3BJLA

Loc, a lambda 1 type light-chain dimer (bence-jones protein) crystallized in ammonium sulfate
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
216
structure length
216
Chain Sequence
ESVLTQPPSASGTPGQRVTISCSGSSSNIGENSVTWYQHLSGTAPKLLIYEDNSRASGVSDRFSASKSGTSASLAISGLQPEDETDYYCAAWDDSLDVAVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords LOC - LAMBDA 1 TYPE LIGHT-CHAIN DIMER
publication title Three quaternary structures for a single protein.
pubmed doi rcsb
total genus 41
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bjlA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bjlA01
3FQNA 3O9WA 1X7QA 3VXMB 1X4YA 3O2VL 4FFWC 5L7XL 1T1YB 1PAMA 2A83A 1EVTC 4FQJH 1Q9LB 1WUNT 4YBLB 5F96L 1S7UA 2FB4H 2K1MA 3G6JB 2NY7H 1INDL 4JFPA 1LO5A 4NQCA 2VN4A 5EO0B 5J6GB 5CZVH 5KVFH 1GZPA 3B5HA 2Y7QA 1XF2A 1ZLWH 4RNRA 4F7MB 3OV6A 4X0KA 3G9VA 1JK8A 1NFDB 1AD0B 4ELKB 2BMKB 3BEVA 3QEQD 1XR8A 2IQ9H 1B3JA 4CKVX 2CDGB 3MUGA 2AEPH 2I26N 1WK0A 2FLBT 1BOYA 4J3VA 4Z7VB 5A43C 4BH8A 3I2CH 5KJRL 1K4CB 1WT5C 4XVSL 3WFCL 3ZL4L 3ARXA 2DM7A 2DJSA 1OD7A 4ODUA 4BK4A 3RZCB 1DVFC 4PJEB 1J87A 4KMTH 3QYCA 5DD6B 3WS6C 5T3XE 1IFHL 1WZKA 2ESVB 1N3NB 4GMTL 4YHOH 1AXSA 4Y2DC 3JV0A 1W0VA 2EECA 2JIXD 1YEIL 4PRAA 2APVA 5TDNB 4LK4A 2P8PB 3CH8A 1QR4A 1BP3B 2WWMD 3P9LA 2Y23A 3VXRE 4HGMA 2AK4B 2FZ3A 2J8UF 2E7MA 1S7WB 1HYSD 2QHRH 3MLZH 3M8OL 4PV9B 4PV8B 4OV6F 4X6BB 1I8KB 2ICWA 4PRHB 1P4LB 1ND0A 1ROWA 3G5YB 3LMJL 3EOYG 1G0DA 3JVGC 1CYGA 5EZLB 5HVHC 2PO6B 3QO0A 5FO8A 1G6RB 1ZLSL 2ZCLL 1DQDH 2W65A 5DJ8B 3NFSL 1KJ3L 3B2UD 2E6QA 4LPTA 3RNQA 5D6DA 5AWNL 2AEWA 4LVNC 4TTDC 4YPGA 5F88A 4QRSA 3QQ9C 2YPKB 3ARED 4JDTL 1P84K 1REIA 4S2SB 4XNUH 4AIZA 3BP4A 3L3KA 5IVXB 4S10A 3AM8A 1S7SB 3SKJH 3SE8H 1YEHL 5DQ9B 4Q9QL 4XPBL 3C8KA 1VA9A 4UIKH 3P11H 5HGGS 3TIDB 1OARL 2XTJB 4H1LH 1ZT1A 2GTWA 4JQXC 1PSKL 2AEQL 3MSPA 1A7BA 2VABA 3PP4H 3CLFL 3JV6A 3MRCB 4G6MH 4HV8A 3DHJA 4PJ5D 4F7EA 4N9OB 3FQXA 4JY4B 2HVKB 4LLYB 1G0YR 1CG9A 3WE6A 3OKOB 5BS0A 2N56A 4OFPA 2O5YH 5AG8A 2QBWA 4K2UH 1LO4H 2V7HA 1RJZB 2Y36L 4UTAL 4X99B 4YK4C 4PJAE 1FLRH 1HXMB 1UM5L 4NQEB 5GRZA 3MLRL 3RY6A 1FVDB 3WJLC 2H32H 1SY6H 4XHJD 1UENA 4KVCL 1FFPA 2W0LA 5I9QB 4APQD 4XC1L 4FQCL 3VWKC 4G8FB 2PUQT 2EXWD 2OJEA 2EZ0D 3DX7A 4YEFA 4G8EA 1A7NH 5KSAC 1M7DA 1T6WA 3ZDXE 2VIRB 1C7TA 3RUGF 4PJEE 1A7OL 1J7VR 32C2B 5ITBL 4A6YL 4DUWA 2V5MA 3V6ZB 1UACL 3V4VL 1S78D 3WIHL 4S11A 2MKLC 2VLKE 3CC5A 1OB1A 4OCRH 2CKBA 3LKQA 4K7PL 4DOHE 5HYJE 2E7BA 4PJDE 4RGNC 1A4JB 2BHZA 4TVPD 1CIDA 4ZUWA 1T0MA 1XF5B 1DL7L 2ZG2A 3QUXB 1TJHH 3MACL 3TBTB 1XCQB 4HKXB 3S36X 3FFCA 1U93B 1EVUA 3RWCA 2X10A 1K4DA 4QHLA 2HJKB 1R3KB 4OUUA 4U1KB 4Z0XB 4I4WB 3U48A 2CR6A 3ZT6A 4CMMA 3MBXL 3VH8B 5FHBL 3PL6A 1LEKA 3U4EA 1V3KA 4I9WD 4Q58C 4I0PB 4XX1E 4Q2ZB 2IH3B 3QIWC 1MIMH 2GQHA 3BX7C 3RP1A 1EEZB 4RGMC 1GIGH 1H8NA 1RUKL 1W0WA 3C08H 4XVUD 4MJIE 4Y1AE 2EE9A 1FRGL 4OLWL 3ZTNL 4C83A 2JTDA 12E8L 3RGVA 5IB2A 3MA7A 3RBSA 2DQIL 3NIDF 2I9TA 1Y18A 3CFCL 3BIKA 3U36B 5I1KH 1ZAGA 5EOQL 4EUPG 1T5WA 3PWVA 1XGYH 3O6MH 4QOKE 3DYPA 4HXAL 3OTTA 4P9HC 5SWQA 1CGVA 2VZSA 4QT5B 4NRXA 3QEHB 3MMEA 5T3ZL 4F9PC 2VR9A 3NA4A 3O6FB 3X12B 1G6RH 3HG1D 3P77A 1RSFA 2YD2A 1NCDL 1FQ9C 1CD8A 4W4NA 3EHBD 5JMOC 4ZNEE 1NGXB 3C5ZD 1PYWB 4Y2OA 1XZ0B 5DEGA 2ZUTA 3WKML 3O3DA 1MREH 3K1DA 1ZLVK 3TJHC 3E8UL 4L8BB 1IM9D 4JKPL 3RAJL 3DGCR 4HKJB 4XPHL 5C0AD 2VUOA 1KJ2B 1UZ6F 3PGDB 5HVWA 5L8JB 1KV3A 3ARBC 4PRNB 4KZDH 4YGVB 3GSVA 4KI5C 2APWA 4G8GE 3K8KA 4Y7MA 4GBXC 3QWOB 3CFEA 1A7PL 1U58B 1BLNA 4RBPH 2YPVL 1F6FB 3G5XA 1HKFA 4XTRC 4E42A 5HHOD 2DS4A 4DVRH 1GGBH 1G7QA 1JNHB 2A6IB 1JWUA 5ICXB 5IFHH 1NGWA 1LWRA 5DC9B 2EDBA 4M5ZH 3Q6GH 1CLCA 3BRGC 2W92A 4WI9A 2XA8H 4P0DA 3QUZB 4JB9H 4F58H 1WQVT 1I1AA 4JFYA 4ZS7L 4JPKH 1FE8H 2UUDH 2Z0BA 3H3KA 5AYUH 3MBEB 4LEOA 1ACYL 5MEQA 1W2KT 3I3DA 4WNQA 2LU4A 3QDMB 3F7YA 3C60D 3FB7B 3DRQA 5F3BB 1U8NA 1KPRA 1KT2A 1AGCB 2X4OB 2IBGA 3WHXA 1N6QL 4KKAD 4PGJA 5DJ2B 5GJTL 4JDZB 2OR9H 5K59F 4PGEB 3WFHB 5IG7A 3BP6A 3WD5H 4IRSB 2H26B 5CJQH 3GJEB 5BCAA 3O3EA 5DUML 4FTVE 4Z77B 2VDLH 5KSBE 2RAMA 2VMFA 2YRZA 2IH1A 4GKZA 4HWEH 5BV7L 5I75B 3CCHB 4HX1B 4KKLD 4M7ZC 1HHKB 3DV4B 4PD4J 1M05B 2VWEC 1C12B 3KPRA 4ODHH 4V2BA 5I1LB 1JNJA 5T3XD 3QIUC 5EU3A 5HHMB 1IARB 3SJVB 2XKUA 1ZV5A 2X1OA 5JIPA 1DUYA 4X6DB 1NAKL 1F97A 2VDQL 1H5BB 1TDQA 4JN1H 3EGSB 5CJOL 4G8IA 1ORQA 2UWEB 1JYXA 1CICC 5DMIL 4YJZL 1MCCA 5KN5A 3A6OA 1MJ7L 4IMLB 4H8WH 1RZFH 3P0VH 4JQIL 3VXRD 4FMFA 3KVQA 3VXOA 3TWCL 4PRID 3MJ9A 2A1WL 4JO3H 2VLJA 1H0DB 1QSFB 1F4WH 3OGCA 2O61A 1A6VH 2UYLA 5E4EB 3OPZL 1DQQA 4K3EH 3D6GA 2OLDA 3HZMB 1HIMH 1PG7X 3QQ3B 4FFZL 1FVCA 4PB0H 5JXAH 5D1XD 3RVWC 4OGAC 3PG2A 2AXGB 3EAKA 1Q0YL 4ELMA 4WU7A 5DVMA 5TE4L 1UEMA 1IZKA 1NBZA 5JUEH 2HWZH 1S8DA 3RHWF 4TNWK 1FG2A 3OL2A 1R5WB 2G75B 3ZKXB 3OGOE 1LEGB 1MCKA 3CMGA 1MELA 2FDBP 3O11A 4XHQA 3G6AA 1HH9B 1EERB 1CT8A 1DQLH 4KXZI 5I1IH 5D9SB 4KJYA 2DBLL 3RU8L 4J7RA 3RTQD 3RPIA 1LE5B 2GIYA 3HC0B 3QNXB 3VXMD 4WTWA 1I1CA 5IQ7H 2YD1A 3LDBC 1KJ2H 3WNMA 5EU6B 4KUCD 4HKZA 2Z31A 2JCCF 1SJEB 2CXGA 2H3NA 4KZEH 3T2NH 