3BJLA

Loc, a lambda 1 type light-chain dimer (bence-jones protein) crystallized in ammonium sulfate
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
216
structure length
216
Chain Sequence
ESVLTQPPSASGTPGQRVTISCSGSSSNIGENSVTWYQHLSGTAPKLLIYEDNSRASGVSDRFSASKSGTSASLAISGLQPEDETDYYCAAWDDSLDVAVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LOC - LAMBDA 1 TYPE LIGHT-CHAIN DIMER
publication title Three quaternary structures for a single protein.
pubmed doi rcsb
molecule tags Immunoglobulin
total genus 41
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bjlA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bjlA01
2ZWLT 4DN4L 1AQKL 1EH9A 2WIMA 3GNML 1JYWA 1N5YL 3MLRL 4G6MH 4JFOB 3QHZL 4Z77B 4LLQA 4X0KA 5GGRY 2VH5L 4M61B 5GIRA 1U3HA 1MFCL 2BNUA 4XPTH 4XCNB 1RUQH 3RWJB 2EC8A 2YSSB 4JHWL 2AJSL 1QQDA 5TGBB 3IAQA 4HIXH 2AK4D 4AMKH 1MLBA 3FQRB 4W4NA 4L8SC 1IC1A 5DEGA 4M48L 5J56B 1QR1B 2UUDK 2YA1A 3VGBA 3CC5B 4X4XA 4S1DD 2PYFA 3QUZC 3TJEL 2GK2A 1Q1JH 3QWRA 3F5WA 4U6VH 3OB8A 4HIEB 4G6FD 3G5YA 3O45A 4KKLD 4IMLB 3MJ7A 4JPVH 3ZKQD 1JHTA 5FF6A 2NY0D 5K9QG 4CJ1A 2ICWA 3BPOB 3QA3B 1H3TA 3H0TA 1I7RA 4MA3B 5EU5B 2JELL 1MREL 4KUZH 3FB5A 1JI2A 4WHYH 3V6BR 1U3HD 2BRRH 2ZSWB 3GMRA 1A1MA 3SKJL 5L6YL 2AEIT 4LQ1A 2WZPD 3QHTC 5DJZB 1RZIB 3JWNC 1KN2H 1UACH 3GSXB 5HY9A 2P8MB 1UM5L 4IRJA 3BOVA 3NPSB 1U58B 2GCYA 3WJJC 4KKAC 2R9HC 2FNBA 1HWGB 3VD9A 1QA9A 2F5AL 1ZKAA 5BMFH 3FKUS 2A9NH 3QWRD 2HKHL 2MOVA 2PR4H 5MENB 3LRSB 2F53E 3CPLB 5E9DE 4PRIE 4LLUB 5DUPL 1ODAA 4BSWB 1KB5A 5GPRA 5GZOC 1LO3L 4LHUA 5GJSL 2BVQB 1W72H 5CWSA 2J7LA 5I76A 3X13B 1KCKA 3P30H 1YJDH 5DUBB 3JV4B 2P8LB 1NLBH 1BEYH 4JLRB 4LCUB 1JRHH 3PHSA 3PL6C 5EO1A 1YNLH 4AL8L 3QFJA 4IRJD 3QEQA 1YMMA 3LN4B 4HFUL 1J86A 4JY4B 4J3VA 3GO1H 1FDLH 3QI9C 4FN0A 4KKBC 5HYQB 4M62H 3B83A 2HN7A 2O5XL 3D85A 1A3LH 4O2FB 5EC2B 4GRLB 5FHBL 2A6IB 3QDJA 1BFVL 3FB8B 1INQB 3BP4B 4Y1AB 2W0KA 1NKOA 3IETA 1B3JA 3HCVB 4JQIH 4RAUB 1K8DA 3T3PF 1VPOL 2ZNXA 4A6YH 3C60A 1JWMB 3Q3GB 1BREA 1LP9A 4LHUD 1KIQB 1VACA 5E2TH 3DRTB 1NCWL 4M7JL 3QH3B 4M5ZL 4X5WB 3AMKA 5KVDH 4V1DB 4Z0BH 5MERA 1L7TH 2DYPB 1DVFD 4U1KA 3GIVB 2VOTA 2WBKA 1G84A 1ZV5A 3P4NB 1WIUA 1FNGB 3QFJD 2H6PB 4M1DL 2WUCH 3DMMC 3MCKA 2FATL 2X4OB 4IOIB 2RCSH 4KKNA 1NBZA 1HSBB 5BXFB 4MJ6A 3GSUA 3D85D 1INEL 3U0WL 4Y2OA 4Y4HB 3GMLA 1HKLH 3QDJD 2MPAL 4WNQA 3SGJC 5I2IB 4U1MB 5ACMA 1HSAB 1GGIH 4HIIA 5JLZA 3LRGA 5D2LB 5D7IE 4GS7C 4Y16B 3IRZA 1U8KA 4HK3N 3VMPA 5D2NB 3C60D 2WLYA 5C0FB 1Z3GL 3WBDA 3HG1A 4UIMA 1T0MB 3IFPB 4GW5A 2B5IB 2QQNH 3CZJA 4S1RL 5CD5C 3TO4A 3TC9A 1BP3B 4L4JA 3GMOA 1OP3K 5CBEA 4Q6YA 5B3JF 1BJ1H 2DQDL 5H2BB 3L5WA 4P5TC 4MJ5B 3X17A 1G6RB 4HS3A 3C2SA 3SDCA 1SVCP 2IQAB 5D1QB 1HWHB 1O5DT 4APQB 3P4OB 2OR7A 1LO5A 4NKIL 5A40E 5E2UL 2A9ML 3WS3A 2QSVA 4XP9L 5I71C 4JFEB 1XCTA 3UYRL 4EN3B 5C6TL 2GSIB 2AJ3A 4TPRH 3B9VA 1F3RB 4E41B 5HDLA 1I3VA 2NPLX 1D9KB 3HG1D 2D0GA 3BP6A 1VEPA 2DQGH 3PDDA 3BN3B 1FYTB 5I8CA 5DRXA 5FUCE 3TO4D 1KCUH 3QHFL 5IMOA 2R0WH 3NAAH 4YC2C 4CVZA 1MLCB 5I30L 5FKPB 1SHMA 4YHOH 5D6DC 3SDCD 2XNAB 3OAZK 1W0YT 3EW3B 2GEEA 3D69B 3PWNB 2NY3C 2APWA 1G9MC 4JFPA 3RL2B 4NZRL 4HX1B 5I73C 1HKFA 5D5MB 4F7PB 3JV6A 1BBJA 4UAOB 3HPJA 4HWNA 4PGJA 2HT4D 1YEGL 5B8CC 3GMMA 3P0GB 2OXHA 4F9LC 3QUZB 3KYNA 4LPVA 5KVGH 2BCKB 2XFXB 5FYLD 4NQCB 4WCYH 4K3EH 3FN9A 4MCZB 4ZXBA 1QLRA 3IJHA 2CDEB 3TA3A 4MD5A 3D5OF 4H8WL 3QUMA 2HFEA 1ZMYA 4CU8A 3C5SB 3MC0A 3WKML 3S36L 3SQOH 3PGFL 3P0YH 2XG5A 2XZAH 1EMTL 1AHWA 3VI3F 1NFDA 4TUKL 2AJUL 1JRHI 4HJJH 2OI9C 4U6YB 5CMAA 1LNUA 2BY2A 3BIBX 1QZ1A 4LASH 4LEOA 4ODSL 2YEZB 5DZNA 4ZFOA 5D9SB 1JGDB 5F7UA 2F54E 4G9FB 1DUYA 4YXHL 5L7XL 2ADIB 4WFGD 2XZCL 3UP1A 3LKQA 5GGRA 4DTGH 2RIKA 3FOLB 5F93C 5DD6B 5I18L 5SWQA 1IGYB 1FN4A 1QLEH 4KK8C 5KOVC 2HTLD 3MYZA 4NWTH 3ZDXE 1OAYL 3TA3D 5DK0B 3BEWB 1LWRA 3P77A 2Y7QA 4MXQD 1ZVSA 1J87A 2Z0BA 3UZQA 1B0RA 5IVNA 3FHQA 2FECI 3G6JE 3RVVC 3PL6B 3S5LB 2VSDA 2DBJA 3PP4H 4ORGB 1QTYT 2COQA 3V7AG 3SQBA 4OLUH 4PJGE 4N1EA 2P5WA 4QOKE 4X9IA 3QI9B 3T65A 3EO1A 3LHPL 1U8PA 2WWKO 2H2SD 3K74B 4DUVA 2AP2A 1T0NB 5AZ2H 1QEWB 4I5BB 4PGCA 2I9TB 3CDCA 5BV7H 1XIWC 5DRWA 2DOCA 2X4NA 5A16B 3V4UH 4Z7OE 4RMTA 3P11L 1NAMH 4P9HL 4JM2A 3OGCB 3I50H 2OP4L 4LKXA 3MNZA 4TSCH 5KS9A 3HZMB 1U9KA 4PJDB 1UXWB 1J1XL 1ZHNB 4JFYA 4JFOA 2D7PA 1T89A 2HFGL 1JUFB 1JPTH 3ZTJG 3HC3L 1ZTXL 1FFRA 1P4LB 3PNWB 2ENYA 5C9JA 1U8IA 2F9BT 3DMMB 4RAVB 5JW4N 1QSVA 4Y0GA 4E5XB 1D5XA 3ZYIA 2P5WD 2Z91A 4JFQA 2IANB 5ID0B 1FAIL 3U7WL 2YK1H 3BKCH 1BQSA 1K5NA 4WU7B 3NTCL 5AYUH 1FVDB 2AV7A 4FQ2L 3H6JA 1MHPL 1G7JA 1QR1A 4EUPB 3MLTA 1NJ9B 4GS7B 4BJLA 3KHOA 3U9PL 4HIEA 4S0SD 2W0LA 3TPUA 3CVHL 4ELKA 3ROOB 4JM2D 1KC5L 4PTUB 3LN5B 3UTQB 3K2UH 1OAXL 1OAUH 1HI6A 3T4AA 5KZCB 4OZGF 1YMHA 3T0EC 5HHNB 1F4YH 5E2JA 1F3JA 1R5WB 3MLZH 4P2QB 4YDIL 3O2VH 3UPRA 2EDRA 1F90H 1FJ1B 2OR8A 2ZPKL 4YDVB 5JMOC 2BXYA 5F7DB 3HUJF 1RZIA 2R29L 4QTHB 3VRLE 4EI6B 5GHWL 5I71B 3S4SG 3SGDI 2E27H 4WUKH 5T5NG 2NLJA 4HWBH 3WHXB 1I1CA 1IEBA 4MNGA 2WBJB 5HHMD 3CFDB 1ZLWH 3MV01 2IG2L 5JIPA 5AZEL 4YEFA 1CYGA 1ED3A 3VH8B 1YC7A 1PYWA 