4HHWA

Crystal structure of the pseudomonas aeruginosa azurin, h124no yoh122
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
127
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNFVLSTAADMQGVVTDGMASGLDKDFLKPDDSRVIAQTKLIGSGEKDSVTFDVSKLKEGEQFMFFCTFPGHSALMGHLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Electron Flow through Nitrotyrosinate in Pseudomonas aeruginosa Azurin.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 34
structure length 127
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4hhwA00
1BXAA 4KOBA 3PXLA 1X9RA 4W9ZA 2AVFA 1R1CA 2IDFA 1JXGA 2CAKA 2YXVA 1JXDA 5TK2A 1KCWA 4EF3A 1E30A 1M57B 1JZIA 3T6VA 1SFHA 1M56B 4N8UA 3TBCA 5I5MA 2R7EB 3D12B 1PZAA 1N70A 3NJKA 1ZV2A 2VSMB 1ZIAA 3FSAA 1OF0A 1AG0A 5I6PA 2XV3A 3MX0B 1AQ8A 3GYRA 3ZBMA 1X9UA 3NJLA 2X87A 1WA1X 4F7KA 1BYOA 3PLYA 4G7QB 1HAWA 2Q5BA 2AZAA 4DPAX 2XWZA 1EHKB 1OCRB 2I85A 2AFNA 2VW7A 5D4JA 2YAHA 3TU6A 1KGYE 3UAAA 2XXFA 1GYCA 2A3TA 2J56A 1ETJA 2H47C 4DP9X 4E9VA 3UADA 1AANA 1RZPA 4YSPA 1BEXA 4M4RB 2I7SA 2LLNA 1V55B 1E65A 3CG8A 5B7FA 1IBYA 2UXGA 4FAAB 1AIZA 2IWFA 1GW0A 2IDTA 2EIJB 3TA4D 3AG3B 1AZCA 2XX0A 1M9WA 2OCCB 8PAZA 1PY0A 1J9TA 4A2HA 2PPCA 1V54B 1WS7A 1ET7A 4DP0X 2QPDB 1ZPUA 4DP8X 3BQVA 3AG1B 4NB7A 2YAMA 4DP5X 4YSUA 2CCWA 1NIFA 3OD3A 2UXFA 4Q89A 1NTDA 4TXVB 1PZBA 2HXAA 1A4BA 2Y69B 3FYIB 1AZBA 1OCZB 3HB3B 2HRHA 2AZUA 1IUZA 1PNCA 2FT7A 4DPCX 4BWTA 4YSEA 1JZGA 3H56A 3ABLB 1CURA 4NERA 1SJMA 2HX7A 3X1BA 2UXVA 2IAAC 3FS9A 1CYWA 1JVOA 3OMAB 3ZIYA 1MZZA 4HZ1A 3UGEA 5AZUA 3WNJA 6PCYA 4Q8BA 4CSPA 4GP4B 2IDUA 2Q9OA 1PAZA 2EILB 2PCYA 1A3ZA 1JZFA 4FA7B 2DV6A 3N55A 3EH3B 5B1JA 4YSDA 1L9TA 1ASOA 2HX9A 1SNRA 2VMJA 3QJQB 4WKXA 1IKOP 4X4KA 2BHFA 4K9JA 1NZRA 5A7EA 2B3IA 2HLEB 3CZUB 3FSWA 2GC7C 3PAVA 4YSRA 3FPXA 1KDIA 4KO6A 4JKNA 1GS8A 2YAEA 2IWEA 5I5IA 3T9WA 3U25A 4G72B 4UF7C 4YVUA 1NPJA 2OJ1A 5D4IA 2Y1AA 1XB8A 3FU7A 2R7EA 3UABA 4L0PB 1BXVA 1HFUA 4PCYA 5F7AA 1GY2A 4WTQA 3WKPA 1KBVA 4KNSA 7PAZA 4N4YB 2XU9A 4BK5C 4KO7A 2FT6A 2YAOA 3DTUB 3NSDA 1JXFA 5I6MA 3WI9A 3NP4A 5TK4A 4G71B 4A2EA 2YAPA 2BWDA 4W1TA 4ENZA 3FU7B 4BWUA 1AOZA 4A68A 5B3SB 3FPYA 2XX1A 2EIMB 1XB6A 2WO2B 4UANA 2XUWA 1KCBA 3NSCA 1OCCB 1QLEB 4E9QA 2W8CA 4CSZA 1ASQA 1KV7A 1E67A 1BQKA 5E9NA 1ADWA 1KBWA 1I53A 2FJSA 3FQ1A 3EF4A 3GXUB 1PLAA 2DYSB 3NJJA 4GXFA 4E9TA 2J5WA 5B1KA 1L9RA 3QJTB 3QJRB 2CUAA 2IDQA 1JZHA 3FQ2A 2XLLA 3EH5B 1J9RA 2YAQA 1HAUA 1A4AA 2CJ3A 5B1JC 4E9YA 5B7MA 3WG7B 1PZCA 1SFDA 3WKQA 1DYZA 1F56A 1J9SA 2MRYA 3NJFA 1A4CA 1SHWA 4F2EA 3OMNB 5ANHA 1BXUA 1E5YA 2H3XC 5AFAA 1ZDSA 1BYPA 1BQRA 2WO3B 5F7BA 4JHUA 2PPAA 3JT2A 2PPEA 5I5JA 1SF5A 1AS6A 4NAJA 1NPNA 2OV0A 3EHBB 2EINB 2GBAA 1NIDA 2ZXWB 4M3HA 5PAZA 5I28A 1N68A 1TKWA 4HCFA 4GY4A 4YSTA 1SF3A 2XV2A 3PAUA 3PPSA 1RKRA 4A67A 2PP8A 4A66A 5B7EA 5FC9A 2HRGA 3QQXA 3QJUB 1L9SA 1URIA 1ZIBA 2VM4A 2P80A 2HZHA 2GIMA 1OV8A 2XYBA 3FU9A 1JZJA 9PCYA 1ID2A 1QHQA 2JFCA 3S3CB 3DKHA 2FWLB 3WNIA 5I6OA 1W6LA 1W6WA 1KDJA 3AY2A 1GS6X 1L9QA 1AZRA 2N0MA 3TASA 2BW4A 1MZYA 6PAZA 1AS7A 4E9SA 2FT8A 4KO9A 1OE1A 1AACA 4QLWA 4G7RB 2YQBA 4YSCA 3ABMB 4GYBA 2ZOOA 1YLBB 1JVLA 3EH4B 2BZCA 3NYKA 4AX3A 4HAKA 3BVDB 3FSZA 3QJVB 3SBPA 3NJNA 4DP7X 3NJHA 5PCYA 1AZNA 1PLBA 3IN0A 3T6ZA 3ZDWA 2GSMB 1BQ5A 3X1FA 3PAZA 1BAWA 1NIEA 1WA2X 2IH8A 2BP8A 1CYXA 4BWWA 5IY5B 3CDZA 2W88A 4KOCA 1GS7A 1AAJA 2DWSA 2BW5A 2I7OA 1A65A 3ASOB 4A2FA 4DP2X 3SQRA 2DY2A 2JXMA 3MBWB 2BP8B 1ET5A 1J5CA 1FWXA 3C75A 3CDZB 3FQYA 2PPFA 3V9EA 2FNWA 3GDCA 3IEAA 3TBBA 4YSAA 1TU2A 3G5WA 1CC3A 3QJSB 4YSSA 4A2DA 2UX6A 3DIVA 4DPBX 1A8ZA 2IWKA 4A2GA 2EIKB 3ERXA 1W8EA 2UX7A 1FFTB 2GI0A 1NINA 1OE3A 2QDVA 3OM3B 3CVBA 1MDAA 2GC4C 4P5SA 1NICA 2YXWA 1L9PA 1RCYA 1NWPA 2NRDA 1B3IA 1GY1A 2FQFA 3NJIA 3OMIB 2ZONA 3QPKA 4G7SB 3AG2B 2FQGA 1TEGA 1FA4A 1NIBA 4P5RA 1IC0A 2CBPA 3IBOA 4HIPA 1E5ZA 4MFHA 3UACA 3SBQA 1TEFA 3CVDA 3KW7A 3N2JA 3SBRA 5LDUA 2XXGA 5EHFA 2RACA 1KYAA 2VW6A 2ZWNA 4DP1X 2B08A 1XMEB 5I26A 2FTAA 1SDDA 1PF3A 2IDSA 3X1NA 1QNIA 2FQDA 3ABKB 1AR1B 2VSKB 1MG2C 3OQRA 4HCGA 1AZUA 4HHGA 4KO5A 3S8GB 2YARA 3H4HA 2CALA 1SDDB 4F2FA 2PPDA 2BP0A 1PMYA 1ET8A 2MTAA 4E9RA 5B1AB 4KNUA 5D4HA 2QPEB 4AKPA 5I6KA 3RYMA 2JKWA 2BO0A 2PCFA 4YSOA 3S8FB 1AG6A 2QT6A 2GHZA 1JOIA 2BP0B 4G70B 3ASNB 3KW8A 4HCIA 3CVCA 2PP7A 1VLXA 5AKRA 3S3DB 3NT0A 3X2QB 2DYRB 1ILSA 4BXVA 1OE2A 1SHXA 2IH9A 2TSBA 4PAZA 2AANA 3FSVA 3T6XA 4YSQA 2P80D 4BDVA 2J55A 3FT0A 3H4FA 4GP5B 1MG3C 4YL4A 3NP3A 5B1BB 1NDTA 2WSDA 2VM3A 4KNTA 3FYEB 4AI7A 2H5UA 1WAEA 2TSAA 2VW4A 3L45A 2HX8A 2DWTA 2XVBA 3WIAA 1WA0X 1RZQA 2YAFA 4AZUA 1JERA 4E9WA 3T6WA 4AKOA 4JHVA 1EZLA 1PCSA 1GSKA 1ZDQA 4GP8B 4ZK8A 1T5KA 2XV0A 1AS8A 4UAHA 4HHWA 4BDVB 3AG4B 3T71A 1ASPA 1J5DA 3AZUA 5I6LA 3ABGA 1IBZA 4AKQA 4E9XA 2J57A 3ZX1A 1CUOA 4DP6X 3NSFA 1DZ0A 4BXSV 3FU8A 3UAEA 4YVNA 2GB2A 1JZEA 4QKTA 4RH4A 1UATA 1PNDA 4DP4X 2PP9A 2E86A 1V10A 2X88A 2UXTA 3AW5A 1ILUA 2VN3A 2BWIA 1PLCA 2PLTA 1GR7A 3PCYA 3S3BB 7PCYA 3X1GA 3JTBA 1WS8A 1OCOB 4HALA 3HEIB 1NWOA 1L9OA 1XB3A 2FQEA 3NJMA 3NJGA 3V9CA 3X1EA 3IN2A 5I6NA 3IE9A 2QDWA 1OOWA 1J9QA 3NSYA 1NIAA 2BZ7A