3BGFC 5DI8B 3VGBA 1JTOA 4Z7QE 1P53A 1WSST 1BIIA 1T66C 4LIQE 4JRYE 3HPJB 1NCCL 4ZOCA 4KJPD 1DBBL 3DARA 4XZUB 3RKDC 3IDYC 3BKML 1C16B 5IHLB 2D4DA 4JY6A 2GJ6A 3OX8A 3MQIA 3RZCD 1HN1A 2XPGA 2DTML 1WITA 1R3HB 2BERA 1FL6A 4GW4A 1Y0LB 2XV6B 2PYEE 1B6DA 4GJTB 3MRGA 2FH8A 1BM3L 2VLKD 4F15B 3QCTH 4JPVH 5HYJD 1TPXC 2W59A 4I2XA 1OAYL 3IGAB 3ALWA 3VXUB 1A6AB 1XGRA 1AKJB 2YUWA 5C0DB 4OT1L 3O2DA 1UYWH 1KN2H 4G43B 2EDNA 3IU3A 1MWAA 4P2RE 3U2SB 5KZCD 3KNBA 2XZAL 3MLUL 3ZHDA 3GDBA 2L4OA 4NRZA 3D0VA 4RGNE 2BY3A 1AGEA 3DURA 1T2QH 1NMCC 3SGEH 3QR2A 1Q9KA 4JG1H 1CFVL 2EDQA 3HAEB 3MREB 3HI1A 3TBWB 3GHBH 3ZO0A 3EO0B 2BHYA 4JFOA 4XB7A 1NDGB 5C0EB 1P7KB 4OBSA 1N59A 4MJID 2YS4A 4Y1AD 5IWLA 3V0WL 3FO9A 4GMSL 5E2JA 2H6PB 3FONB 4Y5XA 5FA3A 4QCIA 5GGTH 3TNMA 4YDKL 2HH0H 1R5IB 4RWYH 1FNEB 5MHSE 4X80L 4PJ8A 4QOKD 4ORGB 5FFLA 2VXSL 4ZQKA 4EN3A 5CP3H 3CFJB 1IT9H 1GAFL 2E7LA 2H1PH 4YZFE 4DTGH 4GG8A 5E2WL 1YY9D 3QUYD 4HS6B 5I1CL 5F6IB 5A2IH 1NBYB 4LSVH 1F3RB 3NIGF 4PJGB 3UJIH 2X1QA 1IAIM 1LMKA 1Z5LA 4OGXL 3O6KH 1TJGL 3MRNB 1VFUA 2R0ZH 3ULSA 1GHFL 2Y25A 4Q6IC 5EBLB 4PRPA 5C0CB 2GTZB 2C4XA 3NCCB 1TZIB 4U6XA 4XGZB 1JPTL 4F2MB 3SE9L 3F6IA 3TJEH 1TCMA 2MWCA 4OLUH 4NNYB 4TRPH 1X4ZA 1J0IA 3QXAB 3FZUC 3HR5B 1N6VA 3PIQA 5E95B 3V5DA 4D9LH 4YHZL 2X7LB 5C70A 5GSVB 3RZWA 4BUHA 5ABDE 5KG9A 1FZMB 4LF3A 5C9JA 4OZHB 4B41A 3H9SE 3F62A 4CVZA 4OM0L 2VXQH 3QNZA 3T77A 5IB3A 5EORH 2KPNA 5DUBB 4HF5H 2BSRA 3QISA 2EDLA 3IVKA 3C9NB 3GSWA 4LRNL 2Z8VC 4LARL 4HIJB 1T0PB 4I48B 2FHFA 1T89A 3MXWH 4HC1H 5E24E 5DEFB 3GBNL 4XBPB 3BQUD 1TTGA 1LO3H 1T83A 1P7QB 4ONHB 1TIUA 2E7HA 3QDGE 4R7NB 4H0IA 3B9DA 1YN6A 2QHLA 1PEZA 2AQ2A 5D2LB 5DRZA 1I9EA 2Z8RA 3MGTA 3TA3D 4C4KT 1BZ9B 2ZJSL 4HZLB 1I3GL 1D5XA 1YQVH 5ESAB 5JPMA 5AZEL 4HIIB 1RJLA 4G9FE 3ZE2F 4LPVA 3P30H 5FYKH 2R2BA 1HSAB 2ICES 2R1WA 4CN4A 5DUPL 4HIXH 1IAOA 3WFEH 1OT1A 4FTVD 3VMPA 4EI6A 2PR4L 3H2WA 2FX9H 2BFVH 4WHYH 4YHNA 3IXAA 3QUMB 2Q3ZA 1FNHA 4X4YB 43CAB 5CSGA 4L8SA 3EZ8A 4QXUL 1QO3B 5DVOA 4CU6A 2EE3A 4YE4H 5IK3A 3ECBA 3SKMB 4V2CB 4DQOL 4TNVK 3WYRA 1QFWM 2BK8A 1T1XA 3EYQC 1A1NA 5IMKA 2GSGB 4FXKB 2VWEE 4Y19B 1DVFD 3CH1A 4W68A 5JOFB 3HAEH 5J6HA 3X11B 3WIHA 4AM0A 3B9KB 3MYJA 1IL1A 4Y2DD 1QG3A 2D0HA 1OHQA 4HS8L 2XG5A 2WQRA 1ZWIA 1MCHA 2PYFB 2VNCA 4LDEB 4R26H 4OZIB 4OV5B 3B8SA 1MCLA 4RDQF 1A5FL 5CWSA 5F7YC 3SO3C 4GW5B 1SM3H 1ETZB 4U6TA 3GJFK 4WGVB 3VE0B 3VXSE 1NGQH 1S9XA 5HI4C 1LEIB 5IKCB 2XFXB 4PIRF 2HT4D 2QEJA 2HRLA 2VN7A 4M7LT 2B4CL 4CUCA 3IJYB 1OCWL 1FNFA 1Q72L 2VJXA 1XGTA 2CJUH 2YBRB 5HDOA 4JG0L 5CBAA 4ACPA 4B0MM 3C6SB 1YUHB 2V5YA 3DUSB 3QQ9D 4U3CA 4P3CH 3T09A 3AXLB 4M93B 2HKFH 4G80A 3UPRA 1I7UA 1UCTA 1IC5L 3O0RL 2FGWL 4K8RL 4Q0XH 1G7MB 3MNVB 5DGRA 5DRXA 4GXVL 4RFOH 3RWEA 1J0YA 1YEKH 2R56H 3MBED 2OX5A 1KIPA 5C2BH 4GKOA 2NX5E 2J5LB 2JJWA 4M1GH 2ILLA 1SJHA 4X9GA 5F9DC 4CN6A 3O45A 1D5ZA 1QRNB 3BVNA 2J88L 2QSCH 2F15A 2R0LH 1A2YB 3QDAA 1HNGA 1LDSA 4R90H 2IBZY 3MCKA 1AGFA 2ZOKA 5CCKH 2DYPA 2YPLE 3TBYB 4JRYD 3QXTA 3T3ME 1C5CH 5FOJA 1JPSH 4ODVL 3V7AG 3KPQA 4IRSD 1XF3A 4W4OC 1EXUA 4DEPB 4OLXL 3V4UH 1BBDH 4JFDE 2D7QA 3IDNB 3OKDB 2C3XA 2JJVA 2OQJA 2VDML 3WO3B 1MVUB 2IG2H 2BSSB 1QLRB 3IS0X 2X2YA 3MJ8A 3GKWH 1MLBB 3BYYA 3GM8A 4XCFL 3T4AB 3GGWB 4QTIL 2Q76B 3TEUA 3BWAB 4M5YL 1GCFA 3ZZ1A 3VWKD 2PYED 1UWXK 4X5XA 5JW4N 3VJ6A 4L8DA 5D7JA 4M6AA 1S7QB 1ZE3C 4BZ2L 3KLHC 4KAQH 1JGEA 4MDJA 3MNZB 5JNYB 2WBJC 1HOCA 3BZEA 4M9PA 2VDKH 1PZ5B 4DK3A 3PP3K 1FAIL 5IW1A 5JPNA 4PG2A 4OFVA 4JHWL 4MAUH 5KOMC 4NZDA 3QWRD 4QY8B 3VFOB 3P9MA 1T89C 4P2RD 4JFXA 3C5JB 3S96B 1GRWA 1X5IA 1YPZA 4PJIB 2Q8AL 5E8NB 1CVSC 5IVZB 1A1OB 1UEYA 2KBGA 3RVXC 1QSFD 2VLRB 3D3VE 4F57L 3QWQB 5J12C 5IVNA 1DN0A 4MNGE 4KK8C 3QAZB 3FO1A 1S7TA 1M7IB 3QUMH 4QRQA 5KAQF 1MHHA 1BD2B 3N1PC 5TGBA 3MJ7B 1KELH 4Y5VC 1E4XH 3ALXA 4KGJA 2ZSWA 4X5WB 5LCVL 1HWGB 3L7EB 4NKOB 1KTLA 3HZVB 4ZAKC 3GFUA 1T4KB 4G3YH 2UZXB 4IBLT 3ARDA 3QIBA 2BVOB 4C56B 4X4ME 3QIWD 3KXFA 5I74B 4N0UA 4JFEA 2P42B 2BC4A 4OKVA 3RIFF 4MQTB 1AGDA 4R97C 2SEBA 2L7JA 4OJFL 2AJSH 1FGNH 4P23A 2DQDH 5KVEH 3S9DB 4LU5L 4MD4A 3I9GH 3OF6A 1NCUA 2I27N 3IFPB 3H42L 3C5SB 2DQCH 4XNXH 5ICYA 4F37F 1EGJA 3BJLA 5CUSL 2DMKA 4ETQA 3AS2A 4D0DB 3VD7A 2EICA 1I8LA 3MRRB 4NKMB 2AJ3A 5CINH 5EOCL 4XMPH 2DD8H 5DLML 3CFDB 4IIQC 4PLNC 4WEMB 4J4PA 4J8RB 3L5XH 5D2NA 4H5SB 2HFEA 4JFFE 1CLYL 4M4PA 5J57B 2YN3A 5ALCL 3RWDB 3ROLA 3WNNA 3L3DB 1MCPH 4ZO8A 3AS1A 3SCMA 4NZRH 1FZOB 2DKMA 2BX5A 2A6KA 3INUL 1BJ1H 1YECL 3TV3L 1KCKA 3NFPA 1BQHG 5DK2A 3FQRB 1CFNA 4CDGC 3STZB 2XRAH 5CSZA 5F21B 2IFGA 3P4NB 1Q9WA 3QO1B 5F7NC 1LK2B 5SX5K 3TM6A 2BY0A 4GBXD 1WGOA 4WTXA 4F9LC 3VXUD 5ACZA 5KBNC 3MV7A 4KUCF 3T2QA 2VDPL 1AKJD 2V7NB 3G6JF 4PJAF 1TJIL 2OP4L 1PG7W 4OQTH 5GIRB 4U6YA 3BT2H 1UVQA 1CQKA 4LCYB 4U1MA 3IFLH 3QDGD 2P5WE 2ED9A 1JHKL 4PTUA 5BVJB 1VFMA 4Y88A 1A3LL 2EIZB 3PQYA 4UT7H 1NFDF 4H0HB 3PWLA 4HCRH 3IKCA 1FPTH 3ZYOA 3QH3A 5FIEA 1VEOA 1IGFL 2YD9A 4XC3H 2F74A 5HJ3B 4DK6A 4FOMA 4KK9D 4Y4HD 4LLWA 3O3AB 4CADB 1QNZH 3LS4H 4EQ3A 5HSFA 2DICA 3TZVC 1RMFH 2R9HD 4PJCB 4GUPA 5GGQL 3RDTC 4DN4L 4G9FD 1IM3B 1CK0L 1BVKA 1YQ2A 