4HHWA

Crystal structure of the pseudomonas aeruginosa azurin, h124no yoh122
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
127
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNFVLSTAADMQGVVTDGMASGLDKDFLKPDDSRVIAQTKLIGSGEKDSVTFDVSKLKEGEQFMFFCTFPGHSALMGHLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electron Flow through Nitrotyrosinate in Pseudomonas aeruginosa Azurin.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
molecule keywords Azurin
total genus 34
structure length 127
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4hhwA00
3NJMA 5D4IA 2XX1A 3WG7B 4BDVB 2UXGA 2MRYA 1BXUA 2DY2A 2E86A 3CZUB 3V9CA 2XLLA 2IDQA 1SFHA 3OMAB 3NSCA 1A65A 3RYMA 1NIBA 1ZPUA 1OOWA 1PAZA 1WA0X 2H5UA 3FPXA 3JTBA 4DP7X 3EHBB 1SFDA 4KNTA 5FC9A 1BXAA 1BQ5A 4YSTA 1EZLA 2Q9OA 2R7EB 1MDAA 1OE1A 2BZCA 5LDUA 1TEFA 3X1EA 2BP8A 2A3TA 2HRGA 2I7OA 4HALA 3CG8A 2VSMB 1GS7A 1PZAA 3CDZA 3WNIA 4PCYA 4GY4A 3HB3B 4E9WA 4CSPA 3TBBA 3JT2A 1PCSA 4GP5B 4BWTA 4A66A 2W8CA 2QT6A 1JZHA 2EILB 4Q8BA 1HFUA 5ANHA 1OE2A 4A2HA 2B08A 1NPNA 2X87A 1AS8A 1XB8A 1MZYA 2GC4C 2GSMB 3TU6A 5I6KA 1IUZA 1GY2A 2HX8A 3SQRA 1RZQA 1EHKB 2PPEA 3HEIB 2CALA 1J9SA 3H4FA 4JHVA 1CYXA 1OCOB 1RKRA 2J5WA 3UGEA 1AS7A 4BDVA 4HCGA 1UATA 4F2FA 2YXVA 2CBPA 4DP2X 2WO2B 2YAFA 3NJJA 2LLNA 1CYWA 2XV3A 3TASA 4YSCA 5I6PA 3T9WA 3CVBA 4A67A 4EF3A 1CC3A 5AFAA 3NJFA 4YSAA 1OV8A 4YSPA 2DV6A 1V55B 1AACA 2YAHA 1AANA 4E9XA 4JHUA 3DIVA 3QJTB 2BZ7A 4DP4X 2FQFA 3NJKA 1NIAA 5F7BA 4FA7B 4KNSA 3WNJA 1KCWA 3UAAA 1SF5A 1WAEA 2GC7C 4UF7C 4YSDA 1SDDA 3H56A 3UACA 3X1NA 4MFHA 3ZIYA 2TSAA 3UABA 3OMNB 3OMIB 2EIKB 5PAZA 1JVLA 4KO5A 1SHWA 3GXUB 4M3HA 3WI9A 1M57B 3QJQB 3NJNA 4DP6X 3ZX1A 4KNUA 2DYSB 1ZDSA 1NZRA 1VLXA 2JKWA 1T5KA 1SNRA 4WTQA 2H3XC 1DYZA 1QNIA 1NPJA 2IH8A 4AX3A 4HHGA 1M56B 3H4HA 2HRHA 2IDTA 2AZAA 3CDZB 1RCYA 3FS9A 4X4KA 2QPDB 1NDTA 2BW4A 2PPCA 2AVFA 2ZXWB 3ZDWA 4G7SB 3S3BB 1WS7A 3CVCA 3FSWA 3IN0A 3WKQA 4NERA 1BYPA 1BAWA 1AZCA 3PAUA 2IWKA 2MTAA 3AG3B 4AI7A 3T6VA 2FWLB 1ETJA 4BWWA 5I6NA 4YSQA 4DPBX 2BW5A 4G71B 1AR1B 4E9SA 4DPCX 5B7MA 3OM3B 4Q89A 4G70B 5I6OA 4A2DA 1KDJA 5IY5B 2H47C 2VW4A 3ABMB 2OJ1A 1ZIAA 1FWXA 5AKRA 3T71A 1JVOA 2ZONA 3FYEB 4A68A 2BHFA 2VMJA 3UAEA 2VM3A 3QJUB 2FT8A 3QJVB 3ZBMA 1JZGA 2YQBA 2AANA 3N2JA 4E9QA 3FQ1A 1PLAA 4NB7A 3FU9A 3D12B 1V10A 1SDDB 4QKTA 3SBQA 3AG2B 1AZBA 4YSRA 2GIMA 5F7AA 2YAMA 1L9SA 4HZ1A 1XB6A 3NP4A 3QJRB 1L9OA 1KV7A 4GP8B 3KW8A 3AZUA 1I53A 1GW0A 1KGYE 2B3IA 2YXWA 1AG6A 1E5ZA 2QDVA 2FJSA 2PPDA 3GDCA 1J5DA 2BP0B 4E9RA 2UX6A 2I85A 4HHWA 1JERA 3EF4A 1HAUA 2BWIA 1IBYA 1WS8A 3AG1B 4YSOA 2PCYA 2XVBA 2PP8A 4HAKA 1HAWA 3NSDA 3NJGA 5I6MA 1FA4A 4AZUA 3BQVA 1AAJA 2J57A 2WO3B 2HZHA 4P5SA 1URIA 4YVUA 2PLTA 1E67A 3FT0A 3S3CB 2VN3A 3ABKB 1SHXA 4QLWA 4DP1X 1OCRB 3NYKA 2N0MA 3FQYA 4GXFA 4YSUA 3PLYA 2BO0A 2CCWA 3X1BA 1QHQA 1TEGA 2YARA 3DTUB 1OF0A 3X1FA 3X1GA 1B3IA 1ET7A 1GSKA 3GYRA 2UXFA 1GS8A 3UADA 1X9RA 3AG4B 4N8UA 5EHFA 4GP4B 5I6LA 2P80A 3FQ2A 1NIFA 2AFNA 2XXFA 4CSZA 1R1CA 2Y1AA 4HIPA 4W9ZA 1CURA 1BQKA 1ZIBA 2YAQA 1AQ8A 2BP0A 1N70A 2HXAA 3MX0B 4BWUA 1SF3A 5I5IA 1OE3A 4L0PB 1PNDA 4ZK8A 3C75A 2DWSA 1JXFA 5B1KA 3N55A 2BWDA 1W6LA 3ERXA 3AY2A 3FPYA 5D4HA 3S8GB 4NAJA 1KCBA 1ASPA 5B1JA 2Y69B 1ID2A 1A3ZA 2FNWA 2ZOOA 2HX9A 1XB3A 2FQDA 2PCFA 2VW7A 4KO9A 4E9TA 1W6WA 2Q5BA 4BK5C 1PZCA 4N4YB 4M4RB 1TKWA 1BEXA 3FSVA 1MZZA 3IBOA 1AZNA 4YL4A 1PLCA 2P80D 4JKNA 1AZUA 1YLBB 5I26A 1E5YA 1E65A 2FT7A 5TK2A 9PCYA 1JXGA 1BQRA 2UXVA 3KW7A 4UANA 1KYAA 3T6ZA 1XMEB 3ASOB 8PAZA 1NIDA 2IWEA 4HCIA 5B1AB 3CVDA 1AIZA 3FSZA 3IEAA 4GYBA 3NP3A 2YAEA 3FYIB 2QDWA 1J5CA 4DP9X 2FQGA 2WSDA 2XV0A 2DWTA 2IAAC 2CUAA 3FU8A 3QPKA 6PAZA 3FU7B 2VW6A 1AZRA 3SBPA 4YSSA 3ABGA 1GY1A 1A4AA 1M9WA 1X9UA 1NIEA 3U25A 1NWOA 3QJSB 1KDIA 5B7EA 1DZ0A 2XX0A 4DP5X 3ASNB 1MG2C 3G5WA 1ZDQA 1ILSA 1E30A 3FU7A 4DP0X 1L9PA 3V9EA 2R7EA 1IBZA 3WIAA 4PAZA 1A4CA 1JZIA 4G7RB 2CAKA 1CUOA 1KBWA 4YVNA 1BXVA 3IE9A 2YAOA 1ZV2A 1L9RA 4A2GA 2VSKB 2EIJB 2QPEB 1AG0A 2AZUA 5B7FA 1QLEB 3NSYA 3NT0A 4AKQA 3OQRA 4RH4A 5I5JA 2HLEB 3BVDB 3PAVA 3FSAA 1J9QA 1IKOP 2J55A 2PPAA 4DP8X 2XUWA 4E9VA 4BXVA 1J9RA 5E9NA 2ZWNA 2GB2A 4KO6A 3EH3B 4F7KA 1ASOA 2EINB 1PF3A 5B3SB 1JOIA 3SBRA 2EIMB 2HX7A 2GI0A 1A8ZA 3X2QB 4FAAB 3PAZA 1L9QA 1PLBA 1JZEA 3DKHA 2DYRB 1NICA 1JZFA 4G72B 2IDUA 5B1BB 5I5MA 2OCCB 5AZUA 5D4JA 1NWPA 2NRDA 3QQXA 2XYBA 2PP9A 7PAZA 1J9TA 3S3DB 5TK4A 5B1JC 4BXSV 3AW5A 1FFTB 1PMYA 1PNCA 2TSBA 1PY0A 1RZPA 1N68A 4YSEA 1WA2X 2VM4A 3T6WA 2FTAA 3MBWB 3WKPA 4DPAX 1GR7A 1NTDA 3PPSA 4KOCA 1AS6A 4P5RA 3S8FB 3TA4D 3NSFA 2RACA 3IN2A 5I28A 1A4BA 1ET5A 3OD3A 2JXMA 1GYCA 2PP7A 4E9YA 1SJMA 4AKOA 2X88A 4A2FA 2UXTA 4AKPA 2YAPA 2IDSA 3L45A 2CJ3A 2GBAA 3ABLB 4UAHA 2IH9A 1ET8A 1BYOA 2XXGA 4F2EA 2I7SA 4KO7A 1KBVA 2XU9A 2OV0A 4K9JA 1OCZB 2FQEA 2IWFA 1V54B 1OCCB 4HCFA 4ENZA 1PZBA 1WA1X 4TXVB 1TU2A 3EH4B 5PCYA 2UX7A 2FT6A 2XWZA 4G7QB 1ASQA 2W88A 1MG3C 2BP8B 1IC0A 4KOBA 1ADWA 1GS6X 2J56A 1AOZA 2GHZA 2JFCA 1NINA 3TBCA 2IDFA 1F56A 1W8EA 4WKXA 1ILUA 3EH5B 6PCYA 3NJIA 1L9TA 2PPFA 2XV2A 4W1TA 3T6XA 4A2EA 5A7EA 3PCYA 7PCYA 1JZJA 3NJHA 3NJLA 1JXDA 3PXLA
