4HHWA

Crystal structure of the pseudomonas aeruginosa azurin, h124no yoh122
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
127
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNFVLSTAADMQGVVTDGMASGLDKDFLKPDDSRVIAQTKLIGSGEKDSVTFDVSKLKEGEQFMFFCTFPGHSALMGHLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Electron Flow through Nitrotyrosinate in Pseudomonas aeruginosa Azurin.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 34
structure length 127
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4hhwA00
1L9TA 3EF4A 4A2DA 3ABLB 3X2QB 2PLTA 1OCOB 2PCFA 2ZONA 5B1BB 2GHZA 2XV0A 2B3IA 1NWPA 1XMEB 1PF3A 1KGYE 3AG3B 3UACA 2UXGA 3T6XA 2R7EA 3AY2A 4DP1X 1SHWA 1J9SA 1NINA 1GSKA 1TEFA 1CYWA 2PPFA 2PPEA 1PZAA 2E86A 5D4JA 3OMNB 4A67A 5F7AA 2XWZA 2YARA 3V9EA 3ABKB 3OQRA 2IDTA 4YSUA 2JKWA 1JZFA 3ABGA 1CC3A 3N55A 4DP9X 4DPCX 1ZIAA 3NJFA 1E5ZA 1AZUA 2IWEA 4EF3A 2BW5A 3DKHA 1ZPUA 1E67A 2PP8A 4A2GA 1SFDA 4BDVB 4BXVA 1EZLA 3FU7B 1NPJA 1AS7A 1AG6A 2PP7A 3RYMA 3D12B 3EH4B 1OCRB 1AQ8A 1E30A 1RKRA 5I6OA 5I6MA 1J9RA 2WO3B 1X9UA 2XLLA 3IEAA 1BYOA 3ASNB 3AZUA 2X87A 2BHFA 2FNWA 1SF5A 3AW5A 3NJJA 4M4RB 1JZHA 1RZQA 1IUZA 4A2HA 3H4FA 4E9SA 2HX9A 2IWKA 1ZDSA 4KOCA 4NB7A 2AZUA 2HXAA 1ILSA 1XB6A 2XX0A 2A3TA 2EINB 1EHKB 3FU9A 2OJ1A 1RZPA 1A3ZA 2VW4A 4ENZA 2NRDA 4E9VA 1WAEA 1BXUA 2P80D 2VW7A 1NIFA 1OE2A 1FWXA 1KBWA 3OMIB 4QKTA 4PAZA 4P5SA 4CSPA 4DP7X 1JERA 4YVNA 4GXFA 3T6VA 4E9TA 5B7MA 3C75A 4HCFA 2UX7A 2FQFA 2YXWA 3WKPA 1MDAA 2AZAA 2QPEB 1ASPA 1BQ5A 1SDDA 5I5IA 1BYPA 1L9OA 3NSCA 3NJLA 5PCYA 1J5CA 1NIDA 2VSMB 2UXTA 2VSKB 3X1FA 3ZIYA 1VLXA 2GBAA 1OOWA 3NJHA 1PLAA 1T5KA 2P80A 2YQBA 3AG4B 2BP8B 1NDTA 1ZDQA 3GDCA 1J5DA 1WA2X 3HEIB 3NJGA 4KO6A 2HRHA 3PAUA 3WG7B 8PAZA 2YAHA 1WS7A 3T6WA 4E9RA 4NERA 1RCYA 3GYRA 1AR1B 4KO5A 1V54B 4DP5X 1AS8A 1DYZA 1TKWA 4YSDA 4YSQA 4KO9A 3S8GB 2UXFA 4HHWA 2XUWA 3WIAA 2OV0A 2ZOOA 3PAZA 5I6KA 1M56B 4TXVB 3L45A 2BZCA 3CDZA 3HB3B 5ANHA 5AFAA 3X1BA 6PAZA 1GY2A 1MG2C 1SJMA 1QHQA 1PLBA 1M57B 4A68A 3NT0A 1JZGA 4G7SB 4QLWA 4G72B 3CG8A 2W88A 3FQ2A 2GC7C 5TK2A 4A66A 3WNIA 5I6PA 4YSRA 4HIPA 1NZRA 2UXVA 3U25A 2YAMA 4G7RB 2J5WA 3PAVA 3UAAA 2H3XC 5I26A 3JT2A 4UAHA 1NTDA 2YAQA 3NP3A 4JKNA 1L9PA 4K9JA 2CUAA 2BP0A 1WA1X 2XU9A 2TSBA 2BO0A 3EHBB 4BWUA 1AANA 2H47C 2ZWNA 3H56A 2IAAC 2BW4A 1ZV2A 1ETJA 1BAWA 2IDUA 4GYBA 4UF7C 1L9RA 1NIEA 3KW7A 1GY1A 4KNTA 4F7KA 9PCYA 3S8FB 4YSTA 3IN2A 4GP8B 1AZNA 3ABMB 1BXAA 1OF0A 4GP4B 1MZYA 3QPKA 1N70A 1NPNA 4YL4A 3NSYA 4ZK8A 1JOIA 5D4IA 2CAKA 1A65A 4A2FA 3FT0A 3TA4D 3NYKA 4CSZA 4FA7B 2VW6A 4HZ1A 3FYEB 2CJ3A 4AI7A 2HRGA 4GY4A 1J9TA 1JXDA 4FAAB 2N0MA 1XB8A 1ASOA 2EIMB 3AG2B 2WO2B 1JZEA 2YAEA 3TBBA 1PZCA 1OV8A 2AVFA 2MRYA 2PCYA 2XX1A 3JTBA 3CVDA 1XB3A 4YSCA 2YAPA 3QJQB 4HHGA 3V9CA 3X1GA 4W9ZA 1GYCA 2GB2A 4AKOA 2AFNA 1FFTB 5AZUA 2HX8A 3WKQA 3WNJA 5I6LA 5B1JA 1KCWA 2PPDA 1DZ0A 4KO7A 4YSAA 1A8ZA 4YSSA 2BP8A 4Q89A 4W1TA 1L9QA 3BVDB 4DP6X 1M9WA 1W8EA 4YSPA 1AAJA 1PCSA 1KDJA 1WA0X 3S3BB 1AIZA 4NAJA 3X1NA 5F7BA 3PCYA 1QLEB 7PCYA 2DYRB 1ASQA 3TASA 3FYIB 1KYAA 1FA4A 3AG1B 3PXLA 4DPBX 1SHXA 4RH4A 3H4HA 3UADA 1NWOA 2WSDA 1HFUA 3T6ZA 2Q5BA 2AANA 3FPXA 4X4KA 3QJRB 1BEXA 4DPAX 2IDQA 3ZDWA 1X9RA 3FSWA 5TK4A 1QNIA 3T9WA 3FU8A 3S3DB 1JVOA 7PAZA 1PNCA 1SFHA 2IWFA 5I5MA 1IBYA 3OMAB 4JHUA 4MFHA 1SDDB 3FS9A 1AOZA 3ASOB 4YSEA 3QQXA 2DWSA 3OM3B 1JZJA 1W6WA 3NP4A 5B7EA 3MX0B 2DYSB 2LLNA 2JFCA 2I85A 3CZUB 2QPDB 4G70B 2H5UA 1CYXA 1NICA 3PLYA 5I6NA 1AS6A 3FSVA 3MBWB 4KNSA 3GXUB 1SNRA 2GSMB 4YVUA 3QJTB 1BXVA 1BQKA 1UATA 3IE9A 1NIBA 1TEGA 1PNDA 2FQDA 4E9YA 1JZIA 4BDVA 1HAUA 2HZHA 1PAZA 1HAWA 1ADWA 3FU7A 2YAOA 2IDSA 4UANA 1ZIBA 3QJSB 2IH9A 5IY5B 2JXMA 5B7FA 3FQ1A 2XVBA 2XV2A 5PAZA 2W8CA 3SBPA 2B08A 1JXFA 4AX3A 3ZBMA 3CDZB 1R1CA 5A7EA 1OCZB 2BWDA 2FT7A 1PLCA 4PCYA 5I28A 5LDUA 1KBVA 1V10A 5FC9A 4HAKA 4DP0X 3NJKA 4HCIA 2DV6A 2VM4A 1SF3A 2VMJA 2OCCB 2GC4C 1AZBA 2J55A 5B1KA 1IKOP 2R7EB 3SBRA 2UX6A 3DTUB 3TU6A 3ZX1A 1MZZA 6PCYA 3ERXA 4BWTA 4L0PB 4WTQA 3DIVA 2VN3A 1ILUA 1PY0A 1WS8A 5B1JC 5AKRA 1N68A 1I53A 2FQEA 4E9QA 1ET8A 3WI9A 2BP0B 2QT6A 2XV3A 3OD3A 4AKPA 1NIAA 2ZXWB 1A4CA 3CVCA 3EH5B 2Y1AA 4AKQA 2VM3A 1GS8A 1PZBA 1V55B 2FJSA 4M3HA 3FSZA 5EHFA 2Q9OA 3IBOA 1GS7A 4YSOA 5B1AB 3N2JA 3NSDA 4F2EA 2PP9A 1F56A 4DP2X 3G5WA 4Q8BA 1GW0A 2IH8A 1TU2A 4G7QB 4KNUA 4AZUA 4HCGA 4KOBA 2XXGA 2EILB 2DWTA 1B3IA 2X88A 2I7SA 4N8UA 3X1EA 2Y69B 2IDFA 4BWWA 2FQGA 1KDIA 5D4HA 3NJIA 2FWLB 4HALA 5I5JA 3KW8A 4DP8X 3NSFA 4GP5B 4F2FA 3CVBA 1AG0A 3BQVA 1OCCB 1PMYA 3NJNA 3QJUB 3SQRA 2EIJB 1A4AA 2J57A 2J56A 3FSAA 3IN0A 4E9XA 2FT6A 2BWIA 4N4YB 2HLEB 2YAFA 1L9SA 2XYBA 2XXFA 3QJVB 3SBQA 1E5YA 2CALA 2EIKB 2GI0A 1J9QA 1GS6X 4BXSV 1CUOA 1OE3A 4BK5C 1AACA 3T71A 1IBZA 2BZ7A 5B3SB 2DY2A 1URIA 2YXVA 2GIMA 2RACA 3PPSA 1IC0A 4A2EA 2QDWA 3NJMA 3TBCA 1ID2A 1YLBB 2FT8A 1KV7A 2TSAA 3FPYA 2FTAA 4WKXA 5E9NA 3FQYA 3S3CB 1AZCA 4P5RA 3UAEA 1KCBA 1AZRA 2QDVA 3UABA 1W6LA 1E65A 1GR7A 1OE1A 1BQRA 2MTAA 1A4BA 2PPAA 3EH3B 1JXGA 1JVLA 4JHVA 1ET5A 4DP4X 4G71B 1ET7A 4E9WA 2CCWA 1MG3C 2HX7A 1CURA 3UGEA 2PPCA 2CBPA 2I7OA
