4HD9A

Crystal structure of native human madcam-1 d1d2 domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
203
structure length
198
Chain Sequence
VKPLQVEPPEPVVAVALGASRQLTCRLACADRGASVQWRGLDTSLGAVQSDTGRSVLTVRNASLSAAGTRVCVGSCGGRTFQHTVQLLVYAFPNQLTVSPAALVPGDPEVACTAHKVTPVDPNALSFSLLVGGQELEGAQALGPEVQEEEEEDVLFRVTERWRLPPLGTPVPPALYCQATMRLPGLELSHRQAIPVLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Mucosal addressin cell adhesion molecule 1
publication title A Different Fold with an Integrin-Binding Loop Specialized for Flexibility in Mucosal Addressin Cell Adhesion Molecule-1
rcsb
source organism Homo sapiens
total genus 30
structure length 198
sequence length 203
ec nomenclature
pdb deposition date 2012-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09085 Adhes-Ig_like Adhesion molecule, immunoglobulin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hd9A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hd9A01
3VXPB 1T5WA 2VAAA 3L5XH 4P2YA 3PL6B 2DRUA 4JJ5A 5SWQA 3VWKC 1JTOA 1RIHL 1CN4A 4ZDHB 1N7ML 4IRSB 1CL7L 1JGLL 1RZKC 2ZCLH 4XP4L 3KPSD 1NC4D 1ORQB 1XGTB 3HRZB 4HIHB 4PY7B 3DYOA 1CFTB 4Z7UE 3OKEA 1AXSB 3ARGB 4HUWB 4FXLA 3U83A 3QWQB 1S78D 4JM2A 1KBGH 5E2JA 5IT2L 1Y0LB 2XPGA 3B9AA 4XCEB 1XFPA 5T3ZL 4YE4L 4OCYH 4CMHC 2JJUA 2L0DA 4M1CC 3PQYA 1XGYL 4PJ5E 1P7KA 3G5VB 1FRGH 2WUBH 1IGTA 3HPLA 4JR9L 5JW5A 1OAUH 1S3KH 5ICXB 1NEZA 4P4KB 1ZT4A 2HVJB 4M62H 4MQTB 2AK4B 2GAZA 2Y6SC 4PGBB 4G8GA 4NZRL 4WUKL 3KHQA 1RJYB 4QXWA 3UTTE 3U7WH 1UVQA 4M03A 4JHBA 4AT6B 2DDQL 5CGYC 2XWBB 3NABH 1UGNA 2W9EH 1KIQA 5DHVA 3BEWA 4HIJA 1KSRA 4DGVH 3TBWB 4DW2H 4LVOB 2CD0A 4MNGE 3VH8B 3G6DL 4XNXH 4JQXC 1CXEA 4CJ1A 1KJMA 5LGJB 5ICZA 3X11B 4L8SC 3TO4B 3UTZB 1EAJA 3HFML 1S9WA 3SDDB 2B1HH 3H3PL 3S37X 1N5AB 3EYFB 5EZIL 4HH9A 3AMKA 5D2LB 1I8MA 4OJFL 4GKSA 1UXWB 4ONHA 1EERB 5A2LH 4DFIA 1XMWA 4FTVB 4X4ZA 4OLWH 2C3VB 3VGDA 1WC7B 3MPCA 4FHBD 3DVNB 5FXCH 4XI5C 3CPLA 1RJZB 1WT5A 1T3FB 4MA3A 3OKOA 4L9LB 5L2KB 4WW2B 2CDGB 2WBWB 1BGXH 35C8L 4XP6L 3ZE1E 2VERN 1N2RA 4YBLC 3PNWA 5K9OA 1MPAH 3CU1A 4WI3A 3O4OC 3PWUB 4C4KT 2ARJQ 3RU8H 5CMAA 4PJFB 4ELKA 4R0LC 1FCCA 3VFVB 1SYSA 1S5HA 4MXQC 4OV5B 2XA8H 3KXFD 2Q8BL 4OAWB 1A2YB 2H32A 3CMOH 2DQDL 5IJKC 1H5BB 2B8OT 4OZFA 5CJ8A 1Y6MR 5DFVD 4PJDE 1EHXA 3DGCR 2R39A 1MCLA 2BVOB 1QBML 2X10A 5KG9A 2HTLD 1YEHL 2EEBA 2J5LB 4EQ2A 1JHLL 2E7MA 1IMHC 4Y16D 3H42H 4XVJH 1RI8A 3FQTB 1UB5B 1IRAY 1EHAA 4OGYL 5I1GL 2Z92A 5E2TH 2NXZC 3HMXH 2NY0B 4NQDB 2J1KA 3A67L 1U8LB 2A2QT 5DJXA 4K23H 2QHRH 2H26A 4X83A 4XVTL 4GSDL 3C5ZD 8CGTA 1BD2A 3P2TA 1P4LB 1Q38A 4OLYL 2EXWD 4LQ1A 3EHBD 4WY7L 4C56A 2IMNA 4F9PC 4Z76A 1SJHB 4TVPD 1VA9A 1CK0H 4EI6A 5JQHC 1E27B 2AP2A 3FQXA 4H8WH 4Q9RL 1JMZA 1BECA 3HNTH 2GTZB 1KEGH 3UPRA 1FL6B 2EYRA 3QEQB 5DJ6B 5FCUL 1CICD 2VQ1B 5D7JB 1NFKA 3C2SA 3CFJB 2CMRH 3ES6A 3VRLF 1YEFH 4MNQD 1JYXA 4LLVA 4M6NH 4C83A 2J8HA 2AK4E 2PCPA 2VLKD 4XVSH 1NCCH 3QHFL 4MXWH 2DBJA 5I8EB 5E08L 4DZBA 4GAJH 3KLAB 1IAIL 3GMMA 4FNLH 4KROC 1DBMH 2GUOA 1HILA 1V3KA 5IB1A 5JDSA 5J11C 3C60D 1ZHNB 3DYPA 3OHXB 2VZSA 4QRRB 3HAEB 4NKIH 5EZLB 5EU6B 3BP4B 4UV7H 2ZKHL 2DJUA 5GS1C 5I1KL 5CZXC 3CLFL 3TO2B 4LRIA 2ZJSH 4JFHD 1HCFX 1NDGA 4WUUA 3OMZA 4HUXA 2ITDB 1YNKL 5FUZH 2IPUG 3D2UA 1BP3B 4U05A 2Z0BA 3LQMA 4KI5C 1Q0XH 1MJUL 1WTLA 5D2LE 4KY1L 3IDIB 5DRZB 4K94L 3T0ED 1QRKA 3CFIC 5IG7A 4FTVE 4NRXA 1UM5L 2FHFA 4TUOA 1LGVA 1EMTL 3CFEA 2QQLL 3OGOE 4MHHG 1BQLH 4KGLA 4U1IB 3IXAA 4QXTA 1MVUA 3D3VD 5A43C 3CVIL 4OZIA 3LAFA 1CFQB 2OI9C 3MLVH 3ZKND 1WBXB 1KEML 1R5VB 1YEIL 2F74A 1SMAA 5C0CA 1P1ZB 3TVMD 1JWMA 5GGRA 3RWHB 1U0QA 3VFPA 2CR3A 3WO4B 2WV3A 5TQ2L 1IGFL 3C5JB 4YGVA 4PJFE 3GIVA 4RFEB 3GK8H 3WSQH 4LOUC 2FO1A 3PWPA 3MUJA 3AGVA 3TT3L 3CZFA 4K9EC 4U2YA 4WV1A 4GKNB 5ESVB 3ZHKA 4Z6AT 1LO4L 3BH9A 2F53D 1D5MA 3C6LB 1QFWM 2ARJB 2WBJD 2Q8AL 4U6VH 1K85A 1GC1C 3PGFH 3ECBA 3OR7A 1G7MB 3L3IB 4P48A 1C16B 3A6OA 1HKLH 2CO6B 1ES0B 4IHOA 4ZTOL 5EZJA 4K8RH 3HC4L 5F9DC 3KPSB 1NC4B 1I1AA 1A3RL 4D8PA 4JG0L 3ZE2E 4NQDE 5IHZB 4KZEH 4UT9L 4O2EA 3KPMA 4HS8L 4LNRB 4NO5B 5IESL 2CXKA 5DC4B 3PGDB 2FGWH 5INDB 1H9VA 4BZ1L 3AM8A 4RGND 4YJZL 1WAAE 1OAQL 3P4MA 5DTFA 3NA9L 3HMWH 1KGCD 3GSOA 1AD9B 4C57C 2AI0H 4EI5A 4HX1B 3QEQE 2EDEA 3BUYB 2VDPH 2UY6A 2BVYA 1IL1B 1BHGA 1S8DA 2CUMA 4P2OA 5F7EL 1OAKH 1H3VA 1E4XI 4MA8H 4PRBB 1N0XH 5F7DA 1DBKH 1I9RL 3ZKQD 4APQA 3MV9A 1NGXA 5TF0A 3TCXA 5KS9A 2X4SB 4Z7WA 4QRRE 4KH2A 4J3UA 5J7CC 4NNPH 3LQAL 4UI2A 5EU6E 2X05A 5FF6A 4NGHH 4LLYB 3RA7L 5IMLA 4PJIB 1QTYT 1D9KA 1HSBA 2C1OB 3BKCL 4X80H 1SYVA 3T3ME 1ZXQA 4KMTL 4P5TC 4Z7VB 4TRPL 5F7HA 1LVEA 4I18A 3LKSA 1UM4L 3V4UH 4X4XB 1RIHH 3A6CL 1NAMB 1Q0YL 1N7MH 1RUKL 1CL7H 4HK3J 4IS6B 3RIFK 4XP4H 3ZYIA 5D2NA 1QP1A 5FV1L 1R3LA 1OHQA 3DXAA 2AXFB 3OGCB 3W2DL 4JFPB 5IT2H 2J8UA 4ZOAA 1UXSA 1P84K 5EC2A 4GXUN 1UADC 4HKXA 4YE4H 3MA9L 4PR5B 1R0AL 1XGYH 4YGAB 5FA4B 3FB8B 2AEQH 3K7UA 5TDNB 4KMLB 3WS3B 1CD1A 1OP3H 4FXKB 2CLRB 4M43H 1E28A 3KXFB 2R1YB 4MJ6A 5HGAA 1MCJA 1IQDA 4PLKC 4XNZB 4F57L 5J6HA 1AGBB 4EUPH 3WHXA 4OZGB 2DJSA 4NZRH 4WUKH 4RWYL 4WO4D 4X9GA 2DIAA 4CMMA 2H2PC 5E4EB 1WFOA 2O5YL 4KKCC 