5FO7A 5I8EA 5CIPA 4HX1B 4OBSA 3RWHB 3B9VA 5LG1A 3AROA 4N0FB 5ID0B 3QUML 3H3KA 2BNQE 3VFNB 3QUXD 1DL7H 2APWA 3FB6A 4DZBB 1T83C 1GGBL 3VRIB 4KV5E 4WTXA 5MHSE 2WIIB 3EYFB 1YNLH 4UNUA 3QPQD 4I9WE 5FCSH 5DI8A 1M6OB 5DLMH 3OAYK 4OKVA 3LV3A 4FQQB 3WHXB 4UQ2B 2R1WB 4IRZL 1NMBH 5D5MB 4DCQB 5I1GL 4ODVL 4OLYL 4CGTA 3FQUA 4PJXE 3W5NA 1EFXD 1QG3A 4WI7A 1MCNA 3BUYB 4HK0B 4PYHA 3QG7H 3WD5L 5ICXA 4WWKD 3QPXH 2V2XA 1SEQH 1VFAB 3CDGA 2FO1A 4P2QA 4NQDE 4RFOL 2WINA 2IC2A 1E4XH 1TZGL 1F4AA 3DURB 1WC7B 4GW5A 2YC1B 3QT2A 4E0RA 1PYWB 3VJ6A 3QRGH 3MRPB 5J9PA 3C5SA 4GH7B 1UM4H 2A83A 4KTEL 1IGFL 2G75A 3JZ7A 3C9NA 1CLOH 2FBOJ 3V0VB 4MVBD 2VL5B 1L6ZA 3GM0A 2BXZA 5I74B 2OZ4A 2VDRH 4KQ4H 3D9AL 3WLWD 3MA9L 5DMKA 4LVEA 3U9PL 5FYLE 3ARBA 4LKCA 1S9XA 5DEZA 1XGUA 1VFMA 1KLUA 5FGSA 3MNWA 5D7LE 4EVNA 4WEMB 3GB7A 1DEEA 1XCQB 2C7UA 4LMQI 4LLMB 4WNQB 1B0RA 3W9EB 3HC3H 3HE6B 3M17B 5DUBA 5CZXD 3BZFA 3K46A 4G9FA 3RWFB 3KVQA 1G6RA 1OL0A 2VSDA 2X1PA 3QFJD 4KJQD 1QBAA 5B8CB 1MELA 2Q20A 2FATH 2AJ3B 1ZT1A 4PPTA 3T0WA 3DRTA 1CIUA 3BWUC 3IFPA 35C8H 4GJTB 3DLQR 5E8DL 1AQKL 5IV2A 4F9LA 4XP1L 5F7DB 5E94A 2Z8SA 5E6ID 2CJUH 3DX7B 3O6ML 4DN4L 1NPUA 5D7KD 3RL2A 5F6IB 2XG4A 4Y5XA 1IM9A 2EDLA 2FL5A 1AD0A 1AO7B 3AXLB 4ISVA 3QZWG 2R0KH 3THMH 4I8DA 3IDGA 1ZLSL 1B6DA 4ZFFA 3O3DA 4ZUUA 5SWSB 2AV7A 4XX1G 4LRNH 1AE6H 4ZFOL 1KTKE 4J8RB 3BGAA 4MJIB 5CGYD 2Q1EA 32C2B 3MV9D 1I75A 3NFNA 4B41A 2Z31C 2RR3A 4XRCB 1MFCH 1VERA 3JV5A 4X6DE 5DFWH 5C0AD 5F7HA 1A3LL 1G1CA 4HUUA 3DSFL 1MHHA 4XBGA 2IALA 3ZE1E 5KS9E 5BRZE 3LRSB 4G80B 4QHKI 3VWKA 2GSGB 5T3ZL 4YPJA 3W82A 1VKXB 2AQ3A 3EJZC 3BXNB 4XBPB 4JKKA 4KAQL 5EOTA 5FA3B 1F3DJ 4HPYH 4L1DA 4PFEA 2R29L 2LVEA 1IGJA 4M62L 3ZDYE 1VB9A 5D7IF 3RP1A 5BOZG 2ESVE 4HIJB 1RU9H 4OF8A 3O2WL 3WV0A 2Z91B 5KW9H 3NA9H 3HG1B 2X70A 4UI2A 4XVJH 5E08H 3T2PA 4D8PB 2OP4L 3GMQB 3PIQB 4PS4H 1T1ZB 4RGOH 3FMGL 4FQIH 4G6MH 3OKYA 3V79C 1T21B 4JANB 1OPGH 4NFBA 4OZIF 4JFDE 1MLBB 4D0DB 2ZUVA 2IQAB 3S4SB 3DRQA 5LCVH 4NFCA 1EVUA 1PSKH 4NKIL 1FJ1B 5T1LD 5DRWA 2R56H 1DBJH 2PW2B 3BVNB 2W0PA 4KWUA 1CZ8L 3UCRA 5FGBA 2D0FA 1U8OB 5DJ0A 2I26N 5GGTA 5HDOA 1IAIH 3IJYA 3RWCA 4KC3B 1QSEA 3O4LD 3BEVA 4FRWA 4DVBB 1DVFB 1BPVA 1NBYB 3GSRB 3LN9A 1KSRA 2ADGA 3I6GB 4AEIL 1HSAA 4IOIA 3LQZA 5IQ7H 5BVPL 1KCRL 2NTSP 3D0VB 3MC0A 3QEHA 5JIIA 4ORZC 5KVDH 1BM3H 1YN6B 1JTPA 5IT2H 1UB5A 3CFBB 3UTTA 1JGVL 1G6VK 4X6CE 4HJGA 4OI8A 3V6ZA 2C3WA 5D71H 1HHKB 1MJ8L 4NC2B 4FABL 5F71A 3ETBF 4JO3H 2R2BA 2D2OA 4UUJA 2YD7A 3IVKA 1IFHL 2YSSB 4TOYL 3LB6D 4I18C 4KFZC 3O6FD 4KXZH 3CSBA 3GSUA 3VRLF 4MA3A 4JEGB 2H8PA 1KUMA 2VISB 3SDAC 3WXVH 1YQVL 2V7NA 1EA9C 4NO5B 4ONOA 3FZUD 3RGVD 1YECL 4U49A 1ZOXA 3VXUA 3A6OA 2L0DA 5HGBA 3TH4T 1Z3GL 5DDHB 2WUBL 2AW2A 5ACMA 4HCRL 3KR3H 2NY0D 4Z77A 3DWTA 4WWID 3PHOA 2D0GA 4TYUA 3JVGA 3Q6GL 4QOKE 1KG0A 3QHFH 4PBWD 1S7XA 5ERWA 3KPLA 3LEXB 3FB8B 4OM0H 1QLFA 3BIKB 2B20A 3NIGE 3BFOA 1NMAH 2CXGA 3TP4A 3OF6A 