4HD9A

Crystal structure of native human madcam-1 d1d2 domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
203
structure length
198
Chain Sequence
VKPLQVEPPEPVVAVALGASRQLTCRLACADRGASVQWRGLDTSLGAVQSDTGRSVLTVRNASLSAAGTRVCVGSCGGRTFQHTVQLLVYAFPNQLTVSPAALVPGDPEVACTAHKVTPVDPNALSFSLLVGGQELEGAQALGPEVQEEEEEDVLFRVTERWRLPPLGTPVPPALYCQATMRLPGLELSHRQAIPVLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Different Fold with an Integrin-Binding Loop Specialized for Flexibility in Mucosal Addressin Cell Adhesion Molecule-1
rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Mucosal addressin cell adhesion molecule 1
total genus 30
structure length 198
sequence length 203
ec nomenclature
pdb deposition date 2012-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09085 Adhes-Ig_like Adhesion molecule, immunoglobulin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hd9A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hd9A01
5GGRY 4LRIA 3KYMB 3PDOA 4YFLI 2EIBA 4P2RA 2JB5L 2D7TH 3MLVH 4WUKH 2X44D 2ZCLL 2Y36L 3C5SA 1U36A 3L3OB 2VDOH 3KPRA 3DJ9A 3MXWH 4JFEA 2AQ3A 3C08H 3UJJH 5F93C 3HE7B 2F8XC 3BHBB 3MLTB 4ZOEA 2A73B 2JF1A 3KJ4B 3BPOC 4LSQL 5F8RC 2XQBL 2AV7A 1A02N 1MCWM 4JRYB 1T83A 1HZHL 4QO1A 5HGDB 2O5XH 5HYQA 3D69B 2H2SD 3G5XA 4U1GC 1DSFH 3WIIH 4FFYH 4CVZB 3DX8A 4NQDD 5DVNA 1HHHB 2PUQT 4XPGH 5L8KB 1FFNB 5IWLC 1DCLA 3LMJL 3NMEA 2A73A 3H9SD 4DQOH 5HHVH 3MRHA 1WBXB 3RX7A 3SDDB 1WZLA 1EBPA 1HNGA 1WTLA 2D31B 4Z7WE 3T4AA 3V52L 1MCIA 4LHUB 2AABL 2HTLD 1CD8A 2IAND 1GZPB 4ODHH 4PY8I 2HRPL 1CGYA 3V0WH 2XZAL 2QR0B 5HYJD 2B1AH 1BAFL 1ZGLA 5CIPH 1L6ZA 1T89C 1T80A 1YUHB 4DVRL 4OGAD 2VAJA 3SJVD 1IZKA 5IEHB 1A7QL 4YC2B 5B8CC 2KQNA 4XNXH 3QT2A 3AC0A 1NUFA 1U8KB 3U0TA 2VXSH 4XZUB 5DA0B 2AEQL 3NFPB 4RGNE 3REVB 4MZ2A 3ZKNC 4BUHA 4KI5D 1FNAA 4Y5VB 5GGUB 4B53A 1KTDB 3WFCL 3OXSA 4JY5H 1X5JA 3VXRA 3ARBD 2YEZB 1NGXA 3SDXB 1TTUA 3BRFA 4CVXB 4XX1G 5HHXH 2YUVA 3NPSB 3BO8A 2BHUA 5F6IC 2AABH 1KN2L 5E2TL 4X6DF 5GJSL 5L6YL 5JLZB 1YNKL 1DP0A 5D7KD 4KAQL 2B5IB 1FGNL 2Q76A 4JPKH 3BT2H 4J12A 4Y4HC 5TQ0L 3OKOA 1IAMA 3MNZB 3MUGA 5EG6C 3TH4T 3VFGL 4XC1L 2APBA 3QUYB 5F9OL 1F4WH 4BH7B 1DN0B 1C12B 1X6LA 1YDPB 5IJVB 1C5CH 1DLHB 4WRLA 5C09E 2R23A 4YZFF 2HT3C 1U92B 1JWSB 3RY6C 2GSIA 3E6HA 1R3JA 1ZVHA 3O4LD 1K4CA 1A4JB 1N8ZA 3MUGB 1CZ8H 4G6MH 4K2UH 4Y5XC 1GXEA 3F6IA 5J56B 1A6PA 4XBGB 4NQXB 3WD5L 3BZEB 1C1EH 5HDQH 2GITB 3IKCA 3ZKXC 4MS8C 3ARQA 3IFOB 3KYMA 3VWKB 3KAAA 2RFXB 3TZVB 4PJAE 1U92A 1DQQA 4PRHB 4F58L 3MJ9L 4HZAA 5GISL 1JWUA 3E8UL 3TJEH 43CAB 2Q8BL 1FBIH 3TVMD 1NKRA 5I1KL 3V9FA 1WAAF 1FYTA 2XWTB 3QDMD 4JFYA 3KLDA 5LKNA 1S7QA 4ODTH 4WO4C 2BSTB 3ZL4H 5I8OL 2YD9A 3EKCA 4KUZH 4M93C 1FHGA 3PABA 4GKOA 3SO5A 1BQUA 4UI2A 1G7JB 4HH9B 1FNLA 4P2OB 1Y0LA 1KPVA 5KVEL 1OGTA 4WIQA 5C2BH 3IJHB 2WP3T 1GHFL 1OTUD 4HPYH 4NGHL 3SQOH 4B0MM 4N5ED 4X6CB 3V6OA 3BISA 1P69B 2D0GA 3SGDH 3WLWC 4XX1E 1ZSDB 4PRHD 3OPZH 3UXFA 3TO4A 5JPNA 5GRYA 2DTML 1HE7A 2R0WH 4GAFB 4Y5YB 3VXOB 1D9KD 4ZSOA 4G8EB 1L4IA 3PIQB 1T1XB 4G9DA 3HE7C 2VAAB 3NGBC 1KTLB 4PJ9D 2FHCA 5IHLB 2EXYC 3P4NA 1NCNA 5CLTA 4Y89A 1O5DT 3DETD 3QXTA 3MOBH 3GIVA 1I7TB 4Q7DA 3U4BH 1ZSDA 3C6SA 2VTFA 2F15A 1LE9B 4YBQC 2CKBA 3ARFA 2OTPA 2A6JB 3X13A 4MQSB 1ADQH 4KJWD 1AY1H 4WI6A 4HCRH 32C2B 4GUPB 5E8EB 2VH5H 3LKQA 2PYEB 1KCVL 3MRNB 4BJLA 2MCG1 1KFAL 4P5KA 5J0BA 3P4OB 2X4NB 2HG5B 3ZDYF 5ICXB 2MHAA 3FT3A 1U3YA 5TFSL 1MCCA 2D4FA 4GMTL 1DVFC 4LAQH 4CMMB 1F02I 2X1XR 4U1LB 5KS9F 4L4TD 1LGVA 4PJCA 2NW2A 4PJ9B 2VLKE 5TE7H 1K5NA 1I9EA 2H3NA 1CBVL 3GMQA 3T1FB 4P49A 2XOTA 4FG6C 3MUZ1 5GSVB 3LV3B 2R2HA 3WE6A 3QIWB 2EH7H 4LSSL 5C08A 2D9QB 3CLFH 3VXME 4HWBA 3CDYA 4YHZL 4KK9C 1IGFL 2PTTA 1UADC 5DEZA 1Q9WB 2H3NB 1KT2B 2QQNL 4Y5VA 2V2WA 1MFAL 5EU3B 3ROLA 3RGVD 2GQHA 4U3XA 4ONGH 3EDKA 3RL1B 5GGVL 5AD0A 4APQB 5C0BB 2LAGB 1CI5A 3DX7B 3THML 5CBAA 3MREB 5TFSH 4GW5A 1A9BA 3LQMA 3ARFB 2XPGB 3X13B 4G7YL 1PZUB 4CN4A 2GAZA 3GRWL 3KPMA 4Z77A 3UJTL 4EDXB 5C9KA 1U0QA 4UINH 5FHBL 1LO0L 3TBTB 4LSTH 1DJSA 3V4UH 4I1NB 1OAUL 4K55A 4RQQA 4XVSL 5EFIA 2DKSA 4GW5B 5JO5B 3A0OA 4X4ME 4K94H 3PHQB 2WQRA 3ARYA 2Y7QB 1W0WA 1IQWL 4X0KB 4M8VA 4RMSA 4OGXL 3VFSA 1C5DB 1JMZA 4N8PA 4PLKC 1HWHB 3ZKXB 2KBGA 1FLRL 5DEFB 1N3NA 2HJLB 4ZUUB 5LBSH 5IFHL 2DQIH 5IT2L 1QRKA 2Z35B 4ODWA 1UB6A 3WNMA 4H1LB 1WWBX 3SGKA 1UA6H 1AE6H 2ADIB 3DX9A 4HFWA 4FFVD 1EMTL 1HH6A 3KYNB 1AGBA 3QZWB 5CGYC 5C0GB 4KTEH 4TSCH 4UU9B 5L9DH 3ET9F 4OKDA 1SJEA 3GMLB 4R4ND 2CRZA 2FECL 5D5MF 3MQIA 4WV1A 2R9HD 5F7NC 3Q6GL 1IAIH 2KKQA 2XKSA 3VCLA 3WIIL 4XTRC 1NCDL 3GSXB 2C3WA 4P2YA 5C2BL 4U6XA 1H0DA 1NL0L 3LKNB 3PWVA 4PY7A 4YHMH 3O11B 2MOVA 1G6VK 1K8DA 5DEGB 3UBXI 1BD2A 2NTFA 3K0WA 4GW4B 4H88H 4KK5C 1LP9E 2DMBA 2YR3A 3D87B 1OB1B 4S11A 1U9KA 4JZNB 1MIML 1F3RB 3SDXF 5JW4N 4Y4FD 3P9LB 4E9LA 4LVOB 1LVEA 5A43C 3FQNA 1E27A 1I1AC 4U1KB 1JL8A 2PR4L 3I02B 1CGXA 4F7TA 4X83A 5E4EC 3MV11 4HZLA 5CINH 3C6LD 3CU7A 1JTTA 4L1DA 5CJOL 2D0HA 1JYWA 4ZTPL 2YN3A 3EYFA 2FX9H 4GLRI 4NM4L 3QISA 4DVRH 4PTTB 3MR9A 2JIXB 3P9MB 1AI1L 2EZ0D 5I1DA 1H9VA 1C5DA 3MNWB 3E3QE 4MWFB 1IVLA 3F58L 2XTJC 1RIUL 1IAIL 3KHOA 