1OCWH 1VFAA 1EO7A 1ZHBB 3LKOB 3A6CL 4NCDA 3U2SB 1TVBB 4YC2B 1G7HB 5CHNB 2P8PA 2PW2B 4XMKH 5F21B 4UT9L 1PY9A 3BZ4B 3RDTC 2H26A 5B4MC 1SYSA 2VE6A 2HT3C 3ARSA 4YR6B 4CAGA 5TDOB 2MSPA 2CGRL 3BH8A 4RDQG 1FG9C 2G75A 3TT3L 4HV8A 3DUSA 3SOBH 4L8CB 3KPSB 5I8EB 2VL4A 2DLIA 2CIKA 2B8OT 2Z31C 5HYJA 4KAQL 5CGMA 4M93C 3H2WA 2F19L 5KSBB 3QIBC 4I2XE 3HFMH 3IB4A 2VR4A 1INQA 3BP4A 4FXKB 1KT2B 5A2LH 1JNJA 1FFQA 1O7VA 2GAZA 3TPKA 3TCLB 2HWZH 4NJ9L 4L4VA 1B0GB 4Z7VE 5FECA 2AXGB 3M1BA 3LQAH 4PRHE 1WT5A 3KJ4B 4NZUL 3KLAA 1ONQB 3JWDC 1YC8A 1JHLL 5DVLA 1MIMH 1KIUA 3O6MH 5C08A 2EXYD 5ISZB 4I48B 2C3VB 4W4OA 1WCQA 2V9RA 5F1IB 2MCPH 5J1AB 1FNGA 4KVCL 4R4BB 2OI9B 2DLGA 3UTPD 4MNHA 1FFNA 3MRCA 5FGSA 4NSKB 1JGVH 2LVCA 5HYJD 4CMHB 5GQBA 3QDMB 4LLAA 2ESVA 3MV9B 4PJ9C 2VLLA 5IFHL 3HAEB 3DX6B 4YHYC 3RNKB 2H8PB 1RIUL 2NR6D 4U1MA 3ILQC 1J8KA 1B2WH 4TULL 1ADQH 3ARZA 5D2NA 3FFDB 2ZG3A 4L4VD 5CIPH 5EC1A 1UCBL 2FGZA 4FZEL 3MV8B 4UT6L 5T1MB 3RZWA 2C3XA 3QQNA 3BXNB 1F2QA 4NQSB 2HAZA 2HRPL 4GG8B 4PG9A 2BVOA 5C08D 4MNQA 4ZO9A 5TPWL 4PRAA 1YJDC 4KJYB 4XI5C 5DMYA 4N0YH 4BSVB 3F12A 3NCYS 1QSEA 3VFOA 1G7MA 3CCHB 4PJFA 1V3MA 3R8BB 4OLXL 1RZFH 4OIBA 5ICZB 4WW2F 2ESVD 5HYSB 3QIWC 1JNNH 1NCTA 3EDJA 3QULA 4FFWD 1LEKA 4PJIF 3DOSA 2N1KA 1KIRA 5IBUB 4JFHD 4LVHC 3SDYL 5EZIH 1OWWA 2GSIA 1CD1B 1ZE3C 4J3UA 3MFGB 1OTSD 5C0IB 2EYRB 3T2NH 1KV3A 2EYSB 2NXZB 4L4TB 3VFWB 3VD3A 4BZ1H 4JFXB 1BPVA 4JPIA 3U0TA 2FSEA 4PJ7A 5JHDB 2KKQA 4W70A 1XGPB 3VXUE 4QF1B 4XRCB 5DD1L 2Q87A 4CN1A 5GGVL 3FZUD 3HS0B 4MNQD 4XBGA 1B0WA 2YUWA 2YZ1A 1NSNH 4Q9RH 4G6KH 1OY3B 4H88H 4U3HA 2CQVA 4O51A 4CVXB 1IE5A 5DFTA 2V17L 3IKKA 2BRQA 1CDJA 3V8OA 4ELMF 5C0JB 1QSED 1RZGB 3ZKXB 3DJ9A 2FBOJ 3D69A 3PWNA 3MSPA 4XCFL 5F6IC 1KCSL 2WAHA 4BQ9A 3DX9B 1HDMA 3O6LH 1AJ7H 4LQFH 1I9RH 4J3XA 1V7MH 5DF0A 4Q9QL 4UINL 5HVFB 3AY4A 3DUUB 3KXFA 2KQNA 3S98A 5EOTA 4NQCA 1PG7X 1WFUA 5H37G 4QRRE 4CGTA 2LU7A 4JREB 1CK0H 4TVPH 2IWGA 1NCCL 4UV4L 1I1FA 4N0CC 3NCJH 4TSAH 2OMBA 4P4KD 3T0EB 2XKNB 4KHXL 1YUHB 4M5YL 2UY6A 1M05A 2XY1A 4ONHA 5CJOH 1F5WA 5CJQH 3ISWA 2I27N 5C0AA 1QR4A 3NFPA 4YXLL 4FTVA 5TDPB 2HYMA 2EIZA 3SDAC 5IW1A 4LCWA 3CX2A 1E4JA 1H3VA 3W2DL 3ARFA 4OAWB 5T3XH 1Q9LA 3FOMA 2O26U 1B90A 3VGAC 1XGYL 2HFFB 1MQKL 3RKPA 3BW9B 2W9DL 5K9OA 3INUL 5DVOA 3AREA 4PBVC 3KXFD 4G9FA 4MJ4A 3CFEA 4PJBA 3EYFB 5EU3B 2CKBB 3JV0A 3K0WA 5HGHA 3GMQB 4OCLC 4K8RD 3UAJC 5LGHL 4N8VG 2DTMH 1P2CA 5DQ9B 1JK8B 1FG2B 2EDFA 1I9JH 4CUCA 1KB9K 1QBLH 3NH7L 2EE9A 2J12B 4YFLI 4MAUH 3NMEA 4HD9A 3T08A 2GTWB 1MFEH 2ARJQ 1OSPL 4L9LA 5F7EH 1RSFA 5C0AD 3UXFA 2G9HB 1GGUA 1IGFH 1TXKA 4FTVD 5FCSH 4EVNB 1BFOB 1ZWIB 4NFDA 1HHKB 4HH9B 3WSQH 4LCWD 1QVOB 4PLNC 3N85L 4ZPTA 1XT5A 2ZG2A 3ARFD 3BKMH 2LE9A 3SKMB 2G60H 3LEVL 4J3OC 2AJZA 4M93B 3MJ8B 1Q94B 3L7EB 3OF6A 1FYHB 1X5LA 4YX2H 3BZFB 1EHXA 1INDH 3ARED 3QIBB 3ZHKA 3K8MA 3OKMB 1T0NA 4PRPE 1X5YA 3CFKA 4F58H 3SCMB 4LSPL 1HXMB 4ZO8A 4QT5A 3OGCA 4ACPA 2AABL 4KK9D 3DLQR 4QHMA 1N6QL 4ALAL 5IFAL 5F6HI 2IBZX 4OSUH 2GW5A 4PY8I 1CDBA 4LLMA 3W39B 1FNHA 4N0UE 3SGEI 4WFEE 4FXGA 2NW3A 4E0RA 1S9KC 5I1AA 3IJSA 2FB4H 2VLKE 4DKFH 4MD4A 2BVEA 3RY5A 3DVGA 4WU5B 1FO0A 4XAWH 5IK3A 4JRXA 1MCKA 5CS7A 3OL2A 3HNTL 1J8HA 4D0CA 3ARBC 4CDHA 3BT2H 4PJ9B 2EO1A 1Y6MR 4B0MM 2HA1A 5E99L 3HMXA 5DTFA 2JKXA 3I85A 3EFFB 1QYGL 3BSZL 4M03A 2EZ0C 4QXWA 4RFOL 1R24B 3KPRA 5CEZH 1NANH 1NJ9A 3VMNA 3LEYL 5HVGB 3U46B 4JKLA 2FYYB 2P43B 4PTUA 4I0CC 4XCCL 3VRJA 2B1AH 3UTQA 4JR9L 4DQOL 4BH7B 4DKDC 4R2GC 1CU4L 1ZEAL 5BS0E 3T3PE 5HHNA 1KJ2B 43CAA 3NIDF 5EDXA 4KJQC 2O5YH 5IB5A 1MCIA 2VZUA 1G7LB 4I0PD 2NX5A 3D0LB 1E4KA 3O6FA 4UQ2A 4UU9B 4JRXD 4LAQH 4OD2B 1WBZB 5I1CL 4JY6B 1J8HD 1H3XA 1REIA 4EI6A 2ENSA 3C2AL 3DURB 3VG0H 3TJHD 1JMXA 1ZT7B 2E7LC 3FQXA 4YHNA 2K1MA 3IF1B 1XGQB 4UMGA 2EYTA 4LVHB 3KPRD 4M43H 2Z4QB 1ACYH 5I8KL 5IHZB 2VITB 3U83A 4BKLB 2NQCA 2V2WB 4MJ2A 4FQHB 1T04A 1ACZA 5H37H 4OQTH 3BPLC 3Q5TA 5IT2L 1QP1A 5F97E 1U91A 4A6YB 3PABA 2IPTH 3LKOA 4WW1B 2VQUA 1CL7L 1TVBA 3GB7B 1IC5L 4OCXL 4JB9H 3ZKMD 1LO2H 3EGSB 2CO7B 4AG4H 3BZ4A 1T21A 2NX5D 3P3YA 5I1EL 3O6FD 4RMWA 2OL3H 5GS1C 3P0VL 2R8SH 1C5BL 4B7IA 1E6OL 2P47B 1IQDA 3BISA 5B3JE 1BD2E 1TZIB 5F6IB 2D2OA 4RRPA 3BFOA 1L7IL 5DD0H 3KPSA 4X7SL 1T22A 5DGRA 5EIIB 4LLYB 3L9RB 3AS3A 5F1SA 1VGEL 1T1XA 2A0LC 1U95B 2JTDA 4K3GA 2VXTL 4HDIA 2KPNA 3K4ZA 1MWAA 1KT2A 1HILA 1UKSA 4P9ML 4U2ZA 4M1GH 3B8SA 1M6OB 3RWEB 3TCLA 4NN5C 4XB7A 4FFVD 5HI3D 2Q1EA 2NY1B 3O3EB 4MXVF 3SDDC 3BD4A 5J9PA 5MEQA 2D4DA 4MHHG 4MSWB 5C07B 1S9XA 5LXGL 1U8OB 2VXSH 5AWNH 1Q0YL 2FBJH 2XQBH 3QO0A 3NFNA 4ZSOA 5FYKD 1I1RA 1V3KA 2OMNA 3U0PA 2CLRB 4LRNH 1HHHA 4XC1H 1IGJB 2AERT 3UZEA 5J1AA 2V2TB 2WWKT 4QKXB 5ICYA 3QJFB 2UWEF 3CSGA 4YDKH 5ESAA 4NRZA 3BRFA 1I8KA 1T03L 1R5IA 3SDAB 3KPSD 1EEQA 4HSQA 3OV6A 4NKQB 4J3TA 3ZT7A 3L3IB 5L0QC 3STBA 1RY7B 4PR5B 3DX6A 4TRPH 1AQDB 3ROLB 2BNQA 4OIAA 3IFOB 3LS5H 12E8H 1N4XL 4Q0XH 1IARB 3OKNA 2CUHA 4ZODA 1JGUH 1OLZA 1Q0XH 2ICEA 1FAKT 2H32H 5IHUL 1SJEA 2HP4A 3KYAA 3VXQA 4NZTL 2DBLL 3JTSB 1RMFH 3OB0K 4NQSA 3CH8A 4J6RH 2FDBP 3GHBH 1UZ8A 3PHOA 1OPGH 1BM3L 1E4WL 5FDWA 25C8H 4C4KT 4BSVA 