4HD9A

Crystal structure of native human madcam-1 d1d2 domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
203
structure length
198
Chain Sequence
VKPLQVEPPEPVVAVALGASRQLTCRLACADRGASVQWRGLDTSLGAVQSDTGRSVLTVRNASLSAAGTRVCVGSCGGRTFQHTVQLLVYAFPNQLTVSPAALVPGDPEVACTAHKVTPVDPNALSFSLLVGGQELEGAQALGPEVQEEEEEDVLFRVTERWRLPPLGTPVPPALYCQATMRLPGLELSHRQAIPVLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mucosal addressin cell adhesion molecule 1
publication title A Different Fold with an Integrin-Binding Loop Specialized for Flexibility in Mucosal Addressin Cell Adhesion Molecule-1
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 30
structure length 198
sequence length 203
ec nomenclature
pdb deposition date 2012-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09085 Adhes-Ig_like Adhesion molecule, immunoglobulin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hd9A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hd9A01
4QXTB 1EO7A 3PQYA 4ETQB 1OLZA 4CU6A 3L5XH 2HJFA 2GSIB 1MVUB 4MWFA 5FM5M 1HHIA 4G8IA 4TSCL 3T8XB 3RVUD 1B2WL 5F1NA 2H6PA 2DJUA 4LAJH 1WWBX 1HINH 2IGFL 4WEBH 4LLDA 4Q7DA 4QRTB 5T5FH 1VFAA 1FL5A 1QBLH 4JKWA 3WV0A 1MFAL 3GMLB 1CT8B 2MHAB 5DUBB 4DOHB 1I7TB 1CLZH 2VXQH 3LMJL 4LU5H 3MUY1 1NGPH 3UAJD 2O5XH 3C08H 4DVRL 3CXHJ 4Z7WB 4IRJA 4ONOA 1XAUA 3RP1A 4UB0L 1CE6A 3BQUB 3I6LD 4JHWH 4JANB 5I2IA 1LQSR 1QSEB 1EHNA 4NM8L 2R1WA 5J6GA 5LWYL 1HXMA 3IU4H 5ICYA 1RZIB 4WUUD 2X4PB 5SV4A 1YPZB 2X4UB 3RHWF 3O8XB 1N5YH 1JHKH 1F6LL 1QLRB 2C1PA 2OXGA 3GGWB 3BWAB 3LY6A 2VZUA 3T3PE 2BY2A 1NDGB 1HI6B 4P2QA 1HHKB 2WANA 1KCKA 2W9LA 1QLFB 2ILLA 4NO5A 4H25A 2JLLA 1S9YB 2MQ3A 4JY5L 3SE4A 5DJ6A 4QOKD 1MAML 4XCYB 1DSFH 3L3DA 1JI1A 1KYOJ 3FRPG 1NKRA 3DBXA 2DAVA 3BMVA 2VH5L 4OGZA 5HHVL 2NTSP 3M8OH 2IQ9H 4DUVA 5J0BA 5JDJA 3A6BL 4PY7A 4MZ2A 4LVHB 3KYKL 4PJGF 1IMHC 3O2WL 1NMBL 5F9AC 4P3CH 1IC7H 1BIIA 4PB9L 3LRHA 4L8BA 4KUZH 5C08E 3GJFA 4R8WL 5D2LF 4YBQC 3CFCH 4JPKL 1G7IB 1GZQA 2I5YL 3RU8H 3MO1A 2FO1A 3TPUB 5FCSH 2E6QA 4RFEB 5AYUL 5JW3L 1WQVT 4YZFF 2NLJB 3GSRB 5DEZA 2DB8A 5IJKA 1XZ0A 4HD9A 4UILL 2W60B 3IU3A 1OM3H 2IG2H 3OKMA 2OTUB 3GMPB 4GMTH 1TZGH 4Y4FC 4R4BB 3P9MA 5A43C 4K7PL 3CFDB 4OZIA 1XGRA 3VI3E 4LSRH 2CPCA 4RGOH 1DANT 1FJ1B 1L7IL 1WBZB 4B0MM 5HD8D 4ZDHB 2X70B 2QLVB 3O4LD 4ODVL 3B5TA 3KJ6L 4JRXE 1MOEA 2GJ6A 3V6BR 4YDIH 5DRWA 5F6HI 2CIIB 3LKQB 1J5OH 3NFSL 1R5IA 3UPAA 1UENA 3W2DL 2OI9C 1T80A 2HFEA 4G8EB 4X6DB 2NXYD 2XFXB 1J8HD 1WIPA 3CXDL 3DUUA 1JYNA 3PWPD 15C8L 4LSUH 5EIVA 3OKOB 3VXME 1LK2A 4GAJH 3W0WB 4M03A 1A4JA 3KAAA 1LO5B 1WCBB 4YHYB 3WNKA 4ZXBD 4APQD 3GSNH 4Q58C 5JIIA 2DQIL 4JGMA 1T1WA 4H8WL 1I8IB 2DTSA 3JVGC 1PYWB 5ITBH 4EI5D 4TVSa 5AWNL 2FYYA 4JM2D 3RVTD 4KKLC 1VFUA 4NO0D 3QJHA 5ESQA 2BOBB 2M26A 1WVZA 1ADQL 3QH3B 4R4FL 5ELIA 4XB8A 3K4AA 1MWAL 4K7PY 1IM9D 1ND0A 4JPWL 1FLRH 5IGXH 2CD0A 2NQCA 1FVDA 3BH8B 3Q0HA 3UO1L 1TJGH 3PXHA 3T09A 4JR9H 1BGXL 1M7DA 1D7FA 1MRFH 2EIBA 1WAAA 3RI5F 4TYUA 4P5TD 2Y4SA 3SO3B 3SEPA 12E8H 4KH2A 4NKDA 1Q9KB 3L5JA 3L6FA 1DVFA 2GEEA 2WINB 2JELH 1UWGL 1NUNB 3I75A 2CUIA 5CIPB 1GCFA 2EEBA 1ULVA 3C5JA 2HVJB 2XN9E 4MD5A 4R97C 4X6EB 4X98A 4J8RA 3T0EB 3QDJA 1AY1H 3Q1SL 2HT4D 4LARL 1CICB 3G9VA 4MHHI 5JHDE 1BVKA 3RWFA 1PKQA 1VADA 4K3GA 5DR5L 5J8OA 4D0CA 1CXFA 1B90A 5CJXC 3SCMA 3I02B 1QRNE 4XVUC 5I8CA 4I18A 4BSVA 2OTWB 1Q0XL 3ALXA 2NY5C 2ZUQC 2R4RL 3LN9A 1YNLL 4KJWC 4Q9QH 1OTSD 2UZIL 5EN2A 3T77A 5IESL 2Q6WB 4JFYB 4MB4A 1K3IA 3ARDD 4DWHA 4DEPC 4NQXA 2AQ3A 3KXFD 1IGMH 1P1ZA 5CINH 1UH2A 4ODUA 4N0UB 3VMOA 4JREC 4S1DC 5FB8B 3UEZA 1ZXQA 4JN2A 4NQEA 4PP2B 2JKXA 2YZ8A 2WNGA 3C5SA 1SBSH 5DUPH 4YHOH 3TO4C 2VE6A 2WM0A 3P9LB 4PGZA 5CEYA 3N9GL 4J23A 4XP1L 3QZWA 4HMDA 2XZCH 3AS1A 3FTGA 1AXSB 1D5IL 3ZKXC 1CXKA 3FN3A 3ZE2E 1F02I 1D6VL 1FZMB 3SDDD 5L2KA 3UDWC 4CL7A 3RKPA 1CG9B 1GC1C 1IGYB 4KY1H 4ONHA 4X0KA 3OKEB 4RX4A 4OZHA 3UC0L 3NZ8B 4KK6D 2EYTB 3FT4A 3P4OB 3ZE1E 3GUTB 3P4NA 5IW3A 2AS5M 4QY8B 1F6FB 3HMXA 2P5ED 4M48L 5TE6L 2ORBL 4JJ5A 3BQUD 3U9UA 1F00I 2O5YL 1QLEH 3MOAH 1I4FB 3VFWB 2VLLA 1EX0A 4LEOA 2C3GA 4WU5A 1T04B 3IAQA 3OKDA 3P40A 2FIKB 1G0XA 3PGCA 3SDAA 1J86A 5LJYH 3HZKB 5FO7A 1JNHA 3OZ9H 3D39B 3M1BA 1J0KA 1GC1H 1LP9A 3BIAX 4TRPL 4KAQL 3PWVA 4YWGL 1T1XA 3BDYH 4K94C 2HWZH 1CF8L 3B2VH 1NLBH 2Y07H 4E41B 2ESVE 1N0XH 3O8XC 4RFNC 2G2RA 5GSRA 3FQUB 3N1PC 1QFUH 1JHTA 1MRCL 3S4SB 3CCHB 1I3RB 4NBYB 3P3YA 1ZHBB 5D7SL 2BNRE 2CUHA 3DUHA 5DWUH 2VDKH 1Y0LA 1HSBA 1N7ML 3DMMD 1LNUA 1URLA 1EPFA 4LQ1A 4PJHB 1U58A 5KSVB 4UIMA 4O51A 2OZ4A 4XWOD 4K94H 1L0QA 5CGYC 3WUZA 3L95A 1SYVB 3VFOA 1A4KB 2X05A 4GAFB 5DI8B 5FUOL 4LOUD 3SE9L 3REWA 3VMPA 1R24A 5F70A 1FZOB 4X6CA 3AXLB 4PJCE 4WW2F 3VWJA 5TF1H 4MQ7B 5CCKL 4OLUL 3QNXA 4JPIA 4Z77A 5A3IC 5IFAL 2IBZY 3LV3B 3PNWB 3QUMB 1UJ3C 3CFEB 1ZT7B 4P5MB 3RL1A 2GSGA 1T0NA 3UTSE 4RBPH 1D5XA 1F8TH 4MNQE 2DWDA 3BJ91 2RCSH 3G6DH 3V4VH 4OKDA 5FO8B 5FKAB 1HE7A 3THMH 1QYGL 2WBJA 3KYMB 2YD4A 1OL0A 2EDDA 5INDB 4LCWB 1FZKA 3QI9D 3ULUC 2ZPKL 1CU4L 4ENEC 2X4QA 2ARJA 3O6FC 1RVFH 2CDFB 1IQDA 4L4JA 1Z6JT 1H3UA 4LEXH 5ISZE 4X6BB 3O6KH 1QPXA 2AJ3A 2QQKL 1CDHA 1BEYL 5HTSA 1OPGH 