4HD9A

Crystal structure of native human madcam-1 d1d2 domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
203
structure length
198
Chain Sequence
b'VKPLQVEPPEPVVAVALGASRQLTCRLACADRGASVQWRGLDTSLGAVQSDTGRSVLTVRNASLSAAGTRVCVGSCGGRTFQHTVQLLVYAFPNQLTVSPAALVPGDPEVACTAHKVTPVDPNALSFSLLVGGQELEGAQALGPEVQEEEEEDVLFRVTERWRLPPLGTPVPPALYCQATMRLPGLELSHRQAIPVLH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mucosal addressin cell adhesion molecule 1
publication title A Different Fold with an Integrin-Binding Loop Specialized for Flexibility in Mucosal Addressin Cell Adhesion Molecule-1
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 30
structure length 198
sequence length 203
ec nomenclature
pdb deposition date 2012-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09085 Adhes-Ig_like Adhesion molecule, immunoglobulin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hd9A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hd9A01
1CFTA 1R3IH 1IQDA 5EUKA 4Z7QE 4TSCL 5HVGB 5HI3D 2NXZC 2JF1A 4PJDA 4PJIB 4IIQC 4MA1C 4DWHA 4XAKD 4DGIL 5CCKH 3RGVB 5TGBB 2VXSL 4LU5H 4OLYH 4BK4A 2EDKA 3TNNA 2AABL 4EBQL 5FDWB 2VN7A 1GAFH 3S34H 4O5LH 1AIFA 3LY6A 3QFJD 2R2HB 3QO1B 3ZKSD 3L3IA 4Z76B 2VYRE 4HKJA 3IGAB 4P9HH 3E2HC 4WJ5B 3AXLA 1N4XL 1XF2B 4AEEA 3NFPB 3FJTA 1RIHH 2PCPA 2J6EA 4Z18A 4KDVA 3S7GA 1MCNA 4X4ZA 4I0PB 3WFHB 4PBWD 3ZKMD 1N8ZA 3GB7B 3IDJA 1JWUB 3IFPA 2VLLB 3WXWH 4OZIA 4HUVA 3NCEB 1NGXB 1SJHA 1P6FA 2EXYD 3N1QC 2UZYB 1QA9A 2MNUA 2VZ3A 5CAYB 1FSKC 3L7FA 1EHXA 1V7NL 3GBLA 3VFTA 5HGHB 4JDTL 5CBEA 2JTDA 3VFSB 1ADQA 3HE7A 3LSOB 3FFDB 3QEQB 5D1ZA 3P9WB 4IOSD 1YJDL 1FDLH 1T1WA 4DEPB 2PW2A 5FKPB 5IHUL 2Q76A 2YUZA 1A5FH 4RIRB 1FCGA 2KBGA 1IILE 1KIQB 3KS0H 2FBJH 2BJMH 4YDKL 1UJ3C 3D0VA 4ZDHA 3CVHH 4LOUC 3MJ7B 4YR6B 5AD0A 1H5BA 5D7IA 3OXSA 4S1SH 2NXYB 1UWEH 2VSDA 4XVSL 5GZOC 3OJ2C 1XIWA 4LASL 2V17H 1K3ZA 3B83A 3QI9A 4LP4A 5HVWA 1I9IL 2AGJL 3RX8A 1MWAH 1RU9L 3BT2H 4PTUB 1T1XA 3HZYA 5ISZB 4H88L 1CXHA 4W6YB 1ZS8B 5H8DA 5HPMA 1ITCA 2WQRA 4GLRI 3UTQA 1IVLA 2ZKHL 1AY1H 4X6DA 4IRJC 3IDIB 1GIGL 4LGRB 2V2WB 2J88H 5L2JA 1JGVH 3RVWC 1FAKT 2ZCHH 3HE7D 3KJ4B 5D1ZD 3LEXB 1PZUB 1T7YA 4ZUVB 4ETYA 4HKBB 1E6JH 1YPZF 3GMMA 3CDYA 5EBMB 4PGDB 1T7WA 2CLRA 4WHTB 4NQXB 1WWWX 3N1MC 2CGRH 3PP3K 1U93B 5E2VL 4C56A 4R8WH 1ZT7B 3BN9C 3T0AA 3DV4B 3HS0B 1AJ7H 4PV8B 2AK1H 4L8BA 2NMSA 1XR9B 3SDAC 1XIWD 2DIBA 3UZEA 3QI9D 4PRPB 4OCLC 4KUZL 5JHLH 2GKIA 4NUJA 3BISA 4FQCH 1FAIH 5D1XB 5BOPA 2XWTB 3BX7C 1LWRA 4I18A 1FFOB 1I1FA 2IF7A 1T0MA 3F7YA 2F74B 4WI8A 1J10A 3BO8A 2Q8BL 5CS7A 4QYOA 1WGOA 5E8OA 4ALAH 4PLJC 1HXYB 3HZKB 3TT1H 5GXBB 2DWEA 2HAZA 2OP4H 5F1SA 3BIKA 4L4TE 3N9GH 1T1YB 2HTKC 5DC4B 3IDNA 4GKNB 3IDXH 4FTVB 2DF3A 3T8XA 4DQOL 3NBNA 1Q9LA 3MLSH 3GI8H 4GAGH 5JLZA 4BFIB 5C0GA 5EU4B 4NNYA 5EOCJ 3UTPD 5J11C 3ARGC 5C09B 5F7WC 3D39B 3LQAC 1GH7A 3U2SB 5FV1L 1S78D 2Y36H 4C56D 1WTLA 5JNYA 4ESKA 4YFDB 5JOEA 4UU9B 3W9EA 4N0YL 4YX2H 5E8EB 2QR0A 1HH9B 4HS8L 3T1FB 5IMMA 4PJGB 3RNKA 1SM3L 4K55A 1IGFH 2F5AL 1M7XA 5CIPA 3SCMC 3CX5K 4R4BA 1YEIL 3AVEA 5D7JC 2BY3A 4POYA 1KPUB 4PJ9A 3EJYC 1LP9F 4NRXA 1BPVA 3M1BB 1DBAL 4CVZB 2GY5A 1BVKB 2IFFL 5H94A 3TLRA 2PW1A 3CSPA 4M7JL 4OFDA 4RMUA 2GTWA 3PV6A 2ATPB 1T6WA 1EH9A 4G5ZL 2XG4A 3RJDA 3BDYH 2Q6WA 2DQCH 3BPLB 1X9QA 5EBWA 2XXMB 3WNKA 3UTTB 4ERSL 2BSSB 5E7FA 1TPXB 1ONQA 7FABH 4UINH 1DE4B 2I9TB 3TH3T 4LSPL 4J6RH 1LEGA 4JY4A 2EDNA 4MAUH 2EC8A 2KZWA 5DTFA 1V3LA 1K8IB 1YEHL 1KLGA 1XGQA 3SDDA 1BQLL 5T1MA 3EYVB 4O2EB 5FYKL 1F42A 1INEL 2ERJB 3LAFA 1L6XA 3MV01 4HK3N 4MA8H 4BKLA 4PJ9D 4P5KB 1O0VA 2XA8H 4UTAL 4UBDC 2JJSC 5DT1H 4EDWL 2VL4A 4LCIH 3JZ7A 3U1SL 4D9QE 1K9TA 1ZHLA 4P9HC 1VACB 1LK3H 3ZTNL 3QJHB 4Q9BA 1NCNA 2OZ4A 2WIIB 2BC4A 5CEZL 3WJLA 5D70L 2R2BB 2EEBA 5MP6H 3BRFA 2DQIL 1GGIL 3C60B 4H25B 5I15H 3MACL 1OQXA 5GGSB 2Y4SA 4NO0A 1KELH 3FB7A 1DUYA 2IH3A 4XCNA 1N3NA 1QR1A 4M5ZH 4XP6H 2XN9E 4PS4L 5J13C 4TUOA 2VXQL 2P8LB 3MBXH 3GSOB 3SDDD 2Y06L 1HQRB 1MFAH 5D2NA 3FHQA 3L95B 2V2TB 2HN7A 4IS6B 2I24N 4FOMA 2GIYA 4KI5D 3QAZC 4PY7B 1BFVH 4RA0C 4DFHA 3QEGL 3WFDH 1KCSH 3WS6A 3DRTB 1ZTXL 2R56L 3QNZB 4Y2DA 3U0PA 1JV5B 4KUCD 3NAAL 4JQVA 3V6FB 2WLZA 1U41A 4ONOA 1QFWH 5HI4C 4HUXA 4PREB 3BZEA 4LPCA 4I5BB 2DS4A 3QQ3B 3WFBL 3L5WB 4ZUSA 1N6VA 4ELKA 1RZFH 3D48R 4JZJC 2QSVA 4S1RL 2DQFA 1PSKH 1F58L 5DQ9A 5D4QA 2E7CA 4OJFL 3VFRB 1MCSA 4NO0D 3NFNB 3OKLB 3T2PA 5L88H 3PQYA 4LRNH 2PYFA 4JHZA 1NAMH 3NPSC 4M7KL 4PJEA 1I3VA 4ZODA 2E3VA 3SE3A 1PG7L 4QRTB 4Q6YA 4B53A 4OQ1A 1KSRA 1ZGLM 2VDOH 2IWGA 3P77B 3W2DH 5JO5B 4GJTB 4OF0A 4HPYL 4HS6B 1QYGL 3QSKB 1NEUA 4ZSOE 4KJPC 3SKUD 2F5BH 4Y2DD 3MRMB 2VLKB 5B8CB 1QHOA 1ETZB 4QWWC 4GRWF 3MBEC 4H0IA 2DBJA 4Y4HC 3U4EA 4RFEA 1W72H 4N0RA 1T22A 3X3FH 5I1JL 3UDWC 1VA9A 1JHTB 4HUWB 4HULB 5LBSL 5D6CB 1UQSA 4QRPB 1LNUB 1J0JA 3ZMRA 3QCVL 2H26A 4FQPA 4DN4H 3RWJB 2D3VA 1BFTA 4XP9H 4HT1L 4B7IA 1DVFA 1ZHKA 3PIQA 4TVPE 4WHCA 3GRWH 2Z91A 3PQYD 4YZFF 4PJIE 3VE0A 3G6DH 1X7QA 2X70A 5DJ0A 5TE7H 1MREL 1N5YH 3DVFA 5D7LE 4D9RD 5C07B 4KRPC 2GITB 2BXZA 3NCJL 4NN5B 3UYRL 4YAQB 5DJ2B 4M7ZB 5CEYB 5C6WH 3JWNC 3QDAA 2Y07L 1HDMB 