chains in the Genus database with same CATH superfamily
3AXLA 1BZDA 4UQ3B 3MGAA 4Y7MA 4N2NA 2VM9A 4X7FC 1KCWA 4EF3A 2AJUL 1JRHH 3BOVA 2EXWD 4N0CC 1E8YA 3PV7A 1ECZA 1YYLL 2X2HA 3CXFA 2AERT 1J5HA 3NJKA 2W9DL 1FG9C 1ZV2A 1GOFA 3RVVC 2EVIA 4M8VA 1KN2L 4L1LA 1JTTA 1F90H 4AEHL 3UZEA 4PJDF 2VQ1B 5MENE 4B0MB 4ALAC 1D2PA 1D7BA 2XSKA 4OSUL 1ZLSL 4ACTA 4BA0A 4R4ND 3I85A 5ISZA 1MF2H 4WI8A 5AAWA 5LNDA 1KPRB 3GSRA 5E9AA 1N12A 3OHMB 5BOPA 3DRQB 3VG9B 5CU5A 5IQLA 3EDDA 1AR1D 3EYSL 5AVZB 3LRHA 1PVHA 1CN4A 1FFQA 1T80A 2OMNA 2CE6A 2EDNA 4H25B 3SGDH 2E56A 1A14H 5C92A 3OMZA 3F12B 4NWTL 4XAWL 4QHLA 2EO1A 5EZOH 5FO7B 4IRJD 1ZLVK 3FHQA 5DUJA 2CRMA 1NDGB 2NNAA 1UEYA 2GY5A 2NZ9C 2JMRA 5DJDA 2Z91B 1A7RH 5KWYC 5ISZE 1S7WA 2DF3A 1A1NB 5AVTB 4RWYH 4LSRL 5FW8A 3TZVB 5C3IA 4PGDB 1UM6H 2PPCA 4KKZA 4OCWL 3WSQL 1DE4A 3EO0B 2BNRB 4ODWA 4ODVL 4Z7VE 4DW2L 1NFDA 3GZKA 2IOOA 2WO4A 5HYJB 2HXAA 2Y69B 4XN8A 5J1AA 2DJMA 2XKNB 3EYOA 4FFZH 2WLHA 3ESOA 4X6DE 5FM5M 5C0BE 3SE9H 1RSYA 1TLMA 2GEQA 4LGRB 3W56A 1HCYA 1OEZW 3M1BB 2WKLA 5HHNB 3TN0B 4YSEA 1LILA 2AV1A 3EBGA 5DYOA 2J8UF 3CLWA 1TPXC 4NC2B 4I5BA 1CYWA 2VC2L 5DJXB 1L3NA 1F42A 1HHJA 1YMMA 2BIIA 1TZ8A 2O6FA 5CSZB 2HVKB 1B0IA 4XI5D 1TZGL 2JWYA 3PJSB 5FYJE 3SDYH 2D31B 4X80H 1PYWB 2VDKH 4YXHH 4GSQA 4NZRL 2WBJC 1AQHA 1PSKL 1AXTL 1GGBH 1FAKT 5CINL 1ZVNA 1JZFA 3B2UD 4GEIA 4FA7B 3QG7H 1OW0C 5AVXB 3NCFB 1UA3A 2V2XB 4FZ8H 4PJXE 5IGXH 5IBLD 4FLSA 4ANUA 1XF4A 4MGXA 1OT2A 1A9EB 4U1SB 1M2VA 1F6AB 3FB7B 4X4KA 5JZ7C 1R5VB 1BQSA 3PQYA 4U1GB 2B3IA 1KXQA 1VF5C 4LSTH 2LU4A 6CGTA 4IJTA 3KDMA 4DEPC 1RIVL 5DJZA 1RURL 2JKLA 4YDJB 4Z5RB 5D7JB 5AB2A 4DOHB 1IBHA 5HGBB 3KJ4B 1QD0A 4W9JC 1OD7A 3VAEA 1U8NB 1NFIA 2BVQB 3GHEL 3QQDB 2YHGA 5E4OA 15C8H 3N43B 4L0PB 3R8QA 5JNYB 1S7UB 2QQLH 2AJVL 4YZFF 1KBVA 2ZWZA 4Z7QE 3TPKA 1R5IA 1UWXH 1NBCA 1OB1A 3L3DA 2NY4D 2XNAB 1NL0L 2DQHL 1E40A 3OJ2C 3S37X 4UU9A 3CVHL 2VR9A 3PWPD 3JSSA 3CAFA 5CD5C 3IDYC 2H4EA 3QG6A 5TDOB 3TO4B 1XH3A 5FHBH 1QLEB 2Q2LA 1TITA 4FFYA 4MYPA 3GJFH 3BHBB 2DQDH 5A1AA 4IW4C 5CZXC 1PZ5B 5BVJA 4XMVA 2H3KA 3VFGL 3N40F 2Z31B 1NC2A 4JKPL 2CK0H 2ZCKH 3EF7A 4Z7OF 4YHZH 1P4LA 4WCYL 4P9MH 2XWTA 3IDNA 3QPXL 5IHUH 3UGXA 3GXUB 1H8LA 1PLAA 1I3GH 2XWBB 3NJXA 3ES6B 2PCXA 4PI2A 3VGGA 3WDHA 1FNSH 1AZVA 5DURD 4M7ZC 4WIQA 5IIEB 5KSAB 4UQCA 1U8QA 3CUPB 3QJRB 3R0MA 1JZHA 3HC4L 4GQQA 4I3SH 3C60D 4JFFD 1IM9D 4M1CD 3A67H 4G8IA 5GISH 3WHE0 3OHXB 5L2KB 4WHYH 1SOQA 4BCZA 1DJHA 1YUHB 4HGKC 4ZD3L 1MHCB 1SFDA 5BW7C 3HLAA 4DUVA 3SDAB 5BZDA 4QUOA 3DXAE 1HHKB 1P7QB 3ZKQD 1DJIA 1QSFD 1EZVX 4OVVA 5FOBB 2NSMA 3RDTB 5AFAA 3F58H 4P23A 5D8JL 3G08B 3TFKD 3GSOB 2FWOB 2PO6B 4JM2A 4D2NA 3JYCA 4NKIH 3MJ7B 3LIZA 4P57B 2NY3C 2P42B 1D6EB 2DH2A 4L2YA 3EHBD 5KW9H 3R7RA 4U31A 5DVNA 4G6JL 3VWKD 4XCCL 2OBGA 2ZCLL 5PAZA 3Q0HA 4YHIA 5AWNH 5BS0D 1PW3A 2PWEA 4P3WA 3WNOA 4D0BB 5C0JA 4PP1C 2A0LC 4Q52A 4YDIL 3TC9A 4G6MH 3GXMA 5DHVA 2ADJA 1MWAB 3OJVC 1CFVL 1E9PB 1S7SA 4JY6A 1NCHA 4LLQB 4B5ZA 5AZEH 2A9CA 3GEFA 1EFXA 4JLRB 1K2DB 4MCYA 2IALA 3STZA 2YA1A 1AGEA 2EDFA 4LRNL 4LL4A 1NCCL 1OB0A 5BUPA 3PHOA 4ZXBC 3TIDB 1O6SB 2QVMA 3FQWB 3NACL 2W91A 2Y3NA 4KY1L 5D1ZA 1G7MA 3E9UA 2HFFB 2IFGA 2BERA 4BQ8A 4GPVA 5AVRB 3Q5YA 5I6OA 3HG5A 5ICXA 1CR9H 5LN8A 1XO8A 1U42A 4RFEA 1B4RA 1BMGA 3TASA 5LBSL 4MSWA 4E9SA 1G0YR 4XNQA 4KWUA 1WZMA 3IDXL 2J8OA 4GSDH 4HQQL 4J3VA 2HLAB 1LEGA 4R96B 4QRRD 2A6KB 4XNDA 3V0GA 1RH8A 2VDNL 4H8WH 4YZWA 2CO6B 3D9AL 3NA9H 1UCTA 3RWHB 3CFEB 2O61A 1WEJH 4OH2A 3CHQA 5EIIG 4P46B 5AW6B 1NCWH 3MCG1 3X1FA 1KGCD 1TNNA 3TZVC 2O6PA 3BPOB 4JHAH 2BHYA 3T3PF 4ZX6A 3H3KA 3HE6A 2GTZB 3PWPE 5IY5B 3ZYOA 3UYOD 3S5LB 3U9UA 4DEWA 4UNVA 4FCAA 2QLVB 3FHAA 2V2WB 1K8IA 3CSYB 3SDXA 2C3XA 2B20A 4CMHB 3APFA 2B2XL 1CDBA 3WS6A 2AJUH 3TN0C 4AGMA 5JW3L 4W4OA 3BVNB 1OTUD 4NZUL 2A9AA 2IADB 2C9AA 2G60H 2FX7L 1QACA 3B56A 3GRWL 3CX5J 1JK9B 2X10A 1JV5B 5I66B 4XCNB 4RZCA 1DVFB 4BKLA 1HKLH 2EEFA 3FTZA 3OBAA 3ZN6A 4HS8H 4OSUH 4RFNB 1ZLSH 2VDRH 2Y5TB 4AQ8A 3X17A 2JCWA 1DANU 4JFFE 3V6OC 3FUDA 2R1XB 5HHOB 2D7PA 1V7NL 1ZKAA 4ZX3A 3S48A 1ROWA 3KPLB 1IILE 4LQFH 1VESA 3RWCB 1A6AA 1IC4L 1MFBL 3QIBD 3HCVB 2DI8A 4PBXA 3IBOA 1DBJL 1CE1L 1QSFE 2R56L 2VITA 3D18B 4TUKH 5D1QD 5FO2A 1ZA6B 3BZFB 3DYOA 3EYUL 1ACZA 1JFHA 4TSAL 4FJ6A 4GUPA 4HEPG 5D7JC 2NPLX 2VDPB 2VAJA 1P6AB 3KJ4C 3NN8B 4D3CL 1X5XA 5C0CA 5DSCA 5FYKD 4N5ED 3HZMA 1RZGA 3FZUC 3LSOB 1C7TA 1TJGH 2DB8A 3F7LA 4F1ZA 3EJTA 1BF5A 3OQRA 4HUUB 4LSRH 4RGOH 3NIGE 5BS0E 2EYRA 5IQ7H 3L17A 4FI7A 4OCWH 2VABB 3WSQH 2ZQKA 4IEFB 2MFNA 3H4HA 4ODVH 4Y9CA 5C0AB 3MV9B 1XL6A 5I1DA 3DPBB 4CNIA 4N2OA 3G6JB 4E9RA 3TO4C 2DH3A 2AEOA 1XXFC 5D7IA 3BLBA 3TEZA 5EMYA 1ES0A 2V5SA 3OB8A 5KS9A 4G9FB 4HAFA 1HILA 2ZWKA 1JUFB 5I8CB 5K39A 4JRYE 2VN7A 4G5ZH 4IDLA 1FORL 4I8DA 2VC2H 1RZ8A 2Z31C 3MV7B 2ESVB 3N0PB 3VG0H 3EFOA 1TZGH 1DTUA 4LEXH 4HCRA 1BMWA 1H3PH 1USQA 2VLRD 3OR7B 4X83A 3ZQXA 1HXYB 2CKBA 2OMUB 3AXHA 4QRRE 1PSKH 5IZ7A 2OJEA 3O4OC 5KSAC 4AL8H 4NM8L 3IT8D 1UFGA 1ZS8A 2PW2A 3CN0A 5CINH 5DEFA 1X5GA 4YL4A 1QW8A 4WEMB 3DTXA 3PPEA 3FT9A 1FZJA 3BH8B 5BQDA 5DUBB 3OHXC 