3LKSA 3EAKA 4C56B 4Z95L 3MYJA 4NZJA 3SE3A 4IJ3C 5ETUA 3ULVD 3OHXB 3MLUH 5C0RH 3B8SA 4I77L 1A22B 5GJTL 1P6FA 2FEDD 5HI3C 5E6IB 3ULUH 2HJKB 1BBJB 3VXNA 5HVFB 3RWJA 3VI4F 3GSQA 4OI7A 1CQKA 3QULA 5BMFH 5IROC 4YHYC 1JZ2A 3GSVA 3MCLH 3VGEA 4JHAH 1J1XL 5C8JA 4WUUA 4LRNH 5LBSL 5KVEL 4PJDE 2WV3A 1GPOH 1I3GH 4M62L 3LHPL 2GJZA 4NRYB 2EYRA 4LLQA 4X7CC 1MCPH 4PJEE 4JFZH 4K3DH 3MGAA 4XNMB 5GGTL 4X7SL 1A1NA 1MHCA 4PREA 1B6UA 3Q5TA 4R26L 1BMGA 3CH1A 3BVNB 4LSQL 4QOKA 3RKDC 1DLFL 4KRNA 5D72H 1FGNL 4OLZL 1VFBA 3E2HB 3A6CL 3P30L 3RGVB 4CW1A 1UB5A 5GGQL 5TQ2H 4X4XB 1S7QA 3C5ZB 1PG7X 2FEEL 3IDJA 4ZOAA 5FHAL 3NFPB 1CICD 1A2YB 5F97E 1NBYA 1MFDH 3BI9X 4LVEA 1AHWC 4EIZC 2MSPA 2RJMA 5KZCB 2DQJH 2OL3A 4KQ4H 5INCA 3X3FH 4L4TE 3QDME 1AGFA 4ZG1A 2YEZA 4ZYKA 2XQBH 5FKPA 5K93A 4WW1B 3WKML 3WO4B 1U6AH 2PXYB 2BNQE 4M5YH 2MTPA 4XVJL 5C2UB 5C3LD 4XXCA 1KTDB 4MYWB 4FFYH 3UYPA 3MROB 1PLGH 4MJID 1NGXB 4I2XE 3MLTA 5DK0A 1A7BA 1BQLL 1Y18A 1R5VA 1OSPH 2F74B 2YK1H 4B41A 3MACH 5SX4H 3H3PL 2F54E 5JNYB 1QBML 3OF6D 1UVQA 3QXAB 4MX7B 1IFHL 1RUPL 5CIPH 3O4LA 5EUOF 1ODAA 5E7BA 4POYA 3ROLA 2EH7H 3GKZA 4RAUB 1JJUA 4NRZB 4RMQA 3U83A 5DJ2A 2YRZA 1SY6H 2UY7A 4PV9B 4LLVA 2YHGA 2FZ3A 3WE6B 2RGSA 5DFTA 2BK8A 5F7KC 1I7UB 5MHSE 2VYRE 4Z7NF 2EDYA 1A1MA 2VUOA 3D18B 1FQ9C 1QFOA 1J8HA 1CDIA 1UM6L 5CLWA 3PWPA 3O3BB 1KN2L 1FBIL 3VE0B 1S5HB 3GSWA 2VB5A 5IVXF 4Z7VA 4HH9B 4M7JL 2H9GA 3OG6B 4LCIH 4QRRB 1T89C 1UFUA 4ZO9A 4EUPA 4APQA 2VLJE 3LB6C 4NN5C 1CCZA 4EI5A 4YX2L 4NGHH 5DD6B 5C0AE 1NCBL 4JM2A 2UWEF 5JA9A 2QR0A 3BSZH 3TA3B 5TH2A 2BVQB 5E2VL 4HIEA 1EXUB 5HGGS 3TCXA 4PJIE 3V7AE 2ZSVA 3ARED 5DMJB 1X5IA 4OZGA 2VZTA 4WHCA 2XWJA 3CFBB 2VXUH 5CWSB 2EE6A 4L8SB 3HI5L 4GKZB 3RBGA 4KGLA 3TZVD 2DLFL 3CZFB 4LSSH 5SWSE 1QZ1A 3WXVL 3OX8B 5B38B 4UV4L 1HOCA 5HPOA 4HHAA 3RUGE 1CD1A 1FG9C 5BW7C 5DO2C 4P5TA 4PPTA 3G5ZA 3HB3C 4E41D 1ZHNB 4OGXL 4KV5E 2Q8AH 2X42A 3D9AL 1TZIA 5B21A 3PIQA 1UYWH 3DXAD 4P4KA 4XC3L 5D7IF 3SGDH 4DK6A 5JQHC 5EWIL 5DJDB 1KJMA 5BRZB 4P46D 1NFDF 1TMCB 5DVKA 1UZ8B 4JO1L 5E8EA 2CLRB 3HC4H 4ZPTB 1ITCA 4KHXH 4WHYG 3LSOB 4HUXA 3MUJA 4F8QA 43CAA 3TBSA 3B9KC 4XAWL 4I3RH 4MJ6A 5D93C 5E8OB 1LE9B 1G1YA 2VAJA 4BH7B 1A9BA 2KZ1B 5K9KB 1BZ7A 1N59B 4HC1H 3ARDA 1UWXK 3U0TA 3MRBB 5D8JH 4HAFA 3X3GH 4YLQT 4HXAH 3KPSB 3X17A 4X4MA 1I3VA 3EDJA 3MCG1 3KXFA 4XVSH 3MJ9L 4RGMB 2ICEB 4E42A 4M7KH 5I30L 4Y5VC 1SEBB 2Z91A 4PRBA 3LRGA 3D2UB 4XCNB 1LD9B 3MV8D 4FXLA 4LCWD 5C07D 3CVIL 3ARPA 4QXTA 4ETQA 1NL0L 1SHMA 5KSBF 1PSKL 3QEQB 4JO2H 5I1KL 2GSIA 1MLBB 4NHUB 4GBXB 4RRPG 1KCUH 1XFPA 2ED7A 1S7TB 1T6WA 2PTTB 4QRTA 3JUZA 5C09E 3SDDA 4EN3D 3PDGA 3RAJL 3GMLA 3BD5A 4IRSD 1MCJA 1A6PA 1J05A 1I7TA 5JXEC 3HRZB 2PYED 2X5PA 5DSCB 4TSAH 2GCYB 1S78C 4PJ9B 1CGVA 1M7IB 1RIHH 2NCMA 2P5EA 1KB5L 3IFNH 3U0PB 1FNSL 3IFPA 4KTEL 3DVIA 3S8WA 1JF5A 3I9GH 5E4EB 4JO3L 2NY4C 1C12A 1N64L 3GGWA 1QLRA 5E6IC 3BWAA 4M7LH 4QYOB 4ZD3H 5HPMB 4Z8FL 5J4MA 1HHKA 3JSSA 2NXZB 1JGDA 3GBNL 3C8KB 2IALA 4XNZC 3RY5A 1KJ2B 3K2MC 2EE3A 4XCYA 3QSKB 3UJIL 3TBWB 3BZEB 2BOCB 1BQSA 3ROOA 4D9RD 1ZS8A 5J12C 3RGVD 3VD7A 1K85A 4WTXA 1MHEB 4XPHL 2EEDA 4RQQB 2X4RA 1P9MA 3DX9B 4OTXH 3FB7B 1N5AA 3DETC 3DMMA 4XGZB 3BT2H 3E2HC 4IIQB 4X7DC 3IGAB 3U4BL 4H26B 1G7IA 3V0AC 4NRXB 4Q0XL 5IWLC 1FYTE 1ZLVH 3C5ZC 4KU1A 3WDHA 4NP4H 4G42B 4ALAL 3BGMB 3UTZB 3PP4H 4JQVC 2EICA 3GSRA 2Y36L 4AZ8A 4R0LB 5JIKA 3AC0A 4OT1H 2Y06L 5KVDL 3A67H 4PJ7F 2OTUA 1XGPB 4HBCH 4GG8B 3MUHL 3S88L 1G84A 4R4BA 4BSWB 4XMPH 1GRWA 3BP4B 2FX7H 2VXSL 4Z7UE 5EZIL 1NCNA 1FJ1A 1S7SB 4ZDHA 3TN0C 1FFPA 2X70A 3K74B 4YK4C 1S7WB 4QXGL 4DN3L 1AFVL 1X5LA 1DBMH 1FFOB 2R2HB 5C0CE 3RZCC 3HAEG 4JDTH 2X4SB 1YYML 3LKQA 5A2IH 5L6YH 3C9NB 2W91A 5DQ9B 3QI9A 4O9HL 5KVMC 5EBWB 2VITB 5JXAH 3DWTA 4XHJC 4PRDB 1QBBA 1MFNA 1JYXA 3MV9B 2G5BA 5ALCH 4X6DA 2XFXA 1R3KB 4G9DB 3OKOA 4RRPA 1AC0A 3VXRB 3T4YB 3CFKA 4MVBC 2NY0C 2R0ZH 1LO5A 1WCBA 4XP4L 5KTEL 1NEZB 4L9LA 5I17B 4J4PC 3VJ6B 1I8IA 4PJFE 3VFTB 5DMYA 5FA3A 1JFQL 3S35L 4YFEA 3QWRD 1RUKL 3QIBD 5ACLA 5J13B 2DQHH 3TA3D 4OCXL 1LO0L 3GK8L 1MFBH 2BOBA 4UINL 3STLB 3GZKA 5I74C 5MENE 4PJXA 4ZUSA 4XMLH 5E70A 1H3VA 4V1DB 5F7NC 1KJ3H 4M4PA 2F5BL 5C7XL 3HCVA 1DBKH 4EOWH 4RDQG 1SM3L 3QA3B 5E5MB 3IETA 5ANMB 2YS4A 3LN4B 2J88H 5EULV 1K3ZA 5HSFA 4JG0H 2VAAB 4KROD 3LKRA 4TUJA 4ERSL 2OCFD 5JQ6H 1Q9KA 1T83C 1J10A 1NC4B 9CGTA 2DBJA 2P1YA 3BP6B 4YDKH 43C9B 5EO1A 4WFED 4X6EA 5EORH 1D3CA 1T4KB 2G9HB 4O00A 4ACPA 3NCYS 2EC8A 4QXUL 1BOYA 2H2PD 2VABB 4DQOL 3MV7E 3O6ML 5BRZD 2AJYH 4Y2DB 4ODHH 1TQCC 5I16A 4XPGL 3N50A 3I02A 3K7UA 4M6AA 1MRDL 3T04D 2OTWA 3VXOA 2NTFB 5E2WH 4ODWA 1WZ1L 4HV8B 5B3NA 4CGTA 2E9WA 3TNMB 3LRSB 4WFHD 5F71A 5HGHB 4MJIA 4U6HA 5E24E 5BOZG 2B1HL 2Q6WA 1MNUH 4JFYA 1MAJA 3MRJA 1X5JA 2R8SL 1TNNA 4KC3B 1DEEB 3OF6A 5I0ZA 3A6OA 3KPSD 4S1QL 2ZUYA 3QEGL 1EFXB 1CL7I 3VH8G 5E2UH 3MRFA 4G3YH 8FABB 5HDQH 4Q9RL 3D2UD 1OP5K 1G0YR 3RPIA 2PR4H 2GI7A 4PP2A 3HZVB 1OGTB 5K59E 1FNLA 1WZLA 5BCAA 1BFVH 2Q7YB 4MLIA 1XCTB 5I66B 5E6ZA 3EYQD 3G5XA 3T4AA 3SJVB 25C8H 2O61B 2OJEB 1A5FL 2YR3A 3QEQD 4RGMC 3T0XA 1CBVH 3EJZC 3VD5A 1A6AB 1AXSA 5C0EB 1NANH 1GHFL 1B3JA 4TSCH 1VACB 1YDPA 3QUXD 1LEGA 