3QG7H 1FNSH 3PHOA 2GTWB 4HJ0C 3PXJA 5F96L 4LVHB 1H3XA 5EO1A 4WHTA 3QQ4B 2XA8H 4R0LB 1DUYA 2YUWA 4HFWB 5TH2A 3DUSA 3MACL 4GRLC 3QEQA 3H3PL 1T3FB 4P5TC 4Y1AD 5JOPE 1FAKT 2JKXA 4QHKI 1A7NH 1UB5A 4LU5L 1Q0YH 3BH8B 4M1DL 1TJIH 4XPFH 3IXAB 3RIFF 4Z7UB 3E1F1 3U36B 2ICEA 4G6AC 3ZHDA 4JPKL 1KBGL 3TYGH 1YMHA 2R0ZL 2GSGB 3IDYC 4EI6A 1GGTA 1OOAA 4OTXL 4LPXA 2CQVA 3H42H 4KU1A 5EU5B 5FUOH 5J6HA 4WWKC 3CLFL 2BVPA 4MJ4A 1RIUH 4PJBA 3IU3B 1F4HA 4HBCH 5HPOA 3REWA 5C08B 3ULVF 3IDNA 5FA4B 1JF1A 2FBJH 2NQCA 1PKOA 3R0NA 4CU6A 4ELMB 1B90A 1VADB 4N8CL 1JZ5A 4I18C 3B9EA 2X5PA 1S9XA 1UYWH 4KKNA 3VDAA 2XN9B 3F7PC 3QXWA 3MYJA 4K3DH 1I85C 4QXWA 1R0AH 1FG2B 2CUMA 1MFDL 5CCKL 4W6XB 2AK4D 5J3HD 2WUBH 4JFDD 1T5WA 5CSGA 2X4TA 3B9KC 4KRPC 1ZLWH 2WLZA 4UDUA 4JKLA 4QRRB 2GJ6B 3ZL4L 4ERSL 4ZPVA 4OCSL 5DD3L 1T0NB 4HBCL 1ZLWK 3RVTC 3B2VH 3EIFA 4UV7L 4HIXL 1QSZA 3VMPA 3FRUA 4EZMA 3BO8B 2HLFC 4XPAL 4YGAB 1QLEH 4HW6A 1FNEB 4O2FB 4KWUA 4YXLH 5HYSB 2NYYC 2GJJA 5HI5C 3CVIH 2HVKB 1NCWL 5F89B 3OPZL 3D3VE 4WJ5A 4NOFA 1U3HD 4RGNB 5EOTB 3S35H 4QT5A 2Y6SC 1Y6NR 3CUPB 5DUBA 3NIGE 3M8OH 5D7LB 3IU3A 4UTAH 1T20A 1KEMH 5D7LD 1S7UB 3PJSA 1MHHA 1DQLH 2BFVH 5IFJB 3LN5B 1SBBA 2EDWA 3IFNH 1UJTA 3SDXE 5ITFA 2L7UA 2W0FA 4YDJA 4Q58C 1EO7A 2DJSA 4HXAL 3EJYC 4MJ5B 1U8JB 2Y07L 5DVLA 1PYWB 3SDDD 5LXGL 2NR6D 1YEJL 5E95B 5DF0A 5DO2D 4XCCL 3EFFA 4JZOA 2CMRH 2FLRT 3NA9H 5DMGD 2QQKL 4ZUWA 2AJZB 5CWSA 3UTSD 3QDME 3RQ3A 1I3GH 3FO9B 1BVLB 3EDEA 4JPIA 4GRLB 1KXVC 5LGHH 4M7ZC 1Z2KA 4JFOB 5CEXB 1EEUA 4LDEB 2RHEA 3ARED 5ACZB 1CT8A 2W1NA 4HULB 4FOMA 3VD7A 1NGPH 1V3LA 3QUKA 4XXCC 5EBLB 1ZTXH 3QNZB 1JNHA 4KJQD 3C9NA 1SYVB 1OW0C 1MCNA 5E6IC 5KVEH 5GS1B 5KSBB 1E0OB 1B0WA 5EUOB 2QSTA 2P24A 1FNEA 3UDWC 1HHGA 5ACLA 1KIRB 4PRHE 1MFEH 5F96H 1AO7B 1JK8A 4NC2B 2BCKB 4LCWB 4OI9A 4YHZH 1GOGA 4RFOH 1GAFH 4I0PA 4YDIL 2NY5H 3Q1SH 5FB8B 1HCFX 3SDCC 2FX7L 3T2QA 3P73B 1A7RL 3JV6A 5H35A 4PJAA 5F8QC 2A6DB 2MJWA 3MRLB 1IFHH 2BSED 4HS6A 3H7BA 4Z8FH 2YD8A 1KBGH 3HNSH 2H32A 4OUOA 4GQ9H 5TJWK 2X10A 1IEAB 1ZLUH 4EJ1C 3CCHB 3JVGA 5KN5B 3UJTH 2VL5B 3MRCB 4NIKB 3LKSB 4ZPVB 5E4IA 5IBTL 2QSCH 5F1IA 2CLRB 3MOAL 5CWSB 3B9KB 4KRPB 4OBSA 2V2TA 3LKPA 1FORL 4L8CB 2OQJA 4HIJA 2Q7YB 4CBPA 5DGRA 4DUXA 4FQCH 3VI4E 1J1XH 4LRNL 3QIBB 5BV7H 3IB4A 2X4SA 3CK0L 1NFKA 5BO1L 3U48A 1A8JH 5KW9H 3L9RA 5DJZA 2ZSWB 1J0IA 3BE1H 2XN9A 5IBLD 4Z7VE 2I60H 1YY9D 4U1IB 2OMBA 2I5YL 2R1WA 3VXMD 1CL7I 1QLRA 3MV7D 3QFJB 4OZIB 4NN5B 2P5EA 1CD0A 3CFBA 3QWRD 3RGVA 4K7PH 1QHOA 1G1YA 1YQVH 1EXUA 3QH3A 5E5MB 1RJLA 4AT6A 1A5FH 1T4KA 1OWRM 4JG1L 2IFGA 5ANMA 4X9GA 3CXDH 1WICA 1K3ZA 3B2UC 4GJTB 4UT7H 2LE9A 4YHYB 1PKQA 3NIGF 3EOYG 1ZVSB 2DI7A 4UT6H 4H0HB 2ENSA 3IDUA 2EXWD 3FCTA 1QBAA 2NXYD 1NBZA 5T3ZD 1D9KB 3WO4B 2VLKB 4U6HA 1T5XA 1LO2H 3MREA 1J05A 3VD4A 1NCWH 3T3PF 3HRZA 1MIMH 3GRWH 3MBEB 4P5TB 3A6OA 1FDLL 2HT2C 5A2LH 4JPWL 4MD0A 4WEUD 4LCCA 3ZDXE 1Z3GL 2VXVL 1MAJA 3VXMB 2EDNA 1KEML 4YDLC 4JFPB 3HAEA 1EO8H 3O4LA 4M6MH 5EO0A 3RNQA 4LLUA 3CUPA 5DUBB 5GGVY 1ZGLM 5KJRL 1A6WL 4CUCA 3GMRA 3EYVB 3HHRB 3AU1B 3EOBB 2FO4A 1YEJH 4M7LL 2PCPA 2RQ8A 2GUOA 4EQ3A 4H26A 4JRXA 3RJQB 1RJCA 1HQRB 2ZUVA 2XA8L 2DAVA 4BZ1H 1IEHA 2VE6B 4UQ2A 1MCWW 1PZ5B 1EA9C 4NQED 2EC9U 4IRJA 2VITA 1MRCH 1FCGA 5D7IA 5FOJA 3EAKA 4HS6B 1VFBA 5L2JA 5E2WH 5FDWB 3TNNA 4OQTL 1T4KB 1E4XL 4Z0XB 2E7BA 2WWMD 4LSUH 3DMMB 3UPRB 5T3XH 1WK0A 4WW2F 3KPQB 3FONB 3HUJE 3QYCA 4G5ZH 4QXGL 4WV1B 4JO3H 2EDHA 5DRNA 1VKXB 4QRQA 5H37G 2GK0A 1QQDA 4L9LA 3N0PB 3LKSA 3GJFA 1A4KB 2FHFA 3GMPB 2BHZA 4C83A 4YO0B 1H3TA 2H2SC 1SEBB 5I8EB 5F6IB 3S9DB 1MHCB 1FVDB 3SO3B 4G8IB 5IB2B 4F58H 2B5IC 2X1PA 2VERN 4WHYG 4PBVC 5I8CA 5EC2B 2E5EA 3QIBA 4HWEH 1AFVH 3BAEL 4X9HA 1BZ7B 1K3IA 1OTSD 4CVUA 4N8CH 4P23C 4OLYL 4Z7WF 1P5UA 4DUWA 4QTIL 3MXWL 4QEGA 4OSUH 3OKEA 4PP2A 3RVVD 1A47A 1H3VA 4N1HB 4S2SB 1D5BA 2R1XA 4KY1H 5BW7C 3QO0A 4QXUH 1EFXA 4BQ9A 3QB7C 2FECI 3HZKA 4KPHH 1BZ7A 1S5HB 2YOCA 3OB0K 4X5WB 2PNDA 5DJ6A 1KYOK 2BNQB 1B0GA 2P8MA 4JANB 1I8LA 2I9LA 2EH8L 4C57C 4S1DD 5IB5A 3DRTB 5KAQG 1RZKL 4NKDB 5DK2A 5IMOA 3H2WA 1MVUA 2XI9A 2Z31C 5TH2B 3VGGA 5DD3H 3U30B 1YMME 3PL6B 4P2QD 4NCC1 2YSSB 5KVGL 3VA6A 4KI5C 3FTGB 3VFRB 4TSAH 3NFNB 4U7SA 5F9DC 1TCRA 2VC2L 2OQJB 2Q7YA 4HIJB 5B38A 2FO1A 3PWPA 4XGZA 2NXZC 4ZFOL 1CVSC 1P4LB 2D9CA 3UO1L 2A1WH 3R4DA 3X11A 4JY6B 2VUOA 1ZHKA 4ZUVB 3VXTB 1QO3A 5E6ZA 3FQTA 5F7DB 2XWJB 3CFKB 1RUQH 1SEBA 3EBAA 1MQKH 1AR2A 1YEHL 5DMKA 1GC1C 3ARRA 3QEQE 2IALA 3D5OF 3I6GA 2V7NB 1RU9H 2F5AL 1PSKH 3ULUE 1FO0H 1YA5A 5DJ8B 2X9XA 1G9ML 3QCUL 4GKNB 1J12A 4HC1A 1JJUA 5FYJU 4DEPC 1MAMH 4PRIA 4IDLA 4IRSD 4JQIH 2IWGA 1LEKA 5FV2A 2WZPD 3W0WB 3HR6A 3LDBC 2FB4L 1DBBH 1PZ5A 1RUKL 1KNOA 1MFCL 4XC3H 3ZSTA 4JO1H 4XVTL 1W72B 4L5FH 4PRPE 2P8MB 4JANA 1MLBA 5D9SA 4N0UB 2A1WL 2AXJA 5I76A 1WC7A 5FYJH 4HJJH 3NH7H 3CMOL 3UTTD 4X4YA 3RDTB 3NA4A 4Y4HB 5IQ7H 4PREB 5E1AB 1P7QD 4G8FB 4EI5B 5E2VL 5A3ID 1MJ8H 3QUYC 4I0PD 3HTLX 3ZT7A 4AEHH 5J13B 1QLEL 5ESVB 5DFTA 1Q9LA 4YHKL 3U6RB 3L5WB 4PJIA 4CMHC 2A0LD 4I2XB 1NUGA 4L8DA 3KDMA 1RZFH 1HN1A 4U2YA 3G5XB 5EO9B 2ZZUT 2FH8A 3E8UH 2WM0A 3T04D 4GFTB 3O4OB 2D31A 3T4AB 1S7QB 4FTVE 4XMLL 5DHVH 