3WIIH 2AJVH 3OAZH 3PF2A 1J18A 1KIQA 2MPAH 1MCJA 4Y16C 1OLLA 3TH3T 1QUNA 2VDNL 3KS0H 4QHNA 4TVPD 4XP6L 2EDEA 5C0CA 3L7FB 5T5FL 2O93L 4Y4HA 1WF5A 1QFHA 5BRZA 3WIFA 3IJHA 4G6FD 4POYA 4JZNB 3WDJA 3I9GL 2I07A 3S5LA 4HJ0C 4OB5H 2AJXL 4MQ7B 3U0WL 1WCQA 4UB0H 1QRNB 2A6DA 5M7QA 3D85A 1WIPA 2YD2A 5J6HA 5GISH 1C16A 3ARDB 5E70A 1LNUA 5EN2B 3OAZK 1F00I 5K9JH 3GI9H 4OFYD 1BFOA 3PGDB 2GTZA 4L3EE 5C0BB 4FMKA 4JRXD 1JHLL 2IH3B 2R9HC 1KPVB 5CFHA 1CICC 1CFTB 1ZSDB 2QR0A 1K4CB 4EUPB 2Y36H 4JFDA 1B88A 2XA8L 4CVZA 5E9DD 2E6QA 1BFSA 5JR1H 4HIXH 5T3XD 4M03A 4HWZA 1AXSA 4N5EC 3FOMB 3ARFB 5E1AA 1C12B 3WCYA 1XCTB 3L3DA 1KPUA 1QBLL 4R7DA 5IQ9B 1QFWI 5D1XD 4FFZL 1P84K 1QPXA 3S3PA 4MNQA 1MFDL 5SV4A 3P0VH 1MCOH 3MA7A 2A9ML 4H20L 1I1AA 5IBLD 3C60C 4LCYB 4Z7VF 3SKOA 3CCHA 1JWMB 3SKJH 3ULUC 3D69A 2E27H 5MI0C 3OKOB 3MBEA 5DZLA 1A1NB 1HHJB 5GRUL 2C26A 3IRPX 4MD5A 1S7SB 2RHEA 3BPOB 4ZFGL 4YHIA 2WQ8A 3L3GA 3FRUA 3HR5A 4QHMA 3OR7B 4PRHB 2BVOA 4RFEB 4RA0C 3U7AA 2XWBA 1QPPA 1FO0H 1IARB 1KYOK 2C4FU 2F53B 5IHUH 4JPIB 1AQDB 5GJTL 1NAMB 5CGTA 2WLYA 4JQXA 1KN4L 4NZDA 4ORGA 1OGAB 1BF2A 1N5AA 5IHLB 1X6NA 4KK9C 4KVCL 4AIZA 1NUNB 1YEHL 3KPPB 5BZWB 4R0LB 1TIUA 4KI5D 3QUMH 3DBXA 3PUCA 2I24N 5EBWB 4RGNC 4ZG1A 4DGVL 4QTHB 1GGBH 1ZVYA 2NXYB 2I60L 2IQ9L 3D39D 1JN6B 4QRUB 1J7VR 1ZT4B 1AP2B 2A74A 2ZUWA 3TVMD 4LDEB 4P23D 3O9WC 1R3LA 3PNWA 5D5ME 4QRSB 4J3WA 4IRZH 3OKNA 4W70A 5I1GH 4ODVH 4OLYH 1JNLL 3I75A 4WFHD 1E6JL 1A6PA 3G08B 3QA3A 1G7HA 3KLDA 3WBDA 5HPMB 4POZD 4F2MA 3WD5H 1BFVL 4PGCA 4X83A 1M7IB 1FVDB 1L0YA 1YYML 4RFOH 1TZGH 3IFLL 4PLKC 1WT5A 1FZJA 2P5EB 4F7CB 2FH8A 1HHHA 4EDXB 1R24B 2VDLL 2KBGA 3T0EC 5EU5B 3QFDB 3QPQC 4MJ5A 3CFKB 4KTEH 2DKMA 1IGFH 3OMZA 5KSAC 1X5KA 4H5SB 1RHHA 3ELAT 3I6LD 1ZAGA 5GS2D 3GSXA 2NLJB 2WBJD 4WU5B 2YD5A 5CLTA 3TZVD 3D9AH 3TNMB 3MA9H 1JHTA 3DX6B 3R8QA 4YHNB 3U9PH 2QKIB 3B4NA 4G8GB 1T6VN 1ADQL 3BDYL 1NMCB 1EEZB 2B4CC 2Y6SD 4JHAL 4YFDB 1S7QA 2VERN 3LKRB 4NQED 5J1AA 4MA8L 3VG9C 4XWGL 1OP3H 4L3EA 1K4DA 1Q9OA 2YR3A 4FHBD 2QTEA 3KPSA 5EBLB 3BH9A 2APVA 2NY4D 3EGSA 5E2UL 3G5XB 5CBAA 4Q7DA 1S78C 1HIML 1WTGT 2IH1A 2WQRA 3FO2A 5E8DH 4JCLA 1AQKH 2HTLD 5A1AA 4QXTA 3WLWC 2GTWB 5DD1L 4XP1H 3QIWD 1YMME 1A6WL 3O6MH 3QJHA 4DN4H 4JFFD 4NKOA 5DC4B 4R3SA 1OP3K 2PTVA 2X4QB 4NNYA 3QHZL 2PN5A 4KI1A 3S35L 5B38A 1HKFA 2PO6C 3T0BA 4AENB 4FTVD 3G6JB 1E4JA 2J1KA 2V7HA 1ZLSH 1MI5E 1A7RL 1X4YA 3LDBB 2GCYA 3WNKA 4J2XA 2P24A 1VGKA 4NQSA 2ZSVB 2DIJA 3WO3B 1G84A 4KJQC 4G8FB 1AHWB 1NFIB 4P5TA 4Y19B 2X4SB 4UMGA 3H9ZA 2VUOA 3TBSB 1XGPB 2ADIB 3HAEG 4U1GC 1A3LH 4HX1A 3O41B 3GKZA 4N5UA 3RWHA 4Z7WB 1FCGA 3DSFH 3CFDB 1NBZA 3MROB 3MRRB 4N0FA 5ID0A 5E6IC 4KTDL 4U33A 1HN1A 15C8L 5T3ZH 3VFNA 3W0WE 1KELL 1UM6L 4DZBA 4A2MA 4PJ8C 3VRIA 5HYJD 3MRHB 5C8JB 2O5XL 5IFAL 2VIRB 1QBBA 2B7DT 2WIIA 3EYFA 4KAQH 1SVZA 4YPGA 5FV1L 5B39G 5GS3A 1ED3B 2R29H 1M6OA 1QNZL 4M62H 3MV8B 4U6YA 4FQQA 2CXKA 4HG4J 1X5YA 2DD8L 