4NBYB 4ODTH 3V0AC 3RVTD 1DJSA 2F54A 3MRDA 4PJEF 2ZPKH 4Z9KB 5IFJA 5E5MA 4MHHI 4HXBL 1IEAA 4PJ9B 5I6XC 3FFDA 2HFGH 5I76B 1MFBH 5CEXB 4C57C 3WO4B 1U8IB 2FIKB 5DVNA 5DWUH 3QXVA 6CGTA 3PDGA 4UQ2A 4PJDF 5JHDE 4I1NB 5JZ7C 2IAMA 3S6CA 3MRPA 1SYVB 4WRLA 1MHCA 3JWDC 3LQAH 4KVNL 3GSOB 4HS3B 2BRRH 3BPLB 2HN7B 5J06A 3A6BH 4M7LH 4I77H 5CZXC 3BMWA 3T8XB 4OLZL 2OJZH 4TOYH 3MROB 1EFXA 5JDSA 4KK6D 3ARTA 3UZQA 3TO4B 4MNQB 2FYYA 2HG5B 1CDCA 3TF7C 1G1CA 4K7FA 5FGCB 1U8HA 1JFQH 4M43H 1KEMH 4UINL 3CUPB 4R2GB 5FYJL 5C0CD 4FQXC 4I8DA 1D9KC 1DEEB 1M6OB 1OP9A 3BI9X 2FEDD 4Q9BA 3Q1SL 4JY5L 3SDDB 5DK0A 2AVGA 1JGVH 1NCBL 2C4FU 5IVXF 3HCVA 1T1WB 3NCMA 1MIEH 3VGFA 1WBXA 4Z95L 4NZUL 4BQ9A 3OBAA 4EUPB 2YD8A 3U1SH 3VXSD 2ADGA 2BNQB 1EO8H 2P48B 4NN6B 4L4TB 4G9DB 1OSPH 2AV7B 4P4KC 4QRRA 3BHBA 2YUZA 2B39A 2OL3A 1CVRA 3QJHB 3AUVA 4NT6A 4HH9A 4R96A 3ULVC 2NTSP 4XCNA 4IOIB 3EOTH 4YXHH 1VACA 1ZT4B 1X44A 4WHTA 2DLFL 2BOCB 3RVWD 3NCBB 1CGYA 2HKHH 4OGAD 4JFHE 3KYMB 1Y6KR 4JANA 1YNLL 3UZEA 3ZDZE 1YNTB 3VFTB 3VRJA 3QIBC 4ZSOA 5F1NB 4GOSA 2OYPA 1MJUH 1RQ5A 3RBGA 4XCEB 5FYLD 3C8DA 3FQTA 4HK3N 4ODXA 4WFEE 2E5EA 4PS4L 2R2CA 5T33H 5BV7C 2LTQC 4NM4L 3VD4A 4YXLL 1ONQB 4YAQB 1KB5H 3EFDL 5E8DL 2BNRE 4H1LA 4DKFH 1WC7A 3BPCA 1LP9E 2YPLD 4I0KA 4MNHB 1F4HA 4JFQA 1I8LC 2B2XL 5FECA 1ZHNA 5D1ZA 2CPCA 3WFDH 2ATPA 4XBEH 3LEXB 1MFNA 4X9IA 2V17L 3DGGA 1WAAA 1VGKA 5B22A 5IHBA 1ZHKB 1OAQH 5DYOA 1T66D 3VG9B 3UXFA 1YYLL 5HGDB 3SDYL 4JLRA 3BGMB 1ZA6A 2H32A 1B2WL 1SY6A 3QEGH 1RZKL 1MFEH 2BDNL 1EJ6A 2NYYC 4UUJB 2J8OA 3RKDD 2R4SL 4ZO9A 1NEZA 3TPKA 1FHGA 1BF2A 2W60B 1DBKL 5F7MC 4ALAL 5HD8C 4QRPB 4HIEA 4Y19D 2HMIC 4D8PA 1TVBB 1BBJA 1NCWL 5BQ7A 3FB6B 3F7VA 3B9KD 1X9QA 4U1IB 5L2KE 5KS9A 2CXKA 3DO3A 1J8HE 3I50H 4HHAB 4P59L 3X17A 1YY8A 3RRQA 3WN5B 2ZUVA 4PRBB 5T1LA 3UBXA 5J11B 1NLDL 4RMTA 2Z92B 4D9QE 2HRPL 4K07A 5BO1H 4E0RA 2XQBH 4K7PY 5D93C 1TZHB 2YZ1A 1U91A 4LVOC 3HB3D 1MH5B 2C1OA 1I9IH 2IFFL 1NGYA 2YEZA 5B8CC 3MZTA 3BPNC 1I3RA 1EO5A 2ORBL 3BKJL 4U6HB 5D5MA 1NC4D 4O4YL 4UMGA 2AEIT 3SDXA 1PLGH 3HI5H 3MA9L 4P57B 1CGWA 3DRTA 3VFNA 3QT2A 1I4FB 3UROR 1HHIB 5DJDA 2XWJA 3OR6A 2Q6WA 3VG0L 3I84A 1A6TB 4PGBA 5B39A 5F9JB 1JRHH 5GS1C 3MODH 5DJZB 3UAJD 1OGTB 4ZFFA 1EEUA 5ID0B 2AXFB 2D4FA 3GSNL 4U1LB 4YUEH 4F8TA 4KY1H 1KLGB 1KENH 5KVDH 2IAMC 3M17A 3HMWL 4K3DH 4Y5YB 3QBTB 1V7NL 5EO1B 2MCG1 2FJHA 3TYGL 43C9B 4N0FB 4N0CC 5EPMA 4S1SH 3LHPH 4EUPH 2ADFH 1QRND 2Y6SD 4MB4A 5HI3D 2PXYB 2AJVH 4V1DB 4Z78B 3DSFL 2VZOA 4ODWB 2ARWA 4X6EA 1CCZA 2WIIB 3O6LL 3OG6B 1FVEA 1QSEE 3LB6D 5C08E 3FQUA 5IIEB 2A38A 4UV4H 2NY5H 3MLSL 4YR6B 4WFFE 4JZOA 3G5VB 4K23L 4K7PX 4O2FB 3UTPE 1ZLVH 4M3JA 1IBGH 2EC9U 4B5EA 5DD5H 2UY6A 5E8PB 2DDQL 1SBSH 5CBEA 1H15A 2WLYA 2VDNH 1IQWH 2IJ0C 4RMRA 1XR9A 1FZJB 1KACB 3AMKA 35C8H 3GZKA 3OXRB 2W0PA 3LZFL 2IQAB 4K71C 3FZUD 1CLZH 4N8VA 5INDA 4DN3H 3PWJA 5E6IB 3DXAB 3NFNB 3JWOL 3BAEH 3TVMD 5SX4H 4OTXH 1SVCP 4L5FL 3TCLB 4CW1A 3FN0L 2DJUA 5FO7B 5IJKA 3S36H 5MENB 3LSOB 3ZE1E 1QKZL 2UZIH 1I7TA 4Z7QF 2GAZA 5E94B 2P5WD 4LASH 3CVIL 2BRQA 5K9OA 5J56B 1XF4B 1A6WL 4JM2A 1OGAB 4PLKC 1N8ZB 1K3IA 1R3JA 4Z7WA 1VADB 2JB6A 2NXYC 2O26U 3QJFB 4PLOB 3L95A 4PJXB 3W39B 4QF1A 3ILQC 1BD2D 3U0WH 1G9EA 3RNKB 5E0QA 4EVNB 2VZVA 3U83A 4ZUSB 3OJDA 5HHPB 4RX4D 2HLAA 1YNKL 3VMOA 4LEXL 4JPIA 4XAWL 1QLEH 2VL5B 2ATKB 2EEDA 5EZJA 2VITB 5IBTL 3FO2A 1WWAX 1Z0NA 2WLZA 4X6DF 3UMTA 5ERWB 1FL3B 2W07A 3OAUL 5IF0A 5IMMB 3GSRB 5C0BE 1JYWA 1KPUA 4C56D 2UWEF 1AI1L 4FQ2H 3ZT5A 5JHDD 4UIMB 5A2JH 1RZ8B 2X40A 1W72L 1BVLA 5T3ZE 2IADA 1ADQH 1T5XB 2Z91B 4J2XA 4PJBB 1PKQB 4EI5C 4EIGB 5C8JA 2XOTA 2FHCA 5D7LA 4X6CB 4C59B 1BEYH 1U8MA 3ARGA 1CTNA 3OSKA 1J9CT 2HJLB 3I85A 3HE6A 1H8OA 1MI5B 3QDJA 4Y4FC 3DTXA 1XH3A 4N90D 3VI4E 1X5AA 4S1QH 5ADPH 2ARJQ 2MOVA 4NJ9H 1FO0B 1WZ1H 5K9JL 2IANB 1AR1D 4C54A 5I0ZA 1U3HA 2P44B 3EYUL 1X3DA 3ULUH 2CRIA 3FQWB 4G6JH 3HZYA 4RFEA 4JKKA 4ZFOB 1QBMH 3NN8A 1GGIH 1KN4L 4HGWB 1MHEB 3ZYIA 3MLYL 1CL7L 1GSMA 1PJ9A 5FDWB 4F7PB 2NW2A 5CJXA 1ZOXA 4JRXA 5DT1H 1BFTA 2AI0L 5HPMB 4X98B 1V5JA 3E3QC 1JPGB 1ORSB 4LCCA 3BSZH 3P9WB 3SY0A 2EEBA 4LCWE 4YZFF 5ICZA 5KTEH 5J3HC 4MZ3A 1F4XL 3DVNA 5HI4D 5IVOA 4JFHD 3QG7L 4TVPL 5CJ5A 5C09E 5CFHA 4IS6A 4DKEL 3HE7A 4PP2A 1I1YA 3W82A 4BH7A 4UDUA 1IAMA 3ULVE 4Q9RL 3QDHA 3RUGA 3U46A 4OD3H 1SHMA 4Y16B 1LQSR 4MVBC 2WANA 5DSCA 4WFED 2CMRH 2EDJA 3F8UB 1CBVL 4KWUA 2AABH 3H8NA 5DJ0B 4AQ1B 3KPSA 3T1FA 4PG9B 4P9MH 1I9RH 4KK5C 3CZFA 1NQBA 2PCPA 3ZDYE 1HHHB 3PWPB 2OZ4H 4M7JH 2VXVL 3WJJA 1OF2B 3KHQA 2EDRA 1EEYA 2ZNXA 1R3IH 1FDLH 1T04B 3EYFA 2CQVA 4OIAA 4UAOC 2Q20A 2EEAA 4H26A 2QLVB 5F7KC 3KJ4B 2ITDB 5EUKA 3SQOL 1KFAL 1BGXH 1FV1B 5C0NC 2I24N 3UTSE 3L6FA 4L9LB 4HUXA 4R4BB 3C6LA 2R29L 3FQNB 3O9WB 1X7QB 2A83B 4PJBE 1KEGH 1S7UB 2CKNA 1KXQE 2X4UA 4JFPB 3EDEA 3KYOA 1LO5B 5LGJA 5I1HL 4NQCB 5KVMC 4MAYA 3SGJA 1OLLA 2WIMA 3K0WA 1GZPB 1MI5E 4U05A 2Y7QB 4MNQD 5GS0D 1XF2B 1F8TL 4RNRB 3P0YL 2BXZA 4X0KB 1JK8B 1JTTA 2M1KA 1S7XA 2YD3A 3BEVB 1DBML 5L2KD 3K74B 1F00I 1XR8B 1DQML 4P2QE 1QOKA 2B4CC 1UWEH 1RUAH 2HJFA 3S37H 3LD8B 4LAQL 2MMXA 3MUGB 1NCAH 4BH8B 3KJ6L 3F6LA 