4QT5B 1AXTL 4LBEA 1FC2D 3TN0D 4H20H 3WLWD 2YUZA 4QRRE 3PE9A 1RZIB 3UTSA 3G5YB 4ZD3H 1WBXA 2DBLL 3ZKMD 3VH8B 1BBJB 4Z95L 4LVNC 5JR1H 5FUZL 3GRWA 5EN2A 1A6UH 1RHHB 5EU4B 3L3HB 3GHEL 3FONA 4N90D 3DXAA 4OGXH 2BK8A 4D9RE 3W0WA 2Y5EA 4PPTA 3A6BL 5IBTH 1QZ1A 3MOAH 3O9WA 3VWJC 3NACL 1YEFH 2CK0H 5FGCB 1HQ4A 1JFQL 2OI9C 4MAUL 5IT2H 3DV6A 2EKSB 2P43B 5ID1A 1WEJH 1PY9A 2EDTA 1TCRB 1NEZG 3DV4A 2B1AL 2OM5A 1OP3K 1FVEB 3N06B 2P7TA 3MA7A 4H8WH 2VZUA 1IEBA 3VXSA 1NBYA 3H8NA 2X4PA 5D1XD 3DV6B 5E5UB 2ZUQC 3SPVB 1KLUA 5ID1B 4I0CC 2DBLH 4XNZB 1UFUA 4ELKB 2F53B 3KPNA 5I74B 5I75B 5T1LB 3DRQB 4DFIA 4PLKD 1YQVL 5K9OA 4PR5B 1MCRA 3DVGB 4MNGE 2HG5A 2NY2D 3HE6A 2AGJL 4MJIE 2YXMA 5E7BA 4YXKL 4LIQL 3EDJA 3TBYB 1F6AA 1F13A 4ZOBA 1V3JA 4HGWA 4ZUSB 2ATKA 3BZEA 4PJFE 2FNBA 5T3ZH 4NZUL 4LAQL 1T21B 3KJ6H 5F7MC 1NEUA 5D96B 5KSBE 3WS6C 2EDKA 4JFDB 1WCBA 1FG9C 2DMKA 1F3JB 4OIIL 3SDXA 3TBYA 1INQB 2NZ9C 2EDBA 1NDGB 1QFHA 4KJWC 3RZCC 3IT8D 2IF7A 5I0ZA 1FZKA 1P6FA 3GNML 3ULUH 4G8GE 4HUKB 2AJSH 2BY1A 1EHAA 3MACH 3AS0A 4XCFH 4HMDA 2R2CA 1I1AD 3X3GH 1QTYT 4OZFH 4U33A 4G3YH 5EU6B 4M7LH 3FB5A 1I7UA 1ZA6B 1NBVL 3BPNC 4NC1C 3E2HC 5SWQA 3O3EA 1CCZA 1NAMH 4ELKA 1HKFA 4PJEF 1KIPB 5FM4A 5D2LB 5ITBL 1UZ6F 3D3VD 4KUZL 3RIAF 2YD6A 5BVPL 3OGCA 2DQCL 1C5BL 4LOUC 4Y2DD 5D5MB 4BA8A 5FV1L 2E27L 3ULUL 3MRIB 3O6FC 1UXSB 1S7TB 3JWDC 3S36H 1CICB 3S97C 4AEHL 1NEZA 1FZOB 4R7DA 3RA7L 3VWKD 4PRBB 1X5FA 1RFDH 3L3DA 1QBML 2UY7A 5JZ7D 3BPCA 2ESVD 1K4DA 5D5MA 1KCRL 3H6JA 3MRNA 4UUJA 4OV5A 2VZ1A 3GMLA 2R0LH 5HVFB 4JQXC 1J8HE 3GO1L 5FYLD 4TUJB 5JHDD 2AK1L 1YZZA 3NAAH 1EGJH 4JRXD 2W59A 3GMMA 5GRUL 4EUPH 5SX5K 1VFAA 2EE3A 5GJTH 2OLDA 3WKNA 3DGGA 3O4LB 5EO0B 3RNQB 4PY8J 4WI4A 5FUZH 3SGDI 3P4OA 5L2KD 3OJMB 4PJXF 4LPCA 1SY6H 3GM8A 1F4XL 1T7VA 4UV7H 3V7MA 3DUHA 1TZGH 1J8KA 1CICD 5D6DA 4NQEE 2BDNH 4LGSB 3NACH 4X6FB 5MERB 4PJDF 5A2JH 3W5MA 4MCZB 3MNVA 4WWID 4UOJA 3DXAB 1QBMH 3LRSA 4MNQA 1JIBA 3H9HA 2YRPA 5GPRA 5TPWL 1UXWB 1CXIA 3QQ9C 1WT5A 5IB1A 5J8OA 5GRZA 3RIAK 3GM0A 5FO9A 4QHKJ 5CHNB 1HSBB 1D6VH 2PR4H 4M3KB 3LB6D 1URLA 1H3WM 2DLTA 1YY8B 4DKFH 3INUL 4OF0A 2FX9L 4Q6IA 4NQSB 2R9HC 3C8DA 2ZUUA 2YK1L 4YFEA 4UAOB 5C0RH 4WW2A 4NN6B 4L29B 5DDHB 3QPXL 3MA9L 4JJ5B 4HUMB 1EFXD 2Q3AA 4XPHH 3ZE0E 3GMNA 4HIIA 3D18A 4KK6C 4NNPL 4HX1B 3U7YL 2VR5A 5CJ8A 4D9LL 1NAKH 3QIBD 4OLYH 2EO1A 1OY3B 4OZFA 1JMXA 4MVBD 3ULVE 3C5ZC 1TNNA 3U4AA 3SDDA 3SE9H 5HGHB 2VABB 3RTQA 5FYKH 4GG8A 4HKJB 5INCA 5IF0B 1CE1H 2ZG3A 3RUGF 1I1CA 3IS0X 5LGJB 3IU4L 4ETQA 3S3PA 4XVJH 4HIEB 3MCLL 3TESA 1RJYB 2OTUA 2JK5B 5FUOL 3SGEI 1EAPB 1XR9A 3DUUB 1PX3A 1U3ZA 2FJGB 4OF3A 4G9FE 2CR6A 4NPYB 3AXLB 4LNRA 1UM5L 5E9DB 3T09A 3OKLA 3Q2CA 5HHOA 5D7JA 5IVNA 2Q8AH 4LPUA 3UEZA 5F7YC 3NIFE 3RU8H 3B9AA 3L6FA 3TZVA 1U93B 3C5JB 3LRGA 5I1GL 1FV1A 3QDAA 4HUVA 1II4E 1IFHL 3AS3A 3IFLH 4QLRA 2GTZB 2F5BL 1J86A 5DEGA 2BNQE 3OAYH 2NY6D 3ECBA 1QO3B 3PUCA 4KRLB 5IR1B 2XQYK 1JGVH 4Y19E 5FXCH 2HWZH 1CXHA 4M00A 2DQCH 2VN4A 3S7GA 5IROC 4N5UA 4HIHA 3PGDB 4ACPA 4OM1H 2J7LA 2Z35A 5IJVA 4P4RB 1L0QA 2X42A 5MEQB 5HY9B 1DL7L 1JN6B 3CFDA 4Q97A 3LPWA 1I75A 3O2WH 1B3JA 3EYQD 1KB9K 1WIPA 4XVTH 5SX4H 1NGQL 2AJXH 4X6DE 4PJHB 1Q72H 1J87A 3IFLL 1KPRB 1W0YT 2BHYA 3CMOH 2OSLA 4D0DB 1IM9D 4WTZG 3U9UB 5JORB 2V2XA 4LQFH 3WHE0 3R1GH 1JGVL 5DI8B 1ODAA 4GG6A 1A5FL 3EFDH 4HCRA 2FBOJ 4AMKL 3VI3F 2CK2A 1P7QA 4YHIB 1DBML 1UVQB 1F4XH 3PV6A 1HINH 1T22A 2IQAA 4ALAL 1KENH 3MV7A 3RWIA 5C6TH 3ROLB 4D9QD 4HZLB 1H5BA 4TRPH 5KOVC 4X8JA 1S7WB 2CDFB 1DVFA 2YBRB 2X4NA 2NY3C 5I6XC 2VDKL 4I77L 4RMVA 3DROA 1JF5A 1G9NC 2B1HL 3KR3H 4N0UE 4LIQH 1P4BL 3VRIB 3N9GL 5TE6L 2HTKC 3GIZL 2VABA 4FQXA 4LBEB 4X7SL 2HT4C 2ADGA 5D72L 3C5ZB 4ELMA 4NJAH 5FFLA 3O11A 2OMNA 4IRZL 4OCYH 1JPST 3F7RA 4E42B 2NX5B 1DVFB 3GMQB 4M43H 4P2RE 4ODVH 4WUUA 1TZHB 3WL9A 1ZTXL 4D9RD 3FQWA 1DQJB 4M48H 1SM3L 2D03L 1ZVYA 3B2UD 4HIEA 3LQZA 1B4JL 3OKMA 1REIA 1MI5A 2X4OB 2B0SH 2HFGH 1NDMA 1LEGA 4M61B 1I7TA 2HKHL 4R97C 3MV9A 3O45B 2ZUYA 5D2NA 3AB0B 4PRIE 3RUGE 1KCSL 4WFFE 3WJJC 32C2A 5E8EA 4NZDA 2MQCA 3MROB 4D9LH 1WISA 4L3ED 2VDOL 5ELIA 1A7RH 2FD6L 1NFDF 3CDFA 4HG4J 2F58H 1YNKH 4NO3A 3GHBH 5I1EH 4KAQH 4NJAL 4D0BA 2W60B 3G08A 1QSEA 4TNWK 4EDXA 1QD0A 3HFMH 3SE8L 3TF7C 3GSUA 3LEVL 1BFOB 4WENB 4RQQB 3D25A 5IBLC 1QEWA 2J12B 4XP5L 3BKYH 5I1AA 5FYJD 3DVIA 1MJUL 3CZFA 4NO5A 1KTKE 1JNLH 3KG5A 3BIAX 5MEQA 2IPTL 4PJXB 5FGBC 3A6CH 4J3VA 4L8SA 1RSFA 2Y4SA 4FFZL 3BXNB 1QFUL 3L9RB 3VA2C 1RZKC 3LN4B 4K8RD 1PY4A 2UY6A 4Y16C 3WFDH 1YYML 2ED7A 3BESR 6CGTA 4M3JA 1AD9B 5HHOB 4PJDB 5E03A 2HLAA 4H1LH 5F6HI 2UUDK 4C54A 3O41B 5HGAA 5MHSE 2EXWC 1M7DB 4NN5C 3GB7B 3WFHA 3VW3L 1BM3H 2RCSL 3HCVA 4PGCB 2P5WE 4HGKC 5GRUH 4CADB 2XPGA 4PJ5A 1J7VR 4OZFG 1HIMH 2R29H 2BVEA 4J7RA 1X4XA 2BY3A 3SCMA 1S9WB 4Q9BA 1I1RA 2IPKB 2IJ0C 1D3CA 1KCKA 3GSQB 4M9OA 5FYJE 1JPTH 4MNGA 1I1AA 3CFIC 4TSAL 3ARDD 1AQKL 1CE6A 5D6CB 2IH3B 4DW2H 1R3LA 1OB1A 3ZE2E 1BGXL 1LO4H 1XF1A 4IOSD 1NAML 1LO2L 3O3EB 4OCLC 5EBWB 3D85A 2BP3A 4KHTH 2YPVL 4P3CH 1QKZL 5C09B 1BP3B 3QDJD 5E8DH 4KKLC 3L7FB 4HUUB 1EUUA 4RX4D 1OP5H 2NNAB 5CSZA 1QUNA 3BN9D 2AP2A 4WFEE 2IMMA 3LEYL 2HJKA 3HC4L 4U0RC 