3HZYB 1CE6B 3B5HA 4NNPH 2BC4B 2CO6B 3GSRA 5FGBC 3NIFE 1AO7A 1PGRB 1U93B 2EDBA 5D70L 1J0IA 2FCBA 3LZFL 4FNLL 3VI3E 1LP9F 3RWHB 4P9HC 1M71A 3MR9A 1LO0H 5GSRA 3O6KH 1PKQA 3HMWH 3QCTL 2BNQD 2W0PA 3AROA 4R7NA 3Q48A 4WO4A 4NQTA 4HS6A 4HC1H 4MJIA 4AIZA 3EYVA 5ADPH 1LQSR 2J88H 2Y06H 4FG6C 3VFWA 3DO7B 4QRUB 4NUGH 1NANI 3W9EB 4Z78B 4JFXA 1D5BA 4JKKA 4PV8B 1QKZH 4JZJA 5DJCA 3S36X 1TJHL 1WZ1H 4X5XB 3ULUC 1DP0A 5DHVH 3BGFB 3HE6B 1K8IB 3I6GB 4YIQB 5GS2D 3F7QA 1AP2A 3MJ9H 5CD3B 1VEMA 3HPLA 4OZIA 1AO7D 4C57C 3L5JA 5IVXF 5C0ND 3WD5L 4ZPVB 4R0LB 5E0QA 5GRJH 4JN1H 2IPUG 1RHHB 1UWXH 1AGCA 2G2RA 4WO4D 1LDPH 3JTTB 4MJID 4CVWA 4YAQB 4PGBB 4DVBA 4D2NA 2ATKB 3MOAL 3TFKC 3U82B 3QDGD 3VRIB 4LNVA 2WQ8A 4AEHH 5T3ZH 1T6WA 3JWOH 4UQ3B 1RK0B 4MCYA 4R2GB 5EUOB 2DQIL 3WEXB 4PRBA 1A2YB 4R96A 1JP5A 2P45B 1TJIH 5IMMB 4ODUA 4NCC1 1YNTB 3X12B 3VG9C 4FRWA 4KI5D 4QCIB 1CS6A 3O3DB 3C9NA 5CP3A 5KSAA 4XP4L 5JZ7C 1D5MA 5C2BH 3C5ZA 1OTUD 5L2KE 5DO2C 1FNSH 3ESUF 1DLHA 3DYOA 4OGAC 1PDKA 3OAYK 5D6CA 4XVTH 1NDGA 3EYFA 4GAYB 4XPGL 2I9LB 4LVNC 4PV9A 3GMQA 1AD9B 3ULVF 3GJFA 3GZKA 3BPLB 5BV7B 1U6AL 5F3BB 4XZUA 5HHXH 2NNAB 1JK8A 2XKUA 1DN2A 4G6JL 1IEAB 2ADJA 1NAMB 4PJEA 4YBHA 4KGJA 3WLWD 2P44B 4NN6C 5HDQH 2J8UB 1I75A 1YPZB 1YEIH 1CBVH 1GSMA 1Q72L 3KPMB 4ZD3L 4CMMA 2YD1A 4PS4L 1BZ7B 1LE9A 1XF4B 3GSVB 1C1EH 4OZGE 4BH8A 1FVCA 4HK0B 2CK2A 4M6OH 5KSAD 4CRPA 5JXEC 1ZLUK 2HKFL 3BKJL 2ERJB 4M7LT 5CUSL 3C5ZD 2ZUQC 4YDLC 4Q74A 4Y5VC 4L3CB 1IBGL 3HB3D 3T1FB 4F7TA 5FO9B 1IAIM 1YEEH 5HD8D 4D9LL 2Q8AH 3HUJE 2VLRA 1AI1H 5JHLL 4ZDHA 4TOYL 3X11B 2EECA 4XHJC 5M95B 4NJAL 2AJVH 3AXLA 5EIQA 1NFDF 1UXSB 5D96C 3SCMA 1AQKH 4H26A 4NN5B 4DN4H 4EI5C 3GSNL 3MODL 3VE0B 4KH2A 1N5YH 3MLRH 4PLKC 4ISVA 5L8KB 3ZMRA 2VH5H 4OLWL 4RZCA 3PQYA 2M8XA 4OZHB 4G80A 3BI9X 3NA9L 2BVPA 4PGZA 4RA3A 4YGAB 5EPMB 4X6DB 4U1GB 1LEIB 4P4RA 1AD0B 4LCIL 2AJSH 1VEOA 4P23A 5H35B 2XIDA 3KR3L 1OAKH 5A2JH 1DSFL 3C08L 3EDDA 5DFWH 1DDHB 2Q86A 3D18A 3MNVB 4OF0A 1LD9B 3REWA 4XTRC 2VLRD 5ITFA 3RGVC 3EOAB 5D1XB 1QFWL 1FFOB 4ETQB 1E4XL 2L7UA 5C0BE 1UFUA 4Z7WA 4KDTA 4ZUUB 3SCMD 1OVZA 4F8TA 3U46A 3VXMB 3BP5A 4BH7A 1MREH 2GJJA 3PQYD 4UTAL 2P1YA 1W0VB 1RUMH 3V52L 1DQTA 4FABL 4XBPA 5T1LB 1W72A 2ZSVA 3EJJX 1GL4B 1HHIA 1G7LA 4P23D 1UM5H 1I9IL 5E5MB 1T5WA 4UU9A 4U49A 1U8LB 1CGUA 2BSRB 4OD2A 1WBZA 2ADGB 3CX5K 3MA7B 5I16B 4JM2F 5FYKL 2HKHH 4KMQA 5HHQA 1K4DA 5IW6A 2WANA 1U8QB 2HVKA 3IF1A 5ALBL 1IZKA 3H9SA 4I4WB 3L3JB 1FC2D 5DUPH 5AAMA 1MAKA 3EJZD 1P7QD 1LO3H 4GMTL 4IRSC 2FJFB 5GJSH 3K1DA 3DARA 4N0FA 3ZL4L 3VJ6A 3C6SB 3TBSB 4MA7L 4OM1H 4KUCD 1CXKA 2C1PB 2JK5B 5KG9B 1RVFL 4PGEB 3OXRB 4BUHA 4U7MA 4K3DH 4UILH 3CSPA 1MHEB 3PWPA 4XNUH 2QHRH 3Q6FA 2NY4B 4AL8H 1A6UL 1G7PB 4WGVB 1XH3A 4HFUH 2Z35B 4YO0B 1GIGL 5IOPA 3V5KB 3CXDL 3JXAA 2O5XH 4FQIL 5H8DA 3E6FA 1YEDA 4Y4FC 4KQ4L 1DLFH 2VDOL 5CZKA 1BFVH 3L9RA 2JE8A 3DX7A 3H9SD 5ACZA 3CU1A 2AV1B 1VPOH 1F58L 1YYMH 2D3VA 4R3SA 5A1AA 1MI5A 3L3GB 1KENH 4IS6B 4KJPC 4MQ7B 1LK2B 4UB0L 2X40A 3I6KB 3FAWA 2OTPA 2W65A 1CQYA 3MGOA 1RJCA 3HNVL 4M7JH 4PTTA 4UBDD 5CIPB 1JF1B 3IVKA 1A6VL 2AJXL 3BN9C 1BVLB 4LDLB 5AD0A 3PWPD 2N56A 4QRQB 5F8RC 4LKCB 4M1DH 3T0BA 4ZAKA 2D31B 3VG9B 1YYLH 5DMGD 1HOCA 1A7NH 1INEH 3IDUA 4UUJB 1WK0A 2C9AA 3U0WH 2IGFL 2MPAH 3O41B 3WFCL 5HHPB 4ELME 3BH9A 3IDJA 3UC0H 2PCPB 4LSVH 1QOKA 4PR5A 1AFVL 1WISA 2ZCHL 3CIQA 3CJJA 3OJDB 1K85A 5HPOA 2VR9A 1Z3GH 1MI5D 4MAYA 1BX2A 2EE2A 2MCG1 1N59B 2BZDA 2E6QA 5KOMC 2DQTL 4LVNB 4S1RH 5IG7B 3BMWA 4LNRA 3QXAA 1JZ7A 1S3KL 1LEGA 1H15B 3EDKA 1BFSA 3RWIA 5DFVC 3UJJH 2FRGP 1I1AC 5BJTA 2FJHB 4IDJL 3P40A 2WINB 3RUGA 3S97C 2BK8A 4ZAKD 1GZPB 3VWKA 4GKOA 4ZUVA 4NKIH 5E2UH 5F44A 2A9MH 2FEDD 3IDMA 1W8NA 1GC1L 2X42A 4JKPL 3VXSB 2XG4A 2CMRL 1AXSA 2GJ6E 2IPUK 3TESA 3UYRH 3CK0L 2R2EA 2ZUQB 2X09A 1DE4A 4OJFL 4Y5VB 1CGXA 2A6DA 3QJHB 4JN2B 3RY6C 3T4YB 4DVRL 4XNXL 1IT9L 3S4SB 4MAYD 5E08L 4M9OA 3FFCD 5ESQB 3O4LA 4F7MA 1G9NC 2XN9B 4KJWD 4ORZC 4F33B 4QRUA 3DVNA 4EI5B 3S88H 5INCA 1I7UB 4I3SL 1VHPA 5D7KD 4BK5A 1ZA6B 5I30H 5DMIL 3SHSA 3FONB 1K8IA 5F9JA 4YIQA 2CDGB 4PD4K 4NQDD 4HHAA 4ETYA 3VWKD 4LHUG 4ZG1A 4DWHA 3D25A 1HHJA 2VDKH 5D2LF 1NLDL 2EIBA 1KBGL 3OG4B 1RJYA 1P53A 2DRUA 5IW3A 3QNYB 4RBPH 5E8NA 1YEGH 4R0LA 2BMKB 1I8IB 4YUEL 4KXZI 1JV5B 1TVDA 5EU6E 4PGDA 3RKDD 4Z0XA 3UYPA 4PGBA 2BNRB 4HJGA 4S1SL 2DLHA 4OV5A 4NP4L 3O4LD 4RWHA 2KH2B 3RPIA 3W0WE 3AGVA 4HFWB 3OKDB 1U92B 5SWSB 4HG4J 4H8WH 15C8L 3UBXG 1B9ZA 3QUYD 1T7WA 3WKMH 5GRZA 4B5EA 3PGFH 3MRBB 1O7SA 1EMTH 4O02L 5J8OA 2AJUH 4KTDL 1WLHA 3PDOB 3J8F7 1C12B 3UJIH 1YNTA 2E7MA 3PXHA 5JDJA 4ODSH 5B38A 4KROC 8FABA 5JNYB 3BQUA 4XP6H 3K4DA 2GIYA 5DVNA 3MCLL 4OLZL 5K9QI 4XNQB 5IEKB 1WV7T 4IIQA 3H42H 4F2MA 2G5BB 1GVIA 3CVIH 1EGJH 5L7XH 3SE4A 1UKQA 2OSLB 1S9YB 2XZCH 4LSQL 4QXTB 5I18H 5HGDB 4GAYA 1OAYH 3MRFB 4OLVL 5DJ6B 2WK2A 4IRSB 2OCFD 3SN6N 1OGAE 3DXAE 3GRWL 5D7LA 4C56B 1KTLB 2PTUA 1IEAA 5E4EC 3X3FL 3DECA 4MS8C 2F8OA 5KAQG 1FV1B 5D5MF 3ESVF 3AMLA 4XGZB 2C3GA 5J0BA 1NEUA 4XWGL 4XBEL 1XF4A 4H5SB 5FDYA 1ORSA 3RVXC 2I26N 3PWVB 2IPKA 3BQUD 3NZHL 3IDYB 3QO1B 1NKRA 1CFSA 3QEHA 3NIDE 