chains in the Genus database with same CATH superfamily
4JDTH 4OD1L 3VM7A 3WO4C 3CFBB 3VFRA 1U4EA 1SFHA 3IDIA 1OL0A 5JOFB 4P49A 3K71A 3B9EA 2XQYK 3I9AA 3DGCR 2QGBA 3K1KC 3SDDD 3GZKA 2QFRA 3MO1B 3OAUL 2ADJA 1Y18A 3HI1B 2YPVA 1KACB 2VITB 3BVNB 2EO7A 4U3XA 1Z3GL 4X9IA 3ZQWA 2Y6SC 4C83A 3QEHA 2G0LA 4BZ2A 3KGSA 3JT2A 1FFOB 5BXFA 1UTDA 1MFAL 3MLTB 4NQDE 4KZDH 4LVNC 3AQYA 4XBPB 4QHNB 2KKQA 2XY2A 1HFUA 3ML9A 3FTGA 2CNYA 5DGRA 3K6SB 4KXBA 2VXSL 1XB8A 4HIHA 1DQJA 3MJ9L 3KYOB 3GSOB 2O26U 4WUUD 4ZNCD 3UH8A 3MRRA 3SQRA 4EZLA 3QRGH 4AJWA 3VYNA 2NMSA 3RUGE 2P49B 2Y7LA 3C5XA 3RJDA 1L6XA 2I24N 3BLKA 2N7AA 3IU4H 4JQVA 4XO3A 5B21A 2BLFA 2ZXQA 1YEIL 2ZNWA 3LDBB 5ERWA 3CXFA 2APSA 2VZTA 3KBPA 5JOEA 1LO5A 3THMH 4DKAA 3KH4A 2QADC 3O4LE 5K1JA 1BM7A 3QFDB 1CLZH 3D18A 1RJYA 4MDIA 3RJQB 5LQBL 5G2NA 1HQ4B 2EYRA 1CGYA 1Z9LA 3NABH 5E6SB 1QPPA 4X4ZA 2YUXA 4GPVA 4XCCL 3SPIA 3SIKA 3P9MA 1E9OA 2R23A 2ZOWA 3V0GA 2FWOB 1YZZA 3P0VL 3NFPA 3IDGA 3UERA 5ABZA 4X5RA 3QUYB 1JNHB 1FPTH 5MEPA 1FYTD 1V7NL 1Q1JL 1NCHA 2WCPA 1ZVNA 3WKNA 4EAEA 4PRPE 2F7PA 3DIVA 4S1QH 1KIPA 4X8XA 4JM2B 4IRSC 5C0CE 2NYKA 1KPUB 2KI6A 3O9WA 5E8EB 3SGEH 1SF5A 3DMMD 4HIIA 4YEFA 3VXQA 1QKZH 4HEPG 1YO4A 5GS0D 1GJIA 5EULV 2EIKB 1TNMA 4LCYA 1SHWA 3LPWA 4N0YL 4YDKL 1R9FA 3VWJB 1DN0B 5DJZA 4L8CB 1BDYA 4IM8A 4QYOB 4LLQA 2ZXBA 4CMMA 3VW3L 1CS6A 4GRWE 4WWKA 3IVKB 1YSOA 5TE4L 5IMKB 1M56B 3PP4H 3I6GA 4Z0BH 3BFOA 2JELH 3HHSA 4U6YA 4P57B 3UTSE 3KDMA 4JO1H 4NQCA 1E9PA 3CSTA 1FF5A 1RZFL 4U3SB 2HMID 3FO1A 3ESPA 1GKOA 4X4YB 1BQLH 4JZOB 4QF1B 5E4EC 2A6IB 4Y4KD 1ZLWK 2WCGA 1XL6A 2VB5A 5E5RB 5KBKA 3BISA 2E7DA 3JVGA 4KVNL 2BW5A 2KERA 1Q38A 1B9ZA 5EC1B 4CJ0A 3AITA 4G70B 4XP1L 1UADC 4S1RH 2BSCA 2AJUL 3V0IA 4DOHB 5IY5B 1J1OL 3QE5A 2WQVA 3ABMB 4MNGE 5AW3B 1AE6L 1ETA1 4WKZB 3KLLA 2DM2A 2GTZB 4JPVL 3NESA 3X13A 1QQDB 2HT2D 4XWOC 1D5ZB 1NM9A 1RZ8B 3LPFA 4N6RA 4QO1B 3TBWA 2AANA 3FAXA 2YD0A 3FU9A 1ACZA 4DN4L 3MRDB 4YIQA 2JKIS 2P1YA 3GSNA 2GBTA 4M6NL 1EMTH 1D5RA 4JFZH 4J6IA 3JWDL 2HP4A 4ZW6A 4RMBA 1M71A 4PMEA 1CDYA 4FQXA 4XPGL 4ZDHA 1WBZB 2CQVA 4A63A 4Y5VC 2QPUA 2V2XB 2CDGA 2MCPH 3WXWL 1RHHA 2YLKA 2YXWA 4ZZFA 1ZHNA 2FJSA 2BSDA 5IESH 2UZXB 4HUKB 2XTSA 2CJUL 2WIMA 5DJ6B 4XVSL 2D4DA 2A99A 4R7DB 5EZJA 3O8XC 1DFXA 3PWNA 5CUSH 2JKSA 2WVVA 3Q06A 4XNMB 1SN5A 1YN7B 1YNLL 4GLRI 1JD9A 1KJ2H 2IH3A 3BFWA 3IETA 1L5GB 5JIHA 3EBAA 1YEEH 3FCSB 3I2CL 1CI5A 3LB6D 1URIA 2YMXL 3B7TA 3IS0X 4YK4C 1KJVB 1U92B 1T3FB 2QTVA 1D5IL 1DQLL 3D4CA 3GLDA 2V3EA 3KPNB 5CJXC 4HUCA 4NNPH 4I77H 3A4DA 1QFPA 3DGDA 4FFZH 4P2OC 2CIIA 3QAZC 1KB9J 3NZHL 1H3XA 4ZFGH 1JZ6A 4GEJA 2NLJA 2DKUA 4U1LB 3X1GA 3KLAA 1B3IA 3IU3A 4C59B 2AI0L 1IT9H 3CLWA 5KSAB 2L7QA 3AG4B 4BQ6A 4FXGB 2R0LH 4WFED 2YD9A 5FYKE 3UAJD 1UJ3A 1EZSA 3LXUX 2IALA 2YQ3A 3K3QA 2A9ML 2EXYD 1N59A 4CA4A 4TV3A 4DVRL 1W15A 2AV7B 4NBYB 3JWDC 5EO1B 2A6JA 2NCEA 3IDMA 2HYMA 4W68A 1T3FA 5ISZE 2R29L 4Y5YC 5B1KA 1RZJC 1UKQA 3HPJB 4LARL 3WY3A 3Q1EA 5C9JA 5HHXH 3PYCA 5EEWA 5LAXA 2ADIA 1CJYA 1QW9A 2FZ3A 3FQNA 1FNEB 4XNMA 5IW3A 3FH8A 4QGTA 1S7QA 4PB0L 5CEZH 4HUWB 1MCQA 1UQSA 1FHNA 3G6AA 1LP9E 1XB3A 5EZJB 2FLMA 2ED6A 2YA2A 3CN4A 2JI2A 5LXVA 3M8OH 1WEJL 5KBNC 1D2PA 1KBBA 4YHLH 2XY1A 3L8QA 4XP6H 4IGBD 4OT1L 4PTUA 5CS7A 3DV6A 3O2WH 1MI5A 3HBPA 5CD5C 2N1TE 5DZVA 4HS3A 3WHE1 5BOPA 3OX8A 5DJ0B 5GGRY 4EUPB 4ODSL 4LP4A 4JM2D 5DLMH 4Y5XA 1RZJL 4YBHA 2FGWH 5FR3A 5EIIG 5GSVA 1INEH 1CU4L 3GLAA 2X4OB 4QGYA 3TH2T 5CKAA 1ACXA 5T1KB 1PY9A 3OJMB 5L2KD 5JHDE 2ZCKL 1JUFA 1UURA 2FQGA 3HC2A 1YY9D 1ZD6A 1PFOA 3NZHH 3QNXA 4RFNB 2Q6WA 4BFOA 3II1A 3V0WL 1NFDF 1D5ZA 1RZ8A 2NY5H 3PIQB 3NFSL 3QPKA 2PMZA 2BVQB 2IXQA 4Z76B 4PTTB 4DVBB 3F01A 3P40A 4TRPL 4YSSA 3CFQA 2BY3A 4HKJB 1DJWA 3OPUA 1F45A 4LLVB 3D5OF 2QVIA 1TCRA 3K2MC 2OZNA 3RWFA 1ZV9A 1FIGH 3VXTB 2IJ0C 4MVBD 1OAXH 3IRZA 1L9PA 3EJTA 2XWTB 4QF1A 2OL3H 5HHOA 3FO1B 3JWOL 1FG2B 2F15A 3BQUD 3MLWH 4U3SA 1M7DB 1H8SA 2X89D 5F96L 1I7TB 1U8QB 3ATEA 1UWXH 4FZ8L 2XDHA 3UO8B 3CSYA 1UT9A 4ZMQA 3WY2A 2ROYA 3F12A 3SBWA 3UIZA 5EOTB 3O11A 3NSYA 1XF3B 2ZSWB 3NZ8B 1U8LA 3QQ9C 4PJBB 4U6HB 2AC0A 4ZX3A 4DP8X 5KVDH 1T1YB 4LCCB 3P4LA 4G80B 2CRMA 2Y06H 1OK8A 3S35H 5LCVA 3CUPB 3ROLA 2J8UF 1GAFH 1XV8A 2F7RA 2DI7A 3AGVA 4HH9A 2RQ8A 2G0KA 2EH7H 1MCIA 3EGDA 4N2CA 3EYSL 3C6LB 3C9NB 4ELMF 1RZ7H 1ORSA 3V0VB 4G72B 3RGVA 2AXGB 2VLRA 4JKPH 5B1BB 2R0WL 5I73C 3O9WB 1NCDH 4JM2A 2WLYA 4Y1AB 2K1MA 4PSRA 3K46A 4JY6B 2WLLB 1DVFA 3QWNA 5DF0A 3FO9B 3ZYOA 5BV7L 2IANB 3UBXB 2YA1A 4TLTA 1Q0YH 4JGUA 2ZCLL 4MA1C 4J28A 4WENB 3TFKC 3VI4B 3FF8A 3BKMH 1PEWA 2N7BA 4L9LA 3GPSA 1LO3H 5ECGA 2EDMA 3OGCA 2V9QA 4LVHC 2FL5A 1HU8A 4B9KC 1B4JL 3WMPA 3P9MB 4DTGH 1SQ2N 5FO8B 4CKQA 1XSKA 2YD1A 1OF2B 1I3RB 2AI0H 1EEZA 4JKWA 4KMTL 4AH2B 2LU3A 5J11C 2WYIA 3RKPA 3HKZA 4I18A 1WITA 3W9DB 4B7IA 5HP5A 3DHJA 4KXZH 3TPKA 1FE8H 1LO4L 3QH3B 4NUQA 2O5ZH 3U46B 4EUPG 4RGNC 5FYJL 2YGNA 1JMXA 3GI9L 3ULUD 2R9HD 4RMTA 5IEHB 1BIIA 2P5EB 2NY5C 1HCFX 3OF6A 4S1SH 1MJ8L 1SLVA 2OSLB 5DEFA 1EAPB 4JMXA 4XVJH 3J8F7 4PJ8A 1BA9A 3DK2A 1SBSH 1P9MC 3T1WA 2WHVA 