3GIZH

Crystal structure of the fab fragment of anti-cd20 antibody ofatumumab
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
222
structure length
216
Chain Sequence
EVQLVESGGGLVQPGRSLRLSCAASGFTFNDYAMHWVRQAPGKGLEWVSTISWNSGSIGYADSVKGRFTISRDNAKKSLYLQMNSLRAEDTALYYCAKDIQYGNYYYGMDVWGQGTTVTVSSASTKGPSVFPLAPGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab fragment of anti-CD20 antibody Ofatumumab, light chain
publication title Structure of the Fab fragment of therapeutic antibody Ofatumumab provides insights into the recognition mechanism with CD20
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 46
structure length 216
sequence length 222
ec nomenclature
pdb deposition date 2009-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gizH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gizH01
4X7CC 1A5FH 3CSPA 1X4YA 4L8SB 1RVFL 1TQBC 2LAGB 4QO1A 1JPFB 4DN4H 1T80A 5ALBH 1NCTA 4R0LC 1A47A 3GMQA 4I0PB 1HDMB 4QHKI 4FQQA 4ELMA 5IHUL 4PJHE 2NW2B 3VXRB 4OD3L 3TCLB 4NCC1 2QSCH 4M9PA 1MQKL 1VENA 2PXYA 1I7TB 3P4LA 4PLNC 4P3DB 3TVMD 1YEKH 4JG1L 1G7LA 4J3SA 1OD9A 4I2XB 2XA8H 2B39A 4NNXB 3A6CL 2DBLL 5JPNB 2WQRA 4LK4A 1H3WM 5E6IC 1BM3H 2ZNWA 2ESVE 2EH7H 1U41A 3VMNA 1J8HD 2MJWA 5L6YL 3MV7E 3M1BA 1H0DB 4OCSH 5HHQA 2Y9RT 3AMLA 4X4YA 1LNUB 4OCYL 3V4UH 4PJXA 3BDYL 4H5SA 3OKEB 3V6FA 2ORBH 1FFOB 3A6BL 4J12A 5E8DH 3G04B 1O7SA 3LB6D 3H2WA 3QH3B 3QULB 3VFNB 4JRYE 1GPOL 3DETD 5DA0B 1BD2D 3B8SA 1RIUL 1U9KA 5L2JA 2XXMB 2R8SL 2G75A 3L5WA 3MLSH 4LQFH 1XIWA 2GY7B 1FDLH 4KTEH 4PR5B 5ITFA 1CDGA 4PREB 4ZQKA 3HNSL 1IBGH 1T1WB 2WV3A 4YHPB 3KHOA 1E4KA 4IS6A 3UMTA 3ZL4H 4Q0XH 1XF2A 3JSSA 4YC2C 4OF8A 4L3ED 1FVDA 2P8PB 5EH1A 3W39B 4B50A 5C9KA 4BH8B 3CK0L 4PTUA 3LD8B 3KPRB 4HUXA 4CMMB 5I1EL 5IB2B 4HHAB 4PGBA 5DTFB 1CXKA 4X5XA 1BEYL 3TBYA 5I8OL 1IFHL 1NCAH 4WWKC 3ALWA 3X11A 5L0QC 1ZANL 2IALB 2HLAA 4I5BB 2C1PA 1BFVH 3UZQA 1TETL 2QQQA 3LV3A 3V5KA 1JGVH 3TWCH 3VWJB 5I1DB 2EZ0D 3B9AA 4M02A 4EVNB 3HRZB 4L4VE 2AEPL 5C09D 1PY4A 2PXYD 1IC4H 2ICES 3CSBA 3X14A 5FA3A 3HE7C 5DJYB 5IIEB 1MIEL 5IMLB 4G7VL 2H3NB 2F54D 2NYYC 4XMKH 5EOTA 1Y6NR 1F3JB 12E8L 2VDML 3SOBH 4JFDB 5HYIA 4LLQA 1X3DA 3HI6H 2XZCL 4AZ8A 1HINH 2GKIA 1CD0A 5I1HL 3DURB 3BKCL 2I9LB 1IQDA 1QZ1A 4TULH 3VXRE 4MWFA 4JY4B 3ARBD 3PWVA 3PV6A 4JO2H 1F6FB 5D1ZC 1KJVA 5IVZA 2ZSWA 4NO3B 4QHNB 1Q9WB 4I2XE 1OP3H 5MEOA 1B6DA 1GGIL 1OOAA 1MCKA 1DVFC 3L3KA 2VLKD 2KPNA 1I4FB 2GITB 3O0RH 4Y8AA 3JWOC 1XIWD 1S9XA 3DMMA 4MJ2A 1DANT 5I15H 2Y07H 1OAXH 1KV3A 2DF3A 3H3PH 4IHOA 1NFIA 4PJ5A 1NMCC 4YDKH 4Z95L 3C5ZA 3O9WB 5JORB 3EO9H 4HXAH 1DR9A 1U8NB 1N6QL 1U92B 5ETUB 4IMLB 1A6AB 4LSVH 4WJ5B 2B5IB 5HGGS 4KMQA 4NOBA 4OBSA 1MH5A 1RZ8B 5MERB 4AL8H 4P2RB 4R97C 1V05A 1ZLVK 4YHOL 5F3HA 1W72L 3TZVC 3GO1H 1OP5K 5H37H 2NZIA 2E7HA 1HILB 3SBWA 4O2FB 2P5ED 4R3SB 4XP4H 2EE3A 3B2UD 4YWGH 3ZE1F 2DYPD 4LCCA 5E8OA 4LP5A 5MEQA 1A7NH 3ULUC 5SX5H 3EZJB 4FG6C 5E8PB 3D85A 2CMRL 5ISZA 3ARFC 3KPRE 3O6LL 2FB4L 1AY1L 3FN9A 1I1YA 1ZHLB 3BP7B 2PR4L 3GMPA 4KKAC 1AFVL 1U8JA 4NBXB 4ONHA 2KQMA 1HI6B 4KDTC 4OZHA 4Y2DA 2K3TA 5A3IC 2MFNA 1RIHL 5IF0A 4UNVA 4U2YA 4EDWH 4C57C 5D96C 4OD2B 3OG6B 2YEZA 2XKNB 4UIKL 5E94A 5F1NA 1A1OB 2W59A 2P7TA 4HQQL 2Q8AL 5DRWA 3HC0B 1UGNA 1KPUB 5J11C 1A6TB 4GG6F 4IIQA 2HFGH 5D1QC 3CDGB 3EO1A 3PL6D 3TNMA 5HHNB 3VFTA 4JVPA 3V4VH 4G42A 1NBYA 5B39B 5CJXA 1K3IA 3DMMD 3LN4A 4JFDE 5CP3A 4N1EA 3BYYA 2NY2C 3FRPG 5LAXB 4PJ5D 1FE8L 2EKSB 4GOSA 5IJVB 1RJLA 3B2VH 5K59E 3PGFH 1MOEA 3C6SA 3K1DA 3MJ7B 3KPLA 1LO4H 4MD4B 2Y1VA 5I17A 1FQ9C 2NY0D 5F9OH 4BZ2L 5EBMB 1FNGA 4S0SD 1Y18B 4RFNC 3MRLA 2IG2H 1N4XL 4J3OC 1KCSH 4YHLH 5MP6H 4UIMA 4ZAKC 2ILLA 4EN3D 1QHOA 2HVJB 5FOBB 2FEDC 1FZOB 3VFWA 1IL1A 1HXYA 4HV8A 2GW5A 2CPCA 4O9HH 5D1XA 1MJJA 5D93B 3DLQR 3JTTA 5HHMD 1U42A 4RISL 5DDHB 3VDBA 1F4HA 4KDWA 3IDNB 1FAKT 2AXHA 4J3TA 4DKFL 5C86A 2SEBA 4XVSH 5GRXG 4NC1C 4P2RE 1I1FB 2DWDA 3WSQH 4LLYB 1BZ7A 4NQVB 5F1IB 3FMGL 4MQXD 3S96A 4LDEB 3NIGF 5C0CA 1CFNB 1N5YL 2AXFB 4HT1L 3QEQA 4FP8H 2A74B 1F13A 2OI9B 3BUTA 2GK0B 2VDKH 3E6HA 4PJIB 1NGPL 3WMSA 1A0QL 3BQUD 5A2JH 5HPMB 1NEZB 5CP7A 1T0MA 4PJAA 4I48A 1W0YT 2DKMA 2EYTA 4Y1AD 1W0WA 4HPYL 3WS6A 3LS4L 3K4DA 4YPJA 3NCYP 2ZOKB 4CUCA 1FFNB 5TE6H 3UAJD 3MOAL 1RUPL 2WBJB 2PF6A 3LKRA 4I77H 5CBAB 3G9VA 2PYEA 3TA3D 4ZXBB 5K33A 1JPSH 1AH1A 4YNYA 4EQ2A 1UVQA 4W70A 5F96H 2E6JA 3CFDB 4JR9L 4K7PX 1IEHA 4YUEH 3DX6B 5DEGA 5F97E 3N85H 2YD9A 2IBGA 1IZKA 2A83A 2GSGB 4PJBB 5EU6D 5BXFB 4XH2A 2EXWC 2F5BL 4ONFH 1ZGLB 3QDJB 3CZFB 3O2WH 1IAIM 1YN6A 3SCMA 4RIRB 5E24E 1QLEH 4KVNL 3FB6B 4QY8B 1U6AH 2E8YA 1CDIA 2AJ3B 5FEBA 1F6AB 1VPOH 1W72A 1FV1A 3HE6B 4OT1H 1GC1C 1YNTB 3L3HB 3C60A 1XT5A 5JDSA 3FO9A 2Y5TB 2NY1C 4HMDA 3DV6B 5EG6C 3WNLA 1C12A 3LVEA 2IQAB 1UJ3A 3OKDB 4HWBH 4XGZB 4UILL 3BN3B 3MLXH 3T0WA 2BP3A 4BYHA 4MQTB 5JXAH 3FFDB 5C0CD 3C6LC 2LU7A 3MRIB 5EOQH 1KENL 1IVLA 4RFEA 3UYRH 4ZFGH 3QEQD 4XP5H 1HQ4A 1DUZA 1TNMA 2X44D 3O2DL 1IAIL 4AJ0A 1NMAH 4P9HC 2DDQL 5E2TL 5JHDA 3MCG1 4Y4FC 1HSBB 2OCFD 1KB5H 2MKLC 4JZNB 2DQDL 4GXVL 4F7TA 3RNKA 4KI5C 2X10A 1RK1B 1HKLH 4ZYKA 2Q8BH 4Y0GA 4MA7H 2VDPL 