4HEPG 3UTSA 4RFOL 3HUJA 4ENED 1CU4L 1ZHBA 5L6YL 1IAKA 3RWIA 5GSRB 2G2RB 2G5BB 5JW5A 1FFPB 2B2XL 3G9AB 4ZFFB 2NY4B 3VG0H 1KT2B 5F6IC 3BPCB 3BGFB 1U92A 4JDVB 4PJAF 1MCDA 5FYLE 2BRRH 1Z5LB 1AH1A 1JPGA 5CJXC 3UJJL 1MNUH 2A1WL 1S3KH 3UBXG 2OJZL 1N59A 5A43C 5DLML 3S4SB 5DMGD 3DETD 5GSVB 4WUUA 4YUEL 4X4YB 1XGRB 3C2AH 1CD9B 5I0DA 4L4VA 1DBBL 1DUZB 2ADGB 1DVFD 4YC2C 2EYSB 3N85L 3TCLB 1CGUA 3F65A 2YA1A 2IBZX 2B7DT 1NLBH 5CGYD 4ZS6D 2V6HA 5L7XL 4E0RA 3ET9F 2B0SL 4IIQB 4YGAB 1BVLA 2DQDH 1W0WA 3TYFA 1FL6A 3QEQE 5EOQL 4U0QB 2YMXH 2OTUA 3MODL 5JW3H 2P5EA 1VADB 4Y7MA 35C8L 3TBTA 2GSIB 3UTSD 1IQWL 2VZTA 4OSUL 2BVOA 4OCYL 3PNWA 2EZ0C 5HD8D 4Q2ZA 4MWFA 2AEPL 2WUCH 2DL9A 2YZ8A 5M95B 1GZQA 4XX1G 1D5ZA 4R2GD 3HG1B 5IVXF 3QZWA 2QQKH 1YUHB 4LQFL 2NW3B 4XCYB 3Q1SH 1H3XA 5JUEH 1N64L 3WDIA 4JKPH 5DMIH 1W0YT 4I4WA 1XZ0B 1NGQH 4MB4A 4WUUD 1U8LA 3RDTC 3TP4A 1KCRL 2G75A 4R90L 5D1QC 1HNGA 5ISZE 5DC9B 3EYFA 5I1HL 2UYLB 4L4VD 4JVUA 1EHNA 3RWFA 2AEQL 4P4KA 4D9LL 3B6SA 4IMLA 3RKDD 1T5XB 3B9AA 2JELH 4OLZH 5ICYA 1OP5K 4FS0A 3RIAF 1ITBB 1LE9A 3OAZK 4KXZI 5D96B 1A6UH 1NBZA 2N1KA 1MHPL 4UQ2A 4JFDE 1A7PL 3EOYG 1JGEB 5D7KD 4NQDB 2P5ED 2CR6A 4KFZC 4LF3B 5IEHB 2GJJA 1JHKL 1JNNL 4YE4H 5E8NB 5CILL 1HHHB 1NDMA 5DZOA 1P2CA 4KROB 1ZA3B 5CD3A 4YBHA 4IOIB 4HWBL 4X5LA 4KY1H 4OF7A 3QQ4A 1RURL 4JFZL 4HFWA 4RWYL 2IPTL 3PDOA 1WIPA 4XNQA 2EKJA 2XYCA 2Y72A 2E9IA 2G60L 3SGKA 3V8CA 4OFKA 3OBAA 4EJ1C 2ZJSL 5D6DC 2CJUH 1NGWA 1G7JB 1BOGB 1M6OA 3O4LA 3OSKA 4LCYB 4P4KD 4XC1H 3ULVE 3WFZA 4MDJB 4NZRH 5SWZA 2OMNA 3OAYK 3P4NA 5BVJB 4RMQA 3HZMA 1Y0LB 4N1HB 1QVOA 1ND0A 3NZ8A 2DMCA 4J8RB 5HYSA 4XXCA 4XVUD 4GG6B 2J4WL 5IB4A 5EO0B 3L9RA 1H8SA 3K8MA 4HDIA 3RPKA 4JFOB 1HSAA 2Y9RT 5C09E 1A14L 3D39E 1I8IB 4KV5E 4G8EB 4UDTB 2EE9A 5B39B 4MQ7B 3WIIL 5HVHC 3WUWA 4FFZH 1S7RA 2NY0C 2R0LL 4F2MA 4PJCB 3OR6B 5LWYH 3MREB 1BZ9A 4X7TB 2NZIA 5D93B 3V2AR 5ETUA 3QO0A 3VWKC 4PJGE 2VZSA 4NDMB 4YHYB 1J1OL 5EC1B 5DXWA 1U91A 3S96A 5DD6B 4D3CH 3DVGB 1WBYA 3O4LD 2CKBB 3LPGA 4U1SB 3BWUC 1KB5H 2MTPA 2ARJQ 2BVEA 5SWZD 3ZE0E 3AM8C 2IAMB 4MXQC 1CGWA 4U3XA 1ZA6B 2P49B 4NRYA 2OSLA 3IDGB 4X7CC 1RMFH 4X6CB 3MV7A 2JK5B 3UTTE 3LB6C 2ZCLL 5FYKD 1XCTA 2XFXA 5BMFH 5I8CA 2OR7A 2BNQA 1YNLH 3H7BA 5T1LA 1WC7B 4U2YA 1EZVY 1I1RA 3GJFK 2A83A 4JO3L 4HS3B 1JYXA 5EC2A 2IQ9L 1KJ3L 3AU1B 3FB8A 2F9BT 4UI2A 5FM5M 5EPMB 4GQPH 5ACZB 3QIBA 5B3NA 3MJ9H 1YY8B 3C6SB 4XBPB 3ARBC 3VFUA 1A3RH 1XH3B 2YD4A 1SBSH 5LG1A 2PF6A 4WFFE 4OZHB 5GS0H 3ZZ1A 4XPFL 4LLVB 1LILA 3IDYC 4J1UA 1R24B 4K94L 5JXAH 4U6TA 3EIFA 1MAML 4HK3J 2A9NL 4X6EB 4M4PA 5DK3A 3I6GA 3I3EA 4Z7UF 4WI7A 3WNMA 3MV7D 4LIQE 3L5XL 2ITDB 4PGBA 4O2CA 3AREC 5FK9B 2JJTC 1PLGH 4R26L 2BNQD 2O61A 1F3DJ 43CAA 5FYJU 3H3KA 4GMSL 5T1LD 5JA8B 2DWDB 4UTBL 5F6HJ 4MDIB 3MV11 1KJ2L 1V05A 1P53A 4Q9CA 3O0RL 1IAIM 2GUOA 1YEFL 3JV6A 1Q9KB 4E42A 2IG2L 3D85B 1HH6A 4LVNB 1U58A 3QIBD 4Y19A 3LRSB 4C59B 4WV1A 5A2FA 1J0YA 2NY2B 1RUML 5DRZB 1RIVH 4NZTH 2V5TA 4LHUG 2CIIA 4FQXB 4GXVH 1JF1A 4Z0BH 3ORJA 5JQ6H 2QBWA 1MIMH 4LHUB 1E4WL 3C8HA 1YZZA 5IHZA 2DTML 5IFAL 2V9RA 3IT8D 4JHWH 4F37F 4QHMB 1RJLA 3QNYA 3IF1B 4PGZA 4ONHA 2P24A 2VQ1A 5K9OA 1AHWC 2FEEL 4Y16C 3IDUA 2PXYC 3MR9B 3PXHA 3VW3L 1M71B 2CUMA 2WINB 1FPTH 3GKWL 1IBGH 4PG9B 3UZVB 4R7DB 5JDSB 4RAVA 1QO3B 1EGJL 5F9OH 1A7OH 3WXVH 5JPNB 4ODUA 4U6YB 4JHAH 2FX8L 3G5ZB 4QEGA 1JPST 1PFCA 3OJVC 1QEWB 1I8KB 4KQ4L 4QCIB 4HW6A 2XZQH 3R1GH 3SDYH 3STBA 4O58H 4JJ5A 4G43B 2BMKA 5IVXE 1JN6B 1WIUA 3LKOB 5TFSH 2J7LA 4YLQT 3WLBB 3GIVB 4TTDD 5F70A 2VB5A 4TUJA 3QFDA 3RZWA 4Y19D 4V2CB 1ZE3C 4JLRB 2ZWLT 1MJ8L 5IM7A 3TT3H 2BP3A 1GPOL 4XBGB 3MA7A 2BSRB 3IJYB 2JKXA 1FV1B 3BP6A 1NBQA 3HRZA 4NQEB 4MCYB 2VLKE 3NH7L 4LSVH 4QRRB 4ZFGH 3HA0A 1T0NB 5DUBA 2A6JB 3BUTA 4WY7L 1FO0H 4NCDA 4F7EB 1YEKH 3IU4H 4NKQB 3OPZH 3UTZB 3L3OB 3FMGL 3GMQA 3KPPB 4NQCA 2C4FT 3T08A 1NGYB 4QRPE 1UZ6F 1OT1A 1OTTD 32C2B 3O8XB 4M7LH 1N26A 1KTRL 2HG5A 4P46B 1J12A 2MPAL 5GGRA 1CDHA 1JK8B 3IJSB 1DQJB 4W4NA 1CZ8L 2C3VB 1TVDA 4M8QB 1BQUA 5IJVA 2H9GB 4IRZH 1IGCL 3VXMA 5DJAA 5C07E 2VR4A 1KBGL 5DMJB 1K4CB 4BUHA 2NZ9C 1MCOL 1KCVL 3NIGF 2J5LB 3PP4L 4EDXA 1J8HA 4H26A 3GK8H 2EC9T 3QIWA 4NHCH 2R0ZL 1WEJL 4CNIB 1AGDB 5DK0B 5DHYB 3EDDA 1QFPA 5IUSA 4MNGE 3LV3B 3I6KB 5B4MD 5DK2A 1BBJA 3UPRB 1OAXH 3VD3A 1P1ZA 2XA3A 5HY9A 1T4KA 4KVCL 4Y4HB 1WWAX 4NQCD 1D5MA 5EA0H 2F54A 1FZJA 1KN2L 2EYRB 5GISH 3C9NB 3ZE1F 1KEMH 2HKHL 4L3EA 3HKFA 4PTTB 1V7ML 3ZKXC 1LO0L 3CFCH 2YEZB 4WU5A 1TETH 4HWBA 3VXMD 5C8JA 5C0EB 1TZIA 3SJVB 4MNQB 1YECL 4GAJH 3BPNB 1AQKL 2AJYL 1UXSB 5CUSH 5KS9F 1NCDL 5EFIA 2FATL 1J8HD 3LN5B 3HMWH 5J6HB 3QIWD 4G7VL 4KJYB 4PLOB 3D87B 5AWNH 1BJ8A 4OKVA 4U7MA 1SEBB 1WZMA 1IGTB 2EIZB 4YNYB 5DQDH 3H0TB 4EVNB 4QY8A 4ONGH 2HRPH 1U8PA 3HG1E 3EDKA 1XGYH 3V6OC 3EDEA 1PYWA 2VUYA 3H3PH 1J5OL 1TMCB 1FGNL 4NNPH 4WVRA 1MHEB 3P9LA 4QNPF 5FOJA 4GRLC 1X5XA 2WWMD 1A47A 3TO4C 2H2PD 5IOPB 2FX7H 2F54D 5ADOL 1ZGLB 4L9LA 4F3FB 5MERB 1VEOA 2X5PA 1O5DT 2EYTB 2ICWB 2ED7A 1FC1A 1HINH 2BZDA 1KCUL 2WBKA 3G5XA 1IFHL 4L3ED 5ICXB 2PKDA 2IPUK 3DO7B 1FNEA 4JO1L 5IMLB 4H1LG 2QQLH 4LPXA 4Z5RB 3MRFA 4YC2B 4PJ8C 3CZFB 5CP3H 3F12A 2E9JA 3JXAA 5GS0C 