1SXNA 4XBPA 1ROCA 1SJEB 5JIIA 1N8OE 3Q5TA 4JPIB 2FX8L 5BXFB 2ORBL 2XWZA 3ZO0A 3NAAH 1AZZC 4OZFB 4NM8L 3T0WA 2LQRA 4YHYB 3BVNA 4BH8B 5F9WB 2XACC 1X6NA 1Y18B 5JO5A 4AT6A 3IMVA 4KWUA 2OLDA 1SUHA 4JFDB 3F85A 4EI5C 4ODHL 1MHCA 3ARVA 4AGMA 4RFOH 3F3HA 1T7VA 3A0OA 5HHPA 1S7WA 5D1QE 1G9MH 2DY2A 4C4BA 5JDSB 4XMKL 2XG5B 3VI4E 1FVEA 5CGBA 2KT6A 2EUXA 2XN9D 4OLZH 5HJ3A 3EHBB 3FT3A 3VXME 2ZKHH 2AV1B 3FTZA 3OR7B 2FX7L 5TFSL 1M1SA 2XVLA 5L6YL 3E2HB 4UNUA 5K59E 1ZVHA 2V9UA 2E6JA 5FYLH 4NWTH 3MV9D 2YSSB 5HYSA 3MJWA 3V5HB 5I1EH 5L2JB 1G7QA 3KPSD 4UOW0 4AUYA 2VDNB 5CEXB 4JO1L 2XZAL 2H2PD 2FEEI 2VQTA 1RMFH 2C3HA 4LKCA 4D0BB 3CFKA 4M5ZL 4I48B 4GQQA 2FIRT 4DGYH 2ZOTA 1CFVH 3O2DH 4JVUA 5I6KA 3VI3F 1IUZA 1BBDL 2VABA 1H15B 2WB7A 3W82A 3CU1A 4OD2B 4B9YA 4R7NB 3FZUD 5IHWA 3CFDB 1YMMB 1FH5L 1GZQA 2PW1B 3AMLA 3FNKA 4MBRA 1OSZB 3T0AA 1ITBB 4G3YH 5EUKA 1OT1A 1AS7A 2Y22A 3BEVB 4PY8J 1F02I 4IOSA 2ZG3A 2OYKA 4G43A 3EH2A 3F7RA 5SX4H 3ZE2E 1OALA 4PP1D 3T8VA 4MHHI 4OBSA 4KY2A 3IAQA 4NRZB 2P26A 5ACZA 4P2RE 2DIEA 4L4VA 4QRPE 1DBJH 2NY0C 3IF1A 1H5BC 1QSEE 4PJXF 2QKIB 3QCVH 1SEBA 1N0LA 2RH0A 4IU3A 4GRWH 5EORH 4TPRL 3RVUD 4KK6C 1S7VB 2VWEE 4XO5A 1XGPA 4L2YA 4C58B 1TQWA 2LR4A 1L3WA 4P5TA 4P4KD 4AZ8A 5BUAA 2VUOA 1FVDA 1W0WB 4PJXE 1KC5L 3PNWA 1S9KC 5EOQH 2NY7H 3WEBA 4N8CL 1I4FB 1RIUL 3H6AA 2XPGA 4Y19D 1C16A 1SM3L 3A47A 3X1NA 1G6VK 1YPZB 2RFXA 3OBAA 1YJDC 3QWOA 3ZMEA 2PWFA 5J7CC 5EG6C 3HC3H 5SV4A 4MSWA 4M3HA 1IFRA 2YGQA 1JWUB 3MKGA 1XAKA 2R9HC 5MEQB 1Q94A 3VNZA 4O00A 2G2NA 1NZRA 1VLXA 2Z93B 1T7ZA 1I31A 4PUBL 1WG3A 2F18A 3LZPA 5K9QI 4ZQTA 4NOBA 2JKRM 4TMPA 1NPJA 2YD8A 1RULH 2YZ8A 1YEIH 5EFIB 1TQCC 1BWMA 3ZDXF 5IBTH 5I6XB 5KJRL 3LKSB 4G7VH 2ZOKB 4LVEA 4PJFE 2YOCA 1J1PH 3U7WL 3VMPA 3EO1A 4BGLA 1UHVA 2R83A 1PX3A 3L3KB 3N44F 1XGQA 5K9QG 5H94A 3L81A 2W65A 3MRCB 4PJDF 3KPQA 3T2LA 2YPLD 3MOBL 4NO2A 2ZJSH 5IMOA 4AIOA 5D93C 1QRNB 3IRPX 3UC2A 4KMTH 1R0AH 2IQ9L 5CBEB 2NZ9C 4O2FB 2H32H 1EERB 2JIXD 3GJEB 2EXSA 1PYWB 1XF4B 3DWTA 4Y16A 4WUUE 2V2WB 5J57B 3SPCA 1XTLA 3LEVH 1EVTC 4YDNA 5E6RB 3SKMA 1J0ZA 3ILEA 2NPLX 4GMSL 4GW1A 5AQ0A 3QEQE 3ZHKA 4NAMA 3U0TA 1SOXA 3L16A 5K39A 3C5ZB 2J8UA 4TUOB 5M95B 1EHNA 1P4LA 5DQJA 3QJVB 1KJ3L 1U2YA 2J8OA 1ZLUK 3HE7A 3OR6A 1ZK5A 1BX2B 3FQ1A 3FQTA 4PLJD 4N9GB 4NN7C 2YBRA 3ARFB 4HWUA 2E46A 3C08L 2XPYA 3Q5YA 2BHZA 4LL4A 1BQHB 2E7CA 4NN5B 3FAWA 1MVUB 2WBJB 2GIMA 4YSRA 3AREA 2YBGA 4YFLF 2XQYG 2DQ6A 4M5YL 3BSGA 3KW8A 1MH5B 3A67L 4AQEA 3KWWB 3DVNA 2B3IA 2ED7A 1H3UA 3KEHA 2ARWA 3V10A 3RDTA 1A9EB 2NUTA 3DARA 3DVGB 3MV9B 3HIZA 1GZHC 4POYA 3CN2A 4YE0A 2B2XL 4LHJB 4MVBC 1NLBL 1BZ7B 2XICA 1GL4B 4MB5A 5F89B 1OGPA 2B4CC 4B9IA 1S8DA 4RA0C 4EVNB 3AXLA 1IC5L 3C2AL 4MB3A 2B0SH 2QFPA 4H8UA 2XQYA 3NJGA 4PJFF 1ES0A 2AQ2A 1HL4A 3SGJA 5KVFE 3KPMA 3NSXA 3EFOA 2Y25A 5I8KL 2DQJH 2OR7A 4QRQA 1DEEB 1HXYA 4LF3A 3VVWA 5D8JL 3MX0A 1DUYB 4DKFH 2KPNA 3RX8A 1J5HA 4JFYB 4KXZI 4ZMYA 3KPPB 1T1XB 4Y4KB 1FUNA 1ZRUA 2C3VB 1YY9C 3IBEA 4DP1X 4JCMA 2GSIB 1MIEL 2X4QA 3BAEH 3LEXA 1OGTA 4JZJA 3E3QE 1OF0A 3ECVA 5DMGC 5CSZA 3FONA 4Q97A 1T20A 5B22A 4QRRD 3SKJH 2X70B 2JB6B 3F7YB 4PJCA 3DUUA 2YK1H 1FSKB 3QXAA 3LN5A 4G8AC 5EHFA 4H88L 4V1DD 4DW2H 4MA8H 3LD8B 4IDJH 3U4EB 5DJCA 1NC2D 3LKNB 3VAEA 3O6ML 1K3ZA 5I8OL 3L5JA 2WCSA 3CVHL 2FECI 1ZIBA 2WP3O 3W0WB 1ZA3B 5HVGB 4YGVB 4F3FA 5DHYB 3K6FA 1Q9OB 1ACCA 1L0XA 1PKOA 1H8NA 1LQBC 2DWSA 5HGGS 4F58L 1HHKA 1TSHA 2YMTA 4XVJL 4ZUTA 1UWFA 1WVZA 1YNTA 4OM0H 3PGFH 3H7BA 5IVXE 2JNZA 3G7TA 3V8CA 2BC4A 3C5SB 4ZNEA 3C5JB 5B1JA 4HXAH 1JMZA 3JVFC 4DGVL 2D7TL 3TJHD 1I3GH 5C0BE 4X5WB 4X80H 4CC4C 5CLWA 3RWIB 2ZF8A 4YFLI 4Z78B 5L4FA 4R7VA 5KANI 4K8RC 2Z8RA 4HF5H 3VXRA 2VO8A 2EUVA 1FIEA 2AQQA 3PHSA 3QDMA 3RVWD 5C0CB 4B9CA 4GEIA 4UINH 3SOBL 4MJ4A 3U6XS 1LK3L 2WYHA 3IBOA 3ARDB 1AZUA 2VKXA 4OQTH 3VFTB 1KLGB 4ONHA 1ADQA 2YQ2A 3ARPA 2RR3A 4OVVA 4MX7B 4DZ8A 8PAZA 1NIDA 1QBBA 4PJ9D 4BKSC 3CXDH 1WF5A 5ADPH 5TE7H 1UM5L 4RGMB 2F8VA 4HULB 1AIZA 3MLWL 4KXCA 3VXUE 2W95A 2QDWA 4JFHD 3N85L 1J5CA 1EPFA 1KV3A 3MRBA 4K5PA 4KZEL 4CVXA 1LK2A 2LTQB 1GH7A 3CLFH 2X4TA 1FO0B 1S5IH 1YDPB 3EYUL 3P77B 2V8MA 5DTFB 2JCCB 1CL7H 1QZNA 6PAZA 3LVEA 2DJMA 4OKVB 2D0HA 4Z7VB 4TNWK 3KGTA 1GZPB 2WMPB 4YWGH 1OWRM 3BZEB 5JMOC 4ZUVB 2ZAGA 1C12A 3QJSB 1IX2A 2HPOA 1X5XA 2PTVA 3ASNB 1BVKA 1WISA 3QT2A 4ZXBA 5CJBA 1HIML 2VR5A 1ZJBA 2GUOA 4XCEB 3MBED 1PIGA 4MQTB 3ZE1F 2R15A 2B77A 4NP4L 3T0BA 1FFQA 2GJ6A 1NBCA 2P8LB 2RB8A 3VRIB 1IBZA 3AS2A 5C0IA 2VMDA 4X98A 5AOIA 4B9ZA 3KS0J 4J2XA 2V37A 3UMNA 1I1YB 2FGWL 1UOWA 1W72B 3C8HA 3MREB 3DTXA 3GKWL 1QTPA 3QI9C 4MCMA 3IMBA 5BO1H 1KJ2A 1S5HB 2J1XA 1J88A 4MGXA 4NM4L 2I9TA 1JZ3A 3U9UB 2CUHA 3EYVB 5JOPD 3DHMA 2PPAA 3MLPA 4N2OA 1XVSA 4HMDA 3EOBB 3NN8A 2G60L 1YEHH 1WEJH 4D9LL 2UV3A 3WXWH 2FHCA 4QDGA 2F54B 3SBRA 2C7UB 5IGXL 2A77L 4HU2A 2H3NA 3C5ZC 3X2QB 5B8CA 4XMUA 1X5JA 3MV7E 2XIDA 1QO3B 4JQXC 2YS4A 1WBYB 1I85A 2Z7ZA 2CHNA 4HJGB 5I0XA 4N90E 1QI5A 2IDUA 3N85H 5I1IL 4LBEB 3HS8A 4JVPA 4KAQL 3T77A 4ZUSA 2P47B 4J3SA 5MEOA 4NPYB 2OTWB 4KTYA 4R84A 5J1TC 1AXTL 4MDJA 1XXFC 3PV6A 3IGLA 3DX4A 2GJ6B 2P8LA 2WY3B 4KBPA 