4KROD 4RISH 5C0GA 2Z31D 1F11A 2O5YH 5JORA 2PETA 1YQ2A 4RGMC 1HINL 1SJEB 4QRRD 3G5VB 3P73A 4EI5C 3CXHK 1MCSA 3S35X 4GRLA 1N6QH 4PGBB 5JXEC 1KELH 1FL6A 1BBDL 8CGTA 4LCWD 2FR4B 3MLZL 1HXMB 1GAFL 5GIRB 4YDIH 5DUMH 2R4SL 3BPLB 4LPWA 4K3GA 5DYOA 3I75B 4XC3L 1HXYA 2WBWB 5F7WC 2AK1H 2OP4L 3EDFA 2DQJL 3QJHA 2OX5A 1OAYH 2FEDD 5JHDA 3S5LA 2FSEA 3GKWL 1I8MA 3QXDB 3PQYE 5FYKL 1K2DA 5C0DB 1F6FB 5DJZB 2CO7B 1CU4H 5E2VH 2Z4QB 3D39A 1I3VA 5IHBA 5I8EA 3QIWC 4WFED 3AM8A 3DWTA 3N1GC 3SE3A 3ARPA 2BRRH 3MJGX 2M26A 4OZIA 3BFOA 5DMIL 4XMKH 1P7KB 5CIPA 5HYSA 1KB9J 5DUPL 4YE4L 3MLZH 4K23L 3N1QC 3KYAA 2XNAA 5F89A 2WAHA 1UM5H 2WIIA 1J1XL 2KZ1B 1J8HB 2I25N 4HWEL 3I50H 3WFEL 4UBDD 1BWMA 2YWZA 1MJ7H 5HI4D 4WU7B 4NWUH 1MJJA 2GI7A 1MHHB 4PGEB 4QOKE 4P9HC 3LKPB 4OFKA 3ARTA 4YPJA 2G60L 4EEEA 5IQ9A 1XF2B 4FNLH 4K7PL 2W65B 3HFML 4U1GB 5I73C 3HRZB 1AH1A 1FSKB 1ZVSA 3ZTNL 3BZFA 3ZTJH 4D0CA 1D5ZB 2LU3A 1A3RL 5IW1A 1H8OA 1JNLL 1QSFB 3U7YH 4XNQB 3KPRD 1AXSA 1R5VB 3QBTB 4GRWE 4C4KO 5DURD 4YDVA 5FYKD 1I1AB 1A1MA 2Z91A 4KH2A 1N2RA 4JFOA 1CL7H 3VI3E 3CNKA 1MREH 3K1DA 5FOBB 1TQBB 1YYMH 4QKXB 2BXYA 3QHZL 3EYVA 3TN0C 4ESKA 4K7FB 4R8WL 1OSZB 3LRHA 1I8KA 1ETZB 3S96B 4U1NA 5L0QC 3RVVC 2X70A 4Z7UF 4U1LA 4Q2ZB 3ZKMC 1INDH 5CBEB 4U6YA 3KYOB 4IRSC 4MXVE 1ACYL 5F44A 4KJYA 35C8H 1EMTH 3MYJB 4PIRF 2P24B 5DRZB 4FNLL 1EO8L 4FHBD 4LQFL 4OV6F 3MLUH 4OD3L 2V17H 3NZHH 4LPTA 5IK3A 5ESAB 3FKUS 2X6MA 1MPAH 1CD9B 1ZLVK 5C0FB 1A3QA 3OMZA 1C16B 4O02L 2E6PA 5LQBH 4FTVA 5E8OB 1XF5A 1M05B 1NCDH 2EE6A 4YPGB 4QRQB 4R3SA 3MFGB 2VQTA 2PYED 4ELMF 2V2WB 3QULA 1MAML 5C0BE 3D48R 3WKMH 1HXYB 1KGCE 4CDHA 5JPMB 3BUYB 1Y6MR 4DK3A 3HE6D 4BFGA 3QEUA 1TETH 3T4YB 1A9BB 4TVSa 4L8BA 3QHFL 4Z78A 5H94B 2YC1B 1AJ7L 5TQ2H 1IGJB 2CLRA 5F97E 4G9FB 4P4KA 4HDIA 4HJJL 2CKNA 3Q5OA 2JLLA 4PLOB 4LLVB 1N2RB 4FXGB 4M48L 2DLFL 3HR5A 4JM2F 4ZG1A 5IB4A 4YX2H 1OAQL 2GFBB 1Y18B 1KPUB 2R39A 2H2PD 5FYLH 2HKHH 3KJ4C 5AYUL 2X70B 3L5XL 4LASH 4RAHA 1AHWC 4QHMB 2O26U 3GGWA 2HMIC 5F7LB 1UWGH 2PYEE 4DGYL 4OQ1A 4W81A 3T0WA 3KS0J 1C8PA 5DJ6B 3AU1A 4GXUN 3CFJB 1E6JH 1PLGH 1AGEB 2F8VA 4LQ1A 2F58L 1OPGL 5HHNB 1TZIA 5E2UH 1CLZH 5MP6H 1DBMH 3ALXA 4L4JA 4OJFL 2E27H 1I1FA 1JUFB 4JREB 1NCTA 1NC4B 1T22B 1U8HB 2R8SL 4NO0A 3SE8H 1XFPA 4JY6A 2W92A 1SJXA 3X12A 2BJML 4WTZA 3OSKA 3NFSL 4X7FC 1T5XB 3O6LL 4P46C 2CDGA 2DWEB 1L0XA 1X44A 1BX2A 5DK0A 4DAGL 3P40A 4RWHA 5DZLA 4GAJL 1BIIA 3RWGA 2B20A 3A6CL 3N9GH 3MA7B 5TE6H 4YC2C 4HUWA 5DJYA 1RMFH 1S5HA 1GPOH 2A6KA 4JFZL 2Y36H 5JIHA 1SJHA 2IAMC 2Q3ZA 4XCNA 2VDMH 3NABH 3T0EE 2OL3L 3EOAB 5FDYA 4ODVL 4RGOH 2W9LA 3HC0B 3RWCB 9CGTA 4J6RL 2VDNL 2BVTA 4PJBB 5CLWA 1ORSA 4OLUL 5C9JA 2WANA 4LMQE 1E4JA 2HFGL 3T77B 2WUBL 2VLME 4X6CA 1QA9A 1GSMA 5KSBF 5EUOF 2D7PA 3EHBD 2R8SH 3QUZA 2YD7A 3CSYB 2ZNXA 4L3EE 4BELD 3HB3D 3LMJH 3JBG7 2MFNA 2DLEA 4OF8A 4EIGB 1EIBA 3MUY1 4QXTB 2NLJB 4ERSH 1I4FA 3VXUE 2VL5A 1QSED 1ZT4B 1DFBH 2EDJA 4NDMB 3QG6A 2AGJH 3MLXH 3MROA 2BZDA 5BV7B 4M7ZB 4HK3J 3V52H 3FHAA 4I3SH 1P84J 2EE2A 3R8QA 4GBXB 2NY0C 1LHZA 3T2NH 4XPAH 3NBNA 4I48B 4U6VH 1GPOL 4JFDA 3O9WD 1AKJA 5IP4A 2YPKA 1XR8A 1BGXH 1LO4L 2A74A 4NZTH 5F1OB 4YR6A 3SOBH 4PB0H 2FWOA 2VIRA 3FT2B 3CVIL 4NNYB 4O51B 4TPRL 4GG6E 3W82A 3K8MA 4OTXH 1NFDA 4M9PA 3T0ED 4JVUA 1WBZA 3BP5B 4OIIH 4X99B 2R2EA 5I8KH 4ZSOE 5CBEA 3C5SB 3VFUA 3VFPA 4FQ2L 1FIEA 1AGCA 4I48A 1I9IH 2V17L 2IANA 3QI9D 3BQUD 4BSVA 4HV8B 4ZMAT 2JE8A 1G0XA 1S7XB 3CGTA 4OD1H 4YHKH 4JZJB 2CO6B 4R2GC 2XWJA 5GSRB 1T0MA 3TT1L 4PGDA 4F57L 2G5BA 1GGCL 4LEXL 4G6FD 5DUML 1JGEB 3RKDC 4ZS6C 2HJFB 4UILL 4S10A 2R2HB 4FABL 3QULB 3O8XC 5DLMH 3UYOD 3VGHA 3BT2L 3TCXA 1DVFD 5EDXA 1NBZB 4PG9B 1T5WB 1KACB 3O0RH 4YHPA 5KSAB 4ZTOL 2GJ6E 3RX5A 1C08B 4OCXL 1YN6A 4L8BB 1ZT4A 4NDMA 4EN3D 3DBXA 5D71H 3ABZA 5ALCH 4R7DB 3PL6A 1NCBH 4ZUWB 2C3VB 3QIBC 1W72A 1Q94B 4X7TB 3V5HB 2Q6WB 1J0JA 4KK9D 3S98A 4MVBC 1NANI 3HMWH 2I9TA 2DN7A 2SEBB 4AIXA 4CW1B 3L5XH 3VGDA 5JHLL 1JFQH 4FMFA 3EGSA 1U8PA 5EC2A 2YPLB 4KC3B 1VFMA 3GDBA 5CP3H 4YBHA 1CICC 5DTFB 4TTGA 1ZHNA 3TBTA 4PV9A 4XCNB 4WV1C 5HGGS 5E8DL 4XP9H 5C8JA 2H9GA 4U1HA 5HHOD 5CJ5A 2C3HA 2X1WL 2F54E 5J1SC 3HI1A 3MRQA 2AKRB 5KSAD 2A9ML 4IDJH 1TENA 1UM4L 4KK8C 3CFJA 3T77A 4OJFH 1DSFL 3DVNA 3S4SG 3C87A 1LQSR 4Z7UE 4AG4H 1GIGH 4TOYL 5J12C 1TVHB 1QRND 3ZTNH 4MNQD 4P2RD 5AUMB 3CZJA 4AL8L 4X7DC 3V5KB 4MNQB 2PXYD 3TYFB 4OLXL 4NGHH 3B6SA 3GMPA 5JZ7C 4R7NB 2AJZA 1U8NA 4PD4J 2OP4H 1RUPH 4HHAB 5ADPL 2V7HA 3RX8A 2HKFL 5IBUB 3UTTA 2WUCH 3CCHA 5C08E 2R0KL 4FG6D 5IW6A 2CRIA 4FXLA 1CG9A 4EVNB 5EU6A 3QUMA 4BSWA 3STZA 1P4LA 3CDGB 3SY0A 1XIWA 3IAGC 3J7HA 4ZAKA 3C6LA 3HKFA 5DC0A 3PDGA 2R2EB 1IMHC 3MLPA 1MI5D 2DRUA 4JFQA 4XWOC 3IXTA 1AO7E 1JGDB 4J8RA 2AEQH 2YK1H 4OZGE 4I9WE 5TDPA 4JKPL 3QUMB 1NMCB 4OZFB 4XAKD 3UCRA 2X4PB 2OYPA 1NSNH 4X98B 1ZV5A 5HGHA 5JDSA 1XGRA 1N64H 5E7FA 3T2NL 1S7TA 2R69L 3D39E 2HKFH 3UTSB 4NBXB 3SE9L 5I66B 3LB6C 3L95B 3L5JA 4LKCA 4GMTH 4YHNB 1TETL 2AJ3A 3ULSB 4DKEH 1DQTA 5F9OH 2IFFH 4ODXA 4PJGA 1A22B 1J10A 3FFCD 3D3VB 5TQ2L 3OKDA 4ZXBC 4J4PD 4ONOA 1I3RA 3GSNB 1LDPH 4WWKB 3DVFA 5D7LE 1KCSH 1KTLA 1IGFH 3DLQR 1QBLH 5C86A 1UB5B 5FO8A 4NUGH 4BK4A 2DM3A 