5EU6D 1KGCE 3OKEB 1UVQA 1RJLB 3VFVB 1NCNA 2J2ZA 3LZQA 4HLEA 1TVDA 1PCSA 1GSKA 4RMQA 4PJ9B 4LKCB 5K59E 1KXVA 1R75A 3SCMC 3AG4B 4BQ6A 1ASPA 1RIVH 1MHEA 1KMGA 1RURH 4H8HA 1UT1A 1P5UB 3MLXL 3ZX1A 4ZTOL 4Z77B 2E7LC 1K5WA 3NFPB 4CN1A 3U0WL 5EV7A 5JHLH 3GC3A 1AKJB 4HGWB 1E4XI 4U2ZA 1PNDA 1OHQA 4YWGH 4UZUA 2B8OT 5E8EB 1UACH 2BC4A 2IEPA 4PGEB 5D6DC 2QQQA 1Z9OA 1NMBL 4JPIB 1IFGA 3ARSA 2X70B 4PWGA 2IFFH 4LSQL 1JN6A 1PLGL 2BIMA 5D2NC 2DQHH 1QWHA 2FL5B 4XHQA 4X9FA 3Q06A 4XN1A 3N41B 5TE7L 3TIEA 1XB3A 3B9DA 3QI9C 4JFVA 4FABL 1E4KC 1DLHB 3AB0B 5I6NA 2QR0A 2R0ZL 2XWXA 4N2DA 5AOLA 1KCSL 4EDXA 5KAQF 4QRAA 1J8KA 5TDPB 5B3NA 3VWJB 1L5GA 4FG4A 4U4IA 2EYSB 3QQXA 3L95A 5G55A 1RUAL 1BXAA 1H6FA 3Q2WA 5E6IC 4AJVA 1GOHA 5BZWA 3DK0A 4HD5A 3KBPA 3NCJL 4L4JA 2XPYA 1EXHA 3VFGH 3VXTB 4P2OA 4UQEA 4GEJA 4GQ9H 5D1QE 2Z7WA 5IOPB 2EIBA 2ZUVA 1MHHA 3QPXH 3CVIL 4EDWL 2WP3O 2AK1L 3MOAL 4NQEB 5KANG 4YHNA 5EWIH 1X4XA 3JV4B 4FP8H 4UTAL 5BJTA 1T7ZA 2VDQL 2WBJA 1PCXA 3PAYA 4ILDA 3D33A 4KKAD 1X5YA 3VI4A 5FYKE 3ZBMA 4FNRA 4OJFL 4J7RA 3NZSA 5D7SL 3HC4H 4XMUA 2EJ1A 3QWRA 2OK0L 4KVNL 3IJSB 3O4LD 2B4CL 5KSVA 3ZR5A 3OKYA 4P46C 2XV6B 1YQVL 1Q9KA 4ZD3H 5I8EA 1G6RL 3MRMA 4NN5C 3BPOC 1UOKA 1EGJA 4TOYL 5MHSD 1OAJA 1U2YA 2B9AA 4DKAA 1FNGB 1J9CT 5D8JH 2H6UA 4RMUA 2IQ9H 5LGKA 5G2NA 4N8VG 3DV6A 4Z7WF 5J56B 4F7CB 3PGDA 5GPRA 1UOLA 1HESA 1WK0A 4G6JH 2KMWA 4LDCA 1W2KT 4XCCH 1EO8H 1IAMA 1ETB1 3GPEA 1GA2A 4Q56A 5F71A 1MLCB 5L0QC 5F7KC 5B39A 4LLDA 2VLRE 3KLDA 1YEJL 3DURB 4YDIH 5KTEL 3QQ4B 3SGDI 1V54B 5CLYA 3BSHA 1J7VR 3M17A 2EZ0C 3TVMA 3WD5H 2YAMA 5HP5A 1FHNA 3Q8CA 4YSUA 3V0JA 4JREB 4RFNC 5FEBA 2COVD 4LRNH 3V4VL 3VXNA 3BH9B 5EU6E 3UZQA 2L0DA 1CMOA 4P59H 2IBBA 4G43B 3NCWA 1N3NA 4WHTB 2BIPA 2B9BA 4LESA 2VR8A 1JZGA 4M6OL 1ZGLA 4IBYA 1SJMA 4X5PA 5LBSH 5MEQA 1CXFA 1QEWB 2DQUH 1UYWH 1IM3B 1HL9A 1MHPH 1MUJB 3ROLA 3RUGF 5C0ND 1T2QL 5IEHB 1WAAA 3QFGA 4PV9B 2WYZA 2VDNH 2DAVA 2CGRL 4TPRL 4FXGB 4KFMA 5I1IL 3D9AH 2CLVA 4IMKC 4ODBD 3NIDB 2YBRB 3BIAX 3MUGB 2AJSL 1Q9LB 2OLDA 1PG7X 3DX2A 4WWKB 4HJTA 4KK5D 2WPGA 1OAYH 2N7AA 2YD7A 4HFWA 2NX5A 2C3WA 4PRHD 3AC0A 3HI1B 4YGVA 4CN6A 5EBGA 3NG5A 4WU5B 1TCMA 2BNUB 3MRGB 1KXTB 1IFRA 4M6AA 2CHNA 1Z9SA 5DVPA 3GTTA 2EIZB 1B2YA 1RHFA 1G5GA 3BP4B 4YSRA 4U6XA 4KO6A 5ESVA 25C8H 4OM0L 5I5IA 2ZYSA 3MJGX 3ZGHA 2B2XH 5H94A 2GUOA 3ARED 3Q1SL 1W72L 3N9GH 4FQXB 2EDHA 4NZUH 1UCBL 2FX7H 2Y1AA 2NLJA 3CFMA 4HK3J 3AQXA 4N2LA 4NNYA 4PGBA 4KZCA 3MLTA 5F7AA 3GRWH 4YFLI 4G80B 1BA9A 1MJJA 2GJ6B 3M45A 5DHMC 1CT8B 4KJPD 2HSIA 2VE6A 5I6MA 3I3EA 2FATH 1SUHA 5EEYA 1XGQB 4GRLB 2N3JA 5B3SB 4MCNA 3O4LE 3X3FH 2H1XA 5D7HA 2HKFH 1MH5B 4ODHL 2OXGB 5HYEA 3FN3A 4ZXBA 3K4ZA 3OB0H 1IX2A 4IU2A 4E9QA 1TCRB 2ZX5A 2BOBA 1U6AL 3GSVB 4C56D 4LARL 1CE1H 2R56H 4OT1H 4JFEB 1MOEA 4PJ9C 4R5TA 3SO3B 5MHSE 4OZGB 4H25A 3C5ZB 4AC2A 4YR6A 4TSAH 2APTA 2P7TA 3C2SA 1XSKA 1GZHC 4D3CH 2PW1A 3T8MA 3MN8A 4QHUB 1XD1A 1NDGA 2XQYK 2IPKB 2Z1PA 4PSRA 3L3HB 5KYWA 1RJZB 2F74A 1MCEA 1J9RA 1VZHA 2R2EB 2WVVA 4AMKL 5I16B 5FM5O 5B7MA 4KRNA 4FEIA 2NCEA 3QIWB 3EO0A 4ZS6C 4L3CB 4QRQA 3NUKA 4XP1L 5IMMA 1DSYA 1TMQA 3AB0C 1J8HB 4FXLA 3QS3A 2G5RA 4KKBD 1A7QL 3KBFA 3QZNA 3VFPB 3VWJC 1SOKA 4GG6E 5CBAB 3MFFA 1BQRA 2VKWA 3QXDB 4L4TA 5C0GB 3MBED 3TV8A 4CDHA 4BQBA 4ZPTA 3VFWB 4P2AA 5DTFA 3ME0B 2XN9A 3MRKB 3A23A 1FN4B 1OQOA 3PFQA 4WV1C 1G87A 1F4WH 3HG2A 1UJ3C 4KPHH 3ZE2B 4EMZA 2E9JA 4B9FA 1N68A 4J3XA 1L9MA 2YK1L 3PE9A 3UBXI 4BHUA 3ZDYF 3DVNB 2MNJB 2VZTA 2ADFL 3QUYA 4WI3A 5E9DA 4DAGL 2DYPB 3P4MB 5D2LB 4PW3A 4LSPL 4LVNB 1CGXA 3N1PC 3HBZA 3K71B 1SBSH 4RQQA 4MASA 1SY6H 1HK6A 1XH1A 4GAGH 3WIHL 5KVEE 1KB5A 4PRHE 3T08A 3T0EA 2VIRB 1B88A 3QUXB 2K70A 3JT0A 5KVGH 1X3DA 5DQ9A 2YEZA 3EFDH 3L13A 4WWNA 4XAKD 4HWEL 3FQNB 2BFVH 2X1WL 2TRHA 3BISA 1OM3L 1TJIH 4N2KA 3AY2A 3D4GA 5C71A 3BPLB 3U82B 2JIXA 43CAA 1JPTL 4NC1E 3TYGL 3U0WH 4QHNA 2P8MB 5JW4M 3QB7C 5D7JA 4YSCA 1U8HA 2V37A 4RETB 1U8NA 2J3SA 1YLBB 5SWSB 2XOTA 2WWMC 3QXUA 5BRZA 5K1VA 5ID0B 3QJVB 4XBPA 1XIWB 4TUJB 3DJTA 1NMBH 1ECYA 4KROB 5A2LH 4ZRGA 5GJTH 5JNYA 3LRMA 3DROA 5DHYA 5EO9B 4LSQH 5PCYA 3RU8L 3SPVB 1DFBH 1PLGH 3UBHA 2YD5A 5E1AA 5T5FL 4K3JL 4L0ZA 2R0ZH 4XNYL 3Q8EA 3N1FC 2Y6TE 4RX4D 5CGTA 3TO4A 3NMEA 4N6QA 1VEMA 1RUAH 2CA4A 1ZHKB 3V0WH 2MKLC 4WJ5A 3NCJH 3U36B 3CXHJ 5JOFB 2P5PA 2IBZX 1ET5A 5AB1A 1IGCH 3SPJA 4C56E 1VIWA 3CDZB 3MROA 1KSRA 1WBZB 2HG5A 2FNWA 3IEAA 3CVIH 4AMXA 4QHPA 1TU2A 4OVUA 3ULAB 1KENL 1T66D 4OU3A 1U3ZA 3U2SB 2VDQH 5ANMB 1L9NA 4K7PY 5KSAA 3O45B 4OJFH 3SKNA 1JGVL 3D2UB 3FCSB 3KYMA 2C7UB 3R8BB 4GUQA 2IG2H 2UX7A 4FQ1L 4PB0H 4EKXA 5IHZA 3RFZA 4KVNH 3CFQA 2B4CH 5CJQL 5C0IA 3CVBA 1QUNB 1L9PA 3BUQA 3UTZB 3HFML 1B3IA 3MNWB 4HKBB 4OZIB 2Q0ZX 4CA4A 4JKKA 3UPRA 5I75B 1V8HA 1PY9A 3ZW3A 1KCVL 3RPIB 3WMSA 1XF1A 3SCMA 1DUYA 5LDUA 4KXDA 4F20A 4R3SA 1Z9LA 4KK8D 1T1WB 3MJ7A 3WDJA 5FK9B 3UG4A 3SJVB 1SDDA 3LZOA 4PVBA 5I1HH 4YJZL 1LP9F 1VFAB 2G3NA 3O6LL 5D6DA 5EZIH 3L08A 1AI1H 4WVRA 3SGJC 4X6EB 4DVRL 4A55A 4HJSA 1HHGB 5D2NA 2R29L 4X99B 3BAEL 4PY8I 1QYGL 1MQ8A 1MWAA 3QCVL 3CDGA 1KPUA 3QI9A 2PPDA 2WZ0A 4PJDE 3CHXA 4GRLC 4C58B 