5EFIB 4OFDA 3ZT6A 1B2WH 4J1UB 1GGUA 1ES0B 1L9MA 5EZIL 1NDMA 4GAJH 4U6HB 4PJIE 2ICEA 4Y5YB 3P40A 3H0TB 5J1AB 1JNHB 1MHCB 2BVUA 3VMOA 1A14H 1VEPA 4XB8A 1Q9LA 1T7YA 3RVXC 1I3GH 5EWIL 3VXPB 2ICCA 2EDHA 5I75B 1HN1A 5HHVL 1KIUA 2RAMA 4DEPC 2MQ3A 5JIKA 1NCCH 4RWYL 4ETQA 3CC5B 3P9WB 1JGUL 1WK0A 4YK4B 3TFKC 3SKOA 5ILTL 3KR3L 3RPIA 3EDKA 3RJDA 5EO0B 3WEXA 4NFDA 1EEUA 2PTUA 1KTLB 4MD0B 1IGFH 4UQ3A 4C83A 4XAWH 3WNNA 5C0AB 4KZDH 1YNLH 4PJBE 4X98B 4DUVA 4LNRB 1QBAA 1RZGA 2D9CA 1IM9B 3QDJE 3P73B 3JWOL 2R4RH 4LPXA 3C8KB 3MJ6A 3SKMB 2CKBH 4HXBH 3A6OA 4QOKD 5CHNA 1F2QA 1CFVL 5D5MA 2OTPA 4NQDB 4P46B 5MENB 1ZWIA 5ICXA 2QADC 1X6LA 2FRGP 4L9LC 3FRUA 4Y16A 4M93B 3RNQA 4DGYH 3MJ9H 4NRZB 3PWNB 5J12B 4JANA 3FFCB 3MYZA 4DK3A 1NFKA 3VRJA 3QWRA 2WWMC 4RNRB 4Z0XA 3VFGH 3WHE1 5HYQA 4J2XA 5T1KA 4PJAF 5MEPA 4P4KC 3EJZD 1FPTL 5K9JH 3L7EA 4JPWH 4Y4HD 3QG7H 4F15B 2V2TA 3RWHA 3UTSD 1F4XH 2ZCKH 3MREB 1N26A 4CAGA 1Q72L 4M6AA 3HPLB 4KFZC 4F8TA 1DE4A 2J3SA 1J1PH 4I3SL 4R0LA 1MY7A 5E5MA 1Y0LB 3MLRH 5KS9A 1CD1B 2BC4A 3NZHL 3QQNA 5FO7B 1ZLVH 1OAUL 4PRIB 4L5FH 1NMBL 2BOCA 1T5WB 3OJMB 1OP5H 4AIZB 3RWEB 1DN0B 3RJQB 4MZ3A 1F3DH 3E2HB 1OARH 1LO0H 2FBOJ 3MMEB 5FYJH 1I3RB 5F7LB 5E6IA 1MCRA 2A73B 5I19L 1G7QA 2W9LA 3BKMH 5IVXB 5DMYA 3PJSB 3VXUA 4L8BA 1PZUB 1A9EB 4H20L 4LFHD 2DQTH 4JFEA 4L8DA 4ODXB 3U36A 4YHKH 2FH6A 2J8UF 4HLJA 3FT2A 4KVCH 4PRAA 3QCTL 4QYOA 4R96A 3BW9A 5DRZA 5TQ2H 3X3GH 4V2BA 3B5GA 1F3DJ 1PG7H 5EN2A 2RCSL 3E8UH 5BO1L 4LKXB 4BH7A 2HTLD 2YK1H 4DN3H 1CE1H 2BNUB 1X5HA 2C3XA 4NFCA 4F9PC 2BVYA 3WN5B 1UB5B 3RZCB 4GLRH 5C0GB 2P8MB 4JFYB 4LVNB 4OKVA 1YQVL 4NHCH 2AJYL 4AMKH 5JW3L 3H9ZA 2IAMB 5TPWL 1ZVHA 3R8QA 3L6FA 2ARJA 2DLFH 3NABH 3ARPA 1WQVT 5FK9A 2XTJD 3O2DA 3G5YB 5C0AE 1QFHA 3Q6FB 5FYKD 3BGMB 3S4SA 2BCKA 3BZ4A 1CK0H 3BEWA 3MGTA 3UTPE 4LHUA 2PO6D 3E6FB 1SEQH 5K9QG 3ARGC 5L9DH 4U6YB 3MRDB 5DQDL 4WWKA 4Z78A 3I6LD 1N2RB 4NQDE 3T1FA 5DEZA 5MENE 1IKFH 4UUJB 2EDYA 3LN9A 5F6IC 3HKFA 4EUPH 2UZIH 2DQFA 2GT9B 3MLVH 2IPTL 4YHMH 3FFCE 2HJKA 4L4TB 1INDL 1KCUH 3SDAD 4H25B 2FNBA 3KLDA 3FOLB 4JQIH 4K7PY 3HE7A 3MO1B 4GMTL 4WI4A 4J7RA 2UWEF 1VKXA 1HHKA 5E6ID 4S1RL 2Y6SD 1KB5B 2C3VA 43C9A 4YE4L 1RFDL 2W91A 2DMKA 5IHZB 2XICA 1JRHH 2DKSA 4O51A 4XZUB 4HEME 4YO0B 3O41A 5F7UA 4HLZG 3QG6B 3S35L 3WIIL 1H8OA 5HHOA 1OAKL 1R3HB 4PRIE 3U46B 5ICZB 5CWSB 3ZE0F 3L3GA 4TVSa 5D1ZA 3LEVL 4NGHH 1IAKA 3SDXF 3ILPA 3MLZH 2B4CC 4HULB 2CKNA 3P2TA 3MRBB 4PGZA 3MBED 1DVFA 4HS3A 1RU9L 4IRZH 4DZ8B 3L7FB 5IVXE 4TUKH 3IDMB 3BP6B 4ELKA 2I26N 2J8OA 4XWGH 4XVTH 1HNFA 5GHWL 1G6RL 2X42A 4E42A 4PJDB 2H9GB 1SYVB 1DCLA 3HMWH 3FQUB 2P44B 1IMHC 4P2CG 1XZ0A 3VGAB 2HFEA 5GXBB 3ARDB 3ES6A 5TDNB 4NC2B 1MRDH 3MLUL 4R4NC 4XP1H 5GIRB 1F45A 3HUJA 3P9LA 1CG9A 4HC1H 2B1AH 3TZVA 2PW2B 3OZ9H 4M1CC 5GJTL 2APWA 1KCVH 1ONQA 1GC1L 1U58A 1CLZL 4LF3A 2APBA 1A3LL 1RUKL 3RL2B 4ORZC 3PABB 2CKBB 3FO1A 3LZFL 1H3VA 1UXWB 3NZ8A 2F9BT 5HBBA 2FSEB 3NAAH 4Q9RL 3CFEA 1JZ5A 1FL5A 4ORGB 5F88B 5FECA 3FT3A 3MRHA 4YDLB 3ARFA 4R6UA 5IT2L 1P7HL 4JFOB 2HT2D 4GW5B 3SKJL 2EEAA 4KGLA 2ITCB 5FCSH 4KDTA 5EDXA 5J3HD 2R2BB 3B6SB 3U9PL 4XBPB 4HIIA 5ID0A 3T65A 2IPKA 4E41A 1EHLL 4P9HL 4QHMB 5DD3H 5F7YC 4XP9L 1IT9H 3QIUC 5B38A 4XTRC 3VFMB 5DFWH 3G6JB 5HVHC 5EBLA 1CLYH 4OCRH 5IM7B 3CJJA 1QACA 4L4TE 2X4QB 3S36L 1IGCH 5DI8B 5D1QA 4H8WH 2J88L 3F6LA 1LK3L 5CZXC 1PQZB 4ZUSB 4X8XA 4D3CL 3UZEA 6CGTA 4JKMA 5MHSD 5FDWA 4BFGA 2OR7A 3F8UB 4N8VA 5F9AC 1TTGA 4A6YH 2L7JA 1MF2L 2W0FA 3QHZL 4QRRB 3AAZA 4JGMA 3QAZC 4V1DA 4XC3H 3ZKSD 4OZIA 2B2XH 5GZOC 2X05A 5KSBF 3P11L 5TQ0L 5DMKB 3MCLH 5I73B 4X8JA 2KKQA 4ZUTB 1J86A 43CAA 1U3ZA 5JMRA 1CIUA 4LAQL 3RGVB 4L3CB 2FWOB 4ZAKA 4PUBH 1UACH 4OF6A 3ZT5A 4GLRI 2ITDA 4URTB 4LDOB 5D6CA 1D9KC 1DBAH 2Y72A 4WHTB 5HYFA 3QRGH 2D7TH 2FD6H 1P9MC 2IFFL 3N1FC 4PJDE 2GY5A 4NQSA 4NQED 3EOAB 4P2QB 2V7HA 1RJZA 4JFXB 2E7BA 3T0AA 3MNZB 4X6DF 4Y2OA 1EK3A 3AUVA 4H0GA 1FL6B 1ORQA 3KPNB 4O2CB 2AW2A 3UPRB 1HNGA 1ZT7A 2FIKB 4KPHL 4UT7L 1MFAL 1UXSB 4LPCA 4M5ZH 2Z93A 1OB1A 5E2UL 4LEOB 4MAYC 3BPOB 3UDWC 1YEDA 1QVOA 2CD0A 3MXWH 4XPHL 4KTDL 2BDNH 2YA2A 2EE9A 4U6TA 1KF9B 5F9JB 3L9RB 1UA6L 4KV5F 3MLTB 4ZFOB 1JNLH 4K9EC 5IGXL 1NAML 4Z7VB 4P23C 4EUPB 3MCKB 4PJFA 1EHNA 1NFDA 5GGTH 1ZEAH 1FVEA 2Y06L 4MA3A 2R2EB 4FZ8H 5FA4A 2C26A 1YEFL 4OZ4B 1Q1JL 3IKKA 1JRHI 2B1HL 3G5ZA 3OKYA 3QCUL 3TNNA 4HMEA 4M8VA 4MYWB 3E1F1 1LE9B 3TO4D 1RIVL 2CLRA 4WI7A 2G5BA 4J6RH 1HIMH 2Z31D 4QRPD 3G6JE 3BRGC 1UZ8A 1R5VB 1GGCL 1G6RA 3F58L 4XNUH 2Z8WC 3IGAA 1P69B 5ADPH 4NJ9L 5CILL 2F74A 1E4JA 3QDGA 2P5WB 4JDVB 4WW2C 1S9YA 1HSAA 4M6NH 2R2HB 1FIEA 3RWDA 5DS8A 4U3HA 1RHHB 5FF6B 3HUJF 1A1MA 2NW3B 5C07D 5C3TA 1UT9A 3QWOA 2BSSB 1QFWL 1X5AA 5F7DA 3PV7A 4QRRE 4RGMC 2GFBA 5EIIB 3AY4C 4ONGH 3W0WD 4YBQC 5I76A 5FYJE 2QR0B 3I9GL 1XH3A 5KTEH 5GGVH 2G5RA 4YHZH 5C8JA 3GIVA 1WBYB 1U2HA 1CDBA 1MHEA 5J6HA 3FT4B 1I85C 3O4OB 3W82A 1NLBH 1M1SA 3QI9D 4AEHH 1I8IB 4PJ8B 2UVFA 1TJGH 1JZ2A 3DIFA 5E9DB 3RU8L 3U4EB 4Z7WA 2Z0BA 3P77B 3RUGF 2NY4B 4PV9A 4RA3A 3C6LA 3V6OE 3G6DH 1UWGH 1EJOL 1R0AH 5BJTB 5AUMA 4G6JL 3NFNA 5DJ0A 1DBML 2FL5B 1YY8A 4P2QE 4HIXL 4QXGH 4Y4FA 3LSOA 3FTGB 