chains in the Genus database with same CATH superfamily
1XH1A 3ARGC 4I3SL 4AZ8A 4BM7A 5KVEH 5C0FA 2EDRA 4HMCA 3ABLB 1U4FA 3L3GA 1TYJA 1AKPA 4WI6A 1ZV5A 3U6XA 5SWSE 5LXGH 1D5XA 1VCBC 1HE8A 2VXQL 3MV9B 2UXGA 2IV8A 3FJTA 3RIAK 4Q2ZB 1QEXA 5ILTH 5BOZG 1CFQB 2EDWA 4LL9A 3DX3A 3AWFA 3OKMB 5EC1B 4LLQB 4OLZH 4O58H 5DWPA 2CBTA 4PP1D 3S7GA 1E42A 1HHGB 4Z5RA 5J8OA 3EYUH 3O9WD 2UVEA 2XRAH 2K8QA 1EAOA 5E6YA 3CX5K 3QCUL 3K2IA 3K6NA 5DJYA 5DMJB 3GZQA 4A2GA 1C5DA 2IPTH 3OJ2C 2LHAA 3DJSA 4W9HC 5CP7A 5I18H 3SZ6A 1A6TB 4TYUA 5E94B 2WGXA 4JANA 1YEJL 1Q0XL 4AQ8A 1OCRB 1WT5C 3P9LA 4GW1A 3CFEA 4JFUA 5DHVB 4BQ8A 1QFWH 4UB0L 4J1UB 3IF1B 3O41B 3FT4A 4K5LA 4UOQA 4A2MA 1RIHH 3WELA 1PU0A 2KZBA 2VKXA 4G8GB 4M03A 4UILH 3DX8A 2X87A 4L29B 5E9DA 4AW4A 4BIKA 2WUCH 3D18A 3AMLA 4X6CB 4KXBA 4ZSOA 2P5EB 1YQVL 2F18A 5EV7A 2EC9U 5DMGC 2PWEA 2IWKA 3ALXA 4KQ4L 1ZDSA 1COBA 3PL6A 4LKCB 2OXHA 1K85A 3ZDZB 1T7VA 3BH9A 3IWUA 4OCSH 3SGEH 4F57L 1ILSA 2B77A 2DEXX 2WQUA 2EUWA 4UTAH 5E8PB 4NZUL 2VIRB 3EAKA 3OL2A 4YZFE 2WLIA 5IFAL 1XCQB 5KVEE 5KANI 3CV5A 1XR9B 4XH2A 1N0LB 1ZVNA 3HI1A 1LO4L 2VDKB 3QQNA 3MLWH 4XP9L 1X5ZA 5JZ7D 4DTGL 3TO4A 3L54A 2RR3A 4H0LC 2WLKA 3VXSD 1AHWB 1ICTA 1FGNH 5E70A 1L6XA 3HN5A 3TBTA 3B3IB 3QDMA 3D06A 2W9DH 4HH9B 4X4YB 4GXFA 3BAKA 4BFBD 5C0BA 1OQXA 2XJLA 3C75A 4U1GB 5JTWA 3KPRE 4CSTA 1KPUA 1ECZA 4U1LA 1FGVH 1SBSH 2DQIH 4KJWC 2NYYD 1Y6MR 2DOCA 4KRPB 2HSIA 3MR9A 2R83A 4TOYH 1OB1B 4MJIB 4KHXL 3CHOA 3QJFB 2Y22A 4RVBA 2BRRH 4X9HA 1AIFB 2NNFA 3HE7C 5I1CH 1FPTL 3PNWA 4K3HA 2DWDA 5GS1C 1E9QB 2WAQA 2VDNL 3SDCC 3ZQXA 4FEMA 3WO4B 4OF7A 4TQHA 3PFUA 2D7OA 3T2LA 2NY1B 4L4TA 4XVTL 2K9FB 3O6LH 3EYSL 3OKEB 3BUQA 5EZOH 2HRHA 1MQKH 4LBEA 4CN6A 2NW2A 3QI9C 2QSCH 3O2VL 1N0XH 3QUXA 1N64H 3CHXA 3FU3A 4FXTA 3GPSA 5AVYB 4BFNA 1AS8A 3ARQA 1BBJB 1XDTT 1Q94B 1IEBA 2N56A 3B9EA 5J7CC 4J5VA 2UV3A 1EEYA 3X17A 3MLRH 4OTXH 5JW5B 4F58H 2E9GA 4D9LL 1QSFE 4YDIH 3S5YA 4R3SA 4OJFH 5IUSA 1JFQL 1NOAA 1B0GA 4H1LB 4HF5L 4PJIF 4OR1A 2ESVA 2ZP0T 5F6HJ 2OKMA 1FUNA 1GZHC 4QRFA 1D6EB 5HSFA 1S9WA 1UC6A 2IMNA 2MH4A 3CG8A 2Z7WA 4PVNA 4YGVB 3VI3A 4F15C 2ATAA 4JRXA 4R4BB 5GRWA 5I75B 2Z31A 3B1UA 1MFDH 1KFAH 1UZGA 3IAPA 4HIPA 1O6SB 4IBYA 2JI1A 2FX8H 3L4XA 2FIKB 1KGUA 1L7TL 2DQFA 3LV3B 3VGAC 5ITBL 5T1DH 4UNIA 1ETZB 1VFOA 2WXOA 4WKZB 4ZTPH 3BWAB 1BMGA 3DJTA 4FFYH 1T1YA 2JWYA 3AGVA 2IJ0C 2KQMA 3LN4B 4ZMZA 5JPNB 2IBZY 2X2UA 1MRCH 1M3JA 2I60H 4YDJA 2UY6A 4L0ZA 5T3ZD 3FB8A 3HBQA 4FQJH 2VLKB 2O6DA 1QPXA 3MRMB 1KGWA 2FYYA 3SGJC 4GQ9H 2YGNA 4N6RB 1HIML 5KW9H 3UAFA 1ZKAA 5FO7B 1U8JA 4PRPD 1NM9A 32C2A 3NSYA 5JIDA 5I1IL 1I9IL 4IBTA 4LCUB 4UT6L 2CAKA 3MA7B 2EACA 2ZUTA 3B5GA 2J1WA 3FT0A 3QZNA 1NFDF 4GNKB 4L05A 1DQQA 3PWPB 1R24A 3BDXA 4PP2B 4RFEA 1SOQA 3NFPB 1TYEB 1G9ML 1ZHLB 3EOBB 4JMNA 4QGTA 2Z91B 1N9PA 4G7YL 5IWLC 1CR9L 2PYFB 1I1YB 3FB6A 1JWMB 1VGKB 3IDNA 1NC2D 2XY2A 2W80C 3A4EA 1GC1H 4UU9A 3RDTA 3V4PB 1OV8A 1CFVH 2BOBA 2PCYA 4XVSL 4KI5E 1I3GH 5BV7L 2UY7B 4NO0A 3HS0C 3FFCE 5BCAA 4N90D 4HJGB 1KTRL 1RZ7H 4MA7L 4EUPA 5AEAA 3KWUA 4KX7A 3EDDA 5L2JB 3S4SA 2WC7A 5DMKA 5I6LA 5GRYA 2I5YL 4CVXB 1E6OH 1FZKB 4AYFB 2VLLB 5GGSA 3OGOE 3B9KD 1TJIL 3K81A 5E6IA 3MJ9A 3OZ9L 3U79A 2HT2C 4PJ8C 2X2IA 5I1DA 3GI9H 3BHBA 4LVOB 4APQB 1FQ9C 1KPRA 3O9WB 1ONQB 2VSDA 3RFZA 3NPSB 1F3RB 1OP3H 1B90A 5D7KD 5C0GB 5I1GH 5IGXH 4KUZL 3X1NA 4PJ5D 3GM0A 5E6UB 3RFRA 4HBCL 1ASQA 4NM4L 3SKUD 5IIEB 4W4OA 5EEZA 3FYIB 1GA2A 1KYAA 3T3MB 5F88A 2VDML 1INEL 1FE8L 2OMYB 3MRKB 5DO2D 3LNHA 1CXKA 2E6JA 2C3WA 4IIZA 3W9DA 3ZHKA 2I9TA 1T3FB 2VAAB 2X4UB 5F6IB 5DFVC 4X7EC 5C0RL 5IB3A 3FPXA 4WSGA 4PJXF 3GSVA 2AQQA 4OFKA 1KT2B 1CLZH 4IKJA 2YK1H 4PJ7E 2B59B 5CJOL 4Q9CA 1BIIA 2JCCA 2NY7H 1JK9B 4NUPA 1R3KA 4XCYB 3GTVA 4I77H 4EXPX 4MAYB 1FCGA 4X5WA 1FVEA 1SFHA 2QTEA 4JG5A 4MFHA 5J6HA 4FJZA 4G9FA 2MCG1 2YD2A 3CVHH 4J3BA 2UWEE 4PBDA 1IC1A 3M1OA 5KBDA 1D5MA 2ENJA 5HHVL 1FFPB 2DJ4A 3VXTB 1SDAB 2F7RA 4K3GA 4M7KH 4P2QA 4XNUL 2BZDA 1BF8A 3FSVA 1MWAL 4KNSA 4QTIL 3VXSB 4JFHE 2ZCLL 4PWHA 1SEQL 5DJ0B 2Y1VA 3SPVB 1NCAL 3W0WD 1CICD 4BDVA 4F1ZA 1S8DB 1TJHL 2ZXBA 5C0AE 3JYCA 2Q7YB 1U3HD 3FU7A 2M26A 4XX5A 5AAWC 1TKWB 5DHYA 4KTEL 3QJSB 5F71A 4ANVA 4ZUVA 3IJ9A 1OZUA 5IY5B 2ZXDA 1XGYH 5SX4H 4NHUB 2NXYD 3MJWA 3VX1A 4U6XA 2XVGA 2A6JA 2IIJA 4ZXBD 2FSEA 3BP4A 3EO9L 4TTGA 4FP8H 4M62H 5GS2D 1X5HA 2X1XR 4BQ9A 4KVNL 1MF2L 2HJKA 5C7XL 5JPMC 1V10A 2OSLA 3BPCA 1SGKA 2A2QT 2O6CA 2DV6A 2FLBT 4PVMA 5IW1B 2VM4A 4D0CB 3GBNH 4B5EA 2JNZA 3WEXB 2DIEA 2D31A 4FHJA 1G6RL 5FAAA 3QDGA 2P48B 2YKKA 2J1KA 3GHEL 1ILUA 5B1JC 3EBGA 3MOBH 3ZE2F 3QEUB 3G6JB 3IFPA 4NENB 4N2BA 1D5RA 1YMMA 2QQKL 2VXVL 3I9AA 1F2QA 1Q1JH 2QHRH 3QFJD 3J07A 4JZJA 4XXWC 4XMUA 2KT6A 3UBGA 3NFNA 2V2XB 3E6HB 3L3JA 3V52L 5C0EB 4HSAC 4Y4FD 3N2JA 3G5XA 2X09A 1YEGL 5FCSH 4Q8BA 4TV3A 3L16A 2N1TE 3MNVB 1RU9H 3M88A 4HGWA 1ZT4B 2MQ0A 3SDXA 4CMHC 4V1DA 2JQZA 1N8ZB 4NUGH 2X88A 3HB3D 4I18B 2L0DA 4DGVL 3T5WA 3HUJF 5LWYH 3O6FC 5LAPA 3VE0B 2AEPL 4LPWA 1Z5LB 2VWEE 2FBJH 1GGCH 2X0VA 1IKNA 4ZFFA 4NYLA 1WFTA 5D7LE 1JZDC 5EU6E 5DSCB 1UUNA 3SGDH 1GXEA 3NJNA 3APMA 2WKGA 