4UIKL 4F8TA 2HVKB 2Z93B 3H9HB 3VD4A 2C3GA 2DQFA 4YHNA 4YDKH 2W0FB 3ELAT 4X6EA 3O4LD 5HHQB 4IMKC 1WZMA 3CDFA 1C12A 3KPSE 2L7JA 3BN9D 2VNCA 4FFWC 5TE6H 2OTUA 3SJVD 1JFQL 1WIPA 3C5ZB 3HLAB 3PWVA 4QF1A 1OARL 3VXQB 4NJAL 4DFHA 4DZ8A 1FNAA 4YK4B 3H3PH 4X99B 3TA3C 4OSUH 2BVUA 4BFEA 3O41B 3ZHLA 5LWYL 2CIKA 4YZFE 3RL1B 1FNHA 3A0OA 4E42A 3L5WA 2FATH 2BC4A 5B22A 3QI9A 4J1UA 4PRIA 4XCFL 3HTLX 1CICB 4CVUA 2CIIA 4M7LH 1ND0B 1GPOL 1U3HC 5DQJA 5GGSB 1CS6A 4P2QE 2XT1B 2ZSWA 4MNQB 4MVBD 1DBJH 3MRRA 2V9TA 4G6ML 3MFGB 2VLKB 4QXUL 5DS8B 5EOQL 4XP6H 2VDKL 4M93B 2D4DA 2EDXA 5JA8B 2EDHA 3DV6B 1I85A 3FN3A 3G6JF 1J5OH 4M6MH 4QHNB 3C60B 5D6DA 1T6VN 3BZFA 4ZUWB 3ISWA 1AY1L 3V5HB 3KPQA 4QHLB 4PJIE 2A73A 4XPGH 3MBED 1VFUA 5C2BH 3B2UD 2Q76A 1QBMH 4MA7H 4J6RH 5DD0L 2VZTA 5D8JH 1WIOA 4Z7VE 4KUCF 1OSZA 2OP4L 4OGYH 4XPHL 3OZ9H 4KK6D 1KENL 2OTWB 1BJ1H 2IQAB 3T3PF 3T0EB 2DIJA 3C8KA 4OZFH 1QBBA 3VG9C 8FABA 4LLAA 4R7DA 1KT2B 3NFNA 2G5BA 1EZVX 1DQJA 2BSSA 2W59A 3U0WL 3MXWL 4GSDH 3D3VB 4OLYH 3QO1A 4U6YB 3PWLA 4IIQB 1F3DJ 3LRSA 1NPUA 4NKDB 4QWWC 5GZNC 3DUSA 4MCYA 3MOAH 5IEHB 3TVMB 5JUEL 1J0HA 1DLFH 2D0FA 5DHYB 3GBML 5HY9A 3BQUA 3TCLA 2AJSL 1F42A 1NAKL 3D25A 1U8PA 3KXFE 4BQBA 2E8ZA 1OWWA 1T83A 5DK2A 4I48A 3ALWA 4K55A 4NWTH 4CVXA 3BPLB 4JFDA 5IROA 4HKZA 3QHTC 4OZGE 4JB9L 2F53B 5E08H 1YMHB 3S36H 4HBCH 2V5RA 1NCWH 1AP2B 2WBJB 3DBXB 3LKQB 1OGTB 1JWSB 1QFHA 3HHRB 4NM8L 5F7KC 3ZT5A 2VXVL 4LMQE 5GRJL 3A6BL 4MDIB 5AEAA 4XPAL 2UWEA 3LKNA 2NLJA 2CRIA 2MMXA 4JZJC 4Y4FD 1U95B 3VWKA 1NCBL 5I6XB 5HYFA 4J3OC 2H9GB 4ZUVB 1MLBA 5EBMB 5JR1H 1VFBB 5I1KH 2A9NH 3OJVC 1NLDH 5C86A 4M5ZH 5HYQB 3OKNB 3CLFH 4PREA 1ED3A 5C0FA 1KTLB 1YNKH 1HYRC 3V79C 5ENWA 4NUGH 3VFUA 4ZOCA 2AJVL 3BEVB 4RGNB 4QTIL 4RZCA 2R4SH 3HAEG 4TVPE 1PG7X 5F21B 1HQ4A 1QBAA 1RZKL 5JW4Q 3TPUA 2Y7QA 3WNNA 1EMTH 2QQLH 1X5AA 1RZ8A 4HZLA 5EBWA 2VXTH 3D87B 6FABL 4KK8C 2FSEA 4MNQE 1K8IA 1Y18B 2A6DB 5FUCE 5DJDB 2VLKE 4LPYA 4ZFZB 1YEIH 2OS7A 4NQXA 4AG4L 4LCUB 4X9FA 2YSSB 4N8PA 1AGDA 2X5PA 5JNYA 1TZIB 1HZHH 3MR9A 3GGWA 1BBDL 1IGFH 5IK3B 3EOAA 3UYOD 3RPIB 4YFDB 3TT3H 4NO3B 3FO9A 3MGOB 1LO4H 4JQXA 4IEFB 5L0QB 3O2VH 1IEHA 1U92A 2J4WL 2DMBA 1N5YH 4JFHE 2E27H 2PTUA 4L8SA 3QULB 3ESVF 1HDMA 3QWOB 4BZ2L 2IH1B 1MHCB 3JWDC 1A3QA 2FX8L 3OXRA 4KC3B 5AAMA 5I1DA 2CO7B 4CVZA 2YD1A 2FR4A 1QFUH 3MNZB 4ZTOH 4JKKA 3T0EE 1JK8B 1A3RH 3V0AC 1U91A 1EGJL 5D7LA 4UT9H 2R1XA 3G5YA 4WRLA 3WFHA 4GLRI 5IESH 1MREL 3D3VE 1NC2A 2OYPA 2XWTB 4NHUA 1I1CA 1TVBB 4ONFL 5HYJA 3NA9H 3MFFB 5I1EL 2QKIB 1LD9B 4MLSA 1M7DB 3PE9A 2B4CH 4JDTL 4KWUA 5JXEC 4UQ3B 4N0FA 4BH8B 1DQLL 4YUEL 5DK0B 2VSCA 3GMQB 1U8JB 4JFFB 2ORBL 1B0RA 3O3DA 3CSBA 5B4MC 4R0LA 5JO5B 3JV0A 2R0LL 5ESQB 1QR4A 5HI5D 4ZO7A 5IJKA 2ZCKL 3VWJB 1XH3A 2H2SD 4L8BA 2F53E 4WO4B 3TFKC 5KSVA 2DQGL 2WINA 4Z7OE 2H45A 1EBAA 3SKNA 4PGDA 5IJVB 1CGUA 1T1YB 1A7PH 1HHHA 1U8IB 5BW7C 2Y72A 4HS3A 4GQ9L 1D6VL 1NDMA 1WVZA 2GCYA 5DFTA 2OL3B 3LQAH 4LSPL 3TH4T 3O4LB 2IG2H 4Q58C 4WU7B 5FOJA 4F7TB 4R4NC 1A6ZA 4ODSL 4PJGB 4XMPH 1RMFL 3SJVB 4GRLC 1QYGH 5DO2C 2HLAA 2XRAH 4LCYA 3O6KL 4KMTH 1NBYB 4TRPH 4LEXL 4RGNE 1BZ9B 3FO1B 3EYUL 4F9PA 5CD5D 2HWZL 1KGCE 3A6CH 1RUKH 6CGTA 4N68A 3HR5A 3TYFA 3TBSA 2C1PA 5HGDA 1HI6A 3T2NL 5ECJE 4Z7QE 3HUJF 4MD0B 4ZUSB 1N59B 5A2KH 3NCYP 4HUUA 3W2DH 2DLIA 5CEXA 3QDGB 5F6IB 2J12B 3QG7L 5KVGL 3SKJL 4DVBB 2DAVA 4OIBA 1S7UA 5D1QD 3U4EB 1KB5B 3CVHB 3MA9H 1LNUB 5K33A 3TIDB 43CAA 2XY1A 2I24N 4LHUD 1MJ7H 3AU1B 3KDMB 1LMKA 3U2SA 1ZGLA 2BOCA 1JZ6A 5EUKB 4G42B 3FRPA 3VFGL 3U36A 5IMMA 3EFFB 3WV0A 4M4RA 3M1BA 1R3JA 1VADB 2E5EA 3MJ7B 5GS1A 3OAUL 5KBNC 3S36X 4MAYC 1X4YA 2BCKB 4WWID 2CSPA 4UIKH 3LS5L 3LKRB 5EFIA 2ED8A 5HBBA 1P4IL 2ADGB 3IAQA 1PZUB 3OXSA 2OJZL 3TNMB 3CDCA 2X7LA 3I6LD 4JY6A 1HOCA 5LKNA 4WW1B 1F6FB 3ZKXB 1AGCA 4PS4H 2YD3A 2A6JA 5C0GB 5C0AE 4KKBD 4NJAH 3RRQA 2CH8A 3UAJD 2YMXH 4N0UA 5HJ3A 3S97C 2D9QB 2FH8A 3B4NA 4X9IA 3LQZA 5LWYH 4XMKL 4HWNA 4JY4A 1JJUA 2JJVA 4XCFH 3PHQA 4JFFE 4TUJA 3P0VL 2F19L 1GPOH 2C4FU 5HPOA 3LPWA 2QSCL 5IOPB 2YPLD 4G6MH 1EFXA 1LP9B 3GSNH 4QXUH 1PYWA 4L3EA 5EOQH 3D48R 4HEME 2IADA 2ICEA 2VDKH 4AIZA 4I3RL 5IBLD 1Q1JL 1S7QA 3ARFD 3UC0L 3F65A 3VXUD 1JGUH 1R6VA 3VD3A 1T5XA 3BPOC 2NZ9C 4Y0GA 1AY1H 3O4LE 5AUMB 5BVPL 5I8OL 3T65A 1D5ZB 1AIFB 4K9EL 4PJ8D 1BVLA 3QDJD 5CBAA 4PJGE 1RAMA 1W72B 1MCQA 1MRDL 3BH8A 4UB0L 5E2VL 5EO1B 4LSSH 3SJVE 1YC8A 1L0QA 4JFYA 1JYVA 3GSUA 4PP1D 1W0WB 5DD0H 1EO8L 3P40A 3ZDZE 4HUKB 2VKXA 2VISA 1MHHA 1B6UA 2CDEB 1GC1L 4ORGA 2HLFD 1F3JA 1T6WA 2WQ8A 3MV11 2QTEA 4FQIL 3QQ3B 2KUTA 1I9EA 4OCWL 4R2GC 4O51B 2AKRB 3ARBC 4HWEH 1NUNB 2P42B 3U0WH 3MXWH 2ATPA 3I50L 4F8QA 3THMH 3UTSA 5HHVL 3QDGE 1JZ3A 4OCXL 2CKBB 3E6HB 3LN5A 3TV3H 3QZWB 3KJ6L 4L8DA 3ARRA 3MV7D 4MHHI 5DQDL 4GOSA 3I02B 3MNVA 5FUOL 3CH1B 5JUEH 3MLRL 4PJXA 5DUPL 3EFDL 3VD9A 4PYHA 5GRWA 1L7TL 2XNAA 4DN4H 1TZHB 2IAMC 5IP4A 1TFHA 4KI1A 1NAKH 4CVWA 1VESA 4UTAH 43C9B 4PJCA 3ALPA 1CFVL 4OGZA 4K7PY 1I1YB 4OI9A 2EE6A 4LCWD 1CI5A 3AY4C 1FFPB 4PG9B 3KYAA 2CGRH 4PRDB 5D4QA 4JB9H 4POYA 4NM8H 2VXVH 5DD3L 3A6BH 1AD0B 3L3KA 4U0RB 4P5TA 5DEZA 3AMLA 4FQ1L 3P4LA 4LIQL 5F1NA 4WTWA 3MMEB 5C0IA 1NCBH 