4D9QD 3UDWA 4HAFA 4ONOA 1KTKE 3SDDD 4ODUB 4QKXB 4BM7A 4GG6E 2HTLC 4FQJL 1PG7H 3S98A 3KR3H 4YDVA 3U30B 3CVHH 3MOAH 1F4YL 1AXSB 2F19H 3IU4H 4K8RC 4I0CC 1W0VB 3LEYL 4LHUA 4L4TD 1QHPA 4KQ4H 3RVXD 2VRAA 3QG6A 1WFNA 4PRAB 1TTFA 3X3FL 2NZ9D 1KB9K 2CSPA 5GS3A 5A40E 4KK8D 4P46D 3Q6FA 3HTLX 3P9LB 2K3TA 4JM4L 4PBVC 4M7KL 3SOBL 4WFGE 2QADC 1JZ7A 5EOTA 2FZ3B 3L1OL 3C09B 3I6GA 5DQJA 4G6KL 4XCCL 2AEPL 4XP4H 2BVEA 3RL1A 5GGVL 2ICWB 5EWIH 5ISZE 1ND0B 5TFSL 1JWMA 1OTUC 3W2DL 3GBML 4ZAKD 3NTCL 1RFDH 4E41E 3QO0B 2XN9A 5ECJE 4N0YH 5FO8B 1AJ7L 2W65B 2BP3A 2VR4A 2D03L 4TULH 3RNQB 1DQTA 2J3SA 4GXUM 4YPGB 5F88B 4QRSB 4XP1H 5GGTA 4KUZL 5IGXL 4PJ7E 4AIZB 3BP4B 3L3KB 2RCSL 4XAKD 1VCAA 4QNPE 3T0EA 4GQ9L 4MA3A 1TNNA 4NGHH 4NC1C 1OSZA 3C8KB 4MQXD 4HBCH 5C08D 4OZHF 3LQZA 1ZT1B 2GTWB 1JHLH 4GAGH 4S1RH 2VABB 3UTTA 5I8KH 3JV6B 4RMSA 2OCFD 5J1SC 4HV8B 3BDYL 3RI5K 4IRJD 4F7EB 3FQXB 4MA1C 4CJ0A 1CG9B 3WE6B 5T1KA 1AY1H 3EFFA 3RWFA 1U8KA 5BS0B 4AIXA 4NO2A 3KWWA 3ARUA 5FV1L 1G9NL 3SEPA 2V7HB 4HKBA 4Y4KA 3BMVA 3KLAA 3STLA 1FGVL 3CFKA 2PTTA 3NA9H 4ZTOH 2EYRA 4HWBH 1V05A 5D2LF 1G9ML 4LCCC 1FIGL 4H20H 1FFPB 3A67L 2A9NL 4AMKH 1CFSA 4WUUA 3JV4A 2GYSA 2Y06H 3VRLE 2DQHH 4MA8H 3VDCA 3FCTA 2OJEB 5H2BA 1IEHA 3DX7B 4L3EE 4G8EB 3T3MF 3TT3H 1JVKA 4HQQL 1DBAL 1M7DB 2NR6C 1OPGL 3FN3A 4QWWC 2X4NA 1MEXL 1P4IL 4PY8J 3DMMC 4PJHE 4ZXBA 2XNAA 1CU4L 5AYQA 1T03H 4J3SA 1LO2H 3PNWA 2EYSA 5F93C 1CFBA 5B3NA 3CC5B 5I0DA 5T5FH 1OB1B 2CKBB 3LKQB 4MXVE 1AP2A 1EHXA 3OR7A 4ZUWB 1AXIB 1SMOA 3ESUF 4BZ1H 3U9PL 1T0MB 3W5NA 1MFCH 3CU7A 5C0BD 3SHSA 4A2LA 2FD6L 4Z0BL 1A0QL 5JMRA 1EJOL 3FFCB 3N1MC 3RWCB 1J1OL 1K4DB 1RUMH 1E4KA 4L4JA 4QHLB 5D7IA 5T3ZD 4OUUB 5IW3A 4CMMB 4NM8H 4BKLA 2CH8A 3QXUA 3PL6B 1KIUA 1LEKB 5L0QB 3DECA 3C6LC 2ZCKH 3DI2B 1MF2L 1MCWW 2CUMA 3U4EB 3EO9H 5JZ7D 4CVWA 3WNOA 4JZJC 4WW2F 2FO1A 1WCBA 1A7QL 4EKXA 4EBQH 4ZFGH 1BJ1J 2PXYD 3NMEA 2A6JA 3T0AA 1W0WB 1ZK9A 1Q1JL 4GLRH 2DQFA 3SDCD 5CIPH 1VKXA 4I18A 4C83B 4MB3A 3U7YH 3OQ3B 3RGVB 5IB2B 2P8MA 3MA7B 2YR3A 4LL9A 2HT3D 6FABL 2I9TB 1Y18B 1YEFL 3BIKB 5K9KA 1T7XA 3QSKB 4M3KB 1T5WB 2KUTA 3PWVB 4AG4H 4EXPX 5D1QA 2P5EE 3UDWC 5SWQB 4FQXD 1JYNA 4NRXB 1D9KD 2AJXH 3MMEB 3VFVA 4HWNA 2XWTA 5CGYC 4MHHG 3GJFH 5A2FA 4M62H 4XPFH 1QP1A 3P77B 4YHYC 3GMRA 3IDUA 4LCWD 5E6ID 3DXAD 2VXUL 4QRTA 1S5IL 2VLLA 1IGTA 1RZGA 3FRUA 4P4KD 5DEGB 3O3DB 3E3QE 4DUVA 2AV1A 1TQCC 2V2WA 3ULVD 1BMGA 3MCLL 4FNLH 5DHYA 5JR1L 1KLUA 1MFAL 2WUCL 4UT9L 4FMKA 3GSVB 3LV3A 4GRWE 4IJ3C 5LXGL 1OGAD 2R1YA 4H1LG 5TF1L 5HDBE 3CFEB 2DWEA 1BLNB 4PB9H 4KKCD 5E5UB 3SKNA 1IGYA 3G5XB 1V3LA 4E42B 4U1GC 5FKAA 1UJTA 5FUZL 2NQCA 4KTDL 1G7QB 4KJWD 5C1MB 1JWUB 2R0KH 3MUJA 1NGWB 15C8L 4WY7L 4HUKB 3QCUH 1DFBL 5JTWA 2APBA 1ZGLM 4UNTA 1I1AB 4JFYB 5ILTH 2YXMA 3UTSD 5TH2A 4UZGA 3IAPA 4LEOB 1ZT7A 5MEQB 2F53E 4UOW0 4D2NA 1RIVH 1NEZG 4WNQB 1I85C 1KF9B 3FJTA 3F7YB 4HFUH 3DRQB 2LQRA 1U8NB 3S34L 3BW9A 5MP6L 4Z6AT 1KPRB 1KT2B 5IB1A 3ARFC 2D9CA 5I15H 1WZLA 1MJ8L 3WHXB 1EAPA 1LK3H 2OI9B 3ARRA 1MI5D 1UWXH 5CD5C 1BFSA 1F58H 1RZJL 2X9YA 3B2VH 1L7IL 4NKIH 5IG7B 3HMXL 1IGCL 3BP6B 4OM1L 3UBXG 3PP3H 1MRFL 2JIXA 3ZHLA 3O3EB 4QXGL 1H3PL 5I1GH 1P4BL 4GKZB 2IH1B 4R4ND 5ANME 3CFBA 4LVHC 4Q7DA 3PJSA 5EC1A 3HUJA 4XPGL 3KPRB 3IB4A 1P84J 1FC1A 4DGIH 5L6YL 5D96C 5FA4A 4OZGA 4ZD3H 3VFGH 5EU3B 3T08A 4XP6H 4YX2L 1DUYB 5HHXL 3SBWC 3HS0A 2D9QB 1U8LA 4MDIA 5C0JA 2BJML 4ZG1A 1OL0A 3NCFB 4LAJH 5T1DL 4G8IB 1ORQB 3HHRB 1CL7I 1GZQA 4MSWA 3PDOA 5KN5B 1ZKAA 3WDJA 4DKDC 3PHSA 3IDXL 1HQRA 5EZOL 2D7PA 5LJYH 3O8XC 3WXVH 5B39G 1HKLH 2NY4C 4MGXA 3VXOB 5EULV 3NCYP 1O0VA 1ZANL 4EXKA 2VLJB 3OGCB 2O61B 2CUHA 4AL8H 5JLZA 2UYLB 1DQQB 4Y16D 5F7EH 2J8UE 1UM4H 1W72A 1FVCB 4XWOC 2IGFH 1AHWA 2X70A 4GW1A 5JXEC 1SVZA 1VENA 1AH1A 4ELMB 4WU7B 3EYSH 1NBZB 3P0VL 1S8DB 1RZKC 3AY4A 1FG2B 2G5RA 3BWUC 2QQQA 1RURH 1H3XA 1CXLA 3A6CH 3LKSA 1QBLH 3BKCH 3B3IA 5C3TA 2AJUH 2NPLX 1T1ZA 2ZKHL 1VB9A 3O11B 4O02L 2NY6C 1Z9MA 4LSRL 3G6AB 4FP8H 3MRBA 4R0LC 1RVFH 5C7XH 3N1QC 1CT8B 3MV8E 1QA9A 4APQA 4KJYB 4ZMAT 3U9UA 3K46A 3RPIB 3O9WD 1NANI 1EZVY 3O4LA 4OCYL 1X6NA 3VD9A 4N8VG 1G0XA 4HKZB 2Z31B 3O41A 3KHOA 2H3NB 1NUNB 3ROOA 1CGSL 1IZJA 1BIIB 1V8HA 3C2AL 2GUOA 4UB0H 2V5TA 1OAKH 4WWKD 5DHVA 1X5KA 1MHPL 2E9BA 5SX5H 1HWHB 5D71H 1QPPA 4WI6A 3SE4C 1INEL 3FN9A 5I19H 5DO2C 4PLJC 5D7KD 3DLQR 4JY6B 3O2WH 3WUWA 2GJ6B 3OX8B 2XPGB 4NHCL 4KRPC 1UQSA 1FL6B 4NWUH 4GW4B 3V95A 1DBJL 4QHUA 1J86A 2I25N 3MRGB 1ITCA 5AZ2L 1OAXH 4GRLA 5LQBH 3RQ3A 3ESVF 4W6XB 4I2XB 2J8HA 3D39A 4YBHA 1MNUL 5EFIA 1CI5A 1XGRB 1U3YA 1WIOA 3O81A 4HCRA 1JGDA 4JO4L 3ILQD 1V7ML 3IU3B 2YUXA 1ZEAH 1MWAB 1FNSL 2MQ3A 3GMQA 3KNBB 3HPLA 2V2XA 4POZD 1TVDA 4NRZB 3D0VB 1I8MA 1AGEB 3DURB 3TN0A 1CD9B 4IMKC 5JDJA 1Q9KB 3R06A 3VWJA 4E5XA 2JELH 2C4FT 5HYFA 5JOPE 3HI1B 4PJFE 4NQUA 2YSSA 4JFOB 4JKLA 3MO1A 3VGAC 4EI5D 1YEJL 4IDJH 2B1HL 1N59B 4QTHA 4LIQL 1R0AH 1D5IH 3FO9B 1MUJA 4XMKL 4Y5XB 5FA3B 3HG1A 3MRIA 4Y4FD 1OQXA 3MV9A 4QCIB 4WENB 3MRMA 2W38A 3TNMB 4JFZH 1C5BH 3JWOC 2FBOJ 5HHQA 4PJ8B 2VC2L 5FHAL 3QRGL 4YDLC 5SV4A 3WIFA 1FG9C 3C5ZA 2P5ED 3PWNA 2VTFA 4ZQKB 1CGXA 