1Q9WB

S45-18 fab pentasaccharide bisphosphate complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
226
structure length
226
Chain Sequence
EVILVESGGGLVQPGGSLRLSCSTSGFTFTDYYMSWVRQPPGKALEWLGFIRNKPKGYTTEYSASVKGRFTISRDNSQSILYLQMNTLRAEDSATYYCVRDIYSFGSRDGMDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords S45-18 Fab (IgG1k) light chain
publication title Germline antibody recognition of distinct carbohydrate epitopes.
pubmed doi rcsb
total genus 42
structure length 226
sequence length 226
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1q9wB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1q9wB01
5K59E 2PO6B 5MEQA 5ADOH 2CJUL 3DVGB 4X6EA 5DFVC 5C0IB 4ORGA 4FFYH 2AERT 1QR1A 3KPSB 3EO9L 4KDTA 3KYNA 5A2LH 5I71B 4LLQA 4RX4A 1OAYH 1A7PL 2RGSA 3X12B 3C5SA 3O2VH 3MLYL 3IXAB 3I50L 4XI5C 1U8KB 5FECA 3QUYD 2LU3A 1RZ7H 1A7RL 1SEBB 2BNRE 5I15H 2A6IA 4PFEA 5D2LF 3G6JA 1S9KC 3MRDB 3MLRH 2JJWA 1HZHH 5CAYB 4FXGB 4FQJL 5D1QC 2QQLL 4JRXD 5I8KL 2BCKA 1FFOB 2GAZA 1AE6L 2VKWA 3KHQA 4KH2A 1VACA 4R97C 3PL6A 5BJTB 1FORH 1OB1A 4BZ1L 5KSAB 4ZTPL 3TN0D 1RUAH 4N1HB 3DJ9A 3U46B 2Y36H 4JFFA 3KVQA 4RA3A 3HZVA 1FIEA 4WO4B 1EJOH 5E7FA 4QXTB 3ZKSD 1F58H 2FATH 1UZ8A 5GSRB 5MI0B 2NY6D 4ONHB 3VFUB 3BP5A 5DMJB 2EDFA 4LSPL 2AK1H 4FQCH 5FUZH 3R1GL 3MXVH 4JAMB 1OTTD 2EO9A 5I1LA 1CFSB 2NY5H 2KQMA 4PRPA 1LEKA 4YHKH 3FCTA 1VFMA 4YXKH 5HI5D 4UQ3B 4UB0L 3NCEB 1T04B 1IARB 3PXJA 3HC3H 2E3VA 3D85D 2R8SH 5AWNL 3WL9B 1TPXC 3EOBA 4NYLA 5GGSA 3SY0B 2XNAB 3FT3B 4PV8A 1A9BA 1HSBB 1R3JB 3W5NA 2Q6WB 4NFBA 2UYLA 5I1IH 1XR8A 4MXWH 3J8F7 3ZDYE 3NCCB 5DVKA 4GRMA 3UO1L 3VXOB 5TFSH 3TM6A 2X6MA 2YR3A 5BQ7B 3O6KH 1LK2A 2CRMA 1N0XL 3TJHD 5H2BB 3U6RB 5GGUA 1T20B 2G60L 4LLMB 1QBML 3N50A 4FHBD 5HVHC 5E00A 1OTUD 4EIGB 4MNGA 3MNVA 1C12B 3MYJB 4XNXH 1JPTL 2OMNA 4FABH 2F5BH 4MAYD 3S36L 4Z5RB 4K3HA 4QTIH 3RX5A 1YNKH 4XVSH 5T5NF 1NCBL 3ZYJA 4HMDA 4CVZA 3DO3A 1XT5A 3M17A 3KPQB 5IGXH 1SHMA 3QPXL 4O4YL 5C0AA 3SGKA 4XPBH 3V2AR 3X17A 1NGZB 4XTRD 2BRRH 1JI2A 2MHAA 4WHDA 4HQQH 1R6VA 4Y4KB 2VZSA 3LKNA 4MA8L 1F2XK 5KAQF 4NM4L 5I1DB 2EDRA 3UJJL 4FQLH 2OZ4L 4X83A 4I2XA 2Z93B 3LD8B 1HXYA 2VZTA 4MLSA 2BC4B 5IJKA 2A83B 1P4BL 2WLZA 3DNKA 1YMHB 3PWVA 4ELMA 2NX5B 3WFEH 3CZJA 1A6ZA 1T1WA 4P3DA 5DJDA 2JELL 3QJFA 1CK0L 1N64H 1OGTA 1RI8A 5DR5H 1KBGL 3MRMB 5EU4B 5I16B 3L5WB 2RCSH 3OR6B 3BKJL 1BPVA 3TLRA 4TPRH 4YWGL 4OQTH 2LFGA 4PP1C 3IU4H 5DJ6B 3S6CA 1LO3L 1FDLL 2BFVL 4U1IB 3HI5H 1NKOA 2BMKA 3BGAA 3TA3D 1W0VA 3ZL4H 3IS1X 1S7SB 3ARFD 4WI2A 1X6NA 2UWEE 5GGQL 4EDXA 4HS3A 5EBWB 1AJ7H 4K71C 3QWQB 1FG9C 2FHCA 1G0XA 2CR6A 2XXCB 3L3HB 5CBAB 1R24A 1WT5A 2EDKA 3FQRA 2BVQA 3IDGA 4XBGA 3FQNB 2W0PA 2E6QA 4MMXC 4P46D 1Q38A 5CINL 3B8YA 3SGEH 4Z7WB 5H94B 3GJEA 2CJUH 5C2UB 4ELKA 4L8SB 2R23B 2IAND 4YFLF 1I1AD 1DN0A 3TT1H 2QTEA 3UYOD 3L7EA 3EO9H 4ZUVB 1C5DA 3SGEI 4ZO8A 1NCNA 3FN0L 2E9WA 2VQ1A 1J9CT 2V7NB 4OT1L 3C8KA 5C0EB 2QHLA 2W38A 2P8LB 3MUHL 1RZIB 1S7TA 3I50H 1B0GB 3UTQB 2ADJB 3SOBL 1ZGLA 5ERWB 5FKAA 2VOTA 1XGYH 4PS4H 1A7RH 1DJSA 2F5AL 5F88B 2FBJL 1MFCL 2GJZB 2AEPL 3DMMB 1FVEA 4LLWA 4QF1B 1QVOB 1JV5B 4Y7MA 1BAFH 1HH6A 1PAMA 3CC5A 4FQJH 5ECJE 2QQLH 4NRXB 4C56D 5JDJA 4KKLC 1ZGLM 4HF5L 5DGQA 5C7XL 5J4MA 5EO0B 3ZHKA 4KK9D 3C6LC 4RAHA 2YEZA 3PHOB 4Z78B 4K94L 5D7JC 1U3HD 5E8OA 1U93A 5DJZB 3O81A 5BMFL 4B41A 1NBYB 2WWKO 1J5OL 4Y1AD 3MXWL 4YGAB 4ZTPH 3L3DA 1IGFH 3TGXA 4LLDA 1NGPL 5CHNA 4NUGL 5GGSY 4M7JL 1KTKE 5EZOL 3FKUS 1JBJA 1IFHH 2I07B 3AS3A 3G6JE 4XCEB 4AMKL 1NGQL 4E0RB 1ZVHA 4XVJL 3PP3K 4M8QB 1T83C 3OB0K 3D3VE 1DFBL 3MLSH 4Y5YB 2APBA 3U0TB 1I3GH 4HDIA 3QH3A 4I0CC 5SWSE 4HK3N 1D9KD 3VI3F 3EAKA 4ODXA 5DVMA 3S96A 4YHYB 3F7VB 3QA3A 4WFGE 4EUPB 4GKOA 4JCMA 4ZUWA 3VD7A 3TEUA 4ZPVA 2NTSP 4X6BA 1EZVY 1BZ7B 4OFYD 1IGJA 5DJCB 4DN4L 5KN5B 1WUNT 1HHKA 4NKDB 1DQML 2A9ML 2F8OA 4HXAH 3O3DB 4L8BB 2FECL 1V3JA 4F57L 2FCBA 4PGDB 1S7VB 4E5XB 2JCCE 4XNYL 4ZXBB 1R0AH 3UO1H 2Q76A 4ZO9A 1J87A 3VMPA 1R5WB 2GCYB 5JHDB 1F3DH 1CICC 3SDAA 4PRPE 3ZKNC 1QBMH 4FTVB 3G04A 2H45A 3MJ7A 3VFPA 3WJJA 1LNUB 1VGKB 1P2CA 1FQ9C 1JPTH 1UJTA 4PJCB 4C4KT 4ZOEA 4X6FB 2FHFA 4MXQD 1LE5A 1REIA 3IDNB 4O5LH 5I19L 3STZB 3LPFA 2A77L 5H35A 3SDXA 2X9XA 3QEQA 4G8FB 1GC1C 5D71H 3VI4E 1MEXL 3BD4A 3S4SG 4HUWB 1QRNA 3PWLA 4LPTA 5F7WC 2AK4B 2UVEA 1JPST 5GGTL 1QBAA 4M3KB 4MA8H 3BD3A 3OR7A 3VFOB 2C1OB 4NM4H 3UJJH 1FL5A 4JPKH 1FZMB 1IL1A 1BGXL 1IT9H 3ESVF 4G6AC 2HMID 4OIIL 4WENB 1MCBA 3F65A 3WS6A 5CWSA 4S1SL 2L0DA 5ADPL 2NR6D 1NFDF 1YEDA 3MCG1 2F8VA 2JELH 3OAZK 4ZQKA 4M6OL 2X1PA 4OLYL 5SX4H 4HKXB 3ILPB 3CDFA 1KBGH 3HE7B 1DP0A 4NN5B 2HFFA 2PO6D 1OY3B 4LHUG 5FO7A 3VFNB 3L9RB 3VRLE 1M05B 5KS9B 5C0AE 2FO4A 3ARGD 1KJMA 4HFUL 4YWGH 4EQ2A 5SX4I 1YPZF 3B9AA 3U4EA 1LO3H 5C08B 2DJSA 2BFVH 2Z31A 2EDNA 1U8JA 4AQOA 1PQZB 5F9WC 1A7BA 5KVFH 1AGFA 3H3PH 4I2XE 2EKSA 3IJSA 4MNQA 4TSBL 2PW2B 1C08A 3MCKB 3QWRA 5DD1L 2FSEB 4LSQH 1CE1H 4WI5A 4G9DA 3MRNB 3W11D 2ZUVA 4H1LH 4ODTL 2JIXB 5D2NA 4PJ5A 4L1HA 1IQWL 1LMKA 1J11A 1YEGH 5ICZB 4FQHA 3CXHK 3VGFA 2X4NA 1MAML 2P1YA 3BPNC 1IC5L 3SKJL 2HWZL 3LKPB 1HHGA 4MVBC 4ZTOL 