2AK4E 3LHPH 1KELH 2JIXB 4ZUWB 2OTUB 4Y4FB 3MRNB 5DS8A 5DQDL 2Y5TB 3T1FA 5HGBB 1KLUA 1P4BL 1OQOA 4JJ5A 3ZT6A 2YD8A 1Z5LA 3D0VA 4XVJL 3X11A 3P11H 4Q9CA 1X5AA 3L5IA 1UXSA 3MMEB 5D7LD 4NUJB 2XWBB 3VE0A 4HH8A 2AS5M 3RVUC 3BGMB 4U6HB 4D9QE 4F7EA 5AUMA 5EIVA 3I6LD 3CLEH 4JG1H 3QIUC 4DK6A 5KTEH 4B53A 2HFGH 1OOAA 5JR1L 3HC3H 3RL1B 1JL8A 5F1NB 4N0RA 2IH1B 3TWCH 2RFXB 4KI1A 1FAIH 4LPCA 3U7WH 4WY7H 3D48R 2BDNL 3U7YL 2Q20A 4ZTOL 4FQ2H 1MHPH 1CT8A 1F4AA 3RJQB 5FEBA 3EFDL 2JJSA 2Y4SA 3VWJB 1MJUL 1RZKH 3CMOH 3U9PH 3CVHH 5C6PB 5KW9L 2GQHA 1MHHB 4LPTA 5MP6H 5GGTL 2X05A 4JHZA 3NN8B 3V6OA 1BD2B 5FYJD 5ITBL 1GZQA 2LFGA 4KK5D 5TH2A 1I1AB 1EK3A 4YDIH 1KB5H 5CSZB 4MXVE 4XAKD 3O8XC 2Q6WB 4UDUA 2J6EA 1UEYA 2R29H 4M6ML 1YN7A 1T7VA 3QG6B 4PJ5A 2DQEL 3GMNA 1JPGB 5GHWH 4GQPH 1NGXB 2OL3B 3PJSB 4HCRL 4OCWL 1CFTB 1SMAA 1RJLB 1RUAL 4NQEE 1P69B 3DETC 1EA9C 2DTSA 5CEXB 3IDGB 4OQ1A 3PIQB 4WFFD 2UWEE 3RWDB 2IG2H 2LABA 3IU3A 4PJDF 4X9BA 3AFLA 1KJVA 2OR9H 3PHQB 1JZ4A 2FJFA 3U9UB 1H0DA 3PWLB 5E70A 2EIDA 1SEBA 3MA9L 5IWLC 1JPFA 5EUKB 3TBSA 4UT9H 4WJ5A 3ULVL 4XCEB 3WFZA 4DKEH 3U4EA 1XR9A 4G42A 1XF2A 4X6CB 1VADB 4XP5L 2Q8BH 4KDVA 1U8JB 4C55A 1MHEA 5I1JL 3X14B 3QFJE 3QEQE 5TJWK 1YMME 2CGRH 2IQ9L 2R1WB 4PJ5D 1MIEL 3CXHK 3HC0A 2NYYD 4S2SB 5GS3A 4X9FA 4OCSL 5FOBB 3V5KA 5GZND 4LCCB 2F19H 4ZFGL 2A73B 4NQXB 1FSKC 1A7OL 3BWAA 4KV5F 4Z7QE 2XYCA 3WFEL 1PEZA 4ODWB 3SO3C 4K9EC 5CEYA 4N9GB 2X1XR 2A6KA 3DV6A 1BECA 3F8UB 4PBXA 5AAWA 4U3CA 2W9LA 1JPSH 1LP9E 3B9AA 5IBTH 1Y18B 2VZOA 4LCYA 4Q7DA 4NZUH 2W0FB 3F65A 3RU8L 2V2XB 4OF5A 1X5FA 4X6EB 1AGFB 2PO6B 1JHLH 3R06B 5JW5A 5CIPA 2GITA 2H32B 1NCBL 2YC1A 3MLWL 4LPUA 2ZCKH 2X89D 3O9WC 3LKPA 3I02B 1A47A 4LKCA 4ZOEA 4X9GA 3RFZC 4ZQKA 3MV7B 1HYSD 4QYOA 3RIFF 4DZ8A 5BVJB 5T1DL 3VD4A 2WIIB 4M7KH 3G6AB 4GW4B 4X4ME 5IFHH 4G3YL 4ZUTA 4Y89A 1B4JL 1N3NB 1EVTC 1RIUH 1KN4L 2V9QA 3SJVE 1KPRA 3MRHB 1A8JH 4TULH 3U36A 1L0YA 5IVXE 4Y5XB 3MLUH 2NY6C 2WM0A 4QHKI 4AQ1B 4RX4A 3HG1E 4FZEH 4X4YB 3WJLC 1JIBA 4UT6H 2XPGB 1CICA 3E6HB 2VABB 2DWDB 1JWSB 2APXA 3SBWC 1FE8L 2HRPH 3H7LA 4RNRA 3EHBC 4K7FB 3WL9B 3VFVB 1S7QB 2H1PL 4IOFD 5E4EB 5FYLH 5TPWH 1RIHL 1BQHA 4DUWA 1NCAL 4NM4L 1DBAL 3CSYB 1PLGL 5KSBF 4JO4L 4GRMB 5DT1L 3WIHA 1Z2KA 3WDHA 1KPVB 4WHDA 4FZ8L 4P2RE 1E6JL 3OR7B 2YRLA 1FL6B 2L0DA 2FLBT 1S78C 3ARTA 2GFBB 1SEQL 4PB9L 5GS0L 1QD0A 4NQVB 3SDYH 5B39B 2CPCA 2FGWL 5IEHB 4PJAB 4RX4D 4G8IB 1CICD 2X1OA 4S10A 5F71A 5A2KH 4G8GE 4F3FB 4E42B 3EIFA 1HQRB 3GI9L 4HKXB 1MJJA 4RFEA 5GGVH 2R9HD 2XA8H 3KLSA 2YPLE 4JGMA 1UB6B 5EZJA 3BIKB 3OJMB 5E8OA 4MXWL 2VAAB 4AEEA 2V17H 3EYQC 2UYLA 4JZOB 2VZ1A 5ENWA 3ULVE 2HG5A 2V5SA 2CDGA 5JPNA 3ARXA 3DX8A 1LE5B 1SJVA 4TQEH 4NPYA 2CR6A 4L3EE 5C09B 2P24B 3D9AL 1IC7L 1ZA3B 1ULVA 4YHZH 4KMTL 5EO9B 4Z76A 3WUZA 2VKXA 4ERSL 4Q9QH 3H9ZA 3FQWA 4UINH 4LVOB 3SY0B 4ZOBA 3ZTNL 2BNRA 3D3VE 3SKOA 5FCUL 4FQPA 3UCRA 4HAFA 4D0DA 1QRNA 4UV4H 5DRZB 2N7BA 3DYPA 3V79C 2XTJC 4HF5L 1U92A 4JCMA 1BGXL 4KHXH 2OZ4L 4M5YH 2CLZB 3VFUB 3CDFA 4TVPD 5K33A 2YD2A 3WN5B 1CVSC 1YNKH 2Z92A 1XR8A 2YUZA 1NFDE 3O11A 5J12B 1EBPA 5TFSL 2Z8SA 1HCFX 2VL5A 4YXLH 5HVHC 4BUGA 5DJDB 2V7HB 1C12A 2YRZA 2VXUL 5IM7B 3VXTA 5I1KL 5KJRL 3HNSH 3MRKA 1WFTA 4X80L 1VB9A 2HLAB 1T7XA 5GSVA 3GM8A 1N64H 1Z0MA 3EJYC 5E6IA 1XGYH 3KS0H 4QXUL 4JFDE 4K94L 1MNUL 3LPFA 2B2XH 5IEKA 3GGWA 3INUH 4DN3L 4AT6B 2K9UA 4KTYA 3VXRA 2G5BA 2CR3A 3QQ9C 4EDXB 4PREA 2XZZA 2BNRD 3AM8C 5T3XD 3V0VA 3B2VL 3D39E 5LGHH 1QRND 4NOBA 4AM0A 3NH7H 5EORL 4HZLB 2DJ4A 4AENB 3V5DA 1KTLA 3TN0A 1D5ZB 5SWZA 1A6WL 3ILPB 5FHAH 5CP7B 1Q8MA 1HYRC 4GKSA 3V8CA 1PFCA 3STLB 4WRLA 1S7VB 4Z95H 5KVEL 3B43A 2CIIB 4H5SA 4M3KB 1M7XA 3T0XA 3UMTA 5ANMA 5E6ID 4WWKB 3C6LA 1U8MB 4RGND 3LEVH 4LVEA 4ZUWA 4O2EB 2YD9A 1H5BB 2OTUA 5E00A 3VXRD 2E6PA 1V3JA 1WVZA 3B6SB 5I66B 5D6DA 2V7NB 2Z93A 4HKZA 3SO3B 1WAAF 1KACB 2DM4A 1QSFB 5DJ8B 2IH3A 4LSPH 3WNMA 1CF8L 1UGNA 3L3DA 5ILTL 5DJ0A 2ED8A 2AABH 1C08B 3KPTA 5LAXB 1XZ0A 3MMEA 1L6ZA 5IFAH 1QUNA 3TN0D 1NL0H 2M2DA 5IROC 1SY6A 4U6HA 5DI8A 5SWZD 4MQXC 5M7QA 2QV2A 3HZKB 2VISA 1RQ5A 2CXKA 4TNWF 4BA8A 2IAMC 3FAXA 4NGHL 4HWZB 1F13A 3HNTH 1S9WB 3HRPA 4GOSA 3C6LD 4JRYA 5H94A 1KGCD 1EEYA 4M8VA 4L9DA 4V2BA 4F7CA 3EKCA 4JFFB 5E99H 4OKVA 3MX0A 2X4TB 3MGTA 1QYGH 2JB6A 3BSZH 4RFOH 2N4IA 3O3UN 2HJFB 3LEYH 3R1GL 2NY6B 1BQLL 3MYJB 2WUBL 1EHAA 1MHHA 3FT4A 2VIRA 4XCCH 1S9VA 5CEZD 4X99A 4JR9H 2ZKHH 1NBVH 4LRIC 1A6TB 1CU4H 4H1LH 1P1ZB 3VCLB 2XICA 1QNZH 4ZYKB 2FIRT 1G6RL 4OQTA 1X5KA 2C1OB 3BP7A 4S1DC 2GTZA 3QAZB 5FGCB 4FQQA 1QFUL 3CUPB 5IJVA 4CDGC 3HE7C 4KKLC 4LL9A 4XH2A 4NM8H 1FZKB 1NGYB 5JO5A 4JRYD 2R1XB 3C2AH 4X6BB 4PJIB 3MRIB 1EO5A 2H41A 3WYRA 2C4FU 2VLJA 2OL3A 3IKCA 1CFTA 5LQBL 3TVMA 5LGJA 5I8KH 2FD6L 2IBZY 1UB5B 5D71H 5LGKA 5MENE 1CLOL 1T7YA 1EPFA 2NY2C 3TBTB 4O5LL 3G04A 3SE9L 4GKNB 5IT2H 4YE4H 3PHQA 4NC1E 2FL5B 4PRDB 3PWLA 1U8NA 1H8NA 1CL7H 1ORQB 4YHPA 3TBYA 2HJKB 4U3XA 4J1UB 3VXNB 3QNXB 2QTEA 4EQ3A 3N50A 5I1EH 1S7XB 3EO0A 3P0VH 2EICA 1C5CL 4WUUB 1C5BH 1XIWA 2X4QA 4YDJA 5HDBF 4KZEL 1TPXB 2AW2A 2VLJD 1A1NA 4Z7WF 4G5ZL 2D7OA 5FOBA 2D03L 4OTXL 1TVHB 2P5EA 