4PD4J 2HJLA 5E4IA 5E1IA 1LHZA 1LMKA 4HXBL 4IOIB 4X6FA 2GAZB 3LKRB 1ZVYA 2EH7L 2DIJA 2W92A 1IJNA 3NCMA 3TYFB 3O3EB 1MREL 1C12B 3UTOA 3H9SD 2Q3AA 1FZOB 1JK8A 1OT4A 2DMHA 4YE4H 5T1JA 2MNUA 3FSOA 1HH9A 1XL4A 4PJFA 1YCSA 4ZUWB 2HT3D 4E41A 4OZHB 3KWUA 5KZCD 1OK0A 4YO0A 3CC5A 5DTFA 3DO4A 4JRLA 5I1CH 4CVXB 5JW3H 3IGAA 4JS7A 5H35B 2YO3A 3QQ3B 3VI3B 5LJYH 4LDOB 3PY9A 4JFEE 4XOEA 4MXVE 2A9DA 4N5EC 1CLYH 2BSRB 1VCBC 2VLKA 4RAUA 4NSKA 1RY7B 4DZ8B 2OCFD 1ZHLB 4Y9FA 1MCPL 4OD3L 4M6ML 1A3LH 3H53A 2KPWA 1ZOXA 1PW3A 1IC0A 4JO3H 3GIVA 1PKQE 1THCA 5DD1L 5A3IC 4AK2A 5C0CA 5E56A 1E5AA 2DWEB 2ZYHA 4MYPA 3SYPA 5FFLA 2PPFA 1WIUA 4YXHH 5CSBA 1AGFA 5ANMB 4B95C 2IGFL 5F7DA 1OPGH 3TF7C 5F0JB 3QUZA 2WWKO 4ZS7H 3C5JA 4NQVB 3K72A 1WFIA 3DX7B 1LO2H 2APXA 2ZOLB 1KNOB 1AXSB 4KKNA 5DUBA 1F4YL 2CKBH 3RWCB 2BCKB 4GJTB 4L18A 5CFAA 3UCQA 1Q9OA 4K3JH 5DHYA 4FG2A 1BWWA 1IGML 1IC1A 1HNYA 1GZHA 4HGWA 5JPNA 1EZLA 3UO1L 3EH1A 4XODA 1Q8MA 1YUHB 1BM3L 3EKCA 1WCQA 3RWDB 1PDKA 5FA3A 4KV5E 1KXVA 2X6AA 3HBGA 4PJCF 1R19A 4P8QA 3UYRL 2ATPB 3QFJD 2JB6A 4E2OA 5IESL 4BWTA 3QYMA 3WNOA 4ZTPL 5IB1A 4LXFA 4F27A 2DQHH 1I8IB 4WDIA 4OI8A 3SGKC 4Q2ZA 4OCXL 1DE4B 1EH9A 1ZVSA 3UAFA 1SY6L 5IQ7H 1IBBA 3MOBH 4Q6IC 3T4AB 3VFWA 1PZDA 5IIEA 1AQHA 3VCLB 4KZEH 2MCAA 4GAYB 1HINH 1TVHB 1CI3M 2ZSVA 4RMVA 3SDDA 4XVTH 1DUYA 1E8YA 3HE7C 3DPDA 4R2GC 4LF3B 3APNA 2X6CA 3NACL 4Z1PA 5C08A 1VFAA 4AV4A 1OCOB 4NT6A 3V79C 2NXYC 4LGSB 4DVRH 3O3UN 3IJ9A 3UGEA 2RBLA 5CJQH 5F3HA 5J89A 1J0YA 3LPPA 3TNMA 4I85A 3C60A 4H5SA 1EIBA 5KVEE 3SKJL 4UIMA 5E7FA 3L9RA 4UM9A 1CYWA 1TKWB 3RB5A 4TNGA 3MV9A 5I6PA 4IW4C 3DVGA 1RU9L 3KYAA 3WFCH 2YJQA 5I66B 2FATL 2H3KA 1AO7D 1BREA 1BV8A 1NL0L 4AY0A 4F8LA 4DKFL 1BZ9A 3O6FC 4OJFH 3WMSA 3HI5H 1J12A 3MXVL 5E8OA 5AVRB 1BGXH 3KPSB 1ML0A 4U4BA 2FQFA 2DJSA 2VAJA 1CFSA 3V2AR 3FOMA 4L29B 3ZT6A 1QBML 3AREB 3VFOA 5I1AB 3TZVD 2WBJA 4FEIA 1MFDL 5C0AE 4PMFA 2VM9A 3JBG7 4P2AA 4PG9A 3EW3B 5AVWB 3ZY7A 2APFA 2JMRA 2EEXA 3BN3B 3PQYA 4N9GA 3V5DA 1BX2A 1NLBH 3FQTB 2MKLC 4FLRA 4HOZA 4MA8L 4GUCA 4L4JA 3ZX1A 1I1AA 3ZYJA 3L2LA 5EV7A 1TTRA 2WTRB 3SKMB 3VH8G 5JZ7C 3ALWA 4DEPB 1E9QA 1Z9SB 1NCOA 5C0JB 3MV8D 4Y16B 3O2DA 4R90L 2WWMC 1DBAL 3GSQA 1T03L 2VXTH 4NLAA 1OP3K 2Z6FA 1NGQH 2HAZA 5F7MC 4EN3C 1XQ4A 3F7KA 1BBJA 4XMXA 3PS6A 2DQDH 2L7EA 3L3OA 4NO2B 3CHRA 1WS7A 2VXSH 3PWPA 3RPKA 4YL9A 1IU1A 1N0XH 1RUAH 1M6UA 1BAWA 2KZBA 3HCVB 2XCMC 5I1GH 4IJ3C 3HE6A 3L4WA 1Q1JH 3WELA 5I8KH 1HHIA 3KZ8A 4OB5L 3RA7L 2VDRH 4MQXC 3MLRH 4IKNA 4IKKA 3SGDI 5DJDA 1SBBA 3TV8A 4AYFA 1QFWL 4OLWH 5IHLB 3B1UA 2QZQA 4APXA 4U1MB 1KDJA 1BF5A 3PWLB 1TMCB 3EIFA 1JHKH 5GJTL 4GAJH 3V4PH 3UBFA 5IVXB 1LO0H 3GT6A 4N2LA 4MSWB 4AG4H 1FNGA 3SHSA 1AY1H 2EDBA 1IE5A 4NB7A 2ZCHL 4MBOA 2BZDA 3NZSA 4RBPK 5BZZA 4P06A 3D12B 3SZKC 4EE2A 5BS0A 3NH7H 3QQNA 2IFFL 3BUYA 3LXAA 2AQ3A 4Q6YA 3MRHA 1HT6A 2SEBA 3HUJF 5J6SA 5C0RH 5F7AA 5EO9A 1MLBA 5CKGA 4EOWL 5BW7A 3GTVA 3GINA 4JUSA 1E4XI 2CLZA 4PG2C 5ICXA 2OSYA 1QI3A 3WN5C 1TR7A 1TZHA 3QZMA 3L4TA 4Z0BL 1TJHL 4OCXH 3N0AA 4RDBA 1S7UA 3O45B 2Z31D 2IPTL 3O41A 4OJDH 2W80C 4IU3B 4APQC 2X41A 4E9RA 4ZNEE 2XBDA 4FNPA 1DUZB 2CMRH 5BUPA 1N5AA 3L13A 1O6SA 1BVLB 2ZWSA 2B8OT 1GTFA 1WS8A 1VAHA 2C9RA 6TAAA 1NUFA 4UOQA 4OLUL 4N0YH 4YDKH 4ZPVB 3TCTA 2NY6D 1XGUB 4KRPB 3BZFA 4OW6A 5DHDA 1Z9OA 2VH5L 3FQUA 4XO8A 5E1QA 5EUKB 1AAJA 1A2YA 3QFJA 2XN1A 1N10A 4KRMB 4H20L 2Y7OA 5EF2A 3NJVA 1FAIL 1JCVA 2ODHA 1H15A 3U9PH 4FLOA 1NANI 4ANWA 3ABKB 5E2TH 1S9WB 2YKLH 1HILA 1CTNA 1OCRB 2EDHA 2EDLA 3RL2A 5BQ7B 4DERA 1T89A 2BIQA 3UTSB 3GI9H 4EUPH 2WKGA 4QHLB 3X1BA 3RWHB 4HAGA 1MFCL 2IH1A 2BM3A 2W0FA 5E5LA 5HHVH 3R06A 3L3JB 2VMEA 4FQHB 1FAIH 3E6FA 3VG0H 4WUKL 3ULAB 2C9SA 3SE9L 3U48A 4B50A 1UB6A 3UADA 1YVLA 1BFVH 2BOLA 1ZSDB 2NY2C 4LASH 3V5HA 1KTLB 1X3DA 4YZWA 1UD5A 4JRXD 3J27A 4GRLA 1AD0A 2EDJA 4XPFL 3KYMB 5ICYB 1BQKA 3SGEI 3LOWA 5ICZA 1T04A 3CIQA 2NY3B 2ZXGA 4XXCC 1O75A 2AV1A 3OR7A 5IHZA 4NKOB 5HJ3B 1I7RB 4LEOB 5CINL 4LDCA 4CSTA 3MV7A 3VD1A 2Y7MA 3GMMB 3DSFH 2XJLA 1W6LA 2NZ1A 3ULVC 5DWPA 4OF7A 1I8MA 1KCUL 3WAJA 3D69A 3A5VA 5FYLE 1DANT 5HHPB 5T3ZL 4FERA 5I1CL 3D25B 2LHAA 4UT6L 5BUGA 5T5FH 3C12A 4L8DB 1GOHA 4TVPL 1DQMH 1FLRH 5E2VL 1IBDA 2XWEA 2E59A 1MHCB 2MEJB 1O6VA 3Q2CA 4MQ7A 1RERA 4QD2E 3U1QA 2WW8A 3LCYA 3V4PB 4A6YA 4XX1G 7FABL 4OI9A 2FHFA 3O2VH 1SMDA 2FH6A 2O6DA 4MKMA 5G4MA 5JO5B 4MLIA 4N86A 5E6UB 1OTTC 1A6WL 1RMFL 3U2SB 3QUZC 3TBSB 1E4WL 2FT7A 3CDGA 1NCGA 1BM3H 2PTUA 1Z5YD 2ITCB 3ARGB 3I02A 1NM4A 3KW7A 2VERN 2VN7A 4MNQA 4XB8A 1C8QA 3GRWL 1RP9A 4OLXH 1EXHA 1MWAB 2YD3A 4WSJA 3VTMA 2NY4C 4UTBL 4XN5A 3AUVA 1DLHB 2FX9H 2X4RB 1W72H 2YAEA 4NHCH 3CCHA 4XP5H 1XWVA 1UA6L 4EXPX 1ND0A 3ETBJ 5JQHC 4NQXB 2GG1A 3P3RA 4OKDA 4RFOL 1EAPA 3QUXC 3OPZH 2OSLA 1GJWA 1KXHA 1BIIB 4XNUL 1EV2E 1KB5L 4OZFG 5KYWA 4OF3A 2GT9B 3QDGB 4B0MB 1VZIA 1OP5H 1NGYB 2WUBH 5G4NA 4C47A 1JF1B 1MVYA 1A4AA 1PZ5A 2LVEA 2NW2B 1QABA 3CPLA 1A5FH 3LMJL 3NJXA 1ZS8A 1NWOA 3OKEB 4JHWH 4JPWH 4W9DC 5FO9A 3W9DA 3MUHL 4XXDB 1DZ0A 4LHUD 4W9HC 4CU7A 2O93L 4IIQC 4DP5X 1OF2A 5BZWA 1JG9A 1LILA 3O6KL 3D48R 1ILSA 2L4OA 3K6IA 5E4OA 2EH8H 