1A1MB 2Z91B 1G7LA 2FJHB 1ZA3B 3O3UN 1IAIM 5IMLA 2YD1A 1A6AB 5J1TC 5J13C 1OSZA 5JOFA 4N1CA 5T1DH 5I1IL 4WTWA 4JZJA 3TO4D 3QFJE 4U1JB 5GS0D 4X4XB 4PJHF 2F5BH 4H1LG 2K7PA 3CX5K 2F53A 3KPNB 5F9WC 1JGEA 5KZCB 5ICZB 5I71C 4QNPF 1JGUL 5GJTL 3RGHA 4YLQT 4ZTOH 4OD3H 3BGFB 3BKML 2IADB 3SCMD 1QSFE 3L3DB 1I1YB 4XP5H 4GKZA 5EOCJ 4F33A 1ZHLB 2D3VA 2LTQC 4WY7H 1BQHG 1XGRB 1BZQK 3KWWA 1D5MB 5DHYB 3MRDB 4KKBD 3RIFK 5INDA 3ILQC 1HWGB 2FH6A 1N0XL 4OLZL 1WCQA 1NH6A 5E1AA 1BFSA 2A6JA 3NFSH 5EUOE 4X4ZA 5B8CA 1VFBB 3DXAD 3KLAA 2QQQA 4Z6AT 2Z92A 4WNQA 2MCPH 3UJIH 3QDJA 3E6FB 3RI5K 2EYRA 2IAMB 4LF3B 3KDMB 3BHBA 1Z3GH 2VXVH 3MLTA 4NQXA 5DDHA 5FA3A 3SN6N 4LSDA 4BSWB 1BM3L 2RCSH 2UWEA 2XTJD 1NKOA 2DQGL 3OQ3B 5HGDA 5J3HC 1HCVA 4PJ8C 2A9MH 3PV6B 4IDJL 4LMQI 4ZO8A 3BRDA 3BPOB 3BPCB 3QXAA 3MLYH 4ZDHA 4KXZH 3H9ZA 3HAEH 3WEXA 4NQTA 4HX1A 2EDFA 1A6AA 3Q6GH 4FQHA 1A0QL 4JAMA 2W0KA 1YEKL 3R0MA 4LASL 5ISZD 1IC5H 3QRFM 3LDBB 1F58L 2MSPA 4BZ1L 5T3ZE 5F21B 4DW2L 3DTXB 4OKVB 3VJ6A 1XGYH 1IT9H 3CMGA 3DX6B 3PWLB 1S78D 1RPQA 3FOMB 4JB9H 4NJ9H 5GRWA 4LP5A 5FF6A 5GGTA 4ONHA 1PX4A 5I75C 5LAXB 3VFOB 2VZVA 3K4AA 4LSPL 5E00B 4JO3L 1T66D 1KXTB 1HOCA 5D7IF 3DYMA 4NKDA 5IVZA 3C09B 4U0RB 5IESH 5D96C 4JRXE 5DVOA 2BJMH 2DDQH 2VSDA 4OFDA 5A2IH 5BMFL 2OS7A 5FHAH 3WS3B 1B2WL 1YEDA 1J1OL 4H8WC 3MXVH 2VLJD 2N56A 2EEDA 2ITCB 5FA3B 4HUWB 1IC1A 3PV7A 1CN4A 2FDBP 3MLWH 4KQ3L 2OL3H 1FL3A 3IDMA 3PGCA 4RGOL 2E9IA 5C3LD 4Z18A 1FH5L 2A83B 4WI7A 1TJIL 4EOWH 4R26H 1YMMA 3TT3H 1UC6A 3V0AC 3AXLA 4DKEL 5EOCL 1FYTD 2ATKB 4GW4A 4WFGD 3IAPA 4PB9H 4L5FL 3O6FA 5D7JB 1P2CA 4RGMB 3RVTD 4OM0H 5JXAL 5EZIH 2ADIA 2DIJA 3DX9B 4ZFZB 2W0LA 1U8IB 1SY6A 4DTGH 3DTXA 4OCXH 3GSVB 3DECA 1CFSA 5TDNA 1WQVT 3C8KB 1UJ3A 2VXQL 3MRIA 2VMFA 3IDXH 1DUZB 1IJ9A 5GRJL 4GKSA 3DYOA 3NFPA 3IKCB 2IEPA 3MCKB 2ERJB 3MV8D 3F6LA 1FIGH 2VC2H 4K3EL 4M6OH 4XBPB 1U3HC 2IQAB 5GGUA 1BD2D 4QHLA 4P9HL 4HF5H 3DUUA 1CGTA 4GH7B 2HP4A 2OI9B 1H5BB 1UA6L 4U3HA 1U95A 4LF3A 4I3GA 5IM7B 3ARDC 3WNKA 3R06A 5I74C 5F7DA 2IBZY 1R5WA 4FQ2H 3JWNC 3QP3A 3EJZD 3OKOB 4W4OC 3VXUB 5DVKA 1BFTA 5D1ZA 43C9B 4PJIB 3RL1A 1LK2A 4Z7OE 2JJTC 1BMGA 4QHUB 4Z95H 4P2OA 5DRXA 1G9MH 5EORL 2LVEA 5ISZA 5GRJH 3B2VL 4NBZB 3ULVC 4HD9A 5D70H 1HSAA 2X1OA 2D7QA 4MCZA 1NAMA 1WAAA 5SWSE 2BNRD 2V5SA 1MFCH 2ADFH 4HH9A 4M61A 5IB3B 1UXWA 1UKQA 1CDHA 3Q6FA 2NY4D 4PJ8B 5SWZD 3RGVB 3VG0H 3IJHA 3QQ4A 1JPFB 3GJFH 2DLIA 2VZOA 2YPVH 3S3JA 1UG9A 1I7ZA 4KJPC 5HYFA 4ZYKA 3P4MB 3IDGA 3CH1A 4Y5VC 2ZPKH 2GJZA 1H3UA 1AI1H 4JHBA 3S34L 1NCBL 3LS4H 3BJ91 3KPSB 1FL6B 4P0DA 5KSUB 2UWEB 5IMMB 3HA0A 2FEDC 2BC4A 2AV1B 2XYCA 2N1KA 3QRGH 1F58H 4PG2C 5EU7C 3WKML 4J3TA 1ZS8B 4KKCD 5DT1L 3U36A 5F9JB 2FZ3B 2IGFL 3GSRA 2N7BA 1QACA 4F15B 3MRGA 1IT9L 3TJHD 4JRYA 5BJTB 4XP9L 4MD5B 4HLZG 3VD3A 1R5WB 4YXKH 3TIDB 1QRNA 1BZ9B 4HS8H 4L9LC 3BEWA 3IF1A 5EIIA 4OZIF 2P46B 3TBVA 1NANH 5C07E 5C0DA 2R69H 4KZDH 5CEZE 4OGAC 1UM4H 4ZD3L 3TYGL 3G9VA 4W70A 4BH8A 3CSGA 4G6JH 5FCUH 4JZNA 3LEVH 4JQVC 2OZ4A 3NTCL 1CDUA 4MSWB 4AL8H 4XCYA 1DDHA 4XNXL 3SGKC 1CWVA 1WFTA 4N0FA 1HEZB 4UT9H 1YC8A 5A2KH 2BSSB 12E8H 2VLRE 2FBJL 4K23H 5TGBB 4IMLA 5BW7A 4GUPA 3VXRE 3Q1SL 4GAYA 4KMTL 3MUHL 2VDLL 3ILPB 2GW5A 4U3CA 4C55A 3GUTB 3D18B 5E2TH 3T3PE 2AERT 3LCYA 4B41A 2GTWA 3QDGA 3MRBA 3BYTA 5CZXD 2Z8SA 4YAQA 1M4KA 2B4CH 1UH2A 2D7MA 5I1LB 3DI2B 5HJ3A 1UVQA 3W0WE 5CKGA 4F7PB 3CFEB 2ZOKB 1O7SA 3VRJB 3BWUC 1BWWA 4N90E 3MJ8B 3BKMH 4L1HA 5TDPB 1XGUB 2R29L 2APTA 5JO5A 2AJYH 4NO3B 4BUGA 1YECL 4M62H 4P46B 1F8TH 1S9VB 3D39D 1JN6A 5HTSA 4YJZL 2W0FB 4Q2ZA 1C1EL 2XZQL 5GGRA 4QF1A 4NKIL 4LRNH 5EU5A 1R3KB 3H0TA 3OR6A 5TF1L 5CD5D 1UH3A 1S7UA 1JYXA 1TXKA 2O61B 1HXMA 5GQBA 1A7OL 2HFEA 3VDBA 5C0CE 4YHNA 4HAGA 3SBWC 2ICWI 2I07A 2CJUH 2NXZB 4EXKA 4OLUH 4WFHE 1WCBB 1CD1B 2DQTH 4ODXB 4HWBH 4PJGB 2CD0A 1UXSA 5AD0B 4APQA 3VE0A 3RPIA 4G8GB 5JW4Q 1ZMYA 3GNMH 5GGTH 2J8OA 3N1PC 3NGBB 4PV8A 1T1YB 2DQHH 3BQUA 3CD4A 3QI9A 4DKDC 4YH6A 3OJDA 5DQJA 4HXAH 5CKAA 1K4DB 5B38B 4WVRA 2FYYA 4HKBA 4OZGA 4UT7L 4X5LA 1KN2H 1IC5L 1CFVL 3OTTA 1OP5K 4DK6A 1DEEB 1D5IL 4KQ4H 1RV6X 3OL2A 2X4TB 1UM6H 4MD5A 4H5SB 5GZOD 2UZXB 2MKWA 2P4AB 1CFBA 1RUMH 4OB5H 2R0WL 3HE7D 2NXZD 3LH2L 4Y1AE 2HMID 2DQTL 2EXYD 3ARBA 5JW4M 1JWMA 5CIPB 1MFBH 3HN3A 5D5ME 4HKXB 2R23B 3WSQH 1X3DA 1S9VA 5AZ2H 1JYVA 4P3DB 3U4BL 1U8OB 1RK0B 2P5WD 1F42A 2B8OT 3LN4A 4S1RH 4GSDL 3FO1B 4QF1B 2DDQL 4X5XB 4XMKL 1IAOB 4I13B 4XNUL 5KSUA 4KTYA 4FMKA 2HLAB 5D7LA 2FJFB 2FSEB 3VCLB 1W8OA 3ZLQC 3TIEA 1BQHA 4ORGA 4Z0BL 1J1OH 1KULA 1OAKL 5I1CL 2E9BA 5I76B 3QIUC 2G5RA 4NNPH 1WBYA 1KIQB 2ADJA 4AM0B 1AXSB 1R5VA 2UUDH 3NAAL 1LD9A 4MJIB 3TLRA 3UYRH 5CEZH 3V0VB 4K3HA 1FN4B 1MRCL 1X7QA 4L3EA 4G8FA 3QWQB 2P44B 4D0BB 4DZBA 1JYNA 1BQHB 1BOGA 4PJBF 4U1NB 3HMXH 1VFUA 2LVCA 1X4YA 4PGJA 1KLGA 2MWCA 2EO9A 1QPPA 4NRZA 2V5MA 2X9YA 3F5WB 4XI5C 5EO9A 1A6TA 1AIFA 1QLRB 4GSDH 1EX0A 2JB6A 2DJ4A 4PJIF 1DQML 3SE4C 5LWYH 1CDCA 2PW2A 5DJ2B 3L7EB 5E5MA 4P99A 3EUUA 3H9HB 3FQRA 4FXKA 3IETA 5KG9A 4N0FB 2EIEA 5KSVB 5JQ6L 5LGJA 3BZ4B 5DRWA 1UCTA 1XIWD 1LEIB 4HKXA 4F37K 4JFZH 5KW9L 2IANE 2VDML 3NABL 3BZFB 1FE8L 5F3HA 4DKFL 3KXFD 25C8H 1KJ2B 