3BIAX 2CKBL 2J56A 1TJGH 4YHKH 3IMWA 4PJEF 1R19A 3FO2B 4P2OC 4U49A 1KCVH 2FT6A 3KYMA 2ZWSA 1S4IA 4B0MM 4HIQA 1VFBB 4P49A 5D71L 1B3JA 5F1KC 3PS6A 3MV9E 5KVEL 2BCKB 1K4CA 5IOPB 2JVUA 5T8IA 3PDDA 5LXGL 3CGTA 4L2YA 5FKAA 4DT2A 5J1TC 4MMZC 2IALB 1E9PB 5BS0A 1XGPA 5KYUB 4F8PA 5ILTL 3TBYB 1U8OA 3EGDA 4ABQA 2YC1A 3QIUD 2GIMA 4ELKA 5CLXA 1TQVA 3N0PB 4E41D 4HG4J 4LHUG 4OLZL 4O58L 1S9XB 4A2EA 2QDWA 4IRJC 4HDIB 1ID2A 3I9IA 4Q0XH 3WIFB 2APFA 3EYUL 3FQYA 3EGSB 4P5RA 5EG6C 2XRAL 3WE1A 3QUMA 4L9LB 4UTBH 2EDTA 1ACZA 3LH9A 3DROB 3U4EB 1YCSA 2ZE0A 1A8JH 4RMTA 3VFTB 3SB3A 3IAGC 1T0NB 3OXRA 3R0NA 2IPTL 5I18L 1Y1DA 2H32A 3KGTA 4KKZA 4G8GE 2N01B 4X6CE 4UI2A 2P5EE 4YHPA 5DGRA 1DQMH 3X2QB 3BKMH 1QFWL 2XT1B 1RIHL 4IBUA 4WI2A 3ZDZE 1ZS8A 5I0WA 3ARBC 1MHCB 4UILL 4F27A 4NPYA 1PF3A 1AXSB 2WUCL 4FZ8H 3LTVA 4L9DA 5ETUB 1UWXH 2H0FA 4HJ1A 2V2WA 3BT0A 4AVJA 1D6VH 3F00A 3RBSA 4OCSL 4XVJH 4PJ5B 4Q6YA 3VXNA 4UTAL 3MNDA 4Y4KD 3A6BH 2OMTB 4S1DC 1IBFA 5FO9A 4ADIA 2YUZA 1MHEA 4PV8B 5CGTA 4X6BA 3MLWL 1ZEAH 4BZ2H 5M7QA 4JFPB 1F11A 5EU4B 4I2XA 4XB8A 1FGNL 4J6IA 4F9PC 1G4RA 1FYTD 4ZOCA 4FYSA 4P5KA 2P44B 2W9DL 4HH8A 4PFEA 1EZLA 3GK8H 4Q52A 4MJIE 4PJAB 4R26H 1PQZA 3D69B 1P7KB 1FGVL 3OXSB 1KB3A 1SBSL 2DQIL 4JDVA 4W68A 1WFJA 1X4ZA 5F89B 5IQ9A 3BH8B 1MI5A 2QL1A 3K7UA 4TOYL 3ZHLA 1RJYB 3UGXA 3QUYD 1JV2B 3NJJA 1N26A 1EXUA 3QQDA 4OZHB 2BRRL 2MSPA 3RZCA 1I85A 5I1CL 3INOA 4OFVA 3EO1B 4Z95H 4RETB 4WI5A 3LZRA 2VDLB 4IU2A 3O6LL 2AQSA 1DDHB 2VUYA 5EZOL 1MQKL 3W0WB 2JJTA 3VJ6B 5F0JB 5FW7A 1G87A 2MEJB 2QSCL 4NN6C 2X4PA 1N0XL 1N64L 1T4KA 3FFDA 3G04B 2BNRD 2XKNB 2ZF8A 3OB8A 3N1PC 5F97E 3V4PH 2NXYB 1OSZA 5LGJB 3DURB 4LZKA 3MLRL 4OTXL 1QI4A 4L1DA 5TDPA 5EUOB 4QR7A 4DCQB 4DP7X 1P2CB 4F58L 4JM2F 2AEWA 5ACMA 3K71B 4JCWA 1XF4B 2UX7A 4YDIL 3RQ3A 2FHBA 4UZUA 2WVVA 2YXWA 4PREB 2WSPA 4OJFL 5DD6B 5CZXD 5G5DB 1P6FA 5K59F 3VD1A 5HPMB 2AZAA 3GHBH 1KIRA 1TQCC 1CB4A 1BYPA 2IGLA 5IHZB 4CC4A 4W6YB 1CFMA 3FT9A 2HVKB 3FF8A 1MFDL 1KFAL 1VLXA 4LGSB 1DANU 3WFCH 1H5BC 2FE0A 4D0DA 4PRNB 2FX8L 2VTFA 2X1OA 3HBGA 4MNHA 3WTSA 4LIQH 4WFEE 2NYZA 1UXMA 3HAEA 1BHGA 5IM7B 4QO1B 5T1DL 4QRTA 2EKSA 2EO7A 4IS6B 4C4UA 4ZTPL 2J12B 4FFYL 4U2ZA 3T6WA 3DETD 3OC5A 3LEXB 4L8BA 1WAAA 2VLKE 1MW3A 4Y4FB 1XF2A 1MRCL 3EYVB 3WFZA 2ZSVA 1TQBC 2I60L 1Y18A 1X5FA 4ZMNA 3S8GB 1D3CA 3FN9A 4F3FB 3D4YA 3NEEA 4FQJL 5I6KA 5L0QB 1FNFA 3RJDA 1FRGH 3HB3B 4GQ9L 1E2ZA 2NY6D 4P8QA 3L3IB 3PWPE 5KW9L 4FQXC 2BSBA 4Z7VF 5F7NC 5ICXA 2K7QA 3CK0H 5HGDB 4OLUH 1FO0A 3MOQA 1JZGA 3GIVA 4MZ3A 1I1AA 3QIBC 3IPEA 3MRCB 5ENWA 1SVCP 3VXPA 3RL1A 4G1EA 1LP9F 4MS8D 3SN6N 4DOHB 4Y0GA 3TJHD 1UXLA 2J5WA 4WTWA 1I8LC 1HXKA 5D1QB 4TUJA 1VADA 1GC1L 1LD9B 1CFVL 1SLWA 3RVWD 4J28A 3ZGIA 1I3GL 5AOLA 1J48A 2R69A 3PDOB 4V11A 1G9MC 1P6AB 3OQ3B 5FB8B 1ADQA 2E6PA 1RZ7L 1ROWA 2WMPA 3O4OC 5DTFB 1P5UA 3PWNB 4ELMF 2Q8AH 1NEPA 3L3OA 3TYGH 2RB8A 4WI7A 3WIHA 3ZYIA 1YDPA 1E6OL 3QIUB 2AVGA 2ZWKA 4WO4C 3S8FB 1NMAH 1XGRB 2JXMB 4LIQE 3S5LG 2ALWA 2R0WH 3QNXB 4YIQA 4LL1A 3GI9L 4OLXH 4POYA 3NZUA 1QI3A 1NPNA 4YL4A 1A2YA 2FO1A 3T3ME 3MHZA 2Z64C 3N91A 4FHKA 2LLLA 5IGXL 5I1GL 1YPZA 4LKXA 4W9IC 2V9QA 3DVGB 1HESA 4GO9A 1T22B 1MOEA 2LLGA 5KJ7E 1KELH 3UOAB 4L3ED 3LKRA 3F3HA 1ASOA 3QUZC 1CLCA 2B5IC 3V0FA 2WO2B 1OGTA 5ID0B 1CTOA 1U4EA 2MRYA 1F3JA 2WXHA 4M1DH 3OHXB 5HYJA 5EZJA 4JQVA 2YAPA 5L8KB 4KK9C 3CDGA 4PRDB 1CLZL 2YK1L 4Y5XC 2NY7L 3VFSB 1FG2B 1XVSA 3BVNB 3EYFA 4I77L 4M7LT 3T0ED 1F2XK 5IZ7A 3ATBA 5CILH 3QR0A 3CVHL 2Y7OA 1TIUA 2GUYA 3WDIA 1A1MA 4XWOC 3VXSE 1H9DA 4GKSA 1N3NA 1UWFA 3TZVC 5DC2A 2BWQA 1AAJA 1PCSA 4M7KL 3TVMD 4FN0A 3VFNA 5ACLA 2J2ZB 3ZDYB 2V9TA 2WXKA 7PCYA 2BCMA 1KF9B 4X7DC 3SJVA 2B39A 1FYTB 4FERA 4K8RD 1DUYB 5FA4B 2IPKA 2FUQA 4I0KA 3IGFA 2NZ9C 1CTNA 3GSXB 4ESKA 2WWOA 1HFUA 4BQ6A 4JFZH 5GZNC 3C60A 3UBXB 1HKLH 1XGYL 3CFDA 1OF2B 1NGYA 2WQRA 3ZDWA 1X9RA 3CN4A 3QUYB 1N2RA 4Z1PA 4Z7NB 4M62L 3DMMB 4YDNA 3PIQA 5AVUB 5BQDA 3GZOA 2ZF9A 4L2LA 2VC2B 2ZCZA 3N43F 3UIYA 3MNZA 5F9JA 1KY6A 1SDDB 4KK8D 3GBNL 4RAUA 1A3QA 1WTGT 4MA1B 1NL0H 5E4OA 5KSVB 3MC0A 3G6JE 5B7EA 2ZSWB 4DKFH 3NN8B 3FFOA 4M93B 1LO5A 4HVBA 2JFCA 4Z7UF 4YUEH 5E5UB 2BNRB 1K3ZA 2OR7A 4MXVE 3MOBL 3Q2NA 4ZOEA 3GXUB 5C9JB 3F64A 2BS9A 3ARFC 2E7MA 2W0FA 4CN4A 4Z77A 1TQUA 2QHRL 1Q1JL 4J4PD 3U6RA 2FECL 3RX8A 2OAAA 1D5ZB 2YZ8A 2Y23A 4KKAC 3HR6A 2IDSA 4W70A 2FD6H 4XX1G 4FQQA 1T66D 3RNKB 3QCVH 3QO0A 2YGVA 2C9XA 1YMHB 2W8CA 1RU9L 4Y5VB 2B08A 4PD4K 3VFRB 4RA0C 2E7CA 5AB2A 2ZX9A 3QIWC 4NUGL 3O3BA 3O3EA 4WHCA 1PLCA 1EO8H 4ODXB 4BA0A 2FL5A 4JFOA 4I0PC 3IAQA 5LWYL 3F65A 2BVYA 1D5XB 4CVZA 1F4AA 2L3BA 4LSPH 2FBJL 1GGCL 3CLFH 1QLFB 3CQFA 5DJ2B 2Q87A 1WZ1H 4PCTA 2XXMB 1CMOA 4NI6A 3A6CH 2DW5A 1TJGL 4YHKL 1U8PB 3FQXB 3QWRD 1KCVL 1WS8A 2WBJC 1S7TA 3U7WH 4HZAA 1N68A 1O7DC 2HJLA 2IAMD 5AVRB 2FZ3B 1TZGH 2J1XA 1S9YA 2RFXA 3C12A 3FTGB 4GMSH 3VRIA 4FL4C 3HN3A 2WQXA 4X7FC 1CGSH 2Q9OA 1P4LA 3BEWA 4XAWH 2P1YA 1DBKH 4NIKB 5D72H 5E95B 4RRPA 2IH8A 3LXUX 2X0UA 1QASA 4AZUA 1HI6A 1MJ7H 4LDEB 4JANB 5IFJA 4GMTH 2XVLA 3CFEB 5H37A 1J1OH 3L48A 1IE4A 4P46A 1RH8A 2BX5A 3FT4B 1YEHH 4Q0XL 5D1XA 3SPIA 