2FR4A 3W2DL 4NO2B 2XY1A 1AXSA 4ODVL 4RA0C 1EFXD 3PWUB 3NPZB 1L7IL 3UJTH 4QCIA 1JHLL 4UT9H 4FXKB 2IADA 4HK0A 1FG9C 2E3VA 35C8H 3DSFL 5FOJA 3DX7A 1KULA 1CDYA 3U4BH 2HG5A 1WC7B 3V7AE 1R6VA 4P2OC 1HYSC 4KY1L 2EDWA 3O45B 4UI2A 3IVKA 4JLRB 4QNPF 1FFRA 5H2BB 3MRCA 3CPLB 3HMXL 1Q8MA 1FSKC 5F89A 4KZEL 3RDTB 2IGFL 3HI1B 3LQAH 4Z7VE 1A4JB 2JCCB 2AGJL 1FNSH 4JO3H 3SY0A 4S2SA 2J7LA 3DARA 3WKML 1IEBA 4KRMB 5FUZH 1V7NH 2XN9D 1EPFA 1TVDA 3CFJA 3F5WA 3OKNB 4U2ZA 4DKDC 3M8OH 1J1OH 3UO1L 4MD5A 5IEHA 3BESR 5B39G 1EEYB 2XFXB 4FZEH 5DVKA 1X5JA 3MSPA 4K3HA 3DSNA 4AENA 2XG5A 1KLUA 3T04D 4FABL 5I8EB 2Z4QB 1AP2A 5INDA 2B4CL 2HH0H 5E2WH 2FX9H 2Z35A 2Q76A 2P5WE 5JW4Q 4Q9QL 3K2UL 1CFQA 3WCYA 5HYJA 5C08B 1RULL 3GEWB 3ARVA 1GHFH 4P9MH 1TVHB 4KRPD 5BMFL 3LDBC 3Q0HA 5CUSH 5C0IB 4PY8I 3GSNH 4OM0H 1RJYA 4L9LA 3R0NA 1INEL 3AREB 5T5NG 5IMKB 3LKOA 3PHQA 4MDJB 1EUUA 1Q0YH 2CUHA 4OLZL 4G5ZH 3VFOB 3S98A 1G7IA 2CRIA 1WVZA 4XNMA 1TIUA 1OTTC 4P4KA 1YYLH 2NY3B 5BRZD 1NAMA 3RWCB 1DN2A 5E9DE 4X7SH 3PWLA 4RSVA 3VRLF 2Z91B 4GAGL 5BS0B 4Y19A 3S37L 3DYOA 1RZ7H 4JRWA 1I9JL 1WTLA 3QIWD 4POZD 5FB8B 4XNXH 2C1OB 4WTXA 2PYFB 1KCLA 2V2XA 1QQDA 1HQRA 2HRPL 5DT1H 5DUPL 5ID1A 1FZJB 2C7UA 1F11A 4XRCB 4ZFZB 5TFSL 4K94C 5L7XL 2VLJA 5DJDA 3L5XH 1B4JL 4X0KA 2AQ2A 4NWUL 4DFHA 3EYSH 4LLVB 1ZS8A 3ZZ1A 3I02A 4YHNA 2BSRB 5SWSB 5F7FA 5GRJL 4BELD 4BQBA 4UNUA 2ZUQC 4OIAA 2P43B 2Q86B 2FX7L 2YBRA 5EO1B 1BIIB 3GMRB 2X7LB 1KPVA 4WEMB 1SBSL 3MV9B 3OHXB 5E5RB 5TGBB 2NY5C 4OFVA 2AABL 2F53B 2YRZA 1FRGH 2YD4A 2JCCE 4LLWB 4WI9A 2EKJA 1ZLSL 4PLOB 2W38A 3HNVL 1U8MB 4TSCH 2QQNL 4L8SC 1LK2A 5IROC 4F9PA 3MXVL 4TUJA 1DLFH 2ZSVB 2EXYC 3LY6A 4IRJD 1SEBA 2VZVA 4I0PC 3A0OA 2FGZA 5D72L 1CQYA 1SM3L 1JPTH 1XEDA 3PGDB 4NO0A 4RGNB 1WBXB 4RQQA 1I3UA 4N0YL 1NGZA 3WDIA 1WFNA 4NC0B 3KPSB 5I8CA 4XBGA 5DQ9B 4LKCA 3BXNB 3FRPA 5C08E 5GISL 1MEXL 1HH9B 1KB9J 2IANA 3QFJD 5T1MB 2R29H 1M6OA 3QDHA 4TRPH 1QR4A 2WBWB 3H7BA 2BSTA 3QJFA 2E6PA 3AVEA 5KG9B 5CCKH 3VFPB 3TP4A 3WE6B 3MRPA 2D2OA 5JIIA 4HUWB 4NT6A 2OXHA 1QOKA 1VDGA 4Y5VB 5T33H 2VLJD 3DUHA 3OB0K 2VAJA 3HMXA 1P7KB 5H37G 3PIQB 2YKLL 4MNQA 4MNGB 3CX5J 3VH8G 2WZPD 1EXUA 1CU4H 5BS0E 2DJUA 2HKFL 3LKSA 1GYAA 1MRCH 1FYTA 1RV6X 5DD1L 4OZGF 3ZDZE 2E27L 4GKOA 4JFQB 4X80L 4X4MA 4X6CA 3HC3L 4X83A 3CLFL 2GUOA 4JAMA 4LARL 1A3RH 4I3RL 3RI5F 5ESVA 1KXTB 3HR5B 3GJFK 2L4OA 4ERSH 3QHFH 1MQ8A 4QF1A 3RFZC 3V4PL 4TVPH 1KTDA 4HWEL 3DRQB 5SWSE 4X5WB 1BIHA 3P4MB 3WFBL 3VXSB 5AAMA 1ZOXA 1BX2A 1H15B 1N7MH 1TQCB 1IEAA 2ZCHH 3MRNA 3QUML 5DWUH 3THML 4N5UA 4Q2ZA 1PZ5A 4UAOB 3OKOB 3VWJC 2CQVA 3DNKA 2R0ZH 5SWZB 1T22B 1IC5H 2MSPA 3MUGB 3WHXB 5ACZB 3ESUF 5DRNA 3MV9E 3VCLA 4TPRL 4GRMA 4NOFA 4CGTA 2F53E 3A67H 1KT2A 5K9KB 4EI5B 3NTCL 4FQLL 1AR1C 2V5SA 3S34H 5D7IA 1KLGB 2VR5A 5ACLA 2JELH 3DXAB 2A6IB 2R0KH 5EUOA 1WISA 4XAKD 5DD5L 4JY6A 3V95A 4CW1A 1CFSA 1ZHKB 3VXTB 1KPRB 1G9MH 4G8EA 5KAQF 1UYWH 1A7OH 5KSVA 3PQYB 4RGNE 3VI4F 2HT4D 1YYMH 3ALPA 1J0IA 4PY7A 1BF8A 1RZKC 3GSNB 3U6RB 1EO5A 5TDPB 4K3JL 3KPSE 4UU9B 4EBQL 4APQB 2P8LB 3EYVB 2OTUB 3OXSA 4U6VL 4ISVA 4NM8H 5C6TH 1TLKA 4KKLC 5JNYB 3KLAB 2X4PA 4MCZB 1E28B 2R1XA 1X5KA 2R0LH 2MCG1 2JE8A 2J5LB 2IBBA 4JPIA 4PRPB 4M7ZB 2FHCA 3QIUA 1ND0A 1VFAA 4FFWD 3AU1A 2E9WA 3ZKNC 1J9CT 2B5IC 1KIQB 2ZCLH 3TN0D 3TPUA 1Q9KB 2AQ1A 4FTVA 1O5DT 2WSKA 3NA9H 1J0YA 5L2KB 2O5YH 2LQRA 4UV4H 3CVIL 4NZRL 2CR6A 3P0VL 4MNGE 4UB0H 1T0PB 2X4OB 1LD9A 2ZJSL 1E4XL 1HCFX 1QYGL 4PBWD 3K74B 1X5GA 3CUPB 1QBML 3CIQA 1A21A 1G7HB 3HG1B 3GSVB 4JM2B 3TBWA 1JGEB 1K8IB 1AE6H 1AD9B 1SJXA 5FYKU 4OI8A 5LGJA 3ILQC 4JJ5A 1BP3B 3D0LB 1NGQL 4OV6F 4DUXA 1AQDA 1IZJA 3VXSE 4LBEB 1JZ4A 1D9KA 2HMIC 2YPKA 3MJ8A 1P9MA 4QT5A 4F80A 1FNEB 2EE2A 3O3EA 4RZCB 4C58B 4O2EB 1ODAA 4FMFA 5SWZE 1DBKH 4JFFB 4NHUA 4DKEL 3B9KD 2ADFH 3MA7A 5KJRL 4ODSH 1CGUA 1YJDH 2BFVH 3DUSA 3T0EB 3DTXB 5IFJA 1Z9MA 4JO1L 4CL7A 3U0TB 1REIA 8FABB 4IOFC 1HEZA 1HHJB 4CVZA 4XCYB 4CKVX 3X13B 4G80B 3DXAE 4MAYA 5FUCE 3UDWA 5DUMH 4G8GD 1PGRB 1MRFH 1CFBA 3PWPB 1CI5A 3BP5A 3C09B 3QIUD 2H32H 1HZHH 3PQYE 1U93B 3NH7H 3TJHD 1PBYA 3G08A 4XMLH 5E8EB 4ZODA 3BISA 1MFDH 4H26B 4X6CF 2OR9H 3PP4H 4P23A 1P4BH 1K4CB 2AJSL 3VXNA 5F9WB 1C1EL 4QXTB 3CVHL 1JWMB 2OXGA 1JPST 3GHEH 4HUNB 3S88L 1ULVA 2C3WA 3TBTB 1UM5H 5CGMA 1YECH 4QRUB 5TH2B 2HVKA 1SYSA 1AXIB 1I9IL 5IQ9B 3VD3A 2GJ6D 5DHYB 5D93C 2UYLB 4PRPE 4NKDA 5T1LB 3QUMA 1JWSA 3CFCL 5GZOD 2X1XR 3MNVA 5GRVL 3SE3C 3MLYL 1U8OA 1R3KA 1F4WL 4WW2A 3X3FH 1H3PH 2DM2A 4JPKH 5CSZA 1LQSR 1JV5B 2CUMA 1UEYA 4PJCB 5L2KE 5HHPA 3SDDA 2GCYB 1W2KT 3R4DA 5HGDB 5IR1A 1MNUL 5GSVB 5E99L 3UPAA 1LEKA 3TO2B 2PNDA 3UTQB 2WWKT 2HFFA 3WO4B 4I8DA 2J6EL 4P5MA 1AI1H 2CLVB 2F8XC 1D9KD 4WU5A 3MRJB 4HG4J 2OI9C 5TE4L 3AY4A 3QNXB 3UCRA 4UT6L 5T1DL 1IQWL 2NY5L 3HG1E 5JW5B 1KEGH 1KG0B 4NNYB 4JO4L 1PKQA 4M7KL 2NPLX 4AM0A 1ZXQA 2OTWA 2VDLL 1GGYA 4ZPVA 3MV01 1I85A 4PJ9D 3FL7A 1WIUA 3VWKB 2Q7NA 5D71L 1AKJB 5AZ2L 4EXPX 3VE0A 1N0XH 3NIFF 2BVOB 4EJ1C 4WHYH 4YQXL 2WBJC 1CLOH 1NPUA 4R4BB 3MNWB 4XCCH 3IB4A 3TEUA 4MJ5A 4F33B 2ED7A 1LEIB 3T4AA 1MCOL 1F02I 3NCYS 2AXGB 1OAZH 3P0YH 4HFWA 1IGJA 5F7HA 4JFFE 4I4WA 1RK0B 1ZKAA 1WWAX 5CLTA 