2OJZL

Anti-dna antibody ed10
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
218
structure length
218
Chain Sequence
DILMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPTLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHIPLTFGAGTKLEVKRSDAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab ED10 light chain
publication title Specific recognition of a DNA immunogen by its elicited antibody
pubmed doi rcsb
total genus 49
structure length 218
sequence length 218
chains with identical sequence M
ec nomenclature
pdb deposition date 2007-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ojzL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ojzL01
1BD2B 4BSWB 3RIFF 1QFWI 4X6CF 3O41A 4Y4KB 5HDBE 3SE3A 4PG9A 5C0BE 2OL3B 5IUSA 5IW1B 2YSSB 1A7BA 4NCDA 3MCG1 3OZ9H 4HWEH 5DD6B 4LASL 5KOMC 3QAZC 1CGSL 1U8NB 3D39E 3MRKB 3EOYG 4KRPC 3B9KD 3SGKC 1NKOA 2FATH 5CCKH 3SDCD 3FB8B 3ARDA 3BPOB 4PRIB 2PO6A 3VXUE 2VSDA 4OQTA 1UACH 1HYRC 4QRPD 2HAZA 1U2CA 2NY3D 2DIAA 4R6UA 3MGTB 1XIWA 4NM8L 2FZ3B 3RU8L 3U0PB 3X3GL 1A6ZB 5C2BL 1AGFB 5ICZB 3WFEL 5GGVL 2VKXA 3OQ3B 4QEGA 3ULVL 1Q0YL 4GAGH 1OAUH 3E8UH 3HMXA 4LPTA 4OLEA 4IRJA 3KPOA 4XVUC 4PRBA 5LBSL 4CW1B 1JF5A 4Y5VB 1BBDL 4RMVA 3U0TA 4EN3D 3SKOB 2DI9A 4CU8A 4HC1L 4NO0B 4Y5XB 2F53B 1EHAA 3NFSH 1L0XA 3PG2A 5DEZA 1NAMA 4Z0BL 5ADOL 2F58L 2DYPB 4BKLB 1P9MA 3QEGH 3B9EA 1FGVL 3BZEB 3R8QA 4XVTL 3VI4E 1G6RA 2I9TB 1SQ2N 5GISL 4Y4FC 1XGYH 1CK0H 5C07E 1WFTA 1VGEL 4LBEB 4WUUB 3BJLA 2NX5E 4PRHE 2EDWA 5DJZB 5BRZA 3LIZL 3E6HB 2GHWB 1GZPB 4IOFD 3BKCH 1JNLL 4J3WA 1B9ZA 1YC8A 4MZ3A 4YDJB 3QG7L 4IOIB 5MP6H 3U79A 3MLYH 5K9QG 2E8YA 1P69B 1QNZL 2UVFA 5I8EA 1JNHB 4FFWC 3QAZB 1JWSA 2KZWA 4W70A 4BZ1H 2GUOB 2CDEA 4KRPB 3DMMD 3A6OA 4XPAH 4LCUA 2R29H 1HWHB 3VXTB 4ZXBD 2N56A 1F58L 4ISVB 4NNYA 5D7LD 4OLXL 3AS1A 3PWPA 4OCXH 4GW1B 3TWCH 4GW5A 1RUAL 4ODXA 4KKAC 4H26A 4FP8H 1CTNA 3O2DH 1T83A 4LHUA 2FL5A 2IPTH 4KXZI 1MFAH 2P8LA 1C5DB 4LIQE 1ZTXH 2Z91B 2W60A 3D3VD 1I1AC 4QHMB 1EO8H 