4XE0A 4LCYA 3OPZH 3ESUF 2D3LA 1AHMA 4IBQA 2Q7AA 4LLMA 4K7PX 2VDLH 4ONHA 1UHVA 3IXAA 3PP4H 1PMYA 4UTBL 1NCJA 5JOPD 1LMIA 1HU8A 3QORA 4MRCA 1E4KA 4FZEH 1FL3A 5D5MF 4N2GA 3WFEH 1NC2A 3EXJA 5SV3A 3N04A 4Y2OA 1OM3H 3RTQA 1SYSA 5FKPB 4D0BA 4WGVB 1YNTB 2YD0A 5DMIH 2PTVA 4MJ5B 5IMKB 3K1KC 3WFHA 4ONGH 3H0TA 4KTYA 3SPCA 4Y5YA 4JO3H 5MEQA 1DQML 3BKML 3TO4B 1JHTB 5HP5A 1NUFA 3HNSH 8FABA 3PWVA 4PJ5E 1ODAA 3TBTB 4ERSH 2XPZA 4FZ8L 4JG9A 1UENA 4YBQC 4KRMB 5FYJH 1LTXA 3HRZB 1D6VL 5I71B 2OJZH 4PWKA 3BZEB 4XVJL 1XXDC 2J71A 1EAPB 2K70A 3A4FA 4RBPK 2A4EA 2APSA 3N44F 4TNVF 2X1WL 5A2IH 2HPOA 3A6BL 3E8VA 3Q44A 4L3EB 4ZFGH 1F8TH 2CLVB 3K5SA 1MCOH 3MFFA 4FI7A 3X13B 1OLLA 4ZQKA 3MMEB 4BZ2L 1CGVA 4PJAE 5EU5B 1VA9A 5FK9B 4PIBA 2FATH 3ZHFA 1MCBA 4FNUA 3PABA 4BJLA 1NGWB 1U91B 2WIMA 4E9WA 3ULUD 4MNQA 2BIMA 3GK8L 3FT3B 1UWEH 3SOBH 4DUWA 3E2HC 3KM2A 4R26L 1UXWA 4OZHE 2HFEB 3SDDA 3IFOB 3T0EB 1T7WA 1NAMB 3BC9A 4LFHD 2AXJA 3QQ4A 3KE0A 4HU8A 4A6YB 3BCFA 2ADGB 5FR3A 1T04A 1JL8A 1KGYE 5DJ6A 1KCRH 4AYDC 1UJ3A 2XWBB 5A2CA 5AZEH 4YHIA 2MKLC 4DP1X 3I9PA 3W0WE 3C5SA 1FN4A 4B60A 3TVMB 5FOJA 2J6EL 1P7BA 1OXYA 4ECNA 4ZYKA 4Z95L 2ZWZA 4OLVH 1P7HL 2BNUB 1B0GB 2AQ2A 1LM8V 4EMZA 3S36H 5IVZA 3CNKA 1DE4A 1EJ8A 1WGVA 3ABKB 3DO7B 3VI3B 3S4SG 2IDTA 3WTYA 1SMDA 1LJMA 25C8H 1HVXA 3BPNB 3DI2B 4WNJA 2WNWA 4P23A 1ESOA 1H8SA 2A83B 2K3HA 2Z31B 3J27A 4X83A 3V4PL 3MCLH 1RFDH 4UZGA 2D3NA 4ETYA 2O61A 2X2HA 3IVKB 5HHOA 3VXUA 4BK4A 5FYJE 4BXVA 5DVNA 5AW5B 1QTSA 1A4JB 4CU8A 4XVUC 3EH4B 2LU7A 5IT2H 2YA1A 4HCRA 4PGEA 4OFYD 3GHBL 1J9RA 1A6ZA 3FO1B 4NDMB 3GUFA 4H5SA 1OP9A 3FB8B 5BZDB 5EO0A 4N0FA 2PF6A 3T2PA 4D8OA 4PR5A 3WFCL 4RZCA 2ZZUT 2HXAA 3L3KA 4LIQL 4NI3A 1JGVH 4G80B 5GIRB 1LE9A 4PHZA 5C7ZA 4GKNB 5D1ZD 4GSDH 4KITB 5GZOD 3QAZB 1DQQB 3B1TA 3P69A 3B4NA 1TTUA 4QYAA 4O51B 3I74A 1CD1A 4P07A 4Q14A 3BUYA 2CXGA 3TGXA 4PS3A 5EIQA 3ZT5A 4JPVH 3CZFA 2F7IA 4QKTA 4XTRC 3PYCA 1QSED 1CGXA 2X0WA 3EOAB 3RDTB 1BZ7A 1ZV9A 2BOBB 2E74C 1OTTC 2MMXA 3F83A 5D2NA 3T09A 4TF4A 1K8IA 4NO0B 2FR4B 4AY0A 3L5XH 3CK0L 3P3TA 1KXVA 3OPUA 4OLUL 2OMUB 4DOHE 4UQBA 4G1MB 3EHBC 1CGUA 1GSMA 5D1QE 1DQDH 4OW6A 2VSMB 3WSQH 4I87A 1Z9NA 5E6IB 3WY4A 3QNFA 1EXHA 4A2LA 3BHBB 2EDEA 2IAMB 3FCSA 5JQIB 4CW1A 3RFZB 5J12C 3WGVB 3VYPA 3RVXD 1M1XA 4I0CC 1FLTX 1O9VA 2CNYA 5DJZB 2R2HB 5CIPA 1DBBH 2ATKB 4JFYB 2A0LC 4R7XA 3LDBC 3FL7A 1DYZA 1JV5B 4YSDA 4GAJH 4W9CC 1Y6KR 4UDTB 5JHLA 1AD0A 2A7BA 5F88B 2Q8AL 5E4EC 3TYGL 2CSPA 1EQWA 1GC1C 1NCWH 2AQ3A 3D4GA 5CBEA 5K9OB 3W9DB 5AFAA 5A6LA 1NMAL 4YXKH 1Z1WA 1Q90A 2DLTA 2R0WL 1GY2A 3D0LA 4XAKE 3VFUA 4JQXC 5IB3B 4OLXL 2DBJA 5DURD 3UCQA 5IHHA 3PWUA 5BW7C 4QOKD 5LN8A 1HINH 4J3OD 3GKWH 1JPGA 4K3EH 1FVDB 3U25A 4U6VH 2YAMA 4G9FB 5ESQB 2ZAGA 3GSQA 2XICA 3UG4A 4OAWB 3VRJB 5HGHB 5ICZB 5EU7E 1KELL 3RIFF 2IBGA 1KENH 1D5MB 2UZPA 3ES6B 4JKNA 4UDUB 1WA1X 3MUZ1 1S7SA 3EW3B 1ZA6A 4ZMXA 1C8QA 2A74A 4M1DL 4P2QB 2FBOJ 2LE9A 4AGLA 4D9QD 3DJRA 3QBTB 3JV4A 3GUTA 3H3BC 1IL1A 2PXYA 3TIEA 1NBCA 3S9DB 4TLUA 3RRQA 3M8OH 4DN4H 3EZJB 5EORL 4NFCA 5DFTA 5CILL 2Y72A 1ND0A 5DC9B 1UZ8B 2I25N 4UQDA 3TPUA 3ZDYE 1R34A 1U8NA 1FYTE 3ROLA 1UOKA 2ZG3A 1L0QA 2W60A 1QAWA 2HYMA 3D48R 3WJMB 5IF0A 5DJDA 4S0SD 1MAKA 2YWZA 1AD9A 1UH3A 2OSLB 1UZ6F 5AVVB 1HQRB 2M83A 3WN5C 3ARED 4ILDA 4AI7A 1M6OA 4F2MA 4Z6AT 3TM6A 3X12B 1JXDA 2D31B 2M2DA 4OLYH 2AJZA 4NAMA 5ANMA 4LCWD 5DMYA 3TBBA 2X4OA 4Z7NE 3QZLA 2WQSA 4JFZL 3CVDA 3UTQB 2FEJA 1HKLL 3FQNB 4AM0Q 4WNQA 5CD3A 2PW2A 2EE6A 2PR4H 4UV4H 4BUHA 4XNZB 1OSYA 1NEZB 2VWEC 2AFNA 4JZJB 5ADOH 5MP6L 3L95B 3I3EA 2V7NA 2ZJSH 2B14A 3L3JB 3MRPA 4X7SH 5DJXB 2JJWA 1OD9A 3G5XB 2BNRE 2WCGA 1JGIA 3KPNA 4QYOA 2AXWA 3LJ3A 1NL0L 5I1KH 5EUKA 3ILQD 3MTRA 1BVOA 4JREB 4ZPVA 1KOAA 4DKFL 3M17B 4DP6X 1TSHA 4V1DB 2OMXB 3TO2B 4YUEL 2V33A 4QRBA 4KRNA 5L6YH 1WA0X 3TCTA 1T7ZA 4PJBA 3BDBA 1EEUA 4PM1A 3HTLX 3ZKMD 4AIZA 3ZT6A 5CBAB 3ULSB 3JZYA 3Q8BA 4QEGA 1EDHA 1DVTA 1HXMB 1SHXA 2ZAHA 3H4HA 3TBWA 1EFQA 2FD6L 3HE6A 1T7XA 4E9LA 1DLHA 3G5VA 1WC7B 3KYMB 5BXFA 3QCVL 3VGFA 3BFQG 1L5GA 5A3ID 2ED8A 1KB5A 4NRYB 1EO8L 4PH8A 5JQHC 1K4CB 4HKXB 2ICWJ 4JPKH 1FH2A 2FHFA 4JHUA 3TS8A 3G5YA 4Y89A 4F8OA 3IJHB 5D2LB 1T89A 3B9VA 4LSPL 3CLFL 4Y8DC 3NIGF 3O3AA 3TV3H 3QXAA 2IH3B 4EZJA 1G43A 4N2LA 1U8OB 4IIQB 3A6CL 3IYLW 2F53A 5AG8A 4OCRH 3CX5J 4LCCA 4ADGA 1QO3B 5E2JA 3GJFB 3U7WL 2ZWLT 4JLRA 5A6IA 1A6AA 3HC0A 4LAJH 4B53A 1UD8A 3VWKD 1TZGL 5EBWA 1QSEB 1HOCB 2RHEA 5KYNA 1VB9A 1YEEH 4GMSL 3RU8H 1W0VA 5DD1H 1IAKA 1Z9PA 3GSWB 1JGDB 1CGSL 3H9HB 1ZIBA 4XAWL 3MNMA 4QT5B 3IS0X 4G6MH 1CL7H 5D8JH 4ZNEE 3OXRB 5D72L 4GQRA 5IREA 3GZKA 3SBPA 2YFNA 2BINA 2H32B 1NAMH 3EYQC 3FCTA 3HG3A 4X7TB 1MJ7L 5F3BA 3ZBMA 4A6YH 4GMTL 2ETWA 3BAEH 2VYRE 3EGXB 3UG5A 1GH7A 4ORZC 5I0YA 1J1OL 5IEKA 4KXAA 1G7JA 3KH3A 1KJ2B 2I24N 1KYOK 1YEHL 1ZS8B 5DO8A 2Z7UA 3V0AC 3RVTC 1ECYA 1O5DT 1QR1B 1DLFH 2Q3ZA 3OPZL 3T0VA 2VDLL 2UX6A 3DTUB 1E27B 3PP4L 3VU2A 4KRPC 1AGFA 1JWSA 4WK4B 3S3SA 4FZEL 3MBEA 3SBWA 5C6PB 3WFEL 2EVFA 3GC3A 4G8FB 3TCLB 1FF5A 1OM3L 3K2UL 3NCEB 5DMIL 2DBLH 5FO9B 3WO4C 2AI0H 3T77A 3CVCA 3IU4H 4H1LG 1L3WA 1GVIA 2NY1C 