1T2JA 1QA9B 2EIBA 3GGWA 5CEZH 5DJ8A 5LCVL 3T0EE 3U1SH 3DRTB 5GSRA 5SX4I 5HXMA 2ENSA 4XXDA 5DK0B 5ALCL 1WIOA 3QCVH 3F6IA 3STLB 1EJ6A 3OR6B 4IJ3C 2DD8H 2VZOA 1FJ1A 5AG9A 3D18B 2EYSA 5I0DA 5J9PA 1KIPA 1MREH 5DVMA 3PWPE 5ELIA 4P2OA 5JOEA 4XPGH 3UZVB 4ETYA 3SO5A 3V2AR 3HZKA 1JWUA 5DMIL 4I18A 3WIHH 3P30H 1T2XA 2G9HB 3VFSB 1EA9C 4AIOA 2AS5M 4TTGA 2AV7B 2NTFA 4MQ7B 1JMXA 3SDDD 2XNAB 3UTZA 3GSXA 2O5XH 3SDYL 3BSZL 5IJKC 5EU7E 1A4KB 4ZUUB 4HUVA 4Z7OF 2Z92A 3U7WL 3GB7B 2CIKB 2ED8A 2W0LA 3P4NB 3HZYA 1U8PA 3FZUD 4FQCH 5GS2H 1XGTB 3G5VA 4WO4D 2DQEL 1T1ZA 4PJHA 5LWYL 2FEEI 4OUUA 3VG0L 2QQLL 4KTYA 5H94B 2X9XA 3NACL 1UZ6F 3IYLW 2BOBB 5C0BB 1IGMH 1IGYB 2NR6C 4PJCE 1R5WB 4RRPA 1ACYL 5EZJB 1LVEA 4HIJB 1U3HD 4L9DA 1QEWB 2VDOL 4NUJB 2VTFA 4XCNB 2DQUH 3EFFB 5IK3B 3BYTA 3PGCA 3L3JB 4QXUH 2AKRB 1MUJB 3DWTA 1YNKH 3NFPA 4YBHA 5I16B 5JZ7D 5J0BA 1FNHA 3QUZB 2WUCL 4TVPE 4KQ4L 4PD4J 3LKPB 1WZKA 1YDPB 1F4YH 3CSYB 3NCJL 1VACA 4Y5YC 4L8CB 1BAFH 4JG0H 4Z7NF 1RUQL 1FLRL 4O02L 4JRYA 3GRWH 3ZDXE 1WAAF 5IBUB 5T3XH 4NSKB 4OGZA 5E4IA 1C5DA 4U1LA 5EU3B 5HGAB 2MWCA 5I75C 4HKBB 4F3FB 1HWGB 1M71B 3O4LD 5D2LF 3CVHA 1MFNA 5JLZB 1PEZA 5BZWA 5JUEL 4YK4C 3MLWL 1XF5B 5DD0H 5DJ6A 5IP4A 2VXVH 4XHJD 4F2MA 1GGBH 3S3PA 3BKYH 2Z8RA 1U8HB 2DBJA 4LRNH 2M1KA 3MV8B 4EDXA 4LSQH 4NKMB 4NRYB 2D31B 4C4KT 5IW3A 4OJFH 5JQHC 1TJIH 1MCWM 1HH6B 4KU1A 4D0CB 1SY6H 1K8DA 4GUPA 3ZKMD 2H32B 3RL1A 4EUPG 4P46C 4OIIL 1R24B 2LVEA 4DZBA 4UDTA 3BFOA 3EOTH 4FNLH 4P2YA 2J6EA 5HI3D 4S1SH 3ZKXB 3DO7A 4KK8C 4GO6B 4LMQI 4M93C 2A77L 2D3VA 4L4VA 5J12C 2Q7YA 1RAMA 4KHXH 4LSSH 4FFZH 3RWIB 3VMPA 5BOZG 3FB5A 1D5MB 4LSRH 3KYOA 1XR9A 5LGHL 3IDXH 3ORJA 4F15C 1Z3GL 5IROA 3WJJC 1L7TH 1XFPA 3MRMB 1JPFA 1NUDA 4GAYB 3BT2H 4HBQA 4IDJL 5HGHB 1I8KB 1YEGL 1HDMA 4D9RE 5J6GB 4E9LA 2A6JB 1JCKA 2NW2A 4O58H 2D7MA 3QPXH 3TCLA 4FQXD 3OX8B 4HJJL 4K2UL 1CBVL 1I7TA 4DWHA 2YD3A 5C0BE 3E2HC 2P1YA 4I2XA 3L3DB 4RBPK 1JNNL 4NNXA 4X9BA 5H35B 1QRKA 4BZ1H 5JMOC 4LQ1A 1XGQB 3TH2T 3QQ4B 5DO2C 1ADQH 1K85A 1YPZF 1GIGL 4G9FB 5E70A 1PYWB 1H0DA 1A5FL 1Y6MR 1ZK9A 4PLJD 1LNUA 1RURL 1QBLH 5F6HJ 5IESH 1KGCE 1N59A 4DN4L 3OKEA 4LLMA 1S7UB 2EICA 3MRFB 1FFOA 5ALBL 5DJCA 3G04A 3QH3A 3VFNA 3QULA 4LU5L 4KI1A 5JOPD 3TBVB 2P42B 2V5YA 1G6VK 3KPMA 4ENEC 4WU7B 1YEKL 1UQSA 1NUFA 4PR5A 3WN5C 4PREA 3RZCC 4JZJB 4LVNC 4YFLF 1T1WA 1JK8B 1BM3L 3O11B 3ZDYF 2EH7L 3ZTJG 4QXWA 4ZTPH 2P8PA 3W39A 2VO5A 1VA9A 3D87B 3H42H 2IH3B 1MCSA 3MV8E 3O6MH 4BH8A 1WFTA 3V4UL 4WUUD 1HHHB 1QSVA 1KJ3L 1NCNA 5E2VH 3KPRA 4CMMA 5IB2A 4HHAA 1G9NL 2P45B 5DTFA 4F58H 4MCYB 3VGBA 2E7CA 3OR7B 2IALA 4I5BA 3MLSL 4LQFL 1FDLL 4KTEL 2GIYA 2EXYD 4BFBD 3VWJA 3IFNL 5I1DA 4CNIA 4RMUA 1IBGL 3U83A 4NQUA 3VA2C 1FHGA 3EW3B 4OQTH 3ZL4L 1DBJH 1V8HA 4Q0XL 3LHPH 1A7PL 3WFHB 1XCTB 5CMAB 1X4XA 3X12B 4K3DH 3QA3B 5EZOH 3QPQD 4KK5D 3T4YB 5JIPA 5DJYA 5E00B 5IIEA 5IMLA 1UWEH 2H3NA 4LMQE 2VIRB 4MJIA 2A0LC 3D25B 5I9QB 3DURA 2I9LA 5D4QA 1BFVL 2E6QA 4NM4H 4JY4A 1JGVL 3ULVD 4CJ1A 4GRWF 4RX4D 5IB5B 5ENWB 3H8NA 4RMTA 4QHNA 4NO3A 1Q9WA 3T8XB 2X2YA 1WIPA 2OP4H 4JFZH 1I4FA 2GITA 1JYWA 2XQBH 4L3AA 1IC4L 2XACC 3RWFB 1BHGA 2H41A 1GSMA 1CZ8H 1ZLWK 3WFZA 4G9FE 1CGWA 1H3UA 4XMKL 4YXLH 3LAFA 2WUBH 2I5YH 3PWJB 4M00A 1TZHB 5JORA 5IQ7H 4JRXB 3HI6L 3CX5K 1U92A 1AO7B 1HINL 1A6AA 2E5EA 4IMLA 2JIXD 3VGAC 4M4PA 3VXOB 1S9KC 4M6OH 1NDGB 4DCQA 3ARDC 4DGIH 5MERA 2HT3C 4TULL 3IJHB 4XPFH 4JO2L 3QUYB 2OYPA 4O4YL 1OTSD 4NYLB 1N5AB 4OV5B 4Z7QF 3MODL 1IARB 5D70L 1HILA 2BNQD 1T03H 3GMLB 4YDJB 1JPGB 5CEZE 3O0RL 4AH2B 3HC4H 1IM3A 4GRLB 5I15L 2Y07L 1OAXL 3H3PL 5DF0A 1RZJH 1MVUB 5EO9B 5DURB 5E8PA 4M61B 4YDKL 1SJHB 2YPLD 4Y4KD 3EO9L 4HXAL 2RR3A 4YDLC 5E5UB 3BVNB 3B9DA 5BZDB 3OTTA 4WDIB 4WTZA 3BP7A 4GJTB 2DLHA 4UDUB 4LSVL 4N0FA 1WJ3A 3QEHB 4EXKA 4AL8L 3RA7H 3D2UD 4Y89A 5DLMH 5DZLA 3UTTD 5EZLB 1S8DB 5EORH 2J2ZA 3GO1L 1GZQA 4MJID 5TF1H 1OT1A 4OD2A 4ZO6A 1A9BB 1BVZA 2CSPA 4K3EL 1A1OA 3DROB 3BKJH 1I9RH 3VI3E 3GSUB 1A6WL 4XP4L 4ZFFB 1KPUA 5I71B 3ULVF 2HRLA 1JZ6A 1A7NL 3CDGA 3MFGB 2F19H 1MCNA 2YOCA 2M8XA 4MXQD 4JN2B 4OIBA 3VXMD 5B39A 5AYUL 1OL0A 4MNHB 3QDMA 2QTEA 5IFHL 4UOW1 4EEEA 3GK8L 3QXUA 3B5TA 3OQ3B 5CD5C 1QR1B 1XGRB 2NXYD 3M17B 2VDQL 2OK0H 1IRAY 3JXAA 5LAXA 4M1DH 5IJVA 2RBLA 4M8QB 3MJ7A 3FQRB 1S3KH 4EDWL 5CEXB 1R5IA 4MD4A 2WW8A 1VFOA 3TVMB 2R4SH 1XAUA 5EBMA 5I73C 1M05B 4OCWH 1Y18A 5HYEA 3MRGB 3RGVC 1NCBL 5A2LH 2HVJA 2HFGL 4OF7A 5FOBA 3QUXD 1AIFB 1FZOA 1OAYH 5LGKA 1J8HB 1MCEA 2GAZA 1XGYL 1LWRA 3V4VL 2JJSC 1V3MA 4WCYH 3V6OC 4KXZH 4D0BB 5T3XE 3LS5H 3LEYL 3WFEH 4MS8C 5KW9L 5TE7L 4JRXE 5DDHA 4HH9B 4P48A 1AO7E 1L0QA 3IDNA 1EBAA 3SE3A 3DECA 3PGFL 1WGOA 1BD2B 3S5LG 4XI5D 5BQ7B 1I1FA 1LO4L 4LLYA 5F9OL 4NQVA 5F1IA 1HYRC 1QKZL 1JE6A 3S35X 4H1LH 1KCSL 3BPOC 4YHLL 4OD3H 1CDHA 2A74A 4J3WA 1MLCB 3BRFA 3MUJA 2GK0A 4L3EB 3CXHK 4PJIA 5C92A 2GSIA 2GTZB 5HPMA 4O9HL 3KYAA 3KHQA 2X4SB 3A6CH 4PLKC 1BECA 2I9TB 3GSRA 2NZ9D 1S78D 1IC7H 1DQQB 5L6YH 2ZOKA 1KUMA 4CRPA 4XVSL 1FFNA 2WBJA 1JUFA 2Z9TA 3QDMD 4WFFE 3IFPB 3WSQL 5CBAA 1FG2A 4UBDC 4JHAH 1JYVA 5AEAA 3OAZH 4ELMB 3V7MA 2BHYA 3DX6A 5F21B 5C09B 1ERNA 4FP8L 2YD1A 5BXFA 1FNLA 3QDJA 