4HHWA

Crystal structure of the pseudomonas aeruginosa azurin, h124no yoh122
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
127
Chain Sequence
b'AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNFVLSTAADMQGVVTDGMASGLDKDFLKPDDSRVIAQTKLIGSGEKDSVTFDVSKLKEGEQFMFFCTFPGHSALMGHLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Electron Flow through Nitrotyrosinate in Pseudomonas aeruginosa Azurin.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 34
structure length 127
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4hhwA00
3NSDA 4HAKA 3IN2A 1ZIAA 1KBWA 1BQKA 2JKWA 4GP5B 1N68A 3T6VA 1W6LA 7PCYA 2ZONA 2JXMA 1AS7A 1PLCA 4AZUA 3FSWA 4ENZA 2XV3A 1UATA 5B1JA 3T71A 4QKTA 2AZAA 1OE1A 2FT6A 1XMEB 5AZUA 1JZFA 2PCYA 2PPAA 2R7EA 1B3IA 3HB3B 3FT0A 3CDZA 5I6KA 4F2EA 2GC7C 5IY5B 4HCFA 2GI0A 2YQBA 4E9SA 2PPCA 1PF3A 2BO0A 1ASPA 2GB2A 4G7SB 3OMAB 4A2DA 3T6XA 1JVOA 2IWFA 1GY1A 3IE9A 5AKRA 2GC4C 3OQRA 3PLYA 2FT7A 2IWEA 1RZQA 1RCYA 5LDUA 1TEFA 3NSFA 3NJFA 1BXUA 3PPSA 1N70A 5F7BA 3FU8A 2HLEB 2WSDA 2IWKA 3SBRA 2YAOA 1JZEA 4HZ1A 3L45A 3SBQA 1SHXA 2EIJB 2UXVA 4BDVA 1NDTA 5B1BB 4YSQA 2XV2A 1E5YA 1OCZB 2MRYA 2XU9A 1GW0A 2CBPA 1PCSA 2VM4A 1CURA 1NIAA 2BHFA 4TXVB 2IDQA 2QT6A 2EINB 2DYRB 2YAPA 3CVBA 1BXVA 1QHQA 2GIMA 4HCIA 1ZV2A 1KDJA 1A8ZA 4YVUA 4PAZA 2BWDA 3EH3B 2DYSB 1GS8A 4HIPA 3X1NA 4WKXA 3X2QB 2A3TA 3NJKA 3SQRA 2FTAA 3NP3A 4E9VA 6PAZA 1HAUA 3JT2A 4NB7A 3T6ZA 4AKOA 4DP2X 1L9OA 1T5KA 1IUZA 4N4YB 2Q5BA 2FQFA 1NICA 2XLLA 3NJGA 4RH4A 1TKWA 1KV7A 2PPFA 5I6LA 1ZDQA 5F7AA 3ASOB 4X4KA 2HZHA 3UADA 1MG3C 1IBZA 4W9ZA 1X9UA 2XUWA 4E9YA 1JERA 1NIEA 4W1TA 4PCYA 1GY2A 2AZUA 2XX1A 4DP9X 1BYOA 2ZWNA 5I6MA 4M3HA 4KOCA 4BXVA 4HHWA 4A66A 2EILB 4YSAA 3ABLB 1BAWA 1J9QA 2VW7A 3MX0B 3TASA 4YSDA 4F7KA 3ZDWA 7PAZA 2GBAA 1GS6X 1GSKA 4A2GA 2BWIA 2HRGA 2DY2A 4DP5X 5E9NA 1SJMA 5I6PA 3X1FA 4BXSV 4G72B 3D12B 3ZBMA 5ANHA 3H56A 4GY4A 2PCFA 3GXUB 4DP8X 2QPDB 1BQ5A 4A2FA 1NIDA 4Q8BA 2OJ1A 1BYPA 4DP0X 4MFHA 3DKHA 1SFDA 3IBOA 2IDTA 2PPDA 1CC3A 3FQYA 3PAVA 1PLBA 2YAHA 3MBWB 4YSTA 4A2HA 1AZRA 1WAEA 2VSMB 2J5WA 4BWWA 5I5IA 1PY0A 4L0PB 1AS8A 1OF0A 5I5MA 2GHZA 1OOWA 1XB3A 3QJVB 3CVDA 2DV6A 2W8CA 1E30A 4A68A 4YSCA 3JTBA 4BDVB 3NP4A 1DYZA 1ASOA 3WKPA 5AFAA 1IBYA 3ERXA 2Y1AA 4AI7A 1AANA 4GYBA 1L9PA 1MZZA 2IH8A 2OV0A 1FWXA 2PP9A 3DTUB 1JZGA 3ASNB 2I7OA 1L9RA 2IH9A 1PZBA 1EZLA 2J56A 1RKRA 5B1KA 1NIBA 1E65A 3SBPA 1AG0A 1R1CA 4DPAX 4G7QB 1J5DA 3WI9A 3UAAA 3AG1B 2BZ7A 1RZPA 3AY2A 3NT0A 4KNUA 1L9SA 1AR1B 1NWPA 2YARA 2PLTA 3H4HA 3QJQB 4QLWA 4KO7A 1A3ZA 1JVLA 1A4BA 2AVFA 3DIVA 3PAUA 1HFUA 9PCYA 2B08A 1ET8A 3OMNB 1AZCA 2P80D 3ZX1A 1J5CA 4KO5A 1BXAA 2UXTA 1V10A 1ET7A 2IDFA 1KYAA 3FSZA 1JXGA 1NWOA 2EIKB 1FA4A 2HX7A 3CVCA 1NPJA 4DPBX 2IDSA 2FQEA 2XYBA 2GSMB 3IEAA 4NERA 4N8UA 2FQGA 1A4AA 1J9TA 1OCCB 3NJHA 2VN3A 2CUAA 2LLNA 3FSVA 4JHVA 2XXGA 5D4IA 1NPNA 1VLXA 4P5SA 2H5UA 3WIAA 4G71B 2ZOOA 1AZBA 2QDVA 1SFHA 3V9CA 3HEIB 1IC0A 3BQVA 1OCOB 3FYEB 3UABA 1ETJA 4KO6A 4EF3A 1PMYA 3FPYA 3S8GB 2YAFA 4ZK8A 2Y69B 2XVBA 5TK2A 1KGYE 1NZRA 3UACA 1CYXA 1V55B 2CJ3A 1PNCA 2J55A 1BEXA 2I85A 1SF3A 2JFCA 1MZYA 3EF4A 2FNWA 2CAKA 4BWUA 1HAWA 4P5RA 4YSPA 1IKOP 4FAAB 3S8FB 1JZHA 3NSYA 3UAEA 1NTDA 3S3DB 1ILSA 3H4FA 3AW5A 3FSAA 3WNJA 3PAZA 4YSUA 3FPXA 3NJNA 4HHGA 3ABKB 6PCYA 1OV8A 4KO9A 3GDCA 5B7FA 3OD3A 1NINA 2X88A 4YSSA 1FFTB 1AIZA 1OE3A 2WO3B 4G70B 3QJSB 1QLEB 3TBCA 3X1GA 2BW5A 2XWZA 3EHBB 3N2JA 4CSZA 2FWLB 4DP1X 3OMIB 1SNRA 2IDUA 4A67A 4DP6X 1W6WA 2RACA 3ABMB 3U25A 3QPKA 3WKQA 1M9WA 3UGEA 1JXFA 1BQRA 4UF7C 1W8EA 1CYWA 4BK5C 1YLBB 3C75A 4KNSA 3KW8A 2YAMA 8PAZA 5I6NA 2AANA 1AZUA 1J9RA 3FQ1A 3BVDB 4M4RB 1GYCA 1M57B 4WTQA 3X1BA 1MG2C 2UXFA 1F56A 4AKQA 4UANA 4BWTA 1EHKB 1L9QA 3X1EA 2BP0B 1ZIBA 3PCYA 3V9EA 4AX3A 3FU9A 2XXFA 5D4JA 1JOIA 1AAJA 3GYRA 3AG4B 5EHFA 2NRDA 1J9SA 3EH4B 4UAHA 4JHUA 1URIA 2VMJA 1ASQA 5I5JA 5B7MA 4Q89A 5I28A 1PAZA 3S3CB 2UX6A 4GXFA 2UX7A 1A4CA 5PAZA 5B1AB 2VW6A 1WS7A 2QDWA 1I53A 1GR7A 1E5ZA 4E9WA 2HRHA 1WA1X 2TSBA 1KCBA 3CZUB 3T9WA 4G7RB 2E86A 1PNDA 1AOZA 4DP4X 5I26A 1ET5A 4YSRA 2PP8A 2UXGA 2BP0A 5PCYA 2TSAA 2HXAA 2PP7A 2AFNA 2H3XC 2VSKB 1WA0X 2ZXWB 3FQ2A 3PXLA 1ZDSA 2IAAC 3TA4D 1TU2A 4E9RA 2X87A 4DP7X 1WS8A 2XX0A 4E9XA 3S3BB 1KCWA 4CSPA 1PZAA 2HX9A 1KDIA 2VM3A 1AG6A 1SHWA 4GP8B 4JKNA 3AG3B 2BW4A 1ADWA 3FS9A 3NJMA 2CCWA 4FA7B 3OM3B 3FU7B 3AZUA 3TBBA 3ABGA 3FYIB 1X9RA 4NAJA 5B1JC 1ID2A 2FQDA 2HX8A 2DWTA 3NYKA 1CUOA 4HCGA 3WNIA 2BZCA 4YL4A 1A65A 2YAEA 1WA2X 5D4HA 2EIMB 1M56B 3N55A 4AKPA 2H47C 3ZIYA 2FT8A 5FC9A 1GS7A 1OE2A 2Q9OA 1QNIA 2I7SA 2B3IA 2PPEA 4YSEA 3TU6A 2YXVA 1DZ0A 3AG2B 1JXDA 2CALA 2YXWA 3NSCA 2J57A 4GP4B 2YAQA 1JZJA 3FU7A 5A7EA 4K9JA 2VW4A 1SDDB 4DPCX 3KW7A 2BP8B 1ZPUA 4YVNA 1KBVA 4F2FA 2QPEB 1AACA 4KNTA 3T6WA 2DWSA 1XB8A 1NIFA 3G5WA 3IN0A 1E67A 1AS6A 4HALA 1AZNA 1TEGA 2XV0A 1PLAA 3QQXA 2N0MA 3NJJA 5B3SB 5TK4A 2W88A 3QJUB 1SF5A 4YSOA 3EH5B 3QJRB 2R7EB 5I6OA 1V54B 2WO2B 4A2EA 3NJLA 1MDAA 3CDZB 1SDDA 2FJSA 1L9TA 1OCRB 2BP8A 1JZIA 1PZCA 3WG7B 4E9QA 3RYMA 1ILUA 2MTAA 1AQ8A 2P80A 3CG8A 2OCCB 4E9TA 1XB6A 3QJTB 4KOBA 3NJIA 5B7EA