4LPVA 4H26B 4ONGL 3IMSA 4FQHA 4JO3L 3ZYZA 4DKAA 3UPRA 1OM9A 3HNSL 3KNBB 3NAAH 4GEJA 3HAEG 2PP9A 5BZWA 1VEOA 1WJ3A 4XMLH 3UYRH 4ERSL 1CE6A 2DIJA 3DVFA 1IGJA 4B9CA 3GLDA 5FYJL 4QOKB 4L3EE 2JB5H 2ZYRA 2QMKA 2W91A 2OJZL 2Q2EB 3CFCH 5HJ3B 2VDRH 2B0SH 2R59A 3STLA 1DFBH 2WTPA 1CZ8H 4KK5D 3NZ8B 3ARUA 4MQSB 4GIOA 3NSFA 1F8TL 4ZFGL 4WTXA 1MCOL 4FG6D 1LO0H 1M7IB 3EDKA 3DHJA 5JOFB 1Z3GH 3GM8A 3LPOA 4ZFZB 3IN0A 3T0EE 4E9XA 2FATL 3KL0A 3ZJAA 2BWIA 3ML9A 5I75C 2XPYA 4P4RB 3UMNA 1TLKA 1Q9LB 3JBG7 1UWEL 3NJVA 1U6AH 1PJ9A 3DXAD 3SOBL 1WHPA 3FFDB 2APWA 3HLAB 3IB4A 3SY0A 4PGBA 3QC5X 1BM7A 3QA3B 1WWCA 5E56A 1AH1A 4HV8A 1CUOA 1OE3A 1OSZB 2CDFA 1G4MA 1NGXB 2P8MB 1KCRL 2VZTA 3TIDB 4U0RB 1P4UA 5AZEL 1J0IA 5CAYB 4XBGB 1URIA 3V0EA 3FONA 3VI3E 4EUPH 1JBJA 3BPLB 3KXFD 4OLVL 4BZYA 2B7DT 3FB5B 3MRJA 1IRAY 3AREB 3B6SA 4LBAA 3S36L 3NFSH 1KIRB 2H3KA 2PETA 4HWZB 1BWMA 2Y1ZA 5TE6H 1IC5H 3KPLB 1D5BA 2NNAB 3S3CB 1N5YH 1OAYH 1P7QD 1TT6A 1MCCA 25C8L 4JDZA 2QELA 4LCWB 1CBJA 2FGWH 3WS3B 1ED3A 2CUIA 4QRSA 3ZQ9A 3K4AA 3BVVA 3RGVD 3MCLL 1RFDL 3QEQA 1Y7VA 1JNHB 2DWXA 2J21A 1YUHA 4LSDA 4MQXD 3ILPB 3WTTA 3LH8A 4JL2A 2CBPA 4JHZA 2CA4A 5CEZH 1BX2B 1P6WA 2PABA 3O6MH 5F7WC 5IT2L 1U3ZA 4N85A 4H0HB 2AEIT 5L9DH 2Y6SC 1Y18B 4NO3B 1A1NB 1J18A 2VZOA 2Y2YA 3MU3A 1S7QA 2DAVA 1Q9KA 2BSED 4G43B 4NKDB 4HU2A 5CJBA 1RK0A 2MQ3A 1J1PH 1N19A 2FEEL 2P3YA 3L2LA 3QPQC 1JGVL 5FYLH 1XMWA 1YAIA 1WZMA 3GIVB 2Y5TB 4U1HA 1BFVH 4GSDL 2DL9A 5HBBA 4YSUA 4APQC 4LVOC 2P24A 4HULB 1JPEA 5KYXA 4GSUA 3HPLA 1MWOA 4S1RL 2WJ5A 5ENWB 5HI5D 4RMSA 3O9WC 4N9OB 5DUBB 3VXPB 1JTPA 1K5NA 3GINA 1V8HA 3KVQA 3SPHA 4JPVL 3OAZH 2K6YA 1S5HA 5CEXA 3L4UA 2UZIH 5DI8B 3MV8D 1MCDA 1I9RH 1CG9A 2QMJA 4D94A 3PV6A 3L5XL 5JQ6H 3COOA 3WFDH 2WMPB 1QNZH 4KZDH 3ASNB 1WBXA 4MKTA 5F6IC 3C6LA 2GITA 1DQDL 2OW7A 4M4RB 3WSQL 3GHPA 2JJVA 4A2HA 3UJJH 1NANI 5EFIB 3MRQA 2TRHA 1KIUB 1A3LH 1M05B 4YIQB 3D0AA 2AZUA 2J72A 1HXYA 2DYPA 2CZNA 4MAYC 4YZFF 3VWKB 3FTZA 2JELH 5LQBH 3S5ZA 3UAJD 2A38A 1K8DA 3MCKB 2APBA 3HZYB 1A3ZA 2EIZA 3HPJA 5IHWA 1DBBL 2AMUA 2P80D 3I9GL 3N5AA 4L5FH 1JMXA 3VWJA 5JR1H 4J2XA 2WSKA 4GAJL 5HD8D 4XPFH 1IGFH 5KYYA 5CSZB 3D50A 3LKRB 5CKAA 2PWDA 3HC2A 3FRPB 4KROD 1NCWL 4LVNB 3FULA 4IDLA 2UYLB 4HCFA 1F3JB 2EDJA 3B83A 2FQFA 4YXKL 5HYJB 1MCHA 2R56H 1QP1A 3FQUB 3QWOB 1AYRA 3MRBA 3ULVH 1ITCA 1BQ5A 3F5WB 3WIIH 4P5TA 4PJFF 4G9FE 1HWWA 4IEFB 2NY3D 3NJLA 1D9KA 5DZPA 3EYFB 1HINL 1HX0A 3MLPA 4R5XA 3GKWL 3L81A 1CXLA 3AT9A 4I3RH 4K3EL 1FIGH 4JZNA 4U6VL 4P2QE 3ULAB 1RJLB 4X9FA 5HYSB 5C0NC 4X6DA 1BD2D 2AJ3B 1KENL 3FC8A 4GKSB 1YY9D 4L8DA 3D85D 3QH3A 2W0KA 3TH3T 4P2CG 2G4GA 3RPIA 2H2SC 1A9EA 4U6HB 5CHNA 4HX1A 3ARDD 4JVWA 1HYRC 5TPWH 1IE5A 1I7TB 4MB5A 5EOCL 4UINH 1NAKH 5EBMA 5C0IB 3OB0K 4K5NA 5DRZB 5G4MA 4CU6A 3OJMB 1TNNA 5I1AB 5H8DA 5HI4D 3P4MB 2WQ8A 4AJVA 1XX9C 2O4EA 5ANHA 2MKWA 1E28B 2DJMA 3C60B 3E6FB 4R5VA 3SDAD 3ZL1A 4DN4L 6PAZA 4OI8A 2NUTB 4Z76A 1SJMA 1EZVY 5F7MC 1OSPH 4ODUB 2EYSA 2LV4A 3JYBA 1PG7H 3FRUB 4KMTH 2Z93A 1M9SA 3KPSD 4JMXA 3ULUE 1HZLA 4G72B 3PIQB 4HKJA 4N2EA 6TAAA 4L5FE 4IRSD 4JY6A 3MNZB 5F9JB 3LKQA 3NDZE 2LAAA 3BW9A 4EIZC 4U1NB 2BVUA 2PR9A 3V5HA 1F18A 2RMNA 2XKUA 4I18C 4RRPG 2MTPA 4WSKA 4OLYL 1IQDA 3WE6B 3DXAB 4K9JA 4LASH 3JQOB 1AGEB 4ACPA 5H37G 2XPGA 4U1KB 4MBRA 3QUMH 1W80A 4Y1AA 5IQ7H 3B7TA 1JNLH 5TFSH 3ULVE 2ZWNA 1BREA 2PR4L 4UV4L 4RGNB 3V8OA 1A14H 2XQBH 1I8MB 4PLKD 1ZV2A 3MXWH 5ADOL 1YEDB 1ZCRA 4DO5A 5FO2A 3L2MA 1A7RH 2ZJSL 4JO4H 1NIEA 4KZ0A 2H32H 3MV7D 5EIIG 9PCYA 4X7SL 1RIVH 3KXFB 4V1DE 4GBXC 1U8LA 4FQQB 4L23A 1JNNH 5I1KL 2ZNWA 3A21A 5H4YA 3BN9C 3RWCA 1P7QB 3ARYA 4DK6A 3FBQA 3O3BB 2R9HD 1J1XH 1AGBB 5L6YL 2JKJA 1QHPA 2FL5B 4JFOB 5AQ0A 3RGVB 4MCZB 1EV2E 4CVZB 4OZGF 5J9PA 3HW7A 3C5JA 2CUHA 5A16A 2XN9D 3ZO0A 2ITCA 2HG5A 2LGNA 1G5GA 2E0PA 3GGWA 5DRNA 4BGDA 1G7PA 2CBQA 4GIPD 1CLOH 4CMMB 1JUFA 3CH8A 5DD3H 2OP4H 4L9LC 3ROOB 3I02B 4WW2A 2AXHA 3A5VA 3RUGA 3GMOB 3VXRD 2CRZA 1IEAB 1HZHH 1Q9OA 2VJ0A 5D2LE 3DGGA 2P43B 1E3XA 1S9YB 1FFTB 2LAGB 1Z5YD 3IJEA 3DX0A 4QAMB 3OC8A 4JPKL 4DZBA 3BEWB 4AIXA 4R7DA 1BOGA 4TNGA 3TV3L 2XACC 4X4XB 5G2NA 5C09A 4W1TA 1G94A 2C1PB 2YKLH 2DLHA 3EJCA 4NGHH 1IILE 1YC8A 1QSEE 1BPVA 1OZTG 4JM2D 1M53A 5J3HC 3BO8B 4ZFOB 4OCRL 2VJ8A 3INUH 1YEIH 3AUVA 5F3HA 4NAJA 3MNWA 4PLJD 2LT9A 3OR6A 1GIGH 1QLEB 5D1XB 4QHKI 1ORQB 5I76B 3QUKA 1XIWD 2A5UA 4P0DA 4LLMB 4B96A 5JORB 2GIXA 1QACA 1YEEL 3AG1B 3FHAA 4GI9A 4TVSa 3MN8A 1TTBA 1AXTH 3MV8B 5DD1L 5FYKH 3RU8L 1U95A 3TOPA 2GSGB 3T6ZA 4Y2OB 3D25A 4G6ML 1CL7L 4FTVA 4QCIA 5D8JL 3ZE2B 1IBGH 4PJ7F 3SYCA 2IDQA 2OCFD 2F5AH 1NAML 3ATAA 2EEFA 4N25A 1M2VA 1G5AA 2KBGA 3VD7A 4A6YL 3WFHB 3SE4A 3BAEL 1TLMA 3T9WA 5AD0A 3TESA 1SXAA 3ZE0F 5C3LD 1JVOA 2R1XA 1ES0B 4CJ1A 2YLKA 4LP8A 4UQ3A 1NOLA 4MDRA 3PWVB 2OA9A 3FS9A 1DLFL 3PHOA 1FFRA 2WWMC 2EH7H 3K4ZA 5SWZA 2E7BA 4RX4A 1ZSHA 3BGFB 4YLCA 1GJWA 3AXLA 1LL1A 3DK0A 5C6TH 3OJDB 2WYTA 1MCLA 3CDCA 3HZVA 3QP3A 4WHDA 1AQHA 1DBAH 5LNGA 1MNNA 2PWFA 4LXFA 1MVUA 3GRBA 3RY5A 3ARGD 2DBLL 4WO0A 2QZ5A 4ALAC 1NQBA 3EDEA 1UATA 2AI0L 5DQJB 3FOLA 3IU4L 3HAEH 3QDJA 2HZHA 4PJEB 