2VERN 4FXGB 5CP3H 2P24B 1BQHG 2X40A 4RIRA 2VDRH 1LHZA 4QY8A 1EGJH 2F54B 3NN8B 3DI3B 2G60H 4Z7UA 5SWQB 4LPVA 5IBTH 2AJ3A 4KROD 1F6AA 4K23L 3Q5YA 3EO0A 5HHQB 5TE6L 4HWZB 3RVUD 4LPTA 1DLHA 4X4YB 1ETZB 3L3HA 1TCRA 4OSUH 4I77L 2JKXA 3ARBB 1JPSL 4GG6B 3SE4C 5F96L 3DV6A 1ORSB 3ZHKA 1XF4B 4JFHD 3D0VB 3O4OC 4LVHB 3OKDA 4PJ8C 1ZANH 2VLKB 4XGZA 3L5WB 1XIWB 5FM8A 3QBTB 3S97C 3O2WL 5EC2B 5DJAB 2NY4C 1J8HE 3WFCL 1QLEL 5IJKA 3IRPX 2AEPH 4GKSB 4WFHD 3BRDA 1U6AL 3N1QC 3WXVL 5F7NC 4XP6H 3S36X 1VPOL 4GKNB 1B6UA 8CGTA 1HSBA 1P5UA 4OT1L 1LO2L 3HNTH 2PUQT 3VH8A 1MIEH 3EYQC 4JZNA 1BD2E 1CXFA 1T7ZA 4YHIB 2VDMH 4X5XB 3FKUS 3BZEA 3FB7B 4S1QH 4MDIB 3AFLA 2NCMA 4Y8DC 5E95B 2P5EB 3JV4B 4GKZB 2QQKH 4HWBL 2HLAB 4J1UA 4IOSD 3QFDB 4BSVB 2DYPB 1KIRB 3U30B 1JVKA 3MLXL 4AEIL 4L3EE 2XWJB 3FQXB 4U6HA 1S7TB 3HPJA 2XA3A 4HCRH 4Y5YA 3UYRL 4UTAH 3H0TA 5J1AA 1JNHA 1MHCA 3OJDB 1GGIH 5FHBH 3HCVB 3MRQB 4WV1B 4IRSB 5F93C 5JXED 5CS7A 3RDTC 3IDJB 1NMAL 5DC0A 2R69H 1KB5L 3VXPA 1BQLL 1TDQA 2QHRH 4OD1H 4IDLA 1YY9C 2VZ1A 1JMZA 3CC5A 4LHJB 4NUGL 1FO0H 3ZE1E 1HKLL 2EYRB 1JI2A 4OLUH 4LDLB 4H8WC 1ED3A 1N6QH 1JGLL 5IEKB 4MA7L 1HOCB 4ELME 1B2WL 1KTLA 4MD0A 3RX7A 3W9DB 5C09E 2YC1B 5C0AA 4MWFB 4X98A 2J12B 4LNRA 4YHOH 4BJLA 4JM2F 2NLJB 1IM9A 1J8KA 3PL6B 4HJ0C 1MHHB 2XT1B 1GGTA 5MEOB 3C8KA 3SKMA 2DTSA 2F54E 2ZUXA 1K2DB 1S9XB 3DMMB 2YWZA 3PHSA 4P46A 2Z8VC 3BH9B 4KXZI 1P6FA 5MENA 1I3GL 4ACPA 4YX2H 2EDTA 4PJ5B 3IETA 3AREC 1NCCL 3FO2B 1A02N 4ZOBA 2CK0H 3PWNA 5F7MC 3WD5H 3FFCA 3SPVB 1UB6B 4Q9BA 4GG6E 2NY0B 1KNOA 2PR4H 4RNRA 2FBJL 1OGAD 1KC5H 2NX5A 1IGFL 2X6MA 4XAWL 2DTMH 1YNLL 3KXFA 3MRRA 4KZDL 2NY3C 2FATH 1QLRB 2G2RB 2VLKE 4EN3B 2QHLA 1BJ1H 3MREA 2MQCA 1EUTA 3WJJA 3HPLA 3IJSB 4UIKH 4YBLB 1C16B 4HXBL 4HQQH 4D94A 1R3IH 4YXHH 1Y0LA 1U8IB 1CD1A 3U7YH 5DZNA 1NEUA 4PJ7F 3UTOA 1T5WA 4AIZA 4H1LB 3RWEA 1DN0A 1X5FA 3GKWH 2CGRL 4NP4L 4XNYH 4DGYL 3MJ9L 4IEFB 3MMEA 3QXDA 1I3RA 32C2B 2KUTA 4DQOH 3VFGL 5FDYA 1J05B 5IVXA 1OD7A 4Z76B 4PJEF 1JFQH 5C6PB 4MJ4A 4JPWL 2XXCB 3U2SB 2P5EE 2BSED 1AHWC 4DVRH 1F4XL 2ZCKL 4HZLB 4HX1B 5IF0B 4ODXA 5CIPH 3KS0J 2NNAB 2BXYA 3BQUB 5F1NB 3O8XD 2P7TB 3SGKC 3JTSB 4M7JH 4Y1AB 4OLXH 4E5XB 3T0VA 2JB5L 4IIQB 4W6XB 4NPYB 4L5FL 5JOFB 2V2WA 1BJ8A 4LKXA 4G42B 1WWCA 3RP1A 1EV2E 3NIGE 1QSED 5INCB 2YPVL 5FYJL 3WN5A 1UB5A 3RZCA 5C0GA 2P8MA 4JFYA 3TA3B 4ZMAT 4HKZB 5DC9B 4PBVC 4DAGH 3BKML 3O81A 4R2GD 3O3BB 4NN6C 4DKFH 3ZKQD 2WNGA 4RGNC 2DQTL 5FKPB 5EU6B 3REVB 2BHUA 1UCTA 4CADB 3BGMA 2X9YA 1T83C 2NX5D 2VSCA 3MRLB 5TQ2L 3X3GL 3E6FA 4AY0A 1EEZA 3KXFD 4UIMB 4U6YA 1PG7L 4LCUA 2ICWJ 1N2RA 5FYKH 1FYHB 1K9TA 3T3PF 3E8UL 3K46A 4UUJA 3VRIB 4M03A 5JA9A 4DN3L 1CE1L 4PJ5E 4G6AC 4HWBA 3CXDH 2GT9A 4HPYH 3JTTB 3LS4H 3RVWC 4NHCL 2X1PA 4C56B 5JW4R 1KCKA 4L4TA 4QTHA 1I7RB 4H25A 4Y5VC 4HS8L 2VAAB 4HUMB 1BVLA 1L9NA 4XHQA 2X1OA 4HFUH 1CK0L 2FGWH 5J1TC 1KB5A 4JHBA 1F90H 4JR9H 5C0CB 1NUNB 2WK2A 5IHZA 5LXGL 3D3VA 3QEQB 5CJ5A 5L9DL 4BKLB 4YO0A 2BVTA 2VH5L 2CIIB 3QG6A 3GBML 5I1IH 4O5LH 1R3HA 2MPAH 4YPGB 5ICZA 4PGCB 5CWSA 4PJAB 4QRQB 1UKTA 4M4RA 2A6KB 4YHML 2ARWA 4ODBD 3MRBA 3HI5H 1KCUL 4ZDHB 3FAWA 4DZ8A 2X4UB 1CD9B 4OFYD 5C0EB 3L7FA 3AXLB 2PETA 4PTTB 1P7QD 5IBUG 1KJMA 5B4MD 3IDMA 3BP6A 5J57B 3L5IA 4KKNA 1QG3A 1TQCC 1EHXA 1MCHA 3LQAC 5KSAD 2QKIB 2YSSB 1VADB 4QGYA 3QQ3B 3IKCB 4PJDA 1GAFH 4LAJH 4ESKA 4NZTH 2F58L 1KFAH 1JRHL 3FQUA 5BVJB 1FO0B 4Y1AE 3ARDA 2GQHA 4XCEB 1SVCP 5CZKA 4M43H 5GIRA 2Y36H 4EI5C 5IW1B 5GRZA 2DS4A 2CLZB 2X9WA 1KENH 1PKOA 4X7DC 4NGHL 3MLZL 2PW2A 3O2DH 5GPRA 3EDFA 2VB5A 5FUCC 2XWTA 1JL8A 4IRZL 1WCBB 5I66B 4JKWA 3RL2A 3H9YA 3PABA 2J8UB 4TUKL 4M3KB 4N90D 1UXWA 1U8KB 4HMCA 1KBGL 4XVTL 4GXVH 2FSEA 2V17H 5E1AB 5J1SC 5EU6E 4ORGA 3DVNB 1INQB 5F88A 5FYLD 2A9NL 2P47B 5CEYA 1BFSA 1P5VA 3HMWL 5GRUL 3C9NB 1NBZB 5DSCA 4JFOA 4APQC 2VDPH 3AC0A 4GW5A 3ELAT 4QOKB 5JQ6H 3MJ9A 2HAZA 2ITCA 1MRDL 1FL3A 3O6FD 1IKNC 4LPWA 4F7EB 5D7JC 3Q48A 4LNVA 3QEGH 2XWBA 2VOTA 4XBPA 3RKDC 4AG4H 2B1AL 4RFEB 2J5LC 3D3VD 4QHMA 1HQ4B 4PPTA 3OZ9L 4M7ZC 4KMTH 1KCVL 1WWWX 3SGDI 3VFMA 4ZS7H 1Z2KA 3G6JA 5H8DA 5IM7A 5F9DC 3IJYB 7FABH 4C56E 1D5BB 2BNRD 3NAAL 4Y4HB 3OF6A 2VJXA 4ZUSA 1JGUH 2OSLB 3UTSB 5D7SH 5KVMC 2XKUA 1I1CA 1DBBH 3KR3H 5ILTH 3RWJB 4A2MA 1I7ZA 1U3JA 5C0CE 4QRRA 3QEQE 2X09A 3QXTA 5F7EH 5I1KL 3RTQD 1N64L 4JQXC 4RAUB 4JM2C 1FBIH 3AMKA 1WV7T 4PJAE 1IT9L 5DMKA 4YEFA 4ZUTA 1D5XA 1NJ9B 2JF1A 1CFVH 2UWEB 4OCRL 5CIPB 1T3FB 4WHYG 4GBXB 1LDSA 2FX8H 3RGVA 4DGVL 2W92A 4L3CA 1B4RA 2ICWI 4OKDA 1IGCL 2HYMA 2YS4A 4FQHB 4WHTA 1V7MH 3UYOD 4OCXL 2RGSA 4FHBD 5IB3A 3OGOE 2AI0L 3EOAA 2X4RB 1J88A 3B3IB 5JA8B 4JFXA 2ICWB 5E6ZA 4XC3L 3SDXB 3U9UB 2N7BA 2B2XL 2VN4A 3MNZA 3RY5A 3EGSB 1RZGB 4MGXA 1FL6A 3KPNA 4O2CA 3UPRA 5GS2D 4TOYH 2LU4A 3P3YA 2ADIB 2FIKA 4I3SH 1Z5LB 1SQ2N 1UXSA 1YN7A 4NFBA 4LEOA 4Q6IA 4FFVD 4PUBL 1NMBH 1UACL 1OGTB 5AG8A 2RFXB 2J8UE 3C09C 1OW0C 4N68A 4N5ED 2XTJB 3FB8B 2AEWA 3QRGL 3DX8B 2D7TL 5F9JA 3QNZB 4HBCH 3L9RA 5J7CC 3MLTA 3DX9B 4Z0XB 2EDBA 5HYQB 3VFVB 1KXVC 4Z7VA 5HSFA 4EUPA 3MCKA 3TESA 5C70A 2PO6B 5F9WC 3BHBB 3L7EB 3TIDA 5K9OA 3OF6D 3RWHB 4QOKE 1T7XA 1AGEB 1T2QH 2R2EA 3SDCD 