2CPCA 2ZG1A 3U30C 1ACYH 1U8OA 3FAXA 1I7RA 3HZYA 4FXKB 5KG9B 4UDTB 4PGBA 4DEPB 2DJUA 4OF6A 5MEPB 5L2KB 3BGMB 4FP8H 8FABA 4UDUB 4KKAD 4A6YL 5DQJB 5DFVC 5GRVK 4XPHL 4U4BA 3T0EC 3V4UL 5A1AA 4DZ8A 1X9QA 5CZKA 5D7SH 1HYRC 1GGIH 1RZ8A 5FK9B 4Z78B 1TVBB 4UT6L 3RY6A 1MRDL 1V7NL 4LVHC 2IAMD 3RTQB 4AEEA 1NFDB 4DGIH 1JHKH 1YC7A 4LLVA 1S9XB 1Q38A 4OFYA 2B2XH 1DBKL 3NCJL 2HAZA 4NQCE 1FNGB 3DHJA 3BWAA 3F5WA 5CGMA 3L3JA 3QUYD 4I0PC 4ZS6D 1CLYL 4GRMB 4Q9QH 2Y7QA 3FFCA 5C70A 3V4VL 1FPTH 4L4VA 4Y2OA 5E9DE 4BFIB 5ITFB 3PP4L 2A0LC 4PP2B 4K8RH 1Z0NA 5B21A 1HILB 3LS4L 1JHLH 4ZUTB 5JPMA 3PF2A 5ICYA 4JN1H 4KTDH 1EFXB 4MA7L 3T08A 4NUJA 2EC9T 1ZGLB 3O4LE 2FR4A 1LE5B 1N5AA 1V5JA 1RZGB 1OCWH 4EN3C 1ZLVH 1PDKA 5ERWA 3MO1B 1NC2A 1U93A 3QZWA 4ORGB 1EXUB 3QH3B 3W11D 1GGCH 2R2BA 3QXVA 5I1HL 3DMMA 1V7NH 4L4TE 4UILH 5AAMA 2IQ9L 4NQEB 1LD9B 4MJIA 5J9PB 2VLKD 2X4UB 3ARZA 1DLFH 3GSOB 3TVMB 4NUJB 5IB2A 3BW9A 4OB5L 1U41A 3DXAE 3B5TA 2LFGA 4OQTH 1DBKH 4ZPTA 4XNMB 4YO0A 3NCYP 3V6ZA 2AXFB 4LSTL 1NMAH 1XF4A 3I6LD 3D85B 4U6XB 3VWJB 4QRPE 3U0PB 3KPLA 1OSPL 3RZWA 3JTSB 2H26A 4ZS7H 3FL7A 5C09A 1Q1JL 3ES6A 1IGTB 1QBLL 2YWYA 3ZTJG 4K8RL 1W0WB 4P2OD 4Y2DA 4MQ7B 2XV6B 1ORQA 4LCYA 4XCEB 2HJKB 1ZHKB 2YA2A 5I16B 2Q76B 1LO5A 2VWEE 1A14L 1XGTB 1IGJA 5A16A 5HYSG 1FNSL 2BOCB 1F5WA 1K9TA 1KJ2H 3RKDD 5KBNC 1ED3B 4CAGA 4Z9KB 1IGTA 1RMFL 1AO7A 1JK8B 1IKFH 3L3GA 3AS1A 4NSKA 3GMRB 1J9CT 1OGAA 3N1FC 4O58H 4PJFF 4KTEL 5IHZA 5L9DL 4N0YL 5I1DB 1MNUH 3F7YB 1JZ7A 1KJVA 2C7UB 2J88L 4MXQC 4TULH 3W39B 4X7CC 1XF2A 4NRXB 4M6NL 4WHYH 1TVHA 3SDAA 4WY7L 4JFFD 3RP1A 3DMMD 4FZEH 5KN5A 5HD8D 5KTEL 1ZLSL 3VWKA 1QBBA 1CFNA 2ZOLB 5EBLA 1WBZB 4WEBH 1MEXL 4WW1A 2UV3A 3O6FD 4OV5B 4HMCA 3U46B 4HKZB 4TTDD 5HI3C 1JPSH 1A6TB 3PL6D 4P2QB 1BOYA 1K6QL 4QY8B 1ORSB 1EVUA 2LU4A 5JNYB 5A2FA 3OKKB 1ETZA 2XZQH 4KZDL 5I71B 4PJEB 4JO4H 5DJXA 4FN0A 1IGIH 2R0KH 4IBLT 4O58L 4WW2C 4QRSB 2DQGH 1YNTB 4APQD 3BRGC 4Z7QE 1Q9LB 3NCMA 2ARJA 1MHCA 4TPRH 4YHLL 1H15A 5C0AD 1HZHH 1YNLL 5JUEH 1W72L 2RIKA 1TVDA 5ICXA 4NYLB 5HVHC 3DO7A 3BYYA 1VGKA 1WVZA 1PQZA 3O2VL 2RAMA 4U2ZA 2AJUL 3QHTC 3MRPB 5IK3B 3ALWA 2YHGA 3KPSD 1RZ7H 3QNXA 1E4KA 1FYTE 5M94B 3PHOB 3QFJA 5KSAA 1RU9L 3VGEA 2I27N 3QO0B 1A3LL 3VFTA 1F3DH 3ME0A 5FO9B 5C07A 4JCLA 4NSKB 3PIQA 3CFCH 4HH8A 3ILPA 1NC2D 1UZ8B 4LIQE 3MRKA 4LU5H 2AXHA 2LABA 1FCCA 1C08A 4BSJA 2HRPH 2PTTB 3CVHA 3TV3L 1D5IH 4KQ4L 2UYLA 3ARWA 3W9DA 4XAWH 1JHKL 1BAFH 4CW1A 4FABH 4Y4HA 4JGUA 4Y4FB 5HJ3B 3BJLA 2P47B 4NHCL 1JUFA 2V5RA 2XT1B 2BVQA 5JW5A 1NCCL 2Z0BA 5GGQL 3X12B 3BH9A 1XMWA 2EYTA 3NH7L 3FMGH 3L3OA 1FJ1A 3HG1B 3M8OL 4PGDB 4NM8L 3DIFB 4RWYH 4XP6L 1FC1A 5DQ9B 2EEAA 3OKNA 1IKNC 5I1JL 3ARGA 4GT7A 5CSBA 1EGJA 2MHAB 4FFZH 4KI5F 1UWEL 4NUGL 2P8PB 5DO2C 2R56L 3LIZH 4DN3H 2DM4A 2GUOB 1T03H 1TMCB 3OR6B 1R3KA 3H0TB 3K4ZA 4OGYL 4U1JA 4KK6D 1ZAGA 1A7OH 2FHBA 3JZ7A 5EZLA 4V2BA 1RZGA 1KEGH 2DM2A 3P4LA 3C5ZD 4P2CG 4IMKC 2PCPB 1S7XA 4PRNB 2EKSA 3FAWA 4MNHA 3TP4A 3UZVB 1JGUH 5AUMA 5IKCB 4XWGL 1N3NB 2HJLA 3LQAL 4WO4A 3JWDH 4PD4K 1TQCC 4LVEA 4J4PC 5IJKC 5JR1L 5BZDB 3EZ8A 3FB7A 1X6NA 1KB5A 1HH6B 3KYNA 2E7CA 1ULVA 1TTFA 2BNRA 2PO6A 4K2UL 1A14H 2NY1B 4OUUA 5GRXG 4XXCA 1FVDA 4FXGA 5DMIH 1INQA 2PN5A 1S8DA 3Q3GA 3HI1B 3MRQB 1T03L 1S3KH 4M93B 2ZUTA 5E99L 3S5LB 1F6LL 1RUPL 4U1SA 3DVGA 2G2RB 1JTPA 1ZANL 2P5WA 4X9BA 3TO4C 4QGYA 5F1SA 3RUGB 1QKZH 3V5DB 2N4IA 3K2MC 3UJJL 1PG7H 4WJ5B 1SYVA 3O6KH 3K8LA 3PWUA 4O5LL 5K9OB 1FAIL 3EYUL 3MRMB 4MLSA 4F2MA 4G42A 2IPUG 3EGSB 5J57B 1GZQB 4UQ3A 5D7IB 5KVDL 2F19H 4X98A 7FABH 4MDIA 3ULUC 2L7JA 1ZLSH 1LWRA 3L5HA 3OAYK 3TPUA 4JM2B 4LHUA 1FZJB 4LLMB 4JPVH 4LNVA 1TZGL 4MQXD 3WIHH 1WZMA 2JCCB 2GK0B 5HHQA 4BH7A 1S7VB 4M03A 1OAKH 4U1MB 4G7VH 3I2CH 4O4YL 4IS6A 1XGQB 1A6ZB 3FN3A 3MGTA 5AEAA 4ZAKB 3VD9A 3GMOB 2A9NH 4F7EB 1WJ3A 3L3HA 3CVHB 2V9RA 5DK0B 5L8LB 3QUXD 3CK0H 1XR8B 4YR6B 1D6VL 4X7EC 3UBXA 1T7XA 2HN7B 4WCYH 3OKKA 5SV3A 3MGOA 3GSXA 5F1IB 5IW1B 5HHOE 2EYTB 4IIQC 3B83A 4PS4L 1JPGA 5ETUA 3VRLF 5GS1A 3DIFA 1K8DB 1RZJH 4YQXH 3V4VH 3TA3C 1KIPA 1LDPL 2V7NA 3N85H 3OF6A 3MLSL 4LP4A 1U91A 3RVXD 4K07A 3WFCH 4JKKA 3UBXG 2BNQA 4GKZB 1ZGLP 1NUDA 3RVUD 4JN1L 3PGCB 2JJWA 3UTQB 4F7MA 2XICA 3UTZA 5B38G 2NY6C 1NBVH 3JV6B 1XF3B 4JE4B 2J3SA 4G42B 3HC3H 3EZJB 5DD6B 3FQXB 2IADA 4XAWL 1FGVH 4N1EA 1EUTA 3D2UD 3HNVL 3IDNB 5FA4A 1UACL 1LK3L 3QJFA 2HT4D 4TVPD 4YK4B 4C56A 3BN3B 5FO8B 5IOPA 5FCUL 2EIDA 4JRYD 5FKPB 5D1QC 1C16A 1MF2L 3TM6A 2FJHA 4RMQA 3L3KB 1UWXK 5CJQH 1AJ7H 2A74B 2J8HA 5IB1B 5JXAH 5C0IB 4RFEA 3GSWB 3DUSB 4NQVB 3RWDB 4GRWB 4DOHE 3T0VA 3ULUF 1WIUA 2C3VA 3SGJA 2ESVE 2PO6B 1A7PL 4X4XA 4Y0GA 2BERA 1ZEAH 5IOPB 3HS0A 3WNLA 4X4YB 3WEXB 5JQHC 3BEVA 5BV7L 4M5YL 1S8DB 3MPCA 3GSWA 4OBRA 1INDL 4IJ3B 3WN5A 2AQ2A 4PV9B 2I60L 1AP2B 3QXUA 3HS0B 5FEBA 3VXSD 2FIKA 4Q9QL 5L2KE 4OT1L 2QSVA 2VDPH 4HXBL 3C08L 1MIEH 1KPVB 3M17B 2NY4C 2RJMA 1QVOB 1UQSA 3MLYL 3O3DA 5FHBH 2WQ8A 2WWKT 4Q9RL 2YMXH 4Y4KB 3VJ6B 1A1NA 3PQYD 4F7MB 5MP6L 4K94C 4Q74A 3RNKA 3PQYB 4N9OB 2NCMA 1YEIL 1IBGL 1SJVA 4MA8H 4XH2A 3WS6A 5CMAB 3JV4B 3IFPA 1T2JA 3WE6B 4ISVA 2HFFA 3PWJA 4JGMA 4KV5F 2Q7NA 3C2AH 3LZFL 1ZANH 4ZDHB 4GAJH 1EBAA 