5I1LB 4NO2A 1HYRC 2ARJQ 2BFVH 5A1AA 1CG9A 3EGSA 2Y25A 2I07B 1IGYA 4M6OL 1O5DT 4PJBE 1BVLB 4PJ9D 2VTFA 3LMJH 4GBXC 3KPLB 4U1LB 1FN4B 4U1KB 4NQSB 1ZLSH 3FHQA 5I8EA 4U05A 1MCKA 3T0DA 1RJZB 3AREA 5D2NB 3PGFL 4NM8H 1T04A 4IOFC 4PB0L 2APVA 1TETH 1N4XH 3HA0A 1RULH 3HZKA 3TZVA 5IMKB 5LG1A 5H2BB 1ACYH 3CX2A 1MELA 2NXZD 4P2CG 2ITDA 1MIEH 5IM7B 5HVHB 3BRFA 4C4KO 5DD5H 4LNVA 3TV3H 2LVCA 3FZUC 3BDBA 2YPKB 2W38A 5JHLH 3KYNA 2BXYA 1NMCC 4DK3A 4PGDB 3CCHA 1QSFE 5FYKL 4GQ9L 4OB5L 4P23B 3DXAA 4S1RH 3W9EB 3FO0L 3WLBB 4Y4KC 4K23L 1FH5L 5I75C 5C9KA 2ESVB 4GG6E 2ZP0T 3DVFA 4M6NL 4PJHA 4P46A 1WLHA 5KSVA 3CAFA 5JDSB 3SQOH 3U7WL 2DTMH 5GZOC 1SYVA 3CUPA 3V9FA 1I1AB 1BZ9A 5C08D 2ZSWA 5DI8A 2HH0H 1NCAH 1FZOA 2J8UF 1X4ZA 3AXLA 4KKCC 4NN6C 5D7KD 4MQ7A 1CDJA 5FV2A 3LV3A 3H2WA 3PNWA 1KJ2H 3QUMA 3KPNB 3OPZL 4JB9L 3RWGB 2VDQL 4CJ0A 5J89A 2MKWA 5KVGH 2V9QA 1IM3A 5L9DL 5E0QA 4YBLB 2AW2A 3GNMH 5DXWA 3KLHC 4GFTB 2YPLE 5BVJB 2CIKA 3RNKA 3TO2B 5FO8A 2XTJB 5D96B 3RWEA 4MXWH 5IVNA 1QACA 1MCSA 3UTPE 4K07A 4CU7A 1AGDB 3MV8A 4IS6B 4OQTH 4LCWA 5INDA 2FIRT 5C07A 3NFSH 3ZO0A 3LQAL 4NQDE 4XBPB 2VXTL 4D9QE 3MV9D 4YHNA 4UV7H 1WGOA 4X6BA 5EZJB 1WFUA 1G9EA 4X6FB 4KWUA 15C8H 1S8DA 4JLRB 3SDYH 3SOBH 1G6RL 2Q20A 4LAQL 2DRUA 4F37K 4TN9A 3MRLB 5KOMC 3DHMA 3G6JA 4EN3A 1IGIH 4W4OA 5DRZB 4IRSA 4JM4L 4M93B 4Z7QF 5CSGA 2PYEA 4LRIC 1YEIL 3OHXA 4ONGH 1RIUL 2VERN 5IB3B 2HTKC 2RB8A 5ACZA 3VXMD 3K1KC 4Y7MA 1BBJA 1M6OA 1OAZL 3MR9B 4X5XB 4DFIA 3UTTB 4YXKL 1EVUA 5ECJE 4G7VH 5IHUL 4ZOEA 4JFXB 3JV4A 5IMMB 1DBAH 3KS0H 3BISA 1TCRB 4QTHB 3MLWH 5DVLA 4NRYA 3CNKA 5J13C 4JVPA 1CDCA 1FNAA 1PG7H 4Y4HC 1G7HB 4MA3A 3BESR 3DV6B 1VGKB 1ORQA 1A6VL 1TXKA 4PJDB 1BECA 1OF2B 3ALWA 2QHRL 4HIHA 2FD6H 3RGVA 1CXIA 1NC4D 3H42H 4F8TA 4X4XA 1B88A 1P6AB 3IRPX 5GRVL 3MXWL 4WWKB 4DJMA 3NFPA 2VLKE 3PHQB 3MODL 2FECI 1TPXB 1A14L 5IBUG 3FQXB 1GZPB 3Q1SH 1GAFH 1SJXA 4UMGA 4N8CH 4FG6C 2D2OA 3IDXH 3WL9A 1NAMB 3WHXB 3X14A 1ZLWK 4HKXB 4MD4A 2XWBB 1YEGH 4KQ3L 1Q38A 3RTQB 5JHDD 1U3HB 2HMID 2KBGA 4I48B 5IB2B 5D1QB 1KTDA 3QHZH 2HLFD 4Y16B 5HHXH 3BKYL 1NGXA 2HT2D 5F9WB 4TULL 3O6LL 1QRND 1E27B 2AXGB 1I8LC 2XXCB 3FOMB 4OAWA 3D5OF 2V17L 1UB6A 5T3ZL 1EGJL 1OTUC 5FGCB 1ZGLA 3QXAA 4G80A 5A2KH 3PE9A 1R3LA 4MSWB 4Q97A 3NTCH 2B0SH 3JWOH 5T1KD 2E27H 3EYUL 3MXVH 1EFXD 3FQRB 4GLRI 4RAUA 4HUMB 4NRZA 1NGQH 3MA7B 3IJYB 4PJGE 2FECL 4PV9A 2A1WL 3WE6A 1X9QA 1I7UA 4FZ8H 1E4KA 3L5IA 3RDTB 4HKZB 3VRJB 3D18A 5D2LE 1DBBL 5GGSY 3OJMB 4MDIA 5C9JB 1AO7E 1S5HA 1ZANL 2GT9A 3FB8A 1EK3A 3ZYZA 3QT2A 1WWCA 1P4IL 1MFCL 1JTOA 2J5LC 2Q1EA 4Z76B 4YZFE 2JCCF 5I1JH 3QIWB 1NSNL 4LL9A 1T3FB 2AK4B 3QWRA 5DD6A 1INQB 3ZT5A 3QIBA 2P47B 2ZCHH 3TA3A 5TPWL 6FABH 4MCZA 3HRPA 2GAZA 3P77A 1EXUA 3CFJA 3GMMB 1B0GA 5CMAA 1FV1B 4M48H 3ZKMD 2W1NA 3O2DL 3VWKC 8CGTA 3CFBA 1V5JA 4HPYL 3RI5K 1X5ZA 4L8SA 5BZDB 2CGRL 1DL7H 4GKZA 2CK0L 4K55A 2FGWH 3U6RA 4EBQL 4QRQB 2KQNA 2IAMD 4OI9A 3OKNB 5MEQB 2YD3A 2DQUH 3OX8A 1GVIA 5GSVB 3ZL4H 1W0VB 3VXTA 3SDXF 2IFFL 4YHIB 2HJLB 3IDGB 3VFGH 4D9LH 2EC9U 2OYPA 3FMGL 4F7MA 4HKBA 3O9WB 3F12B 1E4JA 2YC1B 4NUGL 1XH3B 5D5MF 1AP2A 4HF5H 3NZHH 1X6LA 1MQKL 3GKWH 4GXUM 2J3SA 2CMRL 6CGTA 4P23D 3QO1B 1HKFA 4IHOB 4XTRC 5D7SH 2ESVD 3TYGL 4P9HH 3BPNB 4EVNA 5HYJE 2BRRL 3HS0A 4S1DD 4NUJB 5HHOB 4G6KH 5CD5D 3S5LG 3F6LA 5FUZH 2CLRA 1YQVL 2Z92A 3DRQA 4I0KA 2BSRB 1YECL 4ZPTA 2NX5E 3TO4D 2BNRD 2YMXL 4EXPX 2DD8L 2GJJA 2AKRA 1LE9A 3SE9H 2AP2A 1QEWB 1T21B 1EEZB 3GJFK 2D03H 3HFMH 4BH7A 1EBAA 1N59A 3GSOB 2A2QT 4OLUH 1K9TA 5H37G 3MRBA 4ZUWA 5FOBA 1SJEB 2DF3A 5CJOL 1IGJB 2HVKB 5C0IB 2GYSA 2JJUA 3KPSA 1QHOA 4NPYA 3S34L 5DHYB 2DWEA 4LKCB 2ICEA 2XTJD 5D9SA 3EO9L 3F58L 3QQ3A 5ESAB 2FH6A 3LEYL 3Q3GB 3UTSD 3TF7C 3UZQA 3KR3H 3FN0L 1LD9A 5I8OH 4LSPH 5EU3A 4YBLC 3WUWG 5HDBF 3DUSB 5E2JA 1RZJL 2OMNA 4HXBL 1DUZA 2QKIB 4ZPVB 1R0AL 4Y8AA 3LPGA 3PXJA 3QEQA 2J6EH 3K4DA 3O41B 4NHUA 5ILTL 5JORA 1J1OH 2A73A 3VGHA 1D9KC 2FX8L 1H3XA 3D0LB 1S7TA 3QUXA 2OR9L 2PTTA 1NEZG 1I7RB 5DJAB 5C0FA 3R1GH 2C5DC 1MCFA 2GY7B 4IOIB 2GCYA 4PJ9A 5DFVC 2DN7A 1TTGA 3KPRE 3QUYC 3BGFB 1QSVA 1RJLA 2DMCA 4WI5A 4JCLA 3UTTD 1REIA 3CSGA 4GRWF 1XGTB 1PX3A 3DOSA 4HCRH 1JYVA 4LHUB 1LDSA 1IL1A 3AS2A 4QNPF 5CGYD 5LBSH 4DCQB 1FDLL 5DHVB 1BFOA 2Y6SC 1XEDA 3B9DA 2FX9L 2X1WL 4HEME 3QISA 1J18A 4X7SH 3WNLA 1U95B 2QV2A 4MB5A 4W4NA 3BZEA 2BOCA 2FJGA 4OLWL 3CDGB 1RFDL 3OTTA 1A3LL 1AI1L 1UXWB 4UQ2A 1ZE3C 5EU6E 5HHPB 4XNUL 3C60C 4HMCA 4EDXB 1MHEA 3GB7B 3HC3L 1CVSC 4WWKD 1V7NL 4HMEA 4YC2C 3G5YA 3ARGC 5IB5B 4LASH 4XGZA 3W39B 4ZFOA 4IIQA 3IGAA 3OJ2C 1RZKL 2ATKA 2E9BA 4P9ML 4NRXA 4J6RH 2XIDA 3FONB 1Q1JL 1F97A 3GRWL 4PJ5E 5GGVL 3SY0A 1IILE 3TT1L 4EJ1C 5C08A 4LHQB 4OCSH 3RTQD 3TGXA 4R0LA 3LKNB 3CC5A 3GM8A 1JRHL 4OBSA 5D1QD 4LVOC 1CD9B 4M00A 4Y16D 3OSKA 4JFOB 4L8DB 4CVXB 3QDMD 2CKBB 1HNFA 1JV5A 4WEUD 4BSWA 4C83A 3DO7B 5F7DB 4QHNA 2W07A 3P2TA 1G9ML 2VJXA 4BM7A 4HS6A 4K2UL 1OVZA 3EOBB 4N5EC 1BAFL 2WQ8A 3HNVL 5H94B 1D5BA 1S7SA 1U3HC 1YEJH 1VESA 4R7NB 1S7WA 3ILPB 3RIAK 4H1LB 1RUPH 2R2HA 1VPOL 3MLSL 4QCIA 3FFDB 2JJTC 1DBJL 3F7VB 4GKSB 1V7MH 5F9WC 3CSYB 1VHPA 2F54D 3LS4H 2IH1A 1GL4B 2JK5A 4PUBH 5DQ9A 5EBWA 1IAII 