3KYAA 4UQ2A 3O2WH 2R1WA 3WS6C 5D5MA 4GW1B 1SQ2N 2XTJE 4DCQA 5FB8B 3MYZA 1JIBA 2OP4H 3BUYA 3FMGH 4HK0A 3MNVB 3STBA 2V5RA 3SDDB 3SGEI 1VFAA 1BZ9B 3VRJB 4OLZL 3WSQL 4KDWA 5HVGB 3AREB 1OQOA 3EYOA 2QQQA 4HV8B 2ITCB 1ZHBB 2XN9E 3EDEA 5IEKB 5HHMD 1DQLL 3BP5B 3DURA 1WC7A 5FF6B 2YC1A 4J3TA 4QO1A 1PYWA 5BZDB 3MRPA 2LAGB 4OI7A 4NKIH 2ZUYA 3DMMC 3CH1B 1IVLA 3QWRA 3UJJL 1CZ8H 3V0VA 4M02A 2VL5A 4YBQC 5F9WC 1LEGB 4RAUB 2YA2A 3S97C 3N0PB 4B7LA 4BKLB 4RNRB 2R1YB 4KKCC 4AEIH 1CTOA 4GW4B 5CD3B 5BVPH 4LPTA 1FZOB 2R0WL 1KCRH 4XB8A 3HUJF 4KK6C 4XNXL 3RZCC 1XCQA 4LLMA 4WNQA 1E0OB 5IM7B 3W9EA 3HE6A 3CVHB 3M17A 5TH2B 4N8VG 3RWFA 1KJ2B 1TQBB 1JGVH 1RVFL 4OCWL 4X7TB 3EYUL 5B8CA 1MQKL 2WNGA 2AJ3A 1MJ8H 4FABH 1YEDB 4ACPA 4PJAB 4FOMA 1IFHH 4TOYH 1OTTD 3HNTL 2VJXA 5FHBL 1FG9C 1CVSC 2HA1A 5F7DA 3DX7A 2C3XA 2H6PB 3OKDB 1YQVH 3D87B 5DSCA 1AO7A 3AXLA 5JW5B 1YECH 1L7IL 3U46B 1Z3GH 5F1KC 1XGYL 2WUBH 3T3PF 5SWSA 4HCRH 2X7LB 5C6TL 4Y5YB 3BO8A 3Q6GH 4J8RA 4S1SL 3RWDB 4MJIA 32C2A 3WMSA 4PJHB 3DVGB 4OCNC 2XQYG 4O2EB 5E5MB 1P7KB 4XRCA 5EPMB 5D2NE 1WQVT 4N8CL 3LB6C 5INCB 3BSZL 4YJZL 2HLFD 4DZ8B 1BHGA 3QXVA 2VDNH 3VXOB 3IJSB 1TVHB 1P5UA 4XP6H 2DTML 3LRSA 4G80A 2VXSL 5T5FH 4I0PC 2GSGA 4EOWL 3C5ZC 1K8IB 3MCG1 5BJTB 3FZUC 3NIDE 3RGVC 3BXNA 2ERJB 3T0VA 4X4XB 4XBPA 1FH5L 1QRNE 4XZUB 5BW7C 3I9GH 5DFVC 5FA3A 5EO0B 2AJXH 4V1DD 3U0WH 2F54D 5I75C 4HIJA 3B83A 2CDEB 3ZT5A 2AQ1A 2Z91A 4G8EB 4Z18A 3HG1A 1JF5A 5HHQB 3HNVL 3OGCB 1WWAX 4D8PA 3GMQA 4HWNA 4PP2B 5DEGB 1T1ZA 4CNIB 4M4PA 1QBML 4OGYL 1T21A 3RUGF 4KUCF 2KKQA 5GZNC 2IJ0C 1JHLH 1H8NA 5JXEC 1MLBA 4D0DA 2IQAA 3S4SA 2IEPA 3V9FA 3VXTB 2X4RB 3RVVC 2XA8H 3QJFA 1BX2B 3DETC 1FJ1A 1MWAB 1FIGL 3TJHC 4K71C 2PW2A 3BVNA 2Y07L 1QBLH 4CVXB 3SJVD 2HJFB 4FFZH 1U8OA 5IMMB 1MFDH 1S9KC 1JGDB 4KV5F 3WJJA 2A9MH 4H20H 4DVBA 1DVFA 1NBYA 3GSRA 4QCIA 3I6GA 4F8QA 2A0LD 4OGXL 5GRUH 3J8F7 1U3HD 4CDGC 3TN0D 3D0VA 4ZFGH 3T4AB 4PGJA 1KULA 5LJYH 4PREA 4ENED 1YN6A 1FDLL 5FM5M 1K3ZA 3CFBA 5FM8A 1MCIA 1EBAA 2E7BA 5GJTH 1MJJB 1WZLA 3TBVB 2X89D 1HHKA 1ZE3C 2YZ1A 3KPRB 3MV7D 1KN4H 1TNMA 5C08E 5F21B 4UAOC 4KVCH 3C5JB 3GO1L 1YEHH 1CD8A 5IK3B 5K93A 2YSSA 3BPNB 4AQ1B 1JTTA 1A7QL 4HIEB 1OP9A 4HGMA 4FFVD 2VLLB 4DGVH 3C08L 2I60H 1XGTB 2IQ9H 2PXYC 2VISA 3GK8L 4NHCL 4PJCF 3HR6A 4NO5A 4NOFA 4P5KB 2EIZB 1SY6A 1QACA 5I73C 3U83A 1X5LA 5DDHA 3C6LD 3ZHLA 4LCCB 2LTQB 4W6WB 2SEBA 4HWEL 4YUEL 3LEXA 3QDGD 1JNLH 1FFNB 1E6JH 4KKBD 4H1LG 3BIKA 4OFIA 1KGCD 1BFVH 1G0YR 5E6ZA 1W8NA 2NW3B 3B9EA 1YYMH 3LS5L 2D0HA 1RIUL 1ZKAA 3IFLH 1BJMA 3CVIL 4NO3B 3L7FA 2VDLH 4J4PD 3LKSB 4GG8B 5E8PB 1CI5A 4ONGL 5ADPL 2ZKHL 4JZNA 3HZYB 1D9KB 3MRNB 3O3EB 4MQ7A 1QRNA 5I1CL 3ARDA 2YPLD 2NTFB 5EN2A 2ARJB 4KHXL 3RIAF 3H8NA 3KPMB 4POZC 1ADQH 3BDYH 3PGDA 4JHAH 3DI2B 3M8OL 2VXTL 2WANA 2NX5B 5HI3C 5C0BA 2RAMA 4DFHA 4MA8H 4XWGH 2IH3A 1KPVA 4FXLA 3VGEA 1QR4A 3BD5A 1ZSDA 4XVTL 1ACZA 1K4CA 4EUPA 1L7TL 5T5NF 3PL6B 2DL2A 3F5WB 