5E6YA 2P45B 4Z7NF 4QYOB 3BAEH 1AFVL 2ITDB 4JPWH 1I1FB 1Q72L 1WV7T 1A7BA 1EEYA 1HQ4B 2OJEB 5IVOA 3VXSB 3STZB 3BKCL 1IGIL 1G84A 1D6EA 3SCMB 5D93C 3RUGA 1P7HL 3K80A 3U0PA 1ZT1B 3CVHH 1SEQH 3FRUB 4QXUL 5BQ7A 5L88H 5D6CA 2J6EL 1YEGH 4GG8B 3V4PH 4EBQL 5DZOA 4JVPA 1A9EB 3GSNH 4L4TA 4S1DC 2OJEA 4XHQA 2VXSL 2VH5L 3WHE1 3MODL 3MV01 4ALAH 3ULVD 4NC1E 2CIKB 5DD5H 3BP4A 2QKIA 2E9JA 2IGFH 1D5XA 1UCBL 5GGSA 4JN2A 1NFIA 1KC5H 3SJVA 1NLBH 4IS6B 2BCKA 4AEFA 4POZD 3QNYB 1QA9B 5B4MC 2Z31A 5ILTH 1MFBL 4PUBL 4G5ZL 5TE4L 2OR9L 4NHCH 4OKVA 5D1ZD 1F3JA 1WIOA 5E9DA 3VFGH 1P84K 4G6JL 4LCUB 2COQA 4H1LA 1QP1A 2HH0H 3DSFL 2WNGA 4MD4B 2YD4A 5I17A 3X14B 4C83B 4IRJD 4YUEH 2KQMA 3TA3B 1JPSL 3WBDA 5C0CA 3RDTC 1M71A 5CEYA 1BX2B 4MXWL 5JXED 3B3IA 4OCWH 3RU8L 4NQSA 4XPTL 2GAZB 3ZE2F 4WUUD 3HE6B 4OSUL 4R97B 1WWCA 1DQQB 1KC5L 3AFLA 2VISA 5GISH 1YNLH 2AI0H 5JUEL 5D6DC 3F7VB 5EH1A 1MCBA 2Q8BH 4N0CD 4HIIB 3BDBA 1QLFB 4M5ZH 4PRPA 2JTDA 4UB0L 1JNJA 3WLBB 1C12A 1RQ5A 5IWLA 3NIDF 1L7IL 1UEYA 5JHDE 4QRUA 5FYJL 3RAJH 4WDIA 3FB6A 3FQUA 5A3IC 4LPYA 3QIWD 4E41A 3MRDA 4L3AA 2HTLC 2BY0A 1FZMB 2Y25A 5ENWB 2Z8RA 1ZEAL 5TDOB 1YECH 4N8VG 4MXWH 4NKMA 4ETQB 1RURL 3JV4A 1MWAA 4IRSA 1JWSA 1I7ZB 1RUAH 4K3JL 1AC0A 1R3HB 3FTGA 4XNYL 5F7EL 2AV1A 3BDYH 2H32B 5IHUL 1IM3B 3AMLA 2J5LB 5TF1H 4IHOA 2GJZB 1T89A 4X6CE 5H2BA 1RZFL 4LCUA 3FB5B 4O51A 4ZSOB 2VDQL 2VLMD 5IMKB 3X14A 3MCKA 5I8KL 2E3VA 4HT1L 3O3BB 5EPMA 4XMLH 3FJTA 3VFPB 3VFUB 1WWWX 5F7FA 3V6FA 3I6GB 3C6SB 1XCTB 2OR7A 3RAJL 3DROB 1J0HA 2X4QA 3R06B 2ENYA 3NCFB 2YN5A 1ZHNB 3EO1A 1CFVH 1TPXC 2Q1EA 3I9GH 1VACA 3K4DA 5CD5C 1QYGL 4W6YB 4KVCL 4R96A 5BRZE 4G7VL 5EBMB 1ZHBA 3WIFB 3FOMA 4C58B 4UOW1 4OLVL 3NCJH 3HG1E 4NQDA 4NP4L 4XCYB 3U9PL 5LAXA 2CH8A 3F65A 3VFOA 3ARFD 5ANMB 1FL5B 1GOFA 5D1XC 1BHGA 2W9EL 3QDHA 3MV9B 4M43L 3AMKA 2GCYA 4YPGA 1NGYA 3T0EB 4PRID 1KB5B 2VR4A 1FFOA 2BFVL 2X41A 4R6UA 3ZDYE 4EBQH 3IFNL 2B0SL 1KJMB 5L2JB 3GSNL 4PJBE 4HGMA 3IJSB 4BQCA 2P5EE 1TJGL 1EDQA 5JHLH 4X9FA 1ND0B 1KELL 3E2HB 4NN6C 4IHOB 2WMPA 1JZ6A 3OG6B 5J6GA 1V7MH 4L4VD 3G6AB 4FQHB 4JAMB 1KT2A 3WJLC 2D7NA 3NZ8B 4U1SB 2EIZA 4P5MB 1A4KA 3VDCA 1SMAA 5KS9A 3FOLB 3CFEA 1JHTB 2KZWA 1P6AB 1FSKC 1NLBL 5SWSD 4F9LC 1Q0XL 3OR7B 5CD3B 4JDTL 4MCYB 4KHXH 5T3XD 5BOZG 3HI6L 1WITA 1SYSB 3MRRA 2WBJC 2DQFB 3RWJA 5FO7B 3MV9D 1NGPL 4P46A 5FKAB 2L4OA 1DBJH 3O41A 1GL4B 1JF1B 1JHTA 4Y4HD 4HQQH 2BNUB 5EU4A 4I3RH 4N5EC 2WWKO 5CJQL 1DE4A 3BEWB 3IF1B 5EIIB 2FX8H 1I9JL 4MX7A 1BVKB 1HI6A 4PJ9A 2H32H 2VZTA 4PJCB 5SWZA 5T1KA 4KRMB 2CUHA 2O61A 3V6OC 5TDOA 3BZ4A 5DRWB 1XH3B 4MAUH 1A6ZA 1OVZA 1OQOA 1A21A 3B5HA 3TNNB 4OCWL 5DC9B 2JB5H 4RBPK 1YEEH 4HHAA 4JY4B 5DFWH 4RA3A 5HGBA 5DFVD 2FJGA 4L3CB 4MAYD 5JQ6H 2XIDA 3CX2A 4L4VE 3RPIB 3X3GL 5DEFA 3GBNH 3B3IB 2IG2L 4FQQA 2XFXB 3OX8B 4P9MH 1I3UA 1OT2A 3BSZH 5FECA 2VRAA 4RCAA 3RJDA 2H8PB 3W2DL 1SQ2N 2JIXD 1FV1B 3OG4B 1MIEL 3CC5A 1J88A 4E5XA 1U8KA 3OKYA 4LOUD 3ZKND 1W2KT 1LK2B 4I3RL 4J3SA 4KDTC 5IMLB 5ACZA 2XWBA 4Q9RH 5DRXB 3UTTE 3JVGC 2BMKB 1SJHB 4WO4D 3EO1B 3NIFF 1N64L 4JHZA 3UTQA 2YEZA 3VFSB 4P3DA 4HIHB 3QCTH 1H3PL 1XF3A 5C08D 1CL7L 3V0WL 3L7FA 1UM6L 1KYOJ 4MAYB 3U4EB 2KL6A 1F90H 3QDMA 1UACH 1QEWB 3VFVB 3BD4A 3F8UB 1DQDH 1T21A 1OWWA 4D3CH 5CP7B 2YPLE 4A2LA 3LH2H 3I75A 3KWWB 2IH1A 1T6WA 1CLYH 5C0IA 3I6KA 3ETBF 1KNOB 1D9KC 3WO4C 4YBLC 5CJXA 2XG5A 1RHFA 4PG2A 3CVHL 4FRWA 3D1MC 2O5YL 4FZ8L 2F54B 3IVKB 3V95A 1R5IA 1LO3L 2RFXA 1JHLL 3LSOA 3VXNB 5BS0D 4I5BA 2ICCA 4ETYA 3VFWB 4XNUH 1N6VA 3RGVC 5ESQB 2ZJSH 1ZT7A 5J06A 3CU1A 4FQIL 3OXRA 3MTRA 2CMRL 3NA9L 2FZ3A 3GSRB 4LHUD 1Z9LA 5GS2D 2H45A 3LKNA 2V6HA 3OR7A 3PWVB 4PY7B 2DQJH 5DZNA 3TVMC 4DJMA 3H3PH 2XNAB 5JW3H 2Q86B 3O9WC 3VWJA 4JQVA 1MWAH 3ZKSD 1F4WL 5BCAA 1S5IH 3IS1X 4N8VA 2OL3A 1P7KA 3D6GA 4X80L 4GAGL 1LEIA 1ES0B 2YMXL 2BMKA 1IARB 4PTTA 3IDJA 1MHEB 2YKLH 2XRAL 3VGFA 2ILLA 3QUXA 4GOSA 3OV6A 4X8XA 3LEXB 2AVGA 4X6FA 1D5MA 5DHYA 5MERA 5FB8A 1J8HA 2E6QA 1A4JA 1N8ZB 3FZUC 3TH2T 2BRRL 4JCMA 1MH5B 1MFEL 2EDQA 1MJJB 3G5YA 1VCAA 2NY1C 1DUYB 1HSBA 5GRVL 5D9SB 4R2GD 1KEGL 1RJLB 1KJ2L 4AT6B 1ND0A 5BZWA 4AENA 1EK3A 5DHXB 3HZMA 2ZCLH 4NRZB 1MH5A 3UZQA 5IW3A 3BH8A 5FGRA 4TUJA 2ARWA 3QDGB 2ZNWA 4N0YH 2XN9E 3O8XD 4HUXB 4XWGH 3EHBC 3LQAH 3SO3C 2ICEB 2Y5TB 2W60A 1T2QL 4AYFA 4FS0A 1X4ZA 3V4PL 1GVIA 4KDWA 4KUCF 1VEMA 5EOCH 2UWEF 4FZEL 1YEKH 4IOFD 3KYOA 1N5YL 4JM2C 1Y0LB 4WWKD 5DJCA 4WEBL 4QY8A 1AGFA 4HJGB 3S96A 4YHYC 2DI9A 2DTSA 3OKMB 4MSWA 2FRGP 4WGWB 4MX7B 1MREL 2MPAH 3BWAB 4NHUB 3QHZH 5ICYB 4M1GH 1PG7L 1EH9A 2OL3B 4GMSH 3JV5A 2QADC 2J5LC 3FO0H 1F2XK 3RTQD 5L2KA 4S1QL 4J3XA 2EC8A 5ID0A 3BSZL 2AXGA 3LEXA 5HYJE 4JRXB 3BQUC 3QI9C 3SKJL 4OF7A 2AAVA 2VDNH 2J6EA 3SKOB 1A1OA 3EJJX 3I6KB 5HD8C 3MRBB 1SBSH 1FPTL 2CKBL 1Q9KA 5HGAB 3MLUL 1T1YA 2HWZL 3B9KD 4KRPD 1AGEA 3SJVE 4MA7H 5H8DA 2IMNA 3JSSA 5HI3D 2IPKA 1RVFH 1TZIB 4XPTH 1HHJB 3GMNB 5HDBE 5K9KA 4X4MA 3JTSA 1JZ4A 2A9NL 3MLWL 2Y07H 4PTUA 5HDLA 3TZVD 3SY0B 5EU6D 2EDEA 1QFWH 2IH3A 3MSPA 3V6ZB 2X40A 5I1HH 2YRLA 1ORQB 4LCYB 1F90L 4R26L 2AI0L 1EAJA 4JFPA 1EERB 1CE1L 5E94A 3BXNA 1FGNH 4PJFA 3QA3A 4ENEC 3L1OL 3QUZD 4GBXC 1T1WB 5GGQH 1L7IH 2XTJB 