5DHVH 3D9AL 4CDGC 3WNMA 5EU7C 1DE4B 4OF0A 1EX0A 4D9LH 4P5KB 1S7XB 2XZAH 1LE9A 1M7DB 2VLMD 4U1KB 5KS9B 1R5VA 4LLUB 3SDAB 2P5WA 4JDVA 1DTUA 2BDNL 3O3AA 4OB5L 3W11C 2EE6A 2R2HA 1ZHBB 3KDMB 4F7CB 5DD6B 4P0DA 4QRSB 3TLRA 2DKUA 3FO0L 3UTSE 1JNLL 2AQ3A 2FYYB 5FF6A 2IBZX 2AJYH 5JW3H 2W65B 3BGFC 5GZND 3WO4C 2R9HC 4L8BB 5GGTL 4X9HA 3VJ6B 2BSSA 4U1SB 3QQ9D 2HLFC 1ZEAL 2E7LC 4MXVF 2NQCA 2PTVA 4FZ8L 2QR0A 4KK9C 2O61B 4QYOB 3BW9B 3SE4A 1TZGH 3MACL 1WBYA 2AK4D 4J6RL 2JK5B 3FT4A 1QNZH 3MBEB 2UWEE 4XNUL 3VWKC 4PJ8A 3GFUA 5ADPL 2ZKHH 3U4EA 2P46B 4X4ZA 1SMOA 1FZKB 4FS0A 1J0KA 2VLLB 4HF5H 5DQJB 3WS3B 3P77A 5DJXB 4QEGA 4PRHD 3MGOB 3BE1H 2CDFB 9CGTA 5BJTA 5KSBB 1MJ8H 3WJLC 3ZE0E 5EBWB 1C7TA 4E0RA 3KYNB 3FTGA 4ONGL 1DDHB 4AQOA 1IGTB 2YA0A 3SDXE 1FZMB 2XYCA 3BEWB 3PWUA 4YHZL 1CGSH 1G9MC 1HHIA 1NC2D 1NCWL 5GGRB 3C2AH 4KGJA 4Z78B 1NLBL 3WIIH 3T1FB 1N6UA 5C7XH 1G84A 3P9MB 4JPVH 1WC7A 4FQIH 3K8LA 2XI9A 4WTWA 3KNBA 4KQ3L 2XTJE 1TVBB 4JLRA 5H2BA 3G6DL 1UWGL 5FYKE 4KJYB 2FH8A 4X6DB 3CPLA 5L8JB 3NBNA 3RDTA 3HI1A 1P4IL 1A4JA 5I1CH 3ZYJA 2JCCA 4MHHI 3VD4A 4QXGL 1KJ2H 4BSWA 1P2CB 4RWHA 1VKXB 4X6BB 5GHWH 3L3IB 3I6LE 3OKNA 1G6RH 1MAMH 2R0WH 1A2YB 3UJTL 1P84K 3K4ZA 4UT9L 1OCWH 1EEYA 3MOBH 2XFXA 4ODHH 35C8L 3O41B 3BIBX 3BPCB 1L4IA 2PTTB 3MUHL 3MOQA 5KS9E 4WI2A 5F72S 5I8EA 2Z4QA 3Q5TA 3U4BL 1CGVA 3D39A 3L3GB 1ZVSB 3JWDH 2DJ4A 5AD0B 1IAKB 4U1NB 3F7RA 5GJTH 2GJZB 1QSFD 1AJ7H 4I0CC 1CLZH 4RCAA 5C08A 1JF5A 3LQAL 1A3LH 4XX1E 5IUSA 1TVHA 5GGQH 1FNSL 4JO3L 3LZFH 5C0IA 3MC0A 4OQ1A 4I9WD 4XVUD 6FABH 3PNWA 5FUZL 1V7NL 3OAYH 5DR5H 3AREA 3CGTA 1GOHA 3QUZC 4WEUD 3M8OL 5D7LD 5IMKA 5KVEL 3MA9H 4LSTH 4MDJA 5CGYC 4P59L 5FHAH 1YMMD 4JHZA 3VFOA 4FZEL 3SKJH 3RVVC 3VG9C 4XNZB 5EBGA 2I60L 3RWCA 3HUJB 2HH0L 5E2WL 2FX9L 3P9LB 3BIAX 1CG9B 4P9HH 4G3YL 2Z91A 5BS0A 1YJDC 2NY7H 4OI7A 4X4XB 1XGUB 5DJZB 2C1OA 3UBXI 1A6PA 1GHFL 4P9ML 4S11A 1YMHB 2PYFA 4NQEB 2I07B 5CUSL 2VXSH 5KSBE 3GSNL 3SO3B 4YDVA 2V5RA 2J88H 3CFEB 1FZJA 2LABA 4K8RC 2EIZA 4XRCA 4U1GB 4ZFZA 1G9EA 4KJQC 4HD9A 3WFDH 5AWNH 1BGXH 1Q0YL 5GS0D 1MF2H 4U7SA 2EO9A 2WINA 3ZTNH 3UBXB 4WUKL 3DVFA 4K7FB 4LLVA 3RAJH 2AJUH 2BSRA 1T1YB 3RUGB 1OSPH 4ZOCA 5GRYA 1WCQA 3WLWC 4UTBH 1AHWA 5ID0B 3T65B 4X7SL 2Q86A 5GGTA 3DVGB 5EO1A 4ODWB 1BIIA 5TQ0H 3ZKXC 1RZ7L 3GMRA 2IMNA 2X7LA 3K81A 1F42A 3SGKA 5DHVB 2BK8A 2VLRA 4X6DE 2DLEA 1D6EA 3D39D 2F53A 3FOMB 2C4FT 2BZDA 5D6DC 4PP1C 3CDFA 2GI7A 4LLWA 4PJGA 5I2IB 1ZT1B 2Q87A 4LSDA 1U8MA 3L5XL 4N8VB 3VGFA 1DQLL 2EC9T 4NDMB 2MKWA 4M48H 1JYNA 1AGBB 3TO4B 2JJTC 2KH2B 2F5AL 5I1AB 2Z31B 2FJFB 5DMJB 4QRPB 1FIGL 3PGDA 4KV5E 5IMOA 2DAVA 5IBLC 3RVTC 4KJWD 4HK3J 4UT7H 3KPSA 1T83A 3ABZA 2VE6B 5DQ9A 1ZT4A 3DJ9A 4ZG1A 3BXNA 2VNCA 2NY3D 5C07B 1ZLUH 4ZUWB 4ZTOH 1NANH 1SJEB 2ADJB 3AS3A 1HH9A 4WVRA 1DL7H 1DQJB 3W0WB 3RHWK 2FJHB 5CSGA 5KG9A 3VFPA 4Z77B 1RZFH 3WE6A 2X5PA 4ELMF 4KJPD 4EKXA 2DI7A 1LO5A 4HUWA 2J4WH 5HI4D 1C8PA 1B0GB 4PB9H 4OLVL 4Y5VA 1JPTL 4CU8A 2Y06H 7CGTA 3QI9B 4WI5A 1P7KA 3HUJE 2VQTA 4KKBD 3PIQA 1ZT7B 4MNGA 1OF2B 1RIVH 4OGXH 5FFLA 1YEJH 4JZJC 2R15A 3L3OB 5I18L 1MFBH 2GJJA 4MXWL 5HVWA 4JFQA 2IBZY 3S5LA 4NQEE 1I9EA 5M95B 2R29L 3JWNC 4PJXF 4TRPL 3ARYA 4CN6A 2VLRD 1S9VB 2W1NA 4N0CC 3HR5A 3TIEB 1EFXB 1IE5A 5ESAA 4PJFB 3NOIA 4U0QB 3DRQA 3EJYC 5T33L 3RUGE 5C0JB 3P4MA 3VXSA 4KHTL 1S5IH 4FQJL 1H15A 3T2PA 2PKDA 4CVXB 3HAEH 4NKOA 3OKOA 1KJ2B 1CU4L 1OWWA 5SWZA 4LOUC 3C5ZD 4D0DA 3CNKA 1T22A 3MUGA 3WHXA 1CE6B 4XT1C 1S7VB 5FGSA 1UZ8B 1G6RB 1I7UB 1D6VL 3GI8H 4F7MB 3RU8H 1DQML 5HHXH 3VW3H 1MFEH 2IPUG 4G8IA 4ZNEE 5K9KA 5DS8B 1U0QA 4EI6A 2XN9B 1FAIH 3VGGA 2APFA 3EHBD 1KLGA 3DXAA 1MCWW 3H3KA 2A6IA 4LHQB 1FC1A 4HEPG 1Q94B 3K0WA 5I9QC 2V9RA 1ZHKA 3VXTA 1KPRA 4GW4B 3ARUA 4QNPE 1N7ML 4QRPE 2ZCHL 4DKAA 2N4IA 2VQ1A 1BQHA 3PQYA 4ODVH 5DWUL 3WKNA 1HKFA 1FFQA 4ODTH 3D85D 2R0ZL 3GSNA 1GZPA 3U6RA 5I0ZA 1IC5L 5TDPA 1NBVH 1GL4B 5ISZD 1BPVA 4UU9A 4APQA 2P8LA 3EYVA 2OTUA 1E27B 5C07E 3KLAA 5JNYA 4KRPB 1IKNA 4MCZA 4Y2DD 5D7JA 1E28A 3LKQB 5C71A 1E0OB 3H9SB 3S34L 5B3JF 5I1JL 3DO3A 1X6NA 3W0WE 4AIXA 3V5DB 4PRPA 4LSPH 4KMLB 2JELL 1I1AA 4RFOH 3NFNB 2NXZC 4KZEH 2IGFH 2R0KL 3PP3H 1YY8B 3G9AB 4P3CH 1BFOB 3LSOB 5LVEA 4PGEB 1KIQA 4JB9L 5EIQA 1G9ML 1UYWL 3S7GA 1A7OL 1DZBA 1YYML 5BRZB 5L2KA 3UO1H 4L1HA 3QUYC 2I27N 4H1LG 3AGVA 3TYFB 1X5XA 2X4OA 4NZUH 3QIWB 4FABH 3NCFB 4TTDC 4NM8L 4M62H 4QWWD 5CBEB 3CUPA 4GRLC 2DMCA 2Q20A 5L8KB 5AZEL 3HG1A 1G7HA 1DUYB 3GSVA 4OFIA 4JQVC 3MTRA 1URLA 4JQXA 4Q9QH 1CXIA 3K2UH 1WWBX 1JGEA 1K8IA 5FKAB 3NCEB 3N9GH 5B21A 4LASL 5F89B 1AD9A 2ZG3A 4PJFE 4MVBC 3SY0B 4D9QD 3IRZA 3VRLE 2ZCLL 3D0LA 3R1GL 2R1WB 3T08A 3NA9L 4LBEA 5GGUB 2O5YL 4PGDB 1PDKA 4P4RB 4NIKB 4UV4L 4OZGB 5GGSB 5FGRA 4X6FA 4I0KA 1FNEA 5D1XD 4RZCA 4UB0L 1ZA6B 4QHLA 2HFTA 4O2EA 4ZS6C 1F8TL 4JFFA 4P99A 3VXQB 1YUHA 4ALAH 2P4AB 4CMHB 3H7LA 5I71C 3W9EB 2Q76B 2C3HA 5GRVK 4GAGH 3S37H 2FEEL 3HS0B 5KVGH 3U0TA 2XN9E 8FABA 1NANI 3BX7C 2R56H 1HHJA 1AE6L 4XCYA 1XR8B 3X13A 1OLLA 4OZHF 2VISB 5D7JD 2DIBA 2VSDA 4IRJB 3WO3B 4L9LB 3Q5OA 3RKDD 1MIML 1OW0A 4PRDB 5L7XH 3LKOB 2BMKB 3PHQB 1I1AD 3SQBA 5E8EA 1OPGL 4NWUH 4KKCD 4NZDA 4FQ2H 