4HZLA 4QOKE 4I8DA 3KDPB 2V17H 3NAAL 4ANXA 3EJUA 1PTZA 1ZHBB 4R7NA 3PABB 4RAVA 5IKCA 3GXPA 4XMLL 3JWNG 3UYRL 4TS6A 5L4IA 1JF5A 1JSYA 1NH6A 2NY3B 4FXLA 4NOBA 4Y16A 1OP4A 2NXYC 2JB5L 1PFCA 3CFCL 2FT7A 2RQEA 2XA3A 3D3VD 2VDRL 2B0SL 4OBSA 2W65B 3QFDA 1DFBL 1JPST 1SY6A 1CZ8L 1T04B 1H3VA 1J0ZA 2CGRH 3PP3K 4RBPH 2YD3A 5K9QI 5FYKE 3D85B 1QOKA 1LO0L 5C0JA 2B9AA 3TA3D 4A7VA 1Z3GL 4M7JH 3ARDB 5ABAA 3VXMD 3REWA 2XWDA 3U4AA 2F8OA 1N6UA 5TD4A 5AOIA 1SRDA 1DE4B 2F74A 2Y2TA 3ELQA 4LQFH 3L9RA 3KCPB 1OW0C 1U6AL 2CO1A 3TEUA 4M7ZB 1QFUH 1T1ZB 2PW1A 1FH5H 1P1ZB 3T1FB 4AXWA 3OKKA 4LDOB 5F93C 3SDAB 3WUWA 3HLKA 3Q1SH 2EVGA 3NSDA 4CSSA 2WYIA 3HBPA 2NW3B 4DP2X 3EFFB 2R69H 3L9YA 4Y4FC 2CDEA 3KPSB 3HR5B 1ADQH 1FHGA 2XWEA 3OKYA 4HCGA 4KWUA 4HJUA 2DWTA 5C71A 4IRSB 4L8CA 4JG0H 1EBAA 1R5WA 1THAA 4LCWE 4WRLA 4MS6A 3WIHH 1SOXA 5L0QC 4BWWA 3LHPH 2FQGA 3NFSL 4R97B 3KLKA 2E9WA 5TE6L 1IC5L 2EDKA 4H5SB 3R7RA 1N5YL 5AKVA 1N4XH 1OAYL 5EO0B 4UOW1 2FGWL 4EBQH 2XSKA 4ZW6A 1N5AA 4QWWC 1Y0LA 1RXLA 1BYNA 1MVFA 3QNZA 2VH5H 4PR5B 2H6UA 4MB3A 5T1LD 3CU7A 1OTUD 3L3KB 5IMOA 1WAAE 1YHPA 4PGDB 1RL1A 3CBRA 5GISH 1UM4H 4FLRA 2XWXA 4P4KA 4ZPTA 3SBQA 5HGBA 4WSJA 5CEZL 1XF1A 5D1QC 2QLYA 3O6ML 3MV7B 4F92B 5CJ5A 2V5RA 1DBMH 2HWZH 4MXWH 4PB9H 3VGDA 1CD1B 2GI0A 2AP2A 4MKMA 4UQIM 1YA5A 1LEKA 5L9DL 1V27A 5EOTB 1BAFH 1J8SA 2LFEA 4V33A 1K4DA 4Q6KA 1KLFB 1E2VA 1QBBA 3B7SA 3MCYA 5JO5A 2X3AA 5D7IF 5AW3B 3VH8A 3W2DH 4EXKA 5LG6A 1HH6A 4OJYA 2OMWB 1FL6A 1EJ6A 1J1PL 1LWJA 3NCBB 2EVHA 1DJYA 1IC0A 1NM4A 3PPSA 4URTB 3UZEC 2KDYA 2KKQA 1X5YA 3QIUC 3QI9D 5F1NB 5FYLL 2XN9B 1RZJH 5CD5C 4N8VG 1BFVL 4G42B 5F7HA 4HJEA 1PX3A 1F97A 4E5XA 5AVQB 5AW8B 3BGMB 4BKSC 3P02A 3U2SA 3VXRB 4BK5A 5HHXH 5CO1A 1F6AA 2WZPD 4KC3B 4X6CF 4ZMAT 4P99A 3UGEA 5I8CA 5HHMD 2UZIL 3UCRA 4ABUA 1I9RL 5GRJH 2IPUK 3EF4A 4WHYG 4L4VA 5E5MB 1S7VA 1XBDA 2APTA 3ZDZF 2A6KA 3BZFB 5B1BB 4QF1A 2D7TH 3GRWA 4F7EA 5JQ6L 3WFDL 4BRJA 4PRID 4KZDL 4FYRA 1AD0B 1MH5B 5C0CA 3OHXC 3I6KA 3ARVA 3K74B 3ZMNA 4XN4A 1LGVA 1IAOA 5EU7C 3KWVA 2HAZA 2OQJA 1XZ0B 4FYTA 5CBEB 4JM2B 3UJJL 1SHWA 2HG0A 4G8EA 4GG6A 1A3LL 3V0GA 1PIGA 5HDQH 3TYFB 1SMAA 4MJ2A 1CYWA 2O5ZH 1BECA 3CCHA 4YBLB 2H1PH 2F54A 1XIWB 2JELL 5ESVB 2AK4A 2XWJB 3LQMA 5LQBL 2DKMA 2BHYA 5EN3A 3WEMA 2HKHH 1JZFA 3A4AA 4TUOB 3RA7H 3ZHDA 3APCA 4L5FL 1U92A 2WLMA 4NQQA 4UNUA 5FS5A 1AZUA 5JR1L 4PMFA 2IWEA 3CH1A 4EF3A 1GTNA 4ZW3A 4XPFL 5HYJE 1IGFL 2PP8A 1SFDA 3IGAA 4ZW7A 5JXEA 1T1XA 3GS7A 4PYGA 2W95A 4MD5A 1UFGA 2HLAA 4Y8AA 4R96B 3UH8A 5EBLA 1TSRA 2A74B 3BDYH 3LRGA 3VG9C 2R56L 3BISA 3S35X 2A6IB 3O3DB 2ITDA 3ULVL 3WIIL 2E75C 4B9FA 5MHSD 3VFPA 2IOIA 3RWGA 3V0IA 4PI2A 3VO0A 4LQ1A 3AAZA 3QUYC 4NQCD 4B41A 3GMRB 4I3RL 2NSMA 1FIGL 5LBSA 4JGJA 4BFKA 3DMMC 5JHDD 4Z7VB 4OZIA 3ARGB 3TPUB 3LHAA 4RDQF 4PIRF 1A21A 4NQEA 2YEZA 3RWEB 5IF0B 4ZS6D 5IV2A 5KSBA 4MA1C 3LKPB 1MCFA 5LCVA 1F4YL 3QYNA 1AD9B 2ZG2A 1G6VK 3P3SA 1EVUA 1G7MB 5TPWL 2GJZB 5DS2A 4UINL 3SKOA 1NAKL 2XFGB 3BXNB 2WIIB 4JE0A 4L37B 1A02N 3PJSB 5ANMB 1SXBA 4W6XB 2HT2D 4JRYD 2X4OB 1Z7JA 1H0DA 4N87A 1DJHA 2GAZA 3D3VB 4PJ8D 4O5LH 1IMHC 4WHTA 1B0IA 4GFTB 5DU7A 2O6EA 1T21B 3L1GA 3WKPA 3AY4C 1QG3A 1OSPL 1R5IB 1V3MA 2P5PA 3OWEA 5DFAA 2R1YA 1HYSD 5CZXC 1PG7L 3SE6A 4KMTL 2WGNB 5FV2A 4YDVA 1FAIH 5FO8A 3TA3B 1M4KA 4PRHA 3DXAE 2VSKB 2Y5QA 4Y5VC 3QRGH 2CWRA 3SSGA 3OLEA 3VXMB 1W9XA 3KGUA 2VDPH 3KPQB 3MRFA 1OOWA 5J57B 4UM8A 3II2A 5H37H 2EEAA 1YNLH 1ZDQA 1J5DA 3BZ4A 3NJGA 2VERN 4ZPVB 4RGNE 4QHLB 4RQQA 4L1BA 2WO4A 4LASL 5DFVD 1UYWH 1JGEA 4XCNB 3LRKA 3GSRB 5BMFH 3QUML 3B2VH 5DS1A 5IQ7L 4NERA 3GYRA 1KIQA 1HT6A 1JNLL 1V5JA 5TFSL 3V0WH 3KXFE 4JE4B 2BVOA 2Z34A 1A14L 4J27A 4XOAA 3U0PA 1MAJA 3HG2A 1BBDH 3MXWL 3WIAA 5EZLA 3FCUB 4PD4J 5FGSA 1A7RL 4JO4L 1BM3H 3U7YH 1RIVL 3FF7A 4P2RD 1M7DA 2Q0ZX 3CDZA 3HE6B 1DLHB 4H8UA 3WUZA 1JNNL 2FEDD 4LNRA 5AZ2H 4JFSA 3RWHA 2J7LA 2YJLA 1F4HA 2VO8A 2PYEA 3Q01A 3FSOA 1JF1B 3NT0A 1G0YR 4JDEA 1SLUA 1J1XL 2MNJB 3LEVH 5F0LB 3UC2A 2YD5A 3X14B 5L7XH 2D9QB 2G75A 2JV6A 1QLRA 3DX9A 3G5YB 2AXGA 2ARJA 3FH8A 4AQ8C 3NCJH 3VW3H 3VSUA 4MS8C 3JT2A 1MFBH 4OCLC 3TJHC 4TLKA 1YEFH 5TGBA 2Z8WC 2PO6A 2F53B 3E0GA 3CFTA 4YHNB 1CLOL 3F58H 2WZ6A 5DD3L 2Y2WA 2OP4L 5AAMA 2NSXA 3AU0A 4AH2A 2E9IA 2SODB 4MDJB 5DDHA 5D93B 1T7YA 3PL6C 4JVPA 2BMKB 3K6DA 4A7QA 4B27A 4UAOC 1HZHL 4W9LC 2BSTB 3P2BA 3X11B 1PY4A 3BIKA 1IAKB 1UFUA 3QFGA 1OGAA 4U6YB 2BOCB 2BS71 2QEJA 3QI9B 3TO4C 3VVVA 5D1XE 3FCTB 3T3MF 4KZEH 2H45A 2YKLL 2VXTH 4XPHH 3R06A 1X5XA 2IGFH 1KACB 1YJDH 4NGHL 3LXCA 1FNLA 5CS7A 1G7JB 3INUL 2O6PA 4FRWA 2YO3A 1MY7A 1YEIL 1BFTA 2V3DA 2WY3B 3DECA 3FYEB 3MV8E 4HKZB 4K5PA 5FGBA 4XC1L 3ZUNC 1T0OA 4BE5A 1GIGL 4FYQA 4F5CA 5I71C 5DZOA 2CKNA 1N59A 4FXKA 2D7NA 3ZE2E 2ZQKA 4DETA 4DQOH 5B8CB 5FYKL 5DVPA 5HHMB 1JWSB 1AXTL 4N2NA 4DEPB 4M5ZH 3SKMA 4U6TA 4MDIB 5T5NF 2XX1A 3VNZA 4ZUSA 1X7QB 4XT1C 2QKIA 4UBDC 3CSPA 3LNGA 1VFMA 3VM7A 1IBGL 1KBGH 1XSOA 1Z0MA 3P77B 2F5AL 1SHSA 2VNCA 4YJZL 2GB2A 4PCKA 5F9WB 4AC2A 2Z92B 4FQHB 3AM8A 2YMTA 4DIXA 5AZUA 1Y07A 3BRDA 1VDGA 2WXPA 4JR9H 5DJCA 4JPIA 4PEEA 4XPAH 4P05A 3VGAB 4BYHA 3IRZA 1G7HA 