4EN3B 1TLKA 2ZSVA 4YFEA 3KPLA 1XGQA 2FATL 3WV0A 2OK0H 4GG8B 2YD6A 3T0BA 5BS0D 1HYSC 1NAMH 2F8VA 2X89A 4NZTH 3NIDE 5C0AA 3NGBC 4XVJL 4Z7NF 2VQ1A 1Z5LB 1MRCL 1MRDH 3CK0L 5GHWH 2MQCA 3LIZL 3AB0C 5C6TL 4N1HB 4YH6A 5FF6A 2AAVA 3ULSB 1OVZA 4PRPB 4TUKL 5FDYA 4U6XB 3B2UC 3CZJA 3KYKL 1JL8A 5E2UL 3MV01 2JK5A 1PX4A 3AREC 4NPYA 5DQDH 3NVQA 3PIQB 5CKAA 4R8WL 2ZG3A 3V5DB 1J0KA 3DBXA 3KPMA 4LLVA 1A4KA 2PW1A 2H1PL 4KV5F 1EHLH 2GJ6E 5TJWK 5KG9B 2MPAH 3TPUA 3HNVL 4LF3B 5FYKU 1YYMH 3OJMB 3F65A 5C9JB 2FJFA 4CVZB 5E7BA 3T77B 3QNZB 4QO1A 3R1GL 1UJ3A 5IB3B 1XCTA 4JHAH 2BSRB 1LO0H 3C60A 3K2UH 2FX8L 2BY1A 3IVKB 3GSWB 4U0QB 1PX3A 1E28A 4J1UA 3ES6A 1JZ2A 4KK5D 4DFHA 1KCUH 4U7KA 1A6UH 4CMHC 1KB5A 1MPAH 2F53D 1YN6B 2LU3A 2O5XH 3I3EA 1U8PA 4XHJC 5DRZB 1IE5A 3U7WH 3MGTB 3LQMA 4APQC 1NGPL 1RZ7L 4GS7B 3PGFL 5DD0H 3QPQD 3ZE1F 1JF1A 3PL6D 3IDGA 4JJ5A 5DZLA 5GGRA 1D5XB 2DQTH 2ICEA 4G5ZH 3BFOA 2EXWC 1J5OL 4FQIH 5JPMB 4D0CA 1S9YA 2EZ0C 1RJLB 3MLVH 2GFBA 1GC1L 1GYAA 2IC2A 5KVGH 1TZGL 1A64A 2R2BB 1YMME 3P73A 5DMKA 4P9HL 2VDRL 2R1WB 5H37G 1G7LA 1CWVA 5D72H 2EE2A 1IAOB 2OR8A 1SQ2N 4O00A 3WKNA 2YD5A 5DD3H 4DAGH 4EI6B 3RGVD 2R23A 4ONGH 5E7FA 4OD1L 3QFJE 3VXRA 2EH8L 3IXAB 4YHNB 1RU9H 3DVFA 4L8SB 4OLYH 3HNTL 1J11A 4ENED 5IESH 4LHUG 5IK3B 4KXZH 3ECBB 4M8VA 2CLRA 5DR5L 4Q9CA 1PD6A 1J1XL 1T1XB 1A1NB 4NUGH 4NQDA 4XNZC 5IMKB 3P30L 3U4BH 4LPYA 3CH1B 5LWYL 5FUOL 5K9QI 2HTLD 3MX0A 5J6HB 3O2VH 5J4MA 4AM0B 5D1XA 3MYJB 5L7XH 1IL1B 4P5TD 5F96H 4TSBL 2D7OA 3V8CA 1INDH 5AEAA 1K8IA 4IRZL 1ZWIB 1EFQA 1Z3GL 3E2HB 3TGXA 3VI4F 3C87A 3OKNA 3GO1L 2D7TL 2P24A 4GAYA 4OQ1A 2VZ3A 2V2TA 5CWSB 3W9DA 1B90A 4OAWA 5DMJB 3IETA 4IOSD 4OB5L 1IEBA 3CMOL 5GJSL 1N7ML 1S9XB 1KJVA 4I3SL 3EZJB 2O5ZL 5JW3L 2EC9T 1XF1A 1NUGA 4FFYL 5DURB 5KJRH 3WFCH 4XVSH 1U9KA 3ZL4H 3RTQA 1MQ8A 2UVEA 2DAVA 1SEQL 3QI9A 1BQLL 1JNLL 1IFHH 1XGTB 4HAGA 3M1BA 4GMTH 4PJAA 5CBAB 4LPWA 3T1WA 2XIDA 4WV1A 1YEIH 4G80B 3UPRB 1I7UB 2GK0A 1RY7B 5C6WH 3RFZC 5KW9L 5DRXB 4BQ6A 3RWEB 3EHBC 5IB4A 3ARQA 2JJTA 1KIPB 3DI3B 1AXTL 1CFTA 4IEFB 1SJHB 1ES0A 3M8OH 1EBPA 3O45B 3ULVF 1D5ZB 3BVNB 3DPBA 4JJHA 1RIUL 3LMJH 3MCKB 1AGFB 2ZOKB 1JV5A 2YKLL 2DYPB 3ZYJA 4M6OL 3LOWA 5IBLC 3RL2A 4JDVA 2WUBL 1ZLSH 2ZCLH 1Q8MA 2VLKA 3KPQB 3FAWA 1XF3B 1EXUB 3NFSH 4PJXF 1KJ3H 5HYJA 5AWNH 2JCCE 4PJDA 3W5MA 2OQJB 3H9YA 3ZDYF 4JDTH 5J0BA 3D85A 3MJ8B 1P9MC 2YWZA 1FNLA 4Q9QH 1YEHH 4XPBH 4ZPTA 5SWSE 1OARH 1PSKH 4X5XB 2AEQH 3VJ6B 4L8DB 5TE7L 5D7JB 4UI2A 1FC2D 1JGEB 3CLFH 3TT1L 4MDJB 3F5WA 1HOCB 3BZEB 1TTUA 4RWHA 5E9DE 4QWWD 5IW1B 4Z8FL 5JPNB 4BZYA 4RAHA 4PFEA 4PJBF 1INQA 1CTOA 3DMMD 5GS2H 3C60C 2CLZA 3V4PL 5TE6L 4X6CF 4UTAH 3P9MB 1UM5H 4JFXB 4KKAC 4ZTPL 1YPZB 2ENSA 1GGYA 3MLRH 4MJIA 2BSTA 4Y1AA 3V5KA 2BVUA 2VLJD 5HYQA 4AY0A 4KVCH 2XZQL 3RA7L 1DN0B 5FYLL 2J4WL 3FO1B 3S3SA 1S7TB 4QRQB 4XC1H 4HUWA 1AO7E 1MHHB 5JOPD 4JVUA 2CUIA 4QOKA 4WHYG 3TH3T 1XIWC 3MLWL 5TGBB 4BQCA 4KKLC 2D31A 5I71C 4HMDA 2X4SA 4TN9A 5EIQA 3BEWA 2ZSWB 2MHAA 3RHWK 2WZPD 1IMHC 4LQFL 3QEQE 3QUYA 3R4DA 1A7OH 1KTLB 4A6YH 1ADQA 3D48R 5E8EA 1OD9A 1UACH 3GM0A 3ARDB 3QIBB 3V4VH 4WO4D 1CDUA 4KDTC 3WIHH 2R2EA 5ELIA 5DJXA 3KXFB 1NMBL 4HSQA 4N0UB 1VFAA 3BP5A 4JFEB 4ZNEA 2BC4B 4K7PH 4OKVB 3HI6L 3FT4A 1AGDB 4JQVC 3L5WA 3OZ9L 2SEBB 4P23B 4MD4B 3NAAL 3QUML 3ZE0E 2F58L 1DL7H 4YHIA 3EJZC 3IF1A 2QV2A 3MACH 4R3SA 5ICYB 4ETQB 3QCVL 3WIIL 3AROA 2DN7A 1KCSL 2Z31D 2NY1B 5EBMA 4G8GA 4NRYA 1DDHA 2AJ3B 1KXTB 1WEJL 5EUOE 4AENA 1YDPA 3MBXH 5FHBH 5E2TL 1MCFA 1FNGA 5C07A 1LDPL 1HXYA 2JJSA 5D2NB 2HFEB 3IT8D 2AJYL 3CXHK 4PJ7F 4QNPF 2CK0L 3ROLB 4U1HA 4YBQC 1RUKH 3SCMB 2ZWLT 2NXZC 3BQUA 4XI5C 2GJ6D 2A6KB 2X5PA 1FRGH 4OLWH 3ZTNH 12E8H 3NFPB 5E1AA 3WBDA 2FECL 5DK2B 2DQIH 3CFCH 2B1AL 5EOQH 5HHNA 1CFNB 4S0SD 5CSZB 4HXAH 1KTRL 2X42A 1N0LA 3TA3A 1Q9WB 3NCJL 1FIEA 4OCXL 2PW2A 3CXDL 4LCUA 5ACZB 3MV7B 5T3ZH 4YBLC 4OLVL 3RWIA 4PJ5E 3EOAA 4U6YB 1UVQB 4WV1C 3ET9F 4U1MB 3TLRA 5DJAA 4PTUB 1G7HA 1NCDH 4RAVA 4YHPA 3PQYB 4JR9H 1T2XA 3PWLB 3IKCB 4FTVA 3QH3B 8FABA 5KSBA 2F74B 4KJPC 3WKMH 4LLWB 5BVPL 2P7TA 3VFWA 3E8UH 3RAJH 4GUPB 4JKPH 4XPHH 4HZAA 1BVKB 5HHVL 2Y07L 2VAJA 5AD0A 2C3GA 2F54B 3MRDB 4RFNC 3RZCC 5IFJB 2R0WL 5E5MB 1IEAB 4PJHF 3T65A 3UYOD 1WT5A 3FFDB 1A7PH 2OXGA 3B83A 4ZOAA 2YPVH 1DVFA 1EO7A 3WS6A 3G08A 5CD5D 1QQDA 4MXVF 3ZE2E 4NO5A 3QFJD 4UQ2B 4Y2DA 2HTKD 2IAMB 4M00A 3MRPB 1MHCB 4EN3D 3NZ8A 2Q8BL 2FX7L 5JDSB 1EFXB 1JN6A 4ZS7H 2XKNA 4I3GA 3BGAA 4D9RE 2FYYB 1ACYH 4NN5B 3MRLA 4JRWA 5IMLA 4UQ3A 1UFUA 5HVGB 4MA7L 4K7FB 1JPFA 2XWBA 1U8HB 4OIIL 4XP5H 1PY4A 4FXGA 3JVGA 3CVHA 4NC0B 1N6QH 5TQ2L 1QACA 5CMAA 2BOBA 4QXWA 3UPAA 5GJTH 5DK0B 2APTA 5BW7C 3U0PA 3HCVB 3O8XD 1WBXB 3PUCA 1F4AA 1S9VA 1QUNA 2DOCA 3LAFA 2OS7A 1OT2A 2AS5M 2ADGB 5DUMH 1MCOL 4FQ1L 3MRKA 2XTJC 3OAYK 1BZ7A 4XPTL 4ERSL 5BV7H 3NZHL 3RWJA 1ZGLP 4QRRB 4UT6L 3BHBB 2YA0A 2OL3B 3D18A 3IRPX 5GGVY 4OBRA 1E27A 4JQXA 4NT6B 4HH9B 4R96B 3WXWL 5JIHA 1V3JA 4XCNB 3Q48A 5DHXB 1VACB 3UYRL 4NNPL 2XZCL 4XWOD 4NN7B 1YY9C 4WHTB 1NAKH 3LRGA 2VDQH 3QUYC 4L3AA 1AQDA 3VFSA 5CJOH 4JANB 1RZJC 1MQKH 4OFIA 1IKNA 4JRYA 3VRJB 5DMIH 4ZSOB 1IRAY 