3QCUL 5D6CA 1MVUB 4OGXL 5IJKC 3O41A 4DZ8A 4TNVK 5ISZA 3PWPD 1OQOA 4QXGL 5EC2A 4OT1H 1W0WB 1YZZA 5EZJA 1MOEA 4YR6A 4LDOB 1LO5B 3SOBH 1A4JB 2N1KA 3QUZB 3WDJA 1M4KA 2GIYA 1CU4H 4M6MH 1MFCH 3V52L 1GZQA 2ZSWA 3BRFA 3BFOA 1KEML 2C4FT 3DLQR 3OJDB 1I9EA 4E41D 1DEEB 3ARDA 5I73C 2CSPA 2O5YL 4HF5H 2DQIL 4LCCC 4G8IB 1U8QB 1Z3GH 1MELA 1OD9A 2VO5A 3QQ4A 4NBXB 3L5JA 3RWDB 4YHIA 5IK3B 3NFSL 2IC2A 3LRGA 1A1OA 1VFBB 3MXWH 1EEZA 1JF1B 3RNQA 3RUGB 3GKWL 1WT5C 4XX1G 3MRKB 4KC3B 1UWXH 1R3KB 5I1KL 4JFHD 3FTGB 4ZMAT 2YPVH 3DPBA 4UNVA 5EZOH 5TE4L 4G3YL 5C9JB 4HUXB 5C3TA 3BP4B 5T3ZH 2ADIA 1MCQA 1T7XA 4R0LB 4M93B 4P5KB 1NGQH 5JIHA 2XYCA 5DD6A 4R4BB 1UKSA 5F8RC 3LEVL 2YN5A 4G6KH 3CXHJ 1DFBH 4U1NB 5E7BA 3QZWA 1BOGB 1UEYA 1HIMH 2DDQH 5L2KB 4JM2F 1SMOA 2H6PB 2DM2A 2VH5L 2NCMA 4Y2DA 3MV8B 4HIJA 4JN2B 5BV7B 5D2LB 2XWBA 1BFVL 3SDDD 3MUZ1 3WFDH 1F02I 2AJYH 4KV5E 3S37L 5BXFA 5J0BA 2NY2D 3KPRA 2YD5A 3LB6C 5JOPE 4DN4H 2MSPA 3HA0A 5HI4C 1NBVL 4ETQB 3PGDA 5IWLC 4F57H 4L9LA 4GKZB 4XNYH 3MV9A 3G5YB 2G2RA 1JHTA 4WDIA 1KCUL 3DX8A 4WEUD 3ZO0A 5J57B 2HAZA 4YZFF 4X4XB 3DGGA 3E2HC 3BGFC 4YDLB 1U8HA 5LGJB 5SV4A 4KKBD 4MJ6B 3BPCA 1QEWA 2NX5D 2P5WB 4LP4A 2Q86A 1GZPB 4P23D 4RWYH 3TFKC 4GS7C 5JMRA 1FJ1A 4OZHF 1FGNH 1MWAB 4NRYB 2DICA 4P59L 3LQMA 4PJAE 4YXHL 4OD3H 1J0JA 3RTQD 4YNYA 1D5ZA 1X5XA 15C8L 4QRPB 1EAJA 1QKZL 2QADB 2FX8L 5ESVB 4N8VA 2A74A 4P9HL 1MEXH 1L9MA 5E4EB 5GS0C 1CTOA 3NCMA 2J8UE 3T04D 3BEVB 1T4KB 3AS2A 4OAWA 3WUZA 5J1AB 2B4CC 3B8SA 2ESVD 5CSGA 1EERB 5JW3H 3H9SA 1HHHA 4LF3A 4IRSA 1BGXH 5BV7L 3LKRA 5GIRB 4J1UB 4OIIH 2CLRB 3IRPX 4Z7NE 4IS6B 4XPGL 2VISB 2DIAA 1RZJL 5EOCJ 1H3PH 3O11B 5DQJA 4S1SH 5ETUB 4D8PA 3B9EA 3TO4C 2Y25A 2CGRL 4R2GC 3G5ZA 4M6OH 1EDQA 1Q9OB 1U91A 4P4KD 3GM0A 4PJBA 1MUJB 3RDTD 1ODAA 3KPMA 4U2YA 5T3ZD 4X98A 1V3KA 4BH8A 3QEQE 1OSZB 1KIPA 4QOKE 3IFNL 4HFUH 1QA9B 4PLKC 3DO7A 5D1ZB 3SDAC 3F7YB 5DT1L 2Q7NA 4RWHA 5F1IB 1WC7A 4J3WA 5HHOA 1MWAL 1F6AB 1CFNA 3QUYA 2W9DL 4G43A 1A7NL 1CFQB 2WUCL 3P3YA 5BO1L 4TSBH 4KHXL 4OUOA 5SWZA 1T0PB 5FYKD 3S5LG 3NCJL 4DJMA 3FB6B 1VFAA 2BY1A 1JGEA 1AGEA 3AM8A 3QO1A 4YK4B 4KJPC 4Q0XH 2EZ0C 4JGUA 3P73B 5D93C 4HWZA 3OKEB 1GH7A 3MGTB 1TQCC 3DROA 3WSQL 5CBEA 1MAMH 1R3LA 5FO8B 3SKJH 1T66D 2HWZH 1XF3B 1WAAF 5E2VL 3KXFE 3VDAA 5E2WH 1JZ6A 2EECA 1PY9A 5CKAA 1FNFA 5I1GL 5I75C 4LSVL 4QXGH 2FH6A 1XIWB 2APVA 5A3IC 3RL2B 4U6TA 5F6HI 3FMGH 3S8WA 2H2SD 4P2OC 4N90E 1MLBA 1DE4A 5DDHA 1XGTB 3WCYA 1G7LA 4G8GA 2J6EA 4MS8D 4QHLB 3E6FB 3V52H 1RAMA 4OBSA 4WHYG 2ED7A 1MREL 4Y16B 2Z31C 5D2NE 5IVXE 4H20H 4JDZA 3T0EB 1ZLSH 5DS8B 5GISL 3U2SB 2DQIH 3ULUE 2ICWI 1RZKL 1BM3L 1B0RA 4XPHL 5FGBC 5C09A 3NZ8B 3NFSH 4Y4FC 2WIMA 1RZFH 3EW3B 3QQNA 5DJ0A 5ISZE 3DHMA 4G42B 3ZT7A 5LJYH 2ZG3A 4DZBA 3GSUA 3X3FL 5I1KH 1DLFL 3B2VL 2C4FU 2GJ6B 4XWOD 1BQUA 5TE4H 4G3YH 4Y5XB 5D2NC 5JW4N 1Y6KR 5LGKA 3REVA 5IW6B 1G9ML 2EYSB 1R5VA 2ICCA 3ULUC 4H25A 4M43L 4YDIL 2ZUTA 3G6AA 2P4AB 2YKLH 2MNUA 3LEVH 1D7FA 5ESAB 5C71A 3B2UC 2YPKA 1BQHB 2BXYA 1JHLH 4R4NC 4TVPE 4EZMA 5JHDD 5LGHL 4LEOA 3QT2A 4PLJD 2A73B 4JQXC 2VH5H 5I18L 4Z7QF 1QLEL 1NMBL 1K4CB 3U30B 1DANT 3K4AA 3LDBC 5EFIA 4XP4L 1T21A 1OAUH 3NACH 2VC2L 4OCRL 3HCVB 3S37H 4WW1A 5IW1A 2MCPL 1XF2A 2DWDB 4AG4L 4NNYB 4PBWD 4OSUL 4M1CC 1SY6H 1MJUL 1PKQB 4S1DD 4RAUA 1ZHNB 2X9WA 4PB9L 4ODHL 4QNPF 1BX2B 3NAAL 5D72L 3FQUA 3PJSB 4GKNB 4MDIB 1KCUH 5IKCA 5C92A 2C26A 2EE6A 2OR8A 3WO4B 1F5WA 5F9OH 3UTTE 5EU6A 3RVUC 3WHXB 3UAJC 5E9DB 5TDPB 1WK0A 3DURA 2R4RH 1IKNC 3QXDB 4LRIC 1ZT1A 1HKLL 5EUOA 3OKKB 1CBVH 2XI9A 4U49A 4YXHH 1L7TL 2XTJE 4QRRA 4O2CB 1J8HA 4CBPA 1FVDA 1J88A 4C83B 15C8H 4YBLC 1QKZH 2YD2A 4AEIH 2JF1A 2FX8H 2D03H 5DHYA 1NLBL 3KPRE 4G6JL 5L88H 4CNIA 2EDTA 3DUUB 5IMLA 4RGOH 2H2PC 1ADQL 3TA3A 5CEZD 4F58L 5F9AC 1UH4A 1ND0A 1MRDH 5AAMA 3WMSA 5DMKB 3ARTA 5CGTA 3EFDH 3OGOE 1NGWA 6CGTA 2V5TA 1E4WL 5CJQL 1H15A 5IR1B 3FO0L 2VDML 2DWEB 4LAQH 2ZJSL 2H1PH 3JV5A 3FQXA 4P46A 3NH7L 2FYYA 3HS0B 3JV4B 3MO1B 3VWJC 1YN6A 1ZSDA 3CDYA 4UDTA 3IXTA 4GQPH 4NBZB 3ZTJH 4DOHE 3OTTA 1I1AA 1WCBB 2HG5A 5C2BL 2OP4H 4PTUB 1T1YB 4JY5L 3DUHA 3GJFK 4WV1B 2WLYA 4ZSOE 3UTSD 3GNML 3HZKA 5DT1H 1X7QA 3VCLA 2F54E 5D9SB 5DK2B 5EOTA 3H9SE 3VFVB 1MWAH 3L3IB 4UT9H 4GG6F 2IALB 1A7NH 2WUCH 4V2BA 1X5GA 5GZND 5E94B 4I18A 3QUZD 2PXYB 1PYWA 5CP3A 1QYGL 3P4OA 4OZ4A 4WUUA 1NEZB 1JPSL 1AHWB 1KXTB 2VUOA 4C56A 3HZMA 4OF6A 4HZLB 4RZCA 2EYTA 1U3HA 1DQTA 2Y1VA 2ZUWA 3WSQH 1DCLA 2FX9H 1JWMB 2WP3T 4IRSC 1QTYT 1TJIH 5EBMB 3CUPB 4R7NB 2ZKHL 5E2VH 1I3UA 3T4YB 1ZA6A 3EO0A 3VD5A 3PHQB 1NFDB 4Q2ZA 3ZTNL 3AMKA 2BJML 1BP3B 5I1GH 4APQA 4F7CA 3FFCD 3ULVC 4PRDA 3MROB 1J12A 2WBKA 5HHOE 3G5VA 3JVGA 1I3VA 1TIUA 3VFGH 5DRNB 4OLVH 3AY4A 4I77L 4YXLH 5DMYA 3T65B 3P9MB 5SWZE 1TVBB 4JO3L 3NIFF 1YPZB 4PRBB 3GI8L 3WIFA 4UAOB 1MREH 5M94B 5D1XA 3RI5F 1A4KB 1A2YB 1FCCA 4N0UB 4GRLA 4F9LA 4LOUC 1D9KA 1ZHLB 2KDGA 2DYPB 5GISH 4HS6A 1RZKH 5FAAA 2P46B 1KJVB 2CK2A 5EU7E 1BM3H 2R69L 4JKMA 3MV8D 4N68A 1KB9K 1ORSA 4LFHD 3PGFL 1AGBB 1T89C 1IAKA 5INCB 2V5MA 1RIVL 1MLCB 4Y8DC 3WD5H 5K9OB 4FXKA 3LPGA 3AM8C 1O7VA 3UBXI 2WZPD 1DLFH 3HLAB 3B2VH 1EO8H 