2W38A 3RJOA 4LRIC 4LBEA 4JMXA 3W38A 2YUVA 1PD0A 2BO0A 2PCFA 4BH7B 3NCYP 5E6IA 3T09A 4EZJA 4MD0A 3ZDZB 3VVWA 3RKDC 2ENJA 2NOYA 4Y89A 4TLUA 1BP3B 4LEOA 2HFFA 4M6OH 4XAKE 1RUKL 1JHKL 2UZYA 4OCSL 3MLUL 4FX5A 1MREL 2MCAA 3II3A 5EN2B 2R23A 4CVXB 1UASA 1WIOA 1Z3RA 3C5ZC 3ML9A 4PREB 1T2QH 1H3WM 5KVDL 3PP4L 1MI5B 4F37K 1BCIA 1QASA 2AKRB 2F58H 3BP7B 4J3UA 1ZLWH 4OF3A 2Z7UA 4BUHA 5I1IH 2FHCA 3H0TB 1DVZA 3NZ8A 2OYMA 4HVBA 1AVAA 3C87A 3QJOA 4TQEL 3WO4B 3CFEA 3NP3A 1JMZA 5KYXB 3A4EA 2ENSA 1U8LA 1N8ZA 2F08A 2VM3A 3I75B 3QCTL 3SODB 4AZ8B 4F15B 3QFJB 4ZYKA 1KBBA 2Z4TA 1JWUB 1U3HC 1WC7A 1JPFA 3QIWC 4J1UA 1IIIA 4ZSOA 4XPBH 3LX9A 2SEBA 5FCUL 3X14B 1FO0L 4ZK8A 1GJUA 3HNTH 1K5NB 1XR8B 4UM9B 5LJYH 4OM0H 2H8PA 3WBDA 1AO7A 1IBZA 4O51A 5KBMA 2A6JB 2J57A 4QXWA 1G43A 1ZLEA 1OTTD 1VFBB 3IWVA 3IMVA 3MAWA 1CD1B 1UCBH 4G8GD 2DQJL 2DZEA 1A6VL 3CCHA 3FFCA 5DRWB 3WFBL 3ESPA 4YDNA 2O93L 2J8UE 3WNNA 2VN3A 2WN2A 1TVBB 1W0WB 1A6WH 4KX9A 2R83A 4ZMXA 1XT5A 1WZ1L 1GR7A 2YD0A 1TQBB 2YPLE 4RMBA 5JQ6L 3JUYA 3JTBA 4NKMB 4Y4HA 4WY7H 1LDSA 2EYTA 2VDKB 3DUSB 4APQB 4LAJH 3NJGA 1ZWIA 2ZJSH 5C08A 4MBRA 4I1PA 4WUUA 4Y4FD 4AK2A 4FQPA 2R1XA 2P8LB 4UTBA 3G6AB 3ZO9A 1CQYA 3NDYE 3BAKA 5CF3A 1NAKL 1QVOB 3V0DA 2H32A 2RIKA 1A1OA 1U6AH 2V9QA 1QFHA 1QQDB 3HG3A 4HUNB 3TT1L 3VYOA 1P7KA 2F19H 3DUHA 3MGTB 4CAGA 5I8KL 1BVZA 1E7VA 2G75B 1OP5H 1UD5A 3S8WA 2HJKB 3BPLC 4HEME 4E36A 5JPNA 4NYLB 1N6VA 5AYUL 5FM8A 4A2MA 2X38A 2NXZC 2E27L 1OF0A 2NMSA 2ZKMX 1AGCB 2FEEL 2LAGB 3FO2B 4IMKA 5E8DL 5JPMA 2NDFA 2K7PA 3BKML 3QNXB 5DVMA 4LAQL 3GMNB 1XIWC 1RPKA 1SDAB 4LT7A 4OLWL 1RULL 2NW3B 4AMKH 5G4MA 2XWZA 3ZLQC 2QV4A 1G7HB 1PEWA 3NCBB 3T4AB 2PR4H 3DPBA 3FJTA 3MUY1 4FFWD 4TLSA 2P47B 2A3TA 3U7YL 2CLRB 2VLJA 1JMXA 2EDBA 3S4SA 2M26A 3MA7B 3ULVH 3P3TA 5I0XA 2I7SA 2X12A 2E75C 3U0TB 1MFDL 2BVOA 4CGUB 1JCVA 2AEPL 5AYTA 1UTDA 1IEHA 3O8XD 3JBG7 1RZFL 3PABA 4NEHB 5EFIB 3QR1A 4MJ5B 5IQNA 4Z7OE 3U4EA 3GS4A 3CH1B 1LEKB 1QFPA 4LVOB 5T3XL 3QT2A 3VRIA 1J05A 5I1EL 4ERSL 4NB7A 4LSPH 5GS1B 2VZ3A 3M1CA 1MQKL 2D2CC 1SEBA 2BNRD 2X4QA 3ZY7A 4Z78A 5C0EA 1COBA 4LU5H 5K9JL 1SYSA 2Z92B 4R7NA 1CTNA 1W8NA 1WPCA 1EZVY 3OKEA 3BRDA 3KLQA 2IOMA 1CFBA 5F1NA 4CJ0A 1MY7A 4NBXB 4LKCA 3LN9A 3NABL 3U6XA 4DIXA 2WXKA 1WBXB 4J5VA 3TYGH 3QHZL 3T8XB 1I75A 2G9HB 3OMAB 5EUKA 3KPQB 5FLUA 3GJEA 1GZHA 1KTJA 1SJVA 2E9IA 2F1AA 3MRNA 5C07D 1DBAL 1F3DJ 4G8GE 5KANI 1HOCA 5KN5B 4BFFA 3QJXA 4DN3H 3D4ZA 3ZTNL 3RU8H 2XICA 4B96A 1QP1A 1QX1A 5E0QA 5DK3A 4Y7OC 1X4ZA 5EUOA 3GIVB 1BIHA 2F1EA 2J44A 4K3JH 3S6CA 3BD3A 1JNHA 5DMKB 1JK8B 4JRXB 2HKHH 4ZUVB 3D06A 3FSWA 1U95A 2VLLA 4PTTB 1R3JA 3T2QA 1AGDB 4AGOA 3BVXA 3HJEA 5GGRB 4OD2B 5T1LB 3S5LG 1WIPA 3OJDA 4BFEA 4JQXC 4WV1A 4G6AD 1UJ3A 1I1RA 5I5RA 3MRBB 3BLKA 3F84A 5F3BA 1KENH 3P3SA 5ERWA 4NZFA 2FUTA 7FABH 1HSAA 5K1NA 4EQ2A 3W11D 3WY1A 4N4YB 4D9LH 2XU9A 5GRJL 1J87A 2KH2B 4PS8A 3UTQB 4OF0A 1U2CA 2KT6A 4CMMB 7TAAA 4BUGA 3J27A 3MRFB 3L3KB 4J2XA 2XQYA 2YAPA 1F18A 4TNVF 3WO4C 3IJSA 2YMXH 2OR7A 4ANVA 3FPYA 1AMYA 2K3TA 5E6SB 2I9TB 1X7TA 4JM2F 1FNEA 3O6KL 5CJ5A 3HFMH 1BG1A 4JCWA 4L4VA 5DO2D 2F8XC 3H6JA 4QRBA 1T03H 1AXIB 1OCCB 3IJ8A 4PRPD 3CDFA 4HISA 1KCVH 1LQBC 2CM5A 3L3IA 4J3WA 1BZ9B 3KEDA 3H2PA 4JPQA 1E67A 1WTGT 3KLAB 3G5YA 1D3CA 1T0NA 2OW7A 1ADWA 4AWJC 1G9NH 1YEGL 3ELAT 1ML0A 1JE6A 4EI6B 2EDRA 1J48A 2PWFA 3NJJA 4GAAA 4F7CA 3KVQA 4ORZC 3O6LH 2R4SH 1YEDA 1RVFL 1MCIA 1UWFA 5C3TA 5E8NA 2DM4A 3MYJB 3S96B 5FKPB 3S2CA 4ELKA 1MLCA 3HI6L 3BAEH 4JG1H 2WCGA 4O58H 3ARGB 1TQBC 4B60A 5DZVA 3ISWA 3QCVH 1FCCA 3QEGL 1A3RL 4APQC 1UKTA 2BNRE 3ZO0A 2A4CA 1CFSA 1K3IA 2VDRB 1CLOH 2Y5EA 4FRWA 3U4BL 5HYJE 1OIOA 5JZ7D 3RDTD 3EGSA 1AOHA 3MSPA 4PSPA 1IEBA 3B37A 1T7VA 1C08A 4KMQA 2QHRH 3VGFA 3FUEA 4NO5B 4Z7NF 5C0FB 1RUKH 3IYLW 1JHKH 4PJAB 1IGTA 2Q20A 3WLBB 2JE8A 2A9BA 4LOUD 4G9DB 3HB3D 3T77B 1N4XL 2HJFB 3INUL 3DHPA 3D39A 3EBAA 1EJFA 1M7DB 5E8OB 1P6FA 2N4IA 3UROR 1DVXA 4TQEH 5K1JA 4LSUH 3PGFL 3QEQD 2GEEA 5FC9A 3SDXF 1N2RB 5D5MB 3O11A 4NRYB 2APXA 5GS0C 4H88L 3DC0A 5DFAA 1KYUA 1Y0LB 3EG9B 3LZLA 2F53D 1RERA 4HBQA 4ZFOA 2BNUA 1BIIB 4QCIA 3T4AC 3ETTA 5FCUH 1MVFA 4I2XB 3K80A 1FO0H 1FQ9C 3WNIA 2ZSVA 4HUCA 2NUTB 4RESB 3RVWC 2Q2EB 1Q90A 5A40E 4E0RA 2ZAGA 5HHPB 1XF5B 5A16A 1XF3A 5AALA 3RIFK 4KJQC 4DOHE 4YQXH 1A6VH 1TYJA 2BZCA 5DUMH 1JCKA 2CDEB 4LPVA 5LXVA 4WK4B 5C2UB 3PDOA 3SBPA 2VC2B 3SGJA 2QBWA 4HIEA 3E6FA 3LIUA 4JJOA 1KLFA 3OKDB 3LNGA 1ZTMA 5JQ6H 4JFSA 2ISDA 4LP5A 1QSEB 2R9HD 3QDMA 4KKLD 4HHAA 4XCYA 4A7VA 2QZQA 1EX0A 2KPNA 1GC1H 1P1ZA 3QBTB 2DMHA 2WYHA 1OKEA 3SDDB 4LRIA 4MD5A 1NAML 2EIEA 1URZA 1MH5A 2PYEA 3ZKMC 3QA3B 3T65A 3NQIA 3ARDA 2QKIA 1NMCB 2RALA 5IB4B 2D03L 4XNUL 2ZG3A 3TT1H 2NCMA 3BAIA 4PRPE 1VFUA 4XNAA 2OR9L 3MBWB 4XXDB 4LLUA 3S9DB 1R33A 5I8KH 1VGEH 3C75A 4JFEA 1M3IA 2C3VB 1BFVL 1NH6A 3GSWA 4PJEB 2ARWA 3RTQB 1CD9B 3SBWC 3C5ZA 3TBBA 5JW5B 4IOSD 2AXFB 5AYUH 1B0RB 2WJ7A 2WVUA 1I8MB 5SX5H 1OAKL 5E8DH 4ZODA 3QZBA 1DVFD 1A3LH 1TYRA 4LAQH 4E5XB 5CGMA 3O3DA 1SDYA 2IPKA 5D7IF 3IFOA 1S9XA 2HYMA 4OLWH 3RL1B 4P5SA 3E6HA 1CL7I 2ZOTA 3H3PH 1B0GA 5KS9F 3JQOB 2EO9A 3IRCA 5DFTA 