1T20A 4LCCA 5BRZA 3TVMD 3RQ3A 5FXCH 4NQXA 3S5LG 5CGTA 2PYEB 3PGCA 1CG9B 3DROA 2VXTH 4BQCA 4Y1AE 3RVVD 4PJCB 4TN9A 5FOJA 3EDEA 3FT3B 2IFFL 4JPWH 4BFIA 1CFNB 4IRJC 1N5AA 3AU1A 5JIIA 1Y18A 4J7RA 4HXAL 2YPVL 2XTJB 5DJAB 5LXGH 5EBMA 3GBLA 5KSUB 1Q0YH 4P48A 2PO6A 4V1DE 1I9EA 3THML 3GKZA 4OLYH 2H32A 3B3IB 4M02A 3IXAB 4K71C 3MXVL 1XIWD 5IVZB 5HVHB 4BM7A 4J3WA 4ODBD 4Z7UB 5IFJA 1S7SB 1DN0A 3CFCL 4L29A 4Y8DC 2P5ED 3U7AA 4HT1L 5BRZD 3SDXB 3G6AA 4D0BA 3BO8A 1A4JB 4HKBA 5CFHA 2EDYA 5D2LE 1RPQA 3QZWA 4P5KA 2VO5A 1MJ7L 4DCQA 2ICCA 4Y5XA 5D2NE 1MRFL 4CW1B 1BIIA 1W2KT 5D7SH 1EAPA 1PSKL 2XPGA 3E6HA 1CDUA 3MFFA 5DJXB 3OXSA 4HC1A 5FK9B 4GG6B 4H25A 1I8LC 2DBLH 3IXTB 4XVSL 3SKUD 1MF2L 2PO6D 2YHGA 3GSOB 4LF3B 1IAKB 1BM3H 2BSSB 1HH9B 4WEBL 4LSRH 2AI0L 1WZKA 3U4BH 4HJ0D 3G5ZA 5IMLB 5DWUL 3IFLH 5DHVA 3C60C 5L2JB 1C16A 4X8JB 4YFDB 3CLFL 5D70H 2AKRB 2H3NA 3I84A 5LKNA 1R3JB 5LBSH 3LZFH 4FNLH 3LKNA 3MJ9A 4JFEE 5TE7L 4WTXA 3J7HA 4NHCH 2DQFB 1ZANL 1SMOA 3EYSL 3QCTH 4UDTB 2R4RL 1XGTA 2OQJB 3N1FC 4A2MA 4NKMA 3WMSA 5B39A 2YN5A 3UTTD 1MUJB 4E41E 4I9WD 2ZOKA 3V4VH 3UTZB 1MRCH 5F88A 32C2B 1DUZB 3WIFA 5E8DL 5ERWA 4GLRH 1FYTE 3TNNB 3P4MB 1TJHH 3ZHDA 1ZHLB 1XF1A 4PJHB 4U1HB 3MRPB 1IAII 1AXTH 3QWQB 5GGQL 1SYVB 4L5FL 3RBGA 1T0PB 4TUOB 5TQ0L 2VAAA 4K8RH 5TDNA 3E2HB 4PP1D 3OKOA 3V4PL 1WF5A 3N9GL 2DQUL 2P42B 2VZTA 2PTTB 3TO4C 5D5ME 3OKLB 1EXUB 2EDHA 4LSUL 1EJOL 1FLRL 1CCZA 1HXYB 3MOAH 3SDCC 3AS0A 4P59L 4RRPG 4JO2H 4KVNL 5DMKB 4NQCE 4QXGL 4RISH 4M4PA 4QHUA 3BDBA 5FA4A 3FHAA 3ZSSA 5JQHC 2F53A 5E9DA 4XC3H 1X3DA 1N8ZA 4PRIA 4P5MA 2X70B 4KRPC 3O2DL 43C9B 4NKOB 5T3ZD 2AK4B 4IHOA 4KY1L 1R3KB 2HT4C 3WN5A 1Z6JT 4GMSL 4BFEA 3F7VA 1NMCB 3RWFA 1OM3L 4G6FB 5DJDA 4LFHD 3O3BB 4EOWL 1A3QA 2FIKB 2NY0B 3GHEH 4XPFH 3VFRA 5JW4M 5JOFA 4QGTA 2CJUL 1F4XL 3HRZA 2EH7L 3NBNA 2EC9U 1Q9KB 3MRMB 4LLQB 2XXMB 4X0KB 2AGJL 4AT6A 4G9FE 5GIRB 5DLML 1U3HB 1W0WB 3ULVC 4OFIA 2BNUB 4XPGH 1CDIA 5JW3H 4HWEL 4LGSB 1PY4A 4HXBL 3Q1SH 2F53D 5E9DD 4N8CL 1U6AH 4PRID 1R3LA 2CRIA 1QQDB 4RFNC 3KVQA 5CZXC 4G6JH 4Y2DC 1RK1A 3QXTA 4KWUA 1NC4A 3W11C 5DEGB 5HXMA 4BZYA 4ZD3H 3ILQD 1QG3A 3ILPA 4N5ED 3F5WB 4U0QB 1H3UA 3MUGA 4WI8A 1QACA 1DANU 3G5YB 3O45B 1G9ML 1XCQA 3MJ7B 5I9QC 4IDLA 3STLA 1JHTB 3WO4C 5FF6B 3ARRA 4ZXBC 2HKFH 3BKJH 2HTLC 1OT1A 5D1ZC 5SX5K 3TA3C 5I1LA 3RY4A 5EBLA 4CNIB 3DSNA 3TH4T 2BXZA 5JMRA 4KTEL 4WWKA 4XMPL 3H0TB 1I7RB 1HEZA 1GRWA 4MXQC 4FQJL 2PNDA 3V6FA 1H5BA 2DMCA 1RJZA 3FB5B 5JHLH 1A14L 3LKSB 4TOYH 1AHWC 2X9WA 5I66A 4NJAH 2V7NA 1FO0H 5EUOF 3GMRB 1A1MB 5D7IA 3QQ4A 3RNQA 1K3ZA 1MCPH 2B4CC 4JZNA 2D7NA 3Q6GH 5HY9B 2X4UB 4FQXC 4GH7B 4IRJB 4KFZC 2NTSP 2GCYB 4OM0H 1NC4D 3DGGA 4OLWH 4F57L 4NN7C 4WWID 4PJDE 1QA9B 1U36A 1A5FL 2BVYA 3TO2A 4LCIH 4YFEA 1WC7A 2Y07L 3HZKA 1UYWH 1P5VA 3C5JB 3MBEC 1R0AL 4ZO6A 4QEGA 3KR3H 1H3PL 4NBXB 3S34H 1KB5B 1DSFH 3ULSA 1FL5A 1S9WA 3NFSL 1CLCA 2IANE 4LHUB 1RIVH 4WWKD 5CWSB 5K59F 1GGBL 1J0JA 2VXVL 1XGUA 2VN4A 1BIHA 1UVQA 1QFWH 1ITBB 1KEGL 1DVFB 4MHHI 5EO1B 1TLKA 4HGKC 2WW8A 2J8UF 1YPZF 1YN6A 4OI8A 4KV5E 1ZT4A 4JEGB 3OPZL 1YQ2A 1IKFL 2HN7B 3D85B 3VCLA 4O2CA 4XXCA 3QDJB 3KS0J 3RX5A 4P2QE 3IETB 2MHAA 5I1GL 3ZDYF 2VLME 3HI6L 3CUPA 3JZ7A 4HEME 3V2AR 1S5HA 4JM2C 1VACB 2R1XA 4N0CD 5C70A 2OXGA 3CFBA 4ZUSA 3MRIA 3HN3A 4G7VL 5FYKH 2V5YA 4LGPB 1BMGA 5ALBH 5MERB 1U2HA 3B5TA 3ELAT 1L9NA 1T89C 4L3AA 1IGTA 5IJKA 4OZHF 2YXFA 3K46A 4YWGH 4GMTH 3TBTA 3MCKB 3CU7A 4X6DF 2C7UB 3ZL4H 1KUMA 3HI5L 4MA7H 1IILE 4MJ6B 3GSUB 3LV3A 1MAML 3VFSA 1RVFH 3GMLB 4CU6A 1MWAH 1FH5L 1PQZB 4WNQB 4PB0H 4PUBL 4HIIB 1S7XA 1A6UH 5SX4H 3I75B 4HUUA 4OLEA 5IB3A 3CD4A 4GW5B 4FQIH 5FFLA 2WNGA 1NAKH 2F74B 2ZOLA 3BPOC 4KQ4H 3KPSE 1OT2A 3TO4B 5EB9A 2VDOH 3W9DA 1NGWA 3GMOB 3DO3A 4D9RE 4JDVA 5CBEB 5DJ2A 2DDQL 5HJ3A 5TE6H 1MCLA 5KSBE 3OX8B 3L5WB 1FP5A 2PYEA 1NPUA 4WHCA 4HS3B 4HUWA 2F54A 5E7BA 2EE3A 1PKOA 3HNVH 3WS3B 1AH1A 4MDJA 3NPSC 5GGUB 2AJXH 5DJAA 1XCTB 4F37K 3U1SH 3BPCA 4KK6C 4WI7A 1RUPL 4PYGA 2AJ3B 4K94C 4LP4A 1WFNA 1CD9B 1S5IL 3LSOA 4YXKL 3G6JA 3WNPA 4LSTH 2BOCA 4BQ8A 3REVA 3HC4L 3P9LA 4AIXA 3OZ9H 3FT2A 3D2UA 2IGFH 5I8CB 4NC1C 4IJ3C 3WFCH 4NIKB 3GJEB 4PJGA 5IMOB 3QDME 5MEPB 2VMFA 1JTOA 4QOKA 3SDXA 3T8XA 4CVZB 4M00A 2PYED 2ZCHH 5J3HC 4U1IA 2CKBL 2I24N 2F54D 1MCSA 4HLZH 2EXYC 3UPCA 1YDPA 1HIMH 4EZMA 2DQTH 3L5HA 3V9FA 1DEEA 1RFDL 5I1DA 4JFPB 3R0NA 1IAMA 4WEUD 3MV8E 3CMGA 3L3OA 4R4ND 5FK9A 3MLYL 3JV6B 1BBJB 3TIEB 4GW1A 2IMNA 3HPJB 4U6XA 3IT8D 2X10A 4IDJH 1S7WA 1BWMA 3GMMB 3ES6A 2VJXA 4G6ML 1CIUA 2Z8VC 1GPOH 3KYNB 2FR4A 3A67L 3T3ME 3MACL 1CLZH 5IMLA 5I74C 4XPTL 5I9QB 1KG0B 1GC1H 3VFGH 2CMRH 2PXYA 3D2UD 5E5RB 5FM4A 3RHWF 3IJHB 2HLFC 1WT5C 3CK0H 3TA3B 4QOKD 5DD3H 4MD5B 4OJFH 4HIXL 3KPOA 5HGAA 2HFEB 4AMKL 4DVRH 4ZFFA 1MH5A 1IT9H 4KJQD 2R39A 5E08H 1AHWB 1NFDB 2ITCA 4L4TE 1KTDA 5T5FL 3UTZA 4P2OA 1E4XI 32C2A 3C8KA 4Q9BA 5CMAB 1LNUB 3V95A 3ARDA 5JHDE 3TNNA 1P84K 5DMIH 1Z9MA 1NGQL 4NN7B 1KLFA 4Y4HC 1MCBA 4FFWC 2FHFA 4PJHA 1SYVA 3DSFL 1OW0A 4FMKA 4KUZL 4TUOA 1DUYB 4Y16C 4POZC 5ID1B 1OTSC 2VDNH 5EFIB 5D2NC 3LKQB 4MLSA 2Y72A 5GGRB 1KBGH 2PXYD 5SWQB 1FN4B 3F6IA 1CLYL 