1L9NA 3WUWA 3KNBB 5D7LE 3TJHD 1NAMH 3MV9A 4GQPH 1MREH 3IKCB 4RGNB 1R3KA 1UXSB 1UM6H 5I73C 1LILA 5TDOA 1G7JB 4K3EH 5MHSD 1NEZA 2NY3C 3MFGB 4WI6A 3RDTC 3V4PL 5I17A 3VJ6A 2BCKB 3VFTA 3WDJA 5KG9B 3QIWD 2W65A 3VXSE 2VO5A 3OQ3B 3VXMA 1DEDA 3QFDB 1ZT4A 4JRWA 4NKOB 3MREB 2HFFB 3RWHB 2AJXH 1N8ZB 1F4WH 4BQ9A 3VFRB 4CRPA 3V6FB 4I5BA 4PRPB 1FAIL 5IMLB 1I7ZB 4OM0H 1F58L 4UT6L 1NC2D 1WBYB 4X83A 3G08A 1NDMA 2V9TA 2NY7L 4R90H 5C0AD 1A7QL 1BOGB 2I25N 3VXUB 4ESKA 1VGEL 4GJTB 5GJSH 4FQCL 2FRGP 4HUNB 5CKAA 2R0KL 5I8KL 4IRZL 4L4VB 3QA3A 4U6TA 1BX2B 1A0QL 3BMWA 3L3KB 3B3IB 5IVZB 4Y1AE 1KIPA 1FORL 3IDMB 2BJML 1X5GA 4S0TD 3CSPA 3O9WD 5SWSD 3OJDB 1NC4A 3QDGE 1CGTA 3ETBF 4ZUTB 43C9A 2APFA 3FOLB 1T4KA 2G9HA 1AKJA 4M3JA 3MBEB 4KXZI 4OCWH 2XI9A 3AM8C 4Z78B 4N68A 4AENB 1H9VA 4U6YB 2XT1B 1N3NB 3BZ4A 1A7NH 2VLME 3GMRB 1HHHA 1F90H 1A9EB 4L3CA 3S9DB 5IQ9B 4HJJH 1ZA6B 1WEJL 3VI4E 2EDLA 1T1YB 5JHDA 3EYSL 4ELMB 3PABB 4IM8A 3VFUB 3MV7B 4XPFL 5JOFB 2AJSL 4NKIH 1QFPA 3I6GA 4LP5A 4NBZB 1LEIA 3TNMA 5AZ2L 3ET9F 3T0VA 1QRNA 3MNVA 2R4SL 3WIFA 4KPHH 5HI4C 1YN6B 2IPTH 3AY4A 5JO5B 4DUXA 5K9QG 3JVGA 1HN1A 3IDIA 2E7MA 1W72H 4JDZB 4OF6A 3H9SB 3ARQA 4MS8D 2Q87A 4HWZA 4BJLA 2AABH 4X80L 5T1KA 3OAYH 3UJTH 1EFXA 2DLEA 1XF4B 3VFMA 3IFOA 4KVNH 2ITCA 8FABA 4AEHL 2EE9A 3HZVA 4NQCB 5C0DA 1KXVC 5L0QB 1MVFA 2L7UA 3QFJB 3TM6A 2MCPL 5I66A 1KEML 3VFNB 5ABDE 4FQLH 1M05B 1ZAGA 5J3HD 5MEOA 4I0PC 1QFWL 1A6AA 5C0EA 1ZGLM 2YUZA 3F65A 2NW3B 4WHTB 1UM4H 5I1LA 1MSPA 2V5TA 3VFVA 2OJZH 2I07A 3FQNB 4MJ5A 1CE1H 1GIGH 4XP6H 1OOAA 1BVLA 3BN9D 2ZG2A 3OGCB 1JF6A 4JFFB 1WIOA 5C6PB 4NJ9H 4U1LA 4NOBA 4U1KA 4NQSA 2IBZX 5JUEL 1KUMA 3B2UC 1XR9A 3DYMA 5TFSL 1RJZA 2J4WH 4MDJA 5T5NF 2NY2D 2A6DA 4YHPB 5KSUB 1FO0L 3IDYC 4H20H 5EUOE 5CJXA 1IGCH 4KK9D 1I9RH 4LHUD 1RZ8B 3REVB 3E8UH 3GSUB 5BXFB 2IAMA 5IMKA 2DM2A 4X4YB 2RAMA 1GGTA 2ADJB 5T3XH 1MJUL 4EQ2A 1A6ZA 1U8IB 4KJQC 3P9WB 4XPTH 4ZTPL 4Z7NE 1G6VK 2CLVA 3B6SB 1LGVA 3GI9L 4QRPE 2DKMA 4OLYH 4YFLF 5L88H 4ZNEE 3W9EA 5LGHH 3V52L 1EEYB 1AGEA 1UCBL 2ESVA 5L2JB 5DGQA 1T5XB 4KKNA 2WBWB 3EDDA 4IMKC 4O58H 1XGUB 5CILL 3I6KA 2DS4A 2UWEE 3MGTB 3PL6B 2H45A 4LDLB 2APBA 3TO4A 2B4CC 2BNRA 4K8RL 4YDVB 4G6JL 3LVEA 5T3XE 5DHVH 3V6OE 5HGDA 2BHZA 2J8OA 3SKMB 5DC9B 4F58L 1A7OL 3FO1B 4UAOB 4W6YB 5DVMA 2Y06H 1BPVA 3RWGA 1IGFL 1C1EH 2VDMH 1KPUB 3ZDXF 2R1XB 4FQQB 3GBMH 3DX8B 1UWXH 2ENYA 4PJCA 3L5XL 5F7WC 1LO4H 5GS0C 5I1AB 1KULA 5BVJA 3X13B 3TO2A 2B4CH 1HINL 4WEBL 5T5FL 1ZWIA 1QFWM 5C2BH 3UTSA 1QBLL 1MI5E 4FFWC 1CLZL 4MNQA 2WLYA 2VXQL 4LU5L 5C92A 1NGPL 2V2XB 2O5XL 3C08L 3N1MC 3HG1E 4G5ZH 2ENSA 1IC4H 4YNYA 4XBPA 3IJHB 5D7IE 4P5KA 5C0CD 5JR1H 2R2EB 4RGND 2CDGB 1NFDE 4N8PA 4JHWL 5IEHA 4UIKH 5GS0H 4X6FA 3O2VH 3WJLC 4ODBD 3IU4L 1Q9WB 3MRLA 2R0LH 4AIZB 1LO2H 4ONFH 2FBJH 4NNXB 2VLRE 1JN6A 1J0HA 1N5YL 1JHKL 2XXMB 3MRNB 3UBXG 4PD4K 4YFLI 1F3DJ 3L3GA 5IB3A 4KGJA 5EBGA 4WUKH 3MR9A 4X5XA 1OARH 1AJ7L 2R69H 1DSFL 1E6JH 3IJSB 4PRPD 1G7LB 4NYLB 5IUSA 3DETD 1N2RB 4OLVH 2CRMA 1A1OB 1QQDB 3UTTA 1S9KC 1IKNA 1H3PH 4H1LH 1VFOA 3M8OL 4P2RE 4JFXA 1UEYA 4X9HA 2HTLD 5C70A 5IMMA 5T1LD 3VXUD 3WEXB 1TCRA 4QTHA 4P3CL 1IC7L 3N1GC 2EXYD 3V8OA 2I60H 2IANE 5CZXC 3V7AG 5MEND 4L4VD 5KN5B 1P7QB 5F9OH 3CFCL 1VGKA 4U1HB 5FYJH 2ZUVA 5DQDH 4PJDA 4XH2B 2AK1L 3RU8L 1U2HA 3X11B 5KSBE 4MD0B 2BP3A 3JV6B 3EOTH 3L5HA 4D94A 2BHYA 4NO3B 3ZE2F 4BQ6A 4LCYB 3VCLB 1L7TH 4WWKA 3UROR 1YY9C 1OM3L 3PHQA 2YWYA 2IG2L 3MBED 5EBLB 4GMTL 5BZWA 1TZGL 3FQXA 4FFVC 3UPRA 2DI7A 1GZPA 3MFFA 5F44A 3RX8A 5GRJL 1C7SA 3ES6A 1GGCH 4HGMA 4LLMB 4ODXB 5L8LB 2DLTA 2NYYC 3D1MC 4CVZB 4RGOL 2CXKA 1NAMA 4YXLL 4ZS6C 3ZTJG 3H0TB 3O6FA 1YEEH 5KSAD 2XWBA 4XPGH 1FVEB 5I6XC 4KI5D 3SO5A 3RTQA 4PY8I 3JWDC 1MEXH 4YDIL 1QNZH 3EYFA 3MV7D 3OXSA 2EDKA 1J5OL 4I48A 5IB2A 5D1QA 4Y16A 3R0MA 1E6OH 5TE7H 1MF2H 3QDMA 1E27A 3FOMA 3U4EB 1KLGB 4M02A 1ES0B 4IOSD 4WI8A 5CFHA 1NFIB 3WIHA 4TOYL 2R8SH 3T0AA 4ZO6A 2R23B 4LSUL 4MSWA 4XXDA 1YEKH 4ORGB 2FCBA 4GAJL 4EEEA 4I2XA 2VL5B 5HYSG 3FQRA 4K71C 2ZUUA 2HLAB 5F6IB 3OJVC 5IB1A 2F54A 1JGUH 3GSNL 3JWDH 1F6AA 4EQ3A 2VDOH 2XRAH 5ITBL 2DQEH 5ITFB 3QFJD 5E9DB 4TTDD 3IDUA 4NC0B 5EOTB 3OR7B 2E7BA 5C9JA 4U1GB 4G7YH 2ICWI 1CGXA 5E8PB 4ZOCA 1NJ9A 5IGXL 1FLRL 3OMZA 4Z76A 2DDQH 4OZFB 5GISH 2HFTA 3QIWA 1T3FA 4JR9L 1AO7B 1INQA 4PJ7E 1MRFL 1VCAA 4MQXC 5E8NB 4JFFD 5A16B 4KJPC 4Y19E 12E8L 5EOCH 4A6YH 2VLJA 3GMMA 1NC2A 2DQGH 5SWZE 2JELL 1AHWA 5F89A 3S36X 4Z7WF 2CR6A 5C0AA 4PRAB 1CLCA 4LHUG 2PN5A 1R3IH 1CL7H 1AY1L 1JPTH 3NBNA 2PKDA 4PRIB 3OKNA 4XI5C 4P3DA 4YHKH 1SMAA 3D25B 3SGKA 1NGZB 4NM4H 1YPZF 2VR9A 4O2CB 2N7BA 3E6HA 2HJLA 3ARBB 3TVMB 1FC2D 1PVHA 3F12A 5SWSA 5MI0C 4D8PB 1XH3A 1PKOA 4JZJC 4PRHE 2EIDA 3RUGA 4Q9QL 4BQCA 1X5HA 4WJ5B 3QO1A 4IHOA 3NGBC 4PG2C 4HK3N 2OTPA 1B4JH 4NUJA 1QR1B 3GHEL 1UKSA 4WDIA 1DP0A 2JB6A 3KJ4C 3QXVA 4CMMB 3PL6D 5KANG 4C55A 1QA9A 4HK0B 1IGML 2P5WE 3V5HA 4PTTB 5CINL 5DJYB 3U79A 5IKCB 3AUVA 2WWMD 1KCSH 3DSFH 5ICXA 1QEWA 1T21A 3VG9B 2P8LA 4ZO8A 3B9VA 1SBSL 5J1AB 3GSOA 4CMHB 4ZUUB 5DUPL 3ZT7A 5DZNA 3LQAC 4YHOL 2EDOA 5ADOH 4MNHB 5DJZB 4JB9H 4FABH 3C6LB 1SJEA 1FPTH 2XZCL 5C0IA 3PQYB 2DLGA 4I3GA 4OD1H 5JZ7C 