4X4ME 5IBTH 1FZOB 5KJRH 4FQJL 4M6NL 4P59H 2BVQB 3FQTB 5C0IB 2IALA 5EOCL 1TQCC 4NQDE 5A40E 5ESVA 5KOMC 4ZS7H 3ULSB 3CSYB 1TTFA 4JRYB 5A2LH 4AG4L 4NIKB 4HXAL 2Z31B 1F11B 4GKOA 4YXHL 3C8KB 3V6BR 2VO5A 3MNWA 3STZB 2DAVA 3PWNA 1XR8B 4OCSH 1WFUA 1T66D 4QKXB 1KJMA 1T7XA 4KK8C 1HILA 5FM4A 4XNMA 5F89B 2A6DA 4LKCB 4U6HB 1Q94B 4L4JA 4XVTL 1IL1A 4P3DB 5SX5H 2EDOA 5C0BE 3EOTH 4LSSH 1A6TA 4FG6D 3QWOB 5BQ7B 4FXGB 3G9VA 1M7DA 1KV3A 1Q1JL 3KPOB 2OQJB 2R23B 2VXVL 2LVEA 3PV7A 3VWJB 2APFA 4YHKH 3GSVB 3WHE0 3SE4C 3TZVB 3VD7A 1WSST 5DS8B 3MLRL 4G6AD 1IAIL 4I2XB 3W5MA 1QBLL 3T0EA 1H8NA 1F3JA 1G9MH 4MXWH 5DFWH 1ZHNA 3PE9A 4GG6E 3HNSH 3T0BA 3OB0H 4MSWA 4L8SB 3HNVL 3KWWA 3NZHH 5J57B 4KDTC 2C1OB 5I1AB 1YEGL 5T3ZE 3OB8A 4F7TA 1KJVA 1L7IH 1RJYA 1MCWW 1JUFB 1LEKB 2W60A 1DEEB 5I74B 4PJCE 1NBYB 5I1IL 5K59E 5CSZA 3QDGB 4ZAKC 1T2JA 5ECJE 3B5GA 3PWJA 5I1DB 4M61A 4K3HA 3TBVA 4XBEH 1CLOL 3IU3A 3MRIB 4BQ6A 1TJHL 4HJJL 4XH2B 2X2YA 4ORZC 1A2YA 4KTYA 4LLAA 3CSGA 2HWZH 5I8KL 3C5SB 1D9KC 3HC0B 1EERB 1DLHB 1UB5B 4OZ4B 1HYSC 4HV8A 1UZ8A 1H3PH 5HGAA 4QXUL 3T0ED 2DMKA 2F19L 1KJ2A 3SGDH 3VFGL 3GUTB 1W8OA 5DZLA 3L1OL 4X6CE 4K8RD 1EJOL 5EU3A 1KPVB 2A0LD 4G42A 4X0KA 5DO2C 1HSBB 1OF2B 1UJTA 3NGBB 5DRWB 4YWGH 1MEXL 2MKWA 4J3WA 1MCLA 1A7NL 1IEHA 1ZVYA 1JTPA 3MCKB 1OAUH 3JTSA 3K0WA 5IBLC 1B4JH 4PY8J 1XGUA 4RISL 1XGTA 1OAZH 4W68A 4NKIL 1T0PB 2BOBA 4P5TA 3WN5A 5HYQB 3B9KA 5KZCD 3OAUH 2N56A 1YPZA 1I3UA 3CFJB 3V4VH 1CLYL 2A74A 1X4ZA 3MA9L 1S7XB 1EGJA 5D7LA 4U7KA 1JZ7A 1S7SB 4U1NB 3HB3D 1S9KC 4NP4H 4OGXH 4P4RA 2Z35A 2HJKB 3C6LA 4OF5A 4WNQA 1D6VH 2VRAA 2JB6B 3N50A 1L0YA 2OTWA 2AXFA 4DK6A 1HEZB 4XRCB 1DQLL 4UOJA 2QADD 3B8SA 3OGCB 1KUMA 4Q6IA 5DJZA 3WL9A 3X12A 2CK0L 15C8L 2AXHA 3O11B 1JMZA 1Z9SA 2R1YB 2XQBL 1KNOB 2R4RH 2HLFD 4KTDH 4WI2A 1IGMH 4HUUB 3FT2A 2UY7A 3T09A 4JZOA 4I0PA 2HJLB 5F1IA 2VNCA 4WEBH 1DFBL 3I3BA 4MMXC 4P5TD 5CLTA 3SKJL 1VFBA 3B9KD 2ADIA 3IDMA 1BWMA 1A3LL 3RY6A 3TIDA 4TVPD 2V5MA 1EBPA 2BFVL 4CBPA 1A4JA 2WUBL 1OTUC 3QWQB 2ITCB 1U3YA 4EKXA 5HGHA 5D7LD 1MH5B 1WZKA 3RKPA 3GJEA 5J9PA 1T1ZB 5TE4H 4G8FB 1ACZA 5GRUH 2WK2A 3B2UD 3C6LD 4UB0L 2JJUA 1IEAA 3GDBA 3RPIA 3FB5B 3ARDA 4Y1AB 1MLBA 1P4IH 2OTPA 1SJXA 1TCRA 3W39B 1Y6KR 2Z4QA 5KOVC 3FOLA 1GXEA 1KEGH 1LP9A 4R97B 3NCYP 1JF5A 4P2QB 5J6GB 4M6ML 1E27A 4PRAB 3OV6A 3BHBB 3O41A 4P57B 4OV5A 3BJLA 4I0PD 3V5DA 1KFAH 4F58L 5E8PA 1J7VR 2GFBA 4Z7WB 4POZC 1BAFH 4ZQKA 1F13A 4XZUB 3H42H 4HKXB 3CLEH 5FO7B 4ODWA 4NN7B 3BEVA 3VGAB 5IESH 1EMTH 2B4CL 5A3IC 3ROLB 3TCXA 1BIIB 2VDNH 3KVQA 4Y5YC 3KLAB 2EO1A 4NQEE 4QRRE 5F1NA 4M6AA 2BXYA 5FXCH 5I75B 3S88L 5E00A 2NTFA 1JGUH 2D0GA 4ODHH 4JFDA 3K2UH 2P5WB 4K3EH 4WGVB 4JQXC 3ARDD 4YXKH 3VXUB 2O5YL 3HN3A 3A67L 2LV4A 2PXYB 4MLIA 3ZKNC 1E6OL 5GJTL 2YHGA 1CXFA 3ME0A 5DR5L 5JW4Q 4NM8H 1A9BA 3QG7L 3MRNB 2FO1A 5DHVB 2CD0A 2SEBA 2Q7NA 4LK4A 3TV3H 4WFHD 5F88B 1WISA 4WFEE 4HZLB 5C71A 1Q0YH 1CL7H 5CJOL 5C70A 4MB3A 5KANG 3SOBL 3L6FB 2V7NB 4Q0XL 2KPNA 3Q3GB 2F74A 5F7MC 4F9PA 3VA6A 2OR9H 1T5WA 3BP7A 2DRUA 3B3IB 3DHMA 4QHLA 3A6CH 1ZLSH 1BGXL 3EGSA 3I6LD 4P2YA 2FCBA 3M8OL 1U3ZA 3AS3A 2X09A 4D0DA 2ATKA 4EI6B 4QXGL 4NKMA 3QPXL 4JFDD 2NY3C 3MFFB 2VIRA 3QUML 4LQ1A 4FFVC 2DQUH 4Y4KA 3QXDB 2X4QB 4MJIA 3VRLE 5HGBB 4GKSA 3ARFC 4RMRA 4BH8B 4YK4B 2VL5B 1J1XH 4XP5H 4ODSH 4ZOEA 4UDUA 2HVKB 4BZ1H 3AAZB 5ELIA 3O6ML 3UPAA 4DZ8A 2QEJA 1IKFL 1B0GA 1TVHB 3JV4B 4LKXA 4O9HL 1R3KB 4RGNC 2VE6A 1TFHA 3DYPA 3QUXC 3P0GB 3EZ8A 1I8LA 1SHMA 4AMKH 1WCQA 3CC5B 1DJSA 3SJVE 5TDNA 3GSXB 1QBAA 3F58H 1GHFL 2X4PA 5ACLA 3U46B 4W4OC 3A6BL 4H8WL 5E24E 4UZGA 2OL3B 1A8JH 3BDBA 4HUMB 3GMNB 2FB4L 1HZHH 1T7VA 1P7QB 4JG1H 5IGXH 4J12A 4K3JH 1BQHG 3OX8A 2O5XH 4X5XA 4O2FA 3U9PL 1I3RA 2ZSWA 5LKNA 1AGEB 5F3BB 4NQVB 4P99A 4UAOB 4OLUH 4Y4KD 4ZUWB 5SWSA 4MJID 3BKYL 1FVCA 4F7PB 5FF6A 4MAYA 1SJEB 1AP2B 2VXUH 2GHWB 4HUNB 1PKQE 1LD9B 5J3HD 3IKCA 1IKNC 3RWEB 3MRKA 4TTGA 3BUYB 5E4EB 1XF4A 3CFEB 2VDMH 1HHGB 3ECBB 5I19L 1CGTA 4ZYKA 4LGPB 4LLYB 5D71L 2MHAB 5DEGA 1QUNA 2L7JA 3RL1A 3WO4C 1ZK9A 4HCRA 5DF0A 1UXWA 3PABA 3HAEA 2XI9A 2I27N 2IADB 5F7DA 3BVNB 2ZUVA 3VXRA 4CL7A 4JRYE 3AGVA 4PJFB 1FNFA 4HC1L 4JFHD 2E8YA 1E4XI 1H15B 4R4NC 2YK1H 4TSAH 1KF9B 4OM1L 4U1LB 3TA3B 3QUYC 4YHLL 1UM5L 1QKZH 4XWOC 4IRSA 4GAFB 2GAZA 4XAWH 5I73C 3MGOB 5SWSD 4NC0B 4DN3H 1XF5A 5CBAA 2CPCA 3NTCL 4MAYD 1U8IA 5E9DA 2BVPB 5IMOB 3QYCA 3W5NA 1X3DA 3R0MA 5F9AC 4H0GA 4APQA 2F58L 3NA4A 4PJAA 4Z0XA 4Z77A 3EYSH 2CH8A 1CE6A 3VI4F 4JY5H 1CLZL 5EOTA 4I2XE 1T21A 1DQDL 2F53B 1C5BL 3CH1B 2AJXH 4A6YL 4RNRB 1RJCA 3BZDA 1QSEA 2DJSA 1A0QH 1BX2A 5T3XE 3VXRD 4KRMB 2R4SL 1JWSB 4R7NB 4R0LA 4G8GB 5C0JA 4KGLA 2PN5A 3HR5B 3D9AL 1Q72H 2D03L 1VGKB 2HLAB 3QDMB 1GSMA 4TOYL 3GO1L 4IRSD 3TBWB 3ZYJA 3O9WB 2VDQH 2XPGB 4DCQA 6FABL 2DKUA 2B5IC 4FQHA 4OLVL 5FYJL 2FGZA 1MFCH 4NKOB 1IT9L 2VWEC 1M1SA 4OT1L 4PYHA 5E9DD 3O2VH 1RFDL 4UIMB 3VFVB 4EI5B 3W0WB 4JO2H 4UIKH 3SE8L 3TBYA 5KSVB 2HKFH 5DMYA 1JI1A 4M1CD 1G6RH 4OCRH 4L5FH 3I2CH 3UC0L 4APQD 4HWEH 5HHQA 5KANI 4NNXA 1K6QH 4ZXBC 4JREC 2YPLB 2R0KH 5IVXA 2FJHB 2H6PB 2R9HD 5I76A 3DROB 3VXNA 3MLUL 3RVUD 5EUOA 5MEPA 3QDHA 1CBVH 1N7ML 1SY6L 3MJ8A 2FECI 3G6AA 