1T66C 3H9YA 1MWAH 3MRNB 5C0RH 4OCWL 1AKJD 3LB6D 2YUWA 3QXUA 4JO3L 4ELKB 1II4E 5DZLA 1FNSL 3D48R 1FNEB 1HILB 3S37L 3TJEH 1AIFA 4NQEA 5EUOA 5B38B 2IFGA 2Y06L 1ZT4B 5J0BA 3AS2A 1I1FA 5M7QA 5BS0D 1LO5B 1UADC 3IDGB 4AEFA 3H9HA 4WIQA 3EDEA 3GJFK 1IGTB 4DGVH 5HXMA 1MFCL 1MFBL 4X83A 3DVNB 4TVSa 2YOCA 3BE1L 3DX7B 3PQYA 3KPSD 4Y4FB 1OAZL 4LCYA 3SBWC 3QPXL 2V2XB 1PW3A 3AS3A 3QUXC 4Y5YA 1EAJA 1C1EH 4PUBL 2KQMA 5DS8A 1MCKA 1UQSB 4JFDA 4YX2L 4TTDD 4QRPE 3DX8A 2C3VB 5EU3B 3HUJF 4JZJA 4HGKC 4D0DB 1X5XA 3ZL4L 3IGAB 2O5YH 3VW3H 3WMSA 3WS6A 4LEOA 4MCYA 3GJFH 4R8WL 4HX1A 3HS0A 3NPSC 1DVFA 3I6LD 3KPMA 4ORGB 5ETUB 2AW2A 3IAQA 3TH2T 2RB8A 3V4UL 3VMNA 4HIEB 4ZUUA 5IW6A 5KANI 4LP4A 5EU6A 4FABH 3TYFA 3O4LB 3FTGB 2K7PA 2I07B 1WZLA 2AJZB 4M62H 5IM7A 3BIAX 4LRNH 1ES0B 1BQHB 3QYCA 3H42H 4GRMB 3PP3K 1EFXD 1GZQB 4IHOB 4NYLB 2VXVL 2VZTA 4XB8A 1UM4L 4PP1D 1I1AB 2VERN 3WIHL 3RNKB 1R0AH 2JJTC 4H8WL 2CIIB 3SKJH 1C08A 2OP4L 3MV7B 1U42A 5CAYB 5GRYA 3TBVB 4PJHE 5ILTH 2ZUYA 2BNQE 3V6ZB 3BOVA 1A7NH 4Y88A 2HP4A 1ZVYA 4L4VB 3MRPA 4GLRH 2H2PD 1MVUA 1PEWA 5DMIL 1QVOA 3RL2B 4F7PB 1NBYA 1M1SA 1L9MA 2UWEF 1IMHC 4FTVA 4PB0L 4L3CA 2YZ8A 4U1IB 1D9KC 3INUH 5CBEB 4JFED 3PP3H 4NBXB 3IRZA 4X5WA 2VLRB 5KVGL 4O02L 4P4KC 1I9JL 3TZVD 5DJXB 1I75A 1F4YL 2N1KA 3QUXB 4GSDH 4L8CB 5FYKH 4I1NB 3CVIL 4B7LA 3DVIA 4XVSH 4NZRH 1F6AA 4PJCA 5D7LE 1IEHA 3U48A 3BYTA 5JXEA 4ODHH 1JN6B 1Q1JL 2VLKD 1TZHB 4PTUA 1QFHA 1R3LB 4PJ8A 1HH9B 4WJ5B 3VFOB 1JGEB 3X14B 4ONOA 4LQ1A 3MRQA 1B4RA 4LEXH 1WK0A 2J8UF 4HS3A 4PJ9C 2HTLD 1G7MB 2F54A 3WXWH 1JMZA 2DQUH 3NPSB 1HHHB 5I1LB 4DKEL 1OY3B 1CXEA 3ARUA 5LGKA 4CJ0A 1J88A 2OSLB 5I1JL 4XCEB 3I6GA 1OTUC 4MNQE 5C3TA 1Z6JT 1OLLA 1U8LB 2Y4SA 3BEWA 4ODUB 3W39A 2NR6D 4FQJL 3WCYA 4NDMA 5HHPA 3HAEA 4NSKB 3BZ4A 3EOTH 3F58L 5B8CC 2FWOB 4DKAA 3F7VB 3V4VH 4P4RA 2ZUQC 5FYLH 5BS0E 4KK6D 1HQRB 4UDTA 4LIQH 4HCRA 2DI8A 3ULSA 1DQQA 5JIKA 4CJ1A 1EMTL 2HT4D 5F3HA 5HHXH 1XGPA 2IANA 2W92A 5MEPB 1BQLH 5C0EB 2Y7QB 1RULH 3K7UA 4Q2ZA 4MQXC 3VGFA 4I0KA 3D85B 1T7ZA 