1Q9WB

S45-18 fab pentasaccharide bisphosphate complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
226
structure length
226
Chain Sequence
b'EVILVESGGGLVQPGGSLRLSCSTSGFTFTDYYMSWVRQPPGKALEWLGFIRNKPKGYTTEYSASVKGRFTISRDNSQSILYLQMNTLRAEDSATYYCVRDIYSFGSRDGMDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S45-18 Fab (IgG1k) light chain
publication title Germline antibody recognition of distinct carbohydrate epitopes.
pubmed doi rcsb
molecule tags Immune system
total genus 42
structure length 226
sequence length 226
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1q9wB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1q9wB01
4MDJA 2CRYA 2P5WD 5DLML 5I2IB 5HHMD 1C5BL 1IC5L 4ZPTA 4ELMA 2YSSA 3NA4A 4ZD3L 1QSFB 2R2CA 3WSQH 4N68A 3U36B 5IIEA 5LGHL 5J13C 4UTAL 2DBJA 5HGAA 3O0RH 2CK0H 4HWEL 1GGUA 4HS8H 2GTZA 4NQED 2GSGA 3B9AA 3B9EA 3OAYH 5CMAA 1YECH 4G9FA 4JPVL 3PGFH 3PP3H 4MNHB 4LOUC 1HNFA 2V5YA 1DBBH 5E2TH 4Q9QH 4LARL 1RIVL 3BDYL 3MBEB 5BVPL 1HE7A 1JPSL 1AD9A 4W6XB 1BREA 3KAAA 4PD4J 2Q6WA 3B8YA 2CKBL 3KPOB 3UCRA 5BZDB 4MYWB 5BVJB 3WLBA 3ARYA 4LMQI 4GRMB 4RAUB 3BHBA 4HAGA 5DEGB 3TZVB 4WDIA 1ZA6B 2XZQH 5F6HJ 3WSQL 1Q9KA 3O4LD 5I1DB 3G9AB 3MLZH 3P9MA 2GK2A 3QR2A 5TPWL 5J6HB 1HNGA 4PB9L 1ZS8A 1RPQA 4MA1B 3HPJA 1NFIA 4ONGH 4LP5A 3CVHB 5DRWB 4JHWH 3O0RL 1L0XA 2HP4A 3DLQR 3VRIA 4HS8L 3KYNA 5GGSA 5T5FH 3EGSA 4JFXB 1YECL 2VISA 2YXFA 2N4IA 3PGFL 3B3IA 3O81A 5IUSA 2HVKA 3QISA 1DBBL 2ZUSA 4N0CD 5E2TL 4Q9QL 4PV9A 1TZIA 1KENH 2HH0H 1FNHA 1U3HC 2EIZB 2JJUA 1BZ7B 5K9QI 2NLJB 1RD6A 2NY3B 1RHHA 2DF3A 1Z6JT 1QLFB 5SV4A 3BP7A 5EU6B 3VCLB 1LNUB 2GKIA 4LK4A 4KDTA 5CILH 5DSCA 3QNYB 4RMQA 4LPVA 2VZ1A 3MLZL 4HZAA 5DJAB 3WIHH 3C8KB 3FN3A 4LKXA 2E8YA 1TVHA 3BYTA 1P2CA 4G8IA 3FQRA 4ONGL 1I1AC 2LU3A 4U6TA 1VHPA 4JHWL 3HC3H 5F1IB 5AG8A 4J23A 1MLBB 5IQ9A 2KDGA 3WLWD 2XXMB 5J3HD 3MA9L 5KJRH 3DX8A 4M5YL 5T5FL 1AO7B 3FCTA 4HG4J 4XX1G 4P3CH 5F6HI 2DIJA 4OFDA 4V1DB 1RJCA 4PJBB 3QH3B 2IWGA 1KENL 2VXUH 1FVCA 2WP3T 4NZRH 4FFWC 1IAMA 1OB1A 3MXWH 3BPLB 3RA7H 4JLRB 2W65A 1QSFD 3JTSA 3LCYA 4I2XB 4LF3A 3OKKB 4ALAH 3E2HC 1I85A 5ISZE 4OFVA 4Q6IB 1XIWC 3T3MF 1ITCA 1TQBB 4P48A 3HHRB 3IDUA 4P99A 4M7KL 1UEMA 3QUYB 4MVBC 1BP3B 4KKLC 1KJ2B 1YC8A 4XBGB 2VL4A 4EIGB 3ZT5A 2V2XA 4HQQH 3PP4H 4AL8L 4OD2A 3S9DB 4MCZB 4KJPD 5J1TC 1HH6B 5E8NB 5CD5D 12E8H 2C3VB 3HC3L 4P49A 2GHWB 5KJRL 4P59H 3MBED 2Y23A 2NR6D 2GCYA 4PLJC 5D2LF 3CU1A 4ODVH 1OGAA 5DF0A 3CUPB 5E6ZA 4P3CL 1M6OA 1T21B 4M93C 4QYOA 2BHYA 1E6JH 3KPRA 5SX5K 1CD0A 1B0GA 2VXUL 4U0QB 3T65A 3NZ8B 3BRGC 4CMMB 4NZRL 2A74A 2Q20A 3HZYB 3MXWL 4LVNC 3TZVD 3RA7L 1LO5A 4ALAL 3QHFH 4DWHA 4LLUB 1TJHH 1CXLA 5LBSH 2GQHA 4L8SC 2CLVB 5C09B 3QEGH 3D18A 5EC2A 2ICCA 1CXEA 2Y5TB 3GHBH 2VE6B 1GVIA 5FO8B 2PXYC 4FS0A 3QIWC 4R4FH 3UBXI 4JG1H 3DETD 5KAQF 1EGJH 5H94A 5ISZA 5GPRA 4GRWF 3BT2H 5C08A 1JWMB 3SGDH 5FKAB 4HQQL 4X4ZA 3PP4L 4NN7B 3DVGA 2Z4QB 4E42A 4JN2B 4PJAF 4S0SD 2G2RA 2FZ3A 4UAOB 12E8L 4YXHH 1INQA 2G9HB 4P4KB 1HQRA 3VGDA 3SE3A 2IBBA 4P59L 4P5MB 2R15A 4XH2A 4FXGA 1H9VA 3SKOA 2NY3D 4ODVL 2XWBA 1S3KH 3GZKA 3MCLH 1MJJB 5JOFA 3B9VA 4OZGE 5EU6D 2BSSB 3OTTA 4DAGL 3RP1A 3VD5A 1U92B 3CFDA 5A43C 1A8JH 2DB8A 3TJEL 3CIQA 3ARGC 5E1HB 4HIEB 2D7QA 1SJHA 4NQSA 3QHFL 1D9KA 1TJHL 3QUXB 5DJ6A 2DJUA 2DQTH 3GHBL 4D0BA 4UU9B 3I2CH 1MAJA 2MQ0A 1S7RB 4JG1L 1C08B 1IL1B 1EGJL 3BT2L 4PREA 4EI6B 1DSFH 2R0WL 5ID1B 1AO7D 1U42A 3CVHH 1XGUA 4P23D 1LEIB 3GFUA 1QLRB 3T0WA 4YXHL 5T1LB 4ETQA 1URLA 4Y89A 5M94B 2YOCA 5BOPA 4LCYA 1R5VA 3B43A 5IKCA 2Z8RA 4U1HA 1S3KL 4JFDB 3QIUB 1M7IA 5E0QA 1KJ3H 3RJQB 2A38A 3WJJA 3OF6D 2EE6A 1YN7A 4I18A 1PY9A 2J5LB 4LNRB 3V95A 3D85B 3QUYD 4BQ9A 1KV3A 4OZGA 5KSUA 2R9HD 4Z95H 1B4JH 5CP7A 3MUJA 3V5HA 2DQTL 4OV5A 3VFTA 3IFPA 5HDQH 2EXWC 2AQ2A 2KL6A 1CFVH 3I2CL 1KLFA 1ZGLP 4ZYKA 1FZMB 1XGYL 4GRLA 3VXPB 4B5EA 4EUPG 2LABA 2A6IB 1DSFL 4QRQB 4PRBB 5HPMA 5HHOA 3RWJB 4ESKA 4ODWB 3CVHL 2NNAB 2OXGA 5GGQH 1JFQH 4Z7NF 7CGTA 4HJGB 1EX0A 2KPNA 3DI3B 4RAHA 3OKEA 5GRXG 4XBEH 4DKAA 1EO7A 1IM9B 3LPFA 4PBVC 4U1IB 3OJVC 1A4KA 1ZT1A 5F1NA 4OCLC 1KJ3L 4Q97A 1Y18A 3OV6A 2D7TH 3RWGB 4F37F 5C09D 3QUKA 3U82B 1I8IA 1OOAA 2KH2B 5FGSA 1PQZA 4X98B 4CVWA 1CVSC 2OQJB 5KOMC 3L3IA 4HUWA 4QRUB 1O7SA 4FQIH 4Z95L 3GO1H 5EWIH 4OKVB 1ZAGA 3BP6A 3RUGB 5HDQL 1CFVL 1KJ2H 1S9XA 4FMKA 1KPVB 4NPYB 5GZOD 4NO5A 3QHZH 4EN3B 4JEGB 4P4KD 4WUUD 2FIKB 1U2CA 1NCCH 4JKMA 4Y2DA 5BW7C 1HCFX 3L3JB 4OJFH 2Z93B 5GGQL 1JFQL 4TVSa 3T77B 2DQFA 1W72A 3V4PH 1GPOH 4XBEL 1X5JA 1QTYT 4WCYH 3EJYD 3WNKA 4DOHE 2FATL 4CU6A 2D31B 2X4PA 4WTZG 2HLAB 3IDMB 1OAXH 4FQXC 5AWNH 3TC9A 3H9SE 4KMTH 4H88H 4HAFA 4U3HA 3RVUD 2CR6A 1ES0A 5ESQB 2D7TL 3QUXD 4W4OC 3T4AB 3MNZA 1F58H 4Z7VB 4KV5E 1R5IA 4JZNA 5EA0H 4XZUB 3S5LB 4ZOBA 1LILA 3QDGE 5KSBE 4F7PB 1TCRB 1IGJB 4FQIL 4ZS6C 3GO1L 1DEEA 5EWIL 1D5ZA 2VR4A 3SJVE 3BWAB 5C92A 4PJIA 1BIHA 4YAQB 1XEDA 1NGXA 4LCCC 2BOBA 1T0MA 1T1XA 5DI8A 2P8MB 4XP6H 2MFNA 1ZLUK 4YJZL 4QRRE 3QHZL 5T1LD 2PTUA 3CMGA 1WFOA 2EDEA 1MIML 1FZOB 4JFDD 3QIUD 5I73B 3K74B 3FRPA 5T5NG 1UM6H 3L95B 3V4PL 1GPOL 4U2YA 4B50A 4WCYL 