2AERT 3BP7A 1MJ7H 3IRZA 5F71A 2NXYB 4JQIH 5F1IA 3FQTB 2LVEA 5JW5A 4ODXB 1U8QA 4ZYKA 5I9QC 1WTGT 3TWCH 3WJLA 2A1WH 2E6PA 2FIRT 4MXWL 4H1LB 3N06B 1M71A 3TYFA 1DP0A 3H7LA 4GRWF 1B4JL 1WC7B 3BPCB 3MGAA 3VWKA 4ODSL 4JFQB 2PYEA 3OPZH 5HDBF 5FECB 1ZHNB 4HWZA 2HKHL 5D1ZB 5GGRY 3GI9L 4FFZH 2ATPB 5KSAA 1C08A 3C2SA 4OF7A 3K80A 3DGGB 1Q0YH 3WUWG 4KDWA 1A21A 1VGKB 4NJAL 5TE4H 5DYOB 4XPAL 3QWRA 2NY3D 3TBVA 4JLRB 1AR2A 4P2RA 2P4AB 4TUJA 5SWSD 3DVGA 1ZA6B 2H32B 4Q74A 4DZ8A 3BQUC 3QUXC 4HUNB 1OM3H 1NEZB 5CEZD 3WHE1 4QHMA 2I07A 5HHOE 5DO2D 4PLJD 4HIEB 1WFOA 2DBLH 3RU8H 5CJBA 2BVYA 4I3RL 4D8PB 4YWGH 1BBJB 4KRPD 3HR6A 4XBGA 5BQ7B 1BZQK 3F7VB 1HZHL 1NPUA 3HNSL 5BZDA 5KS9B 4RDQG 2BCKA 5K93A 4FQLL 1YY8B 5T1LB 3UBXB 4I0PC 3OKMA 4E0RB 4L4VE 3Q5OA 1BX2A 3N1GC 1U91B 5LBSL 1NCCH 4CNIA 5DS8A 3QIWA 2C1OB 1QTYT 1DBBH 1AO7D 2M2DA 1NGYB 2J7LA 2YEZB 1I3RB 3BKMH 3EDFA 3KPOA 5D5MB 1DTUA 3IDMA 2YHGA 5DURD 4R4FL 4EDWL 1R6VA 3SDXB 4M6ML 2DTMH 4FRWA 4OF0A 3DRTB 3VFNB 1J8KA 1S7RA 1I7ZA 3I50L 5DJDB 2XWJB 4X7DC 3OR6B 1BM3H 2Q6WB 3O6FC 4PGBB 1QBAA 1Z9OA 5B39B 4YO0A 1OAYH 2XQBL 4F9PA 3DX6A 4YHKL 4ZFFB 2DQGL 3KDMA 1JNNL 1B0GA 4OT1H 2MCPL 3M17B 1TETL 4UNUA 2FJHB 1RUQL 4N5UA 2OBGA 5CIPA 2XZAH 3MLUH 5EPMB 4NNXA 3HFML 4XXCC 1KCRL 3LEVL 4F80A 4XVTL 4OFKA 1OWRM 2DYPD 1E6OL 3H9SA 5A2KH 5GS0L 3G6DL 4X6EB 2OL3H 4UAOB 1FVEB 4PRIE 3O3UN 3FQUB 3ARBA 2HT4C 4YHLL 1NFKA 1AE6L 2CR3A 2XICA 4L1HA 4GBXA 4JZOB 3GHEL 3V6OE 3GJFA 5MEOA 1QFPA 1CDHA 3V0WH 5KVDL 2HVJA 1WWCA 4GMSH 5CBEB 1H15B 4TPRL 2WWKO 1XR9B 3Q3GA 3QDGA 1N0XL 2AK1H 3QXDA 1RIHL 4YDKH 4PTTA 1JWSA 2VL4A 3QUZC 4X80H 1FFRA 3MV11 4N8VB 1WIUA 2VXSH 5INDB 3PWJB 3M07A 3MBEC 4Y4HA 5HYSA 1D6EA 4OI7A 1GAFH 4PUBL 3TO2A 5E2WH 1FFOA 3BN9C 4G9FA 4CW1B 5I1CH 5D70L 1QBBA 4AZ8A 1FFQA 3R8QA 3QHZL 3PXHA 5J1AA 1I7TB 2AQ1A 2GAZB 5KAQG 5LGHL 4OGXH 3QFDA 5K9OB 1IKNC 1TJGH 5DJ6A 3VXME 4JM2B 1GHFH 1MY5A 5F8RC 1R3JB 4Z7WB 1AFVL 2JB6B 3ZTJG 4IRSC 3QQNA 2F8XC 3G6JE 4JCLA 1JPTH 3IDIA 3SE9H 1OW0C 3L95B 4QF1B 4PPTA 5F7DA 5I75C 4MX7A 3QUKA 4TUOA 5D5ME 3OJDB 3GI8H 1Q94A 1NFDE 2EDWA 2N1KA 2HLAB 2PTUA 4WU5A 4YHZH 3X3GL 4JPIB 2J6EL 5EZJB 1ZLUK 3FO2B 2IF7A 3LY6A 2R1XA 2HLFC 3CDYA 4WFHE 5IF0B 1H5BC 1I3VA 4OM0H 3QIUA 4Z7VE 1KPUB 1II4E 5FM5O 3UJTL 3RIFK 4TYUA 5I1EL 3LCYA 5IR1A 1BVLB 1RHHA 2IADB 4K3HA 3GUTA 3S5LA 5C92A 4ZUUA 2ESVE 2W9LA 5DVKA 1CICA 3N85L 5C8JB 4U1SA 3GBNH 3OF6D 5D7LB 4UTBL 3RIAF 4F37K 3VXQA 2A6DA 3UZVB 1U8MB 2I60L 3LKPA 3ARGB 2XXMB 3QDJB 3HE6B 4U4BA 4WW1A 4D9RD 1DANU 3DTXB 1XH3B 2A9ML 2NY1D 3IJSA 5HVFB 4YDIL 3VXSA 1H3UA 3GMMA 3BYTA 2AK4E 5E4EC 3A0OA 5DC0A 4ZODA 2ZJSH 4PJFF 2CO6B 3LPGA 3W9EA 5DC4B 4J4PD 1UA6L 2I9LA 4FQ2L 5AZEH 3QHFL 5TPWL 3BD3A 4PRHE 4MA1B 1U3HB 4JO1L 2WBKA 1ZMYA 4TQEL 3AGVA 2Q86A 4RFEB 3HZYB 3NN8B 1EMTL 3D0LA 3SCMD 5DUPH 3MR9A 5F3HA 5I17A 5E2VL 4O51A 5C0RL 2NW2B 4JRXB 5FM4A 3MOBL 4U1NA 2PR4H 2E27L 3DROA 4J3TA 5E03A 3VFUA 2XY1A 3RJDA 5A3ID 3FMGL 1TITA 4LCCB 4OGZA 2NX5A 5DGQA 5IVXE 2FECI 4UILL 2DWDA 4QXUH 3SY0B 5ICZB 1X4XA 3DVNB 1RK1A 3IJHA 1HDMA 2XTJE 3MV7D 1GC1C 4IS6B 3HE7B 2YPLA 1I1YB 4PP2B 4BH7B 5IJVA 4UDUB 5CD3A 4D3CL 3STBA 3PABA 1GGCL 3TFKC 3RUGB 4WEUD 3U46B 1CDIA 2R4RL 1HINL 4KH2A 1B4RA 3PQYD 4YFLF 3WNKA 4JFDA 5DSCB 1HCFX 4HS8H 5DT1L 3ZMRA 1YEGL 2ADJA 2YN5A 3KPSB 3T1FB 5GRJL 1MJJA 5GRXG 3BRFA 3CZFB 3L3GA 2FR4A 4NQEE 3W11D 1BFOA 1A5FH 1L0QA 4LOUD 2PCPB 2H2PC 4PR5A 2F54D 3JWDL 4DZBA 3BKYL 3I02A 2VYRE 1EEYB 1A47A 3E0GA 3EYFB 3PHOA 2YK1H 1J12A 4H26B 1GOGA 2B4CH 4F15C 5EUKB 1OCWH 1Q72H 2MJWA 5IBLD 1FCGA 4QYOA 4LFHD 3L6FB 4HUXB 1WZMA 3LH2L 3BDXA 3MTRA 3C6LB 4JG0H 3G9AB 1UXWA 2NY2B 2C3HA 2FBJH 4NCC2 2C7UA 2Y72A 4NC2B 2X4UB 1BQHA 1IC5H 3D1MC 3KYOB 2FGWH 3D3VA 3O0RH 4NFCA 4WW2A 1Q0XL 5LGJB 4K8RH 1N5YL 4MAYB 5GGUA 2ZCHL 3EYOA 4MNGA 3VD5A 1DN2A 4GXVH 5ESQA 4XX1G 3UJJL 4JREB 5H94A 1JHTA 1S7XB 1T7ZA 2VR5A 4KK9C 4Y4HC 4HUVA 2H2SD 1NC4A 3VU2A 3NACL 2R9HC 2HJFB 2ENYA 2J88H 1RZIA 1MFDL 3RVTC 3HC3L 4L4VD 3ULVL 1AIFA 4P3WA 4ZO7A 1OQOA 4X4MA 5FM8A 4ODVH 4YDVB 4D0BA 2GITA 4KU1A 3SDAD 4UNVA 1WBZA 1Q38A 4XRCA 4HT1L 2VDMH 3FHAA 4LHUB 5GRWA 1HEZA 4KMQA 3QG6B 4UU9A 1F90L 1HI6A 3QP3A 4MD5A 4XCFH 4MD0A 1IAIL 1NUFA 4QTIH 1YEEL 4M5YH 3Q6FB 4G42A 1X5ZA 3PHQA 5EOTB 4EOWL 1XIWD 3I6GB 4BZ2H 1TQCB 5DQJB 5F6IC 4KK6C 1UB5A 5FKPA 3RL1B 1NKRA 5EG6C 4LLDA 1FAIH 5DZNA 5L8KB 1JWMB 1YJDL 3SKOA 1WISA 4P2OD 4JHWH 1NBVL 4JFFA 5ACLA 2XN9B 1UB6A 2XZZA 3V9FA 2FEDC 3PV6A 2Q8AH 3AC0A 4NQSA 4Q6IA 1N64H 3S35L 4NQTA 4JAMA 3THML 2B5IB 4R7DA 5IOPA 5CILL 4F57H 4F7TA 4M1CC 3T0EB 4MA3B 3EJZD 2X9XA 3CAFA 1OSZB 4KROD 3EOBA 5D1ZD 3LQZB 5E08L 4XP4L 4GXUN 1D3CA 3UTTB 1FO0L 1NAMA 1VGEL 1I9JL 3TVMA 2G5BA 1HILA 5LCVH 5T1KB 3T0VA 3EFFB 3JTSA 3RWFB 1U8KB 2EDDA 3EDDA 3N1FC 2VLMD 2VAAA 2P5WA 5GPRA 2C3WA 3VMNA 4U6VL 4NO2B 3KWWB 3DYOA 1BQSA 5ALBL 4HKBB 4Y4KB 3KLAB 2QKIA 3IFNL 3STLB 3CFKB 2PTTB 4YBQD 2EYRB 2NXZD 4OJFH 4XI5D 3ZKMC 4BYHA 4LBEA 4KMLB 1FYTA 4LU5H 4OIBA 4G7YL 2C3VA 5J13C 4N5ED 1JCKA 3H42H 1I1RA 5JIIA 4QGYA 1CFSB 4WUUB 3JV4B 4XNMA 5CUSH 3ISWA 5C0IA 3FCTB 4XNYL 3WUZA 5H2BB 4G6AC 3K81A 2H8PA 5T1LD 1MCRA 