2VZVA 4UQ3B 3DYPA 4X6DF 5E2UH 2FBJL 3MUHL 3P73B 3FOMA 3ARFA 1HIMH 1II4E 3ZE1F 5C0JB 5KS9F 1XCTA 2WBJC 5J13B 1UA6L 4CMMB 1BD2E 5DD1H 2XZQL 2D3VA 1A6WH 1F42A 2DF3A 3K74B 4LGPB 4LCYA 4OIBA 3UEZA 1JWMA 3QHZH 3C2AL 3S35H 3OKOA 3BH8A 1A1NA 1HHJA 1S7SA 1J8HD 1J05B 2ESVD 1A7RH 2OR8A 2EDHA 4K07A 3OR7A 4PRHA 4RFEA 2Z8WC 4Y19E 2AXFB 3VGBA 2F53A 4JPIA 1AQDA 1NAMA 3LCYA 1Z9LA 4QRRB 2DM3A 3SGDH 3UYOD 1OGAA 4J12A 1CXKA 2D7NA 2EEBA 3ULSB 3KPPA 1YZZA 5BZWA 4R0LA 1QSFB 3UJTL 5F7UA 2UZYB 3SGKC 3RNKA 2D7MA 4KTDH 4D0BA 4YC2C 3MXVL 5EBWA 15C8H 4X6EB 1KELH 1UM6H 4QTHA 1H5BC 4G6KL 5EH1A 4RWYL 1MVFA 2O5XH 1JN6A 4QRUA 1ZT4A 5B39B 1AP2A 5IFAH 4BSWB 4WO4C 3EDFA 1PY9A 1QNZH 4BELD 3TCXA 1GGCL 4MLSA 1N26A 1ETZB 2G5RA 3QCUL 4HLZH 3RDTB 1X5FA 5FK9B 2DD8H 5T3ZD 2A6IB 3WLBB 1NC4B 3BQUB 4IHOB 1FORL 3O4OC 2EDFA 2QEJA 3RWGB 2YUWA 2MQ0A 3FJTA 5HPMA 4NBXB 2FIKB 4C55A 4OLZH 3WSQH 1M7IA 1FVDA 1KPRB 2GFBB 3CPLB 1P4IL 4X6CF 5GS0L 2VXQL 3HC4L 4G6AC 5D4QA 4LPWA 4PGEB 1DQLH 2P5EA 2EIEA 1T20B 4EDXA 1R24A 4BM7A 1YA5A 8FABA 4XP4L 5SWZD 4XPGL 4MB5A 1Q0XL 5EU5A 1MJ7L 3QFDA 4LCUB 1CIDA 3FO9B 2HN7B 3CFKA 2DQUL 3UJJH 2X1OA 4H5SA 4CU8A 1R3HB 2QADD 1OP5H 5JQ6L 1RJLB 1K9TA 2D31B 2NLJA 3VXMD 4WU5A 4UTAL 2W0KA 3TNMA 3GHEL 3ULVL 2YN5A 3DX6A 5E7FA 4YHNA 4A6YL 2QKIA 1VCAA 4G8GA 4U7MA 5JO5B 1WBXB 4X9GA 2R0WH 1EEZA 2HG5A 4IRSB 2ICWI 1IQDB 4XNXH 4XCNB 3LKRA 5FOBB 1K8DB 4N8VB 1WICA 1NEUA 1J0JA 3QDMB 1GYAA 3MXWL 4QXUL 1RVFH 1Z9OA 3UTPE 4OCWH 1OP5K 4IBLT 3EYUH 5EBLA 1MQKH 2ZG3A 1P4LA 3G5XA 1Q38A 2JB6B 3QI9B 1E4XI 4QWWD 4GG6B 2O26U 4U1MA 5FYJL 1LP9B 4RAVA 4HGKC 2HJKB 3HNTH 4GUPB 5FHBH 2GTWA 3K80A 1R6VA 3LD8C 1G9MC 1I1CA 2ARJQ 4IMLB 5C0ND 2GJ6D 1JWUB 2OTPA 2X4QA 2NPLX 4N68A 3VMOA 4AENA 4F80A 1L7IH 3G6JA 1XGYH 1UJTA 5C6TH 1MF2L 1UXWB 1MQ8A 3TO4D 1MCWM 2NY7L 2ZSVA 4PJHE 4ZO7A 3ULVE 2A1WL 4S1SH 4G8FA 1AHWA 4PUBL 4UILL 4Y19A 2X4SA 1ZEAL 4ELME 3VFRB 5T1DL 3TBSA 2ADIA 1RSFA 3BPCB 4S0SD 1YN7B 3O41A 3U36B 4N8CH 4IJ3C 3BSZH 4Z7WA 1BAFL 3CFDA 5ABDE 4BFGA 3MROA 3MRRA 2DTMH 4MAYD 4F7EB 2ITDB 2VXSH 4EOWH 2VC2L 3MJ8B 2W0FB 2EXYC 3LPGA 4JPVL 3MRHA 4PIRF 2N7BA 5C8JA 2ADJB 3O6LL 2VIRA 1FH5H 3MFGB 1EPFA 1ED3A 1PKOA 2V5SA 3DI3B 5FYJE 5AG8A 3MLRL 4OF6A 3MV8A 4QXGL 1V3MA 4GW1A 3EZJB 43CAB 3HNVH 5FB8A 4G9DA 5I1IL 1QBMH 3MNVA 4MNGE 4OGYH 3SDDA 4M1GL 1ZT7B 3FO1A 1BZ9A 3MSPA 3VRJA 1T7WA 3CXHJ 5I6XC 4BFIB 5JPMB 1IL1B 4F7TB 3AREA 4ZO9A 4HV8A 2ITCA 1ZHBA 1FC2D 3VFTB 5IEKA 4W68A 5FF6A 4F8TA 4WGVB 1D5ZB 2Z31B 2D7TL 4PJ5B 5BZDA 1HSBB 5E95B 3RX8A 1FIGH 4PJ7E 3CH1A 2EDTA 2LFGA 2Y07H 5DZOA 2VLKB 5MEQB 3IAPA 2C3GA 1INEL 2JF1A 4PJFA 2X4UB 3ME0A 4ODBD 1LEGA 4RAUA 4ONHB 2ED8A 3BX7C 4KHTL 4BKLA 2QSCL 2RB8A 2B39A 4RNRA 2R1YA 4PJGE 5DEFB 1UKSA 4GW4A 5CD3A 4OGXH 3DX8B 5TPWL 3B2UD 3PWJB 2DWEB 1A64A 1CGYA 3MOQA 4OCMC 4WRLA 3PQYD 2ZCHL 5IM7A 1FDLH 4JQVC 3CVHA 5TH2A 3QUZD 1BOYA 4HJJL 1KJ2A 3KPRE 5HY9B 4MMXC 1TITA 2FECI 4X7TA 3TEUA 1MEXL 