4WI9A 1INDH 1YN6A 1VACA 3Q0HA 2X1XR 4PIRF 3L5XH 1OAXL 3P0YH 2DLFL 5TE4L 3D85D 5AWNL 3VFPB 4KMTL 4H88L 3DX6B 4QHMB 4LMQE 1DE4A 4NZUL 4IRSA 4OV6F 1NMAH 1KTLA 4P4RA 3BZEB 1F58L 5E9DB 2HVJB 2AJUH 2A9NH 3FB8B 5EA0L 1FFRA 4M02A 5C0EB 3H9SA 4JKLA 1VEMA 4LLQB 2AQ3A 3GGWB 5IJKA 1JTTA 1S9KC 2QQQA 5INDA 1JZ3A 1N59A 1ZXQA 1PZUB 2B0SH 1A6AB 3L3HB 1NCTA 3QDGA 5KSBA 5A2KH 4XP6L 5IJVA 1KCKA 4Z77B 1G1CA 1QO3B 5EDXA 4N0YH 5JOPE 1IM9D 5IF0A 4JFFB 1WFUA 1N5AB 2VZ3A 2C7UA 2BNRB 2QLVB 5E00A 4QRRA 3NCJH 4I48A 5FM4A 4RFEB 3KDMB 1UM6L 5GS1B 1YA5A 1INDL 3BXNA 3T1WA 5IWLA 3L5XL 4LBEA 3OL2A 3P0YL 5F7WC 3UTTB 2I07A 4M8QA 1NMAL 5J12B 4GUPA 3RGVC 5E2JA 1FN4A 4OZHF 2AJUL 2A9NL 4ZFOB 2F58L 3D0LA 3OKDA 3MO1A 4OCMC 4DKEH 4HUVB 1KG0A 1G7HB 4YDVA 5IV2A 4EN3D 3V0VA 1DDHA 4XI5D 4ZUWB 2B0SL 1U91A 3MUZ1 1F6FB 2OX5A 3KYKH 5I0ZA 5EFIB 3KPQA 3V7AE 1JZ7A 1DLHB 2X9WA 1CLZH 2HLFD 1JPST 1Q9OB 2UVEA 2VLKB 2ATPB 1OP3K 2WMPA 1WTLA 3WO4C 4MNGE 1AR1C 1I8MA 4LLWA 3NCJL 1BOGB 3BP4B 1GGBH 4NT6A 4TUKH 4WV1A 3P4NA 2VXTH 4JPIB 3SGEI 1KEML 2X40A 1KIPB 1J05B 4OD1L 4WI6A 1PG7H 3FQXA 1NLBH 3O3EA 4WJ5B 4HFWA 4U1JB 3ZE1E 1NUGA 1JPGA 1FL3A 1GL4B 1ZGLB 4FQQA 4J3TA 1LK3H 2IPUK 3SQBA 3STZA 4DKEL 4NRXB 1K8DA 5HDBE 4GXVH 2LV4A 3HB3D 3RIFF 3HFMH 3MV7B 1RVFH 2BRRH 5CJXA 3U9UA 3MCG1 5BRZE 3KYKL 1A6ZB 4Y16A 3WN5C 4HLZH 5E2UL 2EDLA 4RGMC 5HYJB 3U0WH 2VWEC 3STLB 1V3MA 3G6JE 3RL2B 4XGZB 3CFJA 4YE4H 1DBAH 2F5AH 3MLXL 4X9BA 4F3FA 3DVFA 1MOEA 2EYTA 3WJJC 1JNNH 1GGBL 3HKFA 4KK8C 4TUKL 3SCMA 2YUVA 3CC5B 4HMEA 5AZ2H 2VXTL 5E9DD 5CWSA 1JUFB 3MJ8B 4MNGA 5E4EB 3F62A 2X9YA 3NGBB 5LGJA 1BJ8A 1PG7L 4HS3B 3WUWB 1NLBL 1UKTA 5C9JA 1FNSL 4BFGA 4S0TD 5B38G 3L7FB 1IQWH 1LK3L 4L1HA 1M05B 1QVOA 4TNWF 3DV4B 3QA3B 4GXVL 4P0DA 3K3QA 3HFML 4OUUB 1RVFL 2BRRL 3QIBC 3GSOA 3N9GH 3BJLA 4HGKC 4O2EA 1KBGH 3O4OC 2BNRD 4XPAH 5IVOA 4OM0L 1HQ4A 4LSTH 3U0WL 1FZJB 1E4XI 2NY0B 5BRZA 4YE4L 4D8PA 1DBAL 2F5AL 2F53A 2J8UF 1I7RB 1FFNA 2NXZB 2GSIA 3MQIA 3UTTD 3IXAA 4UILH 1JNNL 5CEXA 5IHZA 4DCQA 5DJCA 1MVFA 2UZYB 3VRJB 2LTQB 3AREC 5AZ2L 5KVFH 1X3DA 3RWCA 4IRZH 4MQXD 4PGDB 2IH3A 2W91A 3ZDZE 4RIRB 3ROOA 2NTFA 4GKNA 1T5XB 5T1KA 1AGBA 4R4BA 5JPMA 4M3KB 1CG9A 2F74A 5T3ZE 4JFOB 4QXTA 3U4BH 4AEHH 1IQWL 4QF1B 4XRCB 4IS6B 4Z0XB 1CIUA 3HUJB 1D5XA 5EUOF 1K9TA 1XF2A 2BSTA 4RMSA 5E8EA 2BNQB 1ZKAA 5F1KC 2AJ3B 3UBXA 2VLLB 5IBUB 1K4DB 4WFGE 3VG9B 3I75B 3N9GL 3HPLB 1KBGL 2CIKA 1J5OH 4YNYA 2GJ6B 1FAIH 4LGPB 5FGCB 3ARQA 5GISH 1EHXA 3EOYG 3LQZA 1KN4H 3ZTJH 1JWUB 4I77H 3PIQB 1H3GA 3VXRD 1TCMA 1V3JA 5H35A 3DUSB 1QP1A 4DZ8B 4UILL 4HDIB 4F8TA 2EYSB 4L4VA 2Y4SA 3UJJH 5GJTH 5KVFL 3G6AA 4LLYA 4IRZL 2HFEA 4N1CA 2DRUA 4ZNEE 5JW5B 25C8H 5TJWK 2K1MA 4HIIA 3O3DA 4C56E 4C54A 3U4BL 3MV7D 1A14H 4AEHL 4MD0A 2GEEA 3OQ3B 3FRUA 4F15C 2FEDC 2XTJC 4HEME 4PJ8A 2DMCA 3QDJA 3LB6D 5GGTH 5J11C 3PABB 5E6IA 5HYJD 4F7CB 3QNZB 4G8EB 4OLVH 4KXZH 2H32A 4IHOB 1YUHB 1CCZA 2J3SA 5DT1H 3PWPA 3GMQA 4JJHA 4EOWH 1J5OL 1FAIL 5GISL 1GZPB 4Y4FC 1KN4L 5CBEB 4ZFZB 1Y0LB 4HS6A 4I77L 2FIRT 1EEQA 3HI6H 5FDYA 3W11D 4U1GB 1IAOB 1WWWX 1AKJB 1I3RA 3UJJL 5GJTL 1H3TA 3PWVA 5I8EB 3MGAA 3D25A 5DJZA 4X7CC 1FVDB 2GITA 3B9KC 25C8L 5L6YH 2NW2A 5HHME 3VMNA 1JF6A 4D9LL 3CZFA 4ELMF 43C9B 3R4DA 2DMKA 4PTUB 2IAMA 1Z9OA 4ZFOL 1A14L 2X89D 3B5HA 2FWOB 4GG8A 4ERSH 5D2NC 1QSEB 1CFTB 4PRNB 4NN6C 4D3CH 4MD4B 5GGTL 1FC2D 4C56A 3TVMA 3H3BC 3WUZA 1PYWB 5HHQB 4OLVL 1IGYA 1U6AH 2NY0D 1W8OA 4HFUH 3T2OA 1GYAA 5DT1L 4P2RE 2NXZD 2FB4H 4GG6E 5CP3A 3C8HA 1UQSB 3I3BA 1CFNB 5F7EL 1BVLB 1BPVA 1MFBL 2XFXB 4YR6B 1OSZA 5JORA 2VDOH 3HI6L 5E1AB 4WO4A 3ZE2E 2IC2A 3QQNA 2AXJA 2DD8H 4DN3H 3VA2C 3DNKA 5IHUL 1H3VA 1OPGH 1ZT7A 2AJXH 2OMBA 2Q76A 1UT9A 4CN6A 3OKMA 3Q5OA 1MHPH 1DVFA 1BQHG 3V0AC 3UX9B 5F3BA 3O3AB 1U8NB 5EU4B 2BNQD 5L6YL 2C9AA 4HV8B 5HDOA 2WWKO 4H5SA 1OWWA 1MY7A 5B39A 3NFPB 3RWHA 1P7QB 4ERSL 1X5GA 3HZVA 4D3CL 5GGRB 2GJ6D 4N0RA 4WWKB 3X13A 3LKSA 3RTQC 3PDOA 3C5SA 1ED3A 1U6AL 4JGJA 4HFUL 4DVRH 2CLZB 4KVNH 1BLNB 2FB4L 1ZT4B 3CX2A 4ZQKB 3CH1B 3IDIA 4M61B 5HI5C 2Z91B 4NQEA 4P2RA 1RZJC 2OL3A 2VDOL 3IVKB 1OAKH 4X9FA 4DN3L 2FBOJ 3L6FB 2FR4A 3GI9L 1CTOA 2AJXL 4U0RC 5KSAC 3QO0A 4HKXA 4R26H 1MHPL 2BVQB 4DUXA 2DQHH 1N26A 4FG6D 1M7DA 2RFXB 3GRWH 2YUZA 1H0DB 1DUZA 1PVHA 1FFOA 4YHIB 4G7YH 5LAXB 5JZ7D 1KCVH 3VFMA 4GH7B 2AVGA 3WIHA 3MV9E 1F11A 4X80H 4J1UA 4ISVB 1P53A 1G7MB 4R3SA 1X6LA 5F44A 4DVRL 5D6DA 1B6UA 4KVNL 1P84K 2V5SA 4HGWB 4K3GA 1E27A 1P4BH 4HKBB 4YFDB 1YEDB 4NKDA 3MRDA 4NQVA 1AKJD 1G7LB 3VG0L 4YO0A 1MH5A 1MHEA 1JMZA 1RULH 3MR9B 3MRRA 4AT6A 1OAKL 4BFIB 1A0QH 3HCVB 3IDXH 1CXFA 5DHVA 3EO9H 1TTGA 3VFGH 1FNGB 5D1ZD 2Q7NA 4XCEA 3ALPA 4R26L 3SE8H 1NAMH 2DQHL 1I1YB 1QSED 2OJZH 3CCHA 3GRWL 4MHHG 4O9HH 1SVCP 4K7PH 3PHOA 2WBWB 5GRJH 5CHNA 4J3SA 3ZYOA 1D7FA 1S7WA 4G7YL 1W0VB 1KCVL 1S9YA 1HN1A 3RQ3A 5A16B 1BQUA 1P4LB 2ZJSH 4X80L 4PP1C 3HRZB 1ACZA 4KTYA 2NPLX 2VDPH 4Z7UE 3S3JA 5LKNA 5GGUB 1FRGH 1IAIM 3MNVA 4KKAC 3RVXC 2Z31A 3DXAB 5HVFB 2GUOB 1IM3A 1P4BL 4YHYB 3LKQB 4PYHA 2FECL 4PJDE 4WFEE 3PGCA 1XF5A 4YFLF 3SBWA 5A2FA 4JKPH 2I27N 1RULL 4NJ9H 2J8OA 1A0QL 1U8IA 3IDXL 1LO0H 1RIHH 