1AIFA 1UACL 2B5IC 1VENA 1U0QA 1BVKB 3P77B 4YUEH 2Y7QB 1ZVSB 5GGVY 1B0RB 4XNYL 2MKLC 4JFZH 3GSQA 2HH0H 3ZE1F 2OK0H 5CJXC 1HXYA 4NP4H 5CP3H 3WO3B 2VUYA 5IR1B 4P2OD 4G6AD 1NEZB 1MCHA 3DNKA 4K3HA 3ARDD 3L7FA 3QP3A 5FB8A 5J6HA 2P5WB 3IDXH 1KJ2L 5C3TA 3T0EE 3T65B 2NZ9D 1WAAE 3VI4F 4O4YL 1U8PB 4NQUA 4O02H 1R3IL 1TDQA 4KTDH 5K9KA 2PUQT 1YJDL 2BP3A 3MRJA 1J7VR 1BEYL 4PGCB 4KQ3L 4NT6A 2L7JA 1D6VL 4FS0A 1A9BA 2OYPA 1ZS8A 1YNLL 1MCEA 4NNYA 4JM2B 5T5NF 2FIKA 3MCLH 4OLZH 5I8OH 3SPVA 4LKXB 2ZUWA 3MNZB 5KS9B 2VTFA 1K2DA 1FDLL 2AEWA 2GJZA 3MRMA 1Q9KA 1A3LL 4JFYB 4LSQH 4R4FL 3ZKND 4LEXL 3QUKB 1W0WA 4JVUA 2GUOA 2AEQL 4JQIL 5C9JB 1U8IB 1OTTD 3EOBA 2W1NA 1G0DA 1I4FA 3LN9A 2CK0L 1D5XB 4A6YL 2R2BA 3KWWA 1Y6NR 1WBXA 2Z91B 4JFQB 4Z7VA 3S8WA 2VWEE 4PRHA 1K5NB 4UAOC 2AVGA 2D7MA 2E8YA 1DQDH 2AV7B 3BUTA 3TZVA 1G7JB 3B9DA 1OB1A 3AY4C 4GXUN 4Z0BL 4GAFB 1Q9OB 2GKIA 3MLTB 4XWGH 1HHGA 4XBEH 2HVJA 5HHMB 5DURD 4RDQF 1IVLA 4MD0A 3VFTA 3TPUB 4ELKB 1J0HA 4PIRF 4QHLA 4JANA 4QNPF 3RI5K 1HI6B 1F6LL 3T4AB 4CNIA 1YMHB 3VFPA 4RMRA 3TYGL 1P4BH 4IEFB 1F3JB 1OAQL 2C3WA 3BE1H 3LKSA 3UPRB 1SJHA 2EDNA 4L8DB 1X7QA 4LARH 4ODTL 2YBRA 2X4UA 3C8DA 3GMPA 3DVIA 4PRHD 3CVHA 3N0PB 2QQNL 2HT2D 3TZVD 3PQYE 2NLJB 2AEPH 5JR1H 2CLVB 1IEBB 4MNGB 2EH8L 3AREC 4H1LB 1RZ8A 4LLDA 4YHKL 4OFYA 3C5JA 5FA3A 1BVZA 3DI3B 1ED3B 1EEZB 1JNHA 4P49A 1PYWB 5CAYB 4NO3A 2VQ1A 3S7GA 2BDNH 1VFAB 5HHOA 4ZTOH 3U7YH 1VERA 1GAFL 2HFTA 4IJ3B 4KK9C 4EDWL 1ZGLA 4NCC2 3RZCA 3E3QC 2P8PB 4FFYL 3LD8C 1KCRL 2V5MA 4K23H 1OP9A 5HDBE 3FTGA 5DC4B 4OUUB 3ORJA 1DVFA 2DJSA 2A74A 3EO9L 2H26B 5F7KC 5GGTH 1SYSB 1F3DH 2VE6B 4HS8L 4TNWK 1JCKA 2OS7A 5ITBH 3BH8B 4DOHB 2G75B 4HV8B 2DQGL 4MMZC 1T3FA 3DUSB 2CIKB 5CBAB 1KLGA 1KCUL 5HYJB 3VXUA 2QSCH 1FQ9C 3H7BA 1EZVX 2Q76B 2R0WL 3NAAL 3GJFK 1X5ZA 4PLJC 1E0OB 3MZGB 1A7RL 4OFYD 1K6QH 1G1CA 5BOPA 3DRQA 4M6MH 5BO1L 2GAZB 3K8LA 1T1YA 5I74B 5HHOD 4L4VB 4G7YH 1UA6L 1FZJA 2XQYG 5FECB 3M1BB 4YZFF 4OCWH 1RZ7L 2K7PA 5DHYA 1RUAH 1V7NL 3ARGA 1GOGA 2X4SA 4OFKA 3KLAB 3RZCD 3MREA 7CGTA 1QLFB 4XNMB 2QQKL 1AXIB 5C08B 5B38G 5ABDE 4YEEA 1I3GL 5E1AA 3U30B 1U41A 3FCTA 2YA2A 1NGZA 2ICWI 4QRRA 3P2TA 3MA9H 2C7UA 4MNHB 1FFNB 4OZ4A 3AUVA 3MRCB 1UWGL 5AG9A 3VXUD 2R23A 5CLWA 2ESVB 3TH3T 3TJHC 5C0DA 2VLLB 5J7CC 1ZHKA 4NWUH 3ETBF 5D7JA 4XP5H 2F5BL 1FC1A 2VSCA 1PQZA 3CSBA 2NTFA 2XWTB 3P0YL 1MIEH 1I85A 1G7QA 2EDLA 1MOEA 3I75A 1FNEA 2VDML 5EC1B 4OCSH 3JBG7 4RAHA 2O61A 5JXAL 3QPQD 4HJJL 3ARGD 4GUPA 4ZFGH 2F74A 4Y19B 1A7OH 1MFBL 4PG9B 3WFEH 4Z8FL 2BVOB 1WIOA 4MNQB 3OX8A 3ZKMC 5FO8A 4PRAB 2BFVH 3F12B 5GISH 4R7DB 3O6FC 5DD5L 3VFMA 4QRRD 1S7TB 1QSEB 1MCWW 4NRYA 3VFOB 1G7MB 4PJFB 1E27A 5CSBA 4OUOA 4Q6IB 5GGUA 4NZJA 4K55A 1AGDA 3MLWH 5C07E 3QULB 5C0EA 1LEKB 3D87B 5D7JD 4YBQC 3WLBA 3FRUA 4TUJA 4UNUA 1KIRB 3TF7C 3F58L 2WBJC 3RGVA 1U42A 1RZJC 3GI8L 4XHJD 3SKNA 1TNMA 5T1DH 3B9KA 5HI3C 4FFVC 3QQ3A 4FOMA 2PW1A 4JPIB 3U0TB 4MVBD 2FSEB 4G3YH 4PJ7B 3NCFB 4ODVL 4PLKD 2WMPA 1B4JH 3GJEA 4P4KB 5D72L 5MEPA 4XBGB 5KVFH 3OMZA 3P73A 4XMLL 3UBXI 1JTTA 4N90E 4O51B 3KYKL 4PRPA 1RD6A 1BOGB 5BV7L 2M26A 3FO9A 3TYFA 4GBXA 4X6CF 3SGDH 1FE8H 5BQ7B 3MUY1 1HDMB 1QBML 3V0WL 1NAML 5LWYL 3TIEA 3NCBB 1FL3B 1RIHH 2XT1B 3I50L 1NCAH 4TSCL 4NM4H 4XT1C 3RGVD 4NHUA 4N0UA 1N0XL 1HH6A 3KXFB 5EOTB 1E6JH 5HVWA 1JPTL 3B9KD 1AGBA 2EXWC 1KG0A 3BEVA 1I1FB 3KDMA 3BD3A 3BDYH 4XPAL 3GFUA 3KJ4C 1SEQH 5GS0H 3BPNC 4YHMH 2YK1L 1M05B 2MTPA 1OD7A 3VGEA 4ONHB 5AYUL 4JY5H 1ZSDA 1P84J 4PRPD 5CGYD 2X1PA 5C0AB 5JUEH 3NFPB 4FTVB 3GI9H 4GBXD 1R3HA 3IGAA 5IB1A 2EIZB 5F3HA 5IW1B 4LCWB 2ADFH 4M6AA 2DWEA 3ARFB 4CMHC 1Q9LB 3FOMB 1N7MH 4MXWH 5K9OB 5BS0A 1F4YL 1MCOH 4WFED 2NMSA 1SM3L 3AREB 1MELA 3CFEB 4PJBB 2HTKC 5ID1A 5LG1A 1T2JA 3O2VL 1IGCL 5EFIA 5HGHB 1IC7H 4MZ2A 1F90L 4Z7NF 3MRLA 1P2CB 2KZWA 5FV2A 5E1HB 1BVKA 3FO2A 2E27L 4WUKL 3LD8B 1A64A 3LQMA 4L9LB 4LSDA 3PWJA 5FCUH 1X4XA 5IUSA 2G5RA 2YPKB 4OZFA 2WP3O 5IR1A 3JV5A 1NEZA 4JDTH 4HF5H 3X3GL 1BGXH 2OZ4H 5C0NC 5GJTL 4ZPTB 1OCWL 2A77H 1OD9A 4D8PA 4XCYA 5EUOE 1ZOXA 2AJZB 2XI9A 3MQIA 5BS0D 1DCLA 2FX7H 4LU5L 4WO4C 1T1ZA 4XMKL 3ALPA 2VXUH 3RGHA 3HHRB 3CFKB 5KJRH 3LMJL 4KJPD 2NXZC 3EOYG 4W6WB 4X80H 1MJ8L 4D94A 4PJAF 3WFBL 1R5VA 4GRWH 1Z9OA 3EAKA 4QT5B 3TV3H 1IQWL 4JZJC 2X41A 1J1OL 4GAGH 1KCVL 4QHMB 1MAJA 1WWAX 4DN3H 3BN9D 1FRGL 3QBTB 4LLMB 5L9DL 4IBLT 3B2VH 4FXGB 1TFHA 3TT1H 2NW3B 4E0RB 3HFML 3QUKA 5I1AB 3IJSB 3L3HA 4PJ8A 5K59E 4I0PB 4MD4B 5KN5A 1JBJA 2XZQL 4JM4L 3ZKXC 3DVGB 4KI5C 4C83B 1FO0B 3TBWA 5IK3B 4JRXB 4R6UA 3WIIL 3ULUL 3M8OL 1J8HB 3G5XA 3M17A 4C4KO 4D0CB 1F6AA 1KFAL 3PXJA 3GIZL 3TNMA 5HGGS 1AY1L 1A6WH 3KYOB 5MI0C 1XEDA 3I6LE 1I3RA 5EA0L 2JJVA 5DTFB 2J8UE 1YPZE 2VDQL 1MIML 3KPRB 1Q9OA 5C1MB 1FIGH 4WI6A 1GH7A 5FYJH 2V6HA 1DBJH 1CWVA 2XWJA 4JREC 5FIEA 1BQHG 1J1PH 3PG2A 5F8QC 3VRJB 1LK3H 3HKFA 5EOQH 4K2UH 1JGVL 3ZDYE 2LAGB 2XKSA 4YHIA 5B21A 3TEUA 2ITDA 43CAB 5IB5B 1GOFA 4PJ8D 3DTXA 4HBCL 1CF8H 1UH2A 2NX5B 4P3DA 3T0AA 1B2WL 4L8DA 3O6FB 1ADQL 4UQ2B 2P7TB 3GDBA 4K7PL 3MRDA 4NDMB 1JZ8A 1CGSL 5EWIH 5BZDA 5ADOH 3FO1A 4NC0B 4KZDL 5T1KA 5INDB 3C5ZC 1UC6A 3CH1B 3FQXB 