3BKCH 4QMEA 5C0FA 4HIJB 1SBSL 4PJDB 4M7ZB 1KFAH 3WHE0 2O6PA 1KLFB 1CLOL 3OGCB 3GSUA 2CBTA 1JZIA 4L9LB 4L1LA 1VSCA 4MJ5B 4WSGA 3D9AH 4KDTC 4FQ1H 3L1OH 1BXVA 3MGOA 2IANA 3UBXA 2APBA 2DQEH 3WS6A 4LCWB 4S1DC 4Y1AA 1L4IA 4ODWA 2F58H 4K71B 2HN7A 5F44A 1AGCA 4OF6A 2PCPA 3NIDF 1D7CA 5IBLC 1IEBB 3DGGB 4G8GB 2FYYB 5E99H 4XBGA 1NGWA 4HX1A 4WNJA 5B39B 5KVFH 1TZIA 3MMEB 3HE7D 4R2GD 4NZFA 1FGVL 1PF3A 3DJTA 2EXWC 3U7YH 1JGEB 2XTJE 2GK2A 4JE4B 1U8HB 5H4ZA 3VX1A 4PBDA 1JZEA 3GXFA 4R97C 2ZUXA 4LNRA 3RURA 3E1F1 3QORB 1RSYA 3T3PB 4GBXB 4WW2F 2MJWA 3CXHK 2XTJB 4HXBH 3NZ8A 1OD9A 4GBXC 2IV8A 3O11B 2R2CA 4D8OA 2UWEF 3E8UH 4JM2F 3F7VA 3Q43A 4DK3A 4KKRA 1L0YA 1NCBL 3QB7C 1PMYA 4O5LL 1D7FA 3MRGB 1I7TA 4ZXBC 1E43A 3UYOD 1QOKA 1PY0A 1FG2A 2A7BA 2P42B 4JJOA 3ZE1B 4HETA 5J1AB 3MLZL 2R2BB 1O6TA 3QXTA 4Z95L 1GGBL 1LDPH 3T0DA 3FCBA 3WIHL 5C07D 1FRGL 3GB7B 1Y0LA 4HWEL 1WAAF 3V52H 4JKPL 4P5RA 4OV5A 3A4FA 5IQ7L 3LZFH 3T2QA 1TJGH 3RUGF 5EC2B 4TOYL 2JH2A 3E9TA 3GGWA 3ARBA 3Q6GL 1DSFH 2EC9U 3QUXA 3RPIA 5HGDB 2FB4H 4ELDA 2UVEA 4O2CB 5IWLA 2H2SC 3INOA 4Z3TA 4MASA 4YC2C 5D1ZI 1QSZA 1RURL 4OLZL 4QRRE 2Q6WB 1DQVA 4RGNB 1P7BA 1USZA 4JFOB 4TNFA 4YDJA 4E42A 4ZG1A 2BVTA 4NKIL 4G1EA 3A6OA 3DSNA 2FQEA 3EOAA 2XKUA 5GZNA 4QXGL 4ZFZA 4ENZA 1BJ8A 4QRRA 5I30H 3MC0A 3AQXA 3DRTB 4K3JL 4XT1C 3GFUA 3JXAA 4EKJA 2D4FA 4QRUA 2W88A 1MG3C 3RBSA 2QV4A 4J3OD 3MHZA 4B53A 1NJ9A 5CF3A 4J1UA 5KS9B 3ZMNA 3FRPA 3DV6B 1E2VA 1A4KB 5TQ2H 1U3HA 3ESUF 4JG9A 3TJEH 1EO8H 3TH4T 3WEXA 1KEML 2E74C 2Z91A 3K2UH 1Y6KR 5D2LB 5DUPL 3MZTA 5K9JL 3AY4A 1BZQK 4J3OC 1QFOA 1HHHA 2HT3C 3G6AB 4Q14A 1MCRA 4I18C 4KMQA 5DK0A 3UOAB 1IVTA 4LL9A 2BRRH 4JY4A 3ZE0F 2ARJQ 2MQCA 3EJPA 4OFYD 3AU0A 4YHZH 5C9JB 5AW8B 2Z1PA 1MCPH 2GPZA 1G9EA 4G1MB 3RYMA 3ARBC 4LHUB 1KCLA 1NCJA 1OOWA 3EOTH 5F96H 2ZF9A 3ARRA 1OT2A 4G6AC 2KBGA 5FC9A 4FEMA 5I16B 2MQ0A 4YZFE 1N59B 2Q9OA 3ZHFA 4HZAA 3UTPE 2NYZA 4PS3A 3GNMH 4WV1B 5IW1B 2XWRA 5D70H 1SJHA 3GS0A 4KQ3H 3VFUB 1D5BB 2G4EA 3CJJA 3KLAB 3VFUA 1KPVB 1WQVT 1XCXA 3BUQA 5K9JH 1JZHA 4DGIH 2ADFH 3CZNA 4JCLA 2B08A 1S9YB 3HR5B 1Q9LB 4I1RA 3W2DL 1IAII 4XAWH 2F7QA 1S9XB 4Z9KB 2GSGB 2H32A 4WHYG 2XHNA 2ZCKH 5I8CB 3S97C 2BNQB 5EIQA 4N68A 2H6PA 3H4FA 2QSQA 3KBHE 3WV0A 1CZ8H 1PVHA 1ZY9A 5SWSD 3AVEA 1RKRA 2DW5A 1AKJB 1CE6A 1RJZB 5FW8A 3B8SA 4JY4B 2D0GA 4Z3FA 5DEZA 2ZPKH 1QFHA 2Y36H 2VR4A 4HJJL 3PWNB 2YGPA 2WAHA 1UCBL 4P2OD 3R7RA 4R3SA 5D2LA 5DO2C 4O5LH 3I9IA 4AQZA 2AEQL 5DJ6A 8FABA 4M62L 5LGHL 2QSVA 3PFQA 4O51A 4PJXA 3QNZB 3V6ZA 2ADFL 4PGBA 4PRIA 3S34L 1NJ9B 1V55B 3MUGB 3L1FA 4IRJD 4GKLA 4MD0B 4JHUA 4PPTA 3VU1A 3LRMA 4OTXL 1D6EB 4J3TA 25C8H 3BP5B 2X44D 3EOAB 4PR5A 2YA0A 3U0WL 5I0ZA 1RZIB 3GBDA 1IFGA 1ZHKA 1LYQA 4YDJB 4YC2B 3IJYA 2O4EA 3OJ2C 5FS5A 3K91A 2YQGA 4QO1A 5FYJD 4N6QA 4UDTA 1MW0A 1CICD 1FV1A 2B0SL 4MJJA 4GO9A 2HTKC 1JWSA 5CILH 3EF7A 4Y2DC 5KSVB 2GVYA 5EU3A 4PGCA 2A77H 5C8JB 1SNRA 4XC1L 4LHQB 4AX3A 4NO3A 5EC1A 3UG5A 5J8OA 1A66A 4YHOH 2IWGA 1Y0LB 1U8JB 2CIKB 5AG8A 1EDHA 4NO0B 1U6AL 1ZK9A 4BFKA 4PH8A 2DWDA 3CVCA 4I9WE 3RZCA 2FIKB 2R0KH 3P2TA 4JRXA 2BNRD 2D7PA 3BIKB 4UI2A 3UEZA 4D2NA 3DXAD 1XCWA 1OM3H 4EI0A 5D6DA 3BP6A 1XD1A 2J25A 2FWLB 5E9DE 1E9PB 5HY9A 1IM3B 1EUTA 1G43A 2Z64C 2WINB 3U4BL 5E08L 2N3JA 3I6GB 5F3BA 3LZQA 2CLRB 4WK0B 4UV4L 1EZUA 1UH3A 2DQJL 2IPUK 5IMKA 5T1KD 4A7GA 3D9AL 1K4CA 4GBXA 4WK2B 4XNUH 3QEQD 3T71A 4BFGA 3QNFA 4A68A 3UAEA 4L8CA 3QDME 1REIA 2ZKMX 1JGEA 3VDAA 1JZGA 3O6KH 3MJ7A 2WQ8A 1ZT1A 1PLAA 4JPSA 1NMCB 4NN6C 3M45A 2DIBA 4RGOL 3QIUB 4F37F 4QKXB 2PO6B 3DGGA 2XYCA 4OLEA 3G5XB 2PCPB 2Y5EA 1I8LC 3LN4A 4MCYA 4L8SC 1FG9C 4U1KB 4F91B 2W38A 5HHXL 5BW7C 1FJ1B 5GRUH 5D1ZD 2XKNA 1KTCA 5FYJU 3T08A 5TF0A 3L1EA 4DUXA 4PJIE 4R7XA 3JWNC 3PWUB 4UTBA 3QRLA 5INDA 1MRDH 4TQPA 4YDMA 4OJAA 2PW2A 3NFPB 3TESA 1G9MC 1HKFA 3HAEB 4DUVA 2UX6A 3WDIA 4RQQB 4UT6H 4IBWA 4Y8DC 3VGHA 5IB3A 5FKAA 1JHTB 3AB0C 4AYGA 3QFDA 4LASL 1ZEAL 1GMEA 2XVBA 1PG7L 3BSZH 4F15C 4CVZB 3GMQA 2NW2A 3NSDA 3ZSSA 4XMVA 1JF1A 3VD3A 3WXVL 4AZUA 2J57A 2WO3B 5DC2A 1NGYA 3V0EA 4UQBA 2F5BL 1D5XB 1KN4H 1G6RB 3MACL 5JPMA 5DRZA 2GITA 3QYCA 3S3CB 3GSOA 4W9FC 2E4FA 1XDTT 5HPOA 5IW6A 1SHXA 4GAFB 4QLWA 4IOFD 4B97A 1EEQA 3PXJA 3L4CA 2CCWA 4QHNA 2X4RA 3QR2A 1TEGA 3DTUB 1MDTA 3MLTA 5DMKB 1A1MA 2WQAA 4J27A 5BVJB 3A4EA 5D7LE 4DH2A 1KXTB 1GS8A 3CQPA 1H0DB 5L4JA 1V3KA 1EO5A 1S9VA 2VITA 1JGVH 4HP5A 5IG7A 4IHOB 1MCWM 4NQDD 4KKBC 4U1SA 5FYJE 2W9DL 2L7JA 2YEZA 1KYOJ 2Z31C 1ZE3H 5I5IA 3NDYE 2DKMA 2Y1VA 4ZS6D 4EQ3A 2EDQA 4MJ6B 4KKCC 4JRFA 4U0RB 4JY5L 1U21A 2NY4B 1VACB 4LLAA 4OCSH 1MCOL 4A7UA 4CW1A 2IIJA 2FR4B 5SWQA 4OF0A 2J12B 3V8OA 4C56E 2NZIA 1IKFL 3TN0D 2MQ3A 1VPOH 4XWOD 3TWCH 5L8KB 1YECH 4OGXH 3SDDC 1GHFL 1G7JA 2A9NL 3FMGH 4JNXA 4B7LA 2NY2D 4LAQH 2WSKA 3UTTD 3TEYA 2VGLM 4UMGA 2XXMB 5CZRA 5I0VA 3BVUA 5JQIB 1MFEL 3D06A 1G1CA 4X6CF 4NYLB 4IRZH 4P05A 2C9VA 3WNMA 4ERSL 1SMOA 3FSZA 2P5WA 3AROA 2COVD 1F6LL 1UUSA 2EDXA 5TFSH 3RWHA 3S7GA 1IJ9A 1CT8B 1R3IL 1RK7A 3FYIB 4CN1A 2EAEA 3OAUH 4FKKA 1OP5K 3BDYH 1WJ3A 4HIQA 3VSUA 4F9LA 2JVUA 1IC7L 2HFEA 2YEZB 3W38A 5D1QD 1OD7A 3TV3L 1XR9B 