3TF7C 1A1NA 3KVQA 2XWJB 4NUJB 2WQRA 4FFVD 2R2BA 5F1IB 2D03L 4K8RD 3RY5A 2XN9A 4LBEA 2R2HA 4O2CA 3LZFL 3B3IB 5F97E 2ZPKL 3K4DA 4OTXL 2D7OA 5FM8A 2BFVH 3REWB 4M7ZC 2AJVH 1A7RL 4QTIH 4WU5A 4I0CC 5I1IH 3Q1SL 4RAUA 4JFED 1TENA 3BIKB 4L4VA 4PRNA 4LDOB 3L3JB 1G9NH 1RZKH 3AROA 2ZOLA 4U6XB 1FSKC 3OSKA 3D39D 3DNKA 6FABH 1DQML 5EDXA 2HJLA 2XTJB 3EJZD 4QGTA 1LP9E 2NY4D 4S1DD 4CW1A 4HQQL 4AG4H 3ZL4L 2DQUL 5FM5O 4WENB 5DYOB 3CFBB 4PRPD 1P2CA 3LHPL 3B9EA 4JRYB 4QO1A 3WS6C 4KJYB 3VXNA 3BKMH 3N9GH 4FQHB 4U49A 4IMKA 2X4NA 2WAHA 4MD4B 4JHZA 5DLML 4JFOB 1FNGB 4JKPL 3T0WA 2VDQH 2AAVA 4EEEA 5C7XL 2X09A 5GSRB 2VDOH 4HG4K 2FX8H 4JHWL 3RIAF 2HFFA 2NY2D 2VUOA 3TA3A 2MPAH 3MCLL 2XOTA 1IQWH 3QFJA 4R7NB 2DWDA 5E7BA 5IVZB 3S96A 3WKNA 4J8RB 1D3CA 1KJVA 5F3HB 1BIHA 1KXQE 1IM9A 1U3HA 1Q9OA 1MF2L 5T1MA 1NCUA 1MREH 1F6LL 3W11C 1MCPL 4ONFH 2BY1A 2N4IA 5D1QB 5HHPA 1A5FH 4HJGB 2X4OB 5I1EH 5I19L 1S7SB 4ZUUA 5CBEA 1GZPB 5IQ9A 3P0YH 1DZBA 2H3NA 4ZFFB 2ORBH 1BVKB 1YZZA 1KIUA 3RZWA 2X9YA 2CK0L 3S5LA 4KFZC 1AHWC 5BZDA 1WISA 1S7RA 5T1KD 3ULSB 4JANB 1KCUL 1YY9C 5ISZA 5IM7A 1A6WL 1GGYA 1C5DB 1D6EA 3Q6GL 2RFXB 2DQGH 5DEGA 5CLWA 3QPXL 3NTCH 4D0CB 3SQOL 3AC0A 2XKSA 3IKCB 2MCPL 1DR9A 3NPSC 4KJPD 3REVA 2JJTC 4GQ9H 1MAKA 1UCTA 4LSPH 4S1RH 4DUVA 1I7ZB 2IC2A 2VO5A 1XGPA 5AYUL 5SX5K 1JV5B 4MNHB 4ODSH 4NT6B 1RMFH 4L4TA 4TPRL 5JPMB 3F7VB 2YPVL 3MRDA 5D93B 3KYOA 5GS3A 1IBGH 3EUUA 3O6KH 3QHZL 2P8MA 3LV3A 3OKMB 1VFOA 5J1AB 3EYUH 2GSIA 1WF5A 3IDGA 1YN7B 4JPIB 2HWZH 4OB5H 3DX6A 5BQ7A 3OB0K 1U8QB 3IDNB 1IGJB 1QA9B 4U1GC 2AJ3B 3WMSA 4Y2OA 4QRUB 3IS1X 1UA6H 3LN9A 1NBQA 1EUUA 2HMIC 1RUML 3HC3L 3FT2A 1CFSB 2W60A 4EVNA 3GHEL 5JW4N 3QG7H 5KVGH 3PWNB 4HKBA 2XTJE 2YPLB 4OZ4A 2AEIT 4ZO9A 4XVUC 5E1AA 4GBXD 2HFTA 4JREC 1J88A 5CSGA 12E8H 2V2XB 1T0NB 5MEQA 3ARFB 5IIEB 3VXUB 2MHAA 4JRYE 1DE4A 4F3FA 3BKYL 3PABA 4K3JL 4U7SA 3VFGH 5DVKA 4AY0A 4JZJA 3ALXA 4KPHL 3BPNC 1X5YA 4PJ8B 3QDJB 4P4RA 3GMLB 3DUUA 4Z77B 1IGIL 5D7IB 3BIBX 4RAVB 4JFZH 1OLLA 4I3SL 1P4IH 1WTGT 4X98B 3GJEA 1EO7A 2F54D 3SGEI 3VXSA 3RP1A 3GMNA 1I8KA 2OJZH 1J0IA 4WI6A 3FFCA 2C3HA 3FB5A 4D9QE 5AWNL 4HC1A 3GSWA 1TXKA 3RTQC 4NPYB 3EJYD 3DSNA 3QQ9C 4NN6B 4NSKB 2IH3A 3V9FA 2DI7A 5TFSL 4ELMB 4QRSB 2Y06L 4D0BB 3OG6B 2DQHL 3MV7B 4X8JB 1FFRA 3TP4A 2QL1A 4OFIA 1CTOA 2YWZA 5BMFL 4XMKH 1CQKA 2I9TB 1NUDA 1FZOA 1UJ3B 4HC1L 4GG6F 4HW6A 1UJTA 2F19H 4ZNCD 5I9QC 4Z0XA 3VXMA 1IZKA 2QSQA 2QSCH 3GMRB 3RUGF 4MSWA 4F7MA 4PTTB 1A3LL 3Q5YA 4LCWB 1G7HB 1JYWA 2BMKB 1Q1JH 2CK2A 3VJ6B 3UC0H 2DTML 1DSFL 3QSKB 5CKGA 3SY0B 3N1FC 1M1SA 5TE4H 1ZLUH 5FOBB 5DJAA 4AM0B 1WBYB 2PYFB 4QRQB 4K2UH 4UDUA 3FT4B 4O9HH 3MRCB 4EXKA 5I8OH 3Q5TA 1ERNA 1U93B 4K9EH 3VXOA 2GK0B 4MDJB 3I6LE 2JB6B 2PW1B 1QLRB 3WDHA 4QY8A 1G7JA 1EO8H 1PG7W 4G8IA 2DLEA 4JO3H 3JWDL 4N8VB 4FQIH 4HIEB 4JFEB 4OCWH 3FB6A 1KELH 4KRMB 1NQBA 1OW0C 3UROR 1QOKA 4V2CB 5JXEA 2B5IC 4MS8D 4H5SB 1LE5A 3U0TB 2W65A 5IKCB 3EYSL 3D39B 3DHJA 3I50H 2FO4B 2VLRA 4ISVB 2HT4D 3ZDYF 4F7PA 4LSVL 4OCXH 2YPLE 3QXDB 3D2UD 3KJ6H 4X6BA 1BQHA 1JTPA 3QXUA 4MJ4A 3QR2A 3ZE2F 2Q20A 5TF1L 4HPOL 5FUOH 2YD4A 4RMUA 1UYWL 3MLRH 5JOEA 4F7EA 4PRPB 3EFDH 4Q2ZA 1UB6B 4X6CE 4L5FL 3VDCA 5BW7A 4JAMA 3E1F1 4QCIB 2QQKL 1YECH 3NMEA 3VI4E 4RX4D 3VW3L 5INCA 1CFVH 2F15A 5F71A 3HKFA 4Y4HC 3QZWG 3RL2A 1UWEL 3QDJE 5BZWB 4AIOA 5KVMC 5D7IE 4GRLA 4WNQA 2EDKA 3ZE0E 3BHBA 4WCYL 2WWMD 1J05A 3KPRA 1HINL 1MCBA 1FL3A 4FQ1H 4LIQH 5A16B 1MCSA 3F7RA 3LKOB 1ZS8A 2X4TA 4TSAL 3PWPD 3B8YA 2D03H 3EDJA 4LARL 1CDIA 5I18H 3LZFH 1IEBB 3RX5A 3KHOA 2A77H 1YEDB 2W9DL 2ZPKH 5DUML 5AD0B 1JWUA 2FHCA 1TITA 2FJFB 2J88L 4RMVA 1A7RH 3FRUA 3T8XB 5BJTB 1J8HA 4QNPF 2VAAB 3MV7E 1KJ3H 3RKDD 3EYQD 4YHIA 1FG9C 5K93A 4X7CC 3SCMC 1R24A 3VFRA 4I9WD 1QG3A 1OM3L 1TVHB 3E0GA 3T3MF 5DEFA 1I1AD 1ZV5A 3C08H 3JWOC 4QRPD 4OCMC 4Y8AA 3O2WL 3OKEB 1OAZH 5HVWA 4J4PC 3WKML 1AR1C 5T1KB 4RRPA 3ZSTA 4LCWE 1H3UA 2F8VA 1PD6A 4HQQH 4EUPB 4JVWA 5DT1L 3U46B 2DQUH 4B50A 4MAYA 3ARWA 1CYGA 5E8OB 2IPUK 3RZCC 5DMKA 4Y2DD 1WBZA 1BIIB 4IRJD 3K8MA 1FVDB 4P2OD 5TQ0L 3SDYL 3VFNB 4X5LA 5FO9B 3BDBA 2K3TA 4ZXBC 1FO0H 1G7PB 4RMSA 5C7XH 5FFLA 4HKJA 5LCVH 4KK5C 3DV4A 4APQD 1CGWA 4JHWH 2EE2A 4OD1L 4NCC2 3MCLH 3BEWB 5CP7A 1EHLL 4JFEE 5HPMB 4E0RA 1UQSA 4FZEH 1S7TA 2Y9RT 3WCYA 3HNVL 4RFNC 3SBWC 1U2HA 1HNFA 5KSAD 5ICZB 4M8QA 4NHCL 4PP2B 3BOVA 2EXYD 3RWDB 3U0PA 1MCPH 2X4QB 2NY1C 5DMJB 2JKXA 3OG4B 1JN6B 2P5WA 4GBXB 3I3BA 1ETZA 1I3UA 4GKSB 1HIML 4LHQB 3IU3A 5MEOA 3Q0HA 5MI0B 1Z2KA 3MV8D 5J1SC 1PQZB 2CK0H 1X7QA 3P9MB 2PYED 5A40E 3QAZC 1NGQL 3DXAD 3Q2CA 4JM2F 1KCUH 1ZHBA 4YZFF 5LBSL 5BRZE 3Q6GH 1VEMA 1T2XA 1XR8A 3E2HB 3DETD 3K2UL 1FV1A 2FEDD 1LO2H 1N2RB 3DX7B 1MRCH 1MWAA 4LHUG 3IGAB 3RI5F 4XNQA 4DQOL 2F54B 5E7FA 1S5HB 2VLJD 1JZ8A 5AYUH 2Y36L 5EPMB 2R0KL 2X89D 4UU9B 1DFBL 4R96A 2QADD 3ARBA 4M1GL 4OZFB 4TPRH 2UZIL 3U1SL 4LLWA 3WO3B 5L6YL 3QHZH 4Y5VB 5KG9B 1JE6A 2R9HD 4M9PA 1MWAL 3KPPA 1CFNB 3EOYG 1UWGL 3L7EA 2FJHA 3GBNL 1HH6A 1I7RB 5C70A 4RMWA 4DVRL 2FNBA 2LU7A 3OAZK 5I8CA 4KQ4H 2EE9A 4BQ9A 5D1XD 4FXGB 2IAMA 4O2FA 3MJ6A 1KIRA 3IJHA 2ADJB 3GHEH 2H26B 3HG1D 3VRJA 4XRCB 1ZA3A 1GL4B 4U33A 5E8EB 5HHME 3AY4A 2D7TL 