4JDTL 3VE0B 4NO2B 2Z8VC 4X6CE 2CUMA 1HYSC 2YMXH 3R8BB 3WUWB 5IVXF 1F3RB 1LMKA 3QIBA 4LL9A 1D9KB 1S78D 5KOVC 3GUTA 1MLBA 4M8VA 2GTZA 5D1ZC 3REVB 1LO2H 2R0ZH 3ISWA 4P4KB 3F6IA 5C0FB 4YHYC 1I3UA 1WSST 5IJKC 3MLVH 1XF5B 5F1SA 1NC4B 3I6LE 4PGDB 4PBXA 1BVKB 5I2IB 4HIIB 5FM4A 4GRLC 5DRWB 4C56B 3D9AL 5DGRA 2QQQA 5CLWA 3QHFH 4XXDA 4POYA 1I9IL 1WTLA 2B2XL 2VXQH 3IETA 4NNXB 3LN4A 4MDIA 3KWWB 1D5ZB 5HYSG 2OI9C 4LARL 4CN1A 1CR9H 1EO5A 2GY7B 3QQ4A 4OZIB 4NJ9H 4PJ9B 2V2TA 1F4XL 4L4JA 2YC1B 2V7NB 1IARB 4JPWL 1Z0MA 1U3YA 1YY9C 4MD4A 4XHJC 1Q9KA 2J4WH 1MNUL 3LRSA 3FQUB 1CVRA 3ZTJG 4M6AA 4M1GL 4NKIH 3X12B 3IDJB 5L2KB 4LSPL 1K8DA 3SE4A 3PGCA 5GRUL 2DLTA 1RJYB 2EIDA 3GMPA 5JQHC 2IQ9H 2Z92B 4WFFD 2J12B 5E99L 4AL8H 1DBAL 4YPGA 4L8BA 5DJ2A 5EOCJ 1FFPB 3GMOA 3ARTA 5ISZD 4KAQL 4KROD 3GI8L 5B8CB 5DDHA 4PIRF 3VD7A 4Y8DC 4MDJA 4UQ2A 4OI9A 3V7AE 2ZUQB 4AIXA 3DRTA 4JM2A 5DK0B 3WKNA 1TNMA 4JFEE 1PAMA 3CZJA 5E8EA 3FB6B 5HD8D 3UP1A 4CNIA 4J3XA 1YNTB 4WY7H 1ZA3A 4G9FA 3VWKA 4MNGA 4C83A 3S98A 1MJ7L 5KG9B 3PL6D 3D25B 2Q6WA 1TLKA 2DL9A 3QJHB 3RX7A 1HI6B 3QO1B 4FFYH 5HI5D 1FFRA 2IPKA 2CO6B 3NN8B 4JQIH 3SCMA 2FEEI 2VLKE 4XCCH 1PYWA 2VNCA 3ROOA 5D1ZB 4XPHH 5D2LA 3P9WB 1T6VN 3IJSA 3MA7A 4RWYH 4OZ4B 5F93C 5D8JH 4YHYB 1U2HA 3VFNB 4P2OD 3DV6B 1YMHA 4F9PA 1U3JA 4O9HL 4WEBL 2FD6H 5IR1A 4GRLB 2BNRB 3NACL 2L4OA 3MJ9H 3RGVA 1FN4A 4YHOL 5IBLC 4M61B 5T3ZL 2OK0L 4OFDA 2O26U 3MBEC 1NCWH 4P2RA 5CEXA 5D70L 2OI9B 1RZGA 2FEEL 5DO2C 3HC4L 1RZ7L 1A47A 1CFBA 1SY6A 4HLJA 3ARBA 3OKOB 1FYHB 1FP5A 1VESA 4JRXB 3W81A 4BM7A 2YD4A 5J13C 3VWJD 3QFJB 3AREA 3LQAC 2ERJC 2EDDA 5DI8A 4ZYKA 5JPNA 1FVEB 4N0CD 5SX5K 2DM4A 3MMEA 3RY6A 5DRXB 3SQBA 2PCPB 1V3JA 4KY1H 3BUTA 3KYMA 5BOPA 1LQSR 1T1XA 1AGDB 1OCWL 1UGNA 1FC1A 1U93B 4JN2A 4HIXH 4I4WB 4JY5H 2UYLB 1YQ2A 2KDGA 3LN9A 5HVWA 2E6JA 4YHPB 4P3DA 5IHLB 3RVUC 4OSUH 5I1KL 1NC2D 2D4DA 2QR0A 4TULH 4UINL 5CJOH 1IC7L 4FZEH 1KLGA 3MJGX 4GKOA 1MI5A 1DR9A 4N9OB 4X9HA 5D7JA 2V6HA 3P4NA 3RWFB 5I15H 4PY8I 4KTEL 2RFXB 1MEXL 1BIIB 4KKCC 