3AM8A 1KTLA 5F8RC 1FNFA 2E9IA 4S1QL 3AUVA 1ODAA 4DQOL 3VWKC 4K94L 1C5BL 1CT8B 4OGAD 3GO1H 3EKCA 1CGSL 1YEDA 3U4BL 4PJAA 1JFQL 3LPWA 1KB5B 1U93A 5HPOA 1A7QH 1ORSB 1X5JA 4Y4KD 2EDQA 1A21A 1P7QB 3DROB 4Y2DC 1A14L 3SKUD 1G7PB 3K8MA 2J6EA 3C08H 3GK8H 4NHCH 2H6PA 3OKDA 2FLRT 4R2GD 2NY3D 1FL5B 1U3HC 4P2YA 4JFXB 4WIQA 5CEZD 5JW5A 4GRWF 4LEXL 4I1NB 4K7PL 1N6UA 4ZXBD 4EIGB 3BIBX 4UINL 2BX5A 4M7ZC 4EN3D 1OT2A 3W2DL 2X7LA 1XF3B 2FIRT 5GS1C 4Y5YA 3ARZA 4YWGL 1AXIB 3RWDA 5L88L 1HOCB 4YUEH 4HWEH 1D5IL 4X0KB 4JCMA 1NFDE 5K33A 5ISZA 2ZCLL 3DVGA 1RPQA 4O2EA 5E5MA 1P7KA 3OG6B 4MS8D 3L3KB 4APQD 5EPMA 5EIVA 3LS5H 4NCDA 3S9DB 1WITA 1RIUH 5INCA 5J11C 3DVNB 4LHUB 3TYFA 4DZ8A 3CVIH 3VXOA 2NY6B 1TVHA 3HPLB 1Y6MR 1A8JH 4FFVC 2COQA 3VI4E 3TPUB 4P5MB 5M94B 1K8IA 3ARTA 1TVBB 3OAUL 2V6HA 5BJTA 3MTRA 3QIBD 5HYSB 1RZGA 3MFFB 3HN3A 4ONGH 5ADPH 4X4XA 3HZVB 4XZUA 2ZKHH 2BVPB 4I18B 4KXZI 2VB5A 3FAWA 4M8VA 4HSQA 5EO0A 5TQ0L 3H7BB 1T2QL 1KOAA 3WNMA 2CDEA 5EBGA 3VG0L 5I1CH 3SDAB 5DVLA 2MFNA 4G8EA 4KHXH 4X7DC 5HHQA 4KKBC 1MAML 2XZZA 2NX5E 3D0LB 1G7QB 3OGCA 3PJSB 1CGTA 4NQCB 1LE9B 4PP2A 1CDCA 5DEGA 1A2YB 3M8OH 2VXTH 4CNIA 1KENL 2CQVA 5CINL 1HE7A 3QEQD 3F7YB 5E6YA 1BQHB 1OWRM 2X4TB 5JHDB 4OZFG 2Q8BL 4HWBA 4XVTH 2DQEL 1L7TH 1EX0A 3VXTA 4GQ9L 4S11A 1BX2A 2FBJH 1MWAA 5GHWL 3IDXL 4E41D 4Y16B 5D7JB 1UT9A 1RZKL 4JY5L 2GT9B 4CVXA 3CX2A 4NYLB 2HJFA 3KPOA 2F5BL 4YLQT 5B4MD 3RX5A 1UA6H 5IMMA 2XZQH 1JGDA 5LWYL 2I9LB 4HKBB 4LQFL 3PABB 2CKBB 5IB1B 4UDUB 2CIIB 1QHOA 1U3ZA 3BPLC 3KXFB 3C2AH 3OZ9L 4UZGA 3FN0L 1EEUA 4MCYB 3RWEB 3T4AA 2XYCA 5J06A 2H32H 3DV6B 2BNRD 4TTDC 4JRYD 3CU1A 1BF8A 1PAMA 2AK1L 4P4KB 5EULV 5BV7C 4QRRE 3KPQB 3GNML 2JJTA 1MJJA 3V7AG 3PWPB 3TBVA 43C9B 1EGJL 1EH9A 1MPAL 4LEOB 4XP9L 3C5JA 1OAXL 2EO1A 3UJTH 1KEGL 5IK3A 3OBAA 2EICA 1NJ9B 5FO9B 3MXVH 4HIEA 5GGVY 1U8JB 4J3UA 2VLLA 1WIOA 5EO1B 4G6KH 4RWYH 1XGTA 1YJDL 2OBGA 1IJ9A 4P5KA 2EIZA 4XVSL 1GGCH 3B5HA 3QCUH 4NZTL 5CJ8A 5CBEB 3WFHB 3X12B 4LCCA 5IVXA 1FORH 5MI0B 4JG0L 3UTQB 3IXAB 1FFNA 3CNKA 3SDXE 3UTSE 4LCWD 2W9EL 4MQTB 4MB3A 4NBYB 3FTGB 1P1ZB 5MP6L 2NW3A 1P4IH 2Y4SA 1I9RL 5GS0H 2VXQH 3HC4H 4BH8B 3ROOB 4D9QE 4NO3A 1XH3B 4QTIL 1JI2A 3LMJL 5F9OL 4CN4A 2C3HA 4ODWB 4XP4H 2WK2A 3LKSA 4XPGH 1Q0XH 4GG8A 1MJ7H 5E8PA 2DQUH 3A6BL 1WJ3A 4NQXB 1LGVA 3HZYA 1D9KA 4NQUA 3MRNA 3SBWA 3O3EA 4RGNB 5JQ6H 3P4OB 4OF7A 1OTSD 2B8OT 2YN3A 4UTAH 4GBXD 5D2LB 5C9JB 3GHEH 4H26B 3ULVH 2NTFA 1A4KA 1AJ7L 2ARJA 5LGKA 1JCKA 4A6YH 4BFBD 4U4BA 3KPMA 2ZUQC 5I8CB 1T66D 3V8OA 1WZMA 3QDME 5I1DB 3SO5A 4UOW0 2NX5A 3A0OA 3I3DA 1OAKL 5IB2A 2KZ1B 5F7EL 3MRBA 2XKSA 1AH1A 1FPTL 3G6AB 3MXWH 4QXUH 3GUTB 4G6JL 4JGMA 1U9KA 3PL6A 3F5WA 3GMOB 4UQ3A 2DQCL 3P73A 5CJXA 1QZ1A 5FUCC 3QUXB 5FYJH 1TXKA 3FHQA 2YXFA 4TNWK 4CMMA 2A6KA 4PG2C 5I1EL 4P9HL 1FFRA 4RFNC 3D1MC 5D8JL 4R97C 1F6FB 4WCYL 4K7PY 5I66B 1MNUL 2PYFA 4EI6B 4NDMB 5EU3B 1J05A 3FHAA 3AC0A 4KJYB 1RD6A 1WCBB 3E6FB 