4MMXC 5EOCH 1RUPL 2FO4A 3WFBL 5DLMH 2X4NB 5LKNA 3QDME 3FKUS 3ELAT 4W70A 3NIFE 4J3UA 5JHDA 1U42A 4ZXBB 5AUMA 2XNAB 3PNWB 2EYSB 1QFWL 4RISL 1IGIL 5ALCH 5CGMA 1XGUA 1AP2B 3OR7B 3OJVC 4FQQA 3B8YA 3INUH 4DCQA 1YECH 4LLMA 4L8CA 4ZNCD 3SGKC 2F5AL 4WFHD 2APFA 3TH2T 4QEGA 1MCJA 4X4ZA 3LKOA 1A22B 2CRYA 1U6AL 5D7IB 2ESVD 5HHME 5H37H 3SJVE 1N6UA 4BKLB 1WFUA 3NOIA 1JGUL 3B9KC 4HPOL 1T2JA 2VDPH 4X6DE 3WS3A 1TJIH 2OP4H 4PYHA 1PEWA 4AEHL 2UWEE 5F72S 1JHKH 1GGUA 3MUHL 1JMZA 1MCQA 1A3LH 1WCBB 4WW2C 4RAUA 3G04A 3FB8A 1IGFH 2AK4D 2EDOA 3HB3C 5DVLA 3ZKND 2A6JB 2WM0A 3VGDA 4BZ1L 4B7LA 1JPST 2DQFB 2R69L 1VKXB 4I18B 5GGQH 1CD0A 1IC7L 2P8MB 4DN4H 2HT2C 1QYGL 4NOBA 1CK0H 2ZUUA 1KC5L 4PRHD 1QSFE 5K9KB 5DJCA 3QPXL 1UH4A 3P2TA 4HXBH 5D1QB 2PO6D 3ZKQD 1SBBA 4RIRA 3ARWA 2WP3O 3IFOA 3VFVB 1RJYA 4AH2A 3EO9L 2XWTB 3CJJA 2HFFA 3IYLW 4M93C 2B7DT 1B88A 1QRKA 2C1PA 3UAJC 3UO1L 1RI8A 3GMRB 3Q5YA 4P5MA 3V5HA 3GIZL 4DVBA 3ZE0F 4KVNH 2AGJH 3BPOB 3W0WA 4FA8A 5C0FA 1M1SA 4QRTB 2VLLB 2BNRA 1IGTB 1RZGB 2XTJD 2J5LC 3FRUB 3PGCA 1D5BA 1LP9A 4WUUE 4P3DA 2Y6SC 1P2CA 4TVSa 4HG4K 2AV1B 2V2WB 1A3QA 5HI3C 5EUOF 3VI3F 3H0TA 2P47B 5DHYB 1KLUB 1EBAA 3P4OA 5J7CC 3LV3B 3S97C 4WJ5A 4UINH 4JM2D 2R1YB 5FYJH 4IOFD 3LB6C 5EU6E 4LPXA 2OMBA 3T0WA 2DWEB 5H35A 5IHUL 3CX5K 3DX8A 5FXCH 4LSUL 4DEPC 4RGOL 3SKNB 3Q1SH 4JY5H 4NQED 1IGYB 3K4AA 4W4OA 5J9PA 5FKAB 3D9AL 3MGOA 4Z95H 4NZUH 1UADC 1HNFA 1Y6MR 1AGBA 1UWGL 3RY5A 3BH8A 3WLBA 1NL0L 4JZNA 2JB5L 2UY7A 5I8OL 4C55A 5BZWA 3GIVA 4E9LA 3MRQA 3OXSA 1YA5A 5L2KA 5TH2B 1ZT7B 4JE4B 1J8HA 3TVMC 1BJ8A 1KB9J 2WBJA 2DLFH 4LSQL 3RWGA 3D2UA 2J2ZA 7FABL 3BW9B 1LNUA 1YNLH 5IB1B 4N1CA 2WK2A 1K5NA 1YPZF 3ARGD 1EAPB 2Y9RT 2X09A 3QDJD 3HE6D 1I8IA 4CU7A 4G6FB 2E3VA 3U82B 3VXUE 2FNBA 2XXCB 4PS4H 3QUXD 4MJ6A 4HPYL 3QAZC 2MKWA 2JIXB 4NM4H 4YXLH 2R39A 5LAXA 3EFDH 5E8DH 3VA2C 3JTTA 3PE9A 3MC0A 3CFBB 4P46A 4GAJL 1CZ8L 3PJSB 5EC1B 3HUJB 1U3HD 1Z9LA 2B2XH 5FA4B 4OZGB 4DW2L 4Y5VA 3HS0B 4MDIB 1U8LB 5C0JB 2V17H 5E6YA 2DQUL 4I0PD 2PTVA 3DUHA 4ZAKA 5I74C 2OSLA 2DJ4A 1GZQB 4MSWB 3PDOB 5IFAL 1YYLH 3SDYH 5B21A 4WI4A 3MXVL 1HQRB 2A0LC 1B2WH 1JGLL 1RZKH 2BDNH 2CKBL 1UM6L 3V52L 2R4SH 1DBKH 4ALAH 1QEWA 3HE7D 1WLHA 1PGRB 3ARPA 2VDOL 4MQ7A 1QSEA 2VUYA 1NCWH 5C08A 5JLZB 4L1DA 1LGVA 4H88L 2R8SL 4P59H 1R5VA 1W72B 3EKCA 3O6FD 4QRUA 4YFDB 4A6YA 1AR1C 5CSBA 2OM5A 3WCYA 3VGGA 4YC2B 1TQBB 1AHWB 2X70B 4GW1B 4IRJA 4PJGE 4WEBL 1GPOL 3KPSD 1JIBA 1NLDH 1FYHB 4WVRA 5I18L 2HRPH 4IIQA 4P2CG 1L7TL 1T3FA 2L0DA 1UKQA 5I8CA 5IMOA 1ZXQA 4WUKH 5I1AA 1VERA 2NY0B 5C0CE 1CE1L 1Z6JT 1U3ZA 2IFFH 5JHLL 4WHDA 2MSPA 3LKSB 3AU1A 3B3IB 1T1ZB 2ORBH 3BKJH 4YDJA 5J89A 2LAAA 4CMHB 1MAML 3MRBB 3WHE0 2EH7L 4OZFH 4OKDA 1QA9B 4APQB 2FSEA 4XH2A 1AQKL 3MA9H 2YA1A 3U9UB 4BFGA 5FGBC 1JUFA 4ZOEA 2J1KA 3RVVC 3O4LB 4OZHE 5KSUA 2ZOLA 3JV5A 3VG0H 2CIKA 4URTB 3VGHA 4JHBA 5EZIL 1WWWX 4LDLB 5HYSG 3O41B 4N68A 3QRFM 3UTZA 4F9LA 3ROOB 4K9EL 3WLWC 1VPOL 4PY7A 3GSNH 1TVHA 1S3KL 2GUOB 1RURL 3RVUC 3HMWH 1V7NH 5DHVB 2AJUL 1U8OA 3I75A 1MSPA 3TYGH 3QUZD 1XMWA 4FP8L 3AS3A 5K33A 3MYZA 5FYLE 4ORZC 3UX9B 5D2LE 3VDBA 2NTFA 3TZVA 3DSFH 3WUWB 5FV2A 3RDTA 4H25A 1CGUA 3QDMD 3BN9D 5C0BA 3O6LH 4PJ9C 3FT2A 1UQSB 3D69A 3X13A 1HK6A 4QHUB 4XNZB 1ZA3A 1C1EL 3WO4C 3MLSH 3QA3A 1KPVA 4XWGL 4GRLB 2Q3AA 4LHUD 4K23H 3OAZK 3D39B 1A9BA 5D6CA 1MAKA 4CVXA 1R24A 1N4XL 2DDQH 1KLFA 5EFIB 3F7QA 2X6MA 4Y8DC 1BIHA 2GCYA 4KFZC 3BPLC 1IAII 1JGDB 2IPKA 5CP7A 3LZFH 4WIQA 2EDYA 3S5LG 4RZCA 2LVCA 3GMQB 3TO4C 3HPLB 2DI9A 2V2XB 5GS0C 4N8PA 1I8MB 3TH4T 3O2WL 3JWOH 5HHMD 3SDCA 2GEEA 3SJVD 4C4KO 2HLFD 3TN0B 4L5FH 4HD9A 3FN0H 1IC4L 3R06B 3VWJB 4R2GC 2R15A 4E5XB 3DV6A 4Z76A 1QKZH 4ODBD 5B3JE 3K8LA 4XP9L 2CLVA 3CVIH 3GB7A 4Y19E 2YSSB 4NO0A 5D7SL 5SWZA 3SDDC 4U1JA 3MO1B 4FQXA 1ZVYA 3SKUD 1D9KA 1A6WH 2YA2A 4QTHB 5I73B 1BWWA 1MUJB 4XCYA 1ZTXL 4GSDL 4PRDA 3HG1B 3MRIB 3E6FA 3MV9B 3MRMB 4NN6C 4OZIE 4LCWA 1BAFL 4D94A 5HHQB 4FZ8L 1T20A 2GKIA 4OFYD 3UTTD 2H41A 2NZ9C 1YNKH 4CJ1A 4LEXH 2VZ1A 5GSRA 3WIFB 5C09A 3C5ZB 4WWID 3LS5L 4P46C 3PWNB 4XAWH 4P4KA 3BZ4A 2ZSVB 4LLQA 1SJXA 5BMFL 3KPLB 1XGQB 3CLEL 5T1KD 4OCWL 3OAUH 4BFIA 3QZWA 2NCMA 5C0AB 3DETD 1AI1H 2VISA 3F12A 4Y4KD 4HGKC 1WTLA 2VQ1B 4OCSL 1W72H 3OAYH 4MJ4A 4JN2A 2V5SA 1KCLA 2V9TA 5EIIA 1CN4A 5FF6B 3WSQL 5F9WB 1GGTA 2R2HA 1AD9A 4L3CA 4WUUD 1P6AB 3BE1L 2ZUQC 4NWTL 4CGTA 3B6SA 3ZHKA 3N9GL 3MJGX 2JK5B 4NPYB 3LPFA 2P8LA 2A74A 4M03A 3MJ9L 3ME0A 2V9RA 5DA0B 2KH2B 5DMGC 3DBXB 3KPMB 1Z2KA 1EA9C 1A4KB 2PW1B 4LLVB 4MQXC 5EU6D 1U92A 3TPUB 4O2CA 1K2DA 5K9JH 1K8DA 1U2HA 2FJFB 1QRNE 25C8H 3UTSA 1WAAF 1IKFL 3EYUH 1UJ3B 3TFKD 1XCTB 4IRJC 1ZSDA 3VA6A 3JBG7 3VG9C 4HMEA 2CD0A 3C60B 1XGPA 4X8XA 1KN4H 3SPVA 4JKWA 1QFWI 4AK1A 3MLYH 1CFQA 4FFVD 1CL7H 1JZ6A 3NCEB 1E28B 4J1UB 2QTEA 2EXYC 5DRWA 3ES6B 1N5AA 2AI0H 2A77L 2VXTL 3HLAA 3P4MA 2XQYK 2H2PD 5DHVH 1KB5B 4P2QA 5FEBA 1DUZA 1U8PB 1ZVSA 1F4XH 1IGMH 3QG7H 4TVPH 5FYKD 5KANI 1NJ9A 5BRZA 2BVTA 1JF1B 5BJTA 5I16A 4DKEH 1E0OB 3IDGB 4F3FA 4JJ5B 4OI9A 4Z5RA 5GGRB 1FCCA 4LNVA 2ICEB 3WN5C 4GG6A 4D0CB 1S9YB 5J11C 4Q9RH 3VFRA 2Q87A 2GFBB 2Q1EA 2GJJA 