4H26A 3TVMC 2ZUVA 4N1HB 5GRJH 1DBKL 1IC1A 1K4CA 4W81A 2DQJL 1A7BA 1B90A 1MCDA 1JWMA 3ARTA 1V3JA 1YJDL 5ABDE 4JN1H 2BFVL 3TBTA 4QRUA 3QFJB 4KRLB 5TH2A 5ITBH 1SBSH 4JZOB 2UUDK 3H9SE 2PYED 1U8QB 2ERJB 5DHYA 2UYLA 5T1LA 2DQGL 1UFUA 4K8RL 4XMPH 3ROOB 1RZIB 3HG1D 2V2XB 3K2MC 4NQCB 1JGDB 2BVQB 1Y6KR 4XPTH 1AC6A 5KOMC 2UZYB 2ZG1A 2VLJB 3DETC 1JV5A 3LRHA 3DVIA 3NH7L 4XMLL 5BRZE 3SCMD 2GCYA 4G7YH 5HGDA 4HS6B 2OR9L 5GSVA 4YHNB 3TO2A 5HJ3B 5T3ZL 4O00A 1J1XH 3PDOB 2H2SD 3IF1B 2CLVA 2W9EH 2Y5EA 5IKCB 2HWZH 3BPNB 3GHEL 2E7LA 3MRJA 4EIGB 4LRIC 3QNXA 1UM5L 1YECL 4N0YH 1VFBB 5JW5A 3C60D 2VZUA 1KG0A 4NNYA 2GTWB 4NN7B 4OAWB 3GBNH 2MNUA 3DUUB 4FQ1H 4B7IA 3HAEB 1MEXH 3VWKA 1IGIH 1AKJA 3CFBB 1ZHNB 1FLTX 3X3FL 1H3PL 2BVOA 2LTQB 4JPKL 4R4BA 2V9TA 3OKMB 3MNWA 2B8OT 4XWOD 4GH7B 4OZGE 4F33A 25C8H 1LEIA 3SGEH 2EZ0C 2WMPA 3B4NA 3F7VB 2AXGA 1AI1L 3WJLA 2K1MA 3KVQA 1X5ZA 1RK0A 5JHDD 1T66D 4S1DD 1G7PB 1QA9A 4BZYA 3DRTA 1MWAH 4XBGB 1CDUA 3QO0B 2UVEA 2K9UA 3F12B 3V0WL 5DK0A 5DD1H 2E9BA 3C87A 2CRZA 1J10A 3OR6A 3W5MA 5SV4A 5CGTA 1N0XL 2NY6D 3D18A 1M6OB 3ULUL 5EC1B 4YJZL 1CLOL 1ZGLP 2OR8A 4XCCL 2X70B 4FFYL 4TNVK 3ARBC 1T0NB 1JTOA 4NT6B 3UXFA 3V4PH 2PCPB 4HWEH 1CL7H 3W11D 3VFSA 4HGWB 2BVPB 2ADGB 1B0RB 3V5HB 2AV7A 2H2PD 1P1ZA 4MQ7A 5CD3B 5LQBH 1X7QB 3UJIH 3QFJE 5C0NC 4ZUUA 1A4KA 3LKSB 2KL6A 2HLFD 3PUCA 5HY9B 1M7IB 2CIKA 3P4NA 3QCVL 1KYOK 1XGTA 2VDNH 5EA0H 3VI4E 3FQNB 2FZ3B 2DD8L 4U05A 4XCFH 4HJGA 4NQCE 4X6CB 5H94A 2VKXA 3TN0B 3WIFB 3BH8B 4HIEB 2BOBA 3OG4B 2YN3A 4FQLH 5HD8D 4K71B 2YD8A 5C0BA 2VLJE 5ESVB 4XPGL 1IGYA 4Z9KB 2AV1B 1R5WA 3QIBC 5EZJA 4HIJA 4JKLA 1QEWA 1RZJC 4NUJA 4UOJA 3P30L 3WIHL 4XCNA 1EBPA 3EFFA 5IK3A 1RQ5A 1S7SB 3WXWH 3L3JA 1E6OH 2VABA 2AKRA 1BX2B 1MUJA 1WEJH 3B2UC 1JBJA 3ARZA 5I16A 1F58L 3U30C 3QUZA 3LKPA 4LFHG 4Y16D 1YDPA 3CSYA 4K3JH 3KLHD 1PSKH 3V0VB 3BDBA 3VCLB 4U6VH 2YXMA 3QWRD 4U1IB 4GRMB 4IRSC 4WV1C 1J0HA 3LPFA 5KN5B 1LMKA 1PJ9A 5T1KD 4NSKA 1AR2A 2A6DB 4QLRA 3RIFK 3FQWB 5EU3A 2VC2H 5HGAA 4HKBA 1WBZB 4F3FA 1M71A 1BJMA 1IGML 2EC8A 3NGBB 5JLZA 1R3LB 5KBNC 2B0SH 1XF5A 1RY7B 5DVNA 4MJ6A 3INUH 4JY6B 2HKHH 1U8LB 1NBQA 2DQUL 1JF1B 3WYRA 1CFSB 4NN5B 4QXUL 1U8HA 2R39A 5KSVB 3MV8A 4K55A 3B9KB 1NGWA 4NKMA 4NRYA 3AM8C 5F3BA 2EDJA 2V9QA 1F4YL 3P0VH 3PL6C 2AAVA 4KH2A 4R7DB 1BAFL 1HH6A 4JG0L 4G43A 4D0CA 1E4XH 3OXSB 4OZFG 2H32A 4GFTB 3GUTB 2OL3H 3GRWL 1XCQA 5T3XL 5T5FH 1R24A 3VXUD 3I85A 5KVDH 2ZG2A 4RRPG 4G8GB 4WWID 4XAKE 2P48B 4JFED 4JPIB 2C4XA 3QIUB 1NAKH 1C5BH 2XG4A 5DD0L 3S9DB 2VXVL 4YXKL 1GGBL 2NY0C 3RWIA 3BKYL 4P5TB 1D5MA 2QEJA 1W0VB 4OI9A 2UV3A 5D6DA 5L88L 3IFLH 5D7KD 3LQZB 4LSQL 4MB4A 1U95B 4EN3C 3CX2A 4OJFL 4PG9A 1NGYB 4X5LA 3DGCR 4YBLC 2DICA 4CDHA 5D5MF 4AK1A 1SY6L 4GAYA 2D03H 2GJ6B 5HGHA 2JJTA 1I8KA 4DKEH 1G7JB 4XX1G 5KJRH 5J6GA 2VITB 5FIEA 2A6JA 2H1PH 2DIJA 3EOTL 4X4ME 4FNLL 2AVGA 1WSST 4X6CE 4ZPTB 4LVEA 3OX8A 4S1SL 3ARWA 5EPMA 3L3DA 1OAQH 2WWKO 4KHXL 4RDQF 4LHUD 5H35A 3T3MF 1XGQA 4MQXC 3AB0B 3P4OB 3QQ4A 4LSRL 3ISWA 4LCWB 4WWKD 4ZSOB 1T4KA 2IFGA 3EJJX 1SMAA 3LCYA 1D9KB 5HGBB 3SGEI 4G9FA 1PYWA 3MJ8B 2Q1EA 3WL9B 4QT5B 3O3EB 2XPGB 3V6ZB 3BQUC 3BO8B 3BT2L 2QL1A 3MRFA 5KS9F 2C9AA 4NHUB 4GXUN 1C1EH 4DK6A 3JVGC 1BZQK 4IIQC 4NO5A 4PJ9B 4B5EA 4F7PB 3S88H 3TBVA 3MR9A 1FORH 3BAEH 5I30H 3QPXL 3WBDA 3HE7D 4WU7A 4GRWH 3UAJC 3I75B 2DQIH 2NYYD 2A1WH 2CDEB 1WTGT 4JZJA 1PX4A 3TA3C 4BZ1L 1JK8A 3RKPA 3O11A 5T3ZD 1MWAB 2F15A 1MJUL 5DZOA 3WUZA 3STZB 1F4WH 3EYOB 4WGVB 5HHOD 1IAOB 2DQCH 2IH3A 1TFHA 1JN6B 3I6GA 3IT8D 1CL7I 3BD5A 1MNUH 5E99H 3D69A 5D1ZD 4GSDH 4LSUH 1B9ZA 2VWEE 3WHE0 3NIFE 4J8RB 1WF5A 4N9OB 1DVFD 2Q3ZA 5D2LB 5CINL 1DSFL 3QUKA 4MCYA 3Q1SL 3GMOA 5I1GH 1DQDH 1NL0H 5AYQA 15C8H 4UT6H 3BIKA 2EDNA 3OR7A 3TT1H 4MZ2A 2VUYA 1EMTL 4YDIH 3WIHA 4G8GE 4M7KH 4H88H 4HGKC 2CDGB 3BPLB 1GVIA 4YR6A 3GSOB 3OSKA 1DP0A 5CZVH 4N1CA 2EECA 5D71H 3PG2A 1U8OB 5AZ2H 3WFHA 5FGBC 3SE9H 1XCTA 5CMAA 3L5HA 1HXMB 4MHHG 3X12A 4ZTPL 3QA3A 3H42L 3KYMA 3T4YA 3O6ML 3SEPA 3RY4A 5E00A 3SDDB 3LEXA 4X6EB 5E2VL 4XVJL 3TZVD 3E0GA 1QP1A 4R90L 4BA8A 1LP9A 3KYKH 1U3YA 2GJ6E 5ESQB 1CT8B 3D25A 2GYSA 4WO4B 2XIDA 2DLGA 1ZE3C 4CVWA 5LCVH 3ULUD 4AM0B 3OAUH 4FG6D 4GMSL 4MQSB 5IB5A 2OTWB 2XRAH 5ENWA 1T21B 4YH6A 4ZPVB 5C0RH 3ARFD 5IB1B 3HA0A 4OQTL 4UQ2B 3T8XA 1DBJL 2CO7B 1DQTA 1U3HB 3LHPL 1S5HB 5FO8B 4KKAD 5A16B 4XNQA 3ULVH 4K3DL 5EZOL 4LCWE 3RWFA 5A3ID 4ZSOE 4Z7OE 2X1QA 5HYSB 1A7RH 1CF8H 4XXCC 3GRWA 2DM7A 4PY8J 5J89A 5ADOH 1UWEL 5IVOA 4E41D 1S7RB 5DMGC 3PWJA 1TZHA 4JRXA 3B9EA 3IDIB 1AO7A 1UZ6E 1QFWM 3VXOA 5HDBF 1FNFA 4NM4L 3GGWB 4P57A 5D1QD 1N3NB 3IJHA 1E4XI 5BVPH 4I1NB 3QT2A 5FM4A 3NCBB 4DW2H 3SDYH 1EEQA 3EZ8A 5IFAH 2QSQA 3QUYA 2PW1B 5SX5K 3U82B 3C8HA 3O4LB 5K9QI 4NYLA 1N5AA 1YPZB 2DQEH 3GMLA 3OKLB 4X7FC 4JFZL 2OP4L 4YDJA 1JPGA 3VG0H 2XQBL 4AH2A 2NY2D 4GRLA 4U3XA 4V1DD 1SY6A 1JHKL 2H26B 1EO7A 4C4KO 3HN3A 1CZ8L 1EAPB 2OL3B 4YFLI 4RAVB 3CDYA 4JQVA 4MX7B 5EO9A 4Z7NE 4YXLL 4M61A 1A7QH 1SJHA 4XPAH 1UEMA 2WUBL 1WAAE 2A9ML 4C54A 2I5YL 3TT3H 5IQ7L 4I18B 3BVNA 1PG7W 4DTGL 5BZDA 3SQOL 4WDIA 4PBXA 4UDUA 5ICYB 4M6OL 2K7PA 5ANMB 5KOVC 5D2LE 4DGIL 4ZAKD 3QEHA 