3EO9L 3VFGL 4J3VA 4HHAA 4TSCH 3SE8L 1P7QD 1QFWI 1NAML 1PAMA 1IQDB 1LO3H 1G0DA 5I2IA 5DMGD 2HT2D 2OJZL 3RX5A 4WWKD 1UGNA 4O9HL 3TCXA 1DLFL 4K94H 1QSFA 5GRJL 2WZPD 5C0BE 3U36A 1V05A 1EGJA 3HNVH 4LLMB 4APQD 4I13B 4S1QH 2ZJSL 3EYUH 2UWEB 4HK0B 2IBGA 4HCRA 2EE2A 2VDPL 4CJ0A 5SWZB 1FRGL 3ZKND 3T2NH 4DVBB 1U8OB 2Y36H 3RBGA 1YJDL 3DI2B 4CVXB 4MNHA 1RIUH 3KPLB 4JKPL 4HPYH 4KRPB 3MBEA 4GRWB 4FTVB 4LIQH 4XBPA 1LO0L 1RIHL 1C5CH 4YHPB 4PJDA 2MHAB 3S37H 3TT1H 3ZL4L 3KPOA 4PJAB 5I16B 4TSCL 5BZDA 1KXQE 5E6IC 5J89A 4XWOC 1DQMH 4GRMA 2FHCA 3LIZH 5DEGA 3TZVA 3V52H 1G7QB 1ZA6A 4K94L 1LE9A 3PDDA 1FG9C 3ISWA 4OF7A 5I1DA 4ZOAA 3TO4B 3CU7A 5ANME 3HNVL 3V6BR 4U6VH 2WV3A 1AO7E 3SKNB 4S1QL 3UTZB 3EYUL 3CVHA 5DRWA 1OTUC 1EFQA 1B0RB 4V1DE 5HVWA 5EUKA 3MRCA 4PJBE 2IBZY 4N90E 3DROB 4JFXA 3T2NL 2J2ZA 2Y36L 2XQYG 5IR1B 3JV5A 3WNMA 2XY2A 1RUMH 2EICA 1OQXA 1RIUL 4RGNE 1Z0MA 4I2XE 5AZEH 3ZT6A 3IT8D 4NQDE 4QNPE 1W2KT 1D3CA 4HPYL 2ADGB 1MFAH 4WHYH 2EIZA 4OKDA 1BZ7A 3E1F1 2ICWB 2NLJA 3B83A 4LIQL 4CW1B 1C5CL 2CSPA 4OZGF 1QLFA 3SDCC 3F7PC 3TT1L 4IIQC 4MNQB 5EU6A 3VCLA 5F6IB 1LO4H 1LNUA 4Y4KC 2DAVA 1RK0B 1D5IL 2M2DA 2W0LA 3V6FB 4YDLC 1DQML 5A3IC 3LIZL 3V52L 1A2YB 1V5JA 4ETYA 2JLLA 4PPTA 4NO0B 5DJAA 2GY7B 3JVGC 3C8KA 4BSWA 4RFNB 3DXAD 4U6VL 3LQAH 1BGXH 3GBNL 1U8HB 3RDTB 5F1IA 1MLBA 1AO7A 1X6NA 4LDEB 4H1LH 5MI0B 2Y6SC 1U58B 4V1DA 1RUML 4PJBA 5GZND 2W0PA 3QH3A 1EFXB 4I0PC 1QBMH 5BQ7B 3CDYA 1MFAL 4EQ3A 4JM2F 3GMRB 2NZ9C 3VMPA 5T3XE 3QUZC 4JLRA 2IQAB 4I2XA 4YLQT 3OF6A 2NX5E 4Q6IA 1NGWB 4KJWC 1N5YH 4K7PY 4R4NC 5IP4A 4ZPVB 5E94B 3X12B 3QUYA 3RWIB 5DEZA 1TLKA 1KJ2A 4LP4A 4K2UH 5SWZD 4UQ3B 1NCDH 1WISA 3LEYH 4U4BA 4YWGH 4MCZA 3LQAL 4FQHA 3Q2CA 4GKSB 2RHEA 1HH6A 5E8NA 5D7LB 2BY0A 2C3VA 4Y5YB 1RU9H 1XGQB 1Y6NR 2QADC 5HGGS 4L3EB 2P5EB 4HWZB 4KRPD 4FTVD 3C60C 4G6JH 3CUPA 4X7SH 3T3PE 2VH5H 5E70A 4G42A 3U7WH 1HHJB 2DLEA 1QBML 4CMMA 5C9KA 1GGTA 1JGDB 3PP3K 4NDMB 1MCBA 3HZYA 1T2QH 5SWSB 2X4TB 3K0WA 5IBLD 3P9LA 1UADC 3PJSB 1NCAH 4R7NB 2WIIB 4LLUA 5C0GA 3FTGB 3TO4D 3LDBB 1N5YL 2CLVA 5C09A 2MTPA 2Y5TA 4QY8B 2VE6A 4OSUH 4U1LB 4DUWA 5FO8A 4L9LA 2DM7A 2QEJA 5CSBA 3VGGA 3DMMB 3HG1B 5L2JA 1UZ6E 4K2UL 1JWMA 1QUNA 3UAJD 5FKAA 1NCDL 4YWGL 1I8LA 5C2UB 2Z4QA 2A6KB 5C0CE 3VXUE 2NW3B 4JN2A 1A6UH 4N9GB 3OSKA 4EUPB 1RU9L 2G9HA 3MLSH 1C5DB 2EC9U 4P4KA 4WENB 5IEHA 3SO5A 1NBZB 3HZMB 4P5MA 1U2HA 3VE0B 4G6JL 3D9AH 1I3UA 4NKOB 2P49B 1MJJA 1JHLH 2J6EA 4X7SL 4MNQD 4GRWH 2BSSA 3U7WL 3KGRA 3T0DA 1U92A 2AV7B 2XWTB 1T2QL 4G6KH 1BBDH 3P4OB 4HIEA 4NKIH 1NCAL 3QUXA 4NO0D 5ITFB 3UEZA 1AGDB 2ICEA 4KV5F 5IMKB 4LHUG 3ROLB 1EHNA 1OARH 4OSUL 5LWYH 5KSBF 5GGRY 1S7RA 4W68A 1C08A 1IL1A 3N85H 3RDTD 3CX5J 2A77H 4EI6A 5ID1A 4MA7H 3MRKA 1UENA 1LEIA 2H26B 1A6UL 1QLRA 2WBJC 5T1LA 2UV3A 1EFXD 2UZIH 4OLXH 2BFVH 4AEFA 2PTTB 2D7PA 3D9AL 4JFDA 2XQBH 3QIUA 3VMOA 1JHLL 3PL6C 3MXVH 3WS3B 2HFFB 1SQ2N 4LPCA 3GSVB 3V7AG 4HUUB 5C6TH 2RQ8A 3I6GB 4G6KL 4LNRA 5IHLB 3BJ91 1CYGA 2X1OA 3MJGX 2FX9H 4NKIL 1ZLWH 1CVRA 1UJ3A 4KROC 4IMLB 2BJMH 1OARL 5LWYL 1U3JA 3DIFA 4PR5B 1FZMA 1HSAB 5D7LD 4IJ3C 3N85L 3VXPA 1BIIA 2A77L 4HSQA 4L3ED 1OVZA 2A6IA 2P5ED 4N8PA 3MRBB 4QRQA 4MA7L 2Y72A 4C4KO 3LRSA 4Z6AT 2NNAA 3BD3A 5HYSG 3WS6C 3S35H 4JG0H 3ZHDA 4OZHB 4HJGA 1T2XA 3I02A 4HUMB 3KNBB 4OLXL 2UZIL 4YC2C 1IM9A 2BFVL 4X6BB 5GRVL 4RNRB 3BEWB 4Y4HB 3WFEH 4LSVH 5SWSD 5FF6B 3N0PB 5K9KB 3MXVL 4UIMB 5FYKH 3KS0J 3RWGA 3EDDA 2CRZA 2DQEH 5C6TL 3H7BB 1A4JB 1AY1H 4X98A 3GMLB 5DQJB 2OQJA 1OAQL 4QRUA 2FX9L 4PJ9B 3DMMD 3HG1D 3T0EC 4L9DA 3UZEA 3TBSB 2FNBA 3BEVB 3NCEB 2BJML 3DETC 4Y5VA 3RUGA 4WVRA 5BJTB 1MLCB 3DTXB 1BM3H 5CEZE 3A67L 1KPVA 4X4YB 4NPYA 5GRZA 4LKCB 5IMLB 5KVGH 2D7MA 4EN3A 2YC1B 5JXEC 2FIKA 4E41E 1OLZA 1VADB 4HJ0D 5B8CC 3S35L 3GMNB 4JG0L 5ITBH 4MLIA 4K71B 1BQLH 3GUTA 3T77A 1T66D 5EU5B 1GC1H 2XTJE 3AS1A 4ZUSB 1GRWA 3QCTH 5JPNB 2ESVB 3QDME 5I30H 5KTEH 2D31A 2HLAA 3IDMA 4LSVL 3WFEL 4MJ6B 4LSUH 2EIDA 1GOGA 4QO1A 3FL7A 1QSVA 1WBZA 5FYKL 5ESQA 1JF5A 3T4AA 1VFAA 2HTLC 2DQEL 5F7NC 1AC0A 3AB0B 5EB9A 1H3XA 3MRFB 4Z7VA 1EMTH 3UYOD 3ESUF 1AY1L 1QKZH 4XZUA 2DKSA 4S10A 2EKJA 5HYQB 5C3LD 3ZE1F 4H8WH 1MHCB 2AK1H 1TCRA 1IGJA 3D39B 3CDGB 3BWAA 4YAQA 3IDNA 5GRUH 4JFFE 5HDBF 4MX7B 3MRLA 4XCYB 3WFHB 2NZIA 2P8MA 2QJDA 3HI5H 5KVGL 3TNMB 4P23C 4QCIB 4NRYB 2OZ4H 4MAYB 5ITBL 5F9AC 2VN4A 1GC1L 4Y0GA 5D2NE 3RX8A 3G6JF 3X14B 1RSFA 3L95A 3QCTL 3BPLC 5D93B 5I30L 3RWEB 5KTEL 1II4E 3LPWA 4NUGH 4LSUL 3VFPA 3DX6A 4QHMA 3SO3B 4LAQH 1H5BC 4K55A 3BZEA 3QUYC 1QHOA 4WEMB 4PRIB 5E9DA 1EMTL 3ALWA 2HVJA 1XF1A 3FB8A 5C0EA 4X99B 2J8UB 4LLQA 5DFVD 4H8WL 3F6LA 4X4ME 2AK1L 1T7XA 3GGWA 3HZKB 1A6AA 5GRUL 3L3HA 2VLKE 2GJZA 4N8VG 4HLJA 2XG4A 3HI5L 2XN9B 1BFSA 3LZFH 4XTRD 2OZ4L 3QFJB 1MRCH 4JFFA 1N5AA 1RZIB 4Y4HD 2AEIT 2BNRA 5B21A 4RA3A 5D9SB 5EUOB 3RIAK 3KDMA 5GS1A 4PRPB 2I25N 5I71B 3W5NA 3AY4C 4FABH 5DXWA 5IGXL 4DK3A 5DC4B 3UTTA 2H9GA 2JJSC 1OAYH 1UWEH 3VGFA 1KGCE 4LAQL 1JGUH 4PJ9D 5DQ9B 3TN0A 3MV7E 4NYLB 3ZDZF 5D7JB 2B5IB 3CAFA 3MOQA 4DGVH 4ZFOA 1BQSA 1SEBB 2ATKB 4HUVA 1G7HA 3F8UB 5GGTA 5B38B 5DGRA 1PSKH 4XT1C 4ZUWA 5GZOC 1QLEH 