1XGTA 5ERWB 5A16B 3HLAA 2CDEA 3UC0L 1MELA 3SGEH 1G7HA 4ZFFB 1A6WH 5EOTA 2HYMA 3JWOH 4AMKH 2K9UA 5I1JH 4EIZC 4HFUH 3VFNA 3G6JB 3Q6FB 2F5AH 3QIUA 2Q8AL 4LFHG 1T1WA 4Y19A 2F54A 1T0PB 2VXTL 2C4FU 5EOQH 5FDWA 1B9ZA 1R6VA 2NXYB 5IVXA 5MENE 4LEXH 4LKXB 3RVWD 4N68A 3MMEA 1PYWA 1IKFL 5SX5H 4OLEA 1HILA 3U46A 4FFVC 5CBAB 2GTZA 3U0TB 3AS2A 3UAJC 3MRJA 4HUXA 1BIIB 4K9EH 5JHDB 5IR1A 4JKWA 5FM8A 3KLHD 3AREC 1G7MB 1MY7A 3S4SB 4MMZC 2A6KB 4Z8FL 2Y72A 4X6DA 2PW1A 4NQCD 1ZA3A 4NKOA 1ZS8A 4XTRD 5ECJE 1GGYA 1IQWH 4NWTH 4C56D 3FT2A 1GC1H 3QUMH 1ONQB 4MDJB 3MRFB 5IHZB 1HH9B 1IILE 1MRFL 5DJAA 3L7EA 2DQDH 2DYPB 3BIKB 4CNIB 3I02A 4L8CA 1BD2B 3QUYA 5D2LA 2DOCA 3RWFB 2NMSA 3MFFA 5HPMA 3NCEB 5H35B 2FJFA 5D1QD 3AGVA 3WL9B 2W38A 1N59B 3SDCB 2W9EH 5DJ8A 5E8PB 4BKLB 2FD6H 5DJAB 2ZPKL 5GSRA 2V2XB 1NDMB 1NMCC 1AC6A 5IFAL 1PBYA 3TPUB 2FL5B 4OCRH 3K74B 1NGYB 2NLJA 3VFMB 4M4RA 4EUPA 7FABL 5B8CB 2JCCA 5HHQB 1N59A 1TCMA 2BVQB 4LPVA 1A6UL 3P9WB 5DMGC 1WF5A 1V3KA 3H9YA 1XGQA 4HJ0D 3DPBA 3B9KA 3IKKA 2V2TB 1IGYB 5DT1H 2UYLB 5M95B 2EIZB 2VDKH 4I77H 2XACC 1JRHH 1RULL 4K8RC 2MPAL 4OZ4B 1Q0XH 4JDTH 4M1GL 2A6IB 4KMQA 5L6YH 3FQTB 4QTHB 1FNFA 3MV9E 2Q6WA 4EI6B 3G6DH 2HLFD 3U6RA 5J6HB 4PB0L 1G7PA 3VMNA 2WLYA 1JRHI 4LEOA 4YIQB 4QWWC 4R4FL 3WFBH 2P5EB 1CBVH 4R4BA 3ULUD 2CKBH 4PJXA 5T33L 1KG0A 3QFDB 5JNYA 1CGWA 5K59F 3WUZA 3K2UL 4UT9L 2K3TA 4ZUTA 1OM3L 4JHWH 4KZEH 2ARJB 5TGBA 2IPUK 2OR8A 3QEGL 4PJIE 5EC1B 3QCUH 1PKQB 1JRHL 1YJDC 2VLLA 1PQZB 3QJFB 5IIEA 4YHPB 1KF9B 2Z9TA 2NXYC 5ILTL 3SCMC 3WHXA 1FGVL 4HWZA 4PUBH 3FT4A 1CXFA 1OP3H 3ARGB 4QHNB 1L7TL 2DF3A 1GGUA 3LD8C 4PJCE 1KUMA 2BVYA 3DYPA 3WFBL 3Q5TA 5IGXH 3BP6B 1CR9L 4BK5A 4GAGH 2P49B 3U0WL 3SKNB 1X5YA 1ZWIA 4NO0D 3L3JB 1BEYL 1IC7H 1EJ6A 4EI5D 2C9AA 4HWUA 1OM3H 4P4KB 3FT3B 4OI7A 5I73B 1Y18A 3KPSE 5F1KC 2UWEE 1KLUB 3FN0L 5DR5H 4M5YH 4QHMA 3IXTB 1BBDH 4NN7C 3PXHA 4G6FB 2UVEA 2CLVA 1YY9C 4D9QE 1P9MC 1FLRH 3RWFA 1P2CB 3HUJF 3EOBA 2E7LC 4CRPA 4Z0BH 3SDCA 5JXEA 1CFQA 1H5BC 1QG3A 1M7DA 1XZ0A 4Z7NE 4Z0XA 4Y7MA 4UQ2B 2HRLA 5ABDE 2NW3A 4FZ8H 2G5BB 3GKWH 4PJ5B 3MRJB 2DS4A 1S7SA 4EUPB 2LTQB 2VITB 4RNRA 5C07B 5F3BB 1CR9H 2JELL 4XNMA 3V2AR 2AXFA 3ARUA 3IRZA 5DD0H 4F8QA 1X5GA 5DJ0A 1RURH 1KCVH 4NKOB 1KCUH 2PXYB 4YHML 4O4YH 2DQDL 4Z7WA 2Z93A 5HVWA 3NVQA 3RWGB 2VZ3A 3QWOB 4NRYB 1X5LA 1Z9MA 2NPLX 3OJVC 4JFXA 3UJIL 5FUCC 3QUKB 1G0DA 3FO9A 2VLRB 3UROR 43C9A 4GXUM 3MC0A 3QCVL 5F70A 2FGZA 5EFIB 4X80H 1MJ7L 3VH8G 4ZNCD 2LV4A 4D8PA 3HC4H 1MHPL 2NX5D 1EZVY 3QWOA 4KJQC 5CJOH 4U7MA 3PNWA 5HY9A 1MUJB 4XAKE 5E8PA 2G2RA 3MBEC 3AY4C 2ED9A 2J6EH 4YDJB 4FQXD 1AGDB 2DL2A 4X5XA 2KDGA 1F6AB 3ROOA 5EU7E 3H9SB 4TNVK 2VL4A 4AH2A 4WU7A 1NC4A 1U8HA 4LLDA 4JEGB 4UIMB 1NMBH 2XN9D 4KVNH 4MWFA 4IRJC 1T83C 2CXGA 1UWXH 2GSIB 4F15C 5JA8B 1GGIL 4ZAKD 2PTVA 2V5TA 4NP4H 1OAYL 5E5RB 1EV2E 2NW3B 3QWRA 4NJ9L 3WNOA 2FATH 5IMMA 2NY0B 3WUWG 5IBUG 5BZDA 5E8NA 3B8SA 3VMOA 3HMXL 4LLYB 4G8GD 3ZO0A 2V9TA 1T3FA 3N1MC 2DM7A 1BLNB 3ARGC 3QDJB 3U82B 3WCYA 5T33H 5C0CB 5D8JH 3V6BR 3MLRH 5DQ9A 4LCWE 1DQMH 3BP7B 5LWYL 5IW6B 2JB6B 5LCVH 5BMFH 4ZUVA 1ZE3C 2GJ6D 3WUWA 4RFOL 3CDGA 2PW2B 5DJ2A 3JWOL 4FQLH 3ZSSA 3ARDB 3QEGH 5D7JC 2WIIB 3ULVL 1MCJA 5C0EB 5C0JB 4EDWL 4KKCC 2ICWB 2CLVB 3RL2B 1NAKL 3M17A 4U31A 5BS0A 3EYFB 5INDB 1H8SA 1I4FB 1RK1A 5EOQL 5I1IH 1PVHA 4LHUG 4ZO9A 5EC1A 5I9QB 4POZC 5ID0B 5KANG 1FFPA 2IBZX 5J1AA 3PNWB 5HHPA 4J4PA 2XKNB 4EOWL 1MQ8A 3WXWH 1BJ8A 1MFDH 2VDPL 4HXBH 3EO9H 4JREC 5CCKH 3QDGD 4UB0H 3W9DB 1AXTH 1E4XI 5EO1B 5CZVL 4FTVB 4FP8L 1V05A 2AW2A 4PBWD 2H6PA 4PJDA 3BMWA 3S36X 1I8LC 4OM0L 4PJ7E 3W5NA 1JTOA 4R3SB 4V2CB 1JV5B 1YN7B 2YRZA 4AIOA 3TGXA 1OSPH 3K81A 5EIVA 1RHHA 5LCVL 3S36L 3T0BA 4N9GB 4ONFL 2PXYA 3DBXB 1MI5E 3L5WA 2D4DA 3Q3GB 2R15A 1F00I 1OAQH 2VN7A 4H88L 4EDWH 4I9WD 5HYJB 2WBJD 4P48A 5AYUH 3VRJA 2BSTA 4PBXA 5EUKA 1CYGA 1PG7W 3WS3A 1BJ1J 3I3DA 3LQAC 2R0LL 3BP4B 3W2DH 3PWUB 1BJ1H 1FNGA 3WDJA 3RWHB 2VKXA 4L8DB 5C0NC 3KYKL 2P1YA 3FFCB 3SJVB 4O2FA 4NM4H 5C8JB 4OAWA 4PRNA 4Z76B 3V8CA 3MNVB 1EEQA 1GCFA 2WSKA 4E0RA 5DD0L 3EO0A 3SDYL 3PWLA 3ELAT 4LVOC 1MCHA 1OAZL 2EDOA 1RK1B 1DTUA 3F7QA 1AO7D 4KI5E 1CF8H 3FO2B 4R9HA 5K59E 3GI9L 1QPXA 5IFJA 4RDQF 1U3JA 2QSQA 1F3DJ 4WHCA 4AIZB 3C8KA 3QHFH 3VG0L 5F7UA 3SDAB 5DS8A 3DHMA 4IIQA 5LGHL 5D4QA 4GS7B 1LNUB 4EVNA 3VXQB 3OJDB 5DGQA 4GO6B 1G7QA 1TFHA 1PW3A 1WFUA 1X5HA 3ORJA 3QEHA 4HDIB 1BLNA 2PYEA 1WSST 2PW1B 3IJSA 3HZVB 3G6JE 4HK0A 1GC1L 3QUML 3QQ3A 3BI9X 2MMXA 3MRMA 3OAUL 4JZJC 1CGSL 4YUEL 4O2CA 3I3BA 1MUJA 4CN1A 3KXFA 1LO5B 1BFVH 1B2WH 1KTDA 1G9MC 1CF8L 4DGYH 4CN6A 1VPOL 3GI8H 3CAFA 4HMEA 1I7UB 4QHUA 4I3SL 5GZOC 4RMTA 5C0AA 1Q9OA 2DWDA 3DO7B 3B6SB 1PLGL 2XQBH 4PJGF 4M7KL 2CIIB 3ARFC 4QRTB 3HUJB 1HDMB 5AZEH 2XRAH 4NZTL 5KTEH 4JN2B 4U49A 3I85A 3IJYA 1MVUB 4LLQB 3L95A 1NDGA 2VLJA 4A6YA 2MNUA 3GJFB 3OKDB 4NQVA 1CFNB 2ZOLA 3T0AA 3VWJD 4OGZA 3O2DL 3FMGL 5ITBH 4WWKA 5JA9A 1BD2E 3KNBA 5J7CC 3V79C 5AG8A 1KIQA 1U8LB 2MKLC 1EFQA 4JY4A 4ZXBB 5HGBB 4RFNC 1J1PL 1G7IA 4LVNB 1FQ9C 4LFHD 2VLJB 3ZHLA 2H41A 4PJ7F 3FN0H 5DR5L 5FECB 3BP5A 1UZ6E 4ZODA 5DWUL 1EVTC 3TWCH 5C0BD 3RY4A 3MJ9H 1UKSA 4M7KH 2BRQA 2UZYB 3S3SA