5I16A 2CJTA 1U3HA 4QJ4B 4RLDA 3CVHB 5IBUG 4AYFA 4PWHA 4AUUA 4EIUA 1J8HA 3U7YH 1E28B 4HIPA 3UACA 3QISA 3RIAF 2FDBP 1XVSA 1JGIA 4U1HA 4ODTL 1ZK5A 5CSBA 5CBAA 3P4OA 4K3GA 2X0UA 4TS6A 3GXNA 3NCYS 3FTSA 3C6LC 4OF8A 3TA3A 1HDMB 2ZWYA 4D8OA 2MQ3A 1S8DA 4GXUN 3G5VB 1CTOA 2JKSA 3QZWA 5HHVL 5I26A 3LPFA 1IAKB 1TXKA 4XNMA 1E50A 4XPTL 2AEPH 4IGBC 1BVNP 3LB6C 4DESA 1RZFH 4Z0BL 2VSKB 3SEPA 3HMWH 1OHZA 1MG2C 4PLJD 3SOTA 3MV8B 5T3XH 3KLKA 2I27N 2GIYA 4TUOA 1C5BH 4ERSH 3ULSA 1Z6JT 4M5YL 1IC7L 5E00B 4H8WC 1FVEA 5C0AD 3N6YA 3T0XA 3MV9D 1ZSDB 3VM5A 1ZVHA 2VRAA 3QEQE 4ODXA 1QBAA 3KR3L 3U9PH 3K71A 3LYRA 3V8OA 2A38A 3H53A 5EOTA 2F53E 2VGLM 3HC0A 4MB3A 4G9FD 1Y18B 2JQAA 4BQCA 4ZO9A 3GMOA 1QMUA 3FU5A 3L1EA 3NABH 4KY2A 4N90D 2PABA 1R17A 5DC2A 3KW8A 2A74B 2PP7A 2IPUG 3NT0A 3V0IA 2PWDA 4HJIA 2B5IC 1SQMA 4G2AA 4XCEB 4WTZG 4LLMB 5ADOL 5EU5A 4HUXB 3D07A 4LASH 3SKMA 1MCRA 2AAVA 3HR6A 5J13C 4S1DC 3MQIA 5AVVB 5HVGB 4Z7WE 3ZTNH 2J6EL 1GIGH 2P80D 4TLKA 2B1AH 1VADA 4NIKB 3CFIC 5DJ6B 3SGEH 3K8KA 4KNTA 2H5UA 3SD5A 2WJ5A 2XY1A 3QDJA 3GHBL 3F62A 3ARGC 4IHOA 2BDNL 2O72A 4LIQE 1TVHA 4N2AA 1MNUL 1DBML 4JHVA 1EZLA 4BDVB 1CO1A 2DJ4A 2BMKA 2Y7QA 3QXAB 1OSEA 4X0KA 5FB8B 5J6HB 1IQWH 2HH0L 4MS8C 1AKJD 1IAII 2X4RB 4FQIL 1K9TA 2F8VA 4U6HB 4PJFB 4BE5A 2F5AH 3U1PA 5I1LB 3ESUF 5EORL 2Y6SC 2ICES 2HFEA 3RZCB 1DBKH 1TTAA 2BWIA 2X09A 5GRJH 1FZOA 2DQMA 2D3NA 1JBJA 3X1GA 1KIPB 2UZXB 3AUWB 3N3EA 2VDNB 4WRLA 5BO1L 4ZAKC 3GGWB 5TDNA 4HS3B 2FQEA 4JG0H 3V5KB 3GB7A 2AXGA 4Y2OB 3VXOB 2FZ3A 5IROC 4IKIA 2EXTA 3EADA 2WLMA 4PJBA 2DQTH 2OKMA 4PP2A 4XX1G 1QUNA 2OXHB 3BP5B 3MRRB 1JZ2A 3M86A 1H6EA 1BLIA 2QPUA 4IKNA 4FXKB 4CC0A 1UM4H 2CO7B 4YLCA 2CNYA 2Z8SA 3VFRA 4JFXA 1OT1A 4V1DD 3GBDA 3DSNB 5L7XH 4BZ1A 4AYID 1AGFA 5EA0H 4I3GA 4N8UA 4XP6L 5D96C 2H1PL 1RU9H 2WWKT 2NY0B 3NIFB 4MCMA 1REIA 1EEZA 4NQED 2LQRA 2DD8H 3SJVA 3O9WC 3I9GL 3V5HB 1KG0B 1X5IA 4KDWA 2JQMA 2UWEA 2IXQB 1AQDB 3G9AB 1FPTH 5DUPH 2VXSL 1CFTA 2ITDB 3MOQA 1DFXA 1KJ2L 1L7TL 1MVUB 1FDLL 4Y0GA 4TSCL 3UMTA 2X7LA 4AL8C 2XVKA 5C0AE 4G1EB 3MV9E 4C59B 5AUMA 3BT2L 3U4BH 3G6JE 4GKSA 1WAAF 1MRCH 3VXMD 3PWLA 1LTXA 1PG7L 4K3HA 3ALXA 4J4PD 1OARH 3B7RL 4DF9A 3SDCB 3WJMB 1QWUA 4PRIB 4G9FE 4B9JA 1BEXA 3TBVB 4PV8A 3WNPA 3T1WA 3NOIA 4JQXA 2CR0A 4WNQB 1OANA 4N90E 3WN5C 3OKMB 4X6BA 4ATWA 5IFJA 3RTQC 1WBYA 3LEYL 3MV7E 4JJ5A 2MOVA 3RPKA 2Y1YA 1AZCA 3DX1A 3LVTA 2DI7A 4YHYB 3BP7A 2X4UA 2ADIB 2DPKA 3DYMA 5HPMB 3NFNB 5GSVA 4PJGA 1K4DB 3EYVA 1DSWA 3I75A 1ANUA 5B1CA 5JLZB 4XO9A 2JB5L 1J86A 4LOFA 3MJ9L 1ZSHA 5CP3A 1FGVL 1XDTT 4X6FB 2OCJA 3QUML 1CURA 1EERB 1RL1A 1XR8A 4NERA 3UO1H 4M6NL 1N18A 2YR3A 2UXVA 4BE6A 5F6IB 5KBKA 4N9GA 2E7MA 3UGEA 3MTRA 1NGWB 1L6ZA 2JJUA 2EABA 5C0DA 2WXHA 1YECH 4GW1B 3VFMA 1ORSA 1G7LB 35C8H 2C9PA 4ZDHA 3HPLB 1EWHA 2UZIH 3APNA 5SWQB 1IBGH 3P73B 4GUCA 5DZJA 5IHLB 2HX9A 3CMOH 1JXKA 3ZDYE 4APQA 3PHQB 2AV7A 3KM1A 2Z8WC 5JYMA 2CWRA 3MRHB 3V4PL 1NAMH 4ABUA 3TYFB 1OPGH 3JWOL 3BXNA 4XNUH 2YAEA 4FCHA 5BV7C 2WTRA 4IIQB 4M4PA 4MRBA 2GSGA 2OR9H 4GFXA 2FB4L 4G72B 4FHJA 1ZANL 4H2CA 2W0LA 2KLRA 3MGTA 1BFVH 3GZQA 4UIKL 4V1DE 3UP1A 5FO8B 3V4LA 3IETA 4FQXD 4FQJL 4X5WA 4K3DL 4OUUA 2A74C 4W4NA 1BBJB 3NA4A 5AKSA 4PWKA 4OD1L 1KCUL 1JDDA 4NQEE 3OPZH 1AIFA 2FT6A 2OMXB 1OGAB 3BO8B 2ALAA 4IRZL 4WW2A 5TK4A 3DX4A 1JF5A 5AOJA 4NWUL 3Q3GB 3GMNA 5FCSH 1QW9A 3LXBA 1C5CL 5IB2B 1LM8V 3ARQA 4UANA 1Q9WA 5JXEA 4YE4L 4ZUUB 1IU1A 5ITBL 4RBPH 4CBZA 3MVSA 5ETUB 4YXKL 4J3TA 4U3SB 3U79A 1Z9PA 3OAZK 3HA0A 4X5QA 1KJVB 1A1MB 4HYTB 4BFKA 2IBZY 3FFDB 4ODTH 3EJPA 4HU2A 3GD1C 4AQOA 4NI6A 3VD2A 1B9ZA 3QC5X 2BHZA 2E8ZA 5HHVH 4KRPC 4LSSH 4NC0B 3WV0A 4ELMA 3GJFA 2ZIDA 5B1KA 5DJAA 1EHNA 2H3NA 4L8SB 4GBXB 5HDBB 3P11L 4Z0BH 3KCWA 4MHHG 2I24N 5L9DH 5ISZD 3RZCC 5EIVA 3CH1A 4PLOB 4PJCB 3OVUB 5BQ7B 2VDQB 4QRUA 4M5YH 1IC7H 5AZ2H 5JIQA 4ENED 3KR3H 3D25A 3BPNC 3QHFL 5HDLA 3UL4A 1EJ8A 2MNWA 5LAXB 3QEUB 3NJFA 4TTDC 2JK5B 4J27A 3VFTB 5JQIB 4NUPA 5DJ8B 3DHJA 1EAPB 1G6RB 1CBVL 1CVSC 1BYPA 4PRAA 3D51A 2WO3B 4FQQB 4XRCA 1BECA 5F7YC 4Y2DC 2OYKA 3CH8A 3ZHFA 4RFOL 2JLPA 2V9TA 1SXCA 3SBWA 1VAHA 3P2TA 3C9NB 3LJ3A 2NYZA 3HN8A 4P5KA 5I1JL 2C34A 5EBLB 5DR5L 5AYQA 3VI3B 1G7JB 3VFOB 2FO4A 3VM7A 4NJAL 5ADOH 4JDEB 3L4VA 1PZSA 3H7BA 3TTYA 3BW9A 3F83A 4NJ9L 4H5SB 4Q2ZB 2DYPD 2A2QT 4XR8C 4GI9A 5IOKA 3NIDE 2HRGA 1YYML 5I76A 1YNLH 5F7WC 4UOW0 4X7TA 3OZLA 3GHBH 5T33L 3UCQA 3HHSA 3EYQD 5JMOC 1HIML 1JK8A 5I73B 3ZDXB 1MNUH 1U92B 3IDJB 2BNQB 4BSWB 1HJBC 4Z76B 1PPIA 4R4BB 1Z0MA 5BUAA 3IMTA 2QSTA 4U3XA 3V4VB 1YMMD 1UQSA 3BQUB 4PTTA 1XAUA 2HH0H 3C6LA 3C08L 4WDIA 5KUMA 1GTFA 2DOCA 5EU7C 3N42B 5DD6A 5HGAA 3QWQB 5GGTH 5T1LA 4ZTPL 4TNWK 2ZOOA 3KHQA 4HMCA 3EH4B 4JGMA 4IGBA 4JDVA 4WF7A 1Y07A 3MRBA 1I1AA 4G8AC 5EC2B 3ARFC 4HF5H 4KI1A 3I6KB 2NSXA 1EZSA 4TSBL 4WHDA 5FO9B 1PLBA 2VL4A 3IAQA 1N7MH 5JYLA 4GW4A 2GJ6E 4WQOA 5BO1H 4TLTA 4RRPG 5E4AA 2JKNA 4XX1E 5LB1A 2KZ1B 4N2GA 4DGIH 3ARUA 2NUPB 1LO0L 1CYXA 3Q8BA 4WO4B 4LVHC 4HMEA 1YY9D 2L3BA 2I9TA 3UAJC 4NUMA 5IESL 3RIKA 4YDKL 3U9WA 4PM1A 3SE3C 5HSFA 1UWYA 4PCSA 3ULUL 2BJML 3B6SB 4JPKL 1X5FA 5I2IB 2GTWB 