1FSKB 3EDJA 3VRLE 2ICWJ 5FM5O 4AMKH 1HEZB 2R1XB 1C16A 5EFIA 3TO2B 2X4QB 1DLHA 3MUY1 3EO0A 2ESVD 3P9WB 1J1OH 1EH9A 1Q9OA 1MRCL 2VLKA 2ATPA 2YA0A 5C0DB 2X05A 4F7MB 4UDTB 1RZFH 2R8SH 3O6FB 1BOGA 1QBLH 3BP4A 1F45A 2R56H 3BZFB 3BVNB 1B9ZA 1W8NA 2CJUH 1CL7I 3VFVB 4FABL 5IB4B 4GKZB 3VXMB 1KIPA 3RVUC 1J05A 1GGIH 2CUHA 4LDLB 1OAYL 4D0CB 2OSLA 1JGUL 4WJ5A 1RZ7H 4OD3H 1IGMH 4U1JA 3D39D 5CSZB 1S7VA 4CGTA 1ZGLA 2PW2B 1KIQB 5F96H 4M6NH 4DGVL 1LHZA 1EEUA 4NRXA 4OIBA 3QEQB 1SY6H 3K8KA 3MV7A 3EDEA 1PSKL 4LSSH 1QLEL 4U3CA 4MAYD 1A6ZA 4AMKL 2FJHB 1RI8A 3VFUB 5HYJA 3G9VA 4ELMB 3RL2A 3QQ9D 1AGFB 4A6YA 2YKLH 3FZUD 2R8SL 3RI5K 2R56L 3HAEG 3CC5A 2CJUL 4CU7A 3ILQD 4PRID 2QSCH 5C71A 1JUFA 3WIFA 3MJ8A 3ZDYE 3L3OB 4UINH 2GSGB 1GGIL 2HT4C 3HUJE 5C70A 4OCXL 5CMAB 4P9ML 3V7MA 4HS3A 3WUWA 1RZ7L 4OD3L 2HG5B 1FNFA 3QP3A 3L7FA 5F96L 1M05A 4M6NL 3GI8H 4HH9B 3IGAB 1BZ9B 1MCKA 2N56A 4D9QD 2ZUQC 3DV4A 3QA3A 5FIEA 5DK0B 1AD9B 1SY6L 1QFHA 4CRPA 2XN9D 4OUUA 2X89A 1NDGB 4LSSL 3QFJD 4HIJB 2BOCB 2HJFB 2V9RA 4R2GC 3MRIB 3WLBB 3LKOB 1JI2A 3VU2A 5FOBB 3JWOH 4CN4A 3NIGE 1FZJA 2VJXA 5JR1H 5LQBH 3AROA 4FZEH 1J87A 4GG6F 3VWJA 1I7RA 2XACC 1GGCH 1HHKB 1CD8A 1FYTB 1GOHA 1DTUA 2YKLL 1YEGL 2H1PH 3HPJB 4M1CC 3VRJA 5I75C 1L4IA 1I1CA 2QSCL 3ZE2F 2PUQT 1N4XL 5D7JD 1OW0A 5C0AB 5EOTB 4PGDA 5DURB 5DZOA 1PBYA 4RIRA 4Q9CA 5GGVY 3EGSB 4YIQB 5C1MB 4JFOA 3TJHD 5AD0B 2IG2H 2CLRB 1JF1B 4MMZC 4NRZB 2ARJB 2HVKB 4QF1A 1UXWB 4IS6A 4XRCA 4Z0XA 3HUJA 1NL0H 2Y25A 4EN3C 1TZIB 4YBLB 4NC2B 2BNQA 1EUUA 1G6RA 3C6LC 2AJ3A 1T4KB 4XI5C 2VLLA 1K4DA 3PGDB 1P9MA 1RHHB 1XMWA 3EYQC 2MCG1 1MVUA 1U8QB 3I75A 4G80B 3IDYB 3HPLA 5FO9B 4ZAKC 2DWDB 2GJ6A 3O6FD 2HLFC 3JWOL 4PYGA 5DSCB 5JR1L 5LQBL 1JWUA 2B2XH 3PIQA 4X7TB 2WP3O 4FZEL 5DEFB 3VXMD 1GGCL 2FRGP 4DZ8A 3WKMH 1TVHB 3LRGA 4HXBL 2H1PL 4HDIA 5KVMC 2EYSA 2ED7A 1BFTA 3QAZB 4MB5A 5L8KB 3CSGA 3GIVB 4LFHG 2GJJA 5FHBH 3DX8B 4RFOH 5JW5A 2V9QA 1ITBB 1HSBA 1A3RH 3VJ6B 1NQBA 1QSEE 4BA8A 3QFDA 3QEQD 1UWXH 1JNHA 3O6MH 1JPTH 1XH3A 1SBSH 2IG2L 1BQHB 3EYFB 2VB5A 3L3KB 4MJIE 5IOPB 1NL0L 3HB3C 2XZZA 4M62H 4U6XB 2N1KA 3FOMB 3PABA 3QWRA 4E5XB 4F7CA 3QNZA 4M7ZC 4MS8D 4IHOA 5I73C 1YUHA 3C9NB 3FT3B 5MHSD 1NFKA 1PJ9A 1KTKE 4AIXA 1MJUL 3EOAB 1GZPA 3IS1X 5CBEA 4ZFZA 1Y0LA 3RZCC 1WWAX 1ZANL 2B2XL 3TLRA 2EZ0C 5I0DA 5FV2A 3WKML 1IAOA 3QWQB 1ORSB 5BZWB 3VI4E 2WLYA 1AKJA 4WGWB 3A0OA 2XXCB 1JJUA 1WTGT 3BGFB 32C2A 3AS2A 5FHBL 5ID0A 1A3RL 3I6LE 5F8QC 43C9A 4PTUA 1JPTL 1SBSL 3TBYB 2FWOA 1CT8B 4QYOB 3REWB 4TVPE 1UZ8B 2QHRL 4M62L 1QSEA 1CFTA 4PRNA 3ZZ1A 4MD4A 3SDAB 2A74B 1NKRA 1PYWA 2VDNH 4GKOA 1LO5B 4JHBA 3BQUB 2ZCKH 2FYYA 4Z18A 1JRHL 1VPOH 1X5HA 4LLAA 1UQSA 2FHFA 1BOYA 4Z7UF 2QV2A 3B2VH 4LEOB 2XFXA 4MSWB 4YR6A 3WHXB 4DZBB 1IZKA 5ISZB 4OI8A 5C0AD 5DURD 3CLEH 4HPOH 5J12C 4PJDF 1CTNA 1QD0A 4MQXC 4B7IA 1MAML 1T7WA 3LMJH 1TTUA 4UB0H 4OCRH 4AG4H 1SYSA 1U8NA 1IBGH 3O3AA 5EU4A 3MJ9H 4HV8A 2Z8VC 3L5IA 3FO1B 1B3JA 1NC4A 2APWA 3NFPA 3JSSA 3RWFA 3GMOB 1OT2A 5IB3B 2K7PA 5GGRA 1F02I 1X4ZA 3EYVB 3CFDB 4WWKA 5A1AA 3NCYP 2RJMA 2Q86B 2VDNL 5HSFA 3KXFE 4LQFH 4NQSB 2CLZA 5EU7C 2ZCKL 1P7HL 1VPOL 5C0NC 4QT5A 4N1EA 1JPFB 3UDWC 3H7LA 4HULB 2VXVH 1CF8H 4ZQKA 4B41A 3CH1A 4D0BB 4M61A 2ZUWA 1OGTB 3ZKMD 4YHNB 1Q9WB 2Z91A 4ODSH 4KUZH 5I1IH 2DQJH 3IVKA 4FN0A 1NEZB 3CLEL 4HPOL 3GEWB 4YHOL 3L6FA 3EO1A 5SX4I 1YDPB 5I19H 3LMJL 2BVQA 4RAVB 1CU4H 4XPFH 4ETQB 4OCRL 4AG4L 4JFZH 3BIBX 1IBGL 1R5VB 3MJ9L 4JQXA 5IKCB 4GSDH 1H0DA 1WAAE 3LB6C 3MV8E 4JANB 4YHIA 2DLGA 5LAXA 4FQJH 2OI9B 1SVZA 2H6PA 3DXAE 4QHLB 5L8LB 1N8ZB 1G7MA 3OB0H 1F4WH 5HD8D 1NH6A 1QA9A 4LQFL 1FNAA 5CZKA 2IPUG 1IKNA 4HGWA 3O8XB 4KJQD 5CP7B 3QPQD 4HKBA 4JAMB 2VXVL 1CF8L 1I7TB 3IFPB 1YEDA 4CMHB 1VENA 4LPXA 5TDPB 1G7LA 1L7TH 5IW3A 4PJBF 1LMKA 4ODSL 8CGTA 4GRLB 4KUZL 4ZFGH 1OP9A 3K80A 5I1IL 2DQJL 3MR9A 1RUQH 4BFIA 4OBRA 3HCVA 3X3FL 1JI1A 5F71A 5HXMA 3N1FC 4M9OA 4QNPF 3O9WC 2A9MH 5I19L 4OZIE 1FFPB 5TQ2H 1J0HA 5HY9B 1CU4L 4JFZL 2AI0H 1KFAH 3LVEA 3SDAD 3DYOA 4WW2B 4GSDL 3IFLH 3RPKA 3K2MC 2UWEE 1ZT1B 3GBLA 1MCNA 5EBWB 4AH2B 1OCWH 2LU7A 3WCYA 3U7YH 1W0VA 3FB6B 3DX7B 3PWLB 4FQJL 1ODAA 5A16A 1I8IB 1P4LA 5D1QB 3HRZA 4JM2B 5F88B 1WAAA 4UDUB 1F4WL 2NXZC 5HJ3B 1KN2H 1DP0A 3MV8A 4P5TB 3JBG7 1A7RH 3AMKA 5GGUA 3WO3B 4KGJA 5ISZD 3I50H 4I3GA 3BISA 3UXFA 1CICA 2LTQC 3DXAA 2GUOA 3WMSA 3LKQA 1D5BB 4D9RD 3C6SB 5D5MB 5ICZB 1JYNA 2VDLH 1U8MB 4ZFGL 1HI6B 4NO5B 2OS7A 1I4FB 1RUQL 5JNYB 1Z3GH 3LD8B 5I1KH 3UYRH 3ARFC 2E7BA 2JB5H 5TQ2L 2DQFB 4X4XB 1IQDA 1NGQH 5F7HA 2P42B 4PV8B 2AI0L 2EEBA 1KFAL 4N8CH 4TTDD 3EFDH 2BNUB 4PY7B 2X4PB 3IFLL 2VR5A 1BVKB 1X7QB 4GAFB 4ZO7A 2ZSWB 1OCWL 3U7YL 1IARB 4LLMA 3AMLA 5KZCB 2PO6B 1R5IB 3W9DB 4JZNB 4KK6C 2UWEA 4KZDL 4HK0A 4JY4A 5EULV 2ORBH 2E9WA 3UPRB 1A7RL 5SWZA 2APVA 3I50L 4JCLA 4F9LA 3A6OA 3AM8C 3T0EE 4DVBA 2D9CA 1U8OA 3NIFE 4CVXA 3DARA 2BY1A 1PEZA 3MJ6A 4NHUA 2Q8BH 3KPLA 1NBYB 4UNUA 1NBVH 3GJFB 2P8PB 1Z3GL 4FTVA 5I1KL 4X9GA 3UYRL 3M1BB 4YHPA 4ODTH 3T3PF 2MHAA 5E99H 3LQMA 5I16A 3ORJA 3ARBA 6CGTA 4F58H 5TGBB 1CZ8H 1NGQL 3FFDB 5HDLA 5I17B 2FH8A 4MAUH 1YN6B 4N8CL 5K33A 4YZFE 3EFDL 1G7QA 