chains in the Genus database with same CATH superfamily
3IXTA 3LPFA 5ALBL 1T1YB 1S7WA 1JPSL 1UKSA 2EDXA 1N5YH 1BBJB 1NA8A 1WFTA 5EEYA 1QKZL 3FUEA 3FQWA 4PQXA 1NAMH 5JW5A 2FCBA 1J5HA 1KFAH 1U0QA 1ZVSB 4NT6A 1J8HD 5CCGE 4BZYA 1KBKA 4JM4H 3ZZQA 2R2BA 4HSCX 1AR2A 2PR9A 3FZUD 5E6YA 2P5EA 2F54D 3KLHD 3PDOA 5AZ2H 3TYGL 3VD9A 3A24A 1BHGA 2O61B 4UTAL 1HHGB 1EO5A 2NY2C 1G9MC 2GUOB 3BCFA 3UPRB 5DHVH 5C09A 4LGRB 5IVXA 3NSXA 3UYRL 3ZHFA 4Q9QL 1KJ2B 2QTVA 2O30A 3FF8A 5JORA 3TJHD 1URZA 4W68A 3IJEB 5IBLC 2HLEB 2BWQA 4FC3E 4L1TA 4QOKA 3SBRA 2VITA 2FR4B 1UKQA 2IQ9L 3D39E 1TCMA 1G84A 1U9KA 1W8OA 4ELMF 4FKHA 3WFZA 3SPIA 1TKWB 2FWUA 5K1JA 4F8PA 2WINB 5DYFA 1DN0A 3GXTA 3MRLA 1TTUA 4JZOA 3O4OC 4AMKL 5JHDD 5EBMA 4D7BA 3QNXB 3I6LD 3RIKA 2D7NA 3GMRB 1CL7L 2VC2L 2XN9E 4AEIH 1NIAA 1EX0A 4HKXA 3SGKC 4ADGA 2QT6A 4CADB 2VRKA 3LYRA 4DZ8A 3OF6D 3LZOA 1QLFA 1YEFH 4NO0D 1RUKL 3V52H 3TNMB 3QUML 5CMAA 3QJFA 3BSZL 3IRCA 3ZDYE 2WUBL 5ALBH 1DVFB 2AXGB 1MFBH 1T89A 6PAZA 1JPSH 1KXVC 1LNUA 4BCZA 4NB7A 4KK6D 2EDQA 2VDML 2X4UA 5FYKL 2HJFB 5JA9A 32C2B 1USQA 2X09A 2X2IA 4QR7A 4A7SA 1FG9C 1I3RB 1RSYA 1GSMA 2HT4C 3D25A 3DRQB 3ASOB 4H13C 4ONGL 4PRBA 3UADA 4X7DC 2DN7A 4U7MA 3G08A 4NUMA 5MI0C 1ETA1 3LKSB 2UVFA 3TYGH 4UTCA 3T1FB 1BOYA 1OP3H 5B38G 1AIFB 2ZG3A 3BLKA 2H0EA 2OZ4H 2XX1A 4E42B 2BVQB 2G2RA 1EHLL 4PGZA 2YSSA 4TNWK 4FP8L 2X4PB 2A6JA 4FFVD 3WIHA 1QSFD 3UYRH 2HMID 4Q9QH 4A39A 4JPIB 1ND0A 5BS0B 2XG4A 2WQXA 4NENB 1Z32X 1OM9A 4BZ2A 3I50L 3L5WA 3MBED 3O6ML 4GW5B 2BWIA 2IQ9H 2VLMD 3OKNA 3QWRA 4Y1SA 2DAVA 2CIKB 2WNGA 1CD8A 4FG4A 3GMOA 5FOBB 1CLOL 4PUBH 2PTTB 3TPUB 2A9ML 5T33L 5E00B 2TAAA 4JHWH 4JN1L 1ETB1 3MUHL 1A1NB 3L4ZA 4U6YA 3HZMB 2EXWD 4WNSA 5DVLA 1CL7H 4QAMB 2D7TH 2DWDA 2VC2H 4Y9GA 4V11A 2YXMA 2WGNB 3UAFA 3AM8A 4M6ML 3UTPE 5E5MA 1W0WB 2NT0A 3RG1C 3QUMH 4O00A 5EOQL 2APFA 2HPTA 4YHLL 1QPXA 2OX5B 3LCYA 3ARGB 1FP5A 1AYOA 3IGAB 3SDAC 3ZTCC 4J27A 1AS8A 3H7LA 2Z31B 4G9FB 1OOWA 4F9PC 2J8HA 1Y0LB 5DZOA 5SWSB 3UZVB 2VDMH 5AYUL 5FYKH 4Z3JA 3T8VA 4TQPA 4YHKL 4BSJA 3Q2NA 2BPBA 4FXKC 1NKRA 3PGDB 3VYNA 3NDYE 4ONGH 3KWUA 1DJSA 4QRTB 3PGCB 4GUOA 1WFJA 1XF2A 4UQ2A 4MYPA 3IMSA 4N6RA 2J73A 2PCPA 2EO1A 3EJYD 5IVNA 1VJSA 4M03A 1G87A 3BH8A 1ZV9A 3TM6A 4PJCF 4HMDA 4EN3B 3F12A 3KWXA 4RNRB 2GQHA 5D5ME 2Q6WA 3L3GB 1BF5A 4OJAA 1AG0A 2XJLA 5EH1A 1I9JL 2XN9A 3AY2A 4IKNA 3I50H 4KNUA 1RLWA 1CDBA 3O6MH 1IKNA 4UM9B 4OCRH 1F42A 3GPSA 2FAUA 2EADA 5CLXA 1PVHA 4H2CA 3EDJA 3BKYL 4N2AA 3DIVA 3DJRA 1BPLB 4R5TA 5EN2B 5MEOB 4AT6A 5ANMB 1CLOH 2ZICA 1D5ZB 2A9MH 3GPEA 3U9UA 3KLQA 2C9SA 1OO2A 4YXLH 1J0KA 3AQYA 2FSEB 1GZQA 1IBDA 3MDJA 4WW2C 5IVOA 1LE9A 1V3LA 3N41B 4NRXA 1AXTL 3CVCA 1NGZB 4PJGB 5I82A 4GAAA 4M6MH 3JZ7A 4Q9CA 2KHAA 2W91A 1PQZA 3IEAA 3MRQB 4ZTEA 4ZUSB 1TVHB 4N8UA 3FCTA 4B9ZA 1RJCA 3BIAX 4BFOA 4YHLH 2AQTA 4O5LL 1JBJA 2XA8L 3F6LA 5D4IA 1XCTB 3KDMB 1SOSA 1X7TA 2JSFA 43CAA 5ICZA 3BUBA 4LP8A 4PV9A 1B4TA 2YQGA 2F7IA 3QEHB 2X4TB 3G7TA 4PB0H 3WJJC 3LS4L 1DEDA 1ETJA 3IDMA 4YHKH 2IGFL 1FYHB 1SRDA 1KEGL 4OF3A 3H9SD 1NUNB 2Z64C 3HC4H 4NZFA 4YZFF 3LNFA 3UACA 4Q14A 2EDHA 5CEZE 3UAJD 4RAHA 2J55A 1EO8H 2X9YA 5I1CH 5KZCB 1S9WB 4QKXB 5FECA 3SKMA 1HAWA 3D18A 3I75A 2EDBA 3SPVA 3APMA 4MWFA 2O5NA 5BVJB 3B7SA 3MLSH 1BA9A 2FHCA 4FGMA 4LSRL 4MD4B 1CBVL 3QPQD 5L7XH 2X0UA 3RZCD 1GGIL 4MD5B 3C5ZA 1GTNA 3NZ8A 1E40A 3P9LA 2AJ3B 4TPRL 3N1FC 5EUKA 4ZTOH 3T8MA 2X53A 5A16B 3EOBA 4HLZG 5EU3B 1W9XA 1FG2B 1TTAA 2NY3C 1Q1PA 3NZHL 1D7BA 4HDIB 5T1DL 1MHHA 2IDUA 3RGBA 1DP0A 1OTSD 5IZ7A 1EANA 4UOJA 5HYJE 1J7VR 3SKUD 4V1DE 3T0XA 4BGDA 1SN0A 5MP6L 1B0RA 5EO0A 3VXQB 5DXWA 4IDJL 2AANA 1A6UH 3VACA 3VRLF 3L2LA 4AQAB 3BVDB 4Y19E 3LZFL 5DR5H 1N10A 4O5LH 3QRBA 5EIIB 2XA8H 1DBAL 5KYNA 1QNZL 1EVTC 3IAGC 4X9GA 2OTUB 3RURA 4JQVC 3DYOA 4XPHL 1OB0A 4ODSL 4X5WB 2IF7A 2FJHA 3FOMB 3WIFA 4ZRGA 5FXCH 2IGFH 3RWEB 1KEGH 5C0FA 1KACB 2Y7SA 3ZHNA 4F7TB 4IYKA 2H1LM 2YOAA 3AAZA 4UAHA 1I3UA 3PNWB 4ZMVA 2YEVB 4W9GC 2X4NB 1YO4A 3FC8A 1DVFD 1QUNA 4XCYB 3MV7B 5L2KE 1NFIB 3CX5K 5DJ8A 5PAZA 2AMUA 3HUJB 4YN3A 4M1CC 4N87A 4ANKA 2B4CL 2TSBA 1UJ3B 1C5BL 5HVHB 4LSRH 4R97B 1SXBA 4W4OC 3FT9A 5INCB 1OSPL 1KJVA 4RAUB 3VVWA 3WCYA 1HL9A 2GFBA 4FJYA 4HF5L 4PJDF 4K7FA 1GGIH 4HJGB 1IAOB 1TSHA 2OK0L 3QVAA 4F8NA 2IOIA 3B7YA 3EO0A 3LZQA 1BQHA 2L4OA 3PXLA 3AC0A 3WJMB 1N6UA 3DX8A 3HMWH 1MCBA 1SJVA 3NZHH 5JNYB 5T1DH 3AGVA 4X5LA 3JV4A 4E9XA 1C7SA 4Q0XL 4N3TA 2VO5A 2YD9A 4JANB 4YDLC 3MOAL 3WIHL 5BS0D 2DQMA 5MP6H 3OB0K 3UDWC 2FO4B 3GT6A 4MZRA 3QT2A 4NQVA 4OFPA 4BZ2L 4IDJH 1IC4H 1KIPB 3SE9L 3CC5A 3CX2A 1QSEE 3S35L 3NPSB 1G1CA 2YGVA 3LH2H 3SY0A 2OMYA 3LZFH 3S36X 3BAEL 1OHZA 4HK3N 4UM8A 3RUGE 1DBAH 1QNZH 4N0FA 4UT9A 3E6FA 4K3JL 1S7UB 3SBWC 1C12B 3QUYC 2X5PA 2E9BA 3BYTA 4P05A 4IKJA 3BGFC 4JM2F 5JPNA 4XPHH 3CGTA 2ED7A 1FFRA 4KY2A 4U3XA 4JZNB 3MLPA 3FFDA 1ZS8A 4D0CB 4FERA 1CF1A 5E6UB 2WKOA 5DJCB 1XR8B 5GRVK 3V7AE 1TCRA 5IGXL 4ICWA 3OC5A 3ZZLA 4GEJA 3ARGD 3HS0A 1BFVL 3MRDA 5ICXB 3KJ6L 4YHPB 2Z31D 1TZAA 2BP8B 3VX0A 1DEEA 4C4UA 2B4CH 1HHHA 2OL3A 3FQ4A 3D0LA 1AACA 1M4KA 5HYJA 4OGYL 4J28A 