2CRYA 4XP6H 3L5JA 2H1PH 4HS6A 4OZGE 3V9EA 2P46B 1IQDA 4P4KB 3T1FB 1NCBL 4Z3GA 4NQTA 5FFLA 2VR6A 5FYLL 4HBCL 1SEQH 1MLBA 2XN2A 3R7QA 3OZ9H 5D1XC 2I32A 3KGSA 2TRYA 4O00A 4JO5A 1EDQA 4IS6A 3WYRA 3AFLA 2VXSH 3AY4C 4QYOA 1KY7A 2GC4C 1MCWW 3MREB 4JS7A 1KJ2H 4JUTA 3HOGA 4PJ5D 5DD1H 3UGUA 3W2DL 1X7QA 1NWPA 3ZHDA 1HZHL 3K6OA 3TNNA 2WTOA 5CIPB 4ECNA 5F9JA 5KG9A 3K6SA 4R84A 3C5SA 5JUEH 2HT2C 3KLHD 2X2JA 3C5XA 3QDGB 4ZTEA 1MIML 4IIQC 5KYYB 4N0UA 1G9EA 2O5ZL 2OW6A 3KWXA 1YG9A 4HUWB 4GB9A 2ARJQ 3MGOA 4NS0A 2P3YA 2A9MH 3O3UN 3LH2L 4PJAA 4ZO8A 4K94L 2CIIA 5AL8A 3MRQA 1G9MH 4QT5B 3FT2A 1JAEA 2CHWA 2VYRE 3JXAA 3KHOA 3ZE2E 5B4MC 2VSDA 1P6WA 4JFZL 4X8CA 1RQ5A 2XZCL 1AZUA 4Y5VB 3OGCB 1J0KA 5DMGC 3H9HB 2D9CA 4ZAKA 5HJ3B 1JJUA 4QRPA 2DEWX 5CUSL 5IROA 3U30C 1CK0L 2MTAA 3OJMB 4NRYA 3IFPA 5I6KA 2JB5H 3KPRB 4ZUSA 4JM2D 3VDCA 2VQUA 3B83A 3MJ9H 4ZFGL 1S7XA 3GMLA 1BIIA 2WVSA 3O3EA 1FGVH 4AT6A 2QT6A 5K5YA 1JHTA 2FJGB 5K9KA 1CD0A 5EDXA 3U0PB 3MACH 1YMME 4XPHH 2XDHA 3MXVH 4PJHA 4JGJA 1KZQA 5KYUA 1MI5D 2QFPA 2XBDA 4NSKB 3O9WA 1EFXD 5SWSE 5GZOA 4BV1A 4L8SC 3FAWA 4HOWA 1Z66A 2E0PA 2HX8A 3PREA 1QSEA 1MCQA 2ZUUA 5D1ZD 1YVLA 3EO9L 4YHMH 3T3MF 4WLCA 3RURA 2ED6A 4HPYH 2WXRA 3BWAA 1R0AL 4L8DB 4HUMB 2QVFB 1NQBA 2XV0A 4UAHA 3IU3B 4GAJL 4D7BA 1PTZA 3JWOH 3F7YA 3LKPA 4P9HL 2XHNA 2J7LA 5KOVC 4KMTL 2AQ2A 2FB4H 3HMXA 3UAEA 1ZANH 5JTWA 4YVNA 2Y1ZA 4UIKH 5F1IA 5IM7A 1INEL 4ONHA 4L3FA 5LCVH 4FQJH 4NKDB 4Y1AA 3WN5A 4OGAD 1P2CB 4K3DH 3RTQA 2OTUB 4RNRB 2ZWSA 1T2XA 3HE7C 3BE1H 2WXMA 2WXJA 2QVTA 4JUSA 1TMCB 2Q76A 1CLZL 5JHLA 5F3HB 4IRZH 3HE6D 4HALA 3W9EA 5I0ZA 1U91B 4NO2A 4NRXA 1O7DC 1A47A 5DA4A 2WUCH 1FNLA 5GRWA 2YOCA 1HSBA 4JHBA 4NCC1 2VLMD 2WNWA 3DPDA 3F7VA 3D85A 4PJ5E 2EKSB 2HLFC 3HS0B 3ZZLA 4WWID 3I9AA 4JK0D 3UEZA 4TVPL 2B1OA 3LZFH 4KITB 2J12B 3LKNB 4L37A 3ZT7A 5ICZA 2P24A 1VKXB 1E28A 1EAQA 2CJSA 1KPVA 3B9KB 1FJ1A 1T22A 3D12B 4EEEA 4XBGA 1LO5A 4WW1A 1VA9A 2P5EB 3CV5A 4YHOH 3G5VA 1E9QB 3DA0A 4AG4H 1AQ8A 2EDXA 2BRQA 4P2QA 3RFRA 3U7WL 5A2CA 1LO2L 3FQUB 2DQ6A 4YK4B 4YBHA 4BINA 4FXTA 4OIIL 4NO0A 3QSKB 1F41A 1QSVA 3EOAB 2X6MA 1PJWA 3DIDA 3SIKA 4UT6A 3QHFH 5IBTH 3WTWA 1FFPA 3E2HB 2PR9A 4NQDB 4UB0H 1JNLL 4KGLA 4P3DA 2ZOLB 3VFSB 4WI0B 4JDZA 1CB4A 1ETJA 2N7SA 4N8CL 5E5RB 2Q10A 4YSPA 4MA8H 3EOBB 2ILLA 5DS2A 1LE5A 3AU1B 3CG8A 1T89C 1MAKA 4KZEH 4PJ7B 5I1JH 1GW0A 2IDTA 4L3AA 5EUOF 4ZUTA 2FSEB 2K6WA 4XX5A 3DOIA 1DQTA 5HDRA 2IAND 3RJQB 3V6FB 4B9KC 3JTTA 1MI5E 2D0FA 4LLMA 4NJ9H 3REWB 3DVGB 8PAZA 1UZGA 32C2A 3DX0A 4DP8X 3DMMB 1ED3A 3P40A 1HXMA 3SYCA 5K9OA 1N0LB 2IBGA 5T33H 2CO3A 4YHLH 3QWOB 2YOAA 3EDFA 5E2VL 1I7UA 1NGZA 4MA7L 4ZW8A 3BUPA 2JJTC 4MNQA 2J8HA 4QXUL 5KVEH 2XKUA 4K73A 4ONOA 1KFAH 1ADQL 1JYNA 3ZOAA 3OAYK 3J7HA 1I85C 1O7VA 3MC0A 4CKVX 5HYSB 3A6BL 3GF8A 4U49A 4XNXH 5F2FA 2Y07L 4LHUA 5I24A 1NCTA 1BAGA 2WQXA 3EO1A 4TQPA 4ZTPH 4MQ7A 1E6JL 5BRQA 3UG5A 5HHXL 4Z7NE 3QUMA 2GUYA 3KPNA 3VX1A 5GGVL 4TSBH 4OBSA 4Y19B 3S4SG 1KBPA 4X9BA 4BFBD 4Y5VC 2XXCB 5IB5A 2WMPB 1RSFA 3QJQB 1LO0H 2KYIA 4WKXA 3TONA 5BVPL 4WJG3 4K9JA 1NZRA 4FQ2H 3NDZE 3P4NB 2WUBL 2X4OB 5IESH 2VLME 3AUVA 1LXMA 2J73A 1RHHB 3IJ7A 1KGXA 1CE6A 4G59C 2VXTH 4Z23A 4YBQD 5I9QC 1OSZB 2YPVA 4CBPA 1N5AA 4Y2DA 2BJMH 4PJ8C 2JJWA 1QRNB 5DDHA 1FO0B 2W0FA 3DSNA 2WC7A 3GDBA 5D4IA 1EJOL 5A6IA 3P9LB 3V4PA 4BFJA 2QADB 2K8QA 1YPZB 4B0MM 1BVNT 4B9IA 1XWVA 4QXGL 3CZFB 2YKLH 1ACYL 2E9GA 3OX8B 2YGOA 1UD4A 2IGTA 3GMMB 4BK5C 3ULVC 2WW8A 2BVPA 2L7QA 1CDIA 4PWFA 1UC6A 1YNTA 2XN1A 3GFUA 1OM9A 2AABL 5CJXA 3US0A 2UY7A 4OF6A 4TYUA 1SXZA 1VCBC 4A68A 2DTSA 3I02B 3PGCB 3W2DH 4L1DA 1F11B 1D5BB 2EE3A 2GJJA 3BKJL 4QI3A 3QCUL 1HZHH 4E5XG 1S7RA 1KCBA 2X4NA 3ILPB 1HQRA 2A6IB 2OMTA 1H3UA 4PG2C 4ONFL 4P2OD 4NBZB 1CGUA 4CSZA 3K5SA 1YDPA 4GT0A 1FYHB 2IH1B 3S3PA 1M7IA 1FFOA 2EE9A 3JV6A 4QY8B 4V33A 3WUWB 3AXIA 4AJ0A 1MIMH 4XHJC 2O5ZH 2IPTL 3OKLB 3S35H 4GLRI 1Q0XL 3S36H 4K94H 3TXAA 3WJJC 4FULA 1BZOA 1JD9A 1CICC 1XZWA 4GRMB 4MDIA 3ARFA 3RB5A 4FERA 2OP4L 4JFZH 3NZHL 3WLWC 1X5LA 2IANE 2DEYX 4M5TA 2WOBA 4E9YA 5B1JC 1RZJL 3WFEH 1PZCA 2APVA 5CUSH 3VDAA 2CUMA 2VR3A 1CK0H 3HG1A 2FIRT 4OCXL 5F21B 3UAJA 2MRYA 5BOJA 3LZPA 5D7IE 1U8JB 5MENB 1SHWA 1HHIB 3LZNA 4QTIH 2O6EA 2H3XC 3HS0C 3SE3A 2A99A 5KS9E 2R27A 4AGLA 1R3HB 3UTTB 6FABH 1SN5A 4AE0A 2OZ4H 2HPOA 3DGDA 5CHNA 3WEMA 3HAEH 3ESMA 2G2PA 5DVKA 2BWQA 3BMWA 2R51A 5EZJA 3HR5B 4YPJA 1FL6A 3S0PA 2G0LA 3VGAB 2X4SA 5HTSA 1J8SA 2PXYB 1MEXL 4GMTL 1P4UA 4UZGA 5E2UL 3TWCL 1TKWA 4GY4A 3DX8B 3VD9A 2VJ0A 3TVMD 1KLGB 2C4FU 1FIGL 1NBZB 4NBYB 5D1XA 1RKRA 5E08L 5D7LA 4P0DA 1XSOA 4PU2A 4M62L 5DRZB 1H9VA 1SJHA 4P5TB 3CNKA 1C1EH 1KEGL 3S35X 3AY4A 2FJHA 3GBNL 1KELL 2AK4A 1X9QA 2XWJB 3S36X 3FOLB 3P73A 3GMRA 3IXAA 3LCYA 4UOZA 1JHLL 4M8UA 3FU9A 2XZQH 4GQPH 4XP5L 4YE0A 1R0AH 3IJ9A 1I8KA 4JRXE 3TF7C 3E2HC 2QLYA 2ZUQB 1SY6A 3CHOA 3MRLA 3QUZD 4Y2LA 5KBLA 4LCCB 1DQQB 4X6DB 1INEH 2IAMB 2V7HB 2NZIA 3I50H 3IXTA 4GYBA 4YPGB 5C0BB 2X44D 2BY0A 3OSKA 5HXMA 1RJCA 4M8QA 5E24E 1A6TB 1KN4H 2ZSWA 2NX5D 3F7QA 1I7TA 1A22B 3DNKA 1AZNA 2J21A 3BVTA 5E5LA 1G9NC 1OTSC 4MJIB 1WT5C 3T6ZA 1HNFA 