4G3YH 3GSWA 1Q8MA 3SGJC 4XTRC 1T03H 5F3HA 1QSED 3S37H 1U8HB 4DVBA 2I60L 4NQSA 3BD5A 5JOPD 3ARXA 4F57H 3VXPA 4ODTL 1HHKA 2D7QA 5C08A 4HIHA 2WBJB 1CD1A 1A1MA 5CCKL 4J3UA 1U3HB 4LU5L 3M17B 1A6WH 4OLYL 4N68A 5FO9B 2V7HA 3MLVH 4J3OC 5MHSE 1S7VA 4F7CB 5FKAA 3U79A 4NRZB 1H3TA 3KXFE 4YDJA 1GAFL 4ZAKB 3S34L 4O5LL 5JPMA 1IM3B 1FORH 2AJ3A 5GGUB 4XB8A 1M05A 4F8TA 3TIEB 5J8OA 1PX4A 4P9HL 3VRIB 1YNTB 1DQQA 4PRHA 2R15A 5JOFB 4LEOB 1RIHL 3MUY1 3RWCA 1PDKA 3GJFA 5LGHH 3WD5H 1RUPH 3F8UB 4NHUB 3WXWL 5C9JB 2X4SB 4MD5B 4P2OB 4DVRH 5HDOA 4BSVA 2NX5A 1LO5A 1ZT4A 4MNGA 1T04B 3LN9A 5C0AA 3VCLA 4WGWB 5ERWB 1NDGA 1HE7A 4S1QH 1EX0A 4L8DB 5C08D 4XCEA 2VDKH 2XTJB 3PWPE 2DI9A 3HE6B 5IFHH 2FR4A 2ZZUT 1QFWM 4ZPTB 2A2QT 3C5ZC 2EDTA 4GW1A 3PHOB 3UBXA 3QUMB 1W2KT 2A73B 2ZUQB 4KJWD 2X4NA 1BJMA 1FN4A 1BJ1H 2XXCB 3WE6B 1FDLL 1XCQA 3BIAX 4CU8A 1OT2A 4HKZB 1P7KB 1WF5A 1A5FL 4OZFA 4EN3C 3HMXH 3V0AC 5T33H 2FIKB 2DLHA 1N2RA 4PRHD 3GSNH 1G7QB 1RHHA 2HT2C 1QP1A 2BJML 4NBXB 2P1YA 3UJIH 3CVHL 3U7YL 1OVZA 2HFFA 3CDFA 3CH8A 4S1SL 2AK4B 2C1PA 1UWEL 5L2KA 3KYOB 1F45A 5K9JL 4FQ2H 3ULUC 2V17L 4LLDB 1S7TB 1YDPA 3KDMA 1N6UA 1MWAL 3RZCB 1FNLA 2NX5D 3KPQB 4P2QE 3WEXA 5C0AD 2ZCKL 2XG5A 4WW2A 2CXKA 4M4RA 1A1OB 4F8QA 1UB6B 2YXFA 4G9FB 1EO5A 1AY1L 1FLRH 2GK0A 4OQTA 5FGSA 4Z7WE 4RZCA 2J88L 1JGVL 3S35X 4NT6B 2OI9B 4XPHH 3NABH 5E5RB 2ZCHL 4PJHF 3RL2A 4YXLH 3MNVB 4RFNC 4YHZH 4X6BB 5IFJB 5SV4A 3NIDF 2X6MA 1FGVH 2BX5A 5IIEB 1BD2B 4QF1B 4E41A 4G6FB 1E6JL 1RULH 5E5MB 2NXZD 1K4DA 4K9EL 2HVJB 4JQIH 2P5WE 3KAAA 4R8WL 1I1YB 3IFNH 5IB5B 4LLUA 1AJ7L 4YH6A 2AK1L 3S5LB 3CMOH 3VXUE 3VD5A 5L2KD 1BEYH 1B3JA 3CU1A 1JRHH 4GBXC 3LN4B 3PWVB 3OR7A 5JHLL 4L1DA 3JV0A 4FQCL 1FAIL 5DJCB 1NFKA 1UYWH 4GO6B 3PGDB 1SBBA 3D18B 1UJ3A 4L9DA 3U30C 4K3DH 1Y18B 1CDJA 3I02B 4ALAL 1SYVB 3SPVB 4J3VA 4Z7UA 1CFQB 2OP4L 5E5UB 1G0XA 2OR8A 1HCVA 5EU7E 3WO3B 5C0BA 5EO9B 3N9GL 5HXMA 3LPFA 1DANT 3IDXL 4EUPB 3FZUD 3K4AA 3KYNA 2A6IB 1MCIA 3TPUA 3MLSL 3GI8L 2CIKA 3OZ9H 4GAGL 1IMHC 4OTXH 4F7MB 2AQ1A 4E41D 4LCCB 1HI6B 4Y8AA 4LLMB 4UUJA 3E6HA 3WIHA 5EIIA 4U1IA 1G7HB 2XKNA 4IRJA 2ESVE 2Y36L 1G9NC 3GSRB 4BQBA 2DJUA 4YX2L 1UVQA 1CF8H 2OXGA 4HG4J 1GZPA 3MV9B 4A6YB 2GY7B 5DUPH 3U4BH 4X8JB 2ARJB 1IGFL 1EEQA 1INDH 1HQ4B 3QIUC 3SKOB 4QHKJ 4JY6A 4EXPX 4HC1A 4WO4C 1M7IA 1VFAB 4LOUD 4PRDB 5CWSA 2BNRB 1SYSB 3Q6GH 3QISA 5E7BA 3WYRA 5BV7C 5GZOD 3SDAA 3DUSA 3EO0B 5C0BD 4Z7VB 5F72S 1A9EB 2Y23A 4K07A 2PTVA 1YNKH 2DQCL 2VN4A 3VGEA 2JCCB 3PHQA 4JFXB 1I1AC 5IF0A 1E0OB 7FABL 2CUHA 3NPZB 4NOFA 4X4XA 1A6AA 1J05B 1PQZB 4NZUH 3AS1A 3QRGL 4IRJD 2Z8VC 1AO7B 1OAYH 4PIRF 1D5XB 2AV7B 4MAUL 5FGRA 3ZLQC 2DJ4A 3RVWD 5IHLB 1LDSA 5JW4M 3WLWC 4XGZA 4RMWA 1RSFA 4HJGA 4XMPL 4HGWA 3B2VL 5BO1H 3HZVB 4M00A 4IOFD 5CEXA 1WAAE 2P7TA 3X13A 3D2UB 2HJFB 3MUHL 1GGCH 5GGTL 3OHXB 5DJ8B 4KZDH 3JSSA 1QBBA 3ARGA 3FT3B 5IVZA 1X5IA 2XA8L 5AUMA 2C26A 5KVDH 1ZWIB 4XMKH 5DT1L 3BN9D 4LCIL 4F33A 1QHPA 4N5EC 5J1AA 5BVPL 3SDAD 5FOBA 3MUGA 2CRIA 1LK3L 3CMGA 3DMMB 3ARWA 2ZUUA 4P2RA 5ALCH 3FQRA 4RBPH 2VJXA 2ZSVB 3FB6B 3SCMA 3ZDZE 4N0CC 5MP6L 3H9YA 5D7JA 5C2UB 3P40A 2UZXB 3BH9A 4O51A 1A1NB 4BZ2H 4ODXB 5I15L 4MXVE 4GRMA 1KELL 4MYWB 2CDFA 2PO6B 4GXUN 3AC0A 4PLJD 2DQEL 4M5ZL 4NC1E 4XP6L 3RNQB 3G04A 3C09C 5IB2A 1ERNA 5EWIL 5J89A 3MBXL 3MGTB 5IQ7H 3DTXA 4JM2C 2HTKD 5I2IB 1NCAH 5IW6B 4NN6B 3ZDXF 3QEUB 1MFAL 4JPIB 5MI0B 1L0XA 5C7XH 4OIBA 3ELAT 1YC8A 1JCKA 4OAWA 1UWGH 1L9NA 4LPTA 1OW0C 1FZKB 2W9DH 1BFVL 3EUUA 3ARGD 1S9YA 3T0WA 1ORQB 5J12B 4NO2A 1GC1L 2X4UB 1KIRA 5FA3A 2E6JA 3BRDA 4G8IB 1QFWL 2KZ1B 3KR3H 5FM8A 3U0WL 3M07A 4JZNB 4YDVB 2GJZB 5B3JF 3MMEA 4P2RD 3L3GA 2VABA 2X4RA 4YHPB 4LHUA 4U6XB 4MMZC 3SDXB 3SCMD 1F00I 2CK2A 5FYJD 1RZFL 3BH8B 5D7JD 1PSKL 4PLKC 3GI9H 5D5MB 1CG9B 5GIRA 1U8QA 1NAKH 1NPUA 4MA3B 1R5VA 3DYOA 5EZJB 2JJSA 5AZEH 5L88L 3QDME 3O3AB 1NAML 3MR9A 1WBZB 5ESQA 1X5FA 3BP4A 5KS9A 1YMHA 5HDLA 3WIFB 4KZEH 2P47B 3N1PC 4EEEA 1HKLH 3HPLB 2VDOL 3U7WH 1OGAB 1V3MA 5EU5B 3W0WE 4KKLC 3FQUA 3BXNA 3MOAH 3FFCB 1P5VA 1U95A 1ACYH 5FEBA 5IKCA 2YPLE 2F5BL 4GSDH 3KYMA 1EEYA 5LAXB 4OLWH 1WBXA 5MEQA 5E6IC 4DKAA 5IG7B 4ZO8A 4Z6AT 1MCJA 4D8PA 3OKEB 5LGJB 1EXUA 1W72L 4WTZG 3X3FL 4LHUD 3DV6B 2BDNL 4IHOB 3D69B 3NIDE 3TN0B 4QRRA 4DN4L 5HDQH 4AY0A 1ZLUH 4UBDD 4PRIB 4H5SB 5HYFA 3GRWL 3EKCA 4TVPH 3L3OA 3G6DL 1CQYA 1I7UA 1J11A 1KOAA 1N5YL 2XQYK 2NY1D 3RX7A 2NNAA 3WNOA 3G5YB 5CJ8A 3CVHA 4U1MA 3BQUC 32C2A 4JZJA 2DLFH 4PLNC 4DTGH 2JLLA 1WV7T 3IJSA 1DQJA 3MLWH 4U0RB 4QOKB 4D0BA 3VXTA 1UEYA 4MS8C 1MWAA 5JA9A 3RY4A 3BMWA 2L4OA 3MO1A 4I1NB 2YD1A 1OB1B 1C16B 4PJ7F 3VG0L 4ZTOH 4HG4K 2ENSA 2A9MH 5TF1H 5FHAH 2BRRL 4U1JB 2BCKB 2IBGA 1RVFH 5FYLH 3LS5H 5DJ6B 1MNUL 1Z0MA 4LSUH 1S3KL 5BS0B 4D0CA 5T5FH 1PD6A 1C12B 4N8VG 4MQXC 5SX5K 1AGDA 3H8NA 2EECA 4QRRD 1Q9WA 1RK0A 3BMVA 3C2AL 5CZXC 2NW2A 4BK5A 4OUUB 4ZPVA 3LQZA 5F6HI 5IB1B 1NLBL 3L3HA 2XTJE 3MBEA 2XNAA 4FMFA 2RIKA 3ABZA 2P48B 5F7EH 2FL5B 4FP8L 4QXTB 3D0LB 5F7UA 3UDWA 5C0NC 3GHBH 5DVKA 5CGTA 3SDCB 2EH8H 2VITA 3QCTL 5HHXH 1F4WH 4HQQH 3OB0K 3DWTA 3TO2B 3VFOA 2YMXL 5I16B 5JW3L 3JWOH 3CXHJ 4CADB 1MCPH 5I9QC 2MKLC 4U05A 4WIQA 1AGCA 4WFED 3HC4L 