3EYQD 3ARUA 4MMZC 3T09A 2V2TA 2X4RA 2NMSA 2Y7QB 4G8GE 4JQVA 4KTDH 2HJLB 3WUWB 2VABB 4MJIA 4M02A 4M43H 5JIIA 1AD0B 5EU7C 3BAEL 4PD4K 4RGMB 5LBSL 2IAMC 2BSED 4H26A 5DUPH 1QQDB 4JRWA 4M6NL 3CZFB 4YH6A 4EN3B 2D31A 3CNKA 2APWA 5LGHH 4HPYH 1IGTB 3L3KA 1BBJA 1BREA 2FDBP 1QLEH 1V3MA 5C09E 1MFEH 3MOBH 3RVWD 3SDCB 4NWUL 5FM5O 3CFDA 4AL8L 4XP4H 3N1QC 3PGCA 2GUOA 4QRPD 2QADD 1K5NB 2MCPH 2XWJB 3O4LB 3L3OB 3D48R 1MJ8L 3MNWA 2C3VA 2R1YA 1EFXD 4OSUH 5E6IB 2XA8L 1QFWM 2C4XA 4LSDA 4PTTA 3P0VL 5KVEL 1J7VR 4PB9H 5EIIA 3BD5A 1WVZA 4HK0B 3IDIB 4J3TA 4XNMA 5D72H 3HI1B 1RFDL 3RX8A 1N8ZB 2WBWB 2EIBA 4J6RH 2XG5A 4HX1A 2W60B 4UUJA 3Q5YA 4JO1L 4Y0GA 3OPZH 5B38G 3U9UA 1KB9J 2Z8VC 3MREA 3IB4A 2YPLD 3QHFL 3CH1A 1I4FB 4XMLH 4JZJC 3WJLA 4S1RH 1JNLH 2BNQB 5IFHH 3DRTB 4L4TD 1L7TH 1KPUA 5K9KA 5J11C 4S1QH 4DCQA 1YY8B 3QIBB 3S37X 2DBJA 1I7TB 4R90H 1QBLL 1R3IL 4YEFA 1NLBH 1ACZA 4JG1L 1MCJA 3HG1D 3GIZH 4LGRB 3ARQA 3V0AC 5C07A 1JTPA 3MRHB 1A02N 2APXA 4JM2B 35C8H 1ADQH 2VLKA 4NSKA 1MCDA 4YFLI 1AQDA 1QPXA 4PP2B 5GRJH 1T2QL 5IFJB 4TQEL 5T3XE 3RWIA 4H8WC 2OJZH 3MPCA 1DUZA 4EJ1C 1YC8A 2NW3A 5HYFA 1T6WA 5IROA 5B22A 1TTGA 4L4VD 1E4WH 4U6XA 5E1AA 1LVEA 2B0SH 2YSSB 4JZNA 1FRGH 1M71B 1VEOA 3FO0H 2VDMH 5JQHC 3IDJA 5EUOE 2ZJSH 4X7EC 2CDGB 3WKMH 1ZA3B 1J8HE 2ATKA 5HI3D 5T1DH 3ARBB 4LHQB 3NGBB 4F7MB 1D5IL 2VLMD 4YBLB 3RU8L 3RZCA 1NAKH 2J3SA 1HHIA 4YDVB 3BZ4A 4HJ0D 3W9EA 4BM7A 4D0BA 2QLVB 1VADA 5AD0A 4AIZA 3PWPA 3FAXA 4XC3L 4EBQL 4LLAA 3GNMH 4OZHB 4KMTL 4OM1H 5FA4A 1EBPA 3QULB 2W1NA 5C0CD 4I4WA 4NQVA 3TIEB 3AB0C 3O6FC 3EGSB 2DMCA 1N2RA 1Z9OA 2VZ3A 4PLOB 3GSNA 4KRLB 3T0DA 1QYGH 2DN7A 5CZXC 1IEAB 32C2A 1QLFB 4WI8A 3VFSB 1JPSH 1X9QA 5IQ9A 1CGWA 5J1TC 3MV7D 3RIFF 3V4UH 2NY3D 1Y0LB 4LASL 4QXUL 1FV1B 4U1KB 5FM8A 1PG7L 3P77B 3RVVC 1FFPB 4O00A 1LD9A 4N5UA 2EIDA 4ZAKC 1DBAL 5F1KC 3ZTNH 3NFNB 2VLJB 5JPMA 2IPTL 1ZTXL 4NT6B 3OQ3B 3QRGL 3S4SA 2R1XB 4ONGH 4F7PB 2A6DA 2H8PA 5J9PA 1AXTL 5JHLH 2XQBL 2A9NL 4I77H 2P43B 2JB6B 3UXFA 4WUUE 2LV4A 3GI8H 3QBTB 1CLCA 4D0DB 3MRBA 2CDEA 4RDQF 5IB4B 5JLZB 1A64A 4OD2B 4N1CA 1E4XH 2B20A 5D7SL 1CVRA 4OCSH 4JFEB 2AJSL 3IFLL 5D96C 1T7VA 2VE6B 1IC1A 4OZFG 3CVHA 1KJ2A 1BJMA 3PGFH 4RNRB 1SBSL 3SDDA 4HBQA 2VLRA 4LHUA 1E4XI 3P4LA 3GGWB 4MD4B 2G5BA 1CXEA 1TZIB 1ITCA 2XPGB 1AR1D 4JZOB 3GEWB 3GO1H 4XH2B 4LPUA 3MNZA 3KYOB 3RWFA 3IVKA 3B3IB 3QDME 1SYVB 5LBSH 3RWJA 5DRXA 4X7FC 5E9DD 3TZVB 5CD5C 4QGTA 4KRPC 1NBZB 5CCKL 1OGAA 4OCXL 4P23A 4L5FL 3UC0L 5CJ8A 2X4UA 4LCUB 4MB4A 4TULH 1MRCL 2BSSB 2MQ3A 3N1FC 2HT3D 5HHQA 4LVHC 4XPAL 1NCDH 4PRIB 1I1YA 4AL8H 1JFQL 2X70B 3VFMB 5KG9B 4X0KB 1HNGA 3CVIH 4YIQB 4DEPB 4RAVB 2VRAA 5D1XC 5E0QA 3GSQB 4GKSB 1DDHA 1FNEB 1TCRA 2OSLB 1W72B 5AYUL 3P0VH 5KVEH 4Q74A 3BHBA 4LCWB 4KTYA 4XVTH 5I66A 1IAIL 1JNHB 1EUTA 3VXRE 4G9FB 4PBVC 3CK0H 5EU5A 3SO3C 4JO1H 1FO0B 4OV6F 5CUSL 3QQ3B 3QEHB 4G5ZL 1IKFL 4NQTA 3FZUC 4I3RL 4FMFA 3TBTA 3ULVL 4TTDD 5FO9B 3QHFH 2ADGA 2DI9A 4ELMF 1RUKH 3RDTA 5DMGC 5DO2D 4J23A 5INDA 1E4JA 1TNMA 4JQVC 1KIQB 2Y07L 1VKXB 1ONQA 4TNWK 1QFUL 3HTLX 4NQSA 4NQCB 4YUEH 1QBLH 2DLIA 2QR0A 2EE2A 4GBXB 4U1MA 4JPIB 4XRCB 4TUJB 3Q6FA 1H5BA 3B9KB 4XCNA 1IBGL 4RMQA 3L3GB 1R5IA 4TQEH 3QPQD 1JPGA 2QV2A 3FRUB 3MOAL 1GYAA 5E5UB 3O8XA 4P5TC 1DVFA 1YECL 3IKCA 2EDDA 4PJ7F 4XP1L 3ZYZA 1S3KH 1HHJB 3C6SA 1MJJB 3F5WB 3FO1B 1MQKL 4LKXB 1CL7L 4NOBA 3HB3C 5D5MA 3QUXA 4Z6AT 1CGVA 1NGXA 2C5DC 4LNRA 3RJQB 1W72L 4R4FL 3RRQA 1F4YL 3AXLA 3OKOB 4HUVA 1L4IA 1QSEB 3KPPA 1WSST 3T08A 2EDHA 5JIPA 2O61A 3MODL 4PJEE 4EXKA 4MCZA 4QKXB 4JVPA 1CT8B 3ARZA 3GMRA 5K93A 1JVKA 3WIHL 2IBGA 2NY1C 1U92B 5C07E 1FZOB 2IQ9H 2MQCA 1FO0L 3GSOB 3NIDE 4UV4L 2MCG1 2VLKE 1JI1A 4KMTH 1INEH 3DXAD 4TVSa 5FYLD 2ADFL 2ARJQ 5IV2A 1XF5A 2Y06L 5IMOA 3ECBB 4ZDHB 4DKEL 3VG0L 1I9IL 5B21A 2GQHA 1FFRA 5F1NB 2JK5A 3C2AL 4EI5B 4F37K 3M45A 3RWHA 4R6UA 2W59A 4JPWL 3L3JA 5EBLB 4ODUA 3E6HB 1QSFB 4HJGB 1FNSH 4X8XA 2EDLA 1IEBB 2V2XA 2DYPD 4M5ZL 3CGTA 2ITDB 1MHPH 3X3GL 3IJYB 4YGVB 3MRCB 1N5AA 3DECA 3EYUL 1DBAH 1B6UA 4AJ0A 3P4MB 4QRSA 5I74B 3OKLA 5TGBA 2DBLL 4EOWL 4LKCA 1Z0NA 3QI9D 3O4OC 3VA6A 1S9WA 4W6WB 3O9WA 3QIWB 2WK2A 3BEWB 4M48H 1CE6A 3ES6A 3ULSA 4I48B 2P45B 4P2RD 3QO0B 4WHTB 2YC1A 3OZ9H 3REWB 4QHMB 3I3BA 1CXKA 2VXVH 3MFFB 5BS0A 4GG6B 2AJSH 3MA7B 2GITA 5IHUH 2N56A 2VDKL 3CCHA 5E8NA 2VN7A 3SDCD 4PJFF 3V5DB 5LKNA 1EHNA 4P2YA 2C7UB 1KN4H 1SBSH 4M7ZB 5L2JA 1OOAA 1FFNB 1KV3A 3ZT5A 5DUBA 5DWUL 5E6ID 4UOW0 2QQKH 2EEBA 5KOMC 5FKPB 1UZ6F 1L7IH 4HMCA 1JYNA 1FSKB 1HE7A 1TNNA 5T1LB 2B5IB 2VDPL 3QFDA 3AREC 2IH3A 1TJGH 2DMBA 3HI6L 5TDOA 3S5LA 5EOQL 3DX7B 4OQ1A 5J13B 4L5FH 5D7LB 3UC0H 5DSCB 3ZKXC 1LO2L 3O2WL 3MLZL 4CVWA 1F4WH 4EI6A 3FHAA 4YAQA 3LN4A 1JHKL 4LPCA 1U8NB 2VLRE 3W0WD 4ZUSB 1Z9SA 3LRSB 4HH8A 4OBRA 3QIBD 2CMRL 4FZEH 2AJUL 4QTHB 4V1DA 3ABZA 5E08H 1QD0A 4XMKL 1VERA 4XP5L 3O3EA 1OF2A 3SDXF 3VWKC 5DJ2A 1J10A 4MA3B 3QNZB 1HILA 4R96B 3BQUD 3RY5A 2R2HA 1UEMA 1CYGA 1FLRL 5I1EH 5IW3A 4X5XA 1I1CA 3EYFB 1LWRA 2VLLB 3QIUD 1QFHA 2HVKB 5J56B 4RGNB 1IMHC 4U1GB 5CUSH 4K9EH 4CN1A 1OGAE 2PTTB 4Z7VE 3HNTL 2P47B 4RMSA 1DBMH 1RK1B 2WINB 4Y19D 