4V1DA 1OSPH 3TVMA 1S7VA 4PJ9A 4MA3B 5BJTA 2W94A 3RTLA 2OK0H 1X5IA 3LIUA 2NY4B 4C83A 1MJJA 2APVA 3P0VH 5FYKU 5HVGB 5L4JA 4Y19A 4EZJA 2ISDA 3SKNB 5ISZE 4PV8B 3Q06A 2F53E 1UWXH 4J8RB 5I1HH 2O1AA 4EN3D 4ABWA 4B95C 2IH3B 8FABB 4W9IC 2CDGB 2DQHL 1T3FA 1FJ1B 2DQGH 1IM9A 4NC1E 4UDTA 5AVUB 3F3HA 3QIWA 4P06A 5EC1A 4FX5A 3LJ3A 4U05A 4MMZB 5TFSH 1NCCL 3BJ91 3TBWA 1ILUA 2ZXEB 1JYNA 4BZ2H 1PTZA 3BW9B 2GTZA 3SE9H 3KCPB 3IDNB 1N59B 2M2DA 3S35H 3SOBL 5KSAC 1YPZE 3S8WA 2GJPA 4A7VA 3BAEH 1QBAA 3LKQB 1P6WA 4ZMZA 3N9GL 4Y2NA 5L2KA 1IB5A 4LGSB 3NSDA 3RBGA 1ZIAA 2HKHL 1WFIA 4NXKA 1NC2A 4K3JH 5FK9A 4WFFE 2IFFL 1AS7A 5KYXB 2J1YA 3H85A 3GBNL 3IFNL 3ETBJ 5B1JA 4YOKA 5D1QE 4BIKA 2YD0A 3VRJA 1C7TA 1WCBA 1T1ZA 4XP6L 3MUUA 4M6NL 5FGRA 4PLNC 4YDIL 5I6KA 4B9IA 4XMVA 1Z3GL 1HILA 5IGXH 2VZSA 4Z7UE 3TLRA 3VYPA 1BFVH 2R0LL 3QNZB 3KJ6H 4WI0A 1ZV5A 4WRLA 3CK0H 4F33A 5JPMA 3EJPA 4ZNCD 1NFDE 1RJLB 4IM8A 4P23C 4U2ZA 5DJYB 1EFXB 1BREA 4P2RD 4CN1A 2FT7A 5DJ6A 2DIBA 2DH3A 4CMHC 3NCMA 3BD3A 1H0DB 3MV8E 1VIWA 5F7BA 2ZPKL 1QSEA 2N7SA 1MW3A 2GYSA 2VLJA 3BH9B 3QDMB 4HHAB 1JTOA 4A6YB 4D9LL 2WYIA 2UY6A 3O41A 1F58H 3QXAB 4BDVA 2DQHH 3OX8B 4PLJC 4D94A 3DX9A 3LQAC 4D0BA 2RAMA 2Y24A 5E2JA 3ETBF 3JV6B 4DN4H 3Q13A 3QFJB 1NCCH 3FXIC 4OF7A 3CVHA 4S1DC 1XCQB 4WO0A 2FVNA 2Z35A 3RWHB 2APWA 4XBPB 2JNZA 3ILPB 2IDQA 4PWKA 1P7QA 3SOBH 3UBXA 3L5HA 1F4AA 3HG2A 5E2UH 1BVLA 3N9GH 1OK8A 5DLLA 3MRKA 3F8UB 2HKHH 5L8JB 1CB4A 3CE1A 4KI5C 2B1OA 4Z7NE 2V2WB 2IFFH 5KG9B 2YOCA 3GBNH 1EBPA 3B5GA 3IFNH 3KLAA 2JH2A 4PW3A 5T1LD 3T6ZA 1DL7L 3EGXA 4Z7WE 5CNHA 3TYFB 2WY3B 4LL9A 2IMNA 1IGTB 3GUTB 3UTSA 4W9DC 4XP6H 3NZSA 4M6NH 4AGQA 3KPSE 1MN4A 3D0VB 5GZOA 2CIIA 1Z3GH 3PIQB 5CP3A 5BVPL 4K71C 3TO4A 1F6FB 2FBJL 2ENJA 4RRPA 2IALB 3SE4C 2R0LH 4R9HA 3RPIA 4EOWL 1SY6L 3ARVA 2D9QB 1GY2A 2D0HA 3WXVH 2PWGA 4JFDD 5I6MA 4G8GD 5D9SA 4Y16B 5CR8A 1QZNA 4OF5A 3QI9A 4HHWA 3SQOL 2EXYD 3FCGA 5F7WC 3HNVH 4KUZL 5CJQL 2HFFA 2YIHA 4F7KA 2ZPKH 3VFNA 1IKFL 2LHAA 1VGKB 1YPZA 4F1ZA 2OFQA 5HDBE 4CGTA 4B9GA 1KTCA 3MV7D 4FTVB 4M5ZL 4A7GA 1E4KA 4HIJB 2Z0UA 3U7WL 3C5SB 4I0PA 4P5TA 4OBSA 3U0PA 5E8PB 2JLPA 3D12B 3STLB 4Z95L 2CGRL 2Y22A 1IVLA 1NIDA 2H9GB 2K8MA 3CHRA 3RTQC 4OFQA 3WN5B 5D1QA 3WY1A 2CZNA 1BF8A 2J20A 2GEEA 3PWUB 3EOAA 3C60B 2K6WA 5IG7A 3ULVE 5JW4M 4G42A 2ICWA 1N9PA 1NCAL 4XMZA 5EOTB 2Z4TA 1AZRA 3B34A 2J25A 1LO2L 2DM4A 3OR7B 4YAQB 4Q2ZB 4YLQT 1ZHBA 4Z7UA 1QPPA 2EIZA 3MLTA 1BZ7B 12E8L 1JL8A 2WLYA 4MJ5A 5AAMC 2E9WA 4X50A 4R2GB 4XN2A 3FQUA 1VB9A 2LV4A 3HC0A 3CNKA 1DL7H 2DV6A 3D85B 3M07A 1MFEL 4HOZA 4A68A 1GZPA 3K4ZA 1OTTD 2FWSA 2QQNL 4NN6B 4ZUUB 3BKML 3MV8A 2A4CA 2ARJA 1A6ZA 1JP5A 2ZD0A 3ERXA 4IRZH 3QDHA 5BVPH 3BAIA 1QBBA 3IDJA 2AF2A 5EO1B 3SSGA 3MBWA 3GLZA 2FBJH 4QXGH 2Z93B 4LHUB 4XNAA 2Z92A 4UT9L 1BQSA 1S7QA 5HHNB 1NLBL 4JPKL 5JO5B 1HC1A 3BX7C 4UZSA 3U82B 2MOQA 2YN3A 1CD0A 3G5VB 1L9MA 4HGMA 1NIBA 3W5NA 3S2CA 3B6SB 1C16A 3K5SA 3K8LA 4H8WC 3WE6A 5C7XL 3CBRA 4U0RB 3WI9A 4M4RA 5CJQH 3EF7A 2V8LA 4HLEA 3D0AA 1IKFH 4I85A 3HC2A 5ACZA 4ODBD 4L1LA 5FCUL 3OKOB 1NOAA 2YPLB 4NHUA 1U8KB 4M5ZH 3LRSB 2DQFB 3HG4A 2FZ3A 2H4EA 3FRPA 3U7WH 3PAUA 2VDRB 1KZQA 2HLFC 5H94A 4AVKA 3GMPA 4Z95H 2CGRH 2LU4A 4D2NA 1OWRM 1HDMA 2OL3L 2Q76A 3P54A 3QSKB 4X80H 5J1AB 1O7DC 4Z7WA 2F19H 2NTSP 5TDNB 5TGBB 2UXTA 2V9UA 5FO7B 2WLJA 4BUGA 1KGJA 1G5AA 4YL9A 5DQJB 1MIML 4X5RA 2WKGA 3KNBB 1KUMA 2NY4D 3CZFB 5KBPA 1GGUA 2OM5A 3ZRSA 3TC9A 3KPSA 1I1AB 2QV2A 1ETZA 3BUDA 3L54A 4UQCA 1J9TA 2WTRB 5I1EL 4L9LA 1QATA 1R47A 4K7PX 4U6VL 3X14A 3QORB 12E8H 4PGDB 5IHWA 4LNRA 1TPXB 2IH1A 3DROB 1SM3L 2X7LA 4P5SA 2NY6D 1J12A 4KJQC 2ZOOA 3BHBB 1PZ3A 3AMKA 4P9HH 3K2MC 3QEGL 1T1WA 3SB3A 3GMQB 4N9GB 4HJUA 3BIKA 4KMTL 5CEZH 1CJYA 2JJTA 1T2XA 1V55B 4Y4HC 1I1RA 4ZAKD 4UT9H 2Y72A 5DD6B 1NLBH 4R26L 3UZEC 2NCEA 1U8LA 3KS0J 2QLVB 3N44F 2BSTA 5IM7A 3L3OA 1F4YH 2J6EA 5FW8A 1P2CA 3PV6A 4EAEA 5C7XH 5B39A 2BMKA 5D7LB 3WNOA 2NSMA 4AIXA 2X88A 5J1TC 2YD6A 4NKQB 3RL1A 2WLLB 3V8CA 5CJOL 3TWCH 1G7MB 1IAIM 2QVKA 2JTYA 2WXFA 1A7NH 1MUJB 5IESL 4XCNB 1SYVA 1YY9C 3QAQA 1R5IB 2OL3H 1EFXD 3QEUB 4UOW0 1XQ4A 1EZVY 1DSFH 2AJSH 4BK5C 1L4IA 5DYOB 2XQYG 4P5KB 1UZ8B 3BP5B 2XACC 3A67L 4RFNB 4ONFL 2PXYB 3IETB 4QRSB 4YR6B 1R33A 5I1EH 1CVRA 3MZTA 3SGDH 1XBDA 3GBML 3SGKA 4OV6F 3VGAC 1JZ6A 3OKYA 1AR1D 1PG7W 1VZHA 3HC3L 2VTFA 3SYOA 4HBQA 3A4DA 4N8CL 2C9AA 2UZYB 3IJ7A 1AO7B 4P5MB 4J3OD 5DF0A 4XVTH 4ZUWA 4IOFC 4Y4KD 2CRIA 4RGOL 2V5TA 1RK0B 3CVIL 4UIMB 3OSKA 2XXFA 3CVHL 4AENB 5KS9F 1JOIA 5J3HD 3UCQA 3LN9A 1U3HC 3GXPA 3QEGH 5TH2B 3GSUB 1KJMA 3JWDC 4Y2LA 2GY5A 4X8XA 2CPUA 2B1HL 4KMTH 4MS8D 5T1KB 5MERA 5FM8A 1W0VA 3CLWA 5KSUB 3QA3B 5AWNL 1I8IB 2VR8A 3VQLA 1OKEA 1YNKL 2X4OA 3BZDA 3NCXA 3B9KB 2I69A 5AB1A 1LDPL 3ILQC 2EO9A 4LEEA 3IFOB 3PL6C 5C6PB 3DSNA 1N7MH 3BWAA 1PNDA 3GS7A 5DC0A 3ULUD 1OD9A 4Y2OB 4Z76A 2NUPA 1KT2B 3AU1B 3OKEA 3JBG7 4X9HA 5CJOH 4NAMA 1ORSA 2EYTA 3ARBC 3EDFA 5ILTL 4RVBA 3V95A 4M1DL 1MWAB 4R8WH 1CLVA 5IESH 1P7KA 4Y16D 4NSKB 4HGKC 5L0QB 2ZJSL 3W0WE 4Q9RL 2VM3A 1SHWA 5A1AA 4OW6A 2Q86B 2FK9A 5HI5C 4J3OG 3GLEA 5LNGA 2OYLA 4Z18A 1VACA 1TJGL 