4O5LH 4GXUN 3KDMA 35C8H 4LKCA 5I19H 4UAOC 4MWFB 1AXTH 1U2CA 3MJ7A 4G8IB 2DL2A 5FYKE 3WS3A 3ULUF 2H6PB 1Y6KR 5JOPE 4OUOA 4H0GA 4LLDB 3O0RH 3U0WH 1VFAB 2NZ9D 1FL5B 1OP5H 4KY1L 3VMNA 2YPLD 5J11B 2OK0H 2AEQL 4ZPVA 2XZAH 3EYVB 5CP3H 1KCRH 5EZLB 2VXTH 4ORZC 1P5UA 2XG4A 3UTPD 5LKNA 2X89D 2AGJH 3MRGA 5AD0B 1CE6B 1QLEL 3MOAL 4NWUH 4TQEL 3D0LA 1IZKA 2R1WB 4NQDD 1G6RH 4LAQH 5DJAA 5ICYB 3AFLA 1CGUA 1QP1A 4J3VA 3OZ9L 5EC1A 3WXWH 1T7VA 2C1PB 4IOIA 1RK1A 1GC1L 2EDTA 4P2QB 1YEIH 2NY1C 1RIUH 4L1HA 3BDYL 4M1DH 1JMXA 4LCCC 2HWZL 1KTRL 1NLBL 1KNOA 2Y07L 3VXQB 3HNSH 1UA6H 1N0XL 1QKZH 4UUJB 2W9EH 4OGAC 1XT5A 3OGOE 5FYJU 3WN5C 1XGTA 5IBLC 1QFUL 3GHBH 3FKUS 2BHUA 5TQ0H 4LHUA 1VB9A 5DJ8B 3BW9A 2FHBA 5GZOD 5DWUL 5CP7A 1TIUA 2VDKL 4FZEH 4HWBA 1P7QD 1PDKA 3GJFB 2QSQA 2XPGA 1U95A 4OI8A 1AIFA 5GIRA 1GZQB 2IF7A 4K94L 3BP5B 4BELD 3MO1B 2IMNA 3P0YH 1BD2E 1XIWC 2WP3T 1HDMA 4EDXA 4J2XA 2KH2B 5TF1L 3KGRA 3ARYA 2E7HA 3FQWB 1XZ0B 4UT7H 4Z9KB 4Y5VA 4ELKB 5IB5A 3OKMB 5EU6B 3W39A 4KVCH 3AB0C 1PY9A 1PQZA 3P9MB 1XR8A 4OZIB 1XGRB 3I2CH 4PJIF 2VLKD 2RCSL 3G6DL 3V4VL 1U93B 3GMQA 3K2UH 3SKJH 5B22A 3THML 4F9LC 4LPYA 2MFNA 3LKNA 4X9IA 1OGAE 5HYFA 5DRWB 1F13A 4CVXA 4YUEH 2CKBA 2WAHA 3DO7A 5F7DA 1RVFL 1S5IH 3CXHK 4U0RB 5K9OA 5GRYA 3V95A 5H94A 5EZOH 4LEXL 3O6KL 4R7NA 3ILPA 1OPGL 3FFDA 4FQ1L 4GKSA 1KFAH 3TIDB 2VN4A 1A4JB 5C0GA 4OD2A 1T66C 1YEFH 4GW1A 3MLUL 5C0RL 5IT2H 1T1WB 4GRLD 1MCDA 4U0QB 5GZNC 4WV1C 3ULUL 2A0LD 5E9DD 5C0CA 2FYYB 5I1HH 3IKCA 3PGDB 1UXSA 5BMFL 3MUGA 5CJQH 3QJHB 4OFPA 3MCLL 2VUYA 2OP4H 5CD3B 4JHAL 1G7JA 1P7KB 1RJCA 3T65B 4W6XB 1GPOL 1FHGA 1I3GL 5HYQA 2UUDK 3LQMA 1ND0B 3BEVB 2IJ0C 1VEOA 1MCPL 1MJ8H 1FVDB 4JFZL 1AO7D 4K3DL 5T3ZE 4KMQA 3QFDA 4NKOA 3MREA 4U1GC 2HFFA 4PS4H 3QIUD 3BEWA 1N8ZA 4J12A 3FL7A 4PRPA 3ZTNH 2YRLA 4CDGC 1I7ZA 3L3JA 3WHE1 1WBYA 4FG6D 4NKDB 4PJFA 3SN6N 1CGSH 3L6FB 1DVFB 3VXSB 5TQ2L 5IWLA 5T1LA 3VXUA 4JAMB 3IRZA 5E56A 3ULVL 1MCRA 1A8JH 2ZKHH 4LLWA 5KJRH 4NT6B 4X98B 1H8SA 5MENA 3QDJB 4WNQA 3VXPB 4M8QA 1BX2A 5ESVA 5KS9E 1BVKB 2IBGA 5IVZA 3RWFB 3IDMA 3C09C 2DQJL 5CHNB 1M1SA 4KQ4L 3X3FL 3TVMD 1Y6NR 3OJDA 5DA0B 2XQBL 5D1XC 4ZUTA 5I8CB 1U6AL 5CAYB 4M5YL 3NA9H 1JK8B 2J8HA 1LE5A 4Y1AB 3MBEA 4FFYL 1PLGL 5EH1A 4Z78A 4AENA 5LXGH 4JO4H 2X6MA 3ARBC 1N3NA 4Z7QE 1Q8MA 5GS1C 2YK1L 1OSPL 5EN2B 3MLYL 3MACL 3TYGH 1A9EA 1CXHA 3WNPA 3ZKQD 3S3PA 2W0PA 3W11D 5KSAA 1WFTA 5GGUB 4NQXB 1ZLWH 1T1YA 4ELMA 3PABA 4CADB 5HYJD 2EH7L 3CK0H 1P1ZB 2AVGA 3MV7A 5JOFA 3VW3H 5EPMA 4XNQB 1RUQH 4FQHA 4ODUB 4WGVB 1SY6L 1ZLUK 1BIHA 2NX5D 2ZUSA 3C5SB 3UZEA 1U9KA 1YN6A 5JO5A 4D0DA 3C6LD 4JCMA 5CEYB 2GITB 3PQYD 4JDZA 3IFLH 4PR5A 1NH6A 1ZA3A 3PDOA 4Y0GA 5I9QC 4N0FA 3FTGB 4N90E 1XF4A 5IR1B 4LCIL 2E3VA 4RA3A 4WO4C 1OP3K 4NFCA 2YSSB 3BWUC 5L2KB 4NGHL 3QFJA 2E7CA 4ONHB 3AU1B 3VFNA 3BSZL 4OZHB 4R6UA 1M05A 2HT3D 4YHMH 3P4NB 4LPUA 2GTWB 5FEBA 1YEHH 5CGMA 4D2NA 2VXUL 4WHTA 2NY6B 5I15H 2VLLB 4LEOB 4WU5B 2EZ0C 1U91B 4LSSL 4B5EA 1KGCE 3FQNA 3PGCB 3SDAB 4OF8A 5FO7B 4XNYH 5L7XH 4IRJC 5F8QC 4JFFA 3M1BB 4Z7UF 4K7FB 1IEBB 4JE4B 1LP9B 4H88H 3PWVB 2CSPA 1O7VA 1HWHB 3BZDA 5KSUA 2Q8AL 1QR4A 1RZ8A 5GSRB 3REVA 2BSED 1JHTB 1UYWL 2BSSA 2DLIA 4BYHA 1HILB 3TESA 4PBVC 4RFOH 1KT2A 1U8IA 4JKPH 4Y5XB 1RK0B 2P24A 1LNUB 3M45A 1NCDH 1U58B 3TNNA 5F3HA 2JJSA 3B9EA 3QXWA 5DEGA 3FHAA 1FL3B 4M1CD 2PTUA 3L95B 4JFHD 2BY1A 4NBXB 4I3RL 4DGIH 1BJ8A 2W0FB 3REWB 5F9JA 1R24B 5I71C 4ZNCD 1EEYA 4G9FE 3VWJB 4HSQA 5FDWA 3TH3T 1G1CA 3CJJA 3HZYA 5L2JA 4C57C 2JCCE 4HC1L 5EU6D 2GTZA 1T5XA 5D8JL 1G9MC 1XGUA 4Y2OA 5IVXB 3X3GL 4HXAL 1T0NB 1QSFA 3O4OC 3PL6A 2YWZA 1KB9K 5FHBH 5EO9A 5CEZD 4R2GC 4YDVA 1EV2E 4M7KL 4GG6A 2E8YA 1B0RA 2Y7QA 1OP9A 3L9RB 2PYFB 4TNVK 2SEBB 2Y9RT 2UWEB 2WBJB 2BY0A 4ZS7H 3GJFH 2HKHH 3L1OH 4AK1A 4JG1H 2BZDA 5FYLD 3CMOH 2R1XA 3QUZB 3DX8A 1T7YA 4TNWK 4JO2L 3SDXE 1IQDB 4KTDL 5I1AA 1JNJA 4R9HA 2Z8WC 3X13A 1KCUL 2CO6B 5I1EH 1EEQA 4X5WA 1U8MA 3C6SB 1VPOH 4QWWD 4MB3A 1IT9H 5D5ME 2YPLA 4TSAL 1RUMH 5JW4Q 1YMME 2ED9A 3IJHA 1RIHL 3VU2A 4Z5RA 4A2MA 2R2EA 1AQDB 2Y6SD 3NCCB 3VXNB 3IFNL 2CDGA 5CEZH 1CK0H 2ED8A 1MI5B 3TBYB 2OQJA 4NIKB 4V2BA 2EXWC 3QG6B 3I9GL 3T2QA 3WJJA 7FABH 4AIZA 3JZ7A 4NQDA 5D7IB 3LKOA 5C8JB 1T22B 4X9BA 3MOQA 4M7LL 4ZD3L 4LGPB 5GGRA 1WCQA 3MRNA 2GJZB 1SVCP 2DJSA 5AZEH 3HR6A 1ZVSA 4AT6A 4Y4KA 1JWMA 3IJSA 3ARGD 4FQIH 3T3ME 1VERA 4AQ1B 1G7LA 4POZC 1OAUL 4ZODA 3F6IA 1A1OA 1QQDA 4HQQH 1F3JA 4QOKB 4WFFE 1VFBB 5DHXB 3U30B 3RIFF 4XHQA 3VXSD 2PF6A 4CW1B 3WEXA 3ZKND 1UB5B 4F80A 4BUGA 4UT9H 3IDJB 5IV2B 4L5FH 5LGJB 5K59F 4OTXL 4XNXH 5KN5A 1P7QA 3QQ9C 2R9HC 3BT2L 2P45B 5IEKB 1NBYB 4MNGE 3DROB 1IAIH 1YMHB 4L1DA 5IFJB 4XH2A 3W82A 1DVFC 2GJ6E 4CU8A 1H5BB 1CFTA 1EA9C 3X11A 1JNNH 4L9DA 3RJQB 4NP4L 2BJMH 4WI2A 2LQRA 5HDOA 2YA1A 2OL3B 3KLDA 5INCB 3PP4L 2M2DA 2X4OA 2YEZB 4ZYKB 1N6QH 3HE7D 3R06B 4XBGB 5FKPB 4WCYL 4F57L 4OT1L 4Y1AD 5SV3A 3A67L 5EBLA 4XCFL 4HBCL 1AD9A 2RR3A 4PRNA 4PJBF 2A6IB 4PBWD 3KPPA 1INEH 4KUCF 4C59B 4ODXA 3MLTB 3BUYA 5DK0B 5CEXB 2X4TA 2YD9A 2FX7L 4CVZA 3SCMC 1R5VB 3TIEB 5DC0A 2E8ZA 2P48B 1G7PA 4I18C 1FE8H 2VLKA 3H0TA 4PJAB 3SQBA 1UVQB 4TPRH 1HEZA 1FVEA 4L3EE 1DBML 1TNMA 4P57B 