4BFIA 3ARBD 4U1LB 1AO7A 1QFUH 4CMHB 1A3RH 2YBRA 1UM6L 1HWHB 1DQDH 3I75A 1H3TA 1NCWL 4M00A 1OCWH 3UTSA 5FHAL 5TQ2H 1U41A 2R4SL 2NTFB 1ZVSA 2YOCA 1G1YA 2YD3A 4DKFH 3MOAH 4S2SA 3RAJH 4JVWA 4JFPB 2AV7A 3MV01 5CJXC 3SJVB 1JRHL 5L7XL 3IU3B 1RJZA 1RUQL 1JK8A 2DQFA 4BSWB 2X4QA 1VFOA 1FG2B 5I1JL 2A6KB 2QKIA 1W72H 3QQ9C 5BRZA 1FE8L 4JFOA 5ABDE 2AVGA 4HD9A 4PJ9C 5D7KE 1WBZA 2AI0L 3WIHH 1DQLL 4H5SB 3EDEA 3VXNB 4NN7B 4KI5F 3VXUD 2ERJC 5IB3B 1MIMH 1PX4A 5ALBL 1FO0H 2F8XC 1HOCA 5EC1B 4BQCA 1RU9H 2DQGH 3T3ME 2GTWA 3QXUA 5GS1B 5MHSE 1NGYA 3GMNA 3P30H 4WW2A 1NJ9B 4U31A 3FONB 2X7LA 4DKEH 3MJ8B 1I9IH 4DVBB 4QT5A 3CDGA 1X3DA 3MQIA 5GQBA 3RL1B 2AW2A 1JN6B 4O2EA 1WISA 5J6GA 2J5LB 4I5BA 3EOAB 5D5ME 3C5ZB 3KYMA 2FLBT 1EPFA 2CKNA 1NMAL 2AJXL 4JPWH 5E2JA 3BDBA 1Z9MA 3HE6D 2I9LA 1BECA 5CSZA 4DQOL 1CR9L 2YN3A 3NA9L 1NC2B 4LBEA 5ICYB 1E28A 2ORBL 3G5XA 4IRZH 1DVFC 1IQDA 4J8RB 3EYUH 4XHJC 1BFSA 3HUJA 5I1AA 1RULL 2E8ZA 3QUXC 1G7QB 3MV11 1P6AB 2J12B 1X4YA 3DVNB 4C4KO 3W81A 4K7PY 3T1FA 4ORGB 3VXMA 2ZOKA 2PR4H 1QR1B 1CIDA 3ESUF 4U3XA 4N0FB 5B3NA 2CXKA 3TZVD 3KYNB 3PP4L 4LLQB 4YHOL 1A3LL 3ROLA 4U6VL 4GRWH 4D9QE 2Z91B 4JRYD 4NNXA 4YQXL 5BZWA 1ZV5A 4KFZC 3QDJA 5FECB 5A43C 3MRPA 4PRID 3VRIA 3GIVA 3TWCH 2NZ9D 1X5ZA 4PJ8C 3TH2T 4OF3A 3BGMA 2A6IB 4WGVB 2HTLD 2IPUK 3G08B 3JWOC 2C3GA 1NDMA 4KMLB 1EFXA 4HLZG 5DWUH 5CKGA 1DL7L 4HWUA 2GAZB 3UZQA 1T1XA 1YNTA 1NKRA 3PL6B 1BWWA 3SKNA 3SE8L 2AGJL 1OB1B 4EDWH 2OL3B 4P2QA 5EOQH 1WWAX 5BS0E 1LK3L 1UVQA 3MRGA 4WFHD 4JFFB 1QO3A 3T0BA 1BD2E 3MCLH 3VXQA 5HYIA 3HZVB 4WVRA 4QYOA 2OX5A 3O9WC 4Z0BL 4F2MA 3BP5B 2P5ED 2CMRH 3UPRA 4NQCD 1FYHB 3HG1A 4P4RB 2Y6SD 4AY0A 3HR5A 4GBXD 4Z7UF 4IMKC 25C8H 1ZANH 2CK0L 4JHWH 3B9KD 5I1LB 2NY7L 2P42B 4Y4HC 4WTXA 1MHCA 1FL3A 5EIQA 4OGAD 1FLRH 1LDPL 1LEKB 1ZEAH 5SV3A 3VFWA 3VXSA 1H3XA 3QXWA 5AZ2L 3MMEA 4DGYL 2F19H 3FFDA 3T4AA 2R2CA 1UENA 1AXSA 3VXTB 4Z77A 4NYLB 5GRVL 5GGSB 3CSYB 2B39A 1J0KA 4PV8B 4N8PA 2ARJA 3C5JB 1A9BB 3FT2B 3HNTH 2UYLB 3A67L 3AS1A 5AYQA 3JWDC 1XR8B 3SCMD 2XOTA 4P99A 1QSED 2JJSC 4W6XB 3HHRB 4PJBF 4V1DE 4GRMB 3TVMA 4YHLL 1UM6H 1T3FA 4PV9A 4D9RD 2PYEE 1NCWH 1LK2B 2OL3L 4ODWA 2YK1H 5JORA 3QUKA 5HHPB 5FHAH 2WANA 4UINH 4DGIL 3PIQA 1MHEA 1A6WL 2AS5M 2J88L 2H26A 5E00B 2X42A 4MNGB 2R4SH 3RBSA 5C0CA 2ZUSA 4W81A 4XXCC 1EMTL 3UPAA 5HXMA 4XI5D 3R06A 5L8LB 3WHE0 4CVZB 2BSTB 5ID1A 5FYJE 1IGYA 5E95B 4GMTL 5C0AB 1AP2A 1S5HA 1OSPL 1IM9D 5CEYA 5FGCE 1QSFD 5DI8A 5D1QD 2MHAB 1W8NA 3LKNB 1HXMB 1VFUA 4N8CL 2R56H 4YC2B 1AO7E 5TQ0L 2F15A 2BNUB 2V9QA 2GI7A 1BQLL 3MR9A 2Y5TA 1SJEA 3MRFB 1HXYB 5ALBH 4KHTL 5HYJE 3BH9A 1F11A 3PWVB 4ELMB 1PDKA 2BNRD 5CP7A 3TBSA 5DJDB 5C0RH 4QRUA 2WUBH 1OGTB 3L7FB 3NPSC 4Y89A 3VG9C 4JFQA 4Q6IC 2NLJA 5EUKA 2ICEA 4MDJB 3RHWK 2E27L 1NMAH 1QOKA 5B38A 2AJXH 4RQQA 5BRZE 2G9HA 1WFUA 4M03A 4DQOH 1SJHA 4AENA 1T5XA 1CGXA 4I0PC 1W0VB 4PJ7B 3FB5A 1A6TA 2R0KH 2FL5A 4X7CC 2QBWA 4EDXB 4OLZL 1EGJH 5JOFA 1EEYB 4LARL 3WNOA 5CGMA 4X6CA 4OFKA 5L0QB 1R24B 4YHNA 2NY4C 5TPWL 1TQBB 4K7FA 2BVQB 3N9GL 1MCLA 3IFPB 2DKSA 3CMGA 3QJHB 1V05A 2ZPKH 3UCRA 2P49B 4ZD3H 3EJYC 5IEKB 5F3HA 5DJAA 2HRPL 3GJEB 5DF0A 1Z5LA 5KZCD 4ELKB 3CFCL 4R8WL 2EH8L 3BXNA 4F7EB 1PSKH 4P57B 4M7LH 2VQ1B 4AT6A 3C8KB 4HFWB 4YQXH 5FYJU 1S7TB 4KKCC 2M8XA 1Z2KA 1ZGLB 3WNNA 5FKAB 3HUJE 4KVNL 3NZHL 1LP9A 1KPVA 5ACMA 2WBJC 4TRPH 2D4FA 3P9LA 5EZIL 4LLWB 3RNKB 3MLPA 3CC5B 4F7TA 2DTML 3VGGA 1DL7H 3CU7A 2IPKB 2JJVA 3QFJE 5E8OB 3KYAA 4R3SA 4XCCH 3VXME 5F71A 1RIUH 2DKUA 3SE8H 2AGJH 3BW9A 5F89A 2ZCHH 3WYRA 1IGCL 3P0GB 4HIIA 4MHHG 4FQQA 1MNUH 2IADA 1J1OL 1BF8A 3UYRH 3L3DB 1FYTB 4LLDB 4OD1L 5EU3A 4YHML 1LK3H 1XMWA 1G6VK 1OAQH 1Q0XH 3RY4A 2VQTA 5CHNB 7FABL 3QDJE 3H0TA 2AABL 4XT1C 1KN2H 4CKVX 5ALCH 2LTQC 3BUTA 4Z8FL 3ARWA 4PP1D 4MYWB 5IMMA 3KAAA 4N0YH 3QCTL 2CK0H 3CX2A 2VXUL 3NIGF 4HDIB 4AQ1B 1PLGL 3LZFL 3QH3B 3MRIA 4PPTA 3MGOA 4UBDC 4OCYL 1YY9D 4PJFB 5AZ2H 4ODXB 3RGVA 4DGYH 3S96B 4FQXC 5F7HA 4UZGA 1M7IB 2X4TA 4RFEA 4P2QE 4AEHL 2ICES 4OFVA 3GHBH 3MTRA 4ZUWB 3W9DB 1V7NL 1PGRB 4ZPVB 4X6BB 4OCNC 2NQCA 1MCWM 2AJZA 1IGJB 1FZKA 1HHKB 3A67H 4OLXL 1PVHA 1Y18A 1P7QA 5C0JB 4MA1C 1FNLA 3RX7A 1FZJB 4OZFA 4BJLA 4YHLH 4NO0A 3BPOB 1F2QA 2ARWA 1BFTA 3P4NA 3OHXA 4AH2A 1CQKA 1UB5A 2W0FB 3DXAA 5ILTL 5EPMA 3VXSE 2YMXH 2ZUQB 3VFPB 3PV7A 1P2CB 4JY6B 5IFAL 4PY8J 4O51A 5C0GA 5T5NG 5HGHA 4N5EC 4PJIA 4BELD 3W2DH 4PRHA 5LWYH 3MBEB 3WFCH 2DQDH 1MIEL 2X4SA 2YA2A 1MCPH 2D4DA 3SDXB 3QEQB 2ZOLB 3C5ZD 3GM8A 1QRNB 5KAQG 2X1OA 1HYSC 1I7RA 5J06A 4UU9A 4WWID 2EC8A 3OR7B 1NC2D 5MENA 3C6LD 2W65A 2O5ZL 1ZE3C 1NUFA 4RMUA 1BQLH 1IL1B 3X14A 2R9HC 4PJGE 4XAWH 1ZT4A 4HG4K 4IRJB 3BMVA 5KANI 1N3NA 1YEDB 3IDXH 2CDFA 4BZYA 2WMPA 3JTSB 3O3BA 3TC9A 1NMCC 2ZUXA 2HFFB 5FO7B 2D9QB 2COQA 1AGDA 3D87B 2FO4B 1KJMB 2E27H 3VRJA 1DQQB 3VGAB 4OKVA 3U4EB 3HR6A 3ZE1F 4NGHL 3TN0C 4XPTH 1U8JB 5L9DL 4PYGA 2VDLL 4RX4D 5KW9L 5E2TH 1TZHB 1KCVH 4HPOL 1AGFB 1JE6A 4MA7H 5A2FA 4MNQB 1DQJB 1YUHA 3IJHA 1RUPL 2NY6C 4OLZH 4NHUA 3S35H 3AAZA 4LARH 3K2UL 5J3HC 2NXYB 2FJHA 3CD4A 1TVDA 4G9DB 3GBNL 2HVJA 3LAFA 3MLVL 3D69B 1HSAB 3N9GH 3VGBA 3D3VD 4IM8A 