4A2MA 1TQCB 3ES6B 4BFBD 4GAJH 1NFDE 4HJJH 3NN8B 3TO4A 2VAAB 1YJDC 4HC1H 5I1LB 2VLMD 4DOHB 3SKNA 2MPAH 3UTZA 4U7KA 2W0KA 2E7MA 3H9SB 5HYIA 1B0RA 1UZ6F 2ORBL 4P2QB 4YXLH 4GRLD 1VFUA 3THMH 3DROA 2ADJB 2EDXA 1AXSB 5IR1A 3S4SG 4J4PD 5DD3H 4KK5D 1ND0B 2Q8BL 3QDGB 1IEHA 2OR9H 5ICXB 3EKCA 1NBVL 1F4XH 3MMEB 5D1ZC 5L2KE 1KLGB 2ADGA 3SJVB 1A7QL 2Y06H 2ICWA 1KXTB 3GB7B 5DHYB 4P46C 4CW1A 2LVEA 4ODTL 4K94C 3LPGA 5I6XB 5E99L 3RKDD 5E00B 4QRRB 2XOTA 1RK0A 4F58L 2X1PA 3D48R 4JFPB 3MX0A 1LQSR 3V6FA 4MAUL 2ID5A 4FFYH 1HHIB 3CFKB 5D1QD 3EAKA 1A2YA 4JM2D 4G43B 2A1WH 3O2VH 4NO0A 4GAJL 5SV3A 4HJJL 4Q6YA 4P2OB 4HC1L 2MPAL 2YZ1A 3RDTA 3CDCA 1KG0B 1RK1B 2VKXA 4YXLL 1YYMH 3WYRA 5GSRB 5FHAH 3THML 1LK2B 1P7KB 4JRYE 5DD3L 5I1JL 4XNYH 3K8MA 4IRJB 4LU5H 2YD8A 2B39A 1S7TB 3PE9A 1F4XL 5BQ7A 3QXAB 2Y06L 3MLWH 3LEXB 3TV3H 1T20B 4JO2H 4JFYB 1LO2H 2QQLH 1JHKH 5D71H 5GRYA 2IQAA 4LLWB 5DMGC 2VERN 3S7GA 2VQTA 4WV1B 4WWKC 1NGWA 1NANI 2O93L 1Q0YH 3KLHC 5KZCD 2PO6D 4ZPVA 5E94A 2H2SD 1MCEA 3X12A 4FFYL 2R0LH 2A1WL 4QRPB 4APQC 3FRPG 2OCFD 3QI9B 3DRTB 1M71B 2EDWA 4GKSA 5K93A 3ZKNC 1EJOH 5TF1H 5D7LA 5CZXD 4Y5YA 1K8DB 1U3ZA 1G9NH 1G7PB 2AJYH 3TYGL 1YYML 1XGQA 4L3EA 2P5EA 5C0IB 5FHAL 4HWZA 1ZA3B 3I3EA 1RJLB 3BGMB 5HHPB 2DI7A 3T0VA 3R8BB 5JDSB 1YZZA 4OF3A 1QR1B 4XNYL 1LEGB 4LU5L 1AGCB 4JQXC 2L7UA 1FP5A 4NDMA 1JGDA 4JRYA 3TV3L 2ZUYA 1R3KB 3BD4A 4JO2L 2X4TA 2QQLL 1JHKL 5D71L 1F3JA 3PJSA 4PG2A 3MTRA 1X5IA 1FO0B 2WIIA 3FTGA 3SCMB 3LQAC 1O5DT 2FJGB 4QY8A 4U1LA 3L9RA 4U1NA 4U1SB 1N0XH 3H9SD 2R0LL 5F72S 2A6JB 3WJLC 3HG1A 4POUB 1VERA 1HHGB 1X5KA 3PQYB 2A6KA 2NW3A 3RY6A 1EJOL 5TF1L 4AJ0A 1LEKB 4EUPA 3QDGD 1C5DA 2AJYL 1U8LB 2BVTA 1NBZA 5HYSB 3HZMA 3SJVD 1J1XH 5F7UA 2XA8H 3VE0A 4QOKE 1M7XA 3VFOB 4LLDB 1F4AA 5GXBB 4QRRD 1HYSD 4MXWH 4FXLA 1OAUH 5GIRB 1AI1L 4Z7WE 2AV7A 5TE7H 4CNIB 4XPHH 4FNLH 5IEKB 3JWDH 3P4OA 4NFBA 1W72L 3IXAB 2VL5B 5CEXB 3FMGH 1X4YA 3VD3A 5CGYC 5ITFA 1AGDA 3G6JB 5IMKA 2D7NA 5JIKA 1RJYB 1BEYH 2CXGA 1N0XL 4XXDB 2NTFB 2APXA 5T1KB 3SPVB 3BPNB 1AGBB 1KTDB 2PW1B 4QXTB 1EERB 2E5EA 3FO9B 4A2LA 5BS0B 4R0LC 1L9NA 4IMKC 1XF2B 2BSTB 1HHHB 3OG6B 4IRJD 3UBXB 2X10A 3M07A 4YBQD 5MEPB 2PNDA 3NVQA 2PTTA 1J1XL 2XA8L 4XMKL 3QCVH 3DURA 3DV6B 5JA9A 3WDHA 1XGRB 4YNYB 3WS3A 2HFFA 4MXWL 1OAUL 1NUDA 4BH7B 3GSVA 3LQZB 2YZ8A 1IFHH 3IJHB 2WIMA 4XPBH 4WTZA 1AR2A 3DYMA 5TE7L 2B1HH 3GNMH 5IVXE 1IGCH 2NQCA 4FNLL 5H35B 3JWDL 2IF7A 3S97C 1KYOK 3FMGL 4E0RB 3QI9D 5IMMB 1Z0NA 3PG2A 3CPLB 2PYEB 1GXEA 4IMLA 2R0ZL 3L7EB 3BKJH 3LH2H 3FN0H 5IFJB 1BEYL 1HSAA 1T83A 2X4NB 4I3RL 5KN5B 3FQWB 3MRBA 2DM2A 4OZHA 2Q7YB 2CDGA 5DYOB 4PJ8B 4I0CC 4KHTH 4N5ED 1QFOA 4ZUTB 1E4WH 3KNBA 3SGJC 4X6BA 3PV7A 3KR3H 3BPOC 3DGCR 3BEWA 4Y4HA 3QCVL 5FF6A 4XHQA 2EDHA 4M7JH 5K9KA 3I85A 1GCFA 4UIMA 3WNPA 4Z78B 1IFHL 2P48B 3SCMD 4DGYH 4XPBL 5IBLC 3U30C 3H7BA 1A4JA 4C57C 2B1HL 3GNML 3GMLA 1IGCL 4N1HB 4YQXH 5DQJA 3VFRB 4C4KT 5DRZB 3EYSH 4PJ9A 4IDJH 4JHAL 1WBXB 3TBSA 2J8HA 1A1MB 1I3RB 3BEVA 3W9EB 5FECA 1VESA 1UA6H 4J2XA 3BKJL 4MHHI 3LH2L 5BJTA 1MLCA 3DTXA 2CO6B 5DJZB 2BMKB 2VDKH 5C07E 4X4YA 5IMLA 4LKCA 1ZLSH 2GY5A 4WTXA 3CZFB 1YMHB 3VRLF 4N8VB 1JE6A 1VADA 1JBJA 4EI5A 3GMNA 4ZTOH 2CO7B 4UNVA 4Z5RA 3F5WB 5D6CB 2X4OB 3OR7B 5EU5A 4KHTL 4C56B 3TVMB 1E4WL 1TZGH 5JPNA 2AEPH 4DQOH 4K3JH 5EO9B 2ESVA 1OTSD 3KR3L 1MHHA 3U0TB 4GS7C 3MREB 1VGKB 2QKIB 2XYCA 4M7JL 1QYGL 1GAFH 1YPZB 1U3HB 1DJSA 3G08B 4P3DB 4KC3B 1BJ1J 4DGYL 3REVB 2YPLB 4OZFG 4YQXL 5HYQA 4RFNC 1MHCA 5T1KD 3EYSL 1CE6B 4IDJL 4WEBH 5DS8A 1IAII 3CDGA 3FN9A 1ZT7B 3DVNB 4DTGH 1JZ4A 4OF8A 1EEYB 4BUGA 5BS0D 4X8JA 1TJGH 1UA6L 3OKMB 2I5YH 3CFCH 1TNNA 2KQMA 3QFJE 4XCYA 3UTSE 3E6FB 3WFHA 5F3BB 3T1FB 4PBWD 1WEJH 1LDPH 1ZLSL 1CBVH 1U95B 4X6FB 3JWNC 4QCIA 4NRYA 1BMGA 1I1AB 1N64H 4FFVD 4AK1A 4PRPE 4F2MB 4GW1B 4L1DA 2JK5B 4MD5A 5JHDE 4K9EH 4ZTOL 3FHQA 1A6WH 3X14A 1TZGL 1EPFA 2AEPL 4DQOL 3L5HA 1KB5A 3IRPX 4K3JL 1CDJA 1UH3A 3LAFA 3RWEA 3GJEB 2EDKA 2Y7QA 3RZWA 5C2BH 1P4IH 1CGSH 3BDXA 1GAFL 1A9EB 5GRVK 1WT5C 4PGBB 2UY7A 1MQ8A 2FGWH 3E6HA 3NPSC 5B3NA 3ZDYF 2PYED 4XP9H 4PRIA 2OR8A 3HUJF 5DGQA 1IILE 4P2RB 2W60B 1NAKH 4X99A 4GG6B 1ZHKA 2J8UA 3ZHLA 1J0KA 1XIWB 4WEBL 1AQKH 1YMME 5IFHH 4DTGL 2ZUTA 3MRMB 5EOQH 3FAWA 3HZKA 5BMFH 1TJGL 1T1ZB 2I5YL 1VGEH 1ZLWK 1GC1C 1M7DB 4PJ8D 1WEJL 1LDPL 2XKNB 5L8JB 5T3ZD 2XN9A 1DQDH 1F90L 1N64L 2N7AA 3B4NA 3QFJA 5F7YC 2M8XA 4Y2OA 3IKCB 1LD9B 2HMID 4LOUD 5DJ2B 1RZIA 1Z9MA 4TTGA 3UTSA 4K9EL 3BPCB 3I6KA 1K85A 3ALXA 5D9SA 5EUOA 1OL0A 3NIGF 4EBQH 1A6WL 1F11B 4KU1A 5EH1A 4PRPA 4WFGD 3C5ZB 3PV6B 3RL1B 4M93B 5JW3H 3HAEB 5LVEA 2XA3A 5C2BL 1E27B 1P4IL 3L1OH 5DQ9A 3IAPA 3L3DB 3QEQE 1YC7A 4NKDB 4NQVB 4XHJC 4XP9L 3Q48A 4ZSOE 1KJVB 1CXKA 5D7JA 1HYRC 1MH5B 3ULUE 3DMMC 4P57B 1NAKL 1SEBA 2ATKA 3MRRB 2JJTA 1TPXC 4L8SB 1AQKL 1YEHH 5B38A 2YEZB 4L8DB 1ULVA 5IFHL 1W0YT 2NY4C 2PXYB 3OAUH 3QIWB 5EOQL 3RY6C 2LAGB 4XCEB 2WLZA 4LLVB 1UEYA 2IAMD 5BMFL 2VZUA 3H9ZA 4NWTH 1VGEL 1R3IH 1S7SB 5MHSE 1WSST 5D7IE 2G5RA 2R1XA 2HFTA 1Q94B 3GDBA 1YMMA 4HJ0C 3TO2A 4C56D 4HIHB 3TVMD 2X4QA 4Y8AA 3BYYA 4PY8J 1FLRL 1DQDL 3W5MA 1BZQK 4KI5E 