3KPPB 4ONFH 1G1OA 1GL4B 3GTVA 3MNWB 3TBBA 4FTVD 5DJ2A 3JWNC 3K6SA 4N2LA 1FH2A 1DANT 1B6DA 1I8MA 4G9FE 2CU9A 2JB5L 4JRYB 1KYUA 3EYOB 3O9WB 5IQOA 3L1GA 4N8CH 1DVTA 1ZE3C 3OMZA 3VE0B 5I16A 2VDKB 4FNSA 1MCWM 4OCWL 4P2OD 4PBDA 4RGOH 3CVIH 3QHZH 4FLSA 3CVHH 5AW9B 2WD0A 1E9OB 4F9PA 4WSGA 3PHOA 1LO5A 5A7BA 3RVTD 2V3FA 5HYIA 1DBBH 4ZMLA 2O4EA 2OKMA 1Z6JT 5CBEA 3RA7L 2BVEA 2I7SA 2V4LA 1VSCA 4FXKA 4JFXA 4KQ4H 3TU6A 4PS7A 3U2JA 4BQ6A 5AWNH 4MJ6A 2FH8A 4XOAA 4GP4B 1YNKH 4K9JA 5DJXA 2WC7A 5EZIL 1S9KC 2Q3AA 3WAKA 1MWOA 1LDPH 1BF2A 2ZYRA 3D2UA 3GMLB 1P9MC 2AKRA 5E2TL 4RFEB 5D6CB 4GFXA 3OKMA 3WNPA 3EJQA 2KS0A 3IS1X 1U58B 3D08A 5LXGL 1NIFA 2ICEC 1I9RH 3K6OA 4YDVB 3ARDC 3ILEA 2FUQA 5D1XD 3RKDC 5FFOA 2OYKA 4HEPA 2QQLL 4HS8L 4LHUD 5ILTH 1ZLUH 3S4SB 3V4PB 35C8L 2KZ1B 2Q7YB 4BKLB 3CQFA 1UQSA 2KL6A 1XCXA 2QADD 1OGAB 3BH4A 5AAWC 4EDXB 4AYSA 2ADGB 2ZJSH 4NYLB 5DRXB 1QVOB 2R7EB 3IPFA 3D09A 4Q9RH 3DV6B 4RZCA 2WXOA 1BFSA 4KRLB 4ZQTA 5GS2H 3ISWA 4LT7A 1QFWL 5BO1L 3K5RA 5A2JH 3SDDD 1TJGH 2YHGA 3ZHKA 2YPLD 2CUHA 2OCCB 2X38A 1REIA 1EERB 3HKFA 1EHAA 4ZXBD 4KJPD 4BUQA 2XQYK 4LEOA 2JB5H 1ZT7B 2X70A 4HKZB 4QHKI 4LLVA 1TG8A 1JNNL 4PBVC 5GSRB 4X7EC 2ZONA 1NM9A 1PLCA 1S8DB 4GS7B 3L9RA 2XN1A 5DSCA 4MYWB 3F6IA 3B7UX 5FKAA 2KH2B 2GSIA 5FUCC 5ACLA 4XPGL 4OLUL 2EEXA 3INUL 3RA7H 4GBXB 3KLSA 3QORD 4PIRF 3V79C 4IRSB 4KRPB 4E9SA 1K4CA 2J8UF 3Q2LA 2LOEA 3ARFB 1JN6B 5GRWA 1IZJA 3UPCA 4ZFGL 4RGNB 3NMEA 5IEHA 3W0WA 4HUUA 1H15B 1GY1A 1N12A 4Z0BL 4WV1B 1WITA 1W0WA 2BNRD 5K9QG 3NCYP 3PLYA 2JKXA 4WLCA 5AD0A 5DK2A 1W91A 1OAXH 5M7QA 2Y5TA 1E27A 4L8BA 2DMBA 3UMTA 2VDLB 4GIAA 4MAZA 4WTZA 2DIJA 5AZEL 3MV9B 3O2DA 2ITDB 4OCYL 5I71C 3IGAA 4OLYL 2QQLH 2WZ5A 4HS8H 4HZAA 3WMQA 4P4KB 3FB5A 2AAVA 4HUWB 2QMJA 3VFWA 1MSPA 1UB5B 5I8CB 4G6FD 5DFTA 1IGFH 3VSUA 3L3HA 2CK0L 3MLUL 4OAWA 1CCZA 4PCTA 2J6EL 4FZEL 3ZHDA 5C0GA 4ISVA 1G9ML 1QFWH 5BO1H 2FD6L 2XU9A 3ULVL 2CBPA 2JJVA 1KIQB 2VM4A 3AADB 5F0JB 2F1AA 3O11B 3QDGE 4KV5E 2HFEB 2EINB 3K91A 3KPQB 4JE4B 5G55A 1KDJA 4QHNB 4KUCF 3VYOA 1E9PA 3EJSA 4QRUB 4G9DB 4MCZB 1JNNH 4N85A 5D8JH 3EHBC 3MLWL 3HG1D 4UDUB 4RIRB 5ID0A 3MOBL 1SJXA 4OZFG 4DW2L 5KTEL 2Q5BA 2I9TA 1VPOL 3FSOA 1TYRA 5AUMB 3QAZB 2PXYD 2MQGA 3KVQA 1ZDQA 1IIKA 3INUH 3MLZL 3DOSA 1OY3B 5EN2A 2HZHA 1RJYA 2UY7A 4XMLH 3R4DA 1MG3C 3AUWB 2VDOB 1S5IL 3L4CA 4W9ZA 3DWTA 2OJEB 2NYKA 3ZDZB 1OTUC 1AO7D 4GKLA 5FCSH 5DD3L 4KVCL 5DS2A 5IVXF 1UADC 1JG9A 2J43A 4Z0BH 3JV5A 5FV1L 4F7PA 4TTGA 5ENWA 3FOLB 3HBZA 1ULVA 5D1ZC 3REVA 3X17A 1XF4A 4UQ9A 5AZEH 3L5JA 4W4OA 5LAXB 3L3KB 4OCYH 5GZND 1GSKA 5JOEA 4CSSA 4FTDA 4OR1A 3O3BB 2UZXB 1T0PB 3B9KD 4OFIA 1DUZA 1HNFA 2W0LA 2ZWYA 4WU7B 3RB5A 4AEHL 4H1LA 1I4FA 2DWEA 3OKKA 3QUXC 3RDTB 2CK0H 1XIWD 3MLUH 5AW2B 2D73A 3TXAA 1DTUA 3X11A 4O02B 2J6EH 2Z8WC 4FZEH 5AQ0A 4DCQB 3RVXC 3ULVH 3C8KA 3KMDA 5GGSB 1S9WA 4M8RA 4NUJB 1Z9SA 1H3TA 1HN1A 2WB1A 2XWEA 3UDWA 3VXUB 3A47A 1RHHA 4DF9A 5E23A 1BLNA 4TSAH 3I9PA 3VGBA 4LSDA 1WCQA 4N26A 5IBUG 1CS6A 3ME0B 3MLWH 4OJFH 3GI9L 1E4XL 1HSAB 3MOBH 5INDA 4Z5RB 3B5HA 3CVDA 4DW2H 5JXAH 5DD1H 1VPOH 3SBWA 3QUYA 3ZQWA 5GRZA 4JFEB 5E1QA 1A6AA 2Y2WA 4JZJC 1T04A 3HE6D 5A16A 4M9OA 2YJQA 2ARWA 4HD5A 3U48A 4HDIA 5BV7C 4JRYD 4S2SA 1S5IH 5E0QA 4NKIH 4GRLA 5CJXC 3FZUC 3O9WD 1H3XA 2I9LA 1XGPB 5EA0L 3TURA 5C0DB 2F1EA 2IPUG 4HJJL 3LHPL 5DD3H 4KVCH 1Q72L 2VH5H 1CFNA 1HZKA 3EBAA 1IAIH 4M8VA 4KI5E 1RKRA 4UYPA 2DYPB 4HSAC 2ZOUA 1VFAB 3NT0A 3KEHA 4LSTL 2QEJA 3QDGA 4HV8A 4JKWA 1SEQH 1WUNT 2NY1B 43C9A 2C9PA 5ES4B 4W9CC 1U8QB 4HWBA 4BUHA 3OWRA 1PYWA 3OJMB 5IHZA 2EYRB 1N19A 4JFVA 3DOHA 3OGCB 3QP3A 4U1KA 3RWEA 4OVUA 5F21B 3SGJA 1CDUA 4WHYG 1ZSHA 4CUCA 3JUYA 5DK0B 4ZFFB 3HS9A 3ECVA 3SYPA 5MENE 3MGOA 1YRKA 4F58H 5IQMA 5C07E 3UO8B 3V5HB 3PWJA 4I18C 2Z8SA 4UILL 4P49A 4HH8A 1D3CA 3K81A 1P5UC 4LAQL 5KN5B 1P7BA 1A64A 3TESA 1LD9B 2FUTA 1ZEAL 1UUSA 2ADJB 5BQ7A 5ICYA 2WBJC 2N01B 5FF6B 3A6BL 5TF0A 3GI9H 3ASWA 1MHPL 3UZQA 4CNIB 1I8UA 5IJVB 2W81C 4GXVL 3RI5K 3TBTB 5KAQG 4HEME 2J21A 3W81A 1Q9KB 5D2LA 3DSFL 1BW8A 4XXCA 5DFWH 4QRPB 5GRJL 1MCWW 4PWFA 2F9BT 3JVGC 2ARJQ 1R6VA 3DX6A 3HBQA 5A2CA 3EF4A 4HJJH 4JANA 3LHPH 1JPFA 3MR9A 3UJTL 4KDTC 4X6DF 4BWUA 1Q72H 2C9VA 2NQCA 4YSPA 5EFIA 3SYAA 3QNYB 3R7RA 1IGCH 2EE2A 4DESA 2O5ZH 4FFVC 2HMIC 3FKUS 3LQZB 4P23A 2BX5A 3QDME 4GBXD 1QD0A 4LSTH 4E2OA 2X2JA 5B7FA 3TBSB 3TN0D 4IRSD 4KQ3L 4KRPD 1WIOA 3B8SA 3V10A 5ESVB 3VFTB 3ZDYF 4YHNB 3MRHB 4LFHD 3ARFD 1SYSB 2ZWKA 5CGBA 1EDHA 2VERA 1FZJA 4JKMA 1Q0YL 3OR6B 3UEQA 4CSZA 3QFJE 5E8OA 5LN8A 3CBKB 5I2IA 3RVWD 5DTFA 1LM8V 3O2DL 4UILH 2JELL 4H0IA 4YHPA 4P4KD 3WTYA 4LAQH 1J87A 4N2MA 3TFKD 2ESVD 2XKNB 1CFTB 4X7FC 5AAPA 4WK2B 1U93A 3X1BA 5F1IA 3ZU8A 5E6IC 2YD1A 1MHPH 4XP5L 3D52A 3AXLB 5FYLE 2HN7B 2WHVA 1ZWIB 1B0IA 1EH9A 2QHLA 4GXVH 4FYRA 5IF0A 2W0PA 4EQ3A 1AQDB 4XMTA 2YFNA 3ZSTA 5GRJH 4OZGB 4FADA 1C08B 4NBYB 3O8XB 4IRJB 5IK3A 1MLCB 3T2OA 1ES0B 2FEJA 4PH8A 5TE4H 3EJYC 4Y2DC 5DC9B 3HAEA 4G80B 5FM5M 1H8NA 5HDRA 2LVEA 3UJTH 5MHSE 3VXSE 3FAWA 4W6WB 1WS7A 2VIRA 3SE4A 4WF7A 3BWSA 4YDJB 3MRPB 4YBLB 1PD6A 2F68X 1N59A 4R7DB 2B59B 5MENA 4FZ8L 