1EX0A 2OTUA 1VHPA 3P73B 5DMKB 1CBVH 1G7LB 4QLRA 5A2LH 4NSKA 3LN4A 2VH5L 4IHOA 1JJUA 3GMLA 4NBZB 4NP4L 5D5MF 4ZUTA 4PJIE 4JPWL 1B0RA 2DF3A 2R23B 3MV9E 3HRPA 3VXRB 1CXKA 1UH2A 5EU5A 5FCUL 5B8CA 3BUYA 2VLRE 1A14L 1X5GA 2DIAA 2EIBA 2VXVH 3RX7A 1XT5A 3EO1A 2CLRB 4Z7VF 3ULUC 5ISZA 1BD2E 3CGTA 3QNYA 1CLOL 3TBSA 3L5IA 2B0SL 4NQDB 4LP5A 5EA0L 3SQOH 1KFAH 1NANH 4E41A 4BSWA 3MLXL 3WNPA 4Z7UA 3KYNA 2R29H 4WI5A 2BVPA 4FABL 2EDHA 4JVWA 5D1XB 2EDXA 5GS1A 4EIZC 5HI5C 4C56E 1K8IB 1J10A 1T21A 1VFBA 4KQ3H 4OSUL 4PJ7A 5I1HH 4JEGB 2E8ZA 2W9DL 3O2DL 3OKNB 1FSKC 3X14A 2P24B 4GAYB 1F8TH 3BZFA 5FUCE 1MWAL 3P0YH 2V2TB 2W9EL 3W9DB 2PXYC 1DCLA 4OAWB 5IESL 1DBMH 4KHTL 4KHXL 1CGTA 1DQMH 3SDCC 3IETB 1IEBB 2KDGA 1KJVB 2N7BA 1LVEA 4LAQH 1A3RL 4NUGL 4N90E 2HT3C 2YRPA 3KJ6H 4I13B 3RTQB 1HH6A 3VXPA 1RK0A 4LLUA 4UV7L 3QI9B 1N2RA 3DX9A 2YC1A 4ZO6A 1JZ8A 3M1BB 1F4YH 4PJAB 4DFIA 1NMAL 4KJQD 3K3QA 5J8OA 3S3JA 3QEUA 4WV1B 1VEPA 3LEYH 5I8EA 4JO2L 1U36A 2GK0B 5F6HI 4M1CD 3X3FH 1HQ4A 4ZPVA 4WWKA 1AC6A 4M48L 5E6IC 4JM4H 3SOBH 5IB4B 4M7KH 1QZ1A 4OLEA 3L1OH 3T4YA 3T04D 4DGVH 2Q7YA 1FLTX 4G6KH 1CFTB 2ITCA 2NZIA 4XCCH 1ES0B 4L3EA 5FGRA 5GGVH 4YIQA 3SGDI 4RFNB 5TFSH 4FG6C 3H3PL 1RD6A 3W2DH 1JV5B 3GBMH 3NBNA 4NUJA 5D8JL 1DSFL 3CDGA 3NTCH 4PJHA 4JM2F 4G6FD 1KBGL 4Z7WF 3RL2B 2E9IA 4JDVB 1AJ7H 5AAWA 2VLKB 4P4RA 4KKCC 2D03H 4DOHB 5HYJB 3UTQA 1P7QD 4PJDB 2XACC 4KUZH 3ZKMD 1H3WM 5IGXH 3D85B 2RCSH 4GQ9H 3REWA 4KJWC 4ETYA 5CLTA 3BO8A 4ZPTB 5L2JA 3H7BA 4OI8A 1SYSA 5KZCB 1J05A 1FORL 4PJCE 1NC2A 1BECA 4X7EC 4G6AD 4XMLL 1YJDC 3F5WB 3RJQB 4HH8A 1I75A 3BDYH 1NDMA 5MERA 4NQDE 5IT2L 4OGYL 1INQB 3ZTJH 4AEIL 5T3XH 4JCMA 2CLZB 1DANT 5HGAA 1G9NH 3OB8A 2I5YL 1ZLUH 1FGVH 4EI5A 4MJIB 3DNKA 3V5KB 2BSTB 1NGZA 4Y1AB 1G9MH 1T7WA 5HYQB 1FIGH 1TFHA 2BVQA 3FOLA 3A67H 4Y4FA 1K6QL 3KPTA 5F9AC 2A9NH 1FH5H 3L3JA 5F7WC 3V6FA 4HUWB 3QQ4A 2QQKL 4QOKB 4R4NC 5FOBA 3OKLA 2P5EA 2D31B 4MNQE 1I7RA 2X4SB 3BEWB 2D7NA 4HQQH 1DBAH 2MHAB 4MXQC 3REVA 1OPGH 5I1JL 5FGCE 3O4OB 2LAGB 1MEXH 1P4IH 3QUYB 2HA1A 2NY0D 5E8EB 3BIAX 4O58L 1CU4H 2RBLA 5IEKA 1NH6A 1B6UA 2R2EB 4I5BA 5DJXB 5EN2A 1VFAB 3BP5B 3N50A 3FT4B 1BFVL 3L5WB 5DD1L 1UGNA 4O2EA 5J1TC 4KKBD 4HIHA 3U9PH 4YHIB 2BNQE 1IILE 3IF1B 5GZND 2HT2D 2FD6H 3O4LD 4R3SB 4L4TE 4Z0BH 1A0QH 1EJOH 5EOCJ 5HGHA 1J1OH 1KCVL 4HJJL 5CEZL 5L88L 5EBMB 2CIIA 4G8GB 1DDHB 4NRYB 1GJIA 1DE4A 4AENB 1YDPB 4Y16C 4DKAA 3EJYC 4MCYA 1FNGB 5C07B 3UC0L 4MCZA 5FB8A 4TSAL 1I1FA 1MF2H 1HXYB 5B38A 5BOPA 4HUUA 4WCYL 3VW3L 4LPUA 1KIQA 4Z7NE 1QR1A 2RJMA 3BXNA 5I2IA 4ONFL 1A7QH 4HULB 2NNAA 4O9HL 3CD4A 4U1HB 4KRNA 4AQOA 4Z18A 3BQUB 1Q1JH 1T22A 3P4LA 1HYRC 5E1AB 3DUUA 4FQHA 6FABH 4J3OC 1YEFH 2DQEL 2F53A 3L3IA 3KJ4C 5HHNB 1CDYA 4O5LL 4XAKE 5GISL 3NH7L 2QQLL 4GRLD 5GRUL 5TQ0H 3TA3B 1J1PL 4X4XA 5C0GA 4L9LC 3D39D 1MCEA 2PW2B 3CSYA 2YMXL 3EDJA 4ZDHA 2IMMA 3O9WC 4KV5E 4LCUB 3G5ZA 1S7VA 1T7YA 1D6VL 1PBYA 3RWIB 1YC8A 2XI9A 4X9HA 3EOAB 4N8CL 1EUTA 5DJAB 4KTEL 1G7HB 2X41A 4RAVB 4YHPB 5JQ6L 5HY9A 3D25A 2F5BL 2NLJA 3VRIA 2FEEL 4FTVB 8FABB 2VXUH 1S5IH 5KSBB 4WWKC 5ANMA 5JORA 3TN0D 5EU4A 2P7TB 4YQXL 5L9DL 1E6JL 3VFWB 3VWJD 3LD8C 4QRPE 5ID1A 3MCLH 1SEBA 5JR1H 3FO0L 1MFAH 2WUCH 4UT9H 1U41A 5AD0B 2MQ0A 1RULH 4YNYA 3S88L 1ZS8A 5LXGH 3ILPA 3NIFF 3T65B 3H9HA 5TF1H 3U30C 5DFTA 1DVFB 1IGJA 1R3LA 3G08B 5F97E 4UBDD 1QQDB 3MV9D 4LSTL 4NO5B 4K3JL 4P5TA 2VLRD 1FL5A 4Y2DB 5FUZH 3WL9A 4JR9L 5JQHC 4KTDH 4M6NL 5CGTA 15C8H 3NZ8B 3GNML 4WY7H 4HUMB 3C09C 1DFBH 5E00A 4HLZG 1MCWM 1JN6B 2X89D 2XKNB 1FBIL 4POZC 3VXNA 4M1DL 2J8UA 3MRLB 5DZOA 5IMLB 4UQ3B 3L9RA 1JPFB 2XWBB 1CD1A 3ULUE 1V3MA 3S34H 5MP6H 4X7SL 5MEPA 5C07E 4FXGB 3CVHB 2XY2A 1MJ8H 5HVHB 5D6DC 5CMAB 1CDGA 2BOBB 4AEFA 4FZEL 1RZJH 4G7VL 1L7IH 4RMWA 2A0LD 3U0PB 2FWOA 5F9OL 3HMXH 1IGCH 2G60L 4LVNB 4LRIA 2ARJA 3S4SA 1S9VB 3AM8C 4OM1H 4J23A 3CDCA 1MRFH 1KULA 2X1WL 4QXGH 1H3PH 3MRKB 3MV8A 5JIKA 1P4BH 1BZ7B 2WINA 4WI8A 5DMYA 2Y5TA 3RWJB 4K55A 5DF0A 4NQXA 3D18B 4XPGH 4V1DE 3AS0A 1E27B 5L6YH 5H8DA 3BJ91 5ITFA 1X5FA 4X9BA 1E4WL 1KOAA 3L5HA 4YX2H 4XP5L 5HHXH 4KRLB 2BJMH 2FL5A 4GFTB 1AQDB 3VFSB 2W0KA 5T1DH 1CR9L 1OP3K 2A2QT 4JRYB 2QQNL 1PQZA 3BP7B 4LCIH 2JKXA 4JGMA 4KC3B 3RY6C 3IDXH 5F1IB 5FCSH 5EZOH 4YK4B 5JW5B 4LSPL 1U8QB 4ZYKB 3VFPA 3GMNA 2CDEA 3GK8L 4LSSL 3UTOA 1ZANH 2PKDA 4Q6YA 4F8QA 1J0ZA 1M71B 3TYFB 3DXAE 1EGJL 3VWKB 1UG9A 2PYEB 2ERJC 3RVVD 2WP3T 4HWZB 4M4RA 4NCDA 1M4KA 4LKXA 5MENE 5KSAB 3WDIA 1C08B 1MQKL 3BUTA 3WLWD 4MWFA 5B4MD 3DMMA 3RVUD 3MRJA 3GRWL 3F58L 4K94L 2N4IA 1OGAE 4YFLI 3TBVB 3RWHA 4YHML 4P2RB 4TUJB 3DVGB 1DLFL 4J6RL 2AJZA 5L8LB 1NLBL 4DZ8B 2CGRL 2ZKHH 4PJXE 3DIFA 3S37X 5M95B 4O02H 5ADOL 4RGNB 2KQMA 4LSRH 1ZHLA 4QHMB 2I07B 3IXTA 4KPHL 4NQDD 5D7IF 1NSNL 3L3OA 4OFDA 1H3GA 1H9VA 5I30L 4PJ9D 5E99L 1ED3A 4XBGB 4PJFA 2X4QA 3QPQC 2AKRA 4OCYH 2AQ3A 5BZDB 3PL6C 5ETUA 5L0QC 4M61A 2BCKB 2DI7A 1WV7T 1CGSH 2VE6A 3VGEA 3OKMB 3S35X 1CE6A 3NABL 4GRMA 1A7RL 4LVEA 3C2AH 5HDQL 1CF8L 1PKQE 1BX2B 4X7TA 3BH9A 4YXKL 4F33A 4WO4A 2EYTA 4QHKJ 4JZJA 1UCBL 4CNIB 4HW6A 5DS8B 3QIWB 1YMHA 4X6CE 1KYOK 1MHPH 1OM3L 2ZNWA 4RGMB 2IMNA</