1ADQA 2VLMD 4JDTL 4GRWE 3LEVH 3U4AA 1OSZB 5ID1B 1G7QB 4KK5C 4J3XA 5L6YL 4RNRB 1W8NA 4K3JL 5JXAL 2XKNA 3GIZH 1MWAA 1FSKB 1ZEAH 1KLGA 2FZ3B 5D6DC 2E5EA 5ALCL 1K2DA 4PV8B 3MJ8A 1A1MB 2R23A 3HI1A 2D7QA 3KPTA 3QO0B 4MXVF 4HS3A 3DVNB 4ORGA 4FA8A 2FNBA 1MCWM 2VNCA 3OAUH 2VL5A 4NQUA 5DT1L 2R0ZL 5HI5C 2HLAA 1KCLA 1QRKA 4EIGB 2H9GB 4APQB 5L2KD 4GRLA 2DQHL 1PGRB 2HN7A 5EOTA 2QR0B 3OR7A 2BX5A 4PJGA 4XMLL 1A3RH 4U1NB 1MY5A 4GS7B 5E8PA 5LQBH 1KJ3L 2NY6D 4OZGB 1PKQE 3CLFH 2BDNH 2QADB 4OZFA 3S36H 1RI8A 3B83A 4EOWL 1EBPA 1AO7A 2GFBB 2WUBL 3QIUA 1EHXA 1HOCB 5E8NA 2J88L 4AM0B 5T1DH 1CLOH 3BE1H 4JG0L 1RV6X 4HHAB 4MAYB 5A16A 1CD1B 1UH3A 5JQ6L 4P5TB 1KEGH 3G5ZB 2FH8A 3GM0A 4PRAA 4YDKL 4PJ7B 5CSBA 3SDAC 5BOPA 1TTFA 5ADPH 1D5MB 4U6VH 4Y19B 3SDCB 4X9GA 4P4KB 3QWOA 5SX5H 4O2CA 1P4BH 4HK3J 1J9CT 5ID0A 1OTTD 5J6HB 4ODHL 3HMXH 4HJ0D 4ZTOH 2QSCH 1I8LA 3TVMA 2P7TB 4JKMA 4NQEE 4D8PA 3D0VB 4K8RC 5E2TH 5E2WL 3WLWD 5DMGD 1DQTA 4YDLB 3AAZA 4GMSH 4WJ5A 1IGTA 4MJ6B 5E99H 2C3HA 4OBRA 4QLRA 4PLJC 4Y5YA 2QHLA 3AS0A 1MNUL 4QRPD 2X44D 3U0TB 4FNLH 5CILH 3H3BC 1HSAB 2Q7NA 4PTTA 5DJYA 3VWJC 5E2UL 5HYJA 1JYWA 4K8RH 3PV6B 4G3YL 1EJOH 4RSVA 3TPKA 4E42B 5HDQL 3LDBB 1CXEA 3MLVH 2Z91B 4PRBB 2PR4L 4NCC2 2QSTA 3RNQA 4CN1A 3QNYB 1BFVL 2NX5A 1FFNA 2VMFA 4GO6B 1LDPH 4MNHA 5BO1H 1IGFH 2GY5A 1BLNB 25C8L 3C6LA 3QUZD 1CBVL 1HQ4B 2OZ4H 5DS8A 2YRPA 5HGBA 4U1SA 1F4XH 1WBXB 4JFDE 4I9WE 4GW4A 5D1ZB 2BRQA 2BFVL 2XV6B 3QDHA 5BV7B 1JTTA 3SDDB 3VWKA 3CU1A 1J05B 2WIMA 4PGJA 3MJ6A 3QRFM 3EYVA 5EZLA 1ZLSL 3RVUC 4MA1B 5AG9A 2G75B 2FJHB 1MI5D 2P5EB 5AD0A 4OF3A 5C1MB 2OM5A 3IFPB 4OIBA 3ZYJA 3HG1D 1TETL 1N4XL 1RULL 3UAJC 2LTQB 1C12B 1ACYL 4JY6A 1UQSB 5CBAA 1J0IA 3WFDH 1DN0A 2F58L 1MIEL 1QG3A 5C71A 1JGDB 1F42A 2IALB 3ZHKA 2PO6D 5DD5L 2B5IB 3UJJL 5JOEA 3TV3L 3VXQA 1ITBB 1RZ7H 1AJ7H 4UUJA 3TBTA 5JHLL 2VZVA 3AVEA 3ROOB 1S3KH 1ZS8B 2A9NH 2DBLH 5DJ8A 3QXDA 1RZGA 3SGEI 1JZ3A 2A9MH 4S1RL 2I9LA 1QO3B 4WU7B 2CKNA 1PBYA 2BVEA 2X4RB 3GMOA 4G8GE 4H0IA 1C5DB 4JFEE 1N5AB 3DMMB 1AE6H 2DMBA 3GBLA 5IJVB 3OKLA 3SQOL 3LD8C 4M5ZH 2DTML 4K9EH 1WZMA 2AK1H 3BP5A 3FT2A 2HH0L 1NCAL 2YKLH 1B0WA 5HHNA 1U8QB 3HUJF 1WSST 2Z35A 3FQWA 5D7JD 3WFCH 4ELKA 1KJ2L 4OIIH 1HQRB 5EU6A 5IF0B 5KVGL 5GRJH 3V5KA 3DNKA 3OL2A 4G6AD 2BVOA 4NDMA 3GNML 4XX1E 2Y72A 4YXLH 4OKVA 4OZ4B 1FFPB 1U93A 4YIQB 1RZFH 4MXWL 2P49B 4XXCC 5F1IB 1P84K 3N85L 1JWUA 2C3XA 4OQTL 3RWCB 3I6LE 5HBBA 3QI9B 2H2SD 2C4FU 2GK0A 5HD8C 2XA8H 4WUUE 1CTNA 3IF1A 4UV7L 3ARFB 3S97C 1CDGA 2G5BB 2OL3H 1KLUA 5GGTA 1OGAB 4TOYH 1KTLA 1DCLA 4F7CA 3SOBL 1HZHH 3SDYL 1QOKA 1PFCA 5JPMA 4U1IA 4ZUVB 5TGBA 3CFKB 1IGIL 3TIDA 3F7QA 4Z0BH 4L9LB 4UI2A 3L3OB 4ONGL 5GGSB 4FXKA 1JVKA 2NXYC 1BJ1H 5FA3B 4W70A 1JUFB 2F19H 5HGAB 3PGDA 5GGRY 1U8NB 4UDTA 4WI7A 1HHJB 4G7VL 2J7LA 5BS0B 5CD3A 1P7KA 4ZXBC 3VDAA 4PJXB 4APQC 4ZUSB 3QCTH 3T65A 1DBAL 1ROWA 3L3IA 1WFOA 4QEGA 1JNLH 3MPCA 3MLWL 2QADD 4ZFFA 4EI5C 5ERWA 1MIML 1F3RB 3BEVA 2QJDA 4LLYB 4JM2C 4XP5H 1PG7L 3RVTC 4W81A 3HCVB 2D31A 2L7JA 2XY1A 3GO1H 3ARGA 4MAYD 3IETB 1JZ7A 3MRPB 2FD6L 1ZVYA 3ZDXE 4TUJB 3LKRB 2J8UB 1CGWA 4WW2A 4LPTA 2DQTL 3FRPA 3H42L 5IK3B 3VXSA 1VKXB 4JAMA 4EUPH 1EJ6A 1HH6A 4NT6A 5EO1B 4Y19D 3SDCD 4NZUH 5SWZD 3VXPA 1GAFL 1I9EA 4N8CL 4P4KD 1I9IH 3IDXL 1LWRA 3E3QC 3DV4A 5CHNA 4LKXB 2B1AH 2BSTB 4POUB 5I16B 1YEGL 2PNDA 3BPLC 4HUKB 3K80A 1EIBA 3HE7A 4NHCH 3VXOB 2D3VA 1T03H 1JK8A 1W0WB 1Z3GH 4Y1AA 1IQWL 4ODWB 3QHZL 3PWPE 5HHXL 3HZMB 5IBTH 2JJTA 2YD8A 4ZFGH 1MCHA 4MJIB 2P44B 4U6HB 3U1SH 1VEPA 5C0BB 1X5XA 1JZ8A 3MRJB 4P3WA 4OCNC 3GHEH 2NR6C 4M7ZB 3NTCL 2B0SL 3JWOL 5GGUA 2E27L 4OCLC 1FL6B 3MXVL 1YEDA 4CADA 2ZCLH 3U9PH 3DJ9A 3WBDA 5E95B 2IPKB 4N5UA 1NGQL 4XNQA 5BVPL 3DX7B 5ICZB 4FQ2H 2VISA 3MRFB 3HAEB 4DKAA 3O3EB 3ARDC 5EG6C 3RPIB 4FZ8L 3UXFA 2EO1A 4P2YA 2ERJB 3G5XB 2GITA 3T4AB 1KB9J 5LGKA 1B4RA 3CX5K 3R8BB 3RVWD 1ZVHA 5IR1A 1G0DA 4LDEB 4ISVA 2A6JB 1YDPB 4MJ4A 5T33H 5D1ZD 1LEGB 5I0DA 5I1JL 4YAQA 2YSSA 4NO2B 3D87B 5B39G 1ZHKB 3EGSB 3DYPA 3AU1A 2ZCHL 5FYKD 1GSMA 6FABL 5F96H 2C1OA 4XI5D 4M8VA 5DMKB 3UYOD 2AEQH 5JOPD 5I8EB 1NGYB 2GTWA 5BV7C 3SDDC 3AREB 1RU9H 2NW2B 4DZ8B 1U8HA 4TQEH 1DL7L 2FGWL 1U91A 4KK6C 2DQUL 4HGWB 3TZVB 1AR1D 2LU4A 1IKFH 3ZL4L 4J3SA 2XZZA 4CDHA 4XRCB 4K7FA 1IEBA 3BQUC 3VFGL 4D9LL 2ITDB 1SJHB 4LLUA 1DJSA 2YPVH 3V6ZB 3G5VB 1CDYA 2Z31B 4CNIA 4PJ8B 2FL5A 4PGBA 2KUTA 4MCYB 4KZDH 2X9WA 5BV7H 2X1QA 3KYNB 3NZHL 4HF5L 3GKWL 5F88A 2Q76A 3MJ9A 3PJSA 1GGUA 1HILA 3QWQB 3LS5H 4TVPD 3DXAB 4P9HL 4G6KL 4Y5XA 1RK0A 5JW4N 5FUZL 3RY6C 5EUOA 4P46B 1WFNA 3X12A 4BZ1H 3EZ8A 3MTRA 5C6TH 1FL3A 2F5AH 5E08H 4LVHC 3HR5A 3VFSA 1HKLH 3CUPB 1BZ9B 1KC5H 2ZSWB 1R3HA 2P8MB 1P9MC 2W0FA 3EKCA 5FGSA 2D03L 3HFML 3O3DB 4WHDA 1BWWA 4QRPA 5FOJA 3BKCH 2VDRH 2DLHA 3OB0K 5B8CB 2AV1B 4XWOC 5IVXA 1A6TB 4GKNB 1HYSD 3PHOA 1IM3B 3Q6GH 4ZNEA 2EH8H 4LOUC 4DOHE 3UTQA 1PG7W 2CIKB 1KB5A 3RNKB 3L9RA 2PYFA 3GEWB 4Z7WE 3RWEB 2SEBA 3VH8B 4TVPH 3KR3L 2UWEA 2A38A 2VZOA 3FN9A 4LGSB 2J2ZA 5I8OL 4QHKJ 4LSPL 3T1WA 4KFZC 3O3AA 3MV8B 1QSEE 5C07B 1KELH 3QUZA 3DX6B 1G9NC 3V6OA 1YPZE 2J6EL 3ARFD 1CYGA 4YHNB 1OAYH 1OGAD 1J1OL 4WHYH 1KCVH 3C6SA 4JFQB 1S8DB 