1MAKA 1MF2H 4NO0B 3TV3L 1EFXB 1DQQB 1KEML 5F88B 4WI3A 2NY7H 2WWKO 2AXFA 6CGTA 2A1WH 4PUBH 3WFBL 4UILH 1ZEAH 5T1DH 4QRRA 1RJYB 2IGFL 1DSFL 5T1KD 3UZEA 5DQ9B 4POUB 3ULSA 2H9GB 2PTTB 4P59L 1BAFH 2J8OA 1QSFA 5DJXB 2YWYA 3PDDA 4ZS7L 3MO1B 4JG1L 5JA8B 3D6GA 4OUUB 1PG7X 1YEIL 2VC2H 4JPVH 3BHBB 1X4ZA 2ZCKL 5DVNA 3AVEA 3O6LH 4I3RL 5B39A 1SJXA 3K81A 4BSWA 2BY3A 3H9HA 1C8PA 3MLRH 1ETZA 3FT4B 4JFZL 2X1QA 3RDTA 5FK9A 2A6IA 5E56A 3WLBA 1NC4A 3BQUA 4IHOA 3NABL 1T7VA 2PO6B 4QXGH 1YNKL 3DXAD 3RWGA 1T2XA 2E7LA 2VO5A 5I1IH 4OBRA 1NKOA 2FIKA 2YEZB 4M1GH 4B0MM 2EYSB 1RULL 1KPRA 3CPLA 2GFBA 4H0HB 3TA3D 5JW4Q 2AQ2A 1ZLVK 1EXUB 4PGEA 5F70A 5KVGL 1T20A 2X5PA 4U1GB 2D7TH 2Q86B 2VLKE 2PR4L 2AJZB 1TZHA 3LQAL 4LCUA 4RMWA 3FO9A 2CSPA 3QDJD 4K3HA 5C07D 4U3HA 1INEH 5E6IB 1R3HA 1AGCB 1RJLA 1T83A 1OSZB 2D31A 4MJ4A 4PJ8B 1KNOB 5JDSA 5I8OL 5DJ6B 2GK0A 4PY8I 1Q72L 1I3UA 3KYOB 4KHTH 1A7OL 4PP1D 4QRTB 4HMEA 2UV3A 2QSCH 5DRZB 5GRWA 5TPWH 1OCWL 1S9VB 5JO5A 1WBXA 4IRSA 1IQDA 4P5TC 3SCMD 5FOBA 1K8DA 2ZJSL 2ZCHH 2ZUSA 4N8VA 1FL3B 4FFYL 5ADOL 4YHKL 4HJJH 1WAAE 4XP5L 3QDMA 4JZJC 4NZJA 1GAFL 4HC1A 1F6AB 1N2RB 5C0AB 1MEXH 2HTKD 4S1QH 1KB9J 4DQOH 3WKML 4K94H 1C5BH 2JB6A 4GG6A 5MEPB 1CGSH 3U4BH 1JFQH 4QHKJ 5E0QA 1LP9A 1YC8A 5F7LB 2HJKA 4GUPA 1L0XA 3QHTC 4PJIF 3S8WA 3DMMB 1A14H 5D96C 3F6IA 1W72B 4L9DA 4D9RE 4LSDA 4F7PB 4IMLA 4X4ZA 1JWUA 5D7IB 4LEXH 4K7PH 5FO8B 5F9WB 4OIIL 1NQBA 5D9SB 2VAAB 5DJAB 4UINH 3W2DH 4FNLL 2I9TB 4ZSOE 1FLRL 1UXWA 5E4EC 4MA1C 3CC5B 4YWGH 3AY4A 5L88H 3U2SB 1D5IH 1KXVC 1TCMA 3RZCB 2ZCLH 5E5UB 5ESAB 5F44A 3VFRA 2GEEA 4OZIB 3VXPB 2X41A 2GHWB 3BPCA 3VXSE 4YDLC 1YN7A 3ZKXC 3U36A 2AABL 2VDKL 3T2QA 5LGJB 4F7EA 2ITDA 1IKNC 4LLVB 4NHUB 3MJ8A 2NY3C 2W0FA 1N7ML 3OAUH 3M07A 4DEPC 1UYWL 2GSIB 4BH7B 2ADJA 1GRWA 4I2XB 3HZKB 3N06B 4P2QD 4AMKL 5TQ0H 5K59E 1T2QH 4XPFL 3KPNB 4W4OC 3VDCA 3VG0H 1KACB 4Q58C 3L6FA 2P47B 3H9SB 4CAGA 1PLGL 4NQCE 3DHMA 3HE6C 43CAA 2KL6A 1MAMH 3TNNB 3MREB 4WFGE 2VLME 2AV1B 3GSNL 3AU1B 1MRFL 1SJEB 2FGWL 5L7XL 3IETB 4APQC 5FCUL 5JHDE 1KENH 4PBXA 1U91B 5CINH 1ZT7A 5A2FA 2FR4B 1N4XL 3W39B 4BFIA 5JPMA 1IL1A 4OZFB 4F7TA 4YXKL 5IHBA 2Q8BH 3JWDL 4LGSB 3VFTA 1ORQB 2P49B 2DQEH 3UX9B 1FIEA 2Z31A 3ARBD 4PJ5A 4GQ9H 4RDQF 1HSBA 3EYVB 3MRFB 3QWOA 2QSVA 5GHWH 3IDXH 3VD5A 5C0IB 2WM0A 1RZKH 4JY5H 5MEQA 5GGQL 5F6IC 1A6TB 2X4UA 4G9FD 4I0PB 3NCFB 2F5BH 4JHZA 3C5ZB 3KXFE 5LWYH 4LQFH 3RGVB 4ONHA 3HS0B 5JMRA 3OZ9H 5DEFA 3FN0H 2ICES 3DX8A 1S7WB 3PWJA 4OQTL 2DWEA 5I75B 4O2CB 2FX9L 1FFPA 5CP3H 3QO1A 4QRPB 2AK1H 3F58L 1OHQA 1AY1L 4OLUL 5HY9A 4K23L 3GNMH 1B0WA 3F7VB 4PJBF 4WI9A 1EGJH 3ECBB 1S9WB 1MPAH 3ZLQC 2ZUXA 1IKFL 1CT8A 2WMPA 4XP9H 4NNXB 3EOBB 1OAXH 4UV7L 3ZE2F 1KEGH 3FAXA 4MXQC 2BSED 5DJ8B 2G2RB 1KB5A 4DOHB 2CKNA 2VE6B 1ORSA 4G6FB 1LK3L 1P7QA 1LK2B 3DROA 3FKUS 4JKPL 1G7PA 2YA0A 1YJDH 1MAJA 1Z2KA 1ITCA 1FL5A 4PRPB 4JFXA 4XVSH 2F19L 4MQXC 3ZTJG 4OLXL 2DM4A 2J12B 3DOSA 