3BAEH 4OZHE 4YHNB 3HB3C 1U8HA 2CLVA 4X6DE 5CZVH 2EYTB 1YY9D 1P9MC 4H1LA 1KF9B 1KIPA 2PKDA 2IADB 4NGHH 2JJWA 4N0YL 1T04B 2XQYK 3G08A 1EEZA 3OKEA 3FQNA 2IALA 1U91B 1X5GA 2ZUYA 2VWEC 4G8EB 3PABB 4JDZA 4WV1B 4U4BA 3NOIA 1Y0LA 1A22B 2J6EH 5GGSY 4DZBA 2YUXA 2FO4A 3KPPA 2ARJA 1T21B 1BQLH 4MA8H 4OUUA 2WUBH 1A0QH 3OG6B 3T2NL 2QEJA 2VDRL 1YY8A 2DI7A 1IQDB 4BZ1L 4POUB 1N26A 3VXME 5T1KD 1M7DA 1JNLL 1G6RH 2R2HA 1T22B 5CBAA 3LPGA 3KYMB 3ZE2F 2EE6A 4F8QA 3IDIB 2BSTA 2Q76A 1T1XB 3IU4L 1NSNL 4HDIB 4YPGA 3EBAA 1MWAB 5MHSE 1HILB 4QRSA 2H9GA 3SCMC 2EDQA 5D7IF 3WE6A 5J9PB 5MEQB 3L6FA 5LQBH 1BBDH 1S9XB 4FHBD 3BPNB 1JYXA 4U1NB 4LQFL 2FD6H 1I9RL 1QLFA 3QO0B 4XVUD 1V7ML 2VDPH 3NFNB 1JHKL 3BGAA 4XNMA 4ZSOB 1IEHA 4Y88A 5DGQA 3U0PB 5I75C 4O5LH 1HHHB 2APVA 3SGKA 1JZ2A 4XHQA 4P23C 3DIFB 2FZ3A 4JO1L 5ICYB 4QTIL 3ECBA 4NRZB 5ESAB 1I8KB 2EEAA 1R5IB 2LAAA 3HR6A 1DQJA 3ULUE 3LB6C 1TZGL 3QISA 1CR9L 4ENED 2BNQB 1C5CH 3JVGA 1LDSA 5CJOL 1CXEA 1MEXH 3OKNB 3ZHLA 2XWTA 3ZE0F 5CJQL 1VKXA 4KZEH 2Y9RT 4KDTC 2ICEB 3EJZC 3FMGH 2A1WL 5E24E 4Y4KA 4G5ZH 4FQCH 5ESVA 1SJEB 3G6DL 3VXQB 5EOCH 2C4XA 1MFAL 4Y19A 3SGEH 2CKNA 1E28A 1BF8A 4MS8D 3V7AE 5L2KA 1UZ8B 3PHOB 3U6RA 3QIUA 1DBBH 3EDFA 4M7LH 4HGWB 5FDWB 4WDIA 1H8OA 1HINL 2IFFH 7FABL 3K3QA 3PP3H 4R7DA 1N0LA 3F7YA 1MCRA 4LSSL 2FJGA 3GSRB 4HXAH 1S7TA 2YPVH 1AO7B 1KEML 2J4WL 1RURL 1NGPL 3HLAA 4Q6IA 2QQLL 3THMH 2DMKA 3BRGC 1M71B 3MR9B 5GSRB 2K3TA 1PKQB 4KHTH 1Q9WA 4R7NB 2JLLA 3MXVH 1MFEL 4WO4B 1PEWA 4HS6B 1A4KA 1ZLWK 1K4CA 4MJIB 4AIZB 5LJYH 1PZUB 3EYVB 2B1HH 2FH6A 3CFCH 4Y4KD 3QDGB 1IGFL 3LKRA 4OZGA 3U79A 4LGRB 3NCMA 4GFTB 1D5BB 1EAJA 4JVWA 1MCWM 2C3HA 4Y19D 4JZJB 5DJCB 3HR5B 3RVUD 3MRRA 3CDYA 1YA5A 1S8DA 5L2KD 4P4KA 3QIUD 2G60L 3WIHH 5EBWA 1MJ7H 3HUJA 1MRFH 1INDL 1AP2B 2DM7A 3EYOA 1PSKH 3VDBA 3O8XA 2UVFA 1YECH 3HPLB 4OZIB 1BOGA 5DQJA 2HRLA 2NY7H 4XVSH 5DMGC 5BQ7A 1NUDA 1EV2E 2BVUA 1UT9A 1AGCB 2G2RB 2RAMA 1FL3A 2Q3ZA 4HQQH 2NY5H 5MI0B 4EKXA 3MLXH 5HPMA 4X7DC 4DVBB 5DWUH 1N6UA 3DV4A 3T0VA 1VFBA 5D93C 1UWEL 1NBYA 3CLFH 5C0CB 2EDKA 4PG2C 1EFXA 1UADC 2Q7YA 2FB4L 2OJEA 4IMKA 3VI4E 2GT9A 4PJCF 4GXVL 3A6BL 2PETA 5TE7H 3VXSE 2NY1C 1ZANH 3EYSH 4XAWL 1JMZA 2R4RH 2EO9A 4MCYB 5GRUL 4PRBB 3ARPA 4R96B 5IHLB 4RSVA 3EZJB 3HI1B 3QEUA 3O8XD 2DD8H 3OHXA 3NZ8A 4ODUB 1M1SA 5IHBA 2XN9E 5C0BA 1XF3A 4RGOL 5JOEA 4KMLB 3C9NB 1WCBA 5KSAB 1D5MB 3RHWK 3I9GL 3CZFA 4Z7UF 2VN7A 4DK3A 2B1AL 3C5ZB 3R4DA 4TVPE 3IJYA 3B2UD 5TQ0H 1RAMA 2YS4A 1DLHB 3WXVL 5F9WC 4OI9A 3SDXF 3V4PH 5D6CB 1EFXD 1BJ1J 2O5YL 4F15C 1NDGB 2DQUH 4PV9B 3LEXA 4I3RH 3GJFB 1R6VA 3FQTA 1ZLVH 4XZUB 3PGDA 4XB8A 1CDHA 4EUPH 1FLRH 2ADJB 4FQLL 4GG6F 4PJEB 3PF2A 1ZLSL 2BNRE 4QXGH 3O9WA 3TIDA 4QNPE 3VWKC 3AAZA 4CMMB 1ACYL 1LE9B 5C0BD 2YPKA 4BH8B 1FVCB 4HPOL 2X7LB 4R26H 3O2DH 2ZZUT 5SWSE 4HEPG 4KY1H 2JJTA 3K7UA 4C58B 4F7TB 2IPTL 3LS4L 1T2QH 2VLRB 1UQSA 4X98B 3RKDC 4ZDHB 2LQRA 1OM3H 1LO2L 3OKKA 3AXLB 2A83A 3VGDA 1NMBL 4ODXA 4H26B 2R8SL 1F4XH 1CFVL 5IQ7L 5C92A 1HK6A 5JA9A 1NBQA 4ISVB 4G9DA 5JDSA 2AGJH 4RZCB 3PQYB 4NYLA 4O00A 2RB8A 3BGFC 4G80B 2BHYA 1UCTA 2BVPB 3HE6C 5DLMH 3UX9B 3QCUH 3O9WD 4WVRA 3NABH 2Y36L 2E9IA 4P4RB 2F58L 2YWZA 4PJHF 3TCXA 5I75B 5IV2A 1G9NL 4N8CH 2J5LC 3VXPA 3MLSH 4I0PA 4LLVB 1XFPA 4P23B 4WW2A 2X2YA 1CGWA 4C83A 2R15A 2J8HA 3ZO0A 3QZWG 4R0LC 1L0QA 1NMAL 4C56E 2Q86B 3D18B 5FO7A 1G7IA 1NCNA 3GSNA 5EU4B 3REWB 4S11A 5ITFB 3KYOA 1BZ9A 2VXSL 5AWNL 1FZMA 5DC9B 1G9MH 5GGSA 3L95A 1NCDH 1RUKL 2R69L 4Z7WB 4LRNL 4XC1L 2BHUA 1P7QB 1SY6H 3MROA 3O0RH 3BYTA 4KTEH 4XMPH 4OGYH 4YDKL 4ZFZA 3BP5B 4FQJH 4N8PA 5E94A 1NFIA 1IAIL 4TSBH 1A14H 4RWYL 1P4IL 3P9MA 1EBAA 2YD5A 3KPLA 3F62A 2VQTA 4ELMA 1QFPA 3QEGH 4XBPB 1W72B 2ZSVB 3FJTA 4YZFE 3LS5L 1OLLA 1HHIB 12E8L 4NRXA 5JA8B 5IQ9A 4HW6A 1T5WB 4U7SA 2P7TA 5DYOA 4NDMA 1UJTA 3BQUC 5B39G 4F57H 2ZUUA 2YA0A 5J6GB 4GKZA 3WNLA 5INDA 5FM8A 4IIQC 3W82A 3SE8L 3CH1A 5HHQB 2Y07H 2ZUXA 1K4DB 3SE4C 4G43A 5IW6B 2JB5H 2HVKB 1RHFA 1R0AH 1FPTL 3H9SB 1OPGL 2J1KA 1H3PH 1DBML 25C8L 4EEEA 2IADA 4EIGB 4H0IA 3NFSH 3WNNA 3TH2T 3HAEH 5BV7C 1GGBH 5J13C 2VXVH 4N0FB 2AXFA 3VJ6B 3VGGA 2GJ6A 4MA1B 4G8EA 4WV1A 1CIDA 1J5OL 5F7FA 4LFHG 3HMWL 5IB4A 1JGLH 2X4PA 3PWPB 3Q6FB 2UZIH 1XH3B 4HIJB 4UIKL 4OB5L 2Y06L 3OPZH 5IOPB 1IKFH 3GUTB 3E6FB 2ERJC 1YEDB 5IMKA 5C0GA 3RTQB 3KYMA 1YEKL 1WZ1L 3DX7B 3IDIA 1NUFA 5I1GH 3GBMH 5ACZB 1WGOA 2IFGA 2LU4A 2QHLA 3G9AB 5D93B 4LHJB 4R3SB 4Q97A 1MI5B 1DZBA 1JWUB 4RGMB 2W65B 4G7VH 3MGOB 1IKNA 2VLJE 2GJ6D 3W5MA 4PTTB 2AJYL 3FN0H 3IVKB 1JFQH 4KK5C 2WP3T 1X4ZA 2QADD 4LPXA 4JN1L 4U1NA 3OQ3B 4PRNA 4KKCD 5AD0B 5EU6A 4U1GC 2UUDH 4ZAKB 2BJML 3DIFA 1NC2A 4P3CL 2VRAA 3W0WA 1HOCB 2FX8L 1MAMH 5EG6C 4X6FA 5IESH 3UTSA 4WI3A 1FCGA 1C5DA 3BH9B 2EDOA 3IDJB 4YHLL 3QQ9D 3AB0B 5D1XC 4X6CE 4MYWB 5F9WB 3WFDL 1UM6L 4MAYB 1BX2B 4F15B 4ONGH 3FFCB 2HMIC 4DW2L 1A7PL 1NDMA 3V6OC 4LNRB 3QXAB 1YQVL 3MV11 1LEGB 2DDQH 3RWIB 1EHLL 5C2BL 5E03A 5IROA 5BJTB 1IM3B 2D9QB 4PJXA 2F8VA 5EU6D 1WBYA 2P4AB 1WEJH 3RUGB 2APBA 4HGWA 4F9PC 4NQDB 4BZ2H 3VWKB 4ZUVB 2KBGA 3VA2C 1Z9SA 4MQTB 1IM9A 1NC2D 3W0WD 1F2XK 2NYYC 3IDMB 1EFQA 1XF5B 