1CICA 2CUAA 4G8FA 3CQQA 1TETH 4U1IA 5KS9E 1DDTA 4HG4J 3HVNA 2ITEA 1A7NL 3RILA 1KXTA 2WLNA 5DR5H 4CGUB 2VISB 2L04A 4HJ1A 3BDYL 4RIRA 4RX4A 3IT8D 4ZPVA 2GW5A 5BCAA 1OCWH 3V4UH 4FQLH 3HC4H 4PYHA 4GKNB 5D7SH 2FE0A 2CXKA 2NY1C 4I3SL 1HEZB 1XGYH 1O6SB 3FU7A 4PJ5A 2E7MA 3DJSA 3P4MA 5KYUB 1KG0A 4Y9BA 4ZD3L 4MB1A 2HJFA 3O41B 2DJ4A 2J2ZA 5ENWA 1CUOA 2NY0D 3FT1A 4PRAB 1OY3B 4OLYL 1PLGH 2XFXA 3LRKA 4NFCA 2GBUA 3G9VA 3NG5A 4RWYH 3UTTB 1ZV2A 3WLWC 5AAMA 4RFEB 3IFOA 2AZUA 5HSFA 5B7FA 3PV7A 4S1QL 4FGMA 4Z3IA 4PG2A 5DYOA 3FBKA 3L08A 3PU7A 2K3TA 2WLMA 4N24A 2OL3L 3H9HA 1KBGH 4YHPA 3H85A 4OIFA 1JHTA 3MXVH 2Q86A 3OMZA 4BXVA 4U7KA 4DOHE 4G5ZL 1PGRB 4HJUA 5D71L 2O5ZL 2H26B 5I76B 5CCKL 2X05A 3SE8H 3PGCA 3HAEA 4W9KC 1Q4NX 3ALXA 5IKCB 4ZJ9A 1SGKA 3GS7A 4I0CC 1T03H 3PWUA 1NICA 4PWKA 3W3BA 5EUOA 5GHWL 1UKTA 3MLXH 4P5TC 3PWLA 2J73A 2IOIA 3RNKB 5T33H 1CXIA 2Z9TA 4PJAE 1SJXA 4HPYH 1EZVY 1SVZA 3PPEA 4DK6A 2OJEA 4CDHA 2PO6A 3JZ7A 4GW4A 4Z7QB 2I9LB 3GHEL 1FFTB 1UD3A 3SYOA 1WFMA 3M86A 4N85A 4AGPA 1ORQA 1RZPA 2EDYA 3ZDZB 3PHQB 3HCVA 3SDXF 5IQMA 3H2PA 1FI8C 3IDXH 3FFCE 1MVFA 4K2UL 1MFBL 5EU5B 3V4UL 1YEWA 2IBZY 4F20A 2DLIA 3R7QA 4EN3D 5DVOA 4OM1H 3FU3A 5EF1A 4J3OF 1IAIH 3ZZSA 3Q05A 3T2PA 1IRAY 1TIUA 4PJ9A 3FB8A 2WINA 3F7QA 4X2UA 1N9PA 4Y4HA 5JZ7D 3GSRB 4DIXA 4ZQKB 1I1AB 1OAKH 4WFGD 5HJDA 1WYJA 1XAUA 5JOPE 2O61A 2G3NA 5B8CC 1FYHB 5GGVL 1CTOA 3VYOA 1JFHA 4LSRH 1ET8A 4N0FA 4IGBA 3RZCB 5BJTB 2CRZA 2DWDB 1FFPA 3UYRH 2NY1D 4NO0A 2QQKH 1HJCA 2BS8A 2DM3A 3B2VL 2ZXAA 3EXJA 1U9KA 1UCBH 4L29A 3X14B 3LN9A 2FT6A 3UZEC 2QL1A 1SVCP 3NPSB 4FDWA 1CQYA 1G0DA 1U8CB 4UV4H 5KSVA 3WENA 2FSEA 3NEXA 4R8WL 1UFGA 4UUJB 1JRHI 5E2WL 3DURB 3TWCL 4O4YL 1GS6X 5ECJE 4G6MH 2JFCA 5EBMB 6PCYA 3EH5B 4PP2B 4XRCA 4XO4A 2ADGA 1C7SA 1RZIA 1WTLA 2XN0A 4KPHH 3SPVA 3DI2B 5IB2A 2ZXCA 2C9XA 1MY5A 4H25B 2ZX7A 4JW3A 5GSRB 2VRQA 2ZX6A 1XIWC 2H8PA 3ECBB 5F3HB 1D6EA 3NFSH 1KTJA 2XT1B 3SPHA 3V9CA 2XA3A 1YNKH 3L3OC 2ZX9A 4M43L 4ZOEA 3FO0L 4JJ5B 4XO9A 4F57L 4KITB 4IS6B 2D31A 4NUPA 5LNEA 4JBSA 2JQZA 4WCYL 4GAYA 8FABB 1ICTA 2R7EB 1MDAA 2MPVA 5IIEB 1IGCH 2YZ1A 5GRVL 3UTTE 3WIIH 5JYLA 3P11L 2BP8A 5C0DA 2BVPA 4Q2ZB 5FGBC 2PWEA 2OQJA 4ODSH 5T3ZD 1JDDA 3WN6A 1TO5A 1WE5A 1ZLDA 3AXHA 5E23A 1FVCA 3DYOA 1RJZA 3DJ9A 4QUOA 5DZOA 3DYMA 1AKJA 2DLEA 3TX4A 3NIGE 1EFQA 4X6CA 3C8KA 3BOVA 4AXWB 1P7QA 1OE2A 3G5YA 4U1GC 4PV8B 5FDYA 2NTSP 4CMHB 3QXUA 1U3HC 1A21A 1AS8A 4Y2OA 1N6VA 1HXMB 2B3RA 2UUDK 4K9EC 1CDIA 2J6EL 3PDGA 4HGWB 3ZDYE 4QY8B 1KN4L 5HXMA 4ZMVA 4LEBA 1EGJA 3BLPX 2X6MA 2BCKA 2OI9C 4G8GE 2AEWA 4FYQA 1G4MA 3Q6FB 1MJ8H 3CH8A 3FB6B 4IRSB 1KPVA 3ZSTA 3BW9B 5D1XE 3R19A 4ELKA 2GKIA 1D5BA 2D9CA 4JJHA 2E7LA 3K72B 1FHGA 5D1ZA 2OMVB 1KIQA 4MJHA 4W4NA 3STLA 1OO2A 1CFNB 2TRYA 3MXWL 4OTXH 4P59L 4LSUL 5DZAA 4FL4C 4Y4KC 4PI2A 3ZTNH 1DVSA 5LVEA 4M9PA 3IRCA 4YDLC 5LDSA 1ETZB 1H6FA 1M3IA 5CLZA 4LVHB 2VL5A 4UT7L 1OV8A 1UKSA 3S4SA 4JG1L 1KGCE 5TE6H 5EO0A 2HJKA 2F2HA 4Z3HA 4NZTL 3B2PA 3S48A 3ZVVA 4ODTL 5F7BA 2EICA 3SDYH 1JZ2A 3HG1A 2BSRA 2BK8A 2PXYD 3QW9A 2NTFA 2XJKA 1KCWA 3F5WA 2Y36L 4PCTA 4UF7C 2ETWA 3B1TA 4IRJC 4WW2B 3W37A 3ZIYA 3A3YB 2RGSA 3WEXB 4ALAC 3IB4A 2R8SL 3GXUB 3WI9A 1IM9A 1M57B 3DX1A 1PAMA 3LZLA 3L5WB 5EEUA 3LRSA 4KNUA 4OZHA 4YPGB 1KYFA 3TO4A 4YXLL 4ZUWA 3Q1SL 3FQRA 4R4FL 5EPMB 2AMGA 1Q72H 5DMIL 1IBFA 4H7VA 3F58L 2HKFH 4QRRB 3TYFA 3CDZB 4N25A 2VMCA 4R9HA 3WGVB 4GT7A 2FECL 3ZL4L 1A22B 2ZTBA 4E42B 1SN0A 3ATAA 4GQRA 4XGZA 2I5YH 2MIZA 4TRPH 4FULA 2A1WH 4NNYA 2WN3A 4V1DA 2AJYL 2VXUL 3ARGD 3SDXA 1BZOA 3POCA 1D7DA 2HFGL 5D7KE 3EJQA 2RMNA 5MEOB 2X3CA 3HAEH 2QADD 4XMLL 3C6LD 4KTEH 4L48A 3CN3A 2R0ZH 1B4TA 5GS3A 1T0NA 1L3NA 4YN3A 3KJ4B 2J43A 4FYSA 4OR1A 4PJHA 5FLUA 4YHZL 1X5IA 2AXHA 2XQ0A 1L9MA 2K7QA 3QEGL 1FYTE 1C5DA 3VE0B 4HVBA 1CF8H 2VM3A 3MRJA 4PLJC 4ZX4A 2AK1L 3RTQC 3WNNA 1U8MA 4NIYE 5EWIH 3PJNA 3VNYA 1K8DA 2A4ZA 1FAKT 3BWAA 1BYNA 4LLWA 4NQEE 4L4VD 4KJPD 5GRZA 1R5VA 3EOBA 1TZAA 4I2XB 1T89C 3S3PA 4Y19E 3QUKA 1WD8A 4ZW5A 4D8PB 3U9UA 2J88L 4JMNA 2I9TB 2R2HA 5HYEA 1MCJA 1TU2B 2WZAA 3OAZK 4FCAA 2RALA 4JG0H 5FYKU 1YPZE 4L2LA 1RIHL 3B2XA 3KAAA 2LU4A 2KQMA 1MCHA 2FDBP 4FABH 1UGNA 5AALA 5DUML 4X5XA 5HI5D 4PSPA 4X99B 3BYYA 4PJEB 1UM4H 5H2BA 5E0FA 2GI7A 5C0IB 3RDTD 3X12A 4AUJA 4F9PA 3QUGA 2HLAB 3VRIA 2Y3AA 5AOLA 3ZUNC 4G6FB 2BWIA 2K8QA 5AZEL 5KYYB 1NGWB 4HX1B 1UM6L 2IANE 1QG3A 3M1BA 4ONFL 4UCFA 4F8OA 5AG9A 2FYYA 5FM8A 1Y6MR 1SRDA 4LSDA 5IBLD 4P0DA 2WD0A 5A2JH 3D6GA 4XP6L 5E5MA 4XWGH 1XIWD 5HYJD 4ODWB 3E1ZA 4U1NB 4LCWA 3QJXA 4NXKA 1P1VA 3MBWA 3CX5J 2J88H 2B1AL 1YEGL 3FN0L 3GSUB 1F2XK 1LD9A 4FL4B 3H2QA 4Q9BA 3W2DH 5I18L 3GM0A 4G11A 4L0YA 3MRBB 3OKKB 2F6AA 1T83A 3G08A 5DO2D 4OJYA 5J13B 3B43A 5LNGA 1A7PL 3AFLA 2KUTA 5FO9B 2WVSA 2X4NB 3ARTA 5HD8C 4OFYA 5IB4B 5ETUA 2DJUA 4N0CD 2HUHA 1YN6B 3HG2A 1NIFA 4P2RA 2HT4D 4MXQD 2VDPL 5IBUB 1R1CA 2H6OA 2IAMB 4W9ZA 4WHTA 4A38A 4ZTOL 1RAMA 2NR6A 1S7TB 1EEYB 5EN3A 1UB5A 2BSSA 3MDJA 5F72S 3SZ6A 5A6LA 2H0FA 3RVWC 1L6PA 1JZ4A 3OZ9H 5K9KB 2HT2C 2YK1L 4Z78A 2WO4A 1KGJA 2P3YA 4OU3A 2YIHA 4JM0A 3BPOB 4P9MH 2AAVA 2PR9A 4UZUA 1NDMB 3ZKXC 