4NZTH 5J4MA 3FCTB 5AZ2L 2XTJC 4NZRL 3RU8L 4CMHC 1XF3A 4JG0H 4HF5L 1JI1A 4PGBB 3TESA 1HOCA 4X0KA 3PP4L 4JY4B 4RCAA 3UPAA 5D6DC 2W9EH 5GRYA 3MLTB 2X4NA 5MP6H 3O2DL 4TTGA 1I9RH 4M9PA 1HNFA 3DVNA 4LHUA 5E9DB 4LP5A 1MCHA 3N1FC 3HPLA 4NKDB 4QTIH 3LMJH 5F9OH 3TPUA 1HK6A 4UAOB 4P5MA 1T4KB 4CU7A 5D1XB 1TVBA 3WJJC 3MFFA 3A6BH 4URTB 3HZVA 4I18A 2BVPA 2C1PB 3H7BA 5D93C 1R5VA 4NNPL 1KXTB 2PXYB 4Z7VB 3SDAA 5JHLL 3GMLA 1AJ7H 4ODXB 4MNHA 3S36X 4FZ8L 3D0LA 1G7QA 5HD8D 1F8TL 4NQCA 1A6UL 1LE9A 1A2YA 3O8XC 4PJHF 4YIQB 3ULVF 3F7YA 1OAKH 4M3KB 5F7EH 1FPTH 1JPFB 1QSED 2X4TA 4R6UA 4Y1AA 6FABL 4G6JH 3SKMB 4ELMF 2OL3L 5BOPA 5EIIB 1EHXA 4TNWF 1CLCA 3G04B 2DQCH 2E8ZA 1ZMYA 2DWDB 4Y16A 4M93C 5D7JA 4QY8B 2GT9A 2DLFL 4L3CB 4NYLA 3UTTD 3D39B 2NY2D 1B9ZA 4HKBA 2W65B 3PABA 5H94B 5I1EH 2CKBA 4P9HH 5IB1A 4UDUA 4XVUD 2CIIA 4JM2F 5D8JH 1T66C 4JM2D 5GSRB 4WCYH 4XPBL 4BYHA 3IU3A 1MNUH 3LEYL 4MCYA 1VFUA 3RWEA 1VHPA 3SE9L 3TV3H 3DV6A 1KEMH 2FYYB 3ARUA 3IYLW 3H6JA 1CGWA 3MOAL 1D6EB 1I1RA 3WUWG 4KQ3L 4HUVA 3BKML 3OJ2C 3U6RB 3WFBH 3WDIA 3PWPA 5D2NC 43C9A 5SX4H 1BEYL 2IGFH 1DSFH 3VXUD 1GC1C 4LEOA 4NM8L 4P59H 5DYOB 3LVEA 2ZNWA 4ZS7H 4JG1H 1NJ9A 5FO9A 2GYSA 1YEIH 1U8JA 2MJWA 4PJ7F 1KJ3L 5EO1A 2ZCKH 1JZ5A 5DO2D 2IF7A 1YY9D 4OCLC 1IEBA 4I3RH 3ARDC 2IG2L 1T7YA 2WBJB 3OF6D 1CLYL 5C3TA 1FHGA 5C9KA 1GZPB 4QGTA 1BQUA 2Z4QB 1UM5L 1OAYL 4JFZH 1OLZA 4L5FL 3C60A 5CBEA 1J1OL 5C0CD 5C0GB 3KLAB 4PJGF 3X12A 3NABH 4Y4HD 1YNKH 3UTQA 1N59B 3IXAA 4LIQL 3GIZL 4RMUA 3FQRB 4AH2B 4O58L 3QFJE 5EZJA 4WHYG 5I1AB 2WV3A 4L8DB 1F3RB 1QO3B 5IMOB 1P1ZA 2R15A 3QUYC 1RULH 3P0GB 1B2WL 4KPHL 2O61B 3D85D 2NY4B 4JPKL 2MTPA 1DQJB 4BH8A 3ROOA 5K9OB 5KVGH 1XGRB 1XH3A 3UC0L 3DGCR 4ODWA 3NCYS 3OKKB 3L5JA 4R8WL 2PR4H 3LQAH 5D7KE 4NQXA 4RMSA 4YC2B 4DWHA 4JFFB 4X4ME 3P4OA 3OPZL 4HPOL 5EUOE 5I8OH 2WP3O 5D2LA 5C9JA 4FTVB 1Q72H 3QXUA 4H26A 1A7OH 1Z9MA 5HYEA 2R2CA 2IAMD 3O9WA 4PD4K 4OF0A 3BN9D 4WO4B 4C83B 4NCC1 5EZOL 3IDMB 1OCWH 2VABB 5I76B 3ALXA 3MV9E 3V6OC 5I8CA 2ADFL 1PKQB 5I1DA 1BZ7A 1OOAA 2ZJSH 3D2UB 1EUUA 1JZ7A 4X4YB 2FEEL 4XT1C 4FFYH 4MNQD 3HPJB 4YHKH 3DJ9A 2VQ1B 5C0AE 4MYWB 5ADOH 4XP5H 1NFDF 3G6AA 1WTLA 4HKJB 3GUTA 1GAFH 5I1JL 1I1AD 1YUHB 5HYIA 4LIQE 3GMOA 3MBED 2PW1B 1J5OL 3WKMH 5EIQA 5TDOA 1ZVSB 4OV5B 2Y1VA 1KBGL 3QUXA 4G3YL 3VI4F 1T80A 5F7NC 4ETQB 5GRXG 3QXDB 3ILQD 3K2MC 4O02L 1J10A 2YRPA 3TGXA 2Y25A 3JTSB 5D7IE 3RA7L 4Q0XL 3R8BB 3QXWA 3ZDXE 1HCFX 1XIWD 2YPKB 1GGUA 5I66A 1JNJA 1IC1A 4OIIH 4JLRB 4BZ1L 1VSCA 4NDMA 5EU3A 4EI6A 2AEPL 1ONQA 4KJYA 2CLVB 1WCBA 4FNLH 3E6FA 3BRFA 4NO0A 3B43A 1FLRH 2VXVL 1KLGA 3IS0X 3BUTA 1DQQA 5F88A 3V4VL 1IGCL 4EXKA 3VGAC 2HTKC 2Q76B 2KUTA 3S7GA 4HZLB 2GJZB 4UIMB 2NNAB 4NRXB 4YDJA 1RJYA 5HHMB 1CDUA 5DQ9A 2H2PD 2H9GA 2PTTA 2AABH 2Y9RT 2VDKH 5DJXA 1FP5A 3MO1A 4TUOB 4OUUA 1PQZB 5DMIL 3O4LE 1N7MH 3BHBA 4YNYB 1A6ZB 1UYWH 2BP3A 1RUAL 4HDIB 2YOCA 2X6MA 4YH6A 5DURD 3NPSC 2BC4B 4AMKH 4HLJA 5H2BB 