2UZIL 4PJ5B 1TXKA 1ZLUH 2NNAA 3BPLC 5F97E 4ZUTB 1EO5A 5SWSD 1N6VA 2X4NB 4QHKJ 5ACZA 4PBXA 1DSFH 1MI5E 3CFCH 1S7XA 4R8WH 1HHGB 1YEEH 3O41B 4WFGD 1UYWL 4DZ8B 4OCWL 4URTB 5EC2B 1UQSA 4JHBA 2Y4SA 4JFFD 4WCYH 3QUMB 2I5YL 4WY7L 5DGRA 5DYOA 3V4PL 3FRPG 4LIQE 2M1KA 3D2UA 3C60A 4OV5B 5ENWA 3HMWL 2V5RA 1LE9A 2XKSA 4KJWC 2YUWA 3NZHH 4Y88A 3WN5C 3U7YL 4IDJL 2MWCA 1GZQB 4ODSL 5IBLD 3TJHC 4GQ9L 5EZIH 3KPSA 1GGCL 1L6XA 5E5RB 1J86A 3VW3L 2CO7B 2DTMH 1OTUC 3X12A 4PRPD 2E9JA 5HYEA 4TSCH 4DW2H 1QACA 4EIZC 2C1PA 3ARXA 3IXAA 3QIUA 3QQ4B 5F72S 1VB9A 4G6AD 1N6QL 1A1OB 4MJ5B 1J1OH 1EEZB 4OLWL 3RNQB 4WTWA 4JFXB 5LQBH 3C8DA 5CFHA 5J12C 1TLKA 3OAUH 3KWWB 2ADIB 1IZKA 1LP9E 1WBYA 3B43A 1OVZA 4Z8FH 5BJTA 4Y2OA 5DD6B 1HINH 4P9ML 3QCTH 2GSIA 2VXUH 2YD6A 5KSAA 1PLGH 5TF0A 3LZFH 4F9PA 4RBPH 1XCTB 2QSQA 3QZWB 5FOJA 12E8L 3N0PB 4OZIE 3QUML 4ZFGL 4WO4A 2W91A 4Y5VA 5IT2L 4HIJB 2OJEB 3UTPE 1K3IA 4O02L 3ZE2E 1S7QA 5JPNB 5BXFB 3EIFA 5I17A 4C54A 3QISA 4JAMA 5IF0A 3DYMA 2YUZA 1D5MA 4LPXA 3KPRB 4WI7A 5C0AD 4DN3L 1ULVA 4GJTB 3V6ZA 1C8PA 2FGZA 4XCYB 4OLXH 1IC4H 1NDGA 3R0MA 3NFPA 3PGDB 1CDGA 4L9LB 3JTTA 2FBOJ 3MC0A 3MV9B 2OZ4A 3ARFC 3K4DA 1T04A 2G2RB 4WDIB 3VXUA 3MRJB 3DX8B 2WSKA 2BHYA 4J12A 4QRQB 5DFTA 4DAGH 4FP8L 3DGGB 2NXZC 4ACPA 1DLHA 1U8HB 2VTFA 5I6XB 2XNAA 5ILTH 1QEWB 2Q86B 2Q6WA 3O6ML 5HGAA 1FJ1B 1NLDH 1QLRB 3OGCA 4GFTB 4HIHA 5IHZB 1HQRA 2DF3A 3CFEB 1D5ZB 1MIEH 3GRWA 1TVHA 4Z7UB 1NEZG 3R0NA 1OHQA 4CVXA 2A74B 4K3DL 5GS0H 2J2ZA 3CH8A 4OAWB 4JM4H 1KXVC 1GGTA 2B4CH 1URLA 3R8QA 1C12A 4LCIL 2O5ZH 1HHHB 1KOAA 3TYGH 2A6JA 3D6GA 4LF3B 5GJSL 3KR3L 4Y1AE 5C1MB 4BUGA 3LKRB 2HT4C 3KPQA 5JW4M 4AM0A 1MAJA 4D8PB 1U58B 4YDKL 3OAYH 4F15C 2X1XR 4HGWA 4RFNC 1MFDL 4TYUA 3GZKA 3Q1SH 4PJIE 4YHPA 4PRHE 4PJBB 4Y4KA 3KPMB 2A2QT 5IEHB 1CLZH 4MQXC 1CI5A 4KK9C 4L3EA 5JA8B 2H32A 2F53E 2R1WA 4X98B 2EDQA 3T2QA 4BH8B 3QDGE 3HZYA 4X6DA 1J0IA 2Z93A 1KIPB 3CXDL 2AJ3A 4LDLB 1A1MA 1BJ1J 5GRUL 5B3JF 4UTAL 3DO7B 5L9DH 1U6AH 4JRYA 5MENE 3HNSL 1WC7B 3FQTB 4HPOH 2MPAL 3QUYB 5F7KC 3MRMA 4OCMC 1UCBL 5I16A 3L5WA 3EDFA 1EK3A 2I60L 4KTEL 3D25A 3LEXB 2Q8AL 1VFAB 2V6HA 1JGEB 1AGEB 3JZ7A 5DD3L 5IBTH 1UH3A 3LB6D 2PF6A 2HJKB 3NCFB 3PNWA 4HT1L 3BI9X 2UZIH 4HWZB 5HI4D 4JRXB 4J3SA 1U3JA 3UJTL 3SE9H 2ZCLH 1JZ8A 5CBEB 1J05A 1AD9B 3VH8B 4F80A 4UT6L 5C9KA 5FM5M 1I8MB 5DLML 4LHJB 4U7KA 3ZDXE 5JXAL 1S9VA 3L3HA 5CBAA 3UROR 3SKMB 5KVGH 4PUBL 5EN2B 3MRQA 3RIAF 3TFKD 5T1MB 3FQNA 3BKMH 5JOPD 3K81A 4LRNL 1F90H 2RIKA 3V6OA 1EZVX 1MLBB 3WIIL 3S35X 2P5EA 5H94A 5J89A 1G7LB 4G8GB 2FGWL 3QR2A 3C09B 4IDJH 2R23A 4ODSH 2UZYB 5CIPH 4CGTA 4GQ9H 5A2KH 4WWKA 5GS0D 4LVEA 2VAAA 3VW3H 3EJZD 4JDZB 1EAPB 5F7DA 1I9RL 5KSBA 5F1OB 2V7NA 1L0XA 3IGAA 5DC0A 5E8DH 4WJ5B 3LKOA 4QEGA 3OJVC 1PJ9A 5KOVC 3D85B 1B0GA 1B0RB 2ADJA 4Z0XB 4JFYA 2ZSVB 4MXQC 4NC1E 5ERWA 2OM5A 3SE4A 5DJ0B 3KJ4C 4DK3A 43C9A 4OLWH 2D7OA 3L5XH 3H3KA 3DMMA 4B50A 3TO4D 1U0QA 1CD1A 1JV5A 4DZBB 4NWTL 1UADC 3DYPA 3GSUB 3SCMA 2AEWA 1XAUA 4ZPTA 1YEIL 2PCPA 5F8QC 5EO0A 1R5VB 2RJMA 5KTEL 3ULUH 4WI4A 4H25B 4KROC 1N4XL 2NY0B 3G6AB 4L3CA 3MLWL 2BXZA 3KPSE 1NBYA 4XBPA 3DRQB 1CD8A 4IIQC 4P9MH 4WEMB 4NC1C 1U3ZA 2Q8BL 1T03L 4WEBL 4PLKD 2F58H 3SDAD 4OIAA 2GT9A 4LEOB 12E8H 2GEEA 4MAYB 1JYXA 4HXBL 4KDWA 4PJDA 3TV3L 3BYTA 5JW4R 2I07A 1HI6A 3VFTA 2HFGH 5EFIB 2PO6C 1P4LA 1T21B 3ALXA 1MQ8A 4HHAB 4XCEA 1H0DA 3FB7A 3LSOB 2NZIA 1I7UA 5IW1B 3QEQD 4M8QA 1UXWA 3QYCA 3BX7C 1IM9A 4PGBB 3IETB 1QRND 5HVGB 5KSVA 2EZ0D 5GGTA 4M1GL 5T5FL 4RAUB 4TVPH 3UZEA 3VE0B 1CQYA 3FQUB 1GGIL 5IKCB 4YX2L 5EU6B 4FP8H 4OF7A 3G6DL 5ITFA 1CZ8L 2BNRA 3DURB 3LH2L 3MLUL 4U05A 5SX5K 3O6MH 1DEDA 5A3ID 4CU7A 3K2MC 3O3DA 3TPUA 3VXPA 1EHLH 4U1HB 4P2OD 3KDMB 4QRRB 1J8HB 4E5XA 4ZXBA 5ADOL 4S11A 1A6AA 2V7HA 4TSAL 1RZGB 2XKNB 4K3DH 4FFYL 4U33A 5GS2D 1WIOA 5JXEA 4CNIB 2GCYA 5IMLB 2Z31D 5KSAC 5JIKA 2ZG1A 3TA3B 3O2VL 5I2IA 3Q3GA 1ND0B 4LQFL 1LNUA 4LCIH 3AMLA 4WO4C 5GJSH 1NGWB 4MNQD 4X6FA 5MI0C 4N90D 1WV7T 3MLTA 2CKBA 1JZ5A 2YD4A 3QWRD 3STZA 5I15L 3DHJA 1OLLA 4DUWA 3O3UN 2LU7A 2A0LD 1Q9LB 3MLRL 1J0YA 2R15A 1QSVA 3EHBC 2V9TA 2P8MB 1Z6JT 3FQXB 4P46B 1BIIA 1PKOA 2FYYB 4NHCH 2K9UA 2AEQH 4ZUUA 3VFOA 3KPOA 1YN6B 1ZSDB 3ZDZF 4UDTB 3IXTB 3ULUD 1FZMA 3CXDH 2IANB 1I1AB 4N8VG 5ANMB 4HKJA 4R4ND 5ISZD 3TESA 1X7QB 2Y36L 4KZEL 5EOTB 2Z8SA 3HNSH 4IOFD 1UCTA 5CJ5A 2MPAH 4IHOB 4CVUA 1A7OL 1EJOL 4HKXA 1HH9A 3KLAB 1IM3A 3RWGA 1UCBH 5FDYA 2Q3ZA 4CN6A 1PYWB 1OW0C 1M05A 2AK1L 3L95A 2BY0A 4FN0A 4KTEH 2DM4A 4OZ4B 3MXVL 4WUUB 5FUZL 5FUCC 5KS9A 4I13B 1BVKB 5DD3H 1MCKA 5JZ7C 2VL5B 4PR5A 4C56B 3HZMB 5IVZA 2NY5L 4L3EE 1U2CA 3ARDD 2X89D 4TVPD 2EYTB 4YHKL 3UJTH 3Q2CA 1U3HB 3RVXC 3TH4T 3Q0HA 2R8SL 4UT6H 5E5MA 4ONFH 3MCKA 3O45B 1ZA6B 3RVUD 3EO0B 3UAJD 4U7SA 4L1DA 4NJAL 4MAUH 4APQB 4F7CB 2VDOH 1D6VL 4PUBH 1INDL 4NQEA 3RVTC 5I1IL 2R0ZH 1N59B 3TCXA 4MXWL 5HGGS 4LRNH 4Y4KC 4YBHA 1RIHL 1FVCA 2HTKC 4JREB 4UILL 3TBVA 3UMTA 4IBLT 3LQAH 2E7CA 5DRWA 3WIFB 3O6KL 3BIBX 3LD8C 3KHOA 3C8HA 1PFCA 3JBG7 3UTTD 4KKBC 1YMMA 4GRLB 5FV1L 4M1DH 1I9RH 1D9KB 4NIKB 1Q8MA 4HS6B 4FABL 2F5BL 3H9HA 4Y2DD 5FOBB 4QTIL 1ORSB 