4CN6A 3T3ME 5KYXA 1BLNB 2W59A 1A5FL 1A3ZA 3FL7A 5HTSA 2ZOOA 2FQDA 4QYAA 3FZUC 4PBVC 1ITCA 3TBYB 1U8OA 3OLEA 4R26H 4DEUA 2ALAA 4LSPL 3LQZB 5MENA 1YMMD 4L3CA 2GFBB 3U0PB 3GMOA 5AW0B 1U41A 2BCMA 2FEJA 1E5YA 3D33A 4PRDA 4JQVC 3LHPL 3ASOB 5LO7A 4FQJL 4P5TD 4UQEA 2W1NA 3CVDA 1VFMA 3ZPDA 1I8MB 4JFQA 4OF8A 3GMMA 4BUHA 4TL4A 3HUJB 1R0AL 3FTYA 2JCCF 1FYTA 4P46A 2GSIA 4DP9X 4NKOA 5GRXG 2PYED 2C3VA 4PJCE 4MD5B 3HG3A 3KM2A 4NKDB 1YEDA 5FYKL 3KPPA 4TQEL 3EJRA 3HC4L 5ICYA 4H8WL 4X80L 4KRLB 1JPSH 4TF4A 3GRWA 1IAIL 4UM9D 3VG9B 1QR4A 4FRWA 4P2RD 2F53B 3BAIA 4JQXA 4KROD 2WANA 5F88A 1CFMA 2CLVA 3ABGA 2H9GB 3B9KA 4P48A 1NIEA 3CN1A 2WBJD 1AHWC 3WO4B 1I8AA 1B0GB 1WCBB 4UTBH 5F89A 4ACPA 5SWSA 2ITDA 2Q7NA 3P9LA 4DKDC 1JDCA 4X4MA 4JPKL 4LGRB 4QHMB 4IJTA 2D3JA 2ESVB 2OL3A 3L3GA 4FQQA 3B2VH 1BD2B 4D9QD 2DYPA 1PU0A 3QULA 2JF1A 3SJVD 1JI2A 4XPFH 3FN9A 3IE9A 1MH5A 4M48H 2A0LC 3FQUB 1SYSA 1AG0A 4WU5A 3B8YA 4JFFB 3Q2NA 3HB3C 2VQ4A 4AV5A 4GI8A 5T5FL 2LAGB 4RMWA 5CJ5A 1DBKH 1BQHA 4L23A 3IXAA 5DYFA 4OZIA 3O6LH 2XUWA 1EFXB 4E9VA 3ZT5A 4WI5A 1BVLA 4ANUA 4DKEH 4WO0A 5C0AB 5IVNA 1YEFL 4ABVA 5EF0A 1TJIL 1A6ZB 2ZWKA 1A8ZA 1L9NA 3DX6B 3QUMA 4W9GC 4UV7L 3O45A 5BZDB 4ZXBD 3FO2A 2A38A 1TZHB 5FF6A 2R4RL 3H7LA 4U3HA 1YHPA 4P2QD 3PJSB 3V95A 1UASA 4LQ1A 2IQAA 4XCCH 3TXAA 1QZ1A 3HPLB 5DK3A 3JYBA 1FL3A 1YJDL 4TN9A 1J0HA 2SEBB 3S3DB 3BP7B 3ULVD 4JFEB 3P0YL 2X4SA 3BUYB 1VESA 4M48L 4NNXB 3T04D 3HC3L 4U1HA 4LT7A 4LPVA 1OZUA 2W65B 5C3TA 5A2KH 2K6ZA 4N3TA 1T7XA 9CGTA 5JR1L 5CFHA 3L4VA 2PNDA 3VJ6B 1FZKB 2CBOA 3APFA 2DPKA 4YSEA 2OTUA 3QIUD 4Y4FC 3LXCA 1WA2X 5HYQB 3ZL2A 2VLRE 4Z7WA 2VT0A 2B59A 4MAUL 3UJIH 2HG5B 1NUDA 2JXMB 1KC5H 1NTDA 4KOCA 1E6JH 3MRNA 4P23B 1EXGA 4I89A 3BWUF 3OVUB 4KUZL 4PJHF 5IK3A 2M26A 5I28A 3QDAA 3G9AB 2JXMA 4K7PL 4KH2A 1E4HA 1Q94B 3PHOB 3HMXH 4PRNB 2EADA 2LU7A 4OY9A 2F1EA 2NNRA 4WFEE 4YDVA 3VGAC 4W9LC 1DQDL 2YAPA 2IFFH 5D6CB 4I7ZC 4S0SD 2IH9A 3VJ6A 5I18H 3N1PC 4XB7A 1BSIA 2X42A 4J8RA 1SXSA 3AADB 3M1CA 4NNXA 4JFSA 3EYQC 4U1GB 4WNQB 4Z7QF 4URTB 1I4FA 2CHXA 2FWUA 1TJHH 1KXVC 1P84J 2WQUA 1NFAA 3PNWB 3VD5A 1E9QB 1I9EA 3BJ91 3SDAB 4Y16C 2PO6C 4F1SA 4PJGF 4PRIE 4H8PA 3QIWA 2WTRA 3RFRA 5E8DL 3UEQA 1BFOB 2A9AA 5CZVH 3MV7D 2CHDA 3DX6A 1HZLA 1G4RA 1XH1A 2DKSA 2J56A 4U6VH 3RVVD 2Z0UA 4A2MA 4MYWB 3NH7L 1GIGL 2QKIA 2J1ZA 1ILUA 1LE9B 3RAJH 1X5KA 5A7EA 4PG9B 3KMDA 1HINL 1TETL 1DBML 3PP3K 4RVBA 5DXWA 1BECA 1T2QH 2Y07H 2ZKYA 5TF1L 3RKDD 4UQ9A 2PYFA 1GC1L 4M1DH 4AMWA 4GKZB 4HV8A 4G43B 4IIQB 4HLZG 4XCYB 3ZE1E 4FA6A 1CFSB 3MGTB 2EE3A 1SYSB 2DQHL 4JDEA 1KCVH 1RV6X 4CAGA 1INQA 1JHKL 2EECA 2V33A 2Z7UA 3O6FD 4AQ1C 2UWEE 1A65A 1BZ9B 2VNCA 1GZQB 4D7PA 4FCHA 4TQEH 2EVIA 2YUWA 1DO6A 1CD1B 1RIVH 4S11A 1MLCA 2M1KA 3C6SB 2ESVA 1J48A 4C4KT 3IDNB 2ZD0A 5H8DA 3B3BA 2E27L 2D3LA 2M8XA 4UM9B 4HS8H 4KI1A 4ANKA 5IHUH 1VGEL 4MXWH 2Y2TA 4TS6A 1QSFD 2ALWA 4V1DE 2P8MB 2WXKA 3UZQB 2VSMB 1CFQB 3ULVF 3ZT7A 1QFWM 4LKCB 1AYOA 4JDZB 2H9GA 1ODAA 1QYGL 4ZAKC 3SDAD 1G5GA 4X7SL 1C9SA 1NGQL 5DRNB 5MERB 5J3HD 1JV5B 2F53A 1CYGA 4FYTA 1NPNA 4ZS7L 2JKLA 4GO6B 3L7EA 3QZOA 2GSMB 4F7PB 5IFAL 1X5YA 3BT0A 4KVPA 2AJXL 1K4DB 3T4AA 4FP8H 3FT3B 1RZQA 2H4EA 3FU5A 4P99A 1N5YH 3W5NA 3Q0HA 1QEXA 1T0OA 2F8XC 1CYXA 4AUUA 5EU4B 4LFHG 1U91A 2NY6B 3CHPA 4NQSB 1E4XL 1J0IA 2HB0A 5CILL 2AKRA 3DETC 2WWMD 1A47A 2ATPA 4AC2A 2QLYA 3I6LE 3SB3A 1PDKB 5FA3B 1G9NC 4PRDB 1RZKL 4NC1E 1E50A 3NIFB 4LO9A 1TT6A 1EK3A 3F7LA 3BKML 4L3CB 2DI9A 1UH4A 3TEZA 2ROXA 2FO1A 1PS3A 3GHBH 2G9KA 4N3UA 4PWEA 2Z31B 3G5VA 4FFVC 3CK0L 4WEEA 3TBYA 2PYEA 2XV6B 2XN9A 2DV6A 1WC7B 2IV9A 5C0BD 4Z7UE 3FB5A 1AXSA 3O0RH 1HDMA 3EYSH 3SY6A 2RQEA 3FC8A 5CIPA 3T0EC 4G6JH 3LS4H 3R8BB 3QS3A 5FYLL 1ETB1 3UACA 1AGFB 4WI9A 2IMMA 4G9FE 4HLJA 4FQIH 2QQQA 3EJUA 5CMAA 4FZEH 4OCNC 2DWEA 3V5KA 1UB5B 2BSSB 3QIBB 5HHNB 1EEYA 1SLWA 4J4PD 1NDGB 1ZEAH 4Y4FA 5SX4I 3ZR6A 5IEHA 4JEGB 3KBEA 4NQCD 1NAKH 2DQUL 3TONA 4ANVA 4FE9A 2OBGA 4F7MA 1QR1A 2W91A 2A9MH 4G9FB 4QRTA 4Y4HD 3VXUB 3ATBA 3BXNA 2DLFL 3H9YA 5BRZB 2R1YA 3RP1A 2X4NA 2EDTA 1HCVA 1TQCB 4KY1L 1PEZA 4A6YL 4RAUB 2Q7YB 5EB9A 5B1CA 1UM6H 2CBMA 1EEZB 1H6TA 3BI9X 4AH2A 3V4VA 2ZXWB 4ZMXA 3QXWA 1PX8A 4E41E 3FSWA 3X3FH 4OZ4B 4YJZL 4U31A 4PJ8D 1HS6A 2IGFH 3L5XL 1ZLUH 3D05A 2QBWA 1AZCA 1EBAA 4AC4A 4DGIL 4JN2A 3FB7A 4FS0A 2NR6D 1RUQL 1DLFH 1URLA 5MENE 3CC5B 3TN0A 2NY2B 4MA3A 5BS0E 2DLGA 4WLCA 3MRFB 4E41B 2IMNA 1NGXB 3BWSA 5FB8B 3FO9A 1OQXA 1FZOA 5TDPB 4TLKA 2Z8WC 2WQWA 3MTRA 2BSEA 4FZ8H 4JM2C 4P2QA 3QPXL 4UNVA 4P23C 2VSDA 1UH2A 2E56A 4ADGA 1JVOA 2VDOH 2BY2A 5EU6A 2BHFA 5ILTH 3OHMB 2DOCA 3QUYC 3PWVA 2HJLB 4ONGL 2XN2A 4PJ7F 1LTXA 3A6BH 4X9GA 3OB8A 4HPOL 3OHXA 5DVMA 3US0A 4N8VG 4LCCA 1BHGA 3F2LA 3DHUA 5IJCC 2A2QT 2VSCA 3AG2B 3CVHB 4QI3A 4AV0A 1JD7A 4ZUSB 3T77B 3LAFA 1XF3A 1QHPA 2BY0A 2KDYA 4NZUH 4OJFL 4OD3H 1KEMH 4MWFA 4Y2DB 4GKSB 2V2TB 4I2XA 1GW0A 4HJGA 2V9TA 3ARGC 4LARH 3CSYB 3EO0B 3ATFA 4G8IA 5HHMB 5IBUG 5AAWC 2H3NB 3VXMA 1WWAX 3OV6A 5E6ID 2NNXA 4PWIA 4K0OA 3PL6D 1SUJA 1F97A 1FORH 3MRJB 4PJDE 2FWSA 3KPRE 3VE0A 5I1KH 5AD0A 2XRAL 4GS7C 4PJHB 4PQXA 3SQBA 2A74B 3TZVC 