5C07A 5IQNA 1CGSL 1KCRL 1UT9A 4KQ3H 1NBCA 3O3AB 2X89A 3ATFA 2VSKB 3SN6N 2IADB 1LEIB 3G6JE 4GUQA 2BFGA 1UWGH 3HMXA 3WHXA 1T7VA 1Q0YH 5J5EA 2EVGA 4FLQA 4CGUB 1J0IA 2NMSA 1OAUL 3EJCA 3L3IB 3K6FA 1WWWX 3FU3A 3VXOB 5I0WA 4AQOA 5IQ9B 1PL3A 4ZS6D 1PIGA 4WWKA 1ADWA 5GGRB 3RTQA 5KSVA 1DDHA 1AMXA 3MRGA 4FQQB 2NQ3A 1BDYA 2AV1B 1H6FA 4BQBA 3IDIA 3F5WA 3HZVB 1L3NA 5EO9A 4I2XA 1R3JA 5D7IA 3RDTD 4YHYB 2ZUQB 1NCGA 2G9HA 2JB6A 3BPLB 1TLMA 2LQRA 3MROB 3QWQB 2FWOB 4MBOA 3QDMA 1WV7T 3P73A 4A6YA 3VFPA 3ZSSA 3VXUD 5EUOA 4JFQB 3UAJC 2VXTL 4LCWB 3GINA 2WXKA 3TT1L 4LRNH 5G4MA 5HYSA 1EEYB 3LAFA 2Z7WA 1UZ6E 3BN3B 4ELMB 2NPLX 5FDYA 1KIRB 1XWVA 3ESPA 1N8OE 3DPBA 5F1OB 2CD0A 2DIEA 3BUPA 3RX5A 1A4KA 1WZMA 4TV3A 3GSXB 1OP9A 3S3JA 3QPQC 4R3SB 4ZZFA 4NFCA 3KBEA 1CGSH 1VKXA 3RZCC 2WOYA 3FQNB 4QEGA 3NJJA 3MRJB 2KYIA 3DYMA 1NCHA 5DEJA 4XOBA 3AXHA 5SWQA 4BHUI 1MVFA 4KX7A 5LCVA 1SF5A 2AV7B 2C7UA 2D8KA 5J9PA 1HHJA 4JY4A 1OTSC 2DD8H 2UUDH 2Z9TA 1DJWA 2A7BA 1MDAA 4G1MA 5AL8A 3DOIA 1BVZA 4PM1A 4XNBA 2ADFL 4E9QA 5CJBA 3NFNB 3KE0A 2GPZA 2HVJB 2NY1D 3BVNA 4LOVA 3K4AA 4CJ1A 5IROC 5JYLA 4DEUA 4Z7QE 2H8PA 1HL4A 4HWBL 5IW3A 5LBSA 5AKRA 5GGUA 4LOUD 4BRVA 3C5JA 4B0MM 1Y1DA 4H1LH 2MQCA 3VXSA 3T77B 5D7JB 4D8PB 2UZPA 2X28A 5HI4D 3MJ7B 4AZUA 3F7PC 4BK4A 4OQTA 4ENZA 4TL5A 5BPPA 3M1OA 1ZVHA 1P5VB 1W72A 1YQVL 1I9IL 3ZMEA 4ZSOB 5ICUA 1TEYA 2WKOF 1FFPA 4XO5A 1B4JL 4HIJA 5IIEB 2LFGA 1MFUA 2W60B 2CO7B 4U3HA 4F2EA 4QY8A 3ZTJG 2VXTH 5IY5B 5E5RB 3TT1H 1B9KA 5LKNA 3G6JA 2B3RA 2YQBA 2EVHA 1R9FA 4I48A 4DHLA 3JWNE 1HT6A 2NYYC 4MRBA 1LWHA 1RERA 5A3ID 3S35X 5DHMC 5BO0D 1LXMA 5IB5A 3T6XA 5GGSY 1K3IA 5D7LE 1EMTH 2EVIA 1OLZA 4ENED 5HJGA 3UZEA 4WZ9A 2CBOA 5SX5K 1SQ2N 4LMQI 5AKVA 4N0CD 2EYSA 3D07A 4N2EA 1RCYA 5EN3A 3PXJA 1TSRA 1NBYB 5K9OB 2JCCE 4QRPD 1LE5B 4EDWH 3OSVA 5IJCC 5DEZA 4OGQC 1K72A 4R90L 4PS4L 4RFOL 5GJTL 4IIQB 4B5EA 4AXWA 3MJ8A 4K5MA 2LU5A 5E95B 3SDYL 2BP3A 3VI4E 4ZI8A 2V3EA 2MOVA 3KGSA 4IU3B 4G6AC 1KV3A 1CL7I 3QO1B 3V8OA 1CFMA 3QQ9D 2WXIA 2M26A 3CLFH 3LPGA 5EO1A 4NUPA 1PCSA 1IM3A 5JIIA 1RL1A 1KCVH 2VAAA 4B96A 4BK5A 4HU8A 2P52A 5HHNA 1ECYA 1R3LA 2F8OA 3MVSA 3BP4A 4U1IB 5CU5A 4ACPA 3HLAB 4HWBH 3TZVA 1I1YA 4DUVA 4M8UA 2VMDA 5FM4A 1AGEA 3N42F 2DYSB 1S78D 2VDNB 3P9MA 5TE7L 3SO3B 4CBZA 4PJCB 1AD0B 4QHUA 3NP3A 4WFED 3C9NA 1XBRA 1HQRB 1F8TH 5D7SH 2XFXA 4GKOA 1I9IH 1FV1A 3NJGA 5D93C 3K6NA 2QLYA 4URTB 5DJZB 2C7FA 5AOMA 1U3HA 3HG5A 2IAND 3I9AA 4Z77B 4LK4A 3MNVA 5DMKB 4NRYA 3ARGC 1V7NL 2VZ1A 4U1NB 5TDNA 4JVWA 5FHBL 1X9UA 5F7YC 5IB1B 3G6AB 5DUBA 3H2QA 3VM7A 1PU0A 2GK0A 1D9KD 3D05A 4M43L 3S98A 3UBFA 1LQSR 2QPUA 1I1AA 2BIHA 5I6XC 2OMWA 4L4TE 4U1SA 2DQDL 1HQ4A 4OIBA 3AB0C 2EILB 4WJG3 1ID5I 1XGQB 1AHWC 1I8LA 2WIIA 2ZOTA 2WLKA 1KB5B 3PYCA 4YHIB 5IHLB 1JIBA 1WYJA 3O8XD 5CF3A 4BQ9A 1FFOB 2CHDA 4R90H 5FUCE 3CCHA 4RFOH 2NW3B 5DLML 4LIQE 1VFBB 5GJTH 4QF1B 4OD2B 3WTUA 2O6PA 1HI6B 2LFEA 3SDYH 3MGTA 2FIKB 4I3SL 4U6XB 3BZ5A 4Y1AE 1ZJAA 2W5PA 2BSRA 2I60H 3GMQA 2ZCHL 4P3WA 4CN4A 5E4OA 2XG5A 4OUUB 4CC4C 3BVWA 4FA8A 3BP6A 2HRPL 1E8ZA 1R34A 3I6KB 1PDKB 1CC3A 4FYTA 4OLEA 1QR4A 3QCTL 4A2HA 3SDCD 1ITCA 4P07A 3C6LB 2Q20A 1H5BB 3PNRB 4JLRA 3OVUB 1UOVA 3HMXL 4ZFOB 2WANA 3KXFE 1ZVYA 5CHNB 2X4RA 4WI9A 4HOXA 4ORZC 4MVBD 2C1PA 2MJWA 4NHCL 5CGTA 3FFCB 5D7LA 2PW1A 2CH8A 3H9HA 3PQYE 3QXVA 3BLPX 3JTTB 2ENSA 4OCXL 4HZLB 5KSBE 1G7MA 3P30H 2BM3A 5DQDL 5T3XD 2JCCA 1MCCA 4PWGA 4JDVB 3Q0HA 3O45B 4O58L 2OAAA 1CGWA 3HBPA 4NQDB 5CKAA 1NBVL 2AJVL 5FHBH 1SVBA 3VI4A 2OV0A 2NUTA 4HJSA 1TZHA 4WU5A 4WNQB 4ZW7A 2R1WB 4M43H 1JRHL 1CDGA 1PZBA 3D4ZA 4OSUL 2DQDH 3FONA 1GMIA 3MRIB 2Z91B 4L8CA 3DMMB 4M4PA 1TZGH 1MQKL 3PJNA 3QEQD 3MBXH 1YPZF 3L6FA 1G6RB 4NCC2 4F20A 4A7GF 3LDBB 4PRHD 2WVSA 2ICEA 4JS7A 2G5BB 3OPZL 4UQ3B 2D2CC 1JGUL 3APDA 3ARDA 3CN3A 3H4HA 3QJQB 4IMLB 3H42L 3HAEH 5DWPA 3I3EA 4UIMA 1HFUA 5GS1B 1M7XA 1YAZA 1RPQA 3BPCA 3GSUA 4QRQB 2H7WA 5C8JB 2CO4A 2ZCHH 1FC1A 5J6HA 4OD1L 5AAWA 5T1KA 1KLGA 1HH9A 1ET7A 1KPRB 4BCYA 1JXGA 4LLYB 4NN5B 3QA3A 3C2SA 1R5WB 3MO1B 3VVVA 4Z7UF 3F7LA 3US0A 1AHKA 3R0MA 2XYBA 1F3DJ 3EO1A 4NERA 1QQDB 4CW1A 1W8NA 5LCVL 4EKJA 1RZIA 2BXZA 3CFBA 1S4IA 1XSOA 1YUKB 4GSRA 3EJTA 2Y0SA 5LBGA 4PJ5B 3NK4A 4NHCH 1SLVA 1FFQA 1RK1A 4ODWA 4FHBD 5BUAA 4L4TA 1AZBA 3D9AL 1SFHA 5L2JA 3EXLA 1GTFA 1S9VA 4OCXH 2XT1B 2FGZA 3DGDA 4EZMA 4RBPH 2OTWB 3N3EA 5DQDH 4YBQD 1XSIA 3UABA 2ORBL 1BD2D 4PJDB 4G11A 4O58H 5E8DH 3FUHA 2XZAL 4I3GA 4FQCL 4LSVL 3DDFA 4RGNE 5LBSL 1NBVH 3N0AA 3S6CA 5E6RB 3K8KA 5D7JD 3FTGB 1RJZB 2OMXA 1CLZL 4Y1AA 5GGRY 1JRHH 4OQTL 4GSDL 4OSUH 4Y4FB 4JFOA 2HT3C 1W72L 2OMVA 3MNWA 2DF3A 2V9QA 3TO2B 5I19L 2JJUA 3KYNB 4O2FB 4OY9A 5E08L 3RWCB 4A6YH 3OD3A 3T04D 1XGRA 4HVBA 3ECBB 1JGUH 4Z7NF 5J7CC 2DLGA 1X5HA 4LLUA 4PW9A 4Y7MA 3TBCA 3KXFA 5F3BB 4Z7WF 4DQOL 4XPAL 4R97C 4YO0A 5JQIB 4JM2B 3PQYA 1ZGLA 2GJ6B 1JNJA 5KSBA 1QSZA 3DXAB 2H0FA 2CR0A 4ZMOA 2YN5A 3MCYA 5T3ZD 1TQWA 3FUIA 4ZFQA 5I6NA 3QPXL 2NNFA 1PY4A 4JFPA 1K4DB 4N2CA 2H3NA 1R75A 4K8RD 5LCVH 3PUCA 1EHXA 2DBLL 1I7ZB 2PUQT 1U58A 3BXNB 3OJ2C 4APXB 4TNFA 1U2YA 5HGHA 3TPKA 2XKSA 5FYLH 2TRHA 1WBYA 3G9VA 