5DYOB 2FEDD 2WUCH 3QEUB 4KQ4H 4XPFL 2LFGA 5A40E 2DL9A 1OSZB 2GEEA 3NCJH 5EZLA 1S8DA 2Z92B 3SKNB 3LIZH 3HZYB 1CLCA 3MUZ1 3G5VB 1A9BA 1T1ZB 1T03L 1FVCB 3DROA 3GSUA 4U6XB 1TNNA 1MCCA 4ZD3H 3ULUF 1CICC 1WITA 3X17A 4NNPH 3EJZC 4WRLA 4HPOH 1RZJL 3F65A 4HW6A 4Y4HC 1MCPH 5FO9B 5CSBA 3U0WH 4MNHA 3KPTA 3VD7A 2D9QB 3T0BA 4BQ8A 1O0VA 1QR1A 1XGRA 3LRGA 1OQXA 1U36A 4M8QA 3RA7L 4U1HB 5E7BA 5DLML 2NXZD 4FQXB 5E7FA 3FQRA 5CEXA 4QTIL 5TF1L 1WZ1H 3TVMA 4LL9A 4OBRA 3FQTB 5GRWA 3RQ3A 1PG7X 5JHLH 1G1YA 2EH8H 3MRGA 4GBXC 3RWGB 3F7QA 2VXTL 4OLWH 1J8HA 4WTZG 1H9VA 4D0BA 1KACB 1QSZA 2APTA 5IVNA 2LVCA 4OZIF 3NA4A 1RUAL 4GRWB 4HH9A 4LPUA 3W81A 4DVBB 2OK0L 5GJSL 4M1DL 3QWQB 3SN6N 3V8CA 2EXWD 3QDGD 1Z3GH 1EERB 3GIZL 3KPPB 5BQ7A 1S3KL 1KELH 2HTLC 3TJEH 2R4SL 3ZHDA 3BP4B 2IWGA 3O4LE 1GRWA 1YEGH 4OCWL 1YPZE 1B3JA 1T1XB 4DZBB 4UDTB 1PLGH 1MLCA 5A2FA 3KAAA 4LRIA 4G6MH 4L3EA 1OAYL 3HZMB 4K7PH 1AGCB 2XTJC 3PF2A 2GTZA 4A6YB 4WCYL 4HKXA 3LS5L 4QRTB 2X4SA 4WUUB 4JHWH 1VFMA 2NY1D 3WFEL 4N0RA 2I9TA 3L1OH 2PO6C 4GS7B 4G6KH 1DQQA 4U49A 1ZA3B 1GIGH 1NKOA 5ANME 4U33A 4OQTA 1BZ9B 2FLRT 1S7WB 3TC9A 1RURH 1KEML 4OLYL 3V9FA 3IFPA 3ZDYE 4PFEA 5B3NA 3C6LD 1HHGB 4R8WL 3PDDA 1RPQA 4U0RB 4Z8FH 4MAUL 3GHBL 3IDYB 2X4NB 1YEHH 4LU5H 5C09A 4WEBL 4LLDA 2DLTA 2IJ0C 4Y4FD 3SDAC 5DUBB 4ZO8A 4Y88A 4FXGA 1E4WH 3UP1A 2P24A 3O3DB 4AEEA 1DEEB 4TYUA 4KI5D 4PJFF 1KCRL 1NFDF 1T04B 2F54A 3V52H 2C5DC 2Y6SC 3BD3A 3NN8A 5JR1L 2FIRT 1CQKA 5SWQA 4YIQB 1IC7L 2YRPA 1UM6L 2EDQA 4HWZA 3ZLQC 1MY5A 1ETZA 1KJ3H 1N59B 3ARBA 3DBXB 4JHAL 1G9NH 2YD5A 3BDXA 4LLMB 3GSQB 4GG6A 2Z8SA 5C9JB 1BWMA 1D5IL 3ULSB 1ORSA 5DJCB 1XF4A 5MI0B 2EDLA 3D0VA 3MBEC 1NEZG 3KJ6H 1T5XB 2VLKA 3RVXD 4OF5A 2MMXA 1ZSDA 3KPMB 2MCPL 1FFPB 4KUCD 4BK5A 1AGDB 1UQSB 4WFED 5EC2A 5DJAA 3IFNH 5GS1B 1NGXB 2VDRL 1EGJL 3TFKD 2G60L 4GKSA 5IBTL 1A7PH 1QD0A 4YGVB 4GKNA 4GRWE 2JIXB 4HUKB 2JJUA 3CSGA 4JKKA 5JO5B 5I6XB 3G5XB 4UV7H 4OSUL 3IDUA 5JOPE 1KXQE 1ZMYA 4YHIA 3QIBA 1F5WA 5F1KC 5HYJD 3FB7A 4MDIA 2FO1A 4BFIB 3OKKA 2BNQB 3D5OF 4R4FH 4Z7WF 2P5EA 3JV4A 4GKZA 3QFDA 2BRRL 3I6KB 2DYPA 2IQ9H 4BSVA 2QADD 1QFUH 1KIRA 3RX8A 5C0FB 2XWJA 3FQXA 5KZCD 4CNIB 4LCIL 1S7TA 1I1RA 2YPLB 4GQPH 3OJDA 4Y4KB 2IC2A 3HCVA 2WWMD 3MRQA 4IRSA 4WV1A 4WUUE 3V8OA 2GHWB 4XP6L 3IDJA 1TZIB 5DRXB 1NLDH 4P4KD 2HT2C 3ARGA 3HNTL 4KI5F 3ARRA 4JJHA 5IG7B 4Z7QE 1BVKB 1QUNA 5J3HC 4Y19D 3D2UB 1JTTA 2VXUL 2EYRA 3UTTB 1VGKA 2HJFB 4S1QL 1KN4H 4L29B 5IEKA 4MJIB 1RUMH 1MLBA 1F97A 4I3GA 1HOCA 2KBGA 2QQKL 2F8OA 2RQ8A 3T77A 3W9DA 1A64A 2YC1A 4J3XA 3AM8A 1I3VA 2NLJA 4FXLA 4O4YH 2V7NB 3PL6A 4JREB 4L1DA 1MHHA 3MODH 4HCRL 4CN1A 5D70H 4CU6A 4UTAL 5FHBL 2YR3A 3VXMB 3TCXA 3LN5B 3DHJA 1CIDA 3F7YA 1K2DA 5TF0A 4KUCF 3BH9A 2NXYB 2R69L 2QHRL 4OD1L 5E8NB 5C0ND 3FO2A 1PVHA 1FO0L 4K9EL 4OLUL 5FM5M 3ULVE 3SPVA 1UB6A 5JPMB 5KAQG 1M7XA 3LD8C 4DCQB 4M5YH 4XNZC 1KN2L 1QLRA 1R3JB 2G2RA 3LKNA 4EN3A 3QUXB 3QIBD 5D8JH 4D8PB 2D4DA 3IJSA 1MHPH 4K3EH 1BOYA 1C16A 1MI5A 4M1GL 1A6WH 4JDTH 3ECBB 1IM3B 3MRKB 1EIBA 5E08H 1U8IA 4YX2L 5F44A 1L6XA 1X5YA 3SO3C 2AEIT 1AXTH 4NO0D 3HZVA 1OTUC 3EYUL 1VB9A 4W6WB 4H1LA 4U1GC 4HDIB 2CK0L 5AYUH 4IRSD 1H3XA 3WD5L 5IFHH 5IOPB 1P4LB 3GK8H 4N0FB 32C2A 3Q3GA 3ARGD 1KC5L 1J05A 2VDQH 1QRNA 4Z76A 3HAEG 2DTML 5HDQH 2BNQE 2FATL 3U2SA 1VERA 3OGCB 2IAND 4HZLA 4HX1A 3IDGB 1GZQB 2AEQH 2NNAA 1CS6A 3BQUA 4JKPL 3JTSA 1ZAGA 3CDCA 2YPLE 4Y1AA 1R3IL 3V0AC 4OGYH 4E5XA 4YXHL 1NCBH 1NH6A 3JVGA 3U7YL 4NPYA 4JM4H 5SV3A 5JOFA 2YZ8A 1XGYH 5FUOL 2OJZL 3GKWL 5IB4B 4XNYL 3LEYH 4MNQD 5INCA 3MYJB 2XTLA 3QDMB 1CTOA 5KW9H 5TE7H 3B43A 3TA3A 4DQOL 3UTTE 4HKZA 3TO4C 3KWWB 4R7NB 1FYTD 3CH1B 4MJIE 1CWVA 2DJSA 3O3BA 5CJOH 3O9WC 1CGTA 2Z31C 4WI8A 1JFQL 2ATPB 1EGJA 2XZQL 1P53A 3QYCA 5F7KC 4ODUB 4DVRL 4JEGB 2W9DH 5FKPA 5EU6A 2YMXH 1NKRA 2Q3AA 3REVA 4CADA 1R5IB 1OM3H 1BOGB 4NRXB 3GI9L 1QKZH 4M7JL 4OLXL 3SE8H 3VXME 3GM0A 2ZWLT 3J7HA 1NC4B 1UADC 2ZOLB 4KROB 2GAZB 3KJ4B 2MHAB 3VRIA 1XGPB 2XQYK 4NJAL 4YAQA 1MI5D 5IWLC 4PB0L 3EYFB 3R0MA 4NZJA 2L7UA 4CU7A 4X99B 2ATKA 2ID5A 4DAGL 4C56A 1S7QB 3KPOB 1I7RA 5EOCH 1H5BB 5FGBA 3QI9C 4R4ND 2VAAA 3CFKB 1T20B 3O2VH 1CFTB 1AGFB 4HUUB 3ZHLA 4XPBH 3CAFA 3IU3B 1QRND 4M1CD 1BLNA 4OFKA 3H3BC 2F8VA 5LBSH 2HTKC 4WFGD 3MFFB 3VFUB 1TJHH 4BKLA 2JLLA 5FYKL 2CIIA 1RD6A 4WNQA 1BQSA 2GSIB 4NKIL 4YPGA 1J5OH 1CN4A 4PGCA 1YEIH 3H9HB 3CXDL 5EOCJ 2ZUTA 4QRQA 2HJLB 4R26L 2A6KA 2BY2A 3GSRB 3TGXA 3I2CL 2VXQH 4I13B 1U2CA 3FN0L 2AK1H 4K23H 4ZDHA 4NQTA 2X4UA 5C0EA 4HCRA 3AXLA 3RBGA 3O3UN 4PTTA 3IXAB 1O7VA 1JUFB 5CLWA 3DI2B 4C55A 4XXCA 3WNPA 1FG2B 4FRWA 4HFUL 1FH5L 3NFSH 2FGWL 2QKIA 2YSSA 4EOWH 1VADA 1WT5C 1CXLA 3QQ3A 2YUZA 3IKCA 1G7MB 4Z0BH 5D2NB 1F90L 1A6UL 2FECI 1BWWA 2Y23A 4PJ7B 4XTRD 5BVJA 1F00I 1FO0A 4ZUVA 5I1IL 2ARJQ 3Q6GH 4O5LL 4XCEA 3TBSA 2MPAL 4FTVD 1A6ZA 4BM7A 5IW1A 4IMKC 5CZXD 3WFCH 2CLZA 2OZ4H 4KUZL 4PJEB 3QDME 4Z7UB 4X7TA 3WXVH 3HI5L 1NCDH 4IJ3B 2OMBA 3JWDC 3OPZL 1WCBA 5I66A 3JV6B 3WLBB 3EO0B 5A2KH 2J8UA 1LO2H 2CJUH 1DLHB 3WUWB 5HDLA 1TCRB 1U8KA 1Z9SA 4K94L 4Y5XB 5E1AA 3D1MC 3CCHB 3DVNA 1INQA 4C56D 1GAFL 5EUKB 1PX3A 3EKCA 2ZPKH 3BWUC 3IFOA 4NZTL 1KFAL 3C9N