3O6FB 1G7IB 3LHPL 4L8CB 2AK4E 3Q1SL 4FXKB 4ORGA 5JUEL 1ZSDB 5DD5H 4JKPL 5DMIL 5C0CB 4JG0H 1NGQL 1AD9B 3CLFH 1I7TB 2PR4H 3MRDA 4LNVA 1BZ7A 1U0QA 3D25B 4WTWA 1KULA 4MJ6B 3U6RA 3P4OA 5ID1A 5CMAA 4XPGH 2Y5TB 4KJPD 3QUKA 4K23H 2Y1VA 1U42A 1ZV5A 4WWKC 4FA8A 4QWWD 2BERA 5EZLA 3MBED 2YD6A 2JELL 4OLZL 4LNRB 4EZMA 2WNGA 4HH9A 5KSAB 1SMOA 3Q48A 4TYUA 3FO2A 5CJXA 5C0FA 3NA9H 2P42B 1A6UL 3O2WH 1PKQA 2ZNWA 5KVEH 3DX8A 5F9WC 2B8OT 2W07A 1LGVA 2FJGA 5CZKA 2ZOKA 5CSGA 4YE4L 1XF3A 1BD2E 4ZD3H 1D5BB 5MENB 2UVEA 4M93B 5DRNB 1LO2H 1CLCA 4PGEA 4H1LA 1RIUH 4KY1L 1KIUA 5HHOB 4KRPD 2IJ0C 1D5IH 5JHDA 2OK0H 4LVOC 3QULB 1D6EB 3K46A 3GMPA 3S36L 2V2XA 4YPGB 1MFDH 3NIFE 2CJUL 3IAQA 3SE9H 1OAQL 5I17A 2LVCA 1JPSH 3MRPA 4I48B 3CU7A 4MD0A 4NZRL 3ULVH 1QSFE 4K7PH 3FAWA 4EIGB 4Y5XB 1F90L 1YMMA 2NY6B 2WV3A 3G08A 2W9LA 43C9A 3IAPA 4HEME 5HJ3B 4P23C 1BHGA 3RDTA 2XWBA 5ITBH 4J23A 5D1QA 2GW5A 2BOCA 1JNLL 2X7LB 5M7QA 3RWDA 1MJJB 4NO5A 4LLWA 4G9DA 1YY9C 3RTQB 1JGDA 1LO4H 4ZNEE 1S7UA 4FFZL 1I3GL 5JHDD 5JXEC 1RZGB 5LWYL 1C5CL 5B3JE 4OB5L 5CD5C 1FC2D 3MV9E 3PGCB 3MV8B 5K9KA 1MVUA 2G5RA 1UACH 1I8MB 4KK6C 3O3BB 4UQ3A 2EZ0D 3EYQD 3P30H 1N5AB 2UWEB 4PJBF 1S8DB 4D3CL 1WTGT 4MD4A 4OGYH 1R5IA 2VDRL 1QBMH 3ZE2F 1T89A 1S5IH 4WW1B 3EDFA 1KB5L 2C9AA 2LU7A 1YMMD 5EBLA 5KN5A 1IGIH 2B1AH 4Z7VE 5ILTH 5DRXB 5D6DA 1RMFL 2BNUA 3RDTD 1RK1B 3DRQA 1OSZA 2JCCE 5D1QD 5DDHA 3RUGB 2OX5A 4YO0B 5JIPA 3QR2A 2YC1B 1IAOB 4NYLA 3EYUH 1YNLL 3KPNA 4PJXB 1AGBA 3RWGA 3IFLH 3O2DH 1AO7E 3CFBA 1MRCH 5A2JH 5D2LB 2VLRA 2VDLL 4M7LT 1PX3A 1KIPB 3SKMA 3VXSB 4EXKA 1M4KA 4JRXB 4U1KA 4NCC1 1TTUA 3MJ9L 5TQ2H 1B4RA 5E6ZA 1INQB 3RGVC 1A3RL 1H0DB 2D31A 5BJTA 1SBSL 3ZT7A 4JANA 1MHCA 1G7PA 3QDJB 5GS0L 4NSKA 2DMBA 2W65A 3MNZA 4ETQB 1S9WA 1LE5A 1EEZB 1FL3A 3QH3B 4WO4B 5JXAL 3DGGA 3KXFA 1NAMA 4LLQA 1I9RH 3VWKA 1QPXA 5BV7B 4DGIH 1JYVA 2XWJA 6CGTA 4ZFOB 3JWDL 1FBIH 4PYGA 3ULUF 3MJ6A 4UMGA 2AABH 2EXWC 3MRHB 4EBQH 1XIWC 4LIQH 4OI8A 4JFQB 2JJVA 4D2NA 4JN2B 3TJEH 3OJDA 5IW3A 3TH4T 1EFXB 3STLA 3LKQA 3SY0A 3FO0L 3I75B 3AM8A 1ORSA 4UT6H 2E9BA 1UH4A 4XT1C 2VLRD 3HI1A 3CVIH 3TVMA 4YJZL 3CXHK 5FCSH 4KKBC 5DEFB 4Y5VB 2COQA 2QHLA 1NEZB 1RIVL 4NZTL 2FZ3A 4GXVL 5CZVH 4MJ5B 3QJFA 1S9XB 1B6UA 2X42A 4DUVA 5JQ6L 5F93C 1F6AB 3FT4B 2GSGB 2EDWA 3PWPA 1C7SA 2XY2A 1T2XA 3WDHA 4OI7A 3JWOC 4DEPC 4JHWL 3QHZH 2NY0D 4P9MH 3GRWA 4M43H 1J1PH 4DUXA 1U6AH 4KRLB 3O6LL 1QRNB 4RAUB 4URTB 3KXFD 4QHUB 3VWKD 1IC4H 4JDTH 2VLME 1BFOA 3MRBB 2DB8A 4IEFB 3ARBA 4L3CB 3GGWB 3SDXE 2DM2A 1CT8B 1FPTL 1IBGL 2Q8AH 5F9JB 1RJZA 1S7WA 1BIHA 5E95B 3MRGA 5D5ME 2NXYC 3REVB 3DXAE 4NM4H 1EHLH 5F9OL 1A7OL 2H32B 3WXVL 5I1LB 5GRJH 4BSWB 2N4IA 4FQ1H 4W6XB 4JHAL 4AM0B 4WI3A 4OD2B 3OXRA 2EDFA 2XZQL 2J8UB 3R1GL 5K33A 4I18C 3LKPB 4MXQD 4O58L 3LD8B 4HX1B 3IRPX 4S2SB 5TFSL 3TVMD 1AD0A 3F7VB 4R96A 4YDKH 5IP4A 4GAYA 1N6QL 1JF6A 3IETA 4L29A 3FONB 1AGFA 4JM2B 3DBXB 4NZJA 4Q9RH 1OGAE 3LB6D 3TT3L 2G9HB 4ZTPH 5I1GH 3RUGF 2AKRA 3AREA 1IC1A 2JJTA 3Q6FB 3WHXB 3FFCE 3IVKA 5DVMA 1JZ3A 3PWPD 3DGCR 4G6MH 4WU7A 1FZMA 25C8L 4LSVL 4H88H 5T1DL 5KSBB 4ZFGL 1JMXA 1RY7B 4LAQH 3P3YA 5HHNA 4IDJH 5GS1B 1FO0L 2C5DC 3T0XA 4Q97A 3FTGA 2ZKHH 3P0YH 1ZGLP 5DJXA 4YGVA 2RAMA 3KPLA 2QSQA 4KAQH 3RHWF 2Q1EA 3ARBD 2Z92B 3P0VL 3VD4A 1KCLA 1KLFA 4AEFA 5I66A 3SQBA 1NGZA 3DVIA 4BA8A 1HXMB 1KLUA 1NC4B 4PRIE 1MCKA 1ODAA 5IVNA 4OF8A 1FVEB 1DLFH 1MCQA 1TJIH 5GS2H 5D1XC 3L5HA 4IRZL 4QTHA 1AHWA 4Y16A 2PXYA 2YRPA 3ULVC 5B38B 1WVZA 2H8PA 4KU1A 4ELMF 3NCFB 1AC0A 1G7LA 2LU4A 3T0VA 2QJDA 2J6EL 2VWEE 3ARED 2HMIC 1IC5H 5DI8B 5E94A 3GK8L 4QOKE 2VSCA 4NHCL 2WWKT 4ZG1A 1U36A 1T3FB 1FFNB 5IBUG 5IEKB 4OM0L 4PPTA 4ZFZB 3OTTA 2AJUH 4HGMA 3O45A 1EAJA 4OZGF 2DYPB 5IQ9B 4QT5B 1BBDH 5BS0E 2YWYA 2H3NB 3UO1H 5EA0L 1A7BA 3KJ6H 1QPPA 3UZQA 4OLXH 1F6LL 3MUJA 4M48H 3CUPB 5GISL 2OBGA 2ESVA 2XZCH 3IJHA 1AKJB 3MFFA 3HLAA 5DFVD 2GTZB 3CFCL 5EZOH 2RGSA 4GW5A 2GK2A 1DQTA 1TETL 4AIXA 2QHRH 1ZVHA 2MCPH 4Y16D 1IE5A 2PXYD 4YIQB 3G6JB 1C1EH 2IC2A 3FO9A 4GAJL 3VXOB 3FCTB 2IBBA 3UP1A 3MLTA 3QA3A 5CUSL 2Q86A 1RZIB 1QSZA 3J8F7 3WJLC 1FJ1A 4PRNB 2F5AH 4X6FA 3DO3A 3GSUA 4JN1H 5D7SL 5AWNL 3TESA 1RZ8B 3THMH 4DJMA 4Z78A 5DQDL 2HRPL 3HNTL 1XGYL 3H3PL 4HHAB 4R3SA 1BECA 3AB0C 4NNPL 2IFFH 3C5JB 3LKRA 2HFEB 5KSUA 3M45A 4JM2F 3NN8B 5C0CE 1NUFA 2ZUWA 4TN9A 2FX7L 5ALBH 4YHIB 2GEEA 4G5ZH 4HBCH 3OKNB 1K8DA 1HINL 2ESVD 5IB3A 1OCWH 3TPKA 1BQHA 3Q2CA 2QQLL 5BZDA 2ERJC 1FYTA 4LSPH 1AR2A 3DVNB 1PVHA 4HIIA 5IBTL 1G7MB 3BFOA 3BAEH 4AIOA 2QKIB 2Z93A 4YQXL 2EIDA 5KJRL 4FZ8L 4P59L 1X5JA 3VRJA 3U82B 4PV9A 4Y4FB 5IMKB 3VG9B 4ZS7L 1CICB 3MZTA 1MRFH 4JFEA 2Q3AA 3VH8G 5MENE 5ANMA 2NLJA 1MQKH 2X1XR 3WJJC 3C60C 4PJ5B 4U6VH 4OCSL 2L0DA 2Y7QA 1HYRC 3BZ4B 3OKDA 1NSNH 1KB5A 1KENL 4PR5A 3T77A 4EDWH 1U8NA 2NZ9D 2FEDC 1CFBA 3K74B 1D3CA 1DN0B 1YYMH 5JORB 2XY1A 1FVDA 3ULUE 4CMHB 1T6VN 4LSSL 1ZVSB 3KNBB 5HGDB 4XXDB 4JFPA 3GMLB 2DQIH 3G5VA 5A16B 5IW1B 1T2QH 1QLFB 1LEIA 2WAHA 4ENEC 1I7ZA 2IQAA 3RA7H 3WFEL 4WWKB 1CTNA 1FYTD 3V6OA 3FRUA 4N9GB 1IM9B 3IB4A 5INDB 2AAVA 2BSTB 3W9DB 4GW4A 5ABDE 4JFFB 4PS4H 4GRLA 5CJQL 3TO4A 3JVGC 4LBEB 1G9ML 4MXWL 3GSQA 4NPYA 2R69H 3HNSL 1KPRA 