2H8PB 3MUGA 2V7NB 4RDQG 4Z76B 5BS0E 4YHOL 4EI6B 5DA0B 3OKKB 3PV6A 2O61A 4RQQA 1JZ7A 2VZVA 3BKYH 4YO0A 3UPRB 3VI3F 1JBJA 1NFDA 4K3JH 2K7PA 3ES6B 3UBXA 2ADIB 1EUTA 2FIKA 3PGCB 1KN4H 32C2A 4LLVB 2H6PB 2Z91A 1BBJA 1IGIH 1HYSD 5GGUB 3QIWC 1FGVL 5CWSA 5FKPA 2WIIA 2WK2A 1Q9LB 1YQVH 3QNXB 3WFBL 1ZT1B 1YYLH 5ITFA 3HE7C 1HILB 5IB1B 3S88H 4DEPC 5JDSB 1F11A 4MWFA 4TTDD 5LXGL 3S4SA 4HXAL 3HNSL 3DVIA 4NC1C 1WWWX 4OZGF 3QH3B 1RUQL 1W0YT 4UBDD 1A47A 5DSCA 3QJHA 5AWNH 2G2RA 4YHPA 4U1KB 3BVNA 1HXYB 3H7LA 4BUHA 1AE6H 3C09C 4R8WL 1A1MB 5TFSH 5H2BA 1KTDA 4HUXB 2Z31C 2BXZA 3L95A 2AERT 3H9ZA 3MO1A 2DQHH 1BLNA 5CEZE 1IKFL 2KPNA 4OLXH 5BMFH 2XQYG 3EDFA 3DVGA 4Z8FH 3NGBB 3IAGC 1RIVL 1CFBA 5ALBH 4OUUA 5GSVA 1GGBL 2YOCA 4U1JA 4TUOB 3WS6A 1P6AB 1WFNA 2F5AL 1A3LH 5CJ5A 1MVUB 1N3NB 3TBVA 4ZPTA 3VA6A 5EORL 2BERA 3VA2C 3L5JA 4NQCA 4PJBB 4FQCL 3DO7B 3D0VA 2DTMH 2OX5A 1DEEA 4TUKH 1MI5A 1SY6A 3KR3H 4YGVB 1F02I 4LL9A 4N8CL 3UZVB 5I1AB 3BQUD 2PW2B 7FABL 2F54E 3U9PH 2PXYC 1MCKA 3PWPB 3UJIL 5EIIB 4F37K 4I5BA 1R5IA 2KZ1B 5I1CL 2E9JA 4JFDD 4XPBH 5IFAL 3MRFA 4P2CG 2PO6D 1U6AL 1SY6L 3JWDH 1ZE3C 2EE3A 4XCNA 3ECBB 3CFDA 3OR7B 3HN3A 3S7GA 1T2QL 1ZSDB 2GJZB 2MNUA 2GITA 3MREB 1T22A 3RWCA 1IGML 1I1AB 3EYSH 4LPUA 4D8PB 5I71C 2HFEA 4QRPB 2O5ZH 1CGSH 3IT8D 1BWWA 1AHWA 4O2EB 3KPMB 4GMTL 4F2MA 1I7TA 5L8JB 3BP7A 3M8OL 3O2DL 4N8VG 1KUMA 4XZUA 3GHBH 5TF1H 4HPOH 4JGUA 5KSBB 2Y07L 1PJ9A 4M1CD 5E99L 2JJTA 4Y2DB 1WWAX 3VE0B 1ROWA 4JO4H 4L29B 3TNNB 1EIBA 4IRJB 5FA3A 2CRMA 4MA1C 3ZKMC 5EC1B 4P3CL 1IAKA 1U2CA 3T4AA 1JGEB 1B6DA 3DMMC 5GZOC 3OX8A 4P2OB 1YEKL 5JHDE 1UWEH 4YXKH 4OZIF 3X12A 2BSRA 5KANG 2Y6SD 5I0DA 5F7DB 2BSTB 4JHAH 4A2MA 2L7UA 4APQB 1Z5LA 1QPPA 5HI3D 4YX2L 5KS9B 3RGVC 5KVDH 5FF6B 4Z7OF 4LSRL 4LARH 1INDH 3J7HA 3TT1L 3TC9A 2W9DH 4E41D 4GRWF 4LGPB 2IJ0C 5ERWB 5KSAB 1K2DA 1RV6X 4OKVA 4ZAKC 2J88H 1UC6A 3G6JA 3P73A 2IPKA 2N7AA 5BV7H 2Y5EA 5SX4I 1AFVL 1QLFA 1FDLH 5MEPB 4I18B 5ESAA 4NQTA 1LEIB 1CU4L 2EDQA 4W6XB 2XXCB 4ODUA 5C07D 1WQVT 1OM3H 1XF4B 1V8HA 4NRZB 1KC5L 5D2NB 1WK0A 1K8DB 3MV8B 4CNIB 1DBBH 5DRNA 4PB0L 3O9WC 2PYEB 3FONA 2RB8A 3DXAB 2ZNWA 4XI5D 3ESUF 4N0YL 1BM3H 1NUFA 5DT1H 1A7QH 5HYJD 5DJYA 1ACYH 4PJBE 4Z7QF 3CXDL 2BY0A 1TCMA 2GYSA 2HKHL 1L6XA 2DICA 4DOHB 1GGCL 3QG6A 4G6AD 5GS0C 3MRIA 5C0BD 3O3BB 1GZQA 3FO2A 4TQEL 1E28B 2VLJB 5TQ0H 4WHYH 2QADB 3ILPA 1T66C 4KDWA 4HV8B 1A6PA 4CRPA 1ZVSA 4EUPG 4OGAD 4YFEA 1F8TH 1T21B 5JORA 3N1MC 3RTQA 4ZUTB 4WEBL 2V5SA 3NH7L 4UMGA 3WJJC 4TNWF 4HWBA 4YBQC 3QA3B 2AJUL 3DARA 4JQIH 4HK0B 4ZS7L 2F58H 5D6CB 3N06B 1GCFA 1S7WB 3PL6C 2Z4QB 2P8LB 1NEZG 4Z7WF 1RU9L 3QWRA 3LSOA 4Y1AD 4IRSC 1UEMA 4O00A 3CDYA 2NXZD 4KUZL 2LU3A 5D1XB 2C9AA 4XP5H 3O8XD 3ARZA 4QRPE 3ROOB 2EDRA 3HG1B 2OTUB 4NHCH 1EFQA 4HWBL 5E00B 5I16B 1A6UL 1FP5A 4HS6A 3GSNB 4M5YL 4GW4B 5E4IA 3GIZL 1FZKB 1SM3H 1TQCC 2AXHA 2A1WH 5B38B 4GG8B 1FE8L 3EJJX 5KSBE 1FFOA 1S5IL 1HIMH 4K7PL 3BJLA 2YXFA 3NIFE 4E42B 3BW9B 3PDOA 1NBZA 3LRHA 4QYOA 4XX1G 4ALAH 2CIIB 2C5DC 3STLB 5FYLL 4NJ9H 5DQJB 2YD8A 1NGQH 5K9KB 4F58L 2R56L 4P4KC 3V0VB 1P5VA 4XBEH 1JPGB 4NQVA 5CS7A 3FHAA 3MRRB 5LBSH 2J8UF 3ARSA 2VDNL 2Q3AA 1MUJB 4EIGB 3VXRD 3K2UH 4DN3L 5GJSL 5D5MB 3M45A 1A9EA 1S9YA 3WE6B 2ITCA 1BMGA 2E9WA 4KROD 1KCSL 4DQOH 5KS9E 4BA8A 4W4NA 5EO9A 3PIQB 2AABL 1ZA6A 3KPQB 4LVOC 3V6OE 1OW0A 5FGRA 5AZEH 1HH9B 4M1GH 5JIPA 1G9EA 4LF3A 2UZIH 3U1SH 4J3WA 1ZOXA 5L6YH 4G9FA 5SWSD 3H0TA 1T7WA 5CILL 4L3AA 2C26A 3I2CL 1V5JA 1G7IB 1UWGH 2IF7A 3SDDC 1AR2A 4BSWB 4W68A 4IOSD 2IFFH 4DVRH 3U48A 2X1QA 1MCEA 3AXLA 3C8KB 4OZFG 4MYWB 4ZOBA 3MV8E 4OFKA 1A14L 2Q7NA 3EGSA 4RGOL 2BSSB 4X5XA 2PYEE 3LPGA 3DXAE 1BJ1J 3PWLB 3FOLB 2XFXB 3LRSB 4LCIL 2EDNA 4Y4HA 3OQ3B 5EBLA 5I30L 1AJ7L 2HJFB 3QO0A 3B5TA 5B21A 3X3FL 5D7SH 2EKSA 3JV4B 5FO8B 4DOHE 4UNTA 4IMLB 4WEUD 2XIDA 3BQUB 4TOYH 3TCLB 3C9NA 3PP4L 4EOWH 5KJRH 2VLJE 5DK2B 2GY7B 3I6GA 3KLDA 3BP5A 3MRGA 5CZVL 1H5BC 1EFXD 4XPTH 3FT3B 4JFDB 3W9EA 3VFTA 4LVNB 2FX9H 4Q0XL 3FFDA 5SWZD 1G7LB 5JIHA 4NZUH 1YC7A 4LLMA 5LJYH 2PO6B 1QKZL 5BVJA 5D70H 4KHTL 4KAQH 5TGBB 2J5LC 2HYMA 4B7IA 5DRXA 2JIXA 4HXAH 3HNSH 3LKNB 3CSPA 3TIEB 4HDIA 4Z95L 5BO1L 3SCMA 4ZYKA 5ILTL 1TQBC 4NKOA 4LLQB 2MQCA 4GW5A 2NY0C 3QEGL 4PREB 2F8OA 4NZJA 4R8WH 4BYHA 3HG1E 4XB8A 4PGZA 5DMYA 4KJQC 1U36A 2I5YL 4J4PA 3T2QA 2M8XA 4YH6A 1RQ5A 3GSQA 1MFCL 5KOVC 5K9QG 4J12A 2P8PA 3HC0A 1HQ4B 4PBVC 4QHUA 3DWTA 4CMHB 4LPVA 3GJFB 2KKQA 3BPCA 1GGBH 4PJHB 4OCSL 3RZCA 2YPKA 5EO0B 1TCRA 5D7JC 1RZ8B 1UEYA 2P5ED 3JWOL 1V7NL 5FECB 2XZCL 4ZODA 4ODVL 4JG1L 3I3EA 3UTSD 5C09A 1K8IB 3T4YA 3QCUH 5DR5L 5IF0B 1TNNA 1FFNA 2HRLA 1UZ6E 4ZS6C 2IANE 1HEZA 2BRQA 4FQCH 1TJGH 1IT9L 4G6FD 4ZXBA 5D5ME 1CIUA 1I9IL 2ZOKA 3MR9B 3R1GL 2IEPA 5C0DA 3S35H 3TPKA 3IVKA 3MRHA 3G04B 7FABH 1A9BA 1RZJC 4ERSL 2DQTL 3LEVL 4MGXA 1BQSA 1JGVL 3ZHDA 5I1CH 5SV4A 1C5CL 5KVEL 5AZ2L 5D96B 5DMGC 3UMTA 3C5SA 1YNTA 2DOCA 3DHMA 2BHZA 1NMAL 5HDLA 4CJ0A 4LCCB 3SBWA 4E41B 2GW5A 2DD8H 2GQHA 2FWOA 1FNSH 1U6AH 1XGRA 5FYJL 5CSBA 2BNRD 4P5TD 3MLYH 3MLXL 4CVZB 4XH2A 4Y8DC 3MYZA 5C07B 1BFTA 3MRQA 1XR9B 4WFHE 1CIDA 1LK2B 3V52L 1U8MA 2XN9D 4AENA 4N1HB 1EEYA 3P30L 3G5YB 2AEPL 