5I0ZA 5KYWA 3T0EC 1IGCH 4FG4A 4GXUN 3GXDA 2CCVA 4HCRH 5E2WH 5CLYA 1E90A 3OMZA 4LPUA 1U8QB 3W1ZA 2HVJB 2BSSB 2JH2A 5TDOA 1W8EA 4RNRA 2D2OA 1LEGA 1T5XA 5C6TL 2FH8A 3T0AA 2P46B 4OUUA 5IQMA 2R2EA 1DBAL 4Z78A 3STLB 4PJEE 1J5HA 5F7BA 2KERA 3FNKA 3TVMC 3JV0A 2P8PB 3HUJA 4JAMA 1OIOA 3TONA 4DEUA 1EFXD 5I17B 1OT1A 3JWNH 4ZUWB 1OK0A 2DMGA 1NBQA 1A6UH 5G55A 2V17L 4XNAA 4UUJA 3BPNC 1JN6A 3SQBA 2Z31C 3MRGB 5JDSB 4JFED 2DWYA 5IW6A 4F91B 4JCMA 5FFLA 2NPLX 3P73A 4NQCB 7PAZA 1C12B 2VE6A 1B9ZA 4FQPA 4WJKB 4S1QH 3E3QE 4HV8B 3G6JF 1HL4A 2CGRL 1HWHB 4P3WA 3ZW3A 4YSEA 4WGWB 4HS3A 4KK8C 3CBJB 3BX7C 2C1OB 3HS0B 4ZMLA 5F7UA 2R1WA 2Y3NA 4WIQA 1JPFA 4M7JL 4MXVF 2UUDK 1GOHA 3HNTH 1AI1H 4ZD3H 2XI9A 4ZI8A 5GGSY 4KH9A 4Q9QH 2DD8H 1SXZA 4JO1L 4NZFA 5TE4H 5TQ0H 4YVUA 5B39A 1BQKA 3PGDB 3IE9A 4FLHA 3EJTA 2LQRA 1QFUL 3UGUA 1K2DA 1FH5L 4JRYB 4PJ8B 1ED3B 2C4FU 3KPSE 1NCBH 4XOEA 5IJBC 3CFBB 3Q1SL 3FT2A 2Y36H 3QAZC 3CFJA 3FH5A 5CIPH 3FQ1A 3JWDC 2R69L 2Y0SA 4EI5D 1TFPA 3RNQA 3OX8A 1ADQL 1T66C 4Z18A 2WB7A 2CHZA 1J05A 3T8XB 5CFAA 1PZUB 5JHLH 4CADB 1QTYT 4PJDA 5A7EA 4JG0L 2FH6A 3WL9A 2BWDA 4XPTH 5B38B 2FJHB 2NQCA 3WIHL 4L1TA 1G7LA 3I6LD 3LHPL 3RDTC 1ZMYA 3ZLQC 3W37A 3ZYOA 1QUNA 5MENA 4KNQA 1IM9D 3UJTH 2F9BT 3IS1X 2AQTA 1N4XL 5B1KA 1U33A 3IJSA 4EBQL 1YUKB 3G6AA 4FLOA 6PCYA 1A3RH 1RK0B 4WCYH 1S6NA 2VH5L 3DIVA 3U9UB 3KHQA 3MV7E 2VN3A 1FCCA 1PY0A 1NDGB 3DX6A 5E1HB 3NEOA 5E6IC 3UZVB 1I53A 1UM4L 4KQ3H 4L8SB 2QT6A 3OD3A 4U1HB 1SM3H 1A4CA 5GGQH 3W39B 4UOW0 2IAMC 3NRPA 3FUMA 5EO1A 1CDJA 1GS8A 1PZBA 1DBML 2HWZL 3EJRA 3HPLB 4MXWL 1TVDA 4P2RB 4PB9L 5ERWB 2LR4A 2PTTB 2OX5B 3RFZC 1QBMH 1SEBA 4PJ6A 2LU3A 5CM1A 5B1AB 1BAFL 3VGEA 3CE1A 2G9HA 5CEXB 2XN9E 3G5ZA 1XH3B 3O11A 2OR9H 4FKKA 3W2DL 1ETA1 2BVTA 4W4OC 1HL9A 4PJGF 3ZIMA 2ODHA 2HLFC 1TQWA 3EXLA 1ROCA 3V4LA 5JHAA 3GSNA 3NSXA 4MMXB 1RZJL 3SE9H 2UZYA 3VXRE 5IG7B 2VZ1A 2MCAA 3CVBA 1OCCB 5AOZA 1U8MB 1E2WA 4TRPH 3QULB 3CC5B 1N6QH 3VGBA 5J56B 4X6FA 5CF3A 5HHXL 4X8JB 2GSIA 1P84J 5KSUB 2NY5H 1K8DB 5JPMB 1QX1A 2BXZA 2MPVA 2XXFA 4N0RA 4GPVA 2IADB 3PF2A 3PUCA 1E5YA 4U1SB 5GRJL 4ANUA 5J13B 2EIZB 3HPJB 3RWDB 5HVGB 7CGTA 1DEEA 2D7TL 2DTSA 4JFFD 2G5BB 1ETB1 4P3CH 5LGKA 5AVZB 3Q05A 2IPUG 3I75B 2X4TB 1QQDB 1KTDB 1XCXA 3QRFM 1YNKH 5EZIH 4JNXA 2D0GA 5HDQL 2WINB 2E59A 2O5ZL 2H1PL 5E1QA 2NUPA 4R8WH 4YOKA 2X53A 2DMHA 4ZTEA 4X6EB 3H85A 4LFHG 3II3A 3F7QA 1WTLA 1D9KB 3UAEA 2ADJB 2HKHL 3WXVH 3RA7L 3D39A 4PJAF 4PRAA 3UABA 4GAGH 4J8RA 4Q58C 1SVZA 1F90H 2DQGH 2O26U 3DDGA 4JZNB 2NNXA 1OGPA 4AQ1A 1JVLA 1ET5A 1XR8B 3D09A 3RIAF 2XZZA 4N2HA 1B2WH 2HX7A 3ETBJ 4N2DA 4GG8B 4AYMC 1A7NL 5CLWA 3RPIB 2ZYSA 1ZGLB 2CO3A 2K3TA 3MJ6A 1FNEA 1L9TA 3BDYL 1EZUA 1TOXA 2DKUA 3C87A 4QJ4B 2PLTA 5I2IA 2GJPA 3GJEA 1J8KA 4OFPA 5F44A 4M8VA 2R0KH 2CDGA 3IMVA 5C3TA 5DZLA 3E80A 1T1WA 4Z7VE 1VESA 3HG1A 1RY7B 2CO7A 3QYCA 4U1MA 4K71B 3F12B 1KB5H 2GIYA 3L9BA 4U1JA 1MAMH 1BV8A 4JZJC 3VSVA 4Z76B 3VM5A 1BGXH 3TEXA 4WWKB 1GSKA 3OKLB 4XNYH 4F8TA 4XNQB 1ML0A 3ULVC 1J7VR 1OAUH 5E2VH 4GXUM 1EFXB 3EFOA 4P2AA 3V9EA 5A43C 4QKXB 2X10A 5IB2A 2C3VB 1R17A 4U0QB 1LEIA 5HJDA 5ANME 1ZIAA 4JY6B 4PSPA 3FUFA 1WFNA 3VFWA 3F84A 3D3VE 3DKHA 1G7QA 3Q2VA 4OT1H 1IM3A 2NTFB 3MROB 1GCYA 4Y4HD 5I0DA 4JFEB 1MCNA 4XOBA 3H7LA 3OB0H 3N9GH 5DJ8A 5D6CA 4O5LL 4TPRH 2VN6A 4IQHA 4ORGA 4Y1AB 3CHSA 2APVA 1L0XA 1RKRA 1WFOA 5L8LB 4QRRD 4LSVH 2EDYA 2R2BB 1Z9OA 2GUOB 2BNQA 4NQDD 2D03H 5ECJE 5IQNA 1MJUH 4RFOH 2FNWA 1SPDA 4YZWA 1FAIL 4LVHB 3P4NB 1C1EH 1VFUA 3TEYA 3H53A 1UOWA 2N0KA 3GNMH 3QRGL 4OI7A 1J0KA 2VDPL 4ELMA 4JHWH 1U8LB 4AVIA 2DEYX 3QUZD 1YNLL 3DOSA 2B1OA 2OM5A 3RWCB 2DIBA 5EEXA 3FU9A 4BA8A 1UYWL 2GJ6B 4AITA 4QTHB 2X4NA 5BMFL 4KK9D 1RSFA 3B2VL 3QS3A 2NRDA 3NK4A 1WAEA 4I5BA 5IVXB 2CRYA 3MYJA 3V0WL 3VFVA 5DYOA 1BDYA 1E5CA 1FAKT 3C5ZA 3IFLH 4EI5B 1IV8A 5D70H 1JNJA 5INCB 5KBNC 3UXFA 1BBDL 1NUDA 3NABH 4RRPM 1MCWM 2EP6A 5DYFA 2HG5B 3UTSD 3LKOA 2VZUA 4YVNA 2VQTA 1BM3L 3MJ8B 3U7YL 4JO2H 1ZK5A 2I07B 5ADPH 5JW4N 5KVMC 2EVIA 1YZZA 4IBWA 1DL7H 5AZ2L 3O4LA 4XWOD 4WW2B 3T4AB 3RUGB 1BFOA 3LY6A 1TZIA 1QEWA 1IC4H 5BRZA 1QW8A 3WJLC 1CXHA 5AOMA 1GZPB 1QHOA 2YSSA 1KGJA 3LEVL 2ADYA 4JJ5A 3JVGC 4DZBB 4N5EC 2F53E 5L7XL 2ROXA 1BZ9B 1BOGB 2KHAA 4NAQA 1G9HA 2Z4QB 2NZ9D 4A04A 3VW3L 4M6NH 5FDWA 1MFBL 1QPKA 3B34A 3LRHA 1U8IA 1PDKA 1YEFL 2VCOA 3A24A 3MGTA 5GZND 3S6CA 1DJGA 3CJJA 1CDHA 3K91A 1EHXA 4KXCA 2GKIA 3F58L 3P54A 3D52A 3FO9B 5F3HB 3RVXC 4JFTA 3MNWB 2P4AB 1DUZB 1XV8A 4AUJA 3OR6B 5MEPB 1V54B 2F1BA 3KLAA 2QFRA 4B50A 4ZDHA 4P5MA 3WAJA 1UA3A 2X44D 2XUWA 4LLUB 3CZJA 4JKWA 2CMRH 4IOSD 1U95B 1HNFA 2HVBA 1KLGB 3HE7A 4P57A 5GS1A 4FDWA 4NRXA 3D2UD 3SDCA 3KPOA 1E7UA 3BESR 3MZTA 4PG9A 1KYOJ 1EMTH 1CGWA 4PY7B 2JIXA 4WI0A 4KZEL 2VXTL 4XPHL 4ZUTA 2X6CA 2IGFL 2BC4A 3MO1B 4NQSA 2VDNB 3VGHA 3QC6X 3VD3A 2ICWI 4EI6A 2H9GA 5HHME 1SQMA 3WUWG 1INQB 3DPBA 1IGYA 3IRPX 3ARFD 3E9TA 5I6PA 1AKJA 4J3OC 4XHJC 1KXHA 3I84A 5CSGA 1J0JA 4DQOL 1F42A 3A47A 3LKSB 2CUAA 2BP0A 4M5ZL 4RMRA 5LGYA 2R29A 1UA6H 4UOJA 3PWLA 1NFAA 2CM6A 4OD1H 2WZPA 3HZVB 4JFFB 1D7BA 1KBGL 1MLCA 3N1FC 3QXUA 3MLSH 4HUCA 1CQKA 