3M17B 3HR5B 1MCFA 4F7MA 3Q6FB 2R1WA 4UDTA 5T3ZH 2VMFA 3O6FA 3BZFA 3Q1SH 4EBQL 3BVNA 1U3HD 4JE4B 3VFVA 5IB4A 2IPTL 4GKZA 3VXMA 1A7BA 2YPLD 5JW3L 3MNVB 3KYOB 3ARZA 2BCKB 2Z31B 3MV9B 3L1OL 4D0CA 3FONB 4RWYH 5CSZA 5IW1B 2JJWA 1VFOA 3AU1A 5B3JE 3ARGB 2PW2A 3VGEA 1KIQA 1XF5B 1YNTB 3WV0A 1FL5A 4X6DE 5EZOL 2WSKA 3QQ4B 3QEQA 4L8BB 1YEHL 3CH8A 4KUCF 1I1AD 1BFVH 1SM3H 3C2SA 3W39B 1S9WB 1A02N 1LGVA 5I9QB 3NABH 1R3IL 1IGIH 5DZNA 1T6VN 3BZDA 1FYTE 5DVLA 1Q9LB 5IBTH 3V6OC 2FJHA 3VFUA 3EBAA 3PUCA 3PF2A 3R0NA 4U1MB 4IOSD 2XRAL 1AGFA 2R29H 1INEL 1ZLVH 1B90A 5C0AE 1JNLH 3BMVA 2QQKH 3Q1SL 3AC0A 2FH6A 4FFWD 2FEEI 3TH3T 3RNQB 4XXCA 1KOAA 3P3YA 3RVTC 3OGCB 2OK0L 3L3OA 4P2RD 5CP3H 1N6QH 5IROA 3VI4F 4BZYA 1KCLA 1OAZH 1P6FA 2BSRB 1XIWD 4KKBC 3HC0B 3G5VB 4RWYL 4PY8I 5D7KE 3MJ9A 2HG5A 2M26A 4Z7UB 1V7MH 1F3DH 2ENSA 3HE7C 4LPYA 4HH9A 3S36H 3IGAA 3UJTH 1BZ9A 2IMMA 1O7VA 4JZJB 5DK0A 4XBPB 2Q8AH 2GI7A 2R2EB 2RGSA 3O6KH 4PJDB 5AYQA 3AGVA 1IGTB 4NJAH 1NDGA 1BFVL 1SM3L 4HIJA 2HYMA 2BOCA 5E5UB 2HJFA 4LRIA 3NABL 3MUGB 3MRIA 1IGIL 5I18H 3LKOA 5J4MA 4XTRC 4LHJB 5FOBA 5IBTL 2AV1A 4TSBH 4PLJD 4NCC1 4Y4HC 1LE9B 3C5ZD 2R29L 5DJXB 1HHKA 1FYTA 2Z8WC 1E0OB 1JNLL 3CXHJ 3EHBC 1SJEB 4WRLA 2QQKL 3L3GA 2V2WA 1MCIA 1EAPB 4PJFE 3ELAT 3HE6C 1PKQE 4MCYB 5C0BB 2CK0L 4F9PA 3C09B 3T0XA 3BO8B 5EUKB 3MRCB 5C0AA 5EOTA 4OT1H 1N6QL 4GBXB 2XY1A 1OAZL 3H3PH 3MYJB 4YIQA 2CMRH 3OWEA 1A5FH 5AD0A 4RMTA 2CLRA 1JF1A 2OL3H 2PXYD 3QIWD 4NRZA 2ARJA 1V7ML 4TNVF 4HMDA 1UXWA 5FKPB 3S36L 1NCBH 3DVIA 3UJTL 4XC1H 3E3QE 2YXMA 4H0GA 1T4KA 3BUYB 2DKUA 3LN9A 2Q8AL 3PGDA 4BQBA 3O6KL 4JZOA 1CD9B 3KLSA 1EUTA 1U8QA 4G80A 4NJAL 5FO9A 1CDUA 3C2AH 5CJ8A 3LKNA 5I18L 2DWDA 4KVCH 4NM4H 3X3GH 2P7TB 2AKRB 4TSBL 1T0NB 1CDGA 3FOLB 2XZQL 1CR9H 1A7PH 2HFGH 4OGXH 4X7TA 5KBNC 5DEFA 2EDJA 1UB5B 3QSKB 3S6CA 3ZYZA 4BSWB 2Z31D 5IMOB 2MCPH 3MV9D 1IJ9A 1T22B 2M1KA 3SKUD 4CU8A 3AFLA 1I9JH 5CFHA 3ARGD 3GIVA 3HAEH 3OMZA 1WICA 1S7QB 4OT1L 5ANMB 2DS4A 2CK2A 1JP5A 3H3PL 3VJ6A 2CMRL 1A5FL 1PKQA 2HN7B 2OL3L 1BQHA 4MXQC 3EYFA 3L3KA 5IOPA 4KMQA 1LP9B 2JCCE 3JZ7A 3LN5B 3ULVE 5DHVH 4LDOB 1AE6H 4U6XA 4XC1L 3FOMA 1S7UA 2HH0L 3JWOC 3MRGA 4E5XA 1WAAF 3PNWB 2IADA 4MAYC 1WFTA 4NN5C 4LCCB 4RGNB 5A2LH 3SY0A 4NQDB 3C9NA 3FT3A 3C2AL 2Y1VA 1IAKA 4KVCL 1DANT 1KTRL 3QQ9C 4MLSA 4NM4L 5INCB 3TFKC 3EOAA 5CILL 4D9RE 3FZUC 5DWUH 1CR9L 1A7PL 1MAKA 2HFGL 4M4RA 3SO3C 1XCQB 1HKLH 1ZV5A 2ZOKB 3WIHL 4GXUN 4AIZB 1YNLH 1ORSA 2VLJE 5BZWA 4J3XA 2MCPL 2F19H 4FQHB 3TGXA 3ZKSD 2OJEB 3GSNB 3U9PH 4LFHD 1I9JL 5EBLB 5ETUB 4D94A 1MPAH 3PHSA 3RIFK 2PF6A 4PJGB 3WDJA 4PJ5E 4OZIF 4X0KB 2BDNH 4WFED 2EXWD 3TBYA 2XKSA 1CT8A 3QEUB 3REWA 1UZ8A 4G42B 5FCSH 3S98A 5BV7H 1JHTB 1J8KA 5EBGA 2WWMD 3SDAA 2O5XH 3U0PB 2UWEF 4POYA 3N1QC 3MACH 1B0WA 2C5DC 2LFGA 1A6PA 2JCCA 3P9LB 3RVVD 5K59E 3BQUA 2G75B 5C0GB 2HTKC 3MZGB 5HGDB 3WNLA 5HHXH 5E6YA 5M7QA 3WEXB 2Z92A 4G7VH 3NAAH 4L9LB 4M6AA 3DECA 4LEOA 4MSWA 3WHXA 4DZBA 5DWUL 4K8RD 5J9PB 3NBNA 5C0BD 2NX5B 5L2JB 1HKLL 4GQPH 2BXZA 5T1MB 4GBXD 4YK4C 5EIVA 2F19L 2B5IC 4HCRH 3U9PL 1HCVA 4OLEA 5I8CB 5B4MD 2CRMA 4TNWK 2JJTC 1ZVSA 4PJ7E 1MPAL 3MFGB 5IEHB 3TJHC 3SGKC 1EK3A 3RGVB 1AP2B 3FO1A 4POZD 2BDNL 1AJ7H 1J1PH 3SGEH 5HVGB 1E6JL 4FHBD 5F93C 5BV7L 3GMOA 4OQTH 5IB3A 1G0XA 5B22A 2VLME 3DHJA 3EYVA 4YPJA 5F7LB 4HC1A 2Q86A 1G6VK 2OXHA 1PW3A 5EZIH 2H41A 3IAQA 1UB6B 2FSEB 4NSKB 5LBSL 2A83B 2ICEB 1JPFA 3QEGL 5HHXL 2ZG2A 1F3DJ 4R4FL 3NAAL 5LG1A 1OGTA 2V7NB 4YHNA 1Q9WA 3RAJH 1DEDA 4N0UE 3VGHA 3NIFF 1NEZA 2ENYA 3MRKB 5CEYB 4K8RH 4HCRL 1YDPA 1NMCC 4HBCH 4LCUB 4V1DD 5I74B 1J0ZA 4RAVA 4R7DB 1ACYH 4N90D 1WV7T 1Q38A 4Y5XC 4OCWH 4ZS6D 3QRGH 5C0CB 5IK3B 5DVMA 3VXUB 1ZK9A 1HXYB 5DTFA 4MMXC 4LSPH 3MCLL 4QGYA 1AJ7L 3RJDA 5FFLA 4RGND 3IDGB 4JANA 1DFBH 4NQDD 3QXDB 5MERB 1UWXK 4OQTL 2CXKA 4MS8C 4QHLA 1XFPA 1N8ZA 5J57B 5D96B 1NFDF 3JV6B 5D5ME 5EZIL 1KUMA 2Q1EA 3WN5B 3V0WH 3O8XA 1UJ3B 4RGMB 4HUNB 5I1EH 4JAMA 1I7TA 3T2QA 5TDPA 3DIFB 3MNWB 3ZHKA 2UYLB 3V4UH 1O0VA 3WD5H 3RAJL 1S5IH 1BIIB 3TM6A 5IB5B 1KCSH 3DHMA 4J4PA 5MP6H 3LRSB 5MEOB 2NY7H 4K8RL 3QG7H 1E4XH 1FFPA 3EIFA 1V7NH 4LNVA 4N0UA 4I0KA 5HY9A 3ZMRA 3I02B 4YHMH 1NBQA 5JLZB 2YBRA 1AGEB 4OCWL 2R2HA 3QRGL 2C1OB 3NACH 1RQ5A 4WW2A 4KKCD 1JK8B 2XKUA 5FAAA 3KPSE 5EBWA 3SDXE 4AH2A 1DFBL 2SEBB 3PWLA 3FB6A 3DX7A 4JFHE 3UTQA 3CK0H 5T3XD 1D6EA 3QIBB 5D1QA 4JM2A 5F88A 1XT5A 4UDUA 3O4OB 5HJ3A 1FCCA 5IB1B 1J8HB 4P5TA 2NX5D 1B4JL 2VZOA 1YY8A 2W0FA 1B6DA 5I1EL 3MC0A 2VDQH 1YQVH 4Y5VB 2ZKHH 4W70A 4F9PC 1D5BA 2MJWA 5EO1B 1U8KA 3C6SA 2VITB 5D5MA 1VFBB 5A2JH 5ICZA 4UV7H 5IVZB 3V4UL 3WD5L 1U8MA 1HI6A 1S5IL 3NMEA 1MCPH 1I4FA 3B5GA 3IB4A 1QR4A 5C0JA 5JNYA 3AREB 3GSNH 1KCSL 4XNUH 5MP6L 5AEAA 2DWEB 2NY7L 3RGVD 4JVUA 4NQTA 2ZPKH 3GUTB 2YD3A 3QG7L 1E4XL 1V7NL 3VXNB 4YHML 4X4XA 4CVZB 4PV8A 3WFZA 1UC6A 2BNUA 4NC1C 3B9DA 4PY7A 1NCWH 1JNJA 4KJYB 1BVKA 1X7QA 2ZSWA 1WBZB 4P2QE 3OKYA 4KDTC 1VFAB 2PO6A 3CK0L 3W9DA 3KPSA 2NY2C 3K1DA 3UPRA 3KJ4C 4M3JA 4ZDHB 3VD4A 4XP5H 1XGTA 5T3XH 5EZJA 1YEFH 5J7CC 3ZKMC 5E2WH 2VDQL 1YQVL 3IDNB 4RMRA 1BX2A 4JDTH 1QQDA 1A6VH 1KJ2L 3MRLB 3U7AA 4UV7L 