2QJDA 4GMTH 3FAWA 2XYCA 1F4AA 1GGIL 1W2KT 5F88B 5HYJB 4FQLL 1EXUA 2HT2D 3RX8A 4ACPA 4I4WA 1OTTC 3MZGB 2Y07H 4L4VD 3TYGH 1VGEL 2WM0A 3TESA 2BRRL 1HWHB 3WO4C 1S9XB 4N0FB 2X4PB 1LE9B 1Y6KR 5C0BB 2YEZA 1EJOH 1NJ9A 5IW6B 3QUYC 4KK9C 5FYKH 4P3CH 3UPAA 1NMCB 1QHPA 3MCG1 5JQ6L 1BOYA 1YEKH 4V1DD 1RK0A 4ZNEE 2Y5TA 1Z0MA 4U1NA 2R0WL 4JFDE 3U7AA 4N9GA 3C6LC 4DKDC 3LDBB 1IC5L 4LVHC 5E5MB 2JCCA 2ICES 1GGTA 4KKCD 3WLBA 4HS3B 3BN3B 5ALCL 1H3WM 3D69A 1D5IL 2ED7A 4Y1AB 4LSRH 1H8SA 4L8CB 1A6ZB 3TT1H 2NXZB 4UILL 4P2RD 3O8XB 2ICCA 3ARTA 2VDML 1X5IA 1ZT7A 1YPZA 1S78C 3CUPB 3GI9L 4LCYB 3IDJA 4HWUA 1X3DA 1ZLVK 3FL7A 3TA3D 5KSUB 2F5BL 3AFLA 2R29H 2ICWA 3G5ZB 2C1PB 4PJHE 4QLRA 5HGDB 5ID0A 3QDAA 5T5NG 4OD3H 4YQXH 1YA5A 2C7UB 2YZ8A 3QPQD 4HUUB 4LVEA 4WIQA 1U3HD 1WJ3A 2P7TA 3FQNB 4D3CH 1RUAL 4X4YA 5CEXB 1QSFA 1XF2B 4N0YH 2ZUUA 2ZZUT 4B0MM 3PHSA 1S7UB 1PLGL 3QIWA 3CXDH 3VXRB 3L6FA 4KHXL 4LQFL 1E4WH 2YZ1A 5FGBC 1OVZA 1DUZB 4FG6D 4GXUM 4MQXD 1YYML 3GO1L 4KROB 2D9CA 3HE7A 3U2SB 1ZGLB 1GXEA 5MEND 2DBLH 5J11B 4TQEH 4JPWL 5KTEH 3U36B 4L4JA 2NY3D 4U3XA 1KJ2A 5EULV 1F6AA 1OT1A 5ISZD 4XP1L 4E41E 4NWUL 2VC2L 5SWSB 1I3VA 2FEEI 3FCTA 1EAPB 2EIBA 1MCHA 2M26A 4HZAA 4WGVB 3ILQC 2AJUH 3RWIB 2DQJH 2Z31A 2A83A 5EFIB 1AKJD 3BE1L 4MMXC 1HNGA 3ZT6A 3QEHB 5ID1A 1T0MA 1QSVA 4M6OL 1OL0A 3M17B 2O5XL 3LPFA 5C07E 1T7XA 2APWA 1FYTA 1KJ2L 2Q6WA 4DAGH 2XZAL 1BAFL 3UTQA 3G08B 3T77A 1HOCB 4P3DA 5H94A 3I9GH 1GOFA 4NKMB 4P5KA 1FIGH 3L3GA 5E8DL 3VU2A 5C0EB 3TH3T 3OKYA 4P5MA 2VIRB 1A6UH 3WIHA 4HMEA 4M5YH 5C0ND 4DKEH 5HYJE 3OR6A 5DD6B 3RWJB 5GZND 3VFMA 1JI1A 1MFDH 3FN9A 4K7PH 1HHKA 5HHOB 5I75C 3D85A 1VFAB 3G6AA 4JY4B 5DGQA 4F33B 3SHSA 2HFGH 5C0BE 2JB5H 4KKLD 4QOKE 1FVCB 3GDBA 4F58H 2PXYA 2R56H 4TNWK 1MH5A 3MROA 2G60L 4PRHA 3WIHL 3LRGA 1EFXB 4XNZC 3F62A 3GNML 3W39A 2E7LC 1CWVA 5SWZB 5DFVC 5B38G 2FD6H 3PF2A 3VFWB 1CZ8L 1HHGA 5GJSH 5TH2A 1FHGA 5HGHA 4AIZB 5E4EC 3AB0B 2D3VA 2IALB 3S35X 4IDJL 2UZXB 2Z35B 4Q6IB 3BWUC 3X3GH 4ODBD 1JNLH 3RNKA 1QZ1A 4WFGD 2LV4A 5B3JF 4Y1AE 5C0RL 5FDWA 4XCCH 1ODAA 2EDBA 3O0RL 1PZ5A 4OCNC 1BVLB 2WANA 5CBAB 3OKDA 4Z7UA 1HHJB 2QR0B 2APFA 2VN7A 2NZIA 3C5ZC 4P23C 3JUYA 2EXWC 3MRKA 1KLUA 5I66B 1MHHB 1PVHA 3HI6L 3HI1B 3F12B 1BOGA 5FO7B 4JDVA 3BZDA 4J2XA 1CG9A 2Q7YA 4PJ5A 5KZCD 4YC2B 3FFCD 2VUYA 1DQDL 1CICC 2V9RA 1MCIA 3FJTA 4G8FB 2P5EB 1IAMA 2ATPB 5GIRB 2V17L 3UTSB 3QUXB 4IRZL 3I75A 3O11B 3DMMA 3BD4A 4JZOB 2WUCL 4KK8D 1MIEH 3V5KB 1JNNL 3MYJB 1PY9A 1CXHA 3SO3C 5FUCC 1FFQA 5TDPA 3LN5B 3PP3K 5I30H 1AJ7H 1DVFC 5LGHL 2UVEA 4G6FB 3VXRE 3CX5J 3QUKA 3UTTA 3X3FH 4M93C 1A1OB 4XC1H 1R3KA 3U6RB 2EYSB 3BZEA 3C60C 3P4NB 5LQBL 2ZWLT 1OF2A 3ARUA 1JNHB 1FL5B 5D1ZD 2VITA 1C7TA 3RGVA 1SEBA 3QQ4A 4PJCB 4MNGA 3MRJA 2OK0L 4GXVL 1F13A 4Q0XH 3BI9X 4X6CF 5SWSE 3SDXB 1A0QH 1ZTXL 2N1KA 4XWGH 3VI4F 4ZAKA 1QKZH 1KF9B 2RGSA 4KHTH 2BNRB 2NW2A 5GJTL 5CGTA 4P5TB 1H8OA 1TJHH 4LEOB 3IDYC 1DN2A 2VR9A 3S34H 3OPZL 5I1JH 4OM0H 5C0IB 4Z95H 3O6ML 3S8WA 3MLTA 4HT1L 1G6RA 1JPSL 3V0WL 5IB2A 1F00I 5JMOC 2R2BB 3HE6C 3T0EC 3WL9A 1Z9MA 4AIXA 5IVXE 1CLYL 3NPZB 2Z9TA 3WIFA 3X14B 4Y5YB 4IIQC 3DX9A 3WFDL 3ZKNC 1FVEB 4WU5B 2XKNA 2JK5A 4RAUB 1VKXA 4Q9QH 1XIWD 2CRZA 4L4VB 3OAYK 1G6RL 3EBAA 5DRWA 5HHOE 2EIDA 4YDLC 4PGJA 1J1OL 3STBA 5L8LB 1U3ZA 1V7NH 1TIUA 4WFFD 2VLRD 5B4MD 5DR5H 1QO3B 2HJLB 4V1DB 1QBLL 5CINH 5ANMB 5E8NB 3BPLC 2SEBA 2NX5E 1M7IA 5SWZE 3V6ZB 4PJDA 3TFKD 5DQ9A 1FO0B 1I9IH 2WBJC 3WJJA 1GOGA 3R1GH 3RDTC 3WEXA 3D1MC 5KANI 5GS0L 1G0YR 2PTTB 3LEVH 2DQTH 2W0LA 1JPTH 3PL6A 1JGVH 5I6XC 1A8JH 5E9DD 5KVEH 1C5CH 4ZDHA 4G80A 5AZ2H 4IRSA 3HS0B 5C6WH 1NMAH 4P2RB 3HRZA 4X5WA 4PY7A 3UTOA 1J1XH 5CEYB 4GS7B 4MAUL 4S1QH 3KYMB 1E0OB 2P48B 4XHQA 1AXSA 4HUWA 4V2BA 3KLSA 1ZVHA 5FYJH 3KPRD 2XV6B 4AK1A 1Y0LA 4M02A 25C8H 3TA3B 3MLXH 2VWEE 3PG2A 2CJUH 1WGOA 3V2AR 4HBQA 3IU4H 1G7QA 1T89C 3P11L 2P5EE 4KTDL 1T0PB 1U3HB 1Q9OB 3UTSE 5CCKL 3RWEB 1CL7I 5ICXA 4P4KA 3GB7A 2NY7L 2AQ3A 1H3TA 1J8HD 2AK4A 4PGBA 3PDDA 5HHPB 5F96H 2YD2A 4ZUUB 5CBEB 2EDDA 5IQ9B 1VGEH 3MZTA 2K1MA 2E7BA 3KLHC 3HI5L 1CDYA 4AT6A 4RBPH 3VMPA 1CDGA 4JGMA 5LAXB 5MENB 3FTGB 1P7QD 5BZDB 1JL8A 4F15C 5JQ6H 4RWHA 2NY3B 5EUOB 4PJCE 3TBWA 2GT9B 4LU5H 2NY5H 3VH8A 2R0WH 4LSUH 3GUTB 3Q5OA 4GAGL 2Z8SA 2FYYB 3MRMA 5DJCB 4E9LA 5L0QC 5LGJA 1FH5L 3SDXE 2BNQA 3X11A 1IC5H 4FQ2H 1BZ7B 3HZKB 4GG6A 1AKJB 2BNRE 3SDDA 3N1QC 3BUTA 5ALCH 3WIIL 1AI1H 2VRAA 1X44A 3SE8L 3EYFA 3TEUA 2PKDA 5D2LA 3RWFA 3QNZA 2DLFL 1UXWA 5HHNB 3VG9B 4FTVA 2IBZY 2VDMH 2C3VA 3MRDB 2XZQH 3I6KA 1BJMA 3DVNA 3GI9H 3KYOB 4AL8H 1YNLL 2ZG1A 1RJZA 4NFDA 1T3FA 3BJ91 3U7YH 1KPUB 3VG0H 4LPCA 4WEMB 3ZYZA 1S7VB 2F5BH 2ILLA 2CDGA 3DX6B 3IXTA 4XAWL 4PUBH 2W1NA 4W70A 2OM5A 2UUDH 3MV01 4L4VE 3V7AE 5J56B 5T5FH 3S3JA 2YUXA 3DURA 3QIUC 1M71B 4YAQB 1LK3L 4PJFA 2GKIA 4EVNB 3VFVA 2NTFA 1P5UA 4OV5A 4O58L 1XCTB 2A0LD 3P0GB 2AGJH 4V1DE 1A4KA 4OAWA 1A2YA 4OZ4B 5ANME 3BD3A 5I2IB 4QGYA 5CZKA 3W0WB 1H5BA 3KYKH 5E1AB 4ZG1A 1A7BA 3VWJC 1TPXB 1ZANL 3LVEA 4LQFH 4WO4C 4FFYL 5MEQB 2BVOA 4NNXB 1YYMH 1B0GB 2MHAB 3GO1H 2J7LA 2V7HB 1DE4B 4F3FB 4JN2A 2ATKB 4JPWH 5AG8A 3FQTA 5E5UB 2NZ9D 1UB5A 3BT2L 5IW1A 3JV6A 1I9JL 2EDYA 