12E8L 3MJ9A 3NZHL 3MRCB 4JFED 5FECB 3FQXB 5F9WB 5JQHC 1P7HL 3PL6B 4K7FA 1CXEA 3LZFH 4PJ8A 5T3ZH 1K2DA 3PWLB 2D7NA 3NAAH 2J3SA 3G6JF 3AMKA 3TFKC 3H9HA 4N0FA 4P48A 1CWVA 1LK2B 4LPUA 1JBJA 1KCKA 5E2JA 1WWBX 2UWEE 1RZKH 3PF2A 3FQNB 5M94B 2FH6A 1AXSA 4JPKH 1JYWA 2CKBH 2HWZL 4NO3A 4OJFH 2CDGA 4LPYA 4N8PA 1WUNT 2MQ3A 3KYKH 5J06A 3QFJB 3W11C 3IXTB 3X11B 1F2XK 5BXFB 1KXVC 2YUXA 1JWMA 1XGPA 2Y6SC 4GRLD 1U8OB 3TO4D 5B8CC 1DCLA 3TNMA 1EDQA 5DA4A 3S3PA 3MRLB 3RUGE 1HHJB 2ADJA 4YWGL 2BY1A 4K7PX 3QQNA 1I4FA 4PJXE 3SE4A 1OAUL 4PJ8D 1B4JL 1MRDH 2PTTB 5GS0D 4PJHA 5D2LE 3LQAH 1CFTB 1VFOA 5EUKB 1IQDB 1X5ZA 1LDPH 3VXSE 3BEWA 2MMXA 4JRXE 4PJDB 1I85C 3H6JA 3OAUL 1HOCA 4NN5C 3I50H 4M7ZC 3TNNB 4DKFH 4KK5C 3JTTA 4NP4L 4OGXL 1AIFB 3N06B 4KK8D 1A4KA 4UT9H 3L3IB 3PDGA 2FNBA 1D6VL 3KPSA 2XKSA 4HKJB 4S1DC 3SEPA 3QG6A 2APBA 2NY4C 5EB9A 4ELME 3BGFC 3AXLB 3MX0A 4YHNA 2PCPB 1YNTA 2NY7H 1Z0NA 3NFSH 3V79C 3WFCH 3SKNA 1N8ZB 3IDJB 1CU4H 4CVXA 3IFPB 1D9KA 4KTDL 1IGML 1YN7A 4OZIB 4HUVB 4WCYH 3ARVA 3CXDH 1SJHB 4WI9A 5H2BB 4BH7A 1IGJA 4AIZA 4WEBL 3SGEI 1QA9B 4OZGE 2B1HH 1FO0A 3S3JA 4PUBH 3LEVH 2W0FA 3L7FB 1Z3GL 3UJJH 3VFTB 5CBEB 1YN6A 2VAAA 3VXQA 4CUCA 3HE7B 1H9VA 1FRGH 5D1ZB 4N1EA 4PG2C 4KKNA 5EO1A 5TE4L 1T1WB 5GRUL 2LU3A 1JP5A 2PW2B 4FQLH 2RBLA 2Z0BA 3LDBB 2Q76B 1QRNE 1EAPA 3KPSD 2CO7B 4MGXA 5FFLA 3OKMA 4IJ3C 2EEAA 2CKNA 2ZG2A 4GFTB 1KEGL 3D0VB 4X7EC 4ZDHB 5AD0B 1H5BB 5D7IB 3OXSB 5LGKA 4FNLL 1TZGH 4HIXH 4OF3A 35C8H 1XIWB 2YS4A 5F8QC 1D9KD 3ILPA 3QI9B 5IK3A 4JPWH 1HYSD 3ROOA 1KFAL 1T1XB 3HZYB 5GHWH 3P2TA 1BAFL 1TJGL 5HPMB 3H42L 3CLEL 5IV2A 2JE8A 5D9SA 3UTQB 1YEEH 3BN3B 5DO2D 4LSQH 5IESL 1EMTL 4GKZA 4X6DB 3WMSA 5C0DA 5D96C 5L2JB 2YN3A 5DUMH 3TJHC 1UEMA 5JR1L 5KSBE 5IBLD 1JGUL 4D9LH 1NMAH 3K2UL 2HFGL 4GXUM 4K3EL 4XPTH 1MI5A 3FN0H 3MNVA 4KROC 1WCBA 1JYNA 3GMMB 3ES6A 5CSBA 2CLRB 5HTSA 5IIEA 2DL2A 5DD3H 2RJMA 5IHBA 5I1CL 1FL5A 1MHPH 4C56B 2I9LA 4L8BB 4RQQA 4KMQA 4NGHH 4NM8L 3S8WA 5CILH 5HYJA 3TV3L 3UCRA 4NUJB 2R0WH 1QLRA 3NMEA 4YHOL 4I18B 1Q0YL 3PWUA 1I1FB 1CL7L 3E0GA 5DSCA 1T0MB 3F7YB 5I30H 4RBPK 3BO8B 5FAAA 3IYLW 4QYOB 5E8OB 4KQ3L 4B41A 2OR9L 1MIEH 2DWEB 1QSFA 3BIKB 3A6CL 3RIFF 3KPMA 5I1EH 3IDNB 5FO8A 3T8XB 1DBMH 1X5LA 1Q9LB 1EHAA 5JLZB 4XPBH 4TVSa 1VKXA 1MI5D 5C0GB 3FOMA 4GQ9H 4NNYB 2DQUL 2XIDA 5CP3A 4Q58C 4L3AA 1JPFA 4PJIF 1J1XL 5JNYB 1OTUD 5D93C 3W9EB 1URLA 5F7YC 4Y5YA 4BZ1L 2QR0B 1J0IA 4ONFL 4YHYC 5IMMB 3RNKB 2DQTH 4LPWA 4AEHH 3T3PE 5HYJD 1RZKC 4HWNA 5CIPB 4R4BB 4JQXA 1FG2B 4AMKL 1BZQK 2HT3C 3G6JE 4PJ9B 5EULV 3F58L 4NRXB 1V8HA 5LVEA 4K2UH 3VJ6A 2IAMC 5H94B 5BRZE 1P84J 2PW1B 3OKYA 4F15B 2GTWB 3PV6B 1QSFD 2PYEA 1HZHL 1YEDA 4JG1L 5IGXL 2AV1A 5EU6B 4K3JL 3P4LA 2Q6WB 2O5XL 4X7FC 5EBWB 4ACPA 1CFNA 4POZD 1PAMA 3OG6B 4OLUL 5DGQA 1EVUA 4JFXA 1G1YA 1LEGB 4GUPA 4CW1A 3L3KA 4JY4B 4I3GA 1BREA 4XP4H 1CIUA 5A3ID 4PRBA 5DTFB 4TTDC 2CUIA 5DWUH 1KLGB 1XGQB 3BGMA 3SDDB 2DLGA 1KGCD 5T1MB 1C08A 4OD1H 2YBRA 1VB9A 2VDML 4O00A 4MVBC 2BVYA 4U1GB 4BKLB 4H1LH 5SX4I 3PP3H 1ZT1A 2C7UA 2F8OA 3LQMA 3ARFA 3ZKND 4CMMA 4WRLA 1ZHLB 1OP9A 3MYJA 1ZLUK 2PYED 3A0OA 2YK1L 4TSAL 2BC4B 5FGBC 2C4FU 2LTQB 3I3DA 3QUXA 4PJ5E 5E99H 1JGLH 3MLYH 3MLPA 4XPFH 4XAWL 4DN3L 4NO0B 3T4YA 3FB7B 1DUYB 1NC2A 2IH3B 4W4OA 5DVLA 1MAMH 1FNGA 2WP3T 3RBSA 2A9NH 3AB0B 1N3NB 1QR1B 3A6OA 5E8DH 5E70A 3UX9B 4TUOB 4NJ9H 4IDLA 4LVNC 4DGVH 4PJ7A 2NY2C 5D2NB 3DUHA 4FQXC 2HN7B 1MY5A 4R26H 3EYSL 2NY3D 4PP1C 2HYMA 3V4PH 2IANA 5DURD 2O93L 4FFVD 3X3GL 1MF2L 3ZYZA 2EC9U 4LCWE 4M9OA 2AJXL 4G6JH 4I9WE 3VMNA 4Y2DB 3ARFD 3U0PB 8FABA 2JIXA 1A0QL 4ZOCA 1IKNA 3HTLX 4DZBA 4HUXB 3HRPA 5T3XH 3BZEB 3EOBA 3RU8L 4RGND 2VMFA 1Q72L 4ZUSB 3QUXD 4ELKB 3DJ9A 4MCZA 1MFEL 1MCWM 2DQFB 5I8EA 4OGAC 2FYYA 4U1HA 2VDQL 5DQ9B 2IH1A 3GMOA 5D8JH 1MAJA 1MFCL 1NC2D 5I71B 1P6AB 3PQYB 2PYFB 2XICA 3DXAA 4KDWA 3ULVF 3IS1X 1ES0A 3O2VL 4J2XA 4XAKE 4PJEB 4UIKL 3BKML 3LOWA 2YA2A 4HWEL 1G6RL 4OCRL 3I2CL 1K6QL 3V5HA 2R0KL 3QUYA 1TZHA 3QFJE 2IAND 2FX8H 3U36A 1CBVL 4KK9C 1S5HA 3ZO0A 1AFVH 5DD1H 3WS3A 4P2CG 1HIMH 2JIXD 4KV5F 1DSFH 1T03L 3S37L 3BKCH 4WDIA 5DQJA 1ED3A 3U4EB 4RFEB 1HN1A 3L7EA 1T22B 4F57L 1A02N 4PJGF 1CFSA 1CD0A 3DX7A 3E6FA 5ICZA 1UQSB 1ZANH 4JDZA 3O8XC 2EDJA 3NH7H 2H26B 1OAKL 1WT5C 4P46C 2YKLH 4MJ4A 4LEXH 4CDGC 2XZZA 1A6WL 2D7TL 1DVFB 1ZHKB 4UILH 4WTZA 3MLVL 3I84A 1I7RA 3PIQB 3H9SE 4OCXH 4N90D 2Z91B 4PJDE 3DXAD 3VE0B 3EYOB 1X7QB 3FMGH 3VFWA 2X70B 4GMTL 4M62H 5DJ0B 1FORL 3ZE0F 4R4ND 2MCG1 4UNVA 1NUGA 2J5LC 1Q9OA 2VLJE 3DIFA 3QUYD 3UEZA 4XWOD 5IJKC 5E6YA 3REWA 3UTSB 4AEIH 3HUJB 1MQ8A 5SWQA 1ZHBB 1GOGA 4LHQB 1IAKB 5INCA 3RWIB 5LGHL 3WD5L 3KLDA 5TPWH 5JW5B 1RUPL 3AY4C 5DYOA 1NANH 1IZJA 3ARSA 3K8KA 1NCTA 4ZO6A 1U92B 4R2GB 2P44B 4DVRL 1R3LA 3U0TA 1OB1A 2E27H 5GQBA 1JPGB 2K7QA 4ZXBA 3V8OA 2OXHA 1H3UA 3B5HA 4N8CH 1N59B 4OZIE 1U2CA 1K5NA 3IFOA 4LVEA 4WUUB 2VDKL 3BZFA 5DJ6A 5FA4A 4FG6C 4BM7A 3T4AA 5IFHL 2DICA 1PG7X 4L4VB 4HK0A 1P84K 4P5MA 4HSQA 4F9LC 2VKXA 5L0QB 4NWTH 3SGJA 3LH2H 4N8VA 4CJ1A 4EIZC 4AENA 5B21A 4KVCH 4E0RB 4M1GL 1B0RA 1BVLB 1W0WB 1KN2H 3BPNC 3HI6L 3HMXL 5T33L 3TYFB 1FL6B 1Q0XH 2M26A 4CN1A 1B88A 3HCVA 3ARQA 2OTUB 3GSNL 