3QRGH 5EUKA 1OB1B 3ZYIA 1AQKH 4UDUB 4OF5A 3QI9C 4FQ1H 3G6JB 3R1GL 4EN3B 4OGAD 1I75A 4CUCA 4QGTA 4IRSB 5B39A 1ZSDA 4PGEB 5D71H 2PYEB 4S10A 1FNEA 1S7UA 5ACZB 4RMVA 4QO1A 4KRPB 3E6FA 5BJTA 1AQDA 2JB5H 3S37X 5DC4B 1M6OB 1G9NH 1MI5A 3TBYA 1TQBB 4M61B 3QG6A 5BS0D 4HCRL 1YMMB 3HG1A 5D7IA 3JV4B 3VGGA 3ZDYF 1T22A 4YXHH 2YBRA 3ULVC 2BC4A 2V6HA 4NFDA 1NFDA 4N0RA 3QJFA 1MCQA 2WIIB 2YD6A 2Z93B 4MA3B 3B5HA 1OAQH 2PO6A 1P4LB 5FF6A 3LEXA 4WENB 1ORQB 4HIHB 1MJJA 1TTUA 1ACZA 4IMKA 1U36A 4GSDH 1S9VA 5GRUH 3NIGF 5T3ZD 1KLFA 4OFYD 3ULSB 1FFRA 1L6ZA 1K4CB 2YZ1A 3DRTA 5IV2A 4KKAC 3DIFA 4KMTH 1TJHH 5LGJA 3ULUE 3WSQH 3ULVH 4AIXA 4LASL 5IEKA 3SO3C 3DROA 1YMHA 5IFJA 4P2OD 3QAZB 4HIJB 2ZNWA 3KHOA 4XZUA 4J6RL 1H5BA 3WL9B 1YC7A 2MQCA 4I3SH 1BWMA 2X9YA 2OSLA 3X14B 4OCSL 4MD4B 4HS8H 2VXVH 5E8DH 5AEAA 3T0EC 1K8IA 3R06A 2BY3A 4XBGA 3L5WA 1CICC 2DIBA 5D7JA 4X6DE 5MERA 3J7HA 4ODTH 2QBWA 5KSBA 2EIEA 2A6IA 4NZTH 2BMKB 5C0JA 3W0WE 5IFHH 5C0BD 5CEXA 4LVNB 1LEKA 3PWNB 5KBNC 3TIEA 3MLYH 4OAWB 4N8VB 1YEJL 4F7PB 1UB6B 3B43A 4LP4A 5GZND 4UOJA 4PJAA 3QB7C 1ZGLB 4G80B 4RWYH 1R3LB 5I1IH 3ULVE 2AEPH 3ARXA 4P57A 3V7MA 2CDEA 3GJEA 5CZVH 1V7ML 2IQAB 1CFNB 1OSZA 2RFXB 5ID1A 3LS4L 1G7QA 4RNRA 4PUBL 2DL9A 2OMBA 3NPSB 3CVHB 1GXEA 2QQNH 4L3EB 1MCBA 1NAML 1HH9A 1X5KA 3I3EA 4PV8A 3ZE0E 1MREL 4GRWB 5CSZA 3QO0A 1CIDA 4MDIB 3DVNA 4LF3B 1Q72H 3TEUA 2XKSA 3TFKD 4K3EL 2YA0A 2GT9B 3FB8B 4EDWH 3QCUH 5F72S 2H1PH 1JMZA 3G04B 4WEMB 3K1DA 4ZSOE 2FLRT 2AJXL 4P59H 4N90D 1F4WL 1OAKH 3QIBB 5D6CA 4OM0L 2IPUG 3QPQD 3FT3A 4MCZB 4M9PA 3T0EE 2GAZB 3P77B 3ARWA 4F15B 4U1NA 3CFJB 1B0GB 4R90L 5CMAB 4J3WA 3EHBD 5GJSL 1C16A 4LNRB 4OFVA 1OY3B 2VC2L 2UUDH 3U6RB 2GFBA 4PLNC 3TYFA 4YO0B 4I4WB 3ZZ1A 1IAKB 5SWQA 4AM0A 4MAYA 4FS0A 3VXTB 3MRCA 1AD0A 4HJGB 3BPOB 5IOPB 4KROB 2Z31D 1AC6A 4PJ8D 4F7MB 4HKBB 4MJ2A 4PJ7A 3TT3H 3SBWC 4EI6A 1JF1A 1D5MA 1DQDH 3EFDH 4Y19A 1AP2B 3SDCA 1RUAL 4OCWL 3HI6H 5DUMH 4NKQB 5SWZA 1A7NL 2O5ZH 5IBUB 1F90L 1XGQA 4EVNB 3HS0B 5J6HA 1TITA 4N0UE 4HJJL 2O93L 2Z92B 2P7TA 3DRQB 3T2NH 4AJ0A 1WWAX 3D0VA 4NKIL 1YNKH 2AKRB 2MMXA 2AXJA 3M17B 4P46C 2UVEA 4G43B 4KPHL 4PP1D 5DVNA 2IPTL 4F2MB 5TE4H 1W72L 3MZGB 4ZUWB 1BFTA 5FOBB 4GKOA 2KL6A 2AABL 4H5SA 1HSAA 4NPYB 3UJTL 1XF5B 1MJ7H 1YC8A 2DWEB 4KVNL 3PV6A 4QTIH 3BN3B 5D9SB 3RVVD 4HAGA 3QQ3B 2E6PA 2I26N 5DDHA 2Y1VA 3P0VH 3QNYA 4M9OA 2WUCH 5DZLA 4U3HA 1ZLUH 5EU3B 4PGCB 1BLNA 1KBGH 4FQLL 2Z4QA 1DUZB 4JDVA 1HQ4A 4U7KA 4BKLA 3HNTH 4J7RA 4KTDH 4D3CH 3D39E 5JORB 3QBTB 1WBXA 2A73B 5EC2A 1SYSA 1UM4L 2DM3A 3F8UB 3IKKA 3QUXB 5D1ZA 1NCWH 1U0QA 1P84J 2OJZL 5C0FB 1OP3H 1CE1L 5FXCH 4S0SD 4E41E 1GIGL 3QUMH 4XP6L 3FB5B 1CD8A 4OSUH 4M6MH 5FAAA 4NJ9L 5F7UA 4KRPD 1S9XA 1RJLB 2X7LA 4JZOB 2G75A 2FJHA 3VD9A 2F8VA 2AI0H 2J4WL 4EN3C 4H20L 1SEQH 1YMMD 1IGCL 4IRSC 4NZRH 1KXQE 1I9RL 3DO3A 4JKLA 4PJHE 4U31A 1W0YT 3E8UL 4FQXD 3EOAB 1RQ5A 1IL1B 2OR8A 5IW6A 4YHZH 1UQSA 2EDNA 1EMTH 5T3XL 1BFOB 1WIUA 3MA9H 4BQBA 4YR6A 3EJYD 3SGJA 4FHBD 4XPTL 5E1HB 1OAUH 2H26A 4DKEH 2FJGB 4OLYL 4UOW1 4CAGA 2ZWLT 1BREA 1HIMH 4UQ2B 4KKBD 2V5SA 5L88L 3ZDZF 1ZK9A 4UTAH 3STBA 5LGHL 4M1GH 3VFPB 1QO3A 5KAQF 4WU7A 3WFEH 4WFFD 2I24N 3G5YB 2ADFH 2V2WB 1C5DA 4HLJA 5KANI 2G60L 4E5XB 4O58L 3JBG7 1EH9A 5IJVA 4ZFOB 1V3MA 3S5LB 3GFUA 2ATKB 3RGVC 5HVGB 3D48R 4YFDB 4NNPH 4LCWE 5JIHA 3SY0B 3QHFL 3NABH 5IW1B 5C08B 3BP7A 1U8QA 1WK0A 3MRDA 4WCYH 4O2EB 1FC1A 4F57H 3QAZC 4PLKC 3CC5B 1HQRA 2HP4A 1C1EL 4XCFH 4M43H 1FGVH 2VDML 1MUJB 5IF0A 1BD2A 3GBML 1JV5B 4UU9A 1A6WH 3F62A 4C83B 1FG2A 4QHNB 1DLHA 1LO4L 1I9JH 5IMOA 4DGVH 1JCKA 4HS6B 4C56E 1S9WA 1D5BB 4QHMB 3WO4C 4OZ4A 2PXYC 4YIQA 4Z7OF 2B4CL 1IEAB 3D69B 5CS7A 5F1IA 5C2BL 1TVBA 4QCIB 2GK2A 5KVFH 4YPGB 2E9JA 4JJHA 3RWCA 4KI5F 2IH1B 1CVRA 2JK5B 4G5ZL 1IC4L 4K3JH 4L3ED 3S7GA 3WUWB 5JR1L 2EECA 1TENA 3ARFA 2QQLH 4JRXB 1RJYA 5F3BA 1OGAA 4UIKL 3KYAA 5GS0L 4OD3H 3D3VE 4XWGH 3O2VL 5D70H 4ZUVA 3K46A 2R0LL 4UBDD 1LO2L 4ONFL 1Q9LA 2FBJL 5TDOB 2ZUWA 4HX1B 5DT1H 1IRAY 4JRYE 4CVWA 5C6WH 2CKBL 2AJVL 1E4KC 3L3OA 3WCYA 5GGSA 2EDQA 4JFPB 1NCCH 4WUKL 3OKYA 1OD9A 2W65B 4TUOA 3VXMB 3EFFA 1JUFA 1ZT4B 1OARL 4LPXA 5HGAA 2R69L 1E6JL 4OLVL 1U8NA 2I9TA 4I5BB 1JZ4A 1H3PL 1HHJA 1C5BL 1OLLA 2R56H 2IH3B 5BS0A 3DECA 3ILQD 3G08B 3CX5J 1NDMB 2WQRA 4W6WB 4F7EA 1L4IA 3I50H 2I60L 3IXTB 3MZTA 4LLYA 2XYCA 3QIBC 3RIFK 3TA3C 5FUCC 5F9OL 5FYJL 2WUBH 5DQDL 3SKOB 3NCYP 3NPZB 1I8KA 1I3UA 3MRPA 1KIPB 1OAXH 2J8UA 2XG5A 4Y4FB 2WZPD 3EOTL 5IK3A 1FIGH 4L8SC 1EGJA 4HDIB 4OFYA 1VKXA 1UWEL 1K8DB 1L7TL 3CPLB 2UYLB 3WD5H 3S6CA 4XC1H 1QTYT 1AKJB 1IBGH 2DM7A 4NNYA 4DTGH 5F21B 4RISH 1GGCL 4P2OA 1TJIH 3BZ4B 5TDNB 1HHHB 3RVXD 5FFLA 2BNUA 4L3CB 4LKXA 2BSTA 2XN9B 3DI3B 1YEEL 3BRDA 2OI9B 4QHUB 3F5WB 1DFBH 1MEXL 1QNZL 1O7SA 5JHDB 4KK8D 1W0WA 2A74B 4LIQH 2EDXA 1MCNA 1E6OL 3HZMA 3I6GB 1LEIB 2J1KA 1MF2L 5TE7L 3ZT6A 4N0YH 3O11B 3LZFH 5ALBH 5B4MD 3BD3A 5C0BA 1QRNB 3MNVB 3KG5A 3WIFB 2EDEA 4QRRE 3BHBB 4AYFA 1YEKL 3IDIB 5FDYA 2FO4B 1FL6A 3RL2A 4YEFA 4HWZB 5T1KB 5EU4A 1X7QA 2IPKA 1J0YA 4Z0XA 3BZFB 3JWDL 1JGUL 3VFMB 3DX7A 5ICZA 5FUCE 2M8XA 3IFOB 2D7TH 2ITCB 3HAEA 3DURA 1JIBA 5J1SC 2VDOL 2XRAL 3O2DA 3O3EA 2DQEL 