1H3PH 1FC1A 3CZEA 2CLRA 4I0PD 4U31A 1HHJB 4MXQD 5MERA 4RCAA 2JKLA 1DEDA 4JR9L 5KBLA 3ZXAC 4XPAL 1V3KA 3OLDA 1IBDA 1ORSA 5AYUH 1IGCL 1E6JH 4RAVB 3DHPA 4GP4B 1NLDH 1J11A 4HCRL 5E2WL 4BHUI 1MFEH 4DGIH 1W72A 1JOIA 3PQYA 2Q8BH 1TQBB 4WJG3 5HYQA 2WYZA 1XGUA 1YY8A 4UMGA 3DGCR 1OPGH 5KS9A 2WNKA 3G3LA 1OD7A 4IK6A 3BPLC 2HRGA 2OJEA 3FCBA 3L5JA 1J9TA 3AREC 4GW5B 4Z7NF 3VH8G 5MHSE 2QKSA 3HOGA 4PJCF 1A6UL 3IXTA 5E8EB 4AM0B 3QJHB 2VLRA 5KBKA 3CWGA 1PZCA 4LDLB 3SGJA 4CC4C 5CMAA 4NQCE 1DZBA 3KYKH 2KZ1B 2EECA 1VKXB 2E6QA 4ZUUB 3JTTA 4DVBA 4LT7A 3KLHD 3L9RB 4NO5B 4LLDA 2DB8A 3V9CA 3KD4A 4PCSA 4N2IA 5E6SB 4PTTA 1ANUA 1Z9LA 4JX0A 4N20A 4BSWA 4HS6B 3L4VA 2OMBA 5C0DA 4UIKH 4AXWB 4QHPA 2OTUA 1JFHA 4S1QL 5IEHA 3KDMA 1ZLSH 4AVHA 1D7DA 1U36A 1KXQE 2HN7B 4MNGB 4WU5B 3SKNA 3U0TB 3IKCB 4KX8A 4QUOA 3M46A 1YN7B 2C34A 1T6BX 3BKYH 1DN0A 3L3HB 3KPRD 3NESA 4B3VA 5IHLB 1EHNA 4Y2DD 3ILQC 5E8DH 4RGMB 4AG4H 1R5WB 2AV7B 3HNTL 4JRYE 1AI1L 2QQNH 4ZD3L 1TVHA 5FFOA 2DD8L 4EKJA 4Q9QL 1NC4D 1KN4H 5TE4L 2JK5B 3IGKA 5TQ0L 4Y4HB 1HEZB 3BN3B 3ZKMC 1FA4A 1NCDH 3DX7B 5F72S 4XNMA 5BV7B 1IGMH 4HD9A 4NNYB 1NCBL 3D33A 5ABZA 3VG0H 5ID1B 1I1AC 2Y36L 4YBQD 4QRRB 3LNEA 5D5MA 1PW3A 4S0TD 4U7KA 5KUMA 2BHZA 4GRWB 3SYAA 3FSWA 4BBWA 1I8IB 5JHLL 1E4WH 1JHKH 1Z5HA 5A3IC 4XPTL 1SVBA 2GTZA 1TMQA 3BRGC 1Q8MA 5I5RA 3UJTL 1MCJA 2X5PA 1AOZA 4HK3N 3LD8B 4IKNA 1UB6A 5ESAB 5JO5B 3MRLB 2VXSH 3NP4A 1J8HD 3PXJA 1QSFD 4TNWK 1A3RL 1HH6B 4WCYL 1FL6B 2CK0H 1P5UC 1DQJB 2H1LM 2XQYG 3L3OC 1UA7A 2W9EH 2YPLD 3CZUB 4P2RE 5I6NA 4JGNA 4AGOA 1JYVA 3JVFC 4KQ3L 4HUKB 4HEPA 1SM3L 4TQIA 1FZJA 2YS4A 2FO4B 5GGQL 2FQDA 4GXVH 1BQHA 5GGUB 3Q5YA 1WICA 2DDQH 3WS6C 1ADWA 4RMVA 2R4RH 3IWVA 1QBML 2IANA 3CFUA 4ELDA 43CAA 1UCBH 1JHLH 2XVBA 2XV2A 3QQ3A 3VNYA 4NPJA 4CBPA 2OR9L 3VA2C 4A55A 1GYUA 3DO7A 3OAWA 4R9HA 1S7VB 2LTQB 5DEGA 3PHSA 4WZ9A 4OCWH 4YFLF 2F61A 2J8UA 4LVNC 2E7HA 5JW4M 4F7EB 4FCHA 5FFGA 3SE9L 4KKRA 2DQCH 2F08A 3M1BA 1EH9A 4X9GA 1YNTF 3WLWC 3V6ZA 2J55A 4JQVC 1TTAA 2OQJB 2K9UA 2MWCA 4TRPL 5JLZB 4G8EB 4GG6B 2YGPA 1N6QL 1QRNA 1PG7W 1BMZA 1PAMA 4MYWB 1FI8C 5DVMA 1QFOA 2H2PC 2ZUWA 1HSAA 4GT7A 3BUTA 4CL7A 2AK4B 1RZJC 2NY5L 4XVUD 4G82A 2BY3A 2QJDA 3VXOB 5FECB 2E5EA 4JRLA 4M3HA 1CFSB 1T03H 5I19H 3D2UB 1U2CA 2CHWA 3P0YH 4MD0A 3TPKA 4F7TB 4R4ND 4X99B 4P3CL 4BFIB 4MD5B 2HLAB 5C07A 1X9LA 2G30A 4PWIA 4NC2B 1YNKL 5EZIL 4NQVA 3HKFA 4G11A 3X1EA 5E5LA 4R8WL 1G6RB 4G8IA 3NJIA 3C60C 4HALA 4IU3B 2ZPKH 4IKIA 2XWRA 3VFPB 4XXWA 1Z66A 3EG9B 3K5RA 1CDBA 3RWGB 3WXVL 1KLUB 1G7IB 2C3XA 3MRDA 2Z35A 3C08H 3QJUB 4KK5C 4GAGL 4DUVA 3KM1A 1F90L 2DQGL 4XTRD 4UYPA 4GRLA 4NEHB 2QGDA 3G08B 5E5RB 1BLNA 1TCRA 4G7VH 4NQXA 1B2WL 1OTTD 2CPUA 2YEZB 4M3KB 3VTTA 5HHQB 2ZCHH 4I0PB 2OL3A 1T2QH 3L3DA 4IMKA 4JO5A 1UXSA 5C08D 2YMXH 2WCSA 3EHBD 5GXBB 1E40A 3U2JA 2R0KL 3O6FA 3AS0A 3KWXA 3FZUD 1S7XA 1NKOA 2XBZA 4QRUB 3J7HA 3K46A 3QWQB 5EU3A 4NCC1 3VI3F 2EDBA 4RGNC 1H0DB 1KB5L 3GLZA 3K3QA 1MAML 4LSTH 3OF6D 4FE9A 4P2OA 1BGXL 1R3LB 4AWJC 2CBMA 4XNYL 2H4EA 3WO3B 3FPYA 4XHQA 1OAUL 4QRQB 5E2VL 1I3RA 2QSQA 2CKBB 5L2KD 4M8QB 3UTZA 1P5VA 2CXKA 2YLHA 2A0LD 5HVHC 2G3NA 4JFEE 2EYRA 1D5IH 1RLBA 4NWTH 3NCXA 1E65A 4Y19A 3TNNA 4Y1AE 4OT1L 5AKTA 2VABB 3P0VH 4EDXB 1EEZB 4WUUA 4BCXA 1CVSC 4RMQA 5D4QA 3RGVC 2ZOUA 4RQQB 4YNYB 3N9GL 1JGEB 3HHSA 2WANA 3B7RL 3CFIC 4TPRL 4LLVA 1S7UA 1XL4A 1KIQB 1KYUA 2P8LB 4JFHD 4PVLA 2PCFA 3FBKA 4IRJA 1FJ1B 3KAAA 3MJ7A 1UQSB 1EK3A 4LSVL 2D03L 1FL5A 4HLJA 1MJUL 1VZHA 3U0PB 4RFOL 4JY4A 1ZJAA 3UZQB 3NCYP 5C0AD 1J0YA 1S5IH 3H55A 1C1EL 2R7EA 4JUSA 4Y2DB 3GNML 4PB0H 2A73A 1J9SA 2GJ6E 4QI3A 4JHWL 4NKOB 2JF1A 3RWHB 1NINA 2DLGA 5IVXE 1KG0B 1NC4B 5K9QG 5AYTA 5EOQL 3HI5H 4PJFB 2NY4B 4AV0A 5EF2A 2EDMA 2JE8A 3V5KA 3V4VA 2Q7NA 4OZFB 1QLRB 2RTTA 4LHUA 4F93B 1A9BB 3IFLL 4J7RA 3I6LE 4KU1A 5D70L 5HI5C 5IJVA 3ARBA 1YECH 3LQAH 3NABL 4N6QA 4P46C 3RUGE 2V8LA 4OCXH 5D1XC 2VUKA 2ICWA 4JO2L 5IMMB 5ADPL 3WNNA 3G9VA 3L1EA 1VJSA 3QO1B 1DL7L 1NGZA 5IBLC 5FM5O 4OGQC 4QHMA 3JTSB 1FZMA 1WBYA 3REVB 1IC4L 3SCMD 4J39A 1T6VN 3KWTA 2GTWA 2XLLA 3KPMA 3BIKB 1J8HB 1SF5A 1P69B 1QSFB 3H9SA 4ETQB 2RALA 4L3AA 5CN3A 5GGRA 4NNPH 2YPLB 4ZMVA 4X4ZA 2A4CA 4WFGD 1UOVA 1UZ6E 3IT8D 4CILA 4M6NL 3VMOA 4EIUA 4F9PA 1CN4A 3WFBH 2KUTA 4AEFA 4Q7DA 3R06B 4MWFA 4YN3A 1SY6H 1BG9A 2C7UB 4TULH 4AQEB 1CS6A 5AW0B 3WHE1 1OL0A 2H1XA 1XAKA 2DTMH 4M00A 1BMWA 4WY7H 1T4WA 2YQGA 3H7BA 1E9OA 1OE2A 2DPKA 3BGFC 4LSUH 4TL5A 3ZRCC 4BHUA 5JA9A 4PAZA 4YHZH 2JCCF 1AQDB 2CMRL 43C9A 5HD8C 3U36B 2Y4SA 2VITA 1Z9SB 1MFCH 4MSWB 3SKMB 3DIFA 4ZUSB 2CBOA 4E68A 4O9HH 2ATPA 1N12A 1WIPA 5ACZA 4BH8B 3V4UH 1EMTL 1PLGH 3KS0H 5GRVK 4QJ5B 5DQ9B 1G9NH 5B39G 2E56A 4C83A 3GMNB 3GS4A 4M5YH 3NSCA 3CAFA 3GMQA 1GKOA 2UXTA 2LOEA 4HUVB 4ANKA 2NY3C 4JPIB 2BJMH 4AV4A 1G7HB 3NJHA 3SDDC 4F33A 1BVNT 1MN4A 5E8OA 2XNAA 4JFFE 1T5WA 3DUSA 3MBWA 1UT1A 1JYXA 1O5PA 4Y2LA 5TDOB 4QRPD 2O5YH 1UA6L 2ZKXA 3KYOB 5HGAA 4OD1L 1YY9C 1UJ3C 3CSYA 1QI5A 3RGHA 4E9RA 1EHAA 4OZGB 3TN0A 5I1HH 5CJXC 3UMTA 3MLSL 4NNXA 4L1SA 3E3QC 4K94C 2YEVB 3ARDC 1H3PL 4KO9A 4WK2B 4BGLA 2UXFA 4C4KT 5JIQA 5AVTB 2Q76B