1T4KA 4H8HA 1AXTH 3LNEA 5JW4N 2BOCA 4Z8FL 1JV2A 4AL8C 1A7PH 3WJLA 3BAXA 3QK0A 3MREA 1Q0XL 3ARQA 5BS0D 1YRKA 5DD0L 1NCIA 4NNYB 2A6KA 1MQKL 1TDQA 5C3IA 3FT0A 5T1DH 1U33A 4NZUL 3W81A 4GIPD 5HHOD 2IOOA 3EBHA 4TTDD 1HYSD 3QQ4B 4F33B 2GUOB 4PB0H 2XZQH 2N0MA 4YSUA 1BVKB 1WIPA 2XTLA 4KFZC 5T1KA 1JZ7A 2X4OA 4JFVA 1CLVA 4XWGL 5GSVB 1OAQH 4UQAA 1OARL 5D1ZC 3W9EB 1R47A 4RX4D 3TYGL 5GGVY 1CK0L 3OC8A 4GP4B 3O8XD 1IEAB 4OM0L 3QXVA 3W5MA 1CGVA 2AK1H 5CU9A 1PBYA 1IM9B 3MBEB 2Z1KA 3QWRD 2FBJH 4IEFB 1NMBL 1OP3H 5DUMH 3KLKA 2KL6A 2FRGP 3QUYD 2VDML 2PTTA 3G6DL 4FTVD 2Y7QB 2W94A 2NUPA 2WXFA 3L1GA 4PJBF 5F6IC 1UQSB 5DWUH 1J8KA 1S7QB 1M7IB 3ULSA 3X3GH 1A1OB 1OQOA 5AB9A 1FNEA 1GYWA 2FO8A 3L9EA 1FN4B 3L6FB 4CVWA 1IGJA 4E0RB 3D2UB 1A1NB 4JGNA 1WGOA 3D1MC 3M46A 5KSAD 2EKSB 5KUKA 3RHWK 1JPFA 2EACA 2PCFA 4KO9A 5KVFL 4XC1H 3HBZA 3HN3A 5A16A 3NTCH 3CBRA 2LABA 2BXZA 1BEXA 1NC4B 2IALB 3GXNA 1RQ5A 3KNBA 5LCVH 2ZUTA 2P80D 3VWKB 4YOKA 4W6XB 5LGYA 5KSAC 2H1PL 5I30L 1KIQB 1WBXA 3ZKMC 5KSAA 2DTSA 2GJZA 3WN5B 1XIWB 4GG8B 5HYJB 1TITA 3MCKB 3Q48A 3IU3B 4NBXB 4PS4L 1SMAA 4AQ1A 3SO3B 1F18A 1YNTB 3P3UA 3JTSB 3Q6FA 1AI1H 3T2OA 5C07A 4JRYD 4MNHA 4KTDL 3L2NA 4FQIL 2CA3A 3UDWA 3IJ8A 5TQ0L 3IMRA 1ZA3A 2X7LA 1IKNA 4DNLA 4U1JA 2DWTA 2ISDA 3S5LB 4IBTA 2GJRA 4WUUB 5DJCB 4HIXL 3EGXA 1A14H 4ORZC 4LVOB 1KJVA 1ADQL 1MIMH 3FOLA 4J39A 2F8OA 1NCWH 4X6CB 2OSWA 4LP5A 3S88L 1EHXA 4NUGH 4HK0B 3DUUB 1RI8A 4B9FA 1L5GA 3IETB 4AYSA 2PXYA 2DH3A 3OKDA 4DWHA 4XNXL 5TE4H 4UIKL 2AQNA 3DROA 2X4QB 3LEXB 4JREB 2BNUA 4RWHA 4PGEB 4BIKA 1OGSA 4X50A 1OAUH 5BRQA 2R7EA 3BVTA 2AQPA 2OULB 4JFYA 3V7AG 3WFBL 1ED3B 2WXGA 1CVRA 1EXUA 1DEEA 1HXYB 4YHKH 4YVNA 4HPHA 3TPUA 2NT0A 3EFOB 4OFVA 1YEKH 1L9RA 2QVKA 1Y7VA 4DAGL 1M71B 4OCYL 1QLEB 1CFTB 4C56A 1KB5B 4FQXC 4HPYL 2YUZA 1SOQA 4ZODA 2CKBB 4OZIF 1S8DB 4HFWA 2TRHA 3M07A 5DS8A 1BZ7A 3CZFB 4QTFA 4PP2A 4M9OA 1DDHB 3EH3B 3ILQC 1ANUA 2O5YL 5ITBL 5D2LF 3VMNA 1YECL 5DEGA 1F4XH 4YDZA 3PAZA 4JRYA 3BCFA 3UBXG 3ULVL 3DURA 2EIDA 4JVWA 2GTZA 3PP4L 1BF8A 3DVNB 5EDXA 5JW4Q 2NY4D 1DVTA 5KS9F 2OPCA 1TFPA 2LT9A 5ACMA 5CUSL 4AW4A 1PFCA 5IFJA 5E1HB 3A23A 1MVUA 4UOZA 3P0VH 4L3EE 1MNUL 1FFPB 4LSTL 3GTTA 4PUBH 1E4KA 3ARFA 2YRPA 2B14A 2KHAA 4N0FB 5F7LB 2LW3A 4X4YA 4PY8I 2CO4A 2FGZA 1SXZA 3OXRA 5DHMC 4NCC1 1XZ0A 3LYRA 2XNAB 3QCUL 4IK6A 4X6CE 1KN2H 3ULUE 1N6QL 2ZWYA 1SPDA 4GW1B 4OLUH 3EJCA 2R4RH 1DL7H 4JO4H 4U6YB 2YPKB 4MS6A 1HJBC 1X5HA 2JLPA 3S8FB 2CK2A 4KPHL 1FPTL 1I7ZB 1NBYB 1TQTA 4O2FA 3TIEA 1G84A 3U9PL 4N22A 4TLUA 4G82A 4LMQI 1QRNA 3U36A 4A6YH 4ATWA 3SE8L 2X88A 3Q8EA 1DVUA 4AKOA 1I7UA 3DK0A 3EGSA 4KKQA 5IB5A 5EZPA 1XGQB 1AP2A 3L3KA 4UAHA 1E3FA 2WSPA 4KXDA 3U6RB 3Q3GB 2OA9A 4M1CD 5E4EB 1JBJA 1AE6H 1NBZB 1ACYH 3KPOB 4KO7A 4DO4A 4Y5YA 3NK3A 3IMUA 4GW4B 5C7XL 2Y7NA 1HC1A 3VXQB 3EJSA 1IIIA 2VIRB 4L4TB 1R3IH 1KYUA 3B5TA 5E8EA 2EEFA 3BO8B 2VLLB 4POZC 4TSBH 1UCTA 2B1HL 6FABL 3LKQA 1XCQB 1UWYA 3EYQD 4WEBH 2DQMA 7FABH 4LAQL 1ZLVH 1H3VA 4G3YL 4J3BA 3QRFM 1HK6A 2VR9A 5JW4R 2QTEA 5GJTH 4BZ2L 5EIIB 5IUSA 3Q7JA 3TBCA 4MRCA 2HG0A 2IDFA 5LLIC 4OCWH 4MA1B 1E6JL 1U93B 2HLFC 3TO4C 3VD9A 2VDRL 1S6NA 1RJYB 4KI5D 1C16B 4QHUA 4HSQA 3K4DA 1OWWA 3A6CH 3IFNH 1LO5B 1BXUA 1FVDB 1W0WA 2E86A 3BCDA 5AB1A 4X7TB 1GGIH 1R3HA 4JY5H 4JCWA 1WA0X 1PAZA 2Z35B 3LVTA 4PRAA 5ISZD 4DP7X 3OJVC 2ICEC 4D9QE 2HJFB 5DJYB 1J8SA 4NQEB 4CJ1A 1CCZA 1N0LB 3H9SE 1NEZG 3ILPB 4BV1A 4ODXA 5HDQL 1QX1A 3GS4A 1TEFA 1DFBH 1HEZA 3U7AA 1YYLL 3FTGB 5I75C 2I7OA 2BS9A 4ENEC 2Y3NA 2FVNA 3GO1H 4P4KB 3HB3B 2DMCA 5G5DA 1FFOA 3TBBA 4GP5B 2G2RA 2VISA 4RIRB 2AJZA 5K9OB 1OSZA 3BAEL 4J8QA 4C83B 2Y6SD 3Q9PA 1ONQB 2CDFA 5EEZA 2BDNL 4JL1A 4NZDA 4PJIB 2O6CA 2H0JA 4FC3E 4OD2A 1XR9A 4BFIA 1WT5A 1IVLA 5KBLA 1UUNA 3T8MA 4N90D 3UX9B 2C34A 5ESAA 1QASA 2GIYA 5CAYB 5JOFA 3G6JB 4K3GA 1J8RA 4BZ1L 3N42F 5I8EA 1F6AA 5DD5H 3AU1A 4UDUB 5DJXA 5DZNA 4HCGA 1G7QB 4UQ3A 3KXFD 1A7OH 2A0LD 3OKMB 4NGHL 4LVOC 1BAGA 3JV6A 4N8CH 1N4XH 1VRSA 2HLFD 3F04A 3DVIA 4TSCL 3E6HA 5T3XH 3X11B 3BAKA 4IMKA 4NP9A 4E9LA 3ULVH 3KH3A 2X89A 5HHMD 3K5SA 1TMQA 1UA7A 3E0GA 5ITBH 1E3XA 3PXHA 2ZYIA 3IJEB 3MLVH 4P3CH 4R0LA 1KBGL 1J5OH 1B90A 1G7HB 3KGRA 3T2NH 4CW1B 4DP4X 2BZ7A 3VRLE 4MHHG 2E8ZA 2QMKA 3ESNA 1GCYA 4AIEA 4JKLA 5FYKH 2J6EA 1DN2A 1QLRA 1UA3A 3FT2A 3WFCL 2FX9L 1SDDA 2JKXA 3H56A 4LLYA 4MFHA 4DJMA 4G9DA 2OTPA 2TSAA 4N2FA 4XPBH 3EJYD 4ZMTA 3I3DA 4WFFE 1I9RH 1KFGA 1HI6B 3OG4B 5JXAL 4NWTL 1N19A 3H6JA 4PJIA 4B41A 1WWBX 4BH8A 1SLXA 3LH8A 4H0LC 1Q9KB 4OZHE 2CE6A 4R96A 2WVUA 3BSZL 3KL0A 4F7EA 5JHDA 3M6DA 2UZYB 1I8UA 5AKVA 4JPIA 3MI6A 4PHXA 4TQ8A 5DMKA 2LAAA 4LSPH 5GGTL 3MQIA 4XVTL 1AOHA 1RCYA 1DQML 3M17B 3JWNE 1TLKA 1SHSA 2R0WH 3VD4A 3W11C 5IW6B 4X8JB 4DQAA 3ILPA 2V0AA 5FHBL 5I1LA 3BE1H 5JPMB 1QLEL 2F1AA 2OMWB 3LD8C 1HHGB 1A6VL 3S36L 5BRZE 1XSOA 4GB9A 4MZ3A 2Z35A 4EZJA 1LP9B 1LEGA 1OPGL 4X7TA 2DWXA 1AY1L 5HVWA 2HVBA 5D7LD 1MFEH 3WUWB 3MNWA 5B7MA 5JTWA 1NAMA 1RVFH 1DJZA 4I18B 5DQ9B 4FNUA 5JXEA 1U3JA 4JN1L 4MMZA 1BJ1J 4HKZB 3K6DA 2ZYRA 2NZ9D 2VW4A 3F05A 2OJ1A 3BJLA 1D9KB 2ORBH 4ZOCA 2IF7A 5LBSH 3MRKB 2CJTA 4DQOH 3KCWA 1JGVL