4AH2A 3IYLW 1QHPA 1DZBA 3MNWB 4Q9BA 5C0DB 3FO9B 1NCTA 1FVCB 3IS1X 5IG7B 3ARUA 3LQZB 4G7YL 2R2BB 4LIQE 4YEEA 1CDBA 5MEOB 5DMIH 3ME0A 4N0CD 3L3HB 2A6JA 4QT5B 5JW5A 2DDQL 2OR7A 3RJDA 5GISL 2AEIT 4LPVA 3EYQC 3VFVB 2FSEA 1ZHKA 3NN8B 4N9OB 4MJ5B 4EXKA 3V0VB 1V3KA 4JFDD 2V9RA 3K8LA 5DMKA 1R3JB 4I9WD 4WFEE 1TFHA 5EOCL 3DSNA 4A6YL 4X7FC 2DQGL 1NFKA 3H3KA 1Q94B 3QUXC 1NGYA 1XR9B 3TJEH 3NACH 4R7DB 3WFBH 2NW2A 4MDJB 4DZ8A 1R3IL 5BRZE 3HHRB 2A6DB 3IB4A 5MEPA 2ATPA 4D0BB 1CL7L 1JPTL 3CH8A 4MXQD 5D1XA 4PJ9C 4HGWA 4YHKL 4DN4H 2IAMB 4NM4L 2XQYG 4GAGH 1I1RA 4XRCA 4HT1H 1A6ZB 4JHZA 2F58H 1SJHA 3V0WH 4HLZG 3V6ZA 3G5VA 2DYPB 2Z31A 4PTUA 3UJJH 5E4EC 4PJ8A 1OCWH 2CLVB 4MXVE 4MCYA 5HYEA 3Q6FB 4DEPB 4XP9L 5H35B 3TCLB 2NXZC 2AQ2A 3KPSE 1AGEB 1B4JL 4AEIH 5HDLA 3LPFA 4ZAKD 4JREB 1D5ZB 2FATH 3BOVA 5GHWH 3TLRA 3I6KB 5E00A 3HE6D 3H9YA 4B53A 3TO4B 2BNRB 2NNAB 2LU7A 4G8GD 4JFED 1KCSL 3DSFL 2P8MA 4NFBA 2MQ0A 3ZKXB 5HGDB 3O3DA 4FFZH 1H15A 2E7LA 4IIQC 4LMQI 5ADOL 5HHQB 1QUNA 2Q8BH 4FABL 2PCPB 5B8CA 2AV1A 1FPTL 1A6TA 4GKNA 1MPAL 3MRQB 4N8VG 2CQVA 4N9GB 1PJ9A 4X7TA 4OD1L 1T0MA 4O5LL 4PJCB 3R8QA 4G9FA 5CBEB 4YBHA 35C8L 5I19L 1AXTL 2ID5A 1OQOA 4R0LC 2JCCA 3FFCE 1YN7B 3VH8A 2RIKA 1K6QH 4HEPG 3O0RL 1ZWIB 3U0WL 1ZHLB 3UTSB 3BJLA 3SGEH 3N85H 1FNGA 4U4BA 2BVYA 5KS9F 4MNQB 2OK0L 2R29H 2XZAL 2LU3A 1KCRL 5FO9B 3DX6A 3NFNB 5JTWA 4YNYB 4L8CA 4F37F 2XOTA 4P5KB 3KLAB 2DQCH 2H8PA 4JRXD 1U8KA 1YYLH 5HXMA 2AGJL 3D6GA 1I1YA 2DQFB 2H3NB 4NWUL 5IEHB 3MCKB 3S37H 4JFQA 4LCUB 1OB1A 1P2CA 4UDUA 4BFIB 4CN6A 3SDXA 1OWRM 1JN6B 4IBLT 3WXWL 3HLAA 4PGEA 4RFNB 5ISZB 3L3GB 5H37H 4M1DL 4DKFH 2GUOA 3RHWK 2X4NA 3HNSL 1UA6L 3FAXA 5D5MA 1QKZL 1UACH 1N6UA 2W9EL 4M61A 4YBQD 1DE4A 3VGAB 3SE8H 1YMMA 3GHBL 5TQ0L 5GRWA 3GRWA 2V7NA 4OCYH 4FQXA 4LQFH 4MA7H 2FLBT 2MPAH 1EZVX 4FZEL 1MIMH 4L29A 2WIIA 4RMSA 2Z93A 1J7VR 1P4LA 2FWOB 5D7KE 3BAEH 1ERNA 2JJVA 3ZHDA 4Y4FD 1UJ3B 1M71B 3P0YL 2VR4A 3MBXH 5DD1H 32C2B 1KACB 2DQTH 2RHEA 4PJEB 3ULSA 1RSFA 4JHBA 2HRPH 1K4CA 3WYRA 1RMFH 4GAYA 4UT7L 1A47A 1AKJD 3EYOB 4S11A 5BZWB 1U42A 4KVCL 3UPRB 3MFFB 4HIJA 3ES6B 3I2CL 2MNUA 1TDQA 5EOQH 2XN9D 5I76B 3JWOC 3R0NA 5J7CC 3O6FB 3K2UL 3SKJL 4MNGA 3MRRA 3MV9E 1CDUA 3EYFB 3OXSB 4OV6F 1FCGA 1IQWH 3FB6B 4YUEL 3UZVB 1XF1A 4Y2DC 2BMKA 3SPVB 3VXRE 1S5IL 4L4TB 1GOHA 3QDMB 3PWNA 2WSKA 3G9AB 5EZOL 5EO0A 4N8VA 3QPXH 4F7PA 4IJ3B 2BNQB 3QZWG 2UVFA 4Q6YA 2HMIC 4PYHA 1UZ6F 3QXUA 4XXDB 4KKLD 3GSXA 2ICES 1KFAL 4I2XB 1CFNA 2IQAA 2HLFC 2RFXA 2HT2C 2X1OA 4U33A 5IB1B 1YEFL 2F54B 5BVPH 1F6AB 5IT2L 4MAUH 3CVHA 2CJUL 3AY4C 3OV6A 4L3EA 3GIVB 4YGAB 4NJAH 4V1DE 5I1HL 1Z2KA 2BVPB 2GKIA 4MQTB 3RA7H 4EZMA 1F4AA 5CJQL 2CRIA 4LF3A 5A2JH 3HTLX 2OP4L 1NBVH 1K5NA 4F3FA 5ANME 3I3DA 3TBVA 1NJ9B 2HKFH 3G04A 1MJ8L 3HUJE 2G5RA 3UBXB 4PS4L 4LFHD 2VN7A 2ZOKB 3ZTNL 3JTSB 3S3SA 5HHME 1MHPH 3UYRH 2AXFA 1V3LA 5IHBA 1CGSL 4DUWA 2VLJB 1NC2B 4ZSOB 1NLDH 1AHWB 5F89B 1RIVH 5C0AB 4LNRA 2ZKHL 2F53E 5KJRL 3V8CA 5DJ0B 4XVUD 5F7LB 1D6EA 1UM5H 4YO0A 4I4WA 4P9HC 1JE6A 4P3DB 1IAKA 4PJIB 3V5DA 2VDPH 3ZMRA 4KJWD 3WHE0 3LH2H 1JL8A 3E6HB 4HJGA 3ZKMC 2DYPD 5IOPA 5D2NC 4J3UA 1X44A 1JHLH 2VWEC 3ZLQC 2YUVA 4FTVE 4F7TB 1OW0A 5SWSB 2APWA 4U3CA 1ZMYA 5J56B 2IAMC 2NR6D 3NA9L 2KQMA 3VD3A 4Y88A 4KHTH 3RUGB 4QF1A 1JWSA 5LXGL 4JO4L 5HVHC 3DHJA 3MJGX 3MLRH 1E4XH 1YJDC 3I85A 2N1KA 4NCDA 5DJCA 1EVTC 1EUUA 3L7FB 4WDIB 1KG0A 1WICA 3H7BA 2JB6B 3P73B 5D6DA 4LSTH 4XPAH 1CIUA 3PWLA 1QA9B 3CK0L 4P23C 3V5HB 3VW3L 4O2FA 1TVHB 3RPKA 1RUQL 1A3QA 3SJVE 5ICXB 2UZYB 2NY5H 3M17A 5CD5C 5JPNB 4OLXL 2P8LB 5I1DA 4G43A 2VIRB 2B7DT 3ALPA 3T3MF 1R5WB 4F2MA 1YJDH 4NN5B 3IFLL 1I1AC 2QEJA 1CR9H 3JWNC 1XF5A 3P11L 1WF5A 3OXRB 3KDMB 1CZ8H 4XMKH 3MJ7B 4OZIF 5HYSB 3WS3B 1Z0MA 2LVEA 2RQ8A 5TDPA 4XX1G 1FO0A 4JQXA 5E4IA 1A02N 4RMRA 4AG4H 5TJWK 5I1CH 4MNQD 3CLEH 4PGCA 5D2NE 1X5FA 2VWEE 5T5NG 1NCUA 4YHML 1JGLH 2Q86A 2XTJC 5D96C 1S7RB 3MRHA 5DA4A 1YEHL 2F9BT 5E5UB 1BQUA 1SQ2N 3MRGB 1QSED 5I15L 4P49A 4FMKA 1A7RH 4OGYH 4HZAA 4RAVB 2ZCKH 3O8XD 4UZGA 3FB5A 4XNYL 5ISZD 5L7XL 5EC1B 1MCOH 4JFDA 1RK1B 4F9PA 4AQOA 4H88L 1F4HA 1F2XK 2X10A 4JZOA 5C09B 2DMKA 3BPCB 1A7PH 1KNOB 3NCBB 3IAPA 3GI8H 4NWTH 2NY2B 4M93C 4Q6IA 3EOAA 3BW9B 4GH7B 4HZLB 2FB4L 1MFEH 4J1UB 4HPOH 4RFOL 5CP7B 3G6AA 4JKPL 3B9KB 5D93B 4JPVH 1NCDL 1IKNC 1ZT1A 2VQ1A 3VGAC 2XPGB 1CLYH 4X99B 5A3ID 1AIFB 5GIRB 1N26A 2R0WH 1NUGA 4DGIL 1WAAF 5CJ5A 5DK2B 4JN1H 1H3WM 1HDMB 3MLZH 4H0HB 4MGXA 4NQVA 3VFPA 1G7MB 4O02H 4Y5VB 2V2WA 4E5XA 4ZAKA 2XTJE 2YD5A 1VENA 3ESVF 4OV5B 1PQZB 1Y6MR 5FHBL 3S5LA 1DTUA 5FIEA 1XR8B 3H8NA 3EOYG 3LN5A 3ULUD 4KZEH 3HE6A 4ENED 4KMLB 2P8PA 3O6FD 1NAKH 3LAFA 4WWKC 5IW1A 4G8GA 4JFEA 3GMQB 1TPXC 4JY4B 5FM4A 4BQ8A 2R1YB 4IEFB 4O2EA 4QRUA 4ZS7L 1W8OA 5DQJB 1ZV5A 2VKXA 2HKHL 1FYTB 3L1OL 3WFHB 4JG1L 1N0LA 1MUJA 5KW9H 1YUHB 3CMOL 4K7PX 4L4TD 3RIAF 4XPBH 3OB0H 4GUPA 5K9OB 1BM3H 4MA8H 3QYCA 2BNQD 4QHMA 3RTQC 3CDCA 4Q2ZB 2VQTA 5I1EL 1Q0YH 5HI3D 1IEAA 3D69A 3AMLA 1WJ3A 2C26A 5D1QC 4CBPA 2PW2B 4HG4K 1RURH 3W0WD 2IADB 3FCTA 4Y16C 2FEEI 1IT9L 4YPGA 1OT2A 3ORJA 1J0JA 4WY7H 4EUPG 3ARRA 5C0GB 1JZ6A 4OD2B 4Z7UB 3UTTE 1RUML 1XGYH 4IMLB 4YHLH 4GW1