4P9ML 4XP1H 4P4RB 3STZB 3BN9C 4P2RE 2VC2H 1VACB 2MKWA 4NQDA 1U8LA 1KACB 4X7SL 2VKWA 4PTUA 3BMWA 3QCTH 3G5XB 5IHUL 5TJWK 3ZTNL 3BE1H 3SKMA 1WAAA 1W8OA 3GJEB 2O5XH 4OM1H 1RZGB 5HDOA 4RMRA 5D72L 5I8KH 1Z3GH 1E27A 1KJ2H 1QVOB 3DECA 3OJMB 2NXYC 2XZAH 4R2GD 3FFCB 5I1HL 3ARBD 2GTZA 1FL6A 3QEQA 2CXGA 2VQ1A 5D7JA 2GIYA 4M7JL 4P9HC 3U4BL 4MVBC 4H88L 4HG4J 1I1RA 1MFAH 5ETUB 3RAJH 4Z7NF 3SOBH 1CD9B 4L1HA 4LSTL 1NCTA 1MY7A 5I8EA 1F4XH 4ODHL 1FZOB 3KLAA 4OLZL 1ITCA 2HRPL 1GAFL 2VQTA 5MENE 1I7UA 3OHXA 2IAMD 1MEXL 4EXPX 4URTB 3QXAB 3HAEA 4JRXA 5D1ZB 2G60H 1FG2B 4WHDA 3RX7A 3WNLA 3BP4A 5EUOE 3WIHH 5IBTL 4G8EB 1NCDL 4CU8A 3GNMH 2EC9T 4NOFA 2P24B 5CAYB 2FECI 3B2UC 2EDTA 1QRNA 2ITDA 1JPFB 3MRPB 1RURH 4DKFH 1MHEA 1ZLSL 1RZJL 5C0RH 2B0SH 3GEWB 1MCOL 4X0KB 3IDIA 3VXOB 5DRZA 4OCLC 1J12A 4RIRB 3HZVB 2X4UB 3ZKXC 5C3LD 2OXGA 4TYUA 1KCLA 4PJ7E 4G8IB 1B2WL 1I4FB 1NGWA 4BH7B 1WBXA 4Y89A 3HZYB 4HJJL 1XIWB 4JPKH 3FB6B 5DMIH 1P1ZA 2VQUA 1J8KA 3SGJC 4N0CD 3CK0L 4C4KO 3RIFF 3RVVD 2DL2A 5K9QI 2V17H 2VLRB 3QUYA 4IRZH 1X4ZA 4UOW0 1XZ0A 5LGHH 3W0WE 3B9KC 5HDBE 3O3EB 1CBVL 3NCJL 4PJAF 3C6LA 2ARJA 2WP3T 3BP6A 2OMBA 4Q2ZB 3GI8H 1RHHB 4LSQH 4JKLA 1AQDB 5EOCH 5IFJB 5LQBH 2R23B 4UDTB 4MJID 1G7MA 3L3IA 3MUY1 3P9LB 3R0NA 1C16A 4WFGE 1CLZH 3F8UB 5E9DB 1ES0A 3KPSA 1NC4A 3SDAC 4NQCD 3TZVB 1ZTXH 1C8PA 3WDJA 1DANT 1KLGB 3F58H 5IGXL 3FN0L 3V95A 5IHZA 3BHBB 5JHLL 5HVFB 5GJTH 5T1LA 4NO5A 1F97A 1J05B 4ODWA 1MI5D 3PGDA 3DIFB 4XMLL 5BV7B 3DRQA 3OPZH 1T4KB 1F4YL 4HT1H 1JPSH 3V0WH 2VLLB 4UAOC 1OP5H 2OQJA 3WLWC 5EU4B 5H35B 1NLBL 3CX2A 4MB4A 2L4OA 3VGEA 4HX1A 5E6ID 2ENSA 3BUYA 3BGMB 1OB1A 4P2QA 5HDQL 3W11D 3LB6D 2G9HB 2JTDA 1J8HB 2D0HA 1QR1B 4PRBA 4LKCA 1BWMA 2LAGB 1MFBH 5KAQF 1ONQB 4YHIB 5FGBA 3CFCL 1KB9J 3UPCA 1J1OH 1EVUA 2X9XA 2D7QA 1MQ8A 1P7QB 2FX7L 2X4SA 3FMGH 5FYKD 5FAAA 2VZOA 1QBLH 1PKQA 4H20H 4MQ7B 5E2WL 4PJIA 1J0JA 3NIGF 2AXJA 2XG5A 4FFZH 3QEUA 3V7AG 4U0RC 4HFUL 4Z7VA 4NQED 1WBZB 3B9VA 3CSYB 4OLEA 1MAJA 1T1ZA 2YUZA 5MHSD 1OY3B 4OIIL 1NAMA 2XQYK 3MGTA 5B39B 4UT6L 3DX8B 5FK9B 4XBGB 3SGDH 1BEYL 1FAIL 1PDKA 1J18A 1F5WA 1OLZA 1F90L 4ONGH 4GRMA 1ZKAA 3OGCA 1OWRM 2VXUL 4JFPA 2VE6B 2W92A 2D31A 1V7ML 5EOTB 5GRUH 5FHAL 3ZLQC 5I0ZA 1DN0B 2OR9L 4M7LT 5JOPD 4I77L 5CP7B 2X40A 1EZVY 4PR5A 2APVA 1NAML 4FP8L 4Q74A 3TJHD 3FB8A 1MFEL 3VFOA 3BDYH 3O45B 3P11H 1QQDB 2E6PA 5C0JA 1E6OH 2HMID 3WS3A 4KTDH 4FOMA 5CCKH 4FXKA 2CLRA 3KXFA 2NY7H 3U0PB 3JWNC 2AV7B 4NC2B 5JW3L 2XTJC 5F7MC 1CGVA 4BKLA 1AGBA 1C7SA 2E7LA 3HB3D 1DDHB 4OZGA 1FLTX 3C2AL 4LAQH 3EYVB 2VB5A 3NZHH 3HI5H 1CDJA 4KTEL 3SE9L 2HVKA 2V2TB 3K8KA 4LASH 4OCRL 5E9DE 3V8CA 3IJYB 5KSBF 4JZNB 1BFVL 4GAGH 4KUCD 1A7OL 1FH5H 5IFHL 1XR8B 2B7DT 1SBSL 4H26B 4I0PD 3C5ZA 4M7KL 3HLAA 4P23A 4WI5A 3JBG7 1DUYB 5CD5C 4WFEE 2FRGP 4X99A 1L7IH 3O41A 4FQXD 1KCVH 2BNUB 2DS4A 1RUPL 4R2GB 4P59H 4RISH 3ARBB 1INQA 3RL1A 4AMKL 2LAAA 4S11A 1CICA 3L9RB 4KVNL 1I3RB 3MLWL 3UJTH 1YNLH 1GOHA 1EA9C 4MNQA 1CR9L 1IEAB 3KPPB 1CT8B 3L7EB 1DVFA 2VLKA 4XAWH 5D1QC 5DS8A 5GQBA 4TVPL 3UYRL 4M9OA 1OP9A 3QWRD 2DKMA 3DV6A 5I8CB 3GMPB 3CNKA 1IM3A 3OWEA 2EICA 4ODTH 2GFBA 1LK3H 3C60A 2AXGB 2IAMB 3U9UB 5DVLA 1KIRB 4HPYL 5CJXC 4ZUWA 3M07A 2R4RL 3V5HA 4QKXB 1WLHA 1TDQA 3QB7C 4PD4J 2CUIA 4ZSOB 5JW4M 3MUGB 4PGCB 4U31A 5H37H 5J6GB 4FFYH 3CC5B 4J7RA 2AJZB 3QQNA 4KRPD 3IFOB 5CHNB 5DD5L 1NFIA 4NZDA 3IFNL 1AO7D 2JELL 5L7XL 3BT2H 1DL7H 1FBIH 3NAAL 2OTWA 4HIIB 4UT7L 2IQAA 32C2B 1I9JH 1CXKA 3HE6A 4X9HA 1F3DH 4YDVB 3T0EA 1TZGL 2YA1A 1BBJB 1N4XL 2FL5B 4DWHA 3VDAA 5CWSB 5K59F 5FKPB 5IHUH 2CLZA 3ULVD 3ZTNH 3D3VA 3UAJC 1QUNA 4U6YA 4M7ZB 4IIQA 3D18B 5CJQH 5JXAH 4NKDA 1XGUB 1EBPA 3S4SB 1G0DA 3VRLE 1FNFA 3INUL 5IEHA 3AVEA 3KJ4B 5IHBA 4J23A 4H8WC 5C6TL 1R5WB 5DHYA 3BVNB 5L2KE 4GUPB 3LEYL 4G43B 4E5XB 5GPRA 4M7JH 5DJ0B 1OP3K 3U4BH 4ZFGH 5H2BB 3V5DB 3MO1B 3TN0D 1TLKA 3TJEL 1BLNB 2PR4L 4X6FB 1G9MC 4K07A 1BFSA 1ZGLP 2F53A 5EN2B 3QUZD 5IBLC 3DVGB 2WBJA 3LKQA 1FZMA 3DBXA 1OGTA 1JWSA 3ARFC 3JTTB 5L9DH 5E2UL 1DQQB 3RDTA 4BK5A 4MDIA 1GAFH 4AQ1B 4XGZA 4MJIB 4PJ9D 1VPOL 4O4YL 1ZEAH 1GGUA 4U7KA 1U95A 5IBTH 1NCDH 2H9GA 4ZUVA 1P4BH 4PLJD 4UNVA 1G1YA 4ZPVB 5EBMA 1VFBA 4Y4HD 2IGFL 4PJ8C 5HYQA 3OKNA 2EH7L 4NQCB 4QHMA 4A6YB 5J8OA 5JZ7D 1KTLA 3CZJA 2NTSP 4YXLH 1MI5B 1N64H 3D9AH 3BEVA 2HJKA 4YFLI 1J86A 5LG1A 3LCYA 2EDWA 4EBQH 1RZJH 1NFDF 5JPNB 5FM5M 4KQ3L 3KYNA 1V05A 1RULH 4UINH 3BKJL 4JY5L 4U3CA 1UACL 4YXHL 1T89A 1G6VK 5E6IB 4WHTB 3HPJB 4HF5L 4ZFOA 3GMOB 4NN6C 1RFDL 2HKFH 3DRTB 1U58B 1RZFL 1Y18A 4KVCH 2A6DA 5DJDA 1IZJA 1O5DT 4ZFZA 2D7PA 1MCDA 4HJJH 4HMCA 1KCRL 1U8HA 3MUZ1 4XBPB 4EN3D 4TN9A 5D71H 4LCUA 1T22B 2YSSA 3RWCB 4NZTH 2H41A 5IK3A 3JZ7A 1ZHKA 4KKAD 1NGPL 5F1OB 3RPIA 4AH2A 1MJJA 4ZFOL 1WIUA 1VCAA 4GO6B 4NO3A 1AR1D 2AQ2A 3BP7B 3V6BR 4U2ZA 5JIIA 4ZSOE 4XZUB 1MHPL 1T7YA 1UM6L 2ZUSA 2G5RA 1OTSD 3QULA 2YKLL 3QWOA 1OTUC 2IH1A 1NCAH 4OLVL 1MHCA 4NQEB 3H9SA 3RZCD 1EVTC 3MRLA 3MSPA 1X5LA 4JN1H 1ZHLB 3T4AB 3UJJL 4OFVA 5C09D 4FFVC 4PLNC 3OX8B 3MNZA 4K8RC 4LGSB 4YIQA 1C08B 1WV7T 3QDMA 1YEGL 1UT9A 3FN0H 5F9AC 5C0AA 4Z5RB 3N0PB 1JGLH 4HH8A 1S9VA 5FYJD 1J1PL 4KK5D 2LU4A 1TVBA 3FO0L 4XMLH 