2P5EB 2HKHH 1OP3H 1S7QA 3UJIL 4JB9H 1KXQE 3MZGB 3TBTB 2EE6A 1YQVH 2BVOB 1LO0H 3PNWB 1FQ9C 5GGQH 4U2ZA 3E3QC 4Q2ZB 4MWFB 4AT6A 1VHPA 4FQ2L 4Q9QL 1MFBH 4OF6A 5CJBA 3TEUA 2W9EL 3EFDH 1GZQB 4PJBA 3EJZC 2AJYH 1D5ZB 1EV2E 3QZWB 3LPWA 1CFVH 1NCDH 4XMLL 3BD3A 4UOW1 2XV6B 1E4XH 4ZXBD 1QZ1A 4XNXH 3S4SG 4I4WB 3MCLH 1FHGA 5MEOA 4GG8A 1U8LB 1FLRL 1OLZA 2G75B 1S9VA 3EYFB 3H2WA 2CLZA 2DDQH 4XPHL 3RWFB 4P4KB 4XTRD 1RAMA 4YXLL 4AYFA 4IMLB 4A2LA 3LKNA 4YHZL 5KG9A 2OS7A 3T0EC 5ICYB 3TC9A 4C54A 5D72L 3OL2A 2APXA 2ICEA 3GBNH 1FGVL 1FE8H 1LE9B 1NBZB 4UQ2B 1IEBA 4JPVH 4TNWF 3FN9A 1IFHH 4LCUA 2FSEA 4XNZB 5H35A 3C5ZA 3IFNL 4UT7H 4MX7A 2Z31C 1AE6H 4HIJA 4V1DA 1NDMB 3UTPE 3EFFA 1T20A 2VTFA 3CMOL 4ZUUA 1P2CB 3V7MA 3R06A 5CD3B 1JRHL 2I5YH 3QEHA 5MENA 1UENA 4JO4H 3P11H 1X5YA 3QQ4B 4TQEH 4IJ3B 4K94C 1DEDA 4HFWB 5EOCH 4EN3A 3PDOB 4XNQB 5BW7C 2O5ZL 2R8SH 3L3JA 2WSKA 1YYLH 3ZDYF 4EOWH 1CGSH 5EORH 5DHVH 4K3DL 2MQCA 1TNMA 1OOAA 1NGWB 4OGZA 3JUYA 2VDPH 1MLCA 1M6OB 3CPLA 3O4LB 3VWJC 2ARWA 1IC7H 3TZVC 5HHMD 3RWHA 1KTDA 5SWZB 3VI3E 3MRQA 4KKCC 3P4NB 3OZ9L 3ZTJH 3HZMB 4OTXL 2QADC 1QVOB 4LSRH 2J8HA 1ND0B 3NZ8B 2CLVA 1OPGH 2YOCA 5HYSB 4L8SC 4CAGA 4ZOAA 1F8TH 5IB4B 4M1DL 3C5ZD 1B2WH 3L9RB 4G80A 4QHNA 4V1DD 4HDIB 1HSAB 4RGMB 1IAIH 5ITFA 5E03A 5MEND 5DUPL 5FV2A 5I74C 4BSJA 3U4BL 4HWZA 3WUWB 1S7RB 4DK3A 2UZIH 4P5TC 4F2MB 1INDL 4EN3D 1R3HA 3RVXC 1BZ9B 2FHBA 4FMKA 4LGSB 5GRVK 2ZOLA 4ZUTA 1RZGA 3QO0B 2HT2D 5ETUB 3KLHC 1MJUH 4PRPE 3CDGA 1U91B 2P8PA 3GMRA 3S96B 4XWGH 3ESUF 1WBYB 4I3SH 2VISA 1P4LA 3ULUD 4GBXA 1ZAGA 1HHIA 4TNWK 5F97E 4HFUH 4DKDC 5DMKA 1YNKL 2VR5A 4C58B 4X5WA 4N0UA 4LSTH 2OL3H 4NRYB 2OSLB 4NZUL 5EU6E 5J1TC 3MV7B 4FTVE 1OAYL 3RX5A 3NGBC 4LDOB 1XCTB 2XFXB 5I8CB 3VFPA 2BNQB 1JZ2A 5B39G 1FCCA 5BO1L 1OP5H 3HI5H 5T1LB 2FHFA 1G0DA 3OAZH 2A83B 2F19H 2GJ6A 5DZNA 5EC2B 2W38A 2HTLC 3L1OH 1GGCL 3I9GH 1WITA 3B8YA 3FB8B 2E7LA 2LFGA 4HIEA 3E8UL 2DI8A 1UA6L 3QIBB 5KVDL 4XMKL 5BZWA 4YBLC 3VFUB 3VXSA 4KI5E 4FQQA 2CDEA 3CFDA 2AXGA 4M6OH 2I07A 3RIAK 4GBXD 5DJDA 3V0WL 3Q5TA 5ALCL 1CQKA 4NKIH 4KHTH 4J1UB 4X9HA 3D3VA 3QIUA 1G1CA 2FWOA 3PGFH 1JZ8A 1BLNA 1J86A 5TH2A 3I85A 2RCSH 1U8JA 3I6GB 5HHPA 3CFKA 1CLYH 3F5WA 1G6RA 1DBKH 1RZ7H 2VH5H 1NLDH 3OKKA 1N0XL 4O2CB 4ELMA 3IXAA 3OKOA 5IQ7L 3QXUA 2O61B 43CAB 1NCAL 3OAYH 3KPRA 5C7XL 2GJ6D 1UWGL 5IR1A 5HGGS 1I1AA 2VZOA 2W9DL 4LVHB 2YRLA 2E7MA 2GUOB 3JV6B 1TQBB 2CK0H 4CN6A 4E42B 3SBWC 4Z8FH 1HH6B 5D2NE 4JGUA 1U58B 4K8RL 4Y19B 2D0FA 2OYPA 4WV1B 5ID0A 2X4TA 2Z8SA 4OZGA 3BE1H 2CIIB 3VXSD 1JF1B 3BYTA 2VZ1A 5CP7A 5IHZB 1DFBH 3RVTC 2AJZA 1RJLB 3D3VD 3QNYB 3QIUD 4CN4A 2Y25A 3QXAA 2H1PL 4ONHB 3GI9L 2P24B 2VQ1B 3X14A 5K9OB 1NAKL 3QNXB 4OFIA 3LKSA 1FH5H 3CIQA 1KN4L 5AZEL 1NUDA 3KYAA 4R97C 2D7OA 2DI7A 3DX6A 4RAVB 2FJFA 1MCCA 1C5DA 3D6GA 3DOSA 3WUZA 4QO1A 2EH7H 1GJIA 4ODUB 1UM6H 4E9LA 2DLEA 2YPKA 3KPRD 3REVA 3PQYE 3LMJL 1HKLL 3U7WL 2ZUTA 4X98A 1I1AD 4PJEE 4JJ5B 4D9RE 2A6KA 2BMKB 3MOAL 1ACYL 1CD8A 4TUJB 3QFDB 4NN7C 1MOEA 4GSDL 3VGAC 5IM7B 5L8KB 4MB5A 4GG6F 4OLWL 1RD6A 3VFNA 3BP5A 3MA7B 3FRPG 3IS0X 5I75C 3RFZC 3BP6B 3HRZB 1NGPH 3MRRA 3CAFA 3RI5F 2J1KA 2V9QA 1CCZA 3AMLA 5E08H 5DUBB 1OW0A 1TVBA 1RUQH 4PP2A 4Y2OA 1NCCL 3U4AA 1UCBH 4BQCA 4XVJL 4PJCF 5K59F 3P4MA 4DGYH 2M2DA 5HDQL 1GGBL 5J0BA 2F15A 3GMQB 1R0AH 5I0ZA 3O3DA 4E5XA 4NQCB 3P73A 3HMXA 4TVPL 1G0YR 5JDJA 4N5ED 1JPTH 5CJ5A 5DD0H 2Z92A 2R2EA 3GSNA 2HG5B 5GGRB 1QQDA 2FLBT 4N0CD 1JNHA 2DLFL 3L3DA 4DTGL 5IJVB 1MPAH 3VXMB 3MLWL 4MHHI 1N0LA 5DJAB 4XCFH 5EU7C 4JKKA 3FO1A 4DW2H 5GJTH 1CDBA 5AYUL 3ZDYE 3TBSA 3T2NH 3DX9A 2GT9A 4X6CF 4ZTOL 4EDXB 1PZ5A 1J8HB 4RDQG 3UTSE 2A9ML 3HUJE 5TF1L 4H26B 5FHAL 3QIWB 1RVFL 1U8MA 4LP5A 1OL0A 4PD4J 5ESAA 4XP1H 4LSUL 1KG0A 5I8OH 5DK2B 1BBJB 5AG8A 3SOBH 4C83A 4AJ0A 1II4E 3AFLA 4NFBA 1P1ZB 4ZNCD 3CK0H 5HY9B 4KMTH 1T4KB 3WBDA 2R1XA 1L6ZA 5CINH 7CGTA 1I9JH 3KS0J 3MPCA 1D5MB 4HMEA 4YK4C 2V5SA 2F54B 5E6IA 1FZJB 3QCUH 1NFIA 4WUUE 2IPKB 2X9XA 3CSBA 3MGAA 1VEPA 4RMTA 5F7EL 4L4VE 1KC5H 4MNHB 4L3EB 4OZHF 3QUMH 1C8PA 2EH8L 3CUPA 5HHXL 1F4WL 1UFUA 1YQ2A 2C3HA 4HQQL 1AXIB 4O02H 4PLKD 4AL8H 3JWOL 5JW4N 4WU5B 5SV3A 5C8JB 2AVGA 1MCPL 3TF7C 1W0VA 4Z7OE 1TZIB 4KHXH 3R4DA 4H0HB 2CXGA 4LARH 5EFIB 4F37K 1CGYA 1JHLH 3P9MA 3BQUA 4OKVB 2APVA 5DD5L 5BRZA 4OCWH 1F4YH 3CLFL 2P8MA 1R3JA 4KKLD 4QY8B 2PR4L 4ISVA 1U8PB 2X9WA 4L4TA 4UAOC 4P3WA 1PYWB 2P45B 4OBSA 1VSCA 4K23L 4LDLB 4H8WH 3LRGA 5TJWK 3P9LB 3VFMA 1SEQH 5E6ID 4L9LB 2ED9A 5K9QG 1OWWA 1A6ZA 3G5XB 3NA9L 5E4EC 3O2WL 1FNEB 5FCUH 3MRFB 5CHNA 5KTEL 1NL0L 2HRLA 3F12B 3HPJA 5GRXG 4DUWA 3UAJC 2LAGB 2YSSA 1JTOA 3EO9H 4ZD3L 4Z95L 4TRPL 1LO2L 2Q7YA 2IALB 2AERT 1RIUL 5ESVB 1D5IL 1DBJL 2WMPA 3BQUD 5BRZD 1SVCP 4WTXA 3MNWB 3TA3C 4NC1C 1REIA 3PWNB 5F1KC 1MFDL 3MOQA 2GYSA 2ICCA 2DQJH 4L4TD 1KJMB 3VH8A 4MS8D 1HILB 2QL1A 4HZAA 4XNMB 1VESA 1J0ZA 3SE9L 4JAMA 2A6DB 5LXGH 1JPSL 3EO1A 1IL1B 5T1KA 3ULVL 2RFXA 1XMWA 1MUJA 1A6TB 1TENA 2K3TA 1UM5H 3O4LE 4RDQF 1M7DB 4JFYA 3ARYA 4MQXD 4RSVA 5ITBL 5SWZE 1DDHA 3QT2A 5GJSL 1L7TL 5CZXD 1EPFA 5FB8A 3U9UA 4WWKA 3T0EB 1CYGA 1E28A 1F3JB 3U48A 1ZHNB 3WSQL 2X10A 4LCWA 4MSWB 1LO4L 3KWWB 5FYKE 