1AXSB 1L9MA 3UTSD 1OGAA 3DXAA 5GZNC 3T0WA 2R2EB 2ZJSL 1DE4B 4P57A 4H0HB 1P6AB 5A2FA 2A6DB 4ZMAT 4YXKH 1NCUA 3N1GC 3WKNA 5TE4L 3MUZ1 3O4LB 4URTB 4F7MB 1UEMA 3MV7E 3ARWA 3QDGA 3S37L 3BRDA 3DBXA 3DVNB 3WUWB 4PP2A 6FABL 5INCB 1UG9A 4M6OL 5DEFB 1J05B 1X5HA 2MMXA 3HR5A 4PLOB 3QUYB 1P5UA 4RMQA 3LQAC 5F9JB 5ELIA 4Z7NE 1UH3A 3GKWH 4HHAB 1M4KA 3AS2A 1RFDH 1IM9D 2NY4C 3D25B 3EUUA 1A9EA 2J5LB 3B5GA 4YK4C 5IGXL 1FZOA 1KPUA 1HHJB 4JO3H 1GGYA 2AJVL 4S1QL 1SVZA 1YEJL 1N6VA 3MLYH 1T4KA 5TQ2H 2R0ZL 5IKCA 1RJYB 1OGAD 3DXAD 4U0RC 4U1LB 1JN6A 5E8NB 3ARYA 4H20H 5KAQF 4C59B 1WWCA 4PGDB 4NO0A 4Z0XB 3A67H 4HJGB 3MACH 4OV5B 4PY7A 3DVFA 1JGEA 4P99A 3RPKA 2DQCL 3IDNA 3F7PC 5C0CA 1MPAL 3RPIB 4HUXA 2CH8A 4UT7L 4WHTA 1GOHA 4MWFA 2IC2A 1OAKL 3LQZB 3BHBA 2AAVA 4P46B 1NH6A 5KSVA 4HGMA 2MFNA 4OCYL 4OT1H 4IOFC 4K9EL 1BLNA 5F7LB 4PJAE 4HG4K 2QR0A 4WFHE 5T5FH 2GHWB 1IAOA 3HE7D 3HI1A 2I5YH 3E1F1 3KJ6L 3JWDH 5B38B 2NW2A 1DQQB 8FABB 3DPBA 1HNFA 3BQUB 3QNZA 1NGQH 3CAFA 5T3ZE 4WIQA 2R1YA 4D9QD 2YKLL 3U4AA 2DMBA 5F6HJ 4IIQB 4F2MB 4K07A 4NO0D 3DSFH 3KNBA 4PY8J 5EOCJ 3QUXA 3MXWH 1OP3H 4ONOA 1RUML 1TTFA 3F6LA 2NY2D 5C0CD 3WNKA 1CLYH 1CICC 1DBKL 5C09E 3TP4A 3HZVA 1PG7H 2YZ8A 1XGRB 5J13B 4M4RA 5D7LB 2A6JA 4XNYH 5C7XL 3BD5A 3RWCB 3PDGA 4GRWB 4JGJA 5FKAA 4NQEA 3ABZA 3EZ8A 1A6PA 3QG7L 4ZTPL 3VXOA 2UWEA 4J3SA 3STZA 1ORSB 2IPKB 2X7LA 4QHNA 1CFSB 2BERA 1KJ2H 3QEHB 35C8L 5EU7E 4O4YH 1R3IH 5B3NA 4AZ8A 4YGVA 1KYOJ 1YEHL 4OM1L 5DS8B 4BELD 1UJ3A 1TITA 3GRWA 3QUXD 1KLUB 3Q5YA 4KQ3H 3BX7C 1CZ8L 1UENA 4JJ5B 4HULB 3BUYA 4X98A 4K3DL 1Z5LB 3D0VB 1D6VH 4UILL 2NY5C 5DXWA 4Y5YA 4DKAA 5C2UB 4XNUL 1A3RL 2QHRL 3OAZH 5DMJB 4NO5A 2V5TA 4EBQH 3V6ZA 2YD6A 1WUNT 5IB2A 1T5XA 4OF7A 3OKYA 1I8LA 3GNMH 3H8NA 5HDOA 2J3SA 4JQXA 4R4FH 4NQED 4F7EB 2PTVA 3QHZH 5AUMB 1D6EA 5IF0A 1DLFL 4LEXH 1MFCH 2A2QT 4K7PX 3UBXA 2AEQH 5HBBA 5EO0A 3VDAA 4JHWH 1KJ3L 1YYML 2CK0H 4LLVA 4KPHL 3B8YA 1KENL 4RIRA 1A6ZB 1UWXK 3WS6A 2XY2A 4M48H 1CT8B 4HMDA 2GY7B 5EN2A 1DL7L 3KPNA 5EU4A 3TJEH 2OM5A 4CU7A 4CN6A 1JZ3A 3QEQD 1YMMD 5IIEA 1YZZA 3ZE2E 1P7QA 2GK0A 4MDIB 4X7CC 3L3KA 1YYLL 3TBVA 3TYGH 1A7NL 1GZQB 2JELH 4X4MA 5TH2B 4M8QA 1RULL 1OAQH 4HBQA 1BJMA 3T09A 3SJVA 4M3JA 5EZLA 3SKJH 3UC0L 4LSVL 5L6YH 5FV1L 5IVXA 1QSFE 4ODTH 4AH2A 1I7TA 4UDUB 1YN7B 3MCG1 4PJ5B 3GMNB 1NFKA 4HPYL 3RAJL 2HJLB 2Y6SD 3Q0HA 4XXDA 5E6IC 2UZXB 4KXZH 4RGNC 5GGTA 1F45A 5J6GA 2F5AH 4OGXL 1Z0NA 4JAMA 2EH8H 3UJJL 4YHKH 3V7MA 5JORB 5KS9F 2YUVA 3IU3B 4BYHA 1KJVB 4TTGA 1PX4A 1TCMA 1PJ9A 2R2CA 3K4AA 2FX9L 1GAFH 2QL1A 1H0DB 4P2RA 3UYOD 1SEBB 4EDWH 2PF6A 2EDEA 4FFYH 1JPFB 1KCRH 4JFFE 3TN0C 4WJ5B 3SJVD 3ZE0E 3H9HA 1JF6A 1MRDL 4HCRA 4I13B 3FRPA 1B88A 3EO9H 3U4EB 1XR9B 4G42B 1XF2B 3MRGA 1MHCB 4HS8H 3AVEA 5E2VL 1IZJA 4YK4B 4OFPA 3HC0B 4QWWD 5IP4A 4BFGA 4HIJA 1OP5K 2D0HA 3IDYC 4NO2A 4G8GA 3C6LC 4OKDA 3CFJA 3RX7A 1BFTA 1WZMA 4U0RB 3GUTA 3ZKSD 5DRNA 3T77A 3S88L 1AKJA 4Z18A 1CI5A 2YPLA 3BWAB 5FHBH 3RTQA 1A7RH 3AS1A 1J0ZA 5F96L 5FGCE 5BO1H 5CEYB 2A6KB 1A6AB 3DV6B 2CRMA 5L88L 1UA6H 1RZ7H 4P2RD 4LCYB 4L3EA 1V7NH 1JWUA 2VDKL 4KRPD 4PJIE 1NCWH 5ETUA 1F8TL 3FL7A 4Y2DA 3OGOE 4M5ZH 3SE3C 5JW5B 4HMCA 4L8SB 2ID5A 2GITB 2QQKH 2YC1B 3QPXL 3I2CL 2QKIA 1I3GH 3LKPB 1YEFL 2Y23A 2YD3A 2VZ3A 2H2PC 4FQ1L 3D3VA 3MUHL 3FB6A 5AG8A 1EJ6A 4ZQKB 2FATH 4XWOC 4LOUC 4QYOB 1UWGH 2ATPA 4G8GD 2X44D 3WHE0 4DZ8B 2I07A 3S3PA 5D1ZA 2VYRE 1NUGA 1A1OA 1DFBL 3L1OL 1AKJD 5I17A 2YPLD 4HUVB 4ZUTB 3RTQD 2F5BH 3NIFF 4G8FA 1KPRB 3I3BA 2XRAL 3VWJC 3U36B 3ARQA 3C87A 2NXYD 5E5UB 3ULVD 1VFUA 5HI4C 2VDMH 4WUUE 1TCRA 2EDWA 5JXAH 4L3ED 1CICB 3UJIL 4FQXA 3FFCA 4M6NL 3I3EA 5CZXD 5HHVL 4Y2DD 4Q2ZB 5I0ZA 2DKMA 1MFBH 2I60L 1WJ3A 4RNRB 1CE1L 4Z8FH 3W11D 2BOBA 2WWMC 4XP6L 2DQDH 3ZZ1A 3IFNL 2PYEE 4JFDA 1QPXA 1BQHB 1IM3A 3H42L 4I18A 1EZVY 4PJCE 3CVIL 5C8JA 1EGJL 5DD5H 3D3VD 1G0YR 3MBEA 4NQDA 3D39A 1OF2A 2AQ1A 4ONFL 4O58L 1S7UA 4ZXBD 4XP9H 5JIHA 5D1ZD 1IL1A 1J9CT 1XF5A 2XTJE 1URLA 2JCCA 1CN4A 3RVTC 4UOW0 5E8EA 3TVMC 5BVPL 3F58H 5C6TH 3GI8H 5BZWB 3G9VA 4Z7UE 4FQXD 5DK2B 1T2XA 4ODVH 1HQ4A 4JKWA 1MJJB 2FWOA 3QHFH 4RFEB 4HUNB 3WUWA 5D72H 3SDXE 5DEFA 1J05A 3MOBL 1HZHL 4JFDD 5EZJB 1KELL 3F7RA 4XMLH 2W60A 5E8OB 3QUYA 3RJDA 2P49B 3KYKH 2GSGA 1TQBC 2UYLB 3NGBC 5ENWB 2HG5B 5JPNB 3MBED 4NNXA 3D39D 3WHE1 3DX8B 4J4PA 4TTDD 5ICXA 1T1WA 5J1SC 4NPYB 1C7TA 5EZOL 1QBMH 3V0WH 4NZRH 4GG6E 5LWYH 4Z76B 5C6WH 4U1LA 4LCCC 3FQWB 5CILL 4XP1L 4Z77A 1N0XH 2QJDA 1EO8L 3CLEL 4JG1L 4M61A 5KTEL 4OV6F 3SKOB 4XCNA 4IOSD 4D0DB 3RWJA 1QRNB 2YSSA 5CCKL 4XPAH 3TWCL 1FFPB 4JQVA 5TGBA 3UDWC 2WQRA 3LQZA 4WY7L 2KDGA 2PO6C 3FQRA 4PJFF 4P46A 2E3VA 3S36H 2Z92B 3O4OC 5JOPE 1XR8B 3CC5A 3O11B 4TUKH 5GS0D 2C4FT 1GXEA 3TLRA 2VL5B 4HJ0C 4J4PD 1RZKL 3CMOL 4K3JL 3VXTB 4IMLA 4BSJA 1TENA 3MRKB 5MP6L 3N1QC 4UOW1 1DQQA 5GSVB 5K93A 2DI8A 5I1IL 4FXLA 5E6IB 3QA3A 3VMOA 3RIAF 4RGNB 4POYA 4PJHE 5EH1A 4R90L 5A43C 4MA3A 5EU5A 3GGWB 1SM3H 2OZ4A 3ET9F 4PJ7F 1II4E 3VXRB 4P5TB 4YXHH 4PREB 1J88A 2ZSWA 3V0VB 4Y5XC 5GRWA 1IGCH 1K9TA 1KB5L 1JZ6A 2RJMA 5DJZA 4M1CD 3GSXA 4AEIL 2P8MA 4AM0B 1U58A 1XGRA 4P46D 4H0GA 3V5DB 4BK4A 3TN0B