3LOWA 4DKAA 5ACLA 5KOMC 3CFKB 4MJ5B 2QKIA 1LD9A 4OT1L 4UQ3A 1NLBH 4BH8A 5DK0A 5T3ZH 2DI9A 1U8JA 3QIUA 4JFFA 3LKPA 1UH4A 3TWCL 4OKVB 5TPWL 1T20A 5ESQA 5A1AA 2IPKB 4M3JA 3EJZC 3VWJA 1M6OB 2NYYC 4JR9H 5ESAB 4JREB 4WO4A 5GRYA 3G9AB 4PV8B 5K9JL 5IJVA 2R2CA 1T1YA 1KXVC 4JGJA 1U8IA 2ESVD 5CSZB 2FX7H 4MJIE 5DRNB 5FGSA 5ADPL 2OL3A 3O4LA 5E2WH 1UG9A 2DDQH 1AQKL 3E3QE 1NKRA 4P46D 3QIBC 4Y16B 4PJHF 4PJGA 2LE9A 3WNOA 1XF3B 5FB8B 1KULA 3SJVA 1LO3L 4I0PB 5CJOL 5L88L 3G6DH 3QNYB 1B4JL 1MI5E 1NBYA 3CMGA 3L3DB 3QG6B 5JLZB 1PEWA 1BZ9A 3FO1A 4NO0D 3FO2B 2G75A 3F7PC 4FQXB 3EDEA 2OL3L 5TDOB 4UT6H 3HFMH 2CLVB 4WHYG 5BXFA 2FLRT 3UZQA 4AYFA 2AK1L 2KBGA 2VXSL 4Y19A 5E8PB 1FAIH 5DHVH 4MD0A 5EZIH 3GSXB 4HIXL 4OJFH 1A7NL 4HCRA 3QDGA 3NACL 1X5FA 1V7MH 3KPOB 5FHAH 1KPRB 3CU7A 4I77H 3U4EA 1LNUA 4WDIB 1VEOA 5B39G 5GS2H 2D4FA 3TIDA 1VHPA 1NEUA 1YEJL 2BOBA 4LLDA 5EH1A 4HUVB 5I9QB 5EUKA 2BJML 35C8H 4G42A 5FYKE 3EFFA 4P9HL 1T1WA 4HCRL 1B4RA 1BX2A 5E56A 3WNMA 5DJ2A 1VADA 3MJ7A 1RVFL 4M1DL 3QUMB 4QRTB 4YR6A 2Q8BH 3EO0A 3T0VA 2BCKA 4KRPB 1M05B 2DQDH 2JE8A 4KJPC 3L3OB 1AO7B 1NBZB 4NQEE 3O3UN 3MJ8A 2XXMB 5MHSE 1SMOA 4N9OB 2WSKA 1QSFD 4NQVB 1YEHH 1BFVH 1HHIA 3IYLW 5DI8A 3TNMA 1JHLH 4U1HA 4ZD3L 1SBSH 3QIWD 5I1GH 2ERJB 5C0GA 1MFNA 2H32H 2ITCB 1WFTA 1FC2D 3A67H 1NSNL 2HTKD 5JOPE 4XC3L 4XVTH 3S37L 4AJ0A 3KPNB 5EO9B 1W8NA 1LEKA 2LABA 3DGGB 1YN6B 3SGJA 4WY7H 4AMKH 4JKMA 3SO5A 3Q48A 3WHE1 2YR3A 1TETL 1T1XB 1CR9H 5IOPA 4Q9RH 4LLUB 4OFDA 3OB8A 3TN0B 5EU3B 4GBXC 2OR7A 1JF1A 3B9KA 5FCUH 1C5BL 2GJ6A 1K4CB 3RVXC 3QUZB 1NGZB 4P3WA 4GKOA 4OF8A 1FYTD 1H8NA 2ZNXA 4HXBL 4C54A 5HSFA 5ICYA 3IKKA 1JUFA 3QHFH 4PJ9B 3RHWF 4HPYH 4XCYA 1JZ4A 1A22B 3BO8B 5C9JB 1FN4B 3F7YB 4POUB 2KQNA 5GGVL 1IAIH 1IGYB 3I84A 5AUMA 1QFWL 1D5ZA 2VL5A 4Y4HB 1CQYA 3SDAA 4G5ZL 4HLZG 1W72A 3WD5L 5EO1A 3E2HC 1E4KC 5FKAB 1L9NA 3QO0B 5DD5H 2ZKHH 1W0WA 2V5TA 3D85D 3IFNH 2JELH 5L7XH 5C08D 3O6FD 1QSED 4WWKD 2B2XL 5IVOA 1SJEB 3QQ3A 3WFEL 3I6GB 2UYLB 4O51A 4PRHD 2AKRA 3VFTB 3FB7B 1W72L 3WUWA 5DUBB 1MJUH 4B7LA 4KY1H 4Y5VC 2MQ3A 5BVJB 4K94H 5LGKA 3E6HA 1UM5H 2A6IB 3INUH 4EN3B 3I02A 3CVIH 5C6TH 3CH1A 1DJSA 3G9VA 4NKOB 2WLYA 5J89A 1JVKA 1KEMH 2VOTA 2VABB 1TZHA 1FAKT 2GTWB 3VD5A 5IMKA 1F2QA 4HFWB 4HEPG 1OQOA 2YBRA 43C9A 5TQ2H 3GSQB 1I1YA 3ORJA 4OLUL 5J9PA 1P69B 1FFPA 4PG9A 4PRDA 4X9BA 4UZGA 2BVQA 3S4SG 5IVXF 2WWKT 4LAJH 4IJ3B 1AD0A 1AO7E 1EHNA 1EGJA 2NQCA 3PXJA 4O4YH 4ZQKA 3EDKA 3ZKMD 3MMEA 3NN8B 5DXWA 5C09B 2XWJA 3WFCL 2Q8AH 3T4YB 3CCHA 5F1IA 1KG0B 4W6WB 1HEZB 1MQKL 3B3IA 4YWGL 5BOPA 1FQ9C 1WWCA 3ULVE 3UTTD 5F9OL 2ZOKB 3HC4H 3REWA 4PRAB 3OV6A 1IC1A 4GRWH 4JG0H 5ACZB 3IVKB 1UENA 3HUJB 3MRHB 5A2JH 3L5XL 4OKDA 4KQ3H 2VZ1A 4HS8H 3BKJH 3C6SA 3CDGA 3L3JA 2EDOA 4MS8C 4BZ1H 4CADB 3MJGX 3C5SB 1YNTB 1OAQH 2ZCLL 4R4FL 4U6XA 1RFDH 1LO5B 4ZAKD 2FWOB 5CD3B 5A3IC 5HI4C 1HK6A 4PV9A 3H8NA 4ETQB 1KCRH 1MCWM 3NBNA 3NFPA 5DYOA 3MRQB 3NGBC 4OCYL 3CFBA 5F7EH 4K3GA 3MQIA 1CDCA 4JRYA 1NGPH 1FRGL 2ESVB 2P44B 4AENB 2VLMD 2WUBL 3QFDB 4KJYA 1EEYB 3ARDC 3O9WD 1I9RH 3QAZB 1OAUL 1S3KL 4P46B 3FZUD 4FMFA 4M62L 1MHPH 4NN5B 3K8LA 4JFOA 3F6IA 1FZJB 2YKLH 3H3KA 3SDCD 3RA7H 4OLVH 1X5JA 5GSRA 2YEZB 3BKCH 4NO0B 1IAOB 3NABL 4Z9KB 1V3MA 5IVZA 2Y5TB 1T66D 4QTHA 4J8RA 5JDJA 4YPGA 1UM4H 3BGAA 1Q0YH 3O6LL 3CX5K 5FM4A 3UYPA 3FO0H 1YUHB 5IUSA 2E3VA 2B1HL 5D1QA 3RKDC 3EYQC 1JMXA 3H7BB 3MCKB 4HJGA 2X4OA 5FHBL 1S7SA 1GZPA 2EZ0C 3SDXF 2B4CC 1RJLB 4ZFFA 1BVKA 3U30C 4AEFA 1JRHL 4OLWL 5TPWH 1ZT7B 5CJXA 1R0AH 1Z6JT 4S1SL 3OTTA 4GH7B 1T03L 4JFXB 4KJWC 3IDJB 3ULSA 2V5MA 1EEZB 4JANA 1UWXH 4OV6F 4I13B 5CKAA 2X41A 1WCBA 2RFXA 3TBTB 5K9JH 3IKCA 4FS0A 1RPQA 2ICWB 4F57H 1MPAL 2DB8A 3ULUF 3EOTL 2Z8RA 4Y2DC 4RWYH 1SBBA 4PJEB 3MBEB 4IRJC 5ADPH 15C8L 4UOJA 2FEEL 4MCZA 4X4YB 5C09E 4N5ED 1QSFB 1AQKH 1B0WA 1I7ZA 2O5YH 4EIZC 1BF8A 1K3IA 1JV5A 3CMOL 4MNHA 5IB3A 4NT6A 4FQPA 3QIWB 3F7VA 3L6FB 5CJOH 5L88H 1IFHL 1B4JH 5FYJE 1K4DB 2XZZA 3OKMA 1UKTA 2BVEA 4YDJA 3HUJE 1YN7A 4JPIA 3H42L 5HXMA 4KDTC 1JFQH 2OL3H 1ITBB 1U8QA 3IDNA 1IGJA 1QA9A 1OARH 3DROB 2YC1B 3V6OC 3GM8A 2F9BT 4WVRA 1CE6A 1FPTL 5E2TL 5IB5B 1CFSA 5GXBB 3DTXB 4RA0C 5KSAC 3C09B 2BNQD 1A7NH 4K23L 2EXYC 2QHRL 3NACH 3WHE0 3PWNA 2A83B 2YPLA 1QNZL 3KG5A 2VDRL 2JCCF 5DJZB 4QT5A 3JTSB 3RPKA 1A6TA 1T0MB 2OSLB 2A6KB 1CK0L 2V2XA 2HN7B 4JVPA 1OOAA 1FYTB 3ARFA 3GJFK 2Q6WB 4H8WL 4X6CA 1YEJH 3QJFB 2ESVE 2BY3A 4P3DB 5H94B 3L3GB 5F7YC 3LEXA 4HCRH 1YPZF 1YEFL 4WI2A 3RVWD 4M1DH 1RVFH 4PJ8A 3QDJA 1J10A 2GSGB 3GMLA 1YMMD 4Z77A 5D7IA 4RAVA 1G9ML 3B43A 3DETC 4MXWL 4Y4FB 4R3SB 3T2OA 2FEDC 4I1NB 1ZWIA 5ADOL 3NCYS 4I0KA 3D85B 4GAJL 3BWAA 3ZZ1A 2IBBA 1DBML 5C08B 3VGAC 3O6FB 1NGYA 1QSEB 4WWKB 1A6VL 4MMZC 3MROB 4NKIL 2FDBP 4UIMB 1KPVA 3TBYB 4PRHB 1YDPB 2QADC 2E6JA 3VGFA 2OP4H 4XPHH 3BGFB 4NPYA 2MJWA 1KENH 2FZ3B 5HGHB 5EU7E 3V4VL 2R9HC 2ZJSL 4NSKA 4NOBA 4K71C 4IOIB 4QRSA 3GSRA 2W07A 4OD2B 1NSNH 4NFCA 3IJSA 3PUCA 3MV7A 4X8JA 1ADQA 3S37H 2A74B 3UXFA 1Q0XL 3BISA 3ARED 5IVNA 2X70A 5ITBL 2EYTB 5D1XC 1TETH 4Z78A 4I3GA 2LVCA 5HGGS 4JFQB 3GMRA 2YWYA 4PTTA 4QEGA 4LCWA 1FNEA 3GBMH 4PLOB 1C5BH 4WI4A 3FQWB 3MLVL 3X13A 5KN5B 1ADQL 