4L5FH 3HNTH 4C59B 3RI5F 1NBYA 3EUUA 3GJFA 1MCPL 2WINB 2P8PA 3ZKQD 2BC4B 3GSNL 3M1BA 4XNUL 5C0CD 1NCCL 1YEIH 3VXUD 2ZPKL 4OJFL 3IETA 3SOBH 2OMNA 5FUZH 5HYEA 5CJ5A 4RA0C 5TGBA 4O2CB 3FFDA 4E41B 5I17A 4YPGB 4OIAA 2J6EH 1I85C 4F15B 3BE1H 2XTJB 1A7OH 3CMOH 3ES6A 3NN8A 2VAAA 2OR7A 3QDMB 5I1LA 5EC1B 5HD8C 1TIUA 5DRXB 5J06A 3ARPA 4O5LH 4PRHE 1AHWA 3U4EB 4ORZC 4MZ2A 4P2QA 2EDTA 4FFZH 1UACH 1MFNA 2ADJA 5T3XL 4Y4FB 3HLAB 3OB0K 3T4YB 4Z7OE 1YEFL 4TQEH 4MB3A 3QQ3A 1AXSA 4RRPG 5E2WL 2F54E 4JDTL 2HRPH 2GJZB 1A6VL 1EVUA 1ND0A 4PJCE 4ZOEA 4L5FL 1GSMA 3HNTL 5ICXA 1RY7B 3MMEA 1ETZB 4JY5H 1KLGA 5FYJD 3SJVA 2C1PB 5FB8B 3GB7A 1VFMA 5DHYA 1T03H 1YEIL 5FDWB 5TDNB 3SOBL 3B9KB 4PJXB 4Z7WF 4QRPE 3TPUB 3SDAC 5FUZL 2YD4A 3D3VE 1HK6A 3UTPE 4JFPA 1SJVA 4HLZG 4JO4H 4X5XB 4UOW0 2J6EL 3QIBD 1HHIA 3CFKA 1WZKA 4G43A 3VXSB 2H9GB 5D2NB 3BE1L 1A7OL 2XPGB 4NN6B 3CMOL 2Q87A 1VCAA 3TN0B 4P2OA 5CGMA 3WHE0 2DQGH 4O5LL 5HHNB 5ACZB 2I9TB 4S1RH 4X6EB 1RK1A 5HPOA 2ZSVB 4FFZL 5EBMB 1UACL 5GSRA 1S7XB 1LK2A 4MGXA 1P7KA 3ARED 3SEPA 3BWUC 4TQEL 1PG7X 3S5LG 5T5NF 1Q72H 2HRPL 4IRJA 3SE3C 1C16B 1H8SA 1FGNH 3SDDA 1S7TA 2ZNWA 4JY5L 1H3PH 3U46B 1KIRB 1ROWA 3EO0B 3QXAA 3LEXA 4N0YL 1T20A 5FUOH 1T03L 4JFYA 4NIKB 2NY6C 1SMOA 4MJ4A 2R2BB 4JO4L 5IVXF 4NWUH 2AS5M 4Z8FH 3PQYE 1ZSDB 1PX4A 1D9KC 3RVWD 5JIPA 4ZXBA 4QRPA 3P4LA 3QI9A 1CDYA 2K9UA 2OSLB 3FQTB 4HBQA 2VLRB 1NLDH 3RTQB 1S7VB 3VWKB 1AXIB 3DRTA 1M71A 5ESVB 2DQGL 4HXAH 3CFEA 4Y1AE 4S1RL 1G7PA 2JE8A 4RDQG 5C0IA 5FGBA 1ZA3A 1RJLA 3BGMA 3BN9D 2RBLA 4ONOA 5DVNA 1EIBA 3W82A 4NZTH 5CEZD 5HHPA 4JQIH 1Q72L 5JDSA 1QR1A 1LEGA 4XNXH 1AGCA 1FGNL 3GBMH 4M00A 3O3BB 1VEPA 1H3PL 4YHKH 4E41D 2EC9T 1IT9H 5KSAB 4IOFD 5FXCH 5FUOL 1R3KA 1CLZL 2EH8H 5F7FA 1JGEB 3ARDB 3PWJB 4A6YB 4BH8B 2FEDD 2XTJD 4TUOB 1FO0A 1JZ8A 4I18C 2CDFB 4XNQA 3QDMD 3SKMA 2FJGA 2OYPA 4NWUL 5BS0E 3ZTJG 1P5UA 3WIFB 4U1SA 2Y07H 1BF2A 2A6JA 4R96B 4H25B 1HHGA 1NLDL 4ODBD 5EIIA 4Y4FD 3QT2A 3PQYA 5TH2B 4MA3B 4GRLC 1DR9A 1J9CT 2XT1B 1LEKA 3UC0H 5DMIH 1U8LA 3Q5TA 4J4PC 4JRWA 2X09A 3EZ8A 5HYSA 3KYMB 2X5PA 3G5XB 1CGUA 1A21A 4G9DB 4JFFD 5FUCE 4NZTL 2HKFH 3VFOA 2I9LB 4JQIL 4LLDA 4XNXL 2DBLH 3B9KD 5GIRA 5F9WC 3GBML 3V5KB 5CEZH 4HKJA 2PYEE 4CNIA 2EH8L 3VWJB 3OBAA 5IEKA 4QWWD 3VXSD 2VL5A 4F33B 3G6JA 2JELH 5K9OB 3H3KA 3TN0D 2X4SB 1RJYA 2Y07L 3ESVF 4XXDA 3SPVA 2DQDH 1KTDA 3Q3GB 5GHWH 2PW1A 1QFWH 3FO9A 4I9WD 1FNEA 4Z7QE 5BS0A 1PLGH 3AXLB 3ME0A 1MWAB 3OXSB 4JGMA 1HHHA 3UC0L 3LD8C 5DMIL 1G6RB 4Y2DC 5EOCH 5DZLA 5MEPA 4UQ2B 1MVUB 3HNSH 2ICES 4L3CB 4EQ2A 2W07A 2VLKD 3DV6A 2HKFL 2PKDA 4XPAL 1XGRA 4LSRH 2DI8A 1MCWM 2DBLL 4BH7A 2DMBA 4LSTL 3IJHA 4M9PA 5CEZL 2ERJC 3VH8G 1A22B 3EJJX 3SQOH 4J12A 4E0RA 2PO6C 2H2SC 5IMMA 3CPLA 2VLRD 2PYEA 2JELL 3RTQD 4PB0H 3L7EA 3VWKD 5IFJA 1BJMA 4Y8DC 3F7QA 2X4NA 1RFDH 4XVUC 1HSBB 1FC1A 4WTWA 1KGCD 5KN5A 2DQDL 3QFDB 1JNHB 5GHWL 3FQWA 3UO1H 1QFWL 1XH3B 1PLGL 2EDNA 5CZXC 1FBIH 2FHBA 2Q7YA 5HI5D 1OSPH 5DYOA 5E8PB 4BQ8A 4ZUTA 1YPZE 1KXVC 2LE9A 5EOCL 1DBKH 5KSAD 3HNSL 3JWDC 3ARDD 2YPLE 2YR3A 4LSRL 3T0BA 1TDQA 1AH1A 4Z78A 2DYPA 1FDLH 3QNXB 5IQ7H 2GK0B 2KBGA 4IRSC 3MGOB 4XWGH 3VFRA 5DRZA 3TCLB 3SQOL 1JTOA 1WBXA 4UV4H 3LN4B 1A1MA 3B8SA 3W9EA 3ULUF 4ZO6A 2H8PA 32C2B 2BMKA 5JMRA 5IJKC 1RFDL 3A6CH 3FFCE 5ID0B 3B2UD 4NC0B 4ZFFA 3UROR 1WWCA 1QZ1A 4OLYH 3UO1L 1YMHA 2YD6A 3LKPA 4LRNH 4N8VA 4X6CE 5D7IF 2V5TA 4ZNEA 1DANU 5FA4B 3ZLQC 3F5WA 3BN3B 5D6CA 2BK8A 2X4OA 3OR7A 4NBZB 4KI5F 5EO9A 1DBKL 1WZ1H 2CKBB 4MJIB 3U0TA 1RZJH 3MREA 1VGKA 5BCAA 2QKIA 2R39A 3VWJD 3MRPB 4NBXB 2FYYB 4EOWL 1ZVHA 1YPZA 1U3HA 5IBUG 3G08A 4P3DA 3EYOB 1FDLL 5IQ7L 5IWLC 4X83A 4XPGH 3SDCB 3REVA 1EBPA 4A6YH 4IIQB 2YPLA 4EXPX 4Y4KB 1RJZB 4PP2A 2VNCA 4XWGL 5B3JF 1J0YA 1ZE3C 1CE6A 5GS3A 3NPZB 5IG7B 4YDLB 3DVNA 4UV4L 4PP1D 1EEYA 3V5DB 4X6DF 2YPKB 5J1SC 1G9EA 5CGTA 1VB9A 1ZMYA 1B88A 3E6FA 1SYSB 3A6CL 4KKAD 3T1FA 3RVXD 1U95A 4X6FA 4PJHE 4WY7H 1I1AA 3RBSA 2H3NA 4F2MA 1NC4B 4LRNL 4GW1A 2JK5A 4IRJC 4JR9H 1IZJA 1MFDH 3UPCA 3RWFB 2P46B 3GM8A 3MLTB 1WZ1L 3GJEA 4N0FB 4G8GB 4WV1C 1CGTA 2LVCA 4TN9A 4I0PB 1MNUH 4QT5B 1A9EA 5ALBH 3R1GH 4PGBA 1KB9K 1QFUH 4XPGL 2OP4H 2QBWA 2H2PC 4A6YL 1MSPA 2P5WB 2D4DA 2W60A 4HWUA 3QI9C 4M5ZH 4GG6A 1XAUA 2EO9A 3NFNB 1XIWA 2DD8L 4AY0A 3BIAX 1WBYB 3EO1B 1OPGL 5DJ8B 3MRMA 1T1ZA 2CUIA 4M1GH 4GXUM 2C3XA 2UUDH 2YN5A 3WXVH 4G6AC 5FGBC 1RZKH 2WANA 2XKNA 5FYLE 1TITA 4S1DD 5CJXC 1F6LL 3QWRD 1SYVB 2ITDA 2V2TA 4WFHD 4WY7L 4NNXA 3IKCA 1CD1B 1LD9A 1LWRA 3D69B 4JR9L 4Y16C 5DJ2A 3BPCA 1MFDL 3D2UB 1G6RH 1OTTD 2QADB 3TF7C 4J8RB 2H6PB 1K4CB 1QBBA 3C60B 2ZG3A 2NYYD 1QA9B 3C5ZA 3PV6A 1Z2KA 2LU4A 3RL1A 5F9DC 1CE1H 3HAEA 4JDVB 3SCMC 1KCRH 4NFCA 1WZMA 3FO2B 1MNUL 4PJFF 3L3DA 5ALBL 3R1GL 3H6JA 1QFUL 3KXFB 1KJVA 2LAAA 3X17A 2OP4L 4IOIB 4P57A 2NY1C 3VXOB 4M5ZL 5EOCJ 3WNNA 1SEQH 4L8SA 3GK8H 2YEZA 4L8DA 4UOJA 2PXYA 3QIWA 4LLVA 1OTUD 1B2WH 3EW3B 4K9EC 4M1GL 1V8HA 3WXVL 1S7SA 4L4TE 1MCJA 1RZKL 3TEUA 1Q94A 1T1YB 4HIHA 4UT7H 1YY9D 5F7KC 3NH7H 4MJID 4KUCD 3M17A 3HR5A 3Q6FA 3DSNA 4FQPA 1G6RL 2D7OA 5CLWA 4EDWH 3QHTC 1OTSC 1TVBB 3H0TA 4NZDA 1QOKA 4I5BB 2YRZA 3MV8B 