4XPFH 3I3BA 2OXGA 3FT4A 4IOFC 4FP8L 4X7FC 1Z9SA 3OHXB 1PLGH 1J87A 3BZEB 5ANMA 2PO6A 3CSGA 3E6HB 3RVXD 3HUJB 1JPST 3GSNH 4ODTL 4HS8L 3ESVF 4K3GA 1MRFH 2FGWH 5L7XH 2OI9C 5FCUH 4PTUB 2OX5A 1W0YT 5HTSA 1H3XA 4LLAA 3SHSA 5IB4B 3JTTB 3GRWL 1N4XH 2EYSA 4GAYB 5C09E 4YXKH 4M1CD 1EXUA 3JWDH 1MUJA 1S7TB 4LLDB 3WXWL 2Q86A 3BRGC 1VADB 2AJZA 2OMNA 2EYTB 4M9OA 4CW1B 3HMWL 5GGQH 1VACB 5E6IA 1AGCA 4ZPTB 3TF7C 1TMCB 2CUHA 1OSZA 4PJ8A 1KNOA 3KPSD 4N1EA 4ZQKB 5DJ6A 5IVNA 1T89A 2XFXB 3KYOA 4QRTA 4P3DB 3C6SB 5DRZA 2K9UA 3IXTB 3AFLA 1S9VA 4OQTH 2FX9H 1PG7L 4LSPL 5C71A 4NT6B 1K6QL 5ETUB 4UNVA 4P3CL 4KROC 4FG6D 5C86A 1F2XK 3FB7B 1FL3A 4TULL 4OD3L 3F58H 3SDXF 1AY1H 4OLUH 4X5LA 4K23H 4YFLF 1F6AA 1N2RA 4LL9A 1UH3A 4TVPE 5C0AA 4KRLB 2PF6A 3NFSL 1IKFH 1U6AL 4KRPD 4DOHE 5MEPA 3EYQC 5D72L 4U6HB 3QSKB 4UV7H 3U79A 3RGHA 4NGHL 1J88A 2OTUB 5A3IC 3O3AA 1LK3H 3DMMA 4JKPH 1U92B 5CHNB 1W72A 1S7VB 1AGEB 4V1DB 2F54B 1U8HB 3GI8L 5D7IA 1D3CA 2F19H 4R4BB 1HXMB 5FO8A 2C4XA 3ZDZF 2HFTA 4OLXH 1U8KB 5D9SA 2VAAA 5DJAA 2EKSB 3MLWL 5AZ2H 3RU8H 4NZRH 2I9TA 2APXA 2ZOKB 4JRXE 4HF5H 1S9YB 3CC5A 3MX0A 1N5YL 3U2SA 5GRVL 4S1DC 1IC5L 4ZS6C 3PP4H 3RZCA 3RUGB 2HKHL 4Z7UE 4OZIA 5E9DE 3VXPA 5T3XE 3HE7D 3O2DH 4KU1A 1E6OL 5HGGS 1JYWA 4LSRL 5LGJA 2EDOA 4LLVA 5GGRY 4NHUA 3D18A 1RK0B 5TJWK 3QQ3B 3SJVB 5JLZB 2GSIA 3BYYA 3MODL 4BH7A 2BNQB 4I2XA 1EZVY 3QNYB 3HZKA 3H9YA 2V5TA 1QFWM 1A7PL 4NNPH 1FQ9C 5KSBF 1ZHLB 2JLLA 3H9SA 5JHLH 1U3HB 2ENSA 1XGQB 2VZ1A 1SJVA 4OCSL 1C08B 2I25N 3MREA 2AV1A 4FZ8H 3TNNA 3QWRD 3AU1A 4M7ZB 1F8TH 1A6UH 1SJEA 3IETA 1CFNB 3F8UB 1U91A 5GS1B 1WV7T 3AM8C 3VCLA 5H8DA 2C1OB 2FR4A 3W39A 4DK3A 4ZNEA 1LQSR 1E27B 4OZFA 4XCEB 3MV7B 2HVKB 1UC6A 5JIHA 6FABH 5JNYB 1ORQA 2OL3H 4HD9A 3D3VA 4KI5E 4NQDB 3EYVA 1FO0B 3MRFA 5TGBB 1U58B 2JIXB 5J11B 5ITBL 5TF0A 3D39E 5GS0C 5C0IA 4AEHL 4C4KO 3QNZB 3BP6B 4XCYB 2DLFH 4HAFA 5ICZB 5IW6B 3MRDB 1A6TA 4I0PA 3C5ZA 4A2LA 2F8VA 2JCCF 4PJCB 2M2DA 4DUWA 4KKLD 3RGVA 1G7MB 5B3JE 4YHYC 1B90A 3HS0A 5BW7A 5HHNB 5HGAB 4B53A 5HD8C 3OR6B 4Z5RB 4XPBH 1S7WA 2NXZD 1BBJB 3LEYH 4WFHE 5ESVB 4O2CA 1CDBA 3M1BB 1VEOA 4P2OD 3SE9H 2CDFB 3QDGB 3ULVC 3L5HA 3WUWB 3MOAH 1QQDB 4QRPA 5D7LB 3NA4A 2EZ0D 4KQ3H 3BKMH 3GKWL 3QULB 4AJ0A 3JV4B 3CGTA 3F7VA 1AO7D 4FQXD 4ZFZB 3ECBA 5MEOB 1BEYH 2FJGB 3QDHA 1S9WA 4D3CL 5JXEA 1QHPA 2NZIA 4NM8H 4M6NL 5SWSD 2OK0L 3A67L 3EOBA 4NNXA 3RHWF 1DCLA 4GO6B 4GAGL 5DJ8A 2G2RA 4I0KA 5F7MC 3I6LE 2VE6A 1KIUA 4X5WB 4MJID 1LK2A 4LNVA 4F37K 1KJ3H 1QOKA 2IG2H 2WAHA 4Q6IC 4PRPA 1CLYH 2IPTL 3SEPA 3LOWA 2YPLB 4QT5B 2P4AB 4M5YL 1UM5H 3P11L 1OAYH 4NQVB 1UWEL 4L29B 3VWJC 3FCTA 4L5FH 4NQEE 1J1OH 1FFOB 4WENB 4PGBA 5I9QC 4LIQH 3GIZH 5I1LB 4O58H 1G7JB 4JHWL 4JY4A 4BZYA 4IOSD 3MRCB 4Z95L 2Q8AL 3MLTA 1WAAF 3RNQB 4R4NC 5CZKA 5CEXB 1GSMA 4U1HB 1B2WH 3RJDA 4KPHH 1IAMA 3OG4B 4JPKH 1CDGA 2A38A 5E9DA 2CDGB 4X6DB 5E7BA 2NY1C 4NKDA 3HG1D 3HMXL 1EERB 3JWOL 3MLVL 1D7FA 3UC0H 1YY9C