4AH2A 2F58H 2YPVH 3QXVA 5C0ND 1RV6X 2X1WL 1EIBA 4F7TB 1KJVB 1RJYB 1UACL 3O9WC 2W60B 1XEDA 5DJYA 3P30L 3O4OC 5CSZB 3Q0HA 4OGYL 1QBML 3PWJB 1PW3A 3V5KA 3V9FA 1IGYA 4EI5C 2AEWA 2AI0H 5KZCB 5T1KD 3DUUA 3TBVB 2X4OA 1EO8H 4KVNH 3D9AH 5CEZE 3IU3B 1CIDA 3W81A 1IGIL 2B1AL 4UV4L 1A2YB 5ILTL 2XN9A 3RQ3A 2AJVH 6FABH 2QSCH 3DURA 3BOVA 3PG2A 5TDPA 4OLVH 3L5IA 1IT9H 3GM0A 1UZ8B 5HGAB 1MHHA 4GS7C 4WWKD 1RFDH 2P43B 1YC7A 2DM3A 1KJ2B 3EYUL 4U4BA 1U3JA 1U8KA 3B9VA 2QADB 3VRLF 4LCWD 3MV7E 1OGTA 1KTLA 3IFLL 3O2DL 4QTIH 2GCYA 5EU3B 1CE1H 1MRCL 4G42B 4X0KB 1WZ1H 5I6XB 2FRGP 2YUVA 4P23A 1FNSH 2BNQE 3QUZC 3CCHA 1QD0A 4D9QD 1NCBH 3JTSB 2WBJC 1SY6H 1XGUB 1XGTB 1R5WA 1U3HC 4X9IA 1LVEA 3EOAA 4HCRL 1JIBA 2BOBB 4P5TB 2I60H 3WN5B 4M02A 3R8QA 4PD4K 4GH7B 3T65A 5ADPH 2FIRT 1YPZB 5JXEA 3H9SA 4ODTH 4WI5A 5FHBH 1QFUH 2A74B 4QRUA 1I9RL 3KPTA 2N7AA 2XN9D 5D7LB 5GZNC 4P4RB 3V0VA 3ESVF 1FBIL 2EKSA 2Z35B 3Q5YA 4PGCA 3C6LB 1JJUA 1FFQA 4QRQA 3PJSA 4WNQB 4LIQL 2VLJA 2OJEA 2OTWB 2AXFB 3TJEL 3LEYH 3QPQC 4Y89A 3QB7C 3VDBA 4P2OC 4Q6IB 5DJZB 3WL9B 4R4FH 3X12B 4K71B 4UT6L 4ZSOA 1BF8A 4WW2C 1NKRA 3O3EA 3CVIL 4P23D 2AW2A 1AR1C 3BW9A 1Z6JT 2XTJC 5K9QI 3FT2B 3HE6C 4JZOB 3BI9X 5CZVL 2E6PA 4QRSA 5F1IB 1Z9OA 3DI3B 5E1AA 5EH1A 3BWAA 1YY9D 2ZUQC 5AZ2L 5TQ0L 5H2BA 5GRVL 3FZUC 4CRPA 1VFBB 4Y19E 2R1WA 4XNUH 2ADIB 1DANU 5ENWA 2Q3ZA 3QHZL 3IDMB 3ARUA 1CDCA 5JXED 3TIDB 5F9DC 4S11A 1XFPA 3H9SD 4P9ML 4M43L 1J1PL 1A4JB 1U6AL 2GQHA 4YBLB 3ZL4H 5CD5D 2HH0L 4PJIA 1IC4L 4DAGH 4OZHE 3WKML 5J9PB 3GJEB 3RGVA 2D4DA 1RI8A 2YD8A 4KK6D 5TGBA 4OFPA 2Q8AL 1IEAB 2EDYA 2VLJD 3DI2B 3RPIB 4NM4L 1EHLL 3ARDB 5FDWA 2H2SC 3EDJA 1MLBB 5GRJL 4FQ1L 3QO1A 2R2HA 1TCRB 1J8KA 2VQTA 2OMBA 2Z4QB 4Z76A 3FOLB 2P46B 3RZCC 2YZ1A 5C3TA 1LP9B 4H8WC 3IGAA 3S35H 4XNYH 3RVVC 1E27B 3B9DA 4OIIH 4WJ5A 3O41B 5F1OB 1XF2A 3NFPA 1BQSA 3U7YH 2ICWI 4OV5B 4Q9RL 3V5DB 4ZTPL 5I1GL 2X9YA 5K9JH 3WFHA 5E8PB 2GFBB 2OI9C 3GB7A 1JWUA 4ZQKB 4IMKC 2VLLA 4I0KA 4G6ML 2FH8A 1QNZH 1NGXA 4ODWB 3FAXA 1ZLWH 3H3BC 4LAQL 2ZCKH 3BEVB 4IDJL 4FABH 4UNTA 3K1KC 3P0YL 3OQ3B 5JIKA 3DYMA 4DOHB 2DLTA 4KAQL 4OD3L 5F1NB 4YFLF 5E00B 3RGVD 2NTFB 1UWXH 3GHEH 4JFDB 3VFSA 1F2QA 3LSOA 2AXJA 3FFDA 3QEQA 4IOFC 5IROC 4NQCE 1MELA 5FKPA 3GNMH 1DLFL 2QSTA 4RIRA 1TJIL 4K9EH 4JKMA 1KIQA 2DQGH 1A9BB 3DSFH 1OY3B 2SEBB 3MJ7A 4YR6A 5FYLD 2W1NA 2EXWD 1A7QH 3VXME 1IC5L 3ZSSA 3GIZH 1FNAA 3K2MC 4EQ2A 2VXTH 4PTUA 5EZIH 5ISZA 5LQBH 2NY5L 5C0RH 1J8HE 1ZS8A 4LCCC 2AJUL 1T5WB 3BP7B 2WQ8A 4KKBD 4QHLB 1BBDL 2Y5EA 3EGSB 3PXJA 4X7SH 2IGFH 3UO1L 3WHE1 3IDIA 4D0DB 2ATKB 4P3CH 2DQHH 2V2WA 4N9OB 4NKMB 2BVUA 3SO5A 1CDIA 3KJ6L 5DFTA 4YFLI 2AJSH 4OLXL 2VIRB 3MLXH 4M48L 3QEQD 1FIGH 3LEXA 2C4XA 2XZCL 5HDBE 4Y4KB 1MCRA 4MJIB 4ZUVA 1H3VA 3X17A 2F54E 4HLZG 4GKSB 4NUGH 5EZOL 4HKBA 4M3KB 2FEEI 2QHRL 5EBMA 4PGDA 2MCPL 1DR9A 4UDUB 4WHTA 1C1EL 1LHZA 4L3EE 4NQXA 4X80H 1U93A 4CDHA 1ZT7A 4DZ8B 1B0GB 3DV4A 2NR6C 3HS0A 4LKXB 4PV8A 2VE6B 1AXTH 2NXYD 1XR9A 1CK0H 3K7UA 4PRPA 4Q7DA 5TDNB 5HBBA 1TTGA 4JN1L 2X4PB 1VGEH 3THML 2P4AB 1FG2A 3ZTJG 5D1XA 2XWTA 5ISZD 3K8LA 1FFOA 3V4UH 1OM3H 4HUKB 1O7SA 4W81A 4KC3B 1HXYA 3HZKA 2BRQA 4UOW0 3OX8B 4OQTL 5ALBL 4X5XB 4O2FB 1I3RB 2ZSWB 1T1YA 4HBCL 5EU6A 3BSZL 4FTVA 4GKNA 5SWSB 1RUKH 1JZ4A 1OCWL 1EZVX 1FVCB 5FF6B 4MAYB 1UM4L 4BFIA 3LS4H 3MSPA 5EU4A 1OSPH 4WHYG 5C09A 3IKCB 3D39A 3QRGH 3BAEL 4QLRA 3U2SA 3MRKB 4GRWB 2CQVA 5DVNA 1XF4B 1G9EA 4XMPH 4UU9A 1LO3H 3B2VH 5E8EA 4ZYKB 3T2OA 5DEGB 1HNFA 1HH9A 1MRFL 3RL1B 3T1FA 3DMMC 3HAEG 2D9QB 4JGJA 4PRPD 4PJGA 4M03A 2QQNH 4MNQE 1MQKL 1UXWB 5GGTH 3PABB 3HAEB 5D1XD 1KPUA 4U6VL 5F7DB 3VXRB 1NANI 1NSNL 1B0WA 3M1BA 3ULVD 4CVZA 2PO6C 2Z9TA 1BVKA 5BVPH 3E3QE 4KJQD 2NY1C 2HMID 1YYML 5AYQA 4ZO7A 5EU6D 2ATPA 4IRSB 2GAZB 3ULUH 4NN6C 4XCCH 4FTVD 4Z7WF 3QWRA 5MI0C 1XF5B 5CBAB 1TLKA 3UTTA 1T2QL 1U8IB 2BSSA 1ZKAA 3RA7L 5E9DB 1KYOJ 1DE4A 2I9TA 4MJ2A 5C09D 2YD3A 3D39D 3O2DA 2DQEH 3WIHL 4APQB 3O6KH 5EWIH 1RQ5A 4XI5C 5J12C 4LHJB 4PJAB 1NFDB 4Z0XB 4Z77B 1K8IA 2R69L 2FBOJ 4YDLB 1CE6B 5EOTB 3MXWH 1T21B 3K1DA 1L0QA 3EYVA 4O2EA 3T0EE 1JTTA 1XF1A 2UV3A 1IJ9A 3N0PB 4ZMAT 2H41A 1HK6A 3LZFL 4TPRH 3UPCA 2JJWA 5T3ZL 1QSEB 4P5KA 3EBAA 1BX2B 4J3SA 5DVOA 1PY9A 1Y6MR 1CDYA 4R0LB 1GC1H 5C0JB 3U0WH 1V5JA 2IMMA 1VACA 3QJHA 1VCAA 2WIIA 4DCQB 2AEIT 1RZKL 3QWRD 1F6FB 4FQHB 2R2BA 3WJJA 4ZO9A 4JPKL 3UTTD 3C60A 4H25A 1Z9MA 2CKBL 1MJ7H 4X9FA 1OP3K 5I1KH 1MCHA 3KYKL 4TSBH 5DGRA 5GGSA 3TBYB 3RAJH 3EHBC 4HAFA 5HHQB 4G6KH 4NNXB 4BFBD 1CS6A 5IT2L 5IVXB 2P8LA 2EIBA 3GSOA 5I76B 2K9UA 3VXNB 1HQRA 5EUOB 2VZVA 5MEPB 3L95A 2V2TA 4ODBD 3MJ8B 4IS6A 4I13B 3G6AB 3GSWB 4PY7A 4P0DA 5F3HB 3TN0C 1MRDL 4WFFD 3DRTA 1CVSC 4DVBB 5GRZA 4NQSB 1UADC 3QNZA 3LQAL 5EIQA 4PFEA 1KB9J 1JV5A 3JVGA 1LDPL 4YHMH 1TNNA 1PY4A 3PHSA 3V6FA 4K9EC 3CNKA 3VXPB 1G9NH 1HHKB 4JM4H 4KWUA 5C08B 4JVPA 4PREA 4HIHB 4I3RH 1CD1B 4I5BA 1EA9C 1A1MB 1A6PA 3QQ3A 3L5WA 3I50L 2BDNH 2V7HB 4DKFL 2FLRT 3QDGE 1S7VB 1P4BH 3O4OB 3C60D 3CZJA 5FKAB 3T3MF 4YDJB 1YPZE 5JPMB 5TE6H 4U0RC 3VFRA 4UT9L 2AJ3B 3NFNA 3OKLA 4W70A 3EYOA 2E7BA 3HHRB 5A2IH 2RB8A 1M05B 2FEDD 3MOBH 1DQQB 5BV7H 4PRHB 4HMDA 1I1CA 1GYAA 3ILQC 4QRTA