4KFZC 3SDCD 2XIDA 1S8DB 1CE1L 4WI7A 3KYOA 5C0RH 2BCKA 4Y4KD 1CICB 3MV9A 2JIXB 3FONA 3D5OF 3U2SB 5IW1A 2IQ9H 5E5RB 3TIDA 3ARGA 5E8OB 4PD4K 5I1AB 3D0VB 5F9OH 1YNTA 4LCWE 1XR8B 3WDIA 1A1NA 4LAJH 1SEQL 3ARRA 3QQ4A 2QL1A 4L8BA 1TVDA 4R97C 2JCCF 3KHQA 1JV5B 1NC4D 2EKSB 3W39A 3ULVF 1S9WA 1B2WL 3TBTB 3I6LD 1Q9LA 3BAEH 3JV4B 3GKWH 4U1MA 4UT7L 4K7PL 4WNQB 1P84J 3BW9B 1FIEA 4JKWA 3NH7L 4OZIB 2Y6SD 2WBJB 4TVPD 4FQLH 5JW4R 4G8GD 4BUHA 4I0PD 1QACA 3RNQA 4JY4B 3OGCA 3PL6B 1P1ZB 4NUJB 5C0RL 3LS5H 1T3FA 2BSRA 2VN7A 3BH9B 4JM4H 3HC0A 3G5VA 4KJWD 1NGZA 2E7CA 4LVHB 3ZE0E 4R4ND 2IQ9L 5KANI 3C08H 2R0KH 2HJKB 4NHUB 4Z7UA 5F9OL 5TPWH 3V6ZA 4PB9H 1SMAA 4NJ9L 4KROB 4YEFA 4JZJA 4OQTA 2R2EA 2VZVA 4B53A 4H1LG 1IGTA 1DQJB 4LCWA 4XCFH 4PJ8C 4IJ3B 2WQRA 3ARBB 3D2UD 3MUGA 2QADD 1LO3L 2DI9A 4K7FB 1N0LA 3QRFM 3BAEL 2Z9TA 2HMIC 5EU3A 3C60D 5K59F 3GKWL 2J1KA 4NC1E 1FG2B 3NCFB 1EHAA 1NC2B 1SJXA 1G9MH 3LY6A 5DJXA 4FQLL 3UZQA 2EDRA 2HT3D 1SJEA 4YC2B 2GW5A 5HTSA 1EAPA 4HG4K 4TVPH 3QPXH 3EDFA 2ED8A 3KXFD 3ET9F 4MCYA 5C0BA 3BSZH 3BO8A 1LP9E 2G60H 5TDOB 1MF2H 4GBXA 3LS5L 3MYJA 1XZ0B 2APFA 4JM4L 4U3XA 2GAZB 3RKPA 3GSQA 3C08L 1J12A 2R0KL 3MA7A 4PJ7F 2VR9A 5FKPA 3IU4H 3TNNB 2QTEA 1Q0XH 3T0EB 1YEJH 1HZHH 1WWBX 3GMPB 3TA3B 5CUSH 3BUYA 2IAMC 3MA9H 3S37L 4M5YH 4XCFL 1N3NB 2DL9A 4W6WB 3TVMC 2P24B 4U31A 3MRJB 2P7TA 2AKRA 1T0NA 5BW7A 5KOVC 5B8CB 5IW6B 3FOLA 4MQ7B 1TENA 4O2FA 3K4ZA 1KC5H 3MV8D 1G9ML 4J6RH 1UB5A 5DUPH 1C12B 2IPKB 4UZGA 1CICD 1H15B 5IMOA 4PJGE 3VFNA 2JIXD 2DQCH 3KS0H 1T22A 1JL8A 3WE6B 4TVPL 2NY5H 3QPXL 2PYFA 4FQXA 4WO4C 3BSZL 1NFDB 1S7QA 2G60L 5ANMA 1MF2L 1HXMA 4M7KH 1V3KA 4W4OA 4MQSB 3ZKXC 4WW2F 1HWHB 1G84A 3WL9A 1JTPA 1DVFC 4OF6A 1P69B 4AEIH 2HN7A 1BFOB 3VFWB 1LP9A 4AL8H 1FIGH 3IU4L 5AZEL 3LN5A 2VQ1B 4UIKH 1Q0XL 3MJ7B 1YEJL 1HZHL 4DN4H 5CUSL 5JMOC 1PDKA 2X2YA 1OGAE 1FH5H 2OTWB 1MCDA 3PNWA 4JFEE 4LCCA 4WWID 1I9RH 4U49A 5DJYB 4NQDA 3KPRE 4V2BA 2WBJD 1LO4L 5KAQG 5L2KB 4OI9A 3HMXA 4P23B 5INCA 3HN3A 3S3SA 4DEPB 2E9IA 5D5MF 3DYPA 4CAGA 5C7XH 1C7SA 1KC5L 3PL6D 1XCQA 4J6RL 4J3WA 5CSGA 5DUPL 2ZOKA 4KK9D 3NIDE 4AIZA 3IU3A 1UVQA 1AXTH 2XV6B 5ELIA 1BGXL 5KSVB 2DQCL 2OJEA 3GSNA 2AXHA 2NY5L 1ZLVK 5EBLA 5ETUA 3PWNA 4CUCA 4JJ5B 4OLUH 5C08E 2O5YH 2D0GA 4YGVB 4WI3A 4PJGA 2RR3A 1H5BB 3MV01 4KROD 4GAYB 4DKFH 4X0KA 1I9EA 4AEIL 4Q2ZB 4RBPH 4DKDC 1B4RA 3OAYK 3QEUA 1FIGL 4GT7A 1JHTA 3ARBD 2AXFB 4UIKL 2L7JA 2UY6A 3CZJA 1AFVH 4DN4L 4JRYB 1QHPA 3U0PA 1KEGH 1FH5L 5ALCH 2W92A 1ORQA 5KG9B 5J0BA 3BI9X 3DBXB 5ENWB 3L5JA 3SDXF 3P73B 5LXGH 1I9RL 2E7HA 1F3JB 2G75A 4OI7A 1NC2D 4M7LT 4U7MA 1NGYB 3M45A 5GSVB 1NJ9B 2BVPB 1QRNE 2VXQH 5HGDA 3C5ZC 3WEXA 4JFEA 3L9RB 5D6DC 5C7XL 1MI5E 4U1NB 2EC8A 4OCSH 5J9PA 4H20H 1X5LA 4DAGH 3BD5A 2NX5A 4GLRI 5CS7A 3RGHA 5T1MA 3LEYL 3TJEH 2EXYD 1AXTL 2FO4B 4F80A 3S8WA 3VGAC 5I8CA 4WGVB 4F7TB 1RZ8A 1ZVYA 4OLUL 3R0MA 2O5YL 5BXFB 3T0ED 3TA3D 1AQDA 3ARVA 3KPMA 4OZ4B 3RGVA 1AP2A 4DKFL 4N0CC 3BKCH 1JZ2A 2Q3ZA 2DDQH 4OGAD 4G3YH 5CD3B 1CL7H 2R0WH 2VH5L 1UWGH 4M03A 1X5YA 1AFVL 3NCCB 5JXED 2VWEE 2EIEA 1VEOA 4MB4A 1KEGL 1QBAA 5ALCL 5AUMB 5LXGL 4DGIH 4WUUB 3H9YA 3HMWH 1CQKA 1PY4A 1UB6A 2FSEA 4ZODA 4NSKA 2A83A 2VXQL 5HI3D 4OCSL 2V7NA 2Z31C 3L5WB 4H20L 3NFSH 3Q6GH 3OJDA 2DICA 3VI3E 1QRNA 3MRHB 5FYJE 1ADQH 3D87B 3FQNB 5CEYA 2HTLD 5I1GH 1MI5A 3SBWC 3WLWC 1K6QH 2E27H 5J3HC 3TIEB 3F12B 1FV1A 4LCUA 1CIDA 5BV7C 3MLSL 43CAB 4B7LA 4R7DA 3VXQB 5HHOE 3LS4H 5F21B 2VUYA 4GFTB 3ZYJA 5C0CA 5IK3A 3VXUA 1XGYH 3DURB 3BKCL 4ZO8A 1HXYA 5I9QC 2DDQL 4G3YL 3QJHB 3QWOA 1ZHNB 1CL7L 3IDGA 1UWGL 1CQYA 1J8HE 3QXDA 4G8FB 3S35X 5MERA 5L2KD 1TXKA 1AIFB 4QEGA 4QOKB 4O58H 2CPCA 3MLRH 3ILPB 3S34H 4DGIL 1BBDL 3JV6A 2X6MA 3HMWL 1MUJA 4HF5H 3WN5A 4GO6B 4Z7WB 3VDAA 3ZTNH 4EDXB 2CIIB 5ADPH 1EV2E 4XAWH 4CL7A 3MNWA 1H8NA 2UYLA 1JMXA 4WW1B 3NFSL 3Q6GL 4Z7OF 4KJPC 3IS0X 5IB5A 1ADQL 4D2NA 5CD5C 1T5WB 5CCKH 4ODXA 5I1GL 4PJCF 5MEOA 5CBAA 3LKRB 1K6QL 2E27L 2CDGB 4K3DH 3MBEC 2NR6C 4JZJC 4XCCH 1EXUB 5JLZA 5DO2D 5TQ0H 5SWQB 1AGEA 3LS4L 2C1OA 4JRYD 4BYHA 1QSZA 3C8DA 2IEPA 4Z0BH 1JK8A 5DMKA 2AXGB 3DPBA 2EDDA 2COQA 2XQBL 2O61B 2WWMC 5HI4D 4KWUA 2ZUQB 2C3GA 2SEBA 1DZBA 4BZ1H 2BSED 3TZVC 4CVUA 1J86A 3QXUA 3RVVC 4O58L 3QIBA 4MWFB 2NXYB 1NSNH 3MLRL 3FB7B 3S34L 4R2GB 5IB1A 4JKKA 2NTSP 1J8HA 1AD0B 4HF5L 2P8LB 4MA1C 4HH8A 3ZTNL 2FATH 5ADPL 5FECB 4QHNA 4K8RC 3FHAA 3C09C 5IVXB 4XAWL 2O5ZH 5EO1A 5H37G 1XGPA 2VITA 1VFBA 4GBXC 5IVZA 4OGYH 3S4SA 5I75B 2I26N 3AREA 3MROB 4PJIE 5B4MC 1I75A 5CCKL 3ARXA 3G5YB 2DWEA 4EI5B 3GHEH 3IJYB 4Z5RB 4K3DL 2PR4H 2Z35B 2VQUA 1FL6B 4XCCL 3VXNA 5TQ0L 2NY3C 4POZC 4CVZA 5KVEH 1QG3A 1S9VB 3RY5A 1NCNA 1MHHB 1A47A 4FQ1H 1BD2E 1V3LA 3MYZA 1L6ZA 4Z0BL 1HILA 1FZKB 4KJYA 4KMLB 4OCYH 1J18A 1IRAY 1MIMH 3C6LB 4BZ1L 2PTVA 4WHCA 1NSNL 3BH8A 1CWVA 2C3WA 4ZAKB 4EJ1C 4HX1B 4K23H 4ZDHA 5DS8B 4I8DA 3IFOB 2IANB 5TE4H 2DLFH 4X8JB 1JGLH 1I9IH 1OM3H 5FK9B 4UBDD 3BRFA 2O5ZL 1BM3L 3MGTB 4DFIA 4NZUH 1FYHB 4OGYL 4PGCB 4PJXE 2WINA 4HK3N 2BC4A 2YD7A 1HIMH 2IH1B 4RCAA 5IT2H 4GW4A 3JUZA 4MD5B 3ULSB 4EUPH 5C07B 1BQLL 3GHEL 1MCLA 4R6UA 1MCOH 2PR4L 3VXSE 1NUFA