5IWLC 5CS7A 1U3NA 3BO8A 4U1MA 4HZAA 1AHWC 2WLLA 2CIKB 1WA2X 2PTTA 3DMMC 2QZ5A 4ZQKA 4BIKA 2YQGA 4F24A 1JRHI 2YGPA 4OD3L 4KOCA 4W9KC 2G5BA 3T0BA 4JN2A 1EA9C 4XNBA 2BCMA 4MYWB 3FU3A 5KSBA 4Y5YC 4AM0B 2FX8L 2NY3D 4JANA 3ZQ9A 3TF4A 1FVDB 1EUTA 2NY6B 2XTJC 3FONA 1A1MA 4UBDD 3BMVA 4F37F 1IRAY 1E9OA 1IC5H 1S7QB 5EBWA 3FOMA 2Q6WA 3CZEA 2ITCB 2A0LD 4PP1D 5AD0B 3MJ8B 2GKIA 1MW1A 2Q3ZA 2UX6A 5E99L 1JGDA 1XGPA 2QQNL 3N5AA 1JZ6A 1Z9MA 5SV3A 3U7WH 2PYFB 1S2EA 2CMRL 2DMGA 2YFOA 3BDYL 4OZ4B 4Z3HA 1ZHLB 1SYVB 1EMTH 4ZZKA 4PVMA 2OMWB 3TO2B 1JPGA 3OM3B 4A37A 4L18A 4X50A 3VA6A 4H1LA 1NICA 3HI5L 3CSTA 3IJHA 3P2BA 4UNTA 4DJMA 1RUQH 4JEGB 1CDJA 1XCTB 3QPKA 2HTKD 1NIBA 1JNLH 2P52A 3JVFC 2R2BB 2CBPA 2WK2A 3JWDL 2AQ1A 4Y4KC 4S0TD 2OM5A 1QTYT 3MV01 3SBRA 2W60B 1KJMB 3P69A 4N87A 1KYAA 5JOPD 3P77A 4JKMA 3LH8A 2H0EA 3ZXAC 3O6FB 4ZUWB 2XFGB 5EZLA 4POUB 3CN3A 4CADA 2Y7LA 4MDJA 3ECWA 3X11A 3RA7L 3HE7A 1AR1B 1G7JA 4AVKA 3H9SA 2CDGB 3HZKA 3MV8D 4KKQA 2FEDC 2JCCB 1MFVA 3L1OL 4Z3JA 3S8GB 4Q2ZA 2MHAB 1A25A 1FL3A 1G7QA 4H26B 1S9VA 1A7PL 5IEKA 3GT6A 4GW5B 2ROXA 1TJHH 3FCBA 3VRJA 5EBMB 4FQCL 3KBEA 4NUJA 3WTSA 5D5ME 4B7IA 2ICEB 3APDA 4MB1A 4MA7H 1BGXL 4QXUH 4K0OA 2VDLH 1SXBA 3IDJA 4JFPB 4MMZB 2BNQA 1ADQH 2XN9D 4BSWA 4I2XE 4R4BA 2BP0B 4JZNB 1GC1C 3US1A 1KLUB 3G04A 4O2CA 1BQHA 1J1PL 5FUOL 4ZI8A 3P3UA 1NPUA 3TP4A 3CVCA 4QLRA 3S3DB 4XPFL 3X2QB 4ABVA 1BDYA 1J10A 5KBPA 3GZOA 4KRLB 2Y07H 1A2YA 4HX1B 4LLYB 3MLWL 5E9DD 3QUYD 3RWGB 1E6JH 4XPAL 5HHXH 4F2ME 2NQ3A 4HXBL 3UERA 3CK0H 5GZNA 1OE2A 4PJBF 3PL6C 4B50A 2YSTA 3CIQA 4MZIA 5D6CB 2NX5E 2VZUA 3I6KA 5DJ0A 3T0ED 3VXPB 4AVHA 2X6AA 2ZT9C 3FO9A 1II4E 1UD6A 2XPGB 4IIZA 4JQIL 3UIYA 2H45A 3IWUA 3BSZH 1OGTB 4BKTC 3P9MB 3QUKB 4L3ED 3VMNA 2EDKA 2AHIA 4X5XA 1M1XA 4JZOB 1B3JA 3B9EA 4CDGC 5D9SB 1FV1B 2WUBH 2Q8BH 4PRNA 3QJHA 2JIXD 3T71A 4JR9H 3QXVA 4B6ZA 2VMCA 2E6PA 4O02L 5TH2B 4HK0A 1OP3H 5CEZD 3N44B 1JWSB 2MEJB 2YBGA 4PB9H 5ALBL 3TNMB 2CR6A 2A1WL 1G5AA 2UWEF 1T89A 5BRZD 2NZ1A 3F6JA 1RUML 3HUJF 3RB7A 5IVXA 4X8JB 4PJEE 4GIOA 3VGAC 1X6LA 3G6DL 2PXYC 4HKJB 2FSDA 4YLQT 2X53A 4CJ1A 4FG6D 2MCG1 4PRBB 1OL0A 1YJDL 5CJOL 5DLML 2AABH 1L9OA 2GT9A 4R9HA 3RHWK 1MPAL 4MVBC 1FG2A 1M7UA 3F7RA 2Q86B 3X1EA 4P5TC 1OK8A 3C2AL 5KJRH 5CSGA 1OOWA 2VMFA 1GPOH 3PJNA 2JJTA 2EDQA 5I6XB 3U1SH 4FZEL 5DWUL 4R6UA 4ONFH 2NY4B 2KL6A 2YD4A 3NCMA 4IK7A 4L9LB 5TK2A 1GGIH 1NAMB 1YCSA 2OJZL 2ZUQC 3BKYH 4MD4A 3RL2A 2GJZB 1U9KA 3QDGA 1A6ZA 1N70A 3KL5A 5JOPE 4HD9A 2NY0D 5B21A 5AB9A 5KJ7E 2XWCA 4UCFA 4AY0A 4DGVH 3ZMEA 2IAMC 3QRBA 4PJGF 3WY3A 3MX0B 1OXYA 2Y25A 1DSFL 2GCYB 5DVLA 3HG4A 1BV8A 2OMYB 3NZHH 3U4KA 1HI6A 1DN0A 1DZBA 3UIZA 2XWRA 1N0XL 4P04A 1INDL 2FHBA 1ZY9A 2QVKA 4G7QB 4Y5VA 1WGVA 5AOKA 3MV8E 2AZAA 1OCRB 4HIHA 4POZC 2MQGA 4UT9L 3TEXA 4M4RA 2V5RA 5T1MB 3VH8B 5LQBL 4OCXH 1KC5L 5DURB 4OKDA 4X7SL 3BZEA 5F8RC 2J56A 2B39A 4X6CA 1VACB 1ZLDA 3O3AB 4AYBA 3C60B 5HYQA 3UADA 2XQBH 1RZPA 1IM9B 2FO8A 3TBSB 4TTGA 3SDCD 2JH2A 2MMXA 4PJ8A 3ZL1A 3IFLH 4JFDA 2XN9E 3HRZB 1NGQH 1V5JA 2CPUA 2NY6C 1JV2A 2XETA 2DS4A 3D52A 5K9QG 4OV5B 3WXWL 1NLDL 3BUYB 5T1DH 4K9EL 3WFCL 3FN9A 3QO0A 2ITFA 3AG3B 4NHCL 2EXYC 1QSFB 5F6HI 3LDBC 1LD9B 2VISA 4BK5A 5E9DE 1MCCA 1M9WA 5FKAA 4ZFZB 3NH7L 2JF1A 3QI9D 4NSKA 1WHOA 3VXUA 1JZ4A 2QPDB 1TOXA 1ZPUA 4ESKA 5H35B 4F58L 1V3KA 3FRPA 1KELH 3FT1A 1YMHB 3T0EE 3D0AA 2EXWC 5E6ID 1JHLH 4W9CC 4IBSA 2FD6L 2WKOA 3DO3A 4F57H 3BWUF 3DRTB 4L3EE 1RP9A 3MNDA 1CGYA 1FBIL 2OMZB 1J0JA 1IGYA 1XR9A 4BWTA 3B2DC 1QKZL 2VUKA 1FL5A 4HGMA 5AVSB 4KHXL 2CHDA 2G9KA 3MRCB 4WW2F 5SX4H 4CRPA 1G94A 4R4NC 5TF1L 3DX7B 2P45B 2GFBB 1AE6L 5G4OA 1IAOA 1JGEB 3EXLA 1CICA 2EADA 4YS4A 4PJFE 3UJJL 5IQ9A 5CILH 4WEUD 4EBQH 4Q6IC 4HA1A 3ZQWA 1AR1C 2QMJA 1PAMA 4Y8DC 1FNHA 2ICWB 4KK6D 5B1JA 1YAZA 1IGJB 3RY6C 3GKWH 3R1GL 1U91A 5ESAB 2WYIA 4QRRB 4OD3H 4R2GD 4IRJC 2ZP9A 1A0QL 4HKXB 1RFDL 5JHAA 3KPSB 3FPXA 2EKSA 2YXFA 4GUOA 3CDYA 1A6PA 2FX8H 4ELMF 2RFXB 4N1EA 2A77L 1F02I 1DHKA 2YN5A 1KYFA 4L29B 4AV4A 4DT2A 5IREA 1XAKA 1FVCA 4W70A 4UF7C 4MMZC 4ZQTA 3FFCD 3IE4A 2LABA 4PY7B 5KYNA 2NY2B 1NPJA 3CLFL 2AJZA 1AJ7H 3FT3B 3ATBA 5E8PA 3BAJA 2O1AA 2D3JA 3EJQA 3NK4A 1HFUA 3FB6B 4BFIA 4C4KO 5ICYB 5E99H 3D3VA 2NQDA 2NY5H 1O9ZA 4KNSA 2D9QB 4Y4HD 4S1RL 4X42A 2YAOA 2CMRH 5LO7A 4BRJA 3RNQA 5C08D 3D30A 4G71B 2MKWA 5E70A 3U2IA 2BWDA 2ZG2A 2GITB 3FU7B 2J88L 3SQOL 4A6YA 3L6FB 5AOMA 1T1YA 1XB6A 2V7NB 2VLKA 1TETL 3J2PA 2NW2A 5JHDA 3OKNB 5EEZA 1KGUA 1Q72H 4XI5C 4C57C 5EU4B 1YNKL 2P8PB 3RWIA 5INDB 5LWYL 4M7KH 3JWDH 1JGLL 1GGUA 1LL1A 3BH4A 3ZT6A 1PZDA 3EZ8A 3QRGH 3RIFF 1AC6A 2WCPA 1UM5L 3B2UC 3OXSA 1P53A 2ROYA 3MNZB 1P84K 3K2IA 1A64A 1UKSA 2N1KA 4L9DA 3UZVB 5IB3A 1EBPA 5IBLC 5C2BH 3AU1A 3SY0B 2ZXQA 3D0LA 1L6XA 2K6ZA 2I9LB 3QIBB 2Z65C 4GBXD 5D72L 4JM4L 4MA1B 5D1QB 2X4PB 5IWLA 2LFGA 3DVGA 1AHWA 4G8FB 1I3VA 2FR4B 1J5OH 3MRDA 1A7PH 1M05A 1HL8A 1N0LA 2IIJA 2YMOA 3HKFA 3LH9A 5DJYB 4F8OA 2VLJD 1BVOA 1EQWA 1BGXH 3QORB 4Z3FA 1JI1A 1KJ2B 4GKZB 3LNHA 4U1KA 4Y5YA 2H0PA 4P2RA 4XWOD 3G3LA 4XVUD 1A21A 1G7PA 3NTCL 2DBLL 2NY4C 4JN1L 5IW1A 3QFDB 2D73A 2ED9A 2GBAA 4XPFH 