4XVSL 1S7UB 4WIQA 3V6BR 3LS4H 2XTJD 1IAKB 4J7RA 1JJUA 5IGXL 1ZK9A 2P7TA 4P3CL 4X7SH 4FXKB 3WLWC 4XPBL 3KPRD 1RZ8A 2BRRL 3V6OE 5C0FA 1SM3H 2V2TB 1RY7B 1YEIH 2X4RB 2RB8A 1MRFL 3TIDA 2VR4A 5KTEH 4MJIB 4XWGH 3IFOA 4FQLL 4DKDC 5EO1B 4X9BA 3STLA 3MLWH 3EYOB 2D2OA 4IOSD 5IK3A 1T2XA 4H26B 1T03H 4WU5B 2D31B 3L3KB 3T0WA 1BBJB 5ID0B 3SKOA 3TV3H 1EX0A 2Z92A 5DR5L 2PNDA 3NCBB 3V6OC 4R0LA 3CFDB 4P5KA 2RCSL 1XGRA 3PGCB 2GUOB 2J6EH 3PABA 4L8SC 3ZSSA 5T33L 4OQTL 1C5BL 3MNWB 1EUUA 4JLRA 5D8JH 2R1YB 2DIJA 1MY5A 4ZOCA 1TZGL 3M8OH 4PTTB 5T5FH 5I9QC 1BOGA 5EIIB 4U0RB 5D7JA 3ZL4L 2F54D 3H9SD 2Y5EA 4IRSD 4KPHH 3VMNA 5D2LA 4IIQB 1AJ7L 4IMLA 3CSBA 1OTSC 3G6DH 1B4RA 1CS6A 3MREB 3DSFH 1B2WH 2BSRB 3DMMC 3ISWA 3MLUH 4R7DB 1UJ3B 1YNLH 3EDDA 1G7MB 4PJDE 2SEBB 2VDQH 1UGNA 3CAFA 3QNYA 4GKZA 5FCUL 1F6LL 2UY7A 3JV6B 3ARGB 4TSAH 5DC4B 1CCZA 3CFKA 1T83A 3GSRA 3TT1L 4X4XA 3D9AL 1BJ8A 5LGJA 5DEFA 2P5WA 2EDOA 4LOUD 1G0YR 1NQBA 4NSKB 1AQDB 4LQFH 3V0VB 2XKUA 3IF1B 3RWIB 2AXJA 5HHOD 1SBBA 2NW3B 3V5HB 1CF8L 1QFWL 1MCRA 4LL9A 1I9JL 2QQNH 4HJJL 1XGYL 2BVUA 4PS4L 4U6XB 5E1AB 2QEJA 4J3OC 4JZNB 4MS8C 2FWOB 5SWZD 4LSSL 5ESVA 2XZAL 3TYFB 3IDJB 3IDUA 4Y5YC 3F6LA 3D3VA 1VGEH 1BAFL 1CD0A 3OKNB 3LV3A 4OF5A 3NN8A 4PGJA 2X2YA 5SWSA 1ZWIA 3RZCB 5T3XH 4YHYC 5DQDH 1B90A 1EA9C 1YEFL 3BZ4B 2IAMD 2CLRA 4BQBA 4IS6A 4D0BB 1JGDA 4NN6B 4I9WE 3BESR 3HAEG 3PWPB 1CICA 4POZD 1IGFL 1U8LA 5ETUA 1OT2A 4FTVE 5HY9B 4KZEH 1Q9WA 4L29A 3F8UB 4PJCE 5FA4B 4YPJA 3GUTA 3K4ZA 4ISVB 1W2KT 4I4WB 4U1SA 4NQVB 1A7OH 5CILH 1IFHL 1PBYA 1T0MA 1N2RB 1XR9A 4ZXBC 2JKXA 2FEDC 2JCCA 3GSNB 4FA8A 2X4PB 4G8GD 4MCYA 4NQDA 4ZOAA 3CMOL 1MCIA 3MLSL 2AQ3A 1I3GL 1ZMYA 2AK4E 5IQ9B 5JXEC 1KLUB 4NKOB 5D1ZA 4E41B 4Z76A 5DURD 4PLJC 1KT2A 1F6AA 3DYOA 3GMMA 5IB2B 4CADA 1KTLA 1LD9B 4LSUL 5C09D 4QY8A 3OG6B 1WWWX 4GW4B 4WI3A 3QEGL 3SQBA 2IWGA 3NABH 3FB6A 4NJAH 4NO3A 1KB5A 1D6VH 3S4SB 1T7YA 3MJ9A 1INDH 2FJFA 5J9PB 2A6DB 1EXUB 2H8PB 4HXAL 4S1DC 4JDVB 4MWFA 1K4DB 1RIHH 1R0AL 4UILH 2EYRA 4MLIA 4G6ML 1OAXH 5IJVA 5KS9E 1RV6X 4O9HL 3SCMC 2NY0D 5FO8A 3SO5A 5EA0L 1XF3A 2AJVL 5C08E 3UZVB 3MRBB 2CDEB 3W39A 2VSDA 5GSVA 1ZVYA 3RL2A 3BO8A 5IOPB 3CVHB 3GDBA 2GK0A 1XGTA 3HE7C 4O5LL 3SDDB 2OTPA 1HCFX 2FIRT 2VLRB 3GSNL 4LHUB 4MD0B 4NN5C 3WXVL 5CP3H 4QHLA 5DJXB 3E6FA 5E1HB 1DBKH 4P3CH 2NY2B 5D71L 5HBBA 4H1LB 4NQEE 5L8JB 4HAGA 3GMPA 4BFEA 3T0EA 5DS8A 1A21A 3MNZB 1MRFH 3RWFB 4JPKL 3IVKB 5T3XD 1JYVA 1IT9L 5HDBE 1U8OA 5C0ND 1OP3H 5HJ3B 5EU6D 1PEWA 1OM3H 1YMME 4NOFA 3ETBF 5DRXB 4G42A 4P23B 2X4UB 3CDCA 1TITA 4UOJA 4XVUC 3RPKA 1TTFA 4Y5XA 2VXTL 4G8EA 3RTQB 2LVEA 3NPZB 4QRRD 3CFBB 1J8HD 2I26N 3EOTL 3Q48A 5JTWA 1FGVH 2XY1A 5CZXD 5T33H 1C5BH 2KZ1B 1MH5B 4XAKE 5HYQB 4KJQC 3MFGB 1TZGH 2OQJA 2ESVB 3OKDB 1RURL 4LCCA 3BHBB 2VKXA 2A73A 5KVFL 3H3PL 3X11A 2HFEB 3FRPA 3CVHL 5EU5B 1UB6A 4BKLA 1UWEL 3HRZA 4HBCL 2BVEA 3QUZC 4LSQL 4JJ5A 1CE1L 1E27B 3JXAA 3WXWH 2ID5A 2JJTC 2DWDA 3TBTB 3VGHA 4NNYA 5DEZA 3IDYB 4O2FB 4P4KB 3RDTB 1S9XA 4KUZH 3TNNA 5INDB 3PDDA 1TTUA 1HN1A 1BX2A 1YEGL 1ONQB 5FCUH 5JR1L 3PJSA 4GKNA 3PQYA 1JGUH 1LDSA 3BYYA 1IC7H 4U1MB 3D9AH 3Q6FB 1H5BB 4XCNB 5I9QB 2VN4A 3QXAB 2EC9U 5L2KE 3QXDA 1OP5H 1K3ZA 1R5IB 5HTSA 4ZYKA 3TJEH 3O8XB 4NO2B 5D2LE 1CF8H 1QFWH 2EDBA 1I9JH 4R0LC 3IKCB 4M93C 3ZE0F 1IE5A 4HJJH 3C6SB 3KPTA 1CU4L 2XRAL 4LSSH 4M6ML 4Q6YA 4WUUD 3I84A 2IBBA 1FHGA 1JWSA 2XZAH 4P9HC 3DI3B 1NGXB 3PP3H 4LNRB 3OB0H 1QFWI 1RJLB 2A1WH 4X6CF 4U7MA 4KK5D 3RY6C 3ILQC 3AXLB 5IWLA 4HUVB 4QWWC 3K0WA 1Z3GL 2O61B 4MCZB 1YDPA 4WTZG 3GMRB 5MEPA 5EOCL 5BV7C 1YEFH 4HS8H 1ZHKB 2AAVA 3S3PA 1RZJC 5IR1A 2P5WE 1MHHB 4APQD 1FAKT 1QSZA 4U4BA 5TJWK 5IV2B 4ZG1A 2D3VA 2YPVL 3EYQC 5IMOB 3HS0A 5T3ZL 2VL4A 4E42A 4ETYA 4W4OC 1WCBA 3GK8L 4HCRH 4PTUA 1LP9F 5D1XD 3CMOH 4G6KL 3QDMD 2UV3A 4MD5B 4B7LA 4YDLC 3GHEH 3VDCA 4GRLD 5MEOA 3KPLB 3RQ3A 3AU1B 5D9SA 1HIML 5HYSB 2DDQL 1WWBX 3L3IA 5DMIH 2EICA 1N5AB 4PJAA 5E94A 4LSUH 3BSZL 5GS3A 2PXYA 2HLAA 3WFDL 5FYKL 3QEGH 3DETD 2QADC 2AJYL 1NEZA 4UTBH 2VSCA 3TO4A 1YEHL 4YDJA 3OKLB 2GTZA 5E4EC 5TGBB 3ZYOA 1AHWA 5B8CB 1JZ4A 2J8UA 3MRLA 5A1AA 1FBIH 4D0CA 1MY7A 4HZLA 4XNUL 1S9WB 1QFPA 1TJHH 3G9VA 4X7DC 2O5XL 2M26A 4G6MH 4MJID 3ES6B 4NQDE 4O9HH 3ULSB 4OI7A 5EBMA 4R7NA 5EA0H 3VXRD 2DM7A 2AJVH 4LNVA 4YPGA 2YC1B 5DJYB 3V8CA 4JFDA 2YD1A 2AKRB 4RWYL 1V7ML 1FGNL 5DRNA 3DWTA 3OAZH 4KJYA 1J1PH 3WDIA 4OD3L 3PWNA 4P5TD 3T65A 2BRQA 1NFIA 1I7ZB 5GRVK 5BVJA 2OS7A 4KQ4H 3GSNH 3WXVH 1YPZA 4S0TD 5F9JA 3U0WL 3C9NA 4QOKA 3RIFK 1UM5H 1E6OL 4N0UA 5F7YC 5D1ZC 1T5WA 5LG1A 1RZKC 5HVFB 5JW3L 4TUKL 4XNZB 4LK4A 2D7PA 5ITBL 2NY1D 3QFDB 5INCA 3WLBB 2IH3B 1H3PL 3FOMA 1KC5L 5TDOB 2NYYD 3S5LB 1II4E 1PEZA 4HEME 2XWTA 3AC0A 5C8JB 2I9TB 4J2XA 5TH2A 4YK4C 4Y8AA 1G9NL 4KU1A 4P2OA 2WQ8A 2VXTH 4YAQB 3LN4B 1X5FA 5BZDA 4X4YA 3PDGA 1XF4A 2GY7B 1G9MC 2VABA 3EOTH 4PJIF 3LQZA 7CGTA 2ICWB 4V1DB 5MERA 4M5YH 4GH7B 4HJ0C 5CIPA 1YYMH 1KCRH 3SPVA 2XV6B 4MXVF 3CZFA 3KXFA 2BVOB 5DJ2B 3T0EE 3BUYB 5C07D 4EN3A 1HILB 3BKYH 2R2HB 3UTZB 1RURH 2VLKD 1XIWC 4BSVA 4KRMB 3VU2A 2Z4QA 4KK6C 3CVHH 1KJ2H 5FGBA 3E8UH 2XY2A 1UWEH 4PLNC 4HBCH 