3FO1B 1EXHA 1E6OL 1JV2B 1OAKL 2J4WL 1AKJB 2OR7A 2C3VA 4URKA 5F93C 1N8ZA 2ZZUT 1RURL 2XCMC 3ZQ9A 1OTTC 4BQCA 1FAKT 3DBSA 3H53A 3OHXC 5D4JA 2ORBH 5HDBF 3KM1A 1DZBA 2ODHA 4M6AA 4N2KA 5EHFA 3HNTH 3RWFB 5IKCB 2YZ1A 2PWDA 1P4LA 2XZAH 3LB6C 4UQIM 5AALA 4FQCH 4LCVA 4HT1L 4ZMYA 4LSVH 2EDTA 4IK6A 1FNFA 4C56D 4GRWF 4IBLT 1I3GL 3UTZB 3DV6A 5I28A 4GQPH 4X99B 5BXFA 4IBUA 3IKCB 5IQ7H 4J3VA 3UTQB 1YDPB 4HIEB 4NZUL 2VW6A 4Q6IC 2P45B 2ERJC 3I9GL 4TULL 3TP4A 1I9EA 2QDWA 1SOQA 4PJ8C 2R83A 3ULVF 1XD0A 5EIQA 5JLZA 1W72H 1KTDA 2ED6A 3KYMA 5I19H 4KK5C 1ZLWH 4YSRA 4AE0A 5E08H 1ACYL 2VDQL 1S3RA 4K15A 3KLKA 3VXPB 1VADB 4HUKB 2YGNA 3JWDL 5D1ZA 4JN2A 3FK3A 1OSZB 5FKPA 4KQ0A 3CU7A 4S10A 1BM3L 3RLSA 2CUMA 1ZGLP 1SN5A 4DQOH 4XPAH 1VRSA 5AW4B 1EEUA 4ZMNA 4PRDA 1WS8A 2R2HB 5CLYA 4D9RE 3W2DH 1IQDA 1E3ZA 4X7SL 1QEWA 1KYOJ 3QDJB 4OD3H 4KHXH 1AGBB 2R2EB 2OW6A 4PTTB 1U3ZA 3QPXH 1DVZA 5B8CB 3AZUA 3OXSA 1CWVA 4OFDA 4YX2L 2BSED 4W6XB 3IDGA 3FRUA 4QT5B 5E99L 1EAOA 5IOPB 1H15A 1UASA 4NO5B 4IOIA 2DBLH 2EIDA 4OCSH 2WXRA 5EWIL 2O6CA 3T3PF 3GLAA 2NY6C 2WZ6A 2X3CA 3FHQA 4FKEA 4AM0B 2WNKA 5J56B 4JFEE 1E6OH 3QC5X 4MMZC 1OAKH 2J4WH 1DE4A 1PG7X 2BNQB 1RURH 1W2KT 1GJUA 3I2CL 4ZOBA 1SLUA 2GJRA 1D7DA 1AQKH 4OCMC 3LKRB 2QSQA 4HT1H 5F89A 2X4SB 4JZJA 1C8PA 4ZAKC 3VG9B 4DGIL 1EXUA 3LN4A 5GJSH 1WZKA 3DURB 2GVYA 3FFCD 2HP4A 4TULH 3C08L 3V4VA 2BIQA 5B3JE 1JYVA 2HFEA 5FDWB 1IL1A 3OL2A 3T6WA 5BRZB 4M48L 3SKOA 4XXWC 1KYDA 1FRGH 1SGKA 5F6IC 1VEPA 1K2DB 1JE6A 2VSCA 2WYZA 2GJZB 1TEGA 4FF9A 1G0YR 3AQDA 2DI7A 5TK4A 1JYWA 1BM3H 4FFTA 2IO5A 2JCWA 4M9PA 4FI7A 2X4QA 1MW0A 4FEIA 3PABB 4BA0A 5B38A 3N40P 5EDSA 4HKBB 2BS71 4M3JA 5TDPA 2HA1A 5F3HA 3LSOA 5I1DA 3NFPB 1IGYB 5DHXB 1U8MA 1L9TA 3R18A 1KB3A 1PZCA 3UROR 3ZJAA 4J1UB 3R8BB 4NKDA 1AHMA 4P2QB 1A2YA 1SN2A 3HE7D 4F7MB 4YX2H 3ZR5A 4QTHB 1A6VL 5KBMA 5E99H 2Y23A 2XY2A 2K0RA 2YK1L 2ZP9A 4I18A 3V0VB 2W80C 4F92B 1AR1C 2YC1B 4H5SB 2ZXDA 5B7EA 5EWIH 4HAKA 2NSXA 3HBGA 2PYEB 4X8JA 5A2LH 4N2IA 4J3OC 1N2RA 1M1XB 1S5HB 4Y4KC 1U8CA 2WBJA 2R0KL 1ITBB 3I2CH 4FQ1L 5MEPB 1XF3A 1BZ8A 1NMAH 4KMQA 2QL1A 3LEVL 4QCIA 5AZUA 1JZFA 2FYYB 3BGMA 4Y8AA 4HUXB 1MI5E 2UZXA 2WLNA 4MS8C 2RQEA 4PJ6A 3CUPA 2OMUA 1XH2A 1CZ8L 3NQIA 1IFRA 1UD3A 3RNQB 3JT0A 2QGBA 3ZL1A 3P77B 4YHZL 3JWNH 2CO2A 3JVGA 2L3BA 1F1DA 2A74B 2ZOWA 4I13B 2IVFC 2IQAB 1JWSA 4NFDA 4Z78A 4KDTA 4LDCA 1E28B 4QAWA 3ULUC 4TUUA 4M48H 3FQTB 3NTCL 3L95A 1DBML 1N70A 3MFFA 4LIQL 3ME0A 3RAJL 5JIMA 5ALCL 2G4GA 4RX4A 1A4JB 3UGXA 1TDQA 4NNYB 2EC9U 5C0AE 5I9QC 4OM1L 5ITFB 4Y16C 1GGCL 1INQA 3IPEA 5DEFA 4JFEA 2DIAA 1B88A 4XVUD 2X9XA 1AD9B 4JRXB 4GH7B 1OEZW 3KWTA 2XIDA 2L0DA 4PBWD 1CU4L 5KVDE 4NFBA 4MZIA 2BHFA 1OGPA 1S7XA 2DYRB 1A6VH 2VDKL 2OP4L 2Y7MA 1QHQA 1RIUL 3FB8B 3VG0L 1BGXL 3KZ8A 1BVNP 3W9DA 2X3AA 4YDMA 1A7QH 1XR9A 3X2QB 4JM2D 2FTAA 5F2FA 2A9NL 3WN5C 2GJ6D 4P2OC 4ZX4A 3S0PA 2R0KH 1UXWA 2YPKB 1NQBA 4OZGE 5E6IA 6TAAA 2NDFA 2B77A 1RZ7L 2XTJB 4ANVA 3LEVH 2ALWA 2CLZB 5FO8A 1CG9A 3RVTC 1U8QA 1MFVA 2VDPL 5LVEA 3O2VH 1MRDH 4BELD 2B9AA 2GT9A 4L3ED 1JUFB 4B50A 2X6AA 1H8OA 1YY8B 1TTGA 5KJ7E 1GVIA 4YHZH 1X7SA 2MHAB 3D48R 2Q8BL 3GK8L 3JUZA 4ZFFA 3L7EB 5CWSB 2IEPA 5E5UB 1MFMA 1OD7A 3OWEA 3O6KL 4DGVH 2AZUA 1AKJD 1NAMB 5HHMB 4DP9X 4Y2DA 2ZWNA 4NAQA 1MHEA 3FN3A 3ZRCC 1JAEA 2QTEA 3UP1A 1WICA 1QRNE 5KN5A 4HH9B 1PX3A 1AFVH 3IJHB 1BAWA 2F7OA 4PVNA 1XGTB 1WT5C 5D1XC 2RIKA 3MX0B 3KPNB 4PJIA 3RAJH 3VB8A 3ZDWA 5ALCH 1R0AL 1AC0A 3TIDB 2DS4A 2QKSA 2Z4QA 4LCUA 2DY2A 5EPMB 1SJMA 2VWEC 3ULSB 5IJVA 2QADC 4OM1H 4X4YB 5CAYB 4L8DA 3TBTA 5GGTH 3SJVB 3KWWB 2ETWA 3D69B 4OVVA 3TEUA 3H56A 5J89A 4GY4A 1WDAA 2HJLA 4TN9A 2QPDB 2DLFL 1AVAA 5L6YL 4M6OH 4O2EB 4RA3A 4IOSA 3EBIA 4HCRA 4UCFA 3SDDC 1MI5A 5DI8B 4D0DB 3WEOA 4ODXB 3MA7B 1SEBA 2VDKH 2HT2D 3PP3K 1I7TA 2OP4H 4KJPC 4OKVB 4ZXBC 1RIUH 1YEGL 3GIVB 1BGXH 3RHWF 1KTRL 2WM0A 3CAFA 2FL5B 2C34A 1OPGH 2J5WA 1H3WM 1VZIA 3U4BH 1OHQA 1K5WA 4EKXA 1IBFA 4I5BB 3LXBA 1OF0A 3N44B 1MH5A 3QJVB 1RZ7H 3QDJD 1D5RA 4LCWE 4OLWH 1MJUH 2VDPH 3IMVA 1DQQA 1IFHL 3BFQG 3NP4A 3OC8A 3QIBB 1SYSA 2CPCA 2A6IB 3QUZB 1WPCA 1D7FA 5C0JB 4ELME 1JFQL 3MCLL 3V4UH 4Z3FA 1ZHKB 3F7VB 3WO4C 1U8HA 1JZ2A 4K7PY 4UV7L 5F88A 5C0AA 3EZJB 4U1MA 3X3FL 2IH8A 4X7TB 3OGOE 1KTKE 2UYLB 5T5FA 4L2YA 2BNQD 1M05B 4PW4A 1YEIL 2R56H 5L4IA 4GKNA 1E65A 3SBPA 3WLBA 3V4PH 1A6WL 1TTFA 3DHJA 1NC4B 2G9KA 2J12B 3HI6L 3VFOB 1R0AH 2JTDA 2YARA 5J06A 2EH8L 3WUWB 5BV7L 4HGWB 3VFMB 3GM0A 5C86A 3KPOA 1ET8A 3NA9H 1TOXA 1NOLA 2RR3A 3V4VL 1YN7A 1AE6L 5L6YH 3GUFA 4KO5A 5BRZD 1Q94B 4Z0XA 4OM0L 5KS9B 1CO1A 3E1F1 1UURA 2ODIA 1GIGH 4UZGA 4F27A 3ARRA 1ZRUA 1FL5A 4MA1B 4YZWA 1I1FB 4AJ0A 3X12A 4FQ2L 5FM5O 1YEGH 3WELA 1BZQK 1UOLA 3NJHA 4EZLA 1FDLL 2P8MA 3HRZA 5IROA 1KPVB 3IDUA 4HJ0D 4NQSB 3HPJB 5HHOB 2O93L 1E9QB 4H20L 4ETQB 1ZA6A 4KZ0A 2P7TA 5K9KA 4HKJA 2VLKB 3NG5A 3RWIB 2VC2B 1QRNA 4UNVA 3HVDA 5K1NA 1V3JA 3FYEB 1IFHH 1ZAGA 4PY8I 1U95A 4WJ5A 1AOHA 5IV2B 1PZDA 3QUMB 4XO4A 3B2DC 4JJ5A 2M83A 1JFQH 2VLLA 3SE6A 2R4SL 2PO6B 2AJYH 4N25A 1IBGL 4E68A 4EI6B 2PYED 1L0YA 2W0FA 2XWJB 3H2PA 2PW2A 1I8KB 3X3FH 3NABL 3BD5A 5IQ9A 