1BYNA 2X3AA 4N0FA 3MLWH 5DHDA 3QC6X 4QHKJ 2CRIA 4XPAH 3IJYB 3OLEA 4MJ6B 4FLQA 5AL0A 3VGEA 1TQCB 2OX5A 4NFBA 5JO5B 1T3FB 2F7RA 5CKAA 1N6QL 4RGMB 3DVFA 2DLFL 1MRDL 2HG0A 3M8OH 3BGAA 4LPYA 4NP4L 5H2BB 5EU3A 4CW1A 2RCSL 5C8JB 4OZFH 1LO4L 1HINL 2C8NA 3FUJA 1ZVSB 3BGFB 5DEGA 3TV3H 4BZ2A 2VXUL 4LCYB 2CM6A 4LIQH 4ZZFA 3CIAA 4CILA 1EDHA 4F7EB 5FFGA 5F7MC 4Y4KA 1XXDC 1S5HA 1NC4A 4ZG1A 3RVUD 4ATTA 4FYRA 2BSRA 2DBJA 3BQUD 5IMOB 1SXAA 5DK0B 4HSQA 4AMWA 4KO9A 4M1CC 4G42A 1CFNB 1QUPA 5HY9B 2A1WH 3FO1A 4G7RB 5EU6B 1G9HA 3S34H 2BSTA 1LEIB 2UYLA 3FQRA 1AY1L 2RQ8A 1MCBA 4YOKA 1CIUA 3CN4A 1JVLA 2NY7L 4AX3A 2XRAH 3N1QC 1CU4L 3D6GA 5CCJA 3BVDB 5E6UB 3WHXB 2KPWA 1SHSA 5F0JB 1UA7A 3QZLA 1DANT 1YJDH 3OX8A 1TSRA 3SO5A 5CJOH 1PFCA 3DO7A 3TFKC 1MPAH 4XE5B 2A4EA 2EC9U 5EIIB 3WS3A 5FA3B 1E8XA 4WO4D 1AD0B 3V10A 2Z93B 5ECJE 1AP2B 2W88A 3RLSA 5B38A 3EHBC 3OC8A 4QXVA 5H4YA 3VWKC 2NR6C 2I7OA 3OKOA 2CBTA 4LCWA 3IGAB 5KJ4A 5ADPH 4X4YB 4QXTA 4BFOA 2E6JA 1QPPA 2CJUL 5AG8A 1FYTD 5DQJB 2BP8B 2D7OA 2OJZH 3T3ME 4DK3A 1ZLUK 1QI4A 4UT7L 1AD9A 4UILH 4GS7C 1R24A 2FX9H 4JO4H 1YEHH 1CC3A 3MMEB 3G5XA 1RZKL 1EXGA 4F8LA 3SE8L 3ARRA 4DPBX 4OCNC 3PL6A 1DSFH 4HWNA 4F93B 2LT9A 2X2YA 4EN3D 4UM8B 1F58L 3PNWA 1INDH 1ZS2A 3D69B 3VB9A 4L4VD 1X5HA 1UXSA 5AVUB 4NI3A 4ETYA 1RCYA 4PJCE 3F5WB 4UT9H 5LQBH 5IB1A 4HKZA 8CGTA 1RK7A 2GVYA 3QQNA 3F8UB 5HHQB 4PJHF 5FDYA 2VLJE 2ZOWA 2GIXA 2ZCHL 1IT9H 1YY8B 3CVDA 3F00A 2I60L 1A6UH 3O4LB 1R3HA 3DJZA 1C8QA 2F54B 3BZ5A 4MS6A 1MKFA 5F44A 3AAZA 4AUYA 3ZRCC 4K9EH 1F4AA 3WFCH 5HGHB 1UA6H 3U6RB 4NHCH 4D7PA 4ZOEA 2PXYA 1LMIA 2Q8AL 1EFQA 1QNIA 3QZWG 3WTXA 3PWJA 4JFWA 4U3HA 1NOLA 1GHFH 3UYRL 2ZF9A 4I18A 3NH7H 4J3OF 3K4DA 4WFFD 3N85L 1NBZA 4X0NA 1Q0YL 2AQ3A 3VFNA 3QQ9D 3KYNA 4U1IB 4F58H 1I1YA 3SZKC 2WKGA 4ZW6A 4AXWB 2V8LA 1OTUC 4AQ1A 3FOLA 2FD6H 1QLFA 4NIYE 3RYMA 3WIFB 3HRPA 4WKZB 2HTLD 1AC0A 1F45A 4DGYH 4KX7A 2GHZA 3AJ7A 1A9BA 1QKZH 3MXWL 1ZT4A 3UTSA 4KHXH 2EEDA 4JBSA 4Z7VA 3MRPA 5C9JB 4RIRB 3SZ6A 4LF3B 1SJEB 3TH4T 4LKXB 5INCB 2V7HA 2HT3D 1D5MB 3ZTEA 4L8CA 1KEML 5HVHB 4HIIB 1RK0B 4D0CB 4G83A 2GSIB 4RGND 3IM1A 2YPKB 3R18A 2H26B 4QF1B 2N56A 4MA1C 5EUOE 2WSDA 5AAMC 5D1QC 4XZUB 4AI7A 3ZYIA 4P4RB 2CO2A 4GJTB 3MRIA 3H85A 1A0QH 3BGMA 1D5ZB 1RFDH 1WFIA 3BAXA 4MWFB 3Q5OA 4XVJH 1ORQB 4N5EC 5FUZL 1NBVL 1J5DA 3AZUA 2A77H 3DX6A 1JZ3A 4JQIA 1CUOA 4PJXA 4MZ2A 5LLIC 1FYTE 2OI9B 2IQAB 2WLIB 1TTGA 4QHMB 1UATA 4YXLL 1TQWA 4MMXB 2QSCH 4I48A 2DLHA 4ETQA 4UMSA 1LWHA 2W07B 3L48A 3FBKA 4S1RH 4O02A 2NTSP 3QDMD 4B9ZA 4HDIB 5CEXA 2YC1A 1TQCC 3U2JA 3VTAA 3TJEL 2AMUA 2J88H 3AREB 1G9MC 3MZTA 4RGMC 3SQOH 2PYED 4D0DB 3FH7A 2XFXA 3ARDD 5I1CL 3WAJA 5D7EA 3RKDD 5CBEB 2GHWB 1W15A 1JFQL 1NIAA 3FMGL 4KX8A 5FIEA 4FN0A 4NN7B 1LQSR 3DX3A 4D9QD 2PCPB 3PWNA 2F7OA 1JGLH 5FUCE 2XA8L 3GUTB 4FFYL 2WXGA 5IVZB 1S5IL 3KYAA 3MA9L 4LNRB 1CDGA 3AQDA 3B9KD 4UIMB 1YN6A 1UOWA 5CMAB 3EDEA 2VSMB 3OKKB 1AGBA 3C6EA 4NRZB 4OLVH 2P5ED 1F97A 4Y16B 4JRWA 3SN6N 2ATKB 3WUWG 5D71H 2FGWL 3P9WB 4DPRA 1BOGB 3KYOB 2X87A 4Q6IA 1GOGA 5D72H 1LK3L 2V17L 4J3SA 4C56B 4M5ZL 2RB8A 1RZIB 5CKGA 1F6FB 3MNMA 5LUMA 2XY2A 2KZBA 2OL3A 1U3HD 2Q5BA 3RY6A 3K6DA 1JXJA 2VL5B 5HJGA 4WFFE 5E2WL 1F0LA 4JFQA 4TNEA 3X12B 4AQEB 2W65A 4U33A 2E9BA 3NCXA 2YWYA 1D5IL 4H26A 5LKNA 1K4CB 4IRJA 4AGPA 3NAAL 4I85A 4BM7A 3GO1H 1HJCA 4NQDD 3IGKA 3DOHA 3TA3D 2EUWA 1L6PA 4U0RB 3UJIH 4E9VA 3UJTL 3VJ6A 1SOXA 2DBLH 4JN1H 1S6NA 2MWCA 2CLZB 1E65A 2E7DA 2R0WH 2O6DA 3LIZL 1U8MB 4JL1A 4PD4K 4XN5A 3DVIA 3DXAA 5DGRA 3FQ4A 1XGZA 3C8KB 1C12A 1NM9A 2AEWA 4U3CA 3O3BB 4AIZB 3VW3H 1BWMA 4EQ3A 3WE6B 1TFPA 3ARBA 1ZE3C 5CCGE 2XWEA 5CO1A 2C9QA 3MBEB 4F3FA 2DLFH 1MRDH 2OMVB 3K6FA 1ZT1B 3M88A 4RGNE 4I4WA 4MMYB 4OKVB 1TNMA 2ZKHL 4Q58C 4XBEH 2D8KA 5TGBA 2RCSH 2BXYA 1AZBA 1OCZB 5ALCL 1HINH 1OGTA 4PMEA 3THML 2VXUH 5DT1L 3HG0A 4WEBL 5L8KB 4I0PC 1PNCA 2DWDA 3BJ91 5JDSB 1T21A 4EN2A 1AYRA 4DO6A 3LS5L 5CZVH 3RWDA 5FECB 4OLYH 3IF1A 4RRPM 1J1OL 4Y5XB 4JAMB 4PJDB 3D0VB 3Q05A 2IAAC 2XBZA 2ORBL 1LGVA 1AXSB 1J12A 1JWSA 1YNTF 1AY1H 5DZOA 1JWMA 3STLA 3HAEB 2F7PA 4UAOC 2NY7H 4GAFB 4GP4B 5DRXB 4J8RB 4XCFL 1S7TB 2BY2A 3GSNA 1PAZA 3DIFB 2EILB 4EZKA 2G2RA 2FAUA 2VZOA 3VMPA 4HKJA 4JE0A 1U36A 2OS7A 3RI5K 5C86A 4LSVH 4Y19D 3GSQB 3SE4C 3V79C 2W92A 5EH1A 4GG8B 3ZE1B 3EH3B 3QDME 4E41A 1I7ZA 3EJYC 3FTVA 3REVB 5IJVB 2Q86A 4ONGH 3RNKB 4K5MA 1TEYA 2GC7C 2W95A 4IDJL 1Y6KR 1UH2A 1QR1A 5GRVL 3VX0A 1DQIA 1J88A 2B1HL 1T1ZB 2IWEA 3IKCB 4HV8A 4D9QE 2CO1A 5SWZB 1VGKA 1D9KD 2VTFA 5LDSA 2FVNA 1I3RA 2OJ1A 3ROOA 3ZPDA 3PWPA 2QADD 3KYKH 1RZKH 4MAZA 3ARZA 3SE8H 4MQSB 3IDGB 3EFFA 5IF0B 1T83C 1T0PB 2P5EE 4KO7A 5IMLA 5L88H 4CKQA 3CFTA 2XWDA 2QMKA 2SODB 1BEYH 1F58H 1OAUH 4QR7A 3HZYB 3CZKA 3TL5A 4NZTL 5IMKB 5EN3A 5GQBA 2J8UB 3VGBA 5E1GA 5F3FA 2R1WA 1HH6A 3L4TA 2VRKA 2K45A 2CDFA 3EGXA 5C0NC 3JWNG 3OXRB 2FECL 2ERJB 5J6GA 4FG0A 3LV3B 4NQDE 3LQZA 4JE4B 1JVKA 5MEOA 3O3AA 1XGRA 4WHCA 4JFFA 5F7HA 5GRVK 4TNWF 4W81A 1G4MA 2C9XA 4B9CA 2ZKXA 3O41A 3F6IA 4IOIB 2F5BH 1I8UA 4TQ8A 4B95C 5F88B 4GQZA 4MMXC 3QULB 2P1YA 3FQ2A 4N1CA 3RX8A 4W6YB 1ZCRA 3RG1C 4ZFZA