1BOGB 2AJSH 4JDVB 2BMKA 2DQCL 4U1SB 1CG9B 3VJ6A 3MNWA 2FCBA 4RNRB 4HXBH 4PJ7F 4TNVF 3SY0A 5FOBA 1Q72L 3RVTD 3QEQD 4AM0A 4PJEE 2PYFA 4QRQA 4MA1B 4MB3A 1UH3A 3RWGB 3GK8L 3FT4A 3I75B 2FJGB 3FQRB 1QFWH 5GRJH 1U93A 5J06A 4XPAH 5TDPB 3TM6A 4AEHL 4G5ZH 4ZS6D 3EYOB 4MDJA 1HYSC 2FGZA 2JB6A 3WD5H 5MP6L 4HHAB 5F9WB 4D2NA 5J3HC 1YJDC 3EOBB 1CVSC 1QSZA 4U6VL 4TTDC 2B2XH 4N8VA 3L5HA 1Q9WB 4HIEA 5HDBF 4JRXD 1SEBB 3WFEH 5HD8D 1JTTA 3FQUA 4KKNA 4MNGB 3ZDXE 1T04A 4K8RL 1ZLWH 5I17A 2FO4A 3IFPA 4ZAKB 1CGYA 1QRND 1F2XK 5TE7L 3QXDA 3RHWK 5A2IH 3DVFA 3MLTB 3SGKA 1RIUL 2NY6C 3N50A 2BHUA 1JNJA 4FA8A 5EU5B 3DO3A 5DJ8B 1TTUA 3SPVB 4BUGA 3MRNB 3O9WB 4QCIA 3WIFB 2VDPL 4Z7UF 4ZO6A 1RK1B 2R2EB 1BBDH 4PGEB 1VGKB 5BRZA 3QIBA 3GFUA 1OAKL 4MA8L 1U8KB 3EKCA 5BZWA 1H3GA 5I73B 4HGWA 3SDCB 1DBKL 5DRWB 1XAUA 1DBAL 1HSAA 2QQNL 4NRYB 5C08E 2J4WH 1QSEE 3QUYD 3LKOA 4I2XA 4BZ2H 4NGHL 4YHYB 1MQKH 4EDXA 4NCC1 4LVNC 2DM2A 5C1MB 1IEBA 3IDXL 1YEDA 1F58L 4EZMA 4HD9A 2P1YA 5F89B 4XTRC 2PO6C 2FJFA 3T8XA 5BJTA 2Z8VC 1EGJH 2QSTA 4JCLA 1UZ8B 1BZQK 1PG7L 5J1TC 3V4UL 4G80B 4OGXL 5DWUL 4C58B 1G9NC 1TVHA 4MX7B 5GISL 4R4FH 4F9LC 4X5WB 5T3ZD 1HXMB 3QBTB 3BIAX 4JDTH 5HYSA 5T1KA 4PFEA 2RBLA 5T1LD 3OL2A 1DQLH 4LHUB 4YUEH 4EUPA 3U46A 1TQCB 1DCLA 1EEUA 5BS0A 4IM8A 2R0LH 4JM2D 2LTQC 4AEEA 2DQEL 2ZCKH 1G7QB 1M4KA 2AEQL 2HH0L 2ZUQC 4H0IA 5E8OA 2O93L 1ZLUK 1BIIA 3K2MC 1JGDB 1JHTB 1FVDA 1FYHB 3NVQA 3GB7B 4M43L 4P2QD 5DK3A 5C8JB 3PQYD 1KNOB 1MJ8L 4DTGL 3VFNA 5FO9A 4K3HA 1D6VH 5B8CB 2QQQA 1G7PA 1CDBA 2ZG2A 1BFOA 3ZE1F 1U8OB 4UUJA 1DLHA 5HI3C 3KPTA 1JZ2A 4WTZA 4G8GD 1T7VA 3QT2A 4YDKL 5HPMA 4Y5XB 4LEXH 5D96C 4ETYA 4WJ5A 3MTRA 4TTGA 3MRMB 4LCCC 2BNQB 3O6LH 4PJDF 5TE6L 4PP2A 3RWDA 3ILQD 2X4QA 4GG6B 4XHJC 1O0VA 1JN6A 3T2NH 4GBXA 1X4XA 5FHBH 3RUGB 3IETB 4OSUL 4U1MB 4F7CA 3RWFB 3QNZB 5F3BA 1I8IA 5GS2D 4PG2C 4J3VA 3F5WA 3RGHA 3SKJH 4EQ3A 4H25B 4BFIA 2FATL 2VLME 1JRHH 1PQZA 2XQBL 3P9MA 4S1SH 3I6KB 4M7LL 1I75A 1T03H 3PWJB 1I1FB 4BSVB 4K3EL 1F4WL 5AG9A 1DBJL 5CEZL 1YMMB 1ORSA 3IXTB 5GRVK 2DTSA 1E4KA 3O3AB 1HQRB 4C59B 3DX7A 5JOFB 4G6AC 3IGAA 4CUCA 3EOTH 4GAYB 4Q97A 3DURB 1J5OL 4M6ML 3OAUH 3W82A 15C8H 2F54A 2NTFB 3B6SA 1NMCC 1NL0L 1A4KB 3LS5H 5EPMA 4UU9A 3BXNA 4OGAC 2K7QA 4WI9A 3GSVB 1OCWL 4XPGL 3FOMA 1IFHH 5C2BL 3N85L 3LDBC 4Y5VA 1KB9K 4MA7L 3MLSL 4ZOEA 4J6RL 1CGTA 4HJ0C 5D8JL 1CFNA 4NO2B 4JN2B 1LDSA 1I7RA 5IW1B 1EX0A 3FAXA 3OZ9L 3AREB 3JV6B 4R6UA 2ICWJ 4WGWB 1FPTH 1TQBB 1MCWW 4F37F 3BZ4A 3QRFM 2XKUA 4L9DA 5IR1B 3O8XC 4PJAA 4FXGA 2ADJA 4PTUB 1PX4A 2DLGA 4XRCA 3LH2L 4P23D 1QNZH 3IF1B 5E8EA 2VDRH 4P57B 3SKMB 3P0VH 2H8PA 2V7NA 1WZLA 1H3PL 3MOAL 3OKKA 1BD2D 2W0PA 2R0ZL 5D2LF 4LKXB 4C56D 1DLFL 5DHXB 1A64A 3CSGA 1Z0NA 4X6DB 2FECL 2E9IA 4I3RH 1MLCB 5EZOL 2ADIA 5F9JB 2W91A 3PGCA 5JHDA 2MSPA 4NWTL 3MRBA 2H6PA 4OZHB 3SE3C 5MERA 1DVFD 5KW9L 3QP3A 1G9MH 5GGUA 4U6HB 5ADOH 4WW2F 5J12C 3S36L 5BVPH 4HBCL 2X1PA 1NCWL 5F8RC 1Q9LA 4HAFA 3QNXA 1ZT1A 1MELA 2X6MA 3NZ8B 4UB0H 1MRDH 5E2VH 1Q94B 1I7UB 2P47B 1A6VH 1K3ZA 4JRXB 4NYLB 4PJFF 3QH3A 1K6QL 2CKNA 2M1KA 1CVRA 1MSPA 5JR1L 1GC1H 4U1KA 2A9NL 1NLDL 4KTYA 4M5ZL 1HXYA 2BNQE 3V4VH 2EC8A 3WN5B 1A1MA 3DI2B 1QRNB 1RZIB 1A6AB 1QHOA 3KNBA 4PBXA 4GG6E 3E6FA 2IBZX 4NUGL 1MHEB 4HAGA 3RUGE 2EC9U 2R4SL 5HHVH 3X17A 2LVEA 4D0DB 3Q6FB 1PAMA 2CDFB 4WUUD 5FDYA 3ZTJH 5ITBH 2UV3A 3HE6D 2NNAB 2NY4B 2B20A 1FGNL 5DQDH 2RAMA 2K9UA 3UBXI 4RX4A 3ARDA 4G9DA 1CGXA 2VXTL 1NANH 1MY5A 3P9WB 1N3NA 3VRIB 2DKUA 5DUPH 5IMOA 3VXUE 1L7TH 4GKZB 5AAWA 1NGWB 1ADQH 4UQ2B 1YMME 2ARWA 4PJBA 1WAAF 3DO7A 2DQCH 3HCVA 1PGRB 2UY7A 4ESKA 1XGQA 2VMFA 1HZHL 1U8NB 1Q72H 1FJ1A 5I1AA 5E94B 2NR6C 3QUYB 2PW2A 4BZYA 4R26L 4BK4A 3ARPA 5C0CD 1S9KC 5DD3H 1XZ0B 3S3PA 5EIIA 4AEHH 1X6NA 4XB7A 1IGCL 2NY2B 5MP6H 2GI7A 1A21A 3O2VL 3ZYJA 3BP6B 1N5YL 1XCQA 1YY8B 2E27L 3AB0C 4LVHB 3RDTD 1H0DA 4NCDA 1I3GL 4Q6IC 4FQQB 1KOAA 5DFWH 4OTXH 2I9LB 2YA2A 1U3JA 3ZDYE 2MQ0A 2GJZA 1ZSDA 3MREA 4ZMAT 4YHKL 4S0SD 4ELME 1R3HB 1QFUL 2OTPA 1E6JL 5EOCJ 1T5WB 3Q1SH 4PD4K 1GYAA 3WBDA 4QRPA 4JJ5B 4KV5E 5SWQB 1CDUA 5TE7H 4TNVK 4ZTPL 2H1PL 5T1LB 4ODWB 4R97B 4KRLB 2R8SL 3DRQB 2VWEC 1DQMH 3K0WA 5KSBA 4JM2B 1RIUH 3LD8B 1MCNA 2OQJB 4YC2C 2B4CL 4K7FA 1DANU 3ZO0A 2XPGB 1J0YA 3EZ8A 4Y2DA 3VE0A 3ZL4H 4L29A 3TNNA 2AV1A 4IRJA 4X6DE 5EC1A 3QUXC 1JGEA 2WLZA 1OB1B 4P2QB 3PQYB 5JMRA 3LHPH 4BFBD 3GRWA 1P7KB 3VMNA 4HK3N 4EI5D 4OZHE 5J13B 1IGTB 4LKCB 4G6JL 3HPLB 3BESR 1PBYA 5JW5B 2BSTA 4XP9L 1NEZB 3KLHD 4LPWA 1ZT4B 4CDGC 2VDLL 1DBAH 2QQNH 2COQA 2GAZB 5DLMH 1A7PL 3IDMA 1U3YA 4G8GB 3MLUL 4JKPH 4KDTA 4JRXE 4KXZH 1PKQB 2DM7A 1UVQB 3V6OA 2IG2L 3MV9D 3GRWL 4QNPE 3E8UL 3DYMA 3IDXH 1F58H 4XMPL 1KIQB 5DHVB 5F44A 1IILE 3QEUB 2NCMA 4HIJB 4U1LA 5ERWA 5KSAA 3IS0X 2GEEA 1QYGL 1QRNE 4M3KB 2XRAL 1U9KA 5IWLC 5DURD 1QLEL 1D9KD 2X1XR 3H9SD 1KJMB 3D39E 1T1ZB 5MEPA 1PG7H 1CLCA 1MF2H 1LEIA 1WZKA 1P53A 3W5NA 1J11A 3MGTB 4OGXH 5DWUH 1S9WB 2V5YA 5GISH 1XF4A 3O81A 4NRZA 2MOVA 1K8DA 3MV8A 4CNIA 3QDMD 5J4MA 4OI8A 5I19H 2PYEA 1REIA 4HH9B 1I8MB 4GRMB 5C0AD 3ULUC 4Y5YC 4ONHB 4PRPE 5F7NC 2D31B 4JO2L 1AGFA 1PEZA 2HT2C 3R06A 1L0XA 3CPLB 5HGBA 2DQEH 5I75B 2HH0H 4MA3B 3OKOB