3VFSA 2VDMB 3FQXB 4NJ9L 3UAEA 3PPEA 2J2ZA 5FA3B 4MXVE 4KV5F 1HEJC 4AG4L 4OLZL 2V7NA 3EG9A 2XICA 1ZVNA 2RH0A 3AT8A 1XL4A 3VFUA 4EXKA 3RY6A 3BAXA 3HI6H 2A77L 4I4WA 1U8JB 1JK8B 4U1GC 2EH8H 4RDBA 2H1PL 3B9KC 1J10A 1I8AA 1S3KL 3V6ZA 3DO3A 4DP1X 1OXYA 4G7VH 3WYRA 4KJWD 4G8EA 1J05B 4HWUA 4ZQKA 4C4KT 3D5OF 1XIWC 1AE6H 3V5DA 2RACA 2CJSA 3QUHA 4DO6A 4OM0H 1T21B 3PG2A 4MMXC 4WEMB 1SJHB 3GGWA 1CYWA 1P4BL 3P1VA 8PAZA 1NBQA 1NCUA 1XH1A 3UGUA 2F15A 3WD5L 4CMMA 4GJTB 2NZ9C 4PJCE 4PGCA 1J1PL 2ALAA 1FDLH 3ZTNL 1JZ4A 2VM9A 4H20H 4UANA 4JRXD 4TVPE 2BY1A 4GUPA 3U30B 5D2LF 3FQNA 3PCYA 5T1MB 3V9EA 3UBXI 3QCVL 4G43A 5C08B 4LCIL 3HE6C 3MC0A 4M5YL 5D96B 5LGJA 4WFHD 2R4SH 3AREC 3P2BA 1IBGH 2CM6A 2XWTA 2EEAA 1KTLB 3T0EB 4PREB 3ROOA 3O3EA 3K71A 4OZIE 3VX1A 4PGBB 1RIVL 3NABH 5DJAA 4LEBA 1YAIA 5B1AB 5ESAB 1EAQA 4NJ9H 4TUKL 2AK4B 5E9DE 1GGBL 1E5ZA 1FIGL 3W5MA 2XTJD 3IF1B 4CC0A 3KYAA 2EO7A 3KLLA 3QIUD 3KPLA 4AH2A 2P8PA 3MRMB 5I26A 2B5IC 2F5AL 1S9YB 4CN6A 2Q2LA 5BUPA 2PP7A 4TL4A 1TJHH 4N20A 2DKUA 2WQVA 3GRGA 4H7VA 1CIDA 3NCJL 4ZYKB 4AIZA 4O02H 2ZTBA 4M8QB 1S3KH 4ZG1A 2WLIA 3QJOA 5HHMD 1JCKA 1YEJL 2RD0A 3Q8BA 3QZWG 4MA7L 3RWJB 1Q0XL 3DVFA 5FUOL 1A7PH 2HX9A 1F13A 2BIIA 4C4BA 1AG6A 2CG9X 5H37G 5GRVL 3CXHJ 4MJID 3P4MA 4LASL 5IUCA 4RWHA 4DEPC 3RVUD 1BMZA 1P4BH 1XD1A 4LLWB 3RNKB 2EEDA 4G3YL 3F00A 4XXDB 4EVNA 1DVUA 3MHZA 4DAGL 3KPRB 2RA1A 4NAJA 1TZ8A 1RUQL 1J1PH 2X41A 4Y5VB 3S96B 4Z7VE 3ZTNH 1FNGB 2J8UB 4I3RL 3PP4H 4LPUA 3SJVD 4KI5F 4KTEL 1UD6A 2AEQL 3EDEA 4X98B 5F3FA 2PR4H 4DKFL 2EUZA 1KNOA 1WA2X 3D4GA 2ICWI 1KN2H 4PRPB 1Q9WA 4ZUVB 4HCRL 1YG9A 1EGJA 5IEKA 3TA3B 5JIPA 4LCIH 2NXYD 4NQDE 4M5YH 2CKBA 4WKZB 2DZEA 2WWOA 4AITA 3B37A 3LNDA 1F6AA 2G3NA 4P2CG 5IW6B 3DGGB 5C2UB 4OGXL 5F70A 5IMOB 1JXDA 2CDEA 3PAYA 3IAPA 2OJZL 3AQZA 1TYEB 3ESMA 2D31A 3V55A 4TUKH 3VD2A 2FATL 2DM3A 5J6SA 3HVNA 5A2AA 3WEMA 1FIGH 1FC2D 1Z9OA 2XA3A 1WIPA 4Q58C 2E7DA 2LTQC 5EU6E 5KEZA 5DRWB 3QIBD 3NOIA 4GSXA 4HX1A 4E5XG 2D2OA 3V0AC 4P2RA 2QSVA 2F5AH 4PRID 4J4PA 4F37K 3TN0C 4IRSC 4KRPC 4LCCA 4NZTL 3IXTB 3ARFC 2E74C 1BVOA 3US1A 1S7WB 3K46A 2WZPA 1J5OH 3PWPD 2CWRA 3FQWB 5E2WL 4MA7H 5JW5B 3NRQA 5T5FL 2HG5A 2MOGA 3P3YA 1QFWI 5FUOH 1R4XA 1SQMA 5DVPA 4NT6B 1FPTL 5KVDL 3BESR 1SDDA 4LASH 4BRJA 4APQC 1JWUA 3VH8A 2R2BB 2WVTA 4G3YH 2J44A 4JFYB 4YGVA 2YRPA 3E38A 4M7ZC 4W9JC 5IB1A 3PDOB 3U6XS 5D7IF 1RUQH 3UERA 1MDTA 3QJTB 5E5LA 4I3RH 3NJIA 4KROD 4OZIA 3GHBL 2MTPA 3KGTA 1XZWA 2AEQH 4XP9L 5C09B 5IVXB 1KB5A 5E9DA 5CSBA 4DKFH 2ZNXA 4ZDHB 1E4HA 3RFZC 1UATA 1NANH 2QHRL 5JORB 3H2WA 5DURB 2B9BA 4HCRH 4HULB 4YEEA 5EUOF 1FZKA 2V37A 1TT6A 3F7KA 4KKNA 4QOKB 2VITB 5ITBL 3SCMA 1A7RL 3RE0A 3FT0A 4OF8A 4LBAA 1JF1A 2XKUA 1NCDL 5HYQB 1NBZA 4PJAE 4KWUA 2PPCA 3N1GC 2Z8VC 1DN0B 3SEPA 3MRLB 4M7LH 2H6UA 2GB2A 2OJZH 4JZOB 3KEDA 5EBMB 4AYEC 1YYLL 2VLKD 5C0BD 3HRPA 3E9UA 3TH2T 4OJCA 3VRIA 3WTWA 3FUJA 3QAZC 4HKXB 3C6LA 4G8GA 3CXDL 3PHQA 4M62L 2DBJA 3A22A 1A1OA 4DZ8B 1QLFB 2N4IA 2AJUL 1KYOK 3V0HA 3NSFA 5CMAB 1EJ8A 1Z9PA 3ZIMA 4S1QL 2D03L 1NGYA 4PFEA 4NM8L 4N6QA 1R3KB 5HJ3A 7TAAA 1A9BA 2GBTA 4WGVB 4Z7VA 4DKAA 1T7WA 3B2XA 4UQDA 5FYKD 5E2WH 3DXAE 4L4JA 2X4UB 2FX7L 2WXNA 1NDTA 3QRGL 5IMLA 5MEQA 1E50A 2HPOA 1FPTH 1E5AA 5KVDH 4PRBB 3D25B 3FULA 3CZKA 4NQDA 4QLRA 4FNPA 4BGLA 4F2ME 2O6DA 1WEJH 3G08B 4TXVB 3SPHA 1ZXQA 5C0IA 4YQXH 5IUSA 3WAJA 3AUVA 2G2RB 4HP5A 3GMNA 3GHBH 2YSSB 4F7EA 4XP9H 3KR3H 5DRZB 4XPFL 2A6JB 3LEXA 1W16A 1ND0B 3KJ4B 4PRNA 2XG4B 1TQVA 4AL8C 2QHRH 4HJIA 4HQQL 5EU6A 1T5KA 1UOKA 3L5WB 2R39A 5CIPA 3CMOL 4UQ3A 2BERA 1NICA 4DKTA 1WBZA 5ITBH 3G6JF 1MF2L 4WCYL 2AVGA 3OKNB 3ECWA 3OHXA 3G6DH 3B2MA 1FZMA 4X4KA 1NCDH 4G6ML 3GMOB 4NQEE 2QVTA 4J6RL 4XO3A 3JYBA 3LPOA 4U6HA 2HKFL 3G04A 1LMIA 4HJTA 4JQXC 3K0WA 4LPXA 3D30A 3GZKA 3VDBA 1YYLH 5EF1A 1ACCA 3VFRA 4U6YB 3RB7A 1R5WA 2O6FA 4C59B 4XI5C 3P2TA 2DWDB 3MKKA 2K70A 4Q6IA 1GKEA 5C08D 3CXDH 3E6HA 5E5MB 3UJJL 4PJ8A 3ARYA 1X5XA 5GS0C 4NXSA 3VD4A 5EZJA 4NM8H 2HWZL 3Q05A 3TTYA 1LWRA 3WXWL 3SPJA 5A6MA 2DPKA 4R4ND 5I6PA 1X5MA 4JY6A 4JEGB 4G72B 2AK4D 2FX7H 3QRGH 2A99A 1O5DT 3M1BA 3EJUA 2ATAA 4ATTA 1CD1B 4O51A 3IBOA 5EOCJ 4UQ2B 2PPDA 4MHHI 4N6RB 4GKZB 3W57A 1J8SA 3FUMA 4IS6A 2X6VA 2PCPB 1UZ6F 1MCJA 2X44D 1T03H 2F2HA 3DX0A 3UYPB 1UCTA 3BH8B 1BZ9B 3ZT7A 4LOUC 4PJAA 5GQBA 2VSMB 3F12B 1E4XI 1PZ2A 4L05A 3S88L 2Q6WB 3FB7A 1KXHA 1MY7A 3UPAA 5I5IA 4X6DB 1KCSL 1MQ8A 5F7EL 1J0JA 5BZWA 5I5MA 4PVBA 1XB3A 2XN9B 1UXMA 3IMUA 4HQQH 3CMOH 4QRFA 5BZDA 1ZLEA 1E7VA 2XQYA 1WJ3A 5J13B 1MF2H 3KPRD 5L88L 1NFKA 1UB6A 3ZDYB 3DA0A 4Z3EA 1F4WL 1YMME 3Q8AA 1FGNL 2H6PB 2HLAA 4G6MH 2YMXL 4AT6B 4J6RH 3GO1L 3AXIA 4QWWD 4OLXL 3Q6GH 3U9UB 3DXAA 4V2BA 4ZAKA 2ZUXA 4YHML 1XV8A 3CH8A 4MCYA 4NRXB 4PRPD 4ENEC 1WTGT 1NCJA 1N0XH 2NNCA 1EZLA 2J56A 3TA3D 1A0QL 2FBOJ 1EGJL 3UJJH 4MXWL 4L4VE 3B9EA 2CKBL 3FCTB 4F2MA 4ZPTA 1TJIH 4A7UA 4F3FA 4Z7QF 2OZNA 4P9ML 3MRBA 4HC1H 4XXWA 2HWZH 2XYCA 43CAB 5ICZB 3N50A 3WXWH 4ALAL 3U46A 4Y5XC 1NUGA 1HWGB 1HE8A 2X6UA 5JDSA 3WS6C 3SD5A 4J3SA 2B08A 3K2KA 5CUSL 4FG0A 3IDMB 2XDHA 2VXQH 3ARZA 3QQ9C 4XMUA 4P2QE 3WKML 1PLGH 5E7BA 2IWGA 