2B7DT 4Y4FA 1H3WM 3U36A 4CU8A 1K5NA 1KIUA 3O4LA 1P7KA 2GJ6E 4Y16C 4KK8D 4Q0XL 4HIXH 3B9DA 4K7PL 1D5XA 3T0EC 5IVXA 4M62H 4S10A 2P24A 3IDIA 1KELH 5D7IF 5JR1H 1AO7B 3HI1A 3CSGA 5EBGA 3RZCD 1N8ZA 2YBRB 2X41A 2W60A 4XGZA 4P5MA 4HWBA 5E2WL 3UTSB 2QSCL 2XFXA 4XP6H 2DQJL 2VWEC 4HUNB 4JQXA 3FMGL 1RK0A 4S2SB 4Y5XC 2AV7B 1A6UL 2D7QA 4WI6A 2FEEL 5GGVH 3P9WB 4YO0A 2XRAH 1JK8B 2DQFB 4MQSB 2X4QB 5IVOA 3N1PC 2QKIB 1PKQE 4GXUM 4H20L 2OR9L 5CEZL 1ZLSL 2X89A 1ZLUK 4JFOB 1MCFA 1U8IB 4X9GA 4J4PA 3G9AB 1C5CH 1OARL 3PQYE 4PGEA 4HH9A 5EOCH 2BVPA 3U30C 4CDHA 5E9DE 3L6FA 1RZFL 2EDXA 2WQRA 1M71A 2FJGB 1BVLA 2GTWB 3FFCB 3DX6A 1NGYB 1IKNA 1T2JA 4LRIA 3GMNB 3U83A 3RFZC 1AR1C 4JQIL 5HGBB 2X7LB 5I1CH 1I1FB 4QT5B 1G6RA 1FH5H 3GK8H 3LMJH 2YKLL 3KYMB 4JJHA 1AXIB 3WO4C 1HDMB 5I76A 1EJ6A 3UTTA 3VI3E 3N85H 5BVPH 1JHLL 1U95A 1YEKH 5CSZB 1HEZA 1AFVL 3ZZ1A 4C57C 1IAOA 4LBEB 4X9HA 5TE7H 1E28B 4E9LA 3G5XB 1NCCH 3VJ6A 5KBNC 1UKTA 5GRYA 3EGSA 3BSZH 1IQDB 1OAUL 3NACL 3QDAA 3KLHD 5FYKH 2Q20A 2VLRD 4LHUD 3B5TA 4WI9A 2OMBA 4X4ME 2DI8A 5I1AB 1QLFA 1YEHH 2X05A 1OWRM 4GAGL 3OL2A 2RQ8A 1SY6L 4NDMB 3EUUA 3I6LE 3VWJA 4XNUH 3FN9A 2RAMA 5DD0H 2O5XH 2LQRA 4CUCA 3OX8A 4JFZL 3T1FB 4ZS7H 5F9OL 3T0VA 1WTLA 3ZSTA 2ATPB 2PYFB 4PGCA 1U3YA 3ARVA 3NFNA 4NT6A 2A38A 1MF2H 4MB5A 4CMMA 2R4RL 5F7EH 2Q7YA 1OGAD 3UDWC 1V7MH 2DD8H 3DV4A 1U8PA 1XGQA 2FH8A 4NNXB 4PJHA 5BZWB 1CBVL 4AIOA 1R3HA 3ROOB 5FF6A 4WFFE 3MRPB 3RWEA 4AEIL 2D03L 1LGVA 3BGMB 3U0WH 3IAQA 4LVOC 2FRGP 4XBEL 3TT3H 2YZ8A 5L88L 1EFXB 1D6EB 1E6OH 4WV1C 5L8KB 2HT2C 4RGOL 5IB4A 2Z35A 3QQ9D 4ZSOA 3NA4A 5IVNA 1MRDL 2GSGA 4JFEA 4EXPX 2F54A 4HUMB 2VE6A 1T1XB 1YNTB 3EFDL 3GMOA 4TUKH 4PJ9D 1ACYL 5BCAA 5ITBH 2YHGA 5GRXG 1KCSL 1NFDE 2R0LH 2PXYC 1KC5H 4JFDE 2YPLB 4P2QB 5HD8D 4PG2A 4LAQL 3LKQA 1TZIA 1IAIM 1UVQB 2H1PL 3MRGB 1QO3B 1AHWC 4ZNCD 3T8XA 3VXQB 4L4TB 1G9NH 1Q9KA 3I85A 4JZOA 4HKBB 1WEJH 4QYOB 1YPZE 4F2MB 1CDJA 4GUPB 3UPRB 2OP4L 3HG1B 5D7KD 4N0UE 3T3PF 2WM0A 3QCVH 1NBZA 3T2PA 1MHCB 3CFJB 3HPLA 4LCUA 4X9IA 5E6ZA 5CLWA 5MHSD 4UT9L 5DUML 3FFDB 3O8XD 5I8EB 3T4AB 3UBXB 4L4VB 4Z77B 1DVFD 1MPAH 1T89A 2CQVA 1XH3A 3SKUD 3VFMA 4H0GA 4X8JA 2PW1A 4XHJD 1CXLA 4YIQA 4UAOC 3OAYK 2YRPA 1CDUA 1FNEA 1FP5A 3QUXD 2OSLA 5IG7A 3DUSA 3BN3B 5CSBA 2ZNXA 2G75A 3JWDH 4K7PH 3LOWA 2E8YA 2BK8A 2CIIB 1WF5A 4M9PA 5JO5B 1OQXA 1WFOA 2FX9L 3TVMB 2HLFD 4G9FA 5GZOD 1UM4H 1TJIL 1T3FB 4CL7A 2IAMA 4L8DA 4ODWB 4X6DF 3QQ3A 3QEHA 2QSCH 2YA1A 1MCOL 1K8DA 3PIQB 2DQJH 5FO9A 2H26B 4KRNA 3D1MC 5C0CB 2X40A 3VFGL 4OLVL 2R2EA 4KZDL 1VEMA 1T7WA 4YXLL 5IQ7L 1AGCA 2AQ2A 2APTA 4FQ2L 3DVIA 1A6UH 3R06B 2HKFL 5ID1B 3O4LE 2MKWA 4PJ8D 1CLOH 1P4IH 4LAJH 5E99H 1IGYB 4FZ8H 4K8RH 1HQ4A 4RGMC 5DA4A 4P49A 5JUEL 1S5HB 1UACL 1YC7A 2DJUA 1BBDH 4KI1A 4EN3C 3MV7B 2OR9H 5DD5H 2FEEI 4IOIB 2NY3B 4YBQC 3L3GA 5CEZH 2NW2A 2GFBA 2HYMA 1SYSA 1ZOXA 1OARH 4XB8A 4D9QD 4XZUB 3SDCC 2EXYC 2XN9A 3MR9B 2Y5TB 1PZUB 5FK9B 5B39G 4J3VA 3F5WA 3PWUB 3FO1A 4GG8A 3WD5L 2EDWA 4WHYH 4LKXA 3LHPH 4IEFB 1J8KA 4JZJA 2BNQE 3TBSB 5E6IC 4QRUB 1XEDA 4JQIH 1EO8L 1JF6A 1WJ3A 2MQ0A 1P69B 1F3JA 3OKOA 2MOVA 1KEGL 4KTDL 1NUNB 1YA5A 4JFQB 3O9WD 1CT8A 2NLJB 2ICEB 4X7TA 4XCFL 1QG3A 1B9ZA 5DUPL 2KKQA 5B38B 3GSOA 2N4IA 1H3VA 3LKSA 1LEIB 2G9HB 3DX9B 3MRRB 3PXHA 1LHZA 4F33A 4AENB 1AFVH 1T5XB 1E6JH 5BS0D 4HPYL 3U48A 1KENL 3BVNB 3L1OH 5TDNB 4BQ9A 3QP3A 4DK6A 5KSBF 1MFEL 3MOBL 3ECBA 1BD2D 3CIQA 1F4AA 3QIBC 1F8TL 3UEZA 4EI5A 4X6CB 2LE9A 4YHNB 4K7FB 5GJTH 4HJGA 4GAGH 1MCNA 2HJFB 1FNGB 4QRTA 1FPTL 3DVFA 4JM2C 1CGSH 1MCWW 4J4PC 4YZFE 2FX7H 2ITDA 5DJAB 2DQHH 4JFZH 3MRCA 1S5IH 4J6RL 4UIKL 2YD7A 3OPZL 1S9YB 4OZHE 3BXNB 4KDVA 4BZ2L 4XMLL 4N9OB 3OXSB 4S1RL 1JNLL 5IFHL 5F6IB 4GRWF 1V5JA 3O6FA 4S1QL 4YE4L 5D70H 3ARBC 4ERSL 3QIWA 3PWJB 3BEWA 3NGBC 1K2DA 4PJDF 5CZVL 2OTUA 4R90L 1WBXB 1LP9B 3GI9H 1KPVB 4GAJH 4I48A 4V1DD 5K59F 4XBEH 4WHTA 2DQEL 4K8RD 3GIZL 3P9LB 3JWNC 5L6YH 2W92A 1WQVT 2PYED 3HAEA 4QHMA 5DA0B 35C8L 5GRJL 1KNOA 2OJZL 1S7RA 1ACYH 3SN6N 5AEAA 2EE9A 4ZAKA 4LIQL 1BHGA 3BW9B 5F89B 1KCSH 1YJDL 2B0SL 2VLJE 2ZNWA 3Q6GH 3BRDA 3THMH 1FRGL 1G1CA 2VITB 4HIIB 4NM8L 1FFNA 5FYJD 5EU3B 1BOYA 4PJHE 2KUTA 3WKML 1WZ1H 3K1DA 4YJZL 3V6FA 2V5SA 3H0TB 5T1DL 4RMWA 2YUVA 5BW7C 2EXWD 4OF0A 3K8LA 1AO7D 1NAKL 4LVOB 4KKNA 5IMMB 1FNHA 1QRKA 4X99B 3EYSL 3TNMA 3U4BL 1JZ3A 4FMKA 4RISH 1JGLL 4JFEE 5HYJD 4OM1L 5DSCA 3MRIB 4HV8A 1F00I 3MGOB 5I8CA 1WWCA 4I0PD 3RGVB 5DUMH 5KSUB 1A47A 2X4TB 4QTHA 4ZODA 3ULVE 1L9NA 4AZ8A 2IQAA 1FZKB 4MA3A 3QNZA 3EBAA 1Y18B 3V4UL 1MCHA 5BRZD 1P7QB 3MUGA 3N1MC 3EJYD 1WAAE 1WIPA 4PJXA 1IGIH 4NO0B 2HVKA 3L5IA 2HKHH 1P53A 3P4NB 1MJ7H 4K9EC 5IP4A 2W9EH 3OHXB 4AH2B 1MCOH 3DXAB 1RJYB 4PG2C 5EPMB 4GAFB 5C0BA 1AC6A 1H8NA 4ONGL 1KCLA 4KZDH 5JHLL 4O51B 5IQ7H 4OIBA 4PRIE 4I1NB 5FDWA 4PJIB 2C3HA 2GW5A 4FQ2H 5F93C 5IESH 3O3AB 2HKFH 1S7WA 5BOPA 2DQCH 1AKJD 1L0QA 2X4SB 5DZNA 1JZ7A 4EKXA 4NKMA 1N5YH 2WBJD 3QDMA 3ZDYF 3I3EA 3P0YL 5JUEH 1UACH 1YN7B 3HFML 3TZVC 4K7PX 3K8KA 4WNQA 1E4XL 1I7RB 4LCWE 4OCSL 2NTFA 3D0VA 4G9FE 5MENB 2LAGB 2W65B 4KVCH 4JFPA 3T0AA 1ZHBA 1C7TA 2IH1A 4UDUB 2DQUL 5H8DA 3SJVA 