3QH3A 3FSZA 1V3KA 1WP6A 4H26B 2E9JA 2ZYHA 4N22A 3MV11 4KUCD 1U91A 2GSMB 5FECB 3SKMB 2FQGA 2R51A 3LNIA 4NQEA 3I75B 2YRLA 3E2HC 3SPVB 3S88H 4MWFB 1CICA 1S78C 4W81A 1KCUL 1VZGA 4TVPL 4QDGA 1KCSH 4XOCA 2QELA 5F7EH 2VWEE 3K72A 2P4AB 2JCCF 3NCYS 3CDGA 3KBPA 5ABAA 3FH8A 3HEIB 5F6HI 3EGDB 4Y4KA 4PBXA 3C5ZB 4FQXC 3NZ8B 4XAKE 3OZ9L 3P9LB 4AWJC 2LLGA 2P5ED 4XE0A 5EUKB 5L88H 3GSNA 5DQ9A 3EOBB 1F4WH 4OZHE 3VI4F 1L7IL 4I1PA 5JW3L 1CT8A 1MHHB 4WUUD 3GO1H 4ZD3L 3S5LG 4OLXH 1RSFA 5C09D 5GHWL 4Y9FA 2BSDA 3Q1SL 1D9KC 5T5NF 3QR2A 5DURD 3DARA 1B0RB 5EO0B 1B0GA 1Z1WA 2I5YL 3B5TA 1A0QH 2BIMA 3H4FA 3QQ4A 4MAYC 4QOKD 1F90L 4MXWH 3UO1L 4YSUA 1QOKA 1KG0A 5DHDA 4KO9A 1NCIA 2AQSA 1UGKA 3QZBA 4R5XA 5JOPE 1FFTB 4LLDA 1AIZA 2WO3B 4S1RL 1QWUA 4CSTA 4ALAH 3QJSB 4P3CL 4ZO7A 3X1GA 1B2WL 4KVNL 4TYUA 4YFEA 5CUSH 3TJEH 3WIFB 5IMKA 1TQUA 5L9DL 1PBYA 4DP6X 4AGLA 5C0FB 1KY7A 4MB1A 4IMKC 2QZQA 2KLSA 4YC2C 4NC0B 4ABQA 1ZHLA 4C8XA 3AAZB 1U8NA 3H3KA 2BNRE 5A40E 5FYJE 3C75A 4ONOA 3SDCC 3DURA 2YAMA 3MLYL 1QUNB 3ZQXA 1YMMA 1MNUL 1S7TA 1BYNA 4XWOD 3L17A 4FI8A 4A7QA 3WENA 4HPOL 1MG2C 1KCUH 4KZDL 4TVPH 5DZJA 4LP4A 2N59A 1UENA 5D72H 3RL2A 4MX7A 3EYUH 1KJVB 2C3GA 2GFBB 2Y7OA 3X1EA 1DJIA 4LSQL 5GIRA 4K7FB 4IKIA 4ELDA 5DEGA 4L4VA 3FU9A 1EDQA 1KY6A 2XHNA 3EO0B 3FCSB 3OKDA 3OZ9H 1AAJA 4P2OA 4XAWL 1BQHB 1E90A 4P59H 2RGSA 1R3HA 4HJEA 1DBJL 1PKQB 2A38A 3DX8B 5KWYC 2BVOA 1L7IH 3HHRB 1ASQA 4KAQL 1IARB 3JV4B 2ED8A 2LAAA 1GYWA 3RI5F 4YHYC 2GCYB 2UX6A 3J2PA 3LS5L 1KB5H 2ZX6A 1OARL 4J1UA 5AB0A 3Q8EA 2FEEL 3MZGB 4NQVB 3UO1H 3HG1E 3CC5B 2EDRA 4G7RB 2E86A 2LLLA 4J23A 3SY0B 3ZMRA 1U2CA 4XP1L 1IZKA 2OMYB 4TNWF 3GHPA 4UM8B 2WQSA 2DQ6A 5JQ6L 4S1RH 5I1AA 1UXSA 1X4XA 2R29A 1FZOA 1WT5A 2GTWB 4N0FB 3E6FB 4Y1TA 5D1XA 3ZRFC 4EI5C 4P3CH 4K9EH 3BVTA 1B2WH 3SQBA 5JPNB 5C0EB 1NDGB 3SKJL 3CQPA 2FYYA 5KSBF 4CBPA 4MQSB 3TCTA 1O9WA 5CLTA 4DJMA 3FFDB 1KDIA 4Z7OF 1V7ML 1ZS8B 1ROWA 2AQRA 4MB4A 4MDJB 2WXHA 4YHOH 3CSPA 3NJMA 4YK4C 4NKOA 1QX1A 1TCRB 3D3VB 6FABL 1HK6A 3AJ7A 3MLYH 1A21A 4XVOA 3HS0B 1NGQL 4OZHA 1MNUH 3MRDB 4X7CC 1FORL 3SDDA 5EEXA 3FYIB 1K8IA 4FNQA 1DEEB 4PVMA 3WFBL 1HHHB 2OL3B 4KFZC 4S0SD 1EZSA 3DO4A 4HPOH 1RK7A 2WBXA 4ZXBA 2GIXA 3D0LB 3IJ9A 4KKBD 5HYJB 1DJXA 3VTMA 4V1DB 1JPGB 3TVMB 4PJ9B 4LSQH 1VFMA 3VMNA 1CGTA 3GSRA 2P8LA 3FU6A 2H47C 1RZKC 4LDLB 4FL4B 4YBQC 3D39D 4C83B 5ECGA 2FDBP 2VN4A 4Y19B 1URLA 1DBJH 1T2QL 3O6LL 3K4DA 2HFGH 1JK9A 3OZKA 1QNIA 2H26A 4JO5A 4X6FB 3L1FA 5FOJA 4KAQH 4AJYV 1A14L 4IGBC 4YSEA 1WAPA 1T3FB 3FO2A 5D7JC 2J72A 1SLWA 1IM9B 3DX2A 4UDTB 3LS5H 3BZEA 3QIWB 5EC1B 1OARH 2X2YA 2XN9D 3A4FA 4QPEA 4OFKA 1UT2A 3S5YA 2K9FB 4RAVA 3TBWB 4OZFA 2GTZB 1QP1A 2CJTA 3GBDA 3L81A 2DWSA 1BQUA 2BNRA 4ONHA 4XP1H 2WO4A 1M7DA 3IN0A 1HYRC 1XEUA 1FGVL 5L2KB 1MCNA 2XV0A 1R5VA 4XC1L 2FX8L 3QQXA 4HPYL 5B3SB 1NC2B 3UXFA 5LNDA 1KB9K 3DJTA 4N5ED 2R0WL 3N42B 2DDQL 3N40F 4NZRL 5DVNA 3SKJH 3X13A 4F9LC 3NH7L 4KNQA 3VRJB 4JPWH 1CF8L 1ESOA 1WCBB 1T1ZB 5HHQA 4XNZB 4ZODA 1TZIA 4QXTB 3EFFA 1H6TA 1JZIA 1JGLL 1BG9A 2NY5L 3FN9A 4U6TA 3RYMA 5I66A 6FABH 4IIQC 4Z8FL 2VR9A 1WD8A 5CWSA 2P80A 3OLDA 5HHOE 1FORH 3NEXA 2P1YA 4WI0B 4K8RC 1J0HA 4EXPX 3R8QA 4F33B 3L2MA 5JPMB 1OB1A 4XHQA 3WFBH 1F18A 5F9JA 1HNYA 1JF6A 1NCWH 4HH9A 2WYHA 4TLTA 1BJMA 4JUTA 3ZL4L 3HOGA 4XH2A 5DJ6B 3NEEA 4BINA 3UIYA 3HG1A 2J8OA 1HH6B 2P5WD 3ZZSA 4X9FA 1QSEB 2MCAA 3DUUB 3EIFA 1ZTXL 2VLJB 2A4ZA 2PCYA 1P0SE 1T2QH 3H54A 3E7JA 5T8IA 1QYGL 5LWYH 2UY6B 3KWWA 3O41B 4P3DA 4NBXB 1A14H 4L37A 5FW7A 3H55A 3DX9B 3SO3C 4D0BB 1YECL 4O2EA 1YJDC 4J3TA 1UJTA 3PWLA 4DEWA 4LE8A 1IILE 2NDGA 3QWOA 3LXCA 4MNQE 3UTPD 4KDVA 2BSCA 3BPOC 3G5XA 4X9YA 4PRAA 4LQ1A 2Z35B 3C5ZD 3VTAA 2MKLC 4WFGE 3CXHK 3CN2A 3KHOA 4P46C 1QZ1A 4I77H 3UBXB 2FB4L 1GZHC 4EPSA 1FGVH 1JXKA 1BVLB 2M1KA 1OM3H 1GXEA 3GSNL 2WBWB 1THAA 3MRKB 4LNVA 3REWA 4XC1H 4FG6C 1J18A 2FEDC 4FNLH 4JFFE 4U2YA 15C8H 3L5XL 2R0WH 4M7JL 5HPOA 3DETC 2FLMA 2DDQH 3KLAB 1EHNA 4NKMA 3VQMA 1R24A 3EGXB 5B21A 4K2UH 5GSVA 2ATKA 5B1BB 3W9EA 1CF8H 3UTSB 3NAAL 2IOMA 3DHPA 3H8NA 5JA8B 3FMGH 2JI2A 1JGLH 1UACL 2CIIB 1RUPH 2NY5H 4Z8FH 5HD8D 2GW5A 3TO4B 4MMXA 1Y6KR 4WJKB 1XF5A 3AS3A 3RPIB 1ODAA 2W9EL 2NX5D 5HP5A 1ZV2A 3VXRB 1QRKA 3RIFK 3ZN6A 4YVUA 4ZS7H 1RULL 5D9SB 2XPYA 1VCAA 3QI9B 3ZL4H 1S9XA 3RBSA 2OMZB 1MJ7L 2J5LB 1AQMA 4N4YB 3VFNB 1YPZB 4H25A 4HJ1A 2AI0H 3T0EE 3WUWA 3S37X 2R1XA 4GQ9H 1ZSDA 1CTMA 1QYGH 4U1HA 5AKSA 5I17A 5F7AA 4PG9A 1UM6L 1GHFL 4JGJA 4P5TB 3U0PB 4DFIA 5CM1A 5J6GB 4N2BA 4CKVX 5DUJA 5DWUL 1HESA 2Y7NA 3CHOA 4IW4C 1K8DA 2PYFB 3AREA 4YNYA 1K6QL 4XWGH 1PFCA 1RFDL 1BPVA 1MCDA 4KKZA 1BYOA 1RP9A 5IG7B 1P6FA 1N3NA 3SO5A 2EABA 2ICWB 2E6QA 3NCCB 5M95B 2E9IA 4G8IA 4EJ1C 4PY7B 1ZHBB 3VWKC 4Z7UB 3CHPA 2EIZB 3GSNH 3M17A 3MLTB 3HPJA 5HHOA 4UAOB 5EMYA 2XWRA 4Y9CA 5KW9L 4XCCL 1A9EA 3FQUB 4F7CB 3ZVVA 4M7JH 2CXKA 3HC0B 4FQLH 3X1FA 1NPUA 3V0EA 4WEUD 4U1JA 2IAMA 1BIIA 2PMZA 3ZBMA 5EEWA 1KGIA 1GZPB 5IV2A 3ZLQC 3NAAH 4MDRA 5E56A 4DP8X 4A2FA 2V8MA 3MV8B 2ARJB 1A6ZB 2G4EA 4Q8BA 5CEZD 2PO6A 4EI6A 1UACH 4ODUA 2HTLD 3TJPA 3IDJB 1UA6L 3IE4A 1F97A 2VXUL 3HE7C 1UWYA 3KH3A