3VH8G 3BJ91 5EB9A 2HTLC 1YQVH 4DEPC 4OF8A 1CIUA 1N3NB 1OP9A 3M1BA 2CDFB 3QI9B 1IGMH 2PUQT 3GO1L 5D7IB 1KEGH 4DVRL 1YQ2A 4JO2H 3H42L 3EKCA 4XCFH 1AGDB 5T1KD 3VXRA 4P2RB 3QFJD 3VXNA 4OZGA 3VRJB 3VXMD 4N9GA 4OKVB 3SQOL 2DS4A 5AG9A 4Z7QE 1SJXA 5FYLL 3CSPA 3PG2A 1KENH 2FR4B 4TULL 3BN9C 4UBDD 4A6YH 4JDTL 3JSSA 4KKAC 2XN9E 4P5TA 4DWHA 4OI8A 3QDJD 1NCDL 1YUHB 3IJHB 4FQXD 2O26U 4NHUB 3RL1A 3CVIL 5FHBL 4ONOA 2FJHB 4CN4A 1F8TH 3KYKL 4GBXC 2HVJB 1FAIL 4PY7B 5IB1A 3O2DA 1K9TA 1CGYA 3B9KC 4QNPE 2AXGB 1CG9B 1FPTH 1RUML 4OGAC 3BMWA 4XVTL 2NNAB 1IZJA 2R29H 3X13A 3CK0L 5E03A 4UOW1 5ACZB 1M6OB 4UIKH 3WS3A 1S7XB 3LIZH 1DANU 1CFBA 2JB5H 4JO4L 3RKDC 2UWEF 4P2QD 2ILLA 3MSPA 4BZ2H 3BE1H 4A2LA 1UQSB 2IBZY 5F7FA 1RUKL 3UYPA 1DUYA 4JN1H 2CLVA 5DYOB 5I30H 3D2UB 3C60B 3W0WB 4N5ED 2OI9B 5CMAA 4LVNB 4YE4H 5ENWB 4JKPH 4ERSH 3BDYH 5CZVH 1LE9B 1IEHA 4PJEA 4WTZA 4YUEL 4HCRA 1NL0H 2DQEH 1NC4A 3V7AG 1QSFE 1GJIA 4N0FA 4NRZA 4EVNB 4FQPA 1RSFA 3WEXA 2P8PA 4PD4J 5EO9B 3BQUB 1HYSD 2HH0L 1EV2E 1G7PB 1T22B 5DQ9B 2Z91A 3VXSD 1A9EB 3MBXH 5FCSH 2C1PB 5I8OH 3MACH 3QIUB 3S3JA 4PB0H 4LIQH 4Z9KB 5EZLA 4L8CA 1YJDH 1JWUB 1S3KL 3T77A 2R9HD 2K3TA 4NM8H 3NVQA 3G08A 4EI5C 2CXGA 3W82A 2AXFA 4Y19B 1OD7A 2V2WB 3CFIC 3DBXA 2Z8WC 3VGDA 4XC1L 1NH6A 2EIZA 3W5MA 1MCSA 1RQ5A 1WBYB 3TVMD 2OL3A 1FCGA 1Y6MR 2IQ9L 4D3CL 1KULA 3EYSH 1ORQB 2GSIB 3U4BH 5F3BA 1JGLH 4GG6E 1INEL 5I74C 1Q0YH 2CH8A 1FLTX 3F12A 5HHNB 5IUSA 4N0CC 2X10A 2X44D 3EFFB 4M7LT 4Y5VB 3S7GA 3QIWC 1EH9A 3SDYL 1UXSA 4NZTH 1S7QB 1AIFA 4RMVA 5J3HD 5I17B 1NAMH 1NUDA 4P4RA 5IF0B 3MLXH 1D5MB 3G6JF 3V6ZB 1GL4B 1FNSL 5TE6L 5E8EA 1NDGB 3FO2A 2F74A 2CRYA 3NFPB 2RHEA 3H7BA 3JTTB 1PD6A 1MHPL 5LAXA 3K74B 2CUIA 3VXUB 3VXTA 1OWWA 4U3HA 3AREA 5F7NC 3CSYA 1T0NB 3FHQA 1DLHB 1T80A 4M7ZC 1J0HA 5D7LE 2FIKA 3C5JA 3FT2A 4HAFA 1A8JH 1C1EH 1A14H 5HGAB 5EULV 3OGCB 3CLFL 1DBJH 4HIHB 2DQTH 3NIFE 4HK3J 1HQRB 1CDHA 3OWEA 4GW5A 4F3FB 6FABH 5DK0B 4M48L 5F1SA 2L4OA 3PUCA 4KJWD 1FSKC 1TVHB 3U7WH 3VD4A 4CVXB 2JCCF 3OZ9L 2B5IC 5TF1H 3VWKA 3P0YH 1MI5D 3HFMH 2JJUA 3HE6B 5HHPA 5FA3B 2VXVL 5J13C 3FO9B 2VDNL 3E0GA 3OKMA 5IHUL 4PJXE 2IFFH 1JZ2A 2A6JB 1TFHA 2DQUH 4RGNE 1KN4L 3I6KB 2BSTA 3L5HA 2K7PA 5J7CC 4AM0B 5C0BE 3BP7A 1JUFA 4HGWB 2VUYA 5CJOH 4YHPB 4WUKL 3VI4F 2QQKL 1G7IA 1HXMA 5A16A 4DVRH 4L3EB 1CFTB 1L7IL 2H32B 2BNUA 2R1WB 1ES0B 4OZFH 3H42H 2B1HL 3HZYB 4X6DB 1PY4A 2AJ3B 3MRFA 4U1JA 5LXGL 1A1MB 3SQOH 4RGNC 4CJ1A 1D5BB 1TJGL 4U1GC 3WFHA 4HC1H 5FYLH 3OJ2C 1KLGA 3BDXA 4JRYB 1F4WL 4Z7VA 4DTGH 4JDTH 4OLUL 4KMQA 3SJVE 3L7FA 5CJXA 4LCYB 2F9BT 8FABB 3U4AA 4JHAL 3A6BH 1MFAH 3GRWL 4FZEL 4MDJA 4CMHC 5FHBH 1I3RA 2C9AA 5E08L 3D25B 3KYKH 3QNXA 4CDGC 1FAIH 1E4KC 2E5EA 2UY6A 3VRLF 3PNWB 1ZGLP 3FQWA 4W6YB 1RUMH 3OF6D 3TO2B 2H3NA 5I1EL 3TP4A 1YY9C 3D39A 4R9HA 1KXQE 5C6TL 4PJ9A 2L7JA 4PJ7A 5FEBA 3GFUA 4OZGE 1J05B 1F4HA 1OP3K 3OXRB 5FXCH 4JG0H 4JR9L 4JO4H 1A1NA 4K9EL 1EEYA 3UTPD 3KNBB 4KGJA 2NXZD 5IM7B 3PV6A 1S9VB 2WWMC 4DFIA 1NCTA 4OB5L 3MRQB 3QAZC 3IFPA 1DBML 2AV1B 3QJHA 4NZRH 4BFBD 2EEAA 1BF2A 5IEKA 2P5EB 3GB7A 1X5LA 4MSWA 4GO6B 1A3RL 1DQDL 3EYVA 1FN4B 3GSWA 4UQ2A 4NN7C 4TUOB 3TBYB 4UIMB 4WWKB 3BWAA 1OCWL 4XP9L 3P11L 5TQ2L 1X5IA 2VAAB 3I02A 4F7EA 5F7DB 5GS1C 1A7PH 2HH0H 4FOMA 4P57A 3V9FA 5KSBB 3MLYH 4HFWA 3IGAB 4DKFL 3LKOB 3QG6A 3RAJL 3U0PB 5HSFA 4RCAA 3RGVD 3MGAA 3EO1A 4JFYB 3S97C 4ZS6D 2BOCA 2HT4D 4MQ7B 2J5LC 3C5ZC 43C9B 3RP1A 1U36A 5DC9B 3RWCA 2OTWA 3RNKA 1CD1B 3GSXB 5AZEL 4NQXA 3SCMB 3SEPA 4XC1H 3FB8A 4ZPTB 1UA6L 4MQXD 1P7QD 2PCPB 2EIEA 2IPKA 5I8KH 1AE6H 4JKKA 2E6PA 1P6FA 4LP5A 4L3CB 5B4MD 1MIML 4XBPB 4NO0D 4D3CH 4BZ1H 4FFVD 1RU9L 1WZMA 2DQGL 1FYTA 2I25N 1OP5K 5EG6C 5JW5A 2GT9B 4GRWB 4FNLL 3P30L 4Q9BA 4OM0L 1OAZL 1RHHB 4PJDB 4HWEL 3V7MA 1HI6B 3VFTB 4PRHD 3H2WA 1P4LB 4PJ8A 3SDYH 1UFUA 1H0DB 3FB7B 2BVTA 4LSPH 1I8IA 1I7UB 2F53D 3R1GH 4OUUB 3D0LA 3QDGD 1UXWB 2WW8A 3WHE1 1IM9B 2I24N 5TE6H 4KDTC 4LLVB 5D1QB 5KSVB 1XGUA 4PJFA 1G7HB 4UB0H 5MEND 4R97B 4IRZL 1MAKA 1M7IA 5AWNH 1FL6B 5ITFB 3W9DA 2BNRB 4HGKC 4CW1A 4JFFE 3HC0A 4RIRA 4GAYA 4KV5F 3CLFH 3TPUB 3VXPB 2RFXB 2ZP0T 1SEQL 5C0JA 3BRGC 3PHSA 1RJCA 1KTDB 1FZJA 5HGDA 1WGOA 1A6AB 1PX3A 2V7HB 3PL6C 43CAB 2PR4L 1GSMA 1N0XH 2BOBB 4IMKA 3AUVA 5GRZA 5IB5A 1KIRA 1XGPA 2G60H 1O7SA 2W0FA 3O6LL 4Y4HA 5CGYD 2VDNH 3I6GA 5I2IB 3Q3GB 4JY6A 1BD2A 3S36H 3EZ8A 3I9GL 4ENED 1NCBH 1TPXB 3MBEA 3MX0A 1M7DA 3MLTB 1XCQB 3TWCL 2CKBB 5IMKA 4PJAF 3KGRA 2RR3A 2ZOLA 4MX7A 5IBLC 2R0WL 3QPXH 4O4YH 5GGVY 5FGRA 5E24E 3R4DA 3BZDA 3H9YA 1WLHA 1HKFA 4WUKH 1BIIB 3ALPA 4D2NA 2J8UF 2JJSA 1CXHA 4ZUUB 3V0WL 3KPOB 5KZCB 2OZ4H 3D18A 2B1HH 4KROD 1KTRL 1A0QL 4G80A 4EDWL 5LXGH 1P4BH 4IRJA 2J8OA 4HKJB 4MNGE 5HVHB 4Z7NF 1JYWA 3GKZA 3MCLL 5DHVA 4XXCA 1CK0H 4BUHA 3VFRB 4OLUH 1TETL 4P3WA 2DIBA 3UX9B 3JTSA 1HH9B 4P2CG 3D2UD 3C60D 1GRWA 1X4ZA 1IM3B 3RWGB 4JHAH 3GRWH 1K8IA 3BKJH 3L95B 4PRNA 1DQQA 2B1AL 4MQTB 3B6SB 4H1LG 2PYEA 5FIEA 25C8L 1ZANL 1FDLH 3KPSD 4JHWL 4I3GA 4PR5B 1F4XL 1KPRB 3BIKA 1QNZL 5IVZB 1P7HL 4C59B 4LPYA 1WZLA 3EDJA 1TZHA 3OSKA 1ZEAL 4W68A 5C6TH 2F19L 1DQJA 4NPYA 4WFEE 5JDSB 4QHNB