1UEMA 3IFLL 3UPRA 3WIFB 2GJZA 1R3IH 4GMSH 4Z78A 1QEWA 5D72L 5BXFB 4YHLL 2GCYB 5I1CL 1M6OB 3L6FB 1JHTA 3L3DA 1AO7B 1B88A 4GUPB 4M7KH 3HUJE 5IMOB 3DROA 2BMKB 3C8HA 3QBTB 4AEHL 3GNMH 3WS3A 2GQHA 2VITB 3KPTA 4HKJB 4IRSA 4OZGA 5H8DA 1N2RB 1L4IA 7FABL 5E2TL 1MHHA 3MV9B 3E6FB 4GAJL 2L0DA 2YD8A 3JWOC 3QIUA 3C5ZD 4AJ0A 5BVPH 3O3EA 5E2WH 1A3LL 4JG1H 4GG6A 4WFFE 1V05A 3VFVA 1DUZA 3QNXA 5ISZE 4IMLB 5HI4C 2C3HA 1ZSDA 1AR1D 2I5YH 3SE9H 3H9ZA 1XIWC 5J13B 2D9QB 2X4UA 4JRYB 2Y25A 1QYGL 2ERJB 3OAUL 4UBDD 1A64A 1HHGB 3IDMA 4HIHA 3DBXB 2BHUA 4S1DC 1T89A 3NFPB 4A6YB 2R56H 5D7IA 1ZHKA 3FAWA 2HFGH 3KYOB 3BVNA 3HZMA 1W72L 4IRJC 1X5KA 5F7KC 5H94A 4JHAH 4KDWA 1GSMA 3QDJD 4MAUH 4UIMB 3L3GB 5C0GB 1TIUA 2GYSA 1TJHL 2JIXB 3HE7D 4KTDH 5CZXD 1RZKC 1JFQL 2EDLA 4Y19E 1N6QH 1NUFA 3OHXA 4GKZA 4HGMA 3EDKA 4X4ZA 1NEZG 1MCOL 1LP9F 3P73B 3MREB 2EIBA 1IQWH 2XWJA 4J12A 4JPIB 3ZTNH 3BWAA 4G43B 1QHPA 1T1YB 4KKLC 5ICXB 4OGYH 5BJTB 1G0DA 3IJHB 2V2WA 3O41B 4E41A 2XRAH 4JPKH 4M6NH 3EOBA 2RCSL 3DYPA 1UB6B 3T65B 5IVZA 4WI8A 4LU5H 1IBGH 1HH6A 2FB4H 4P57A 1X5JA 4MAYD 5DWUH 1IM3B 1NJ9A 2EIZB 3K0WA 3SKMB 2J8UE 4HS6A 4ZAKC 3MLUL 2B1HH 3CFBA 4KJWD 5EN2B 4M48H 4TSBH 4OIBA 2XA8H 2A6DB 3IAPA 4IRZH 1XAUA 4CVXA 1N0LA 1FNAA 2ZUTA 2AI0H 3QXWA 3EGSA 2B4CL 2B39A 3BQUA 5MI0C 4KJQC 3X11A 1UH2A 4PJDE 2DQEH 4FG6C 4PLJC 4OI8A 1ZLWK 3DARA 2X4PA 1XIWB 3EYVB 1EBPA 4OV6F 1NGZA 4WFGD 1MWAA 3H9SB 4LMQI 3GBMH 4IIQC 5BVJA 3PGFL 4R7NA 4DQOL 3CH1B 1IGCH 1MCSA 5F7YC 4ERSL 1HINL 3RAJH 4WW1A 2FIKB 3H0TA 1KSRA 1KCLA 2VUOA 4YE4L 2YEZA 2WW8A 5KZCB 2CRYA 3HE6D 4P5TD 4QRRD 5T33L 2XYCA 4XMPH 4LQFL 4JO1H 5J11C 3K2UH 3PXHA 5FGBA 2CQVA 3LS5H 4OKVA 2RAMA 3OKKA 1E4XI 4PFEA 5EO0A 3JUYA 1ZLWH 3V6FA 4HUUA 1HIML 1BVLA 1OVZA 4I5BA 2EIEA 4N0RA 3C2SA 1FJ1A 5JIHA 1G6RB 4X8JB 5CP3H 5KJRH 4YWGL 1TZGH 4WW2A 4OV5A 4R26L 5HPOA 3OMZA 5LGHH 2CH8A 4FXKB 5DJCA 3MV11 5JW5B 3IVKA 4Y5YC 2Q3ZA 2ZZUT 2YN5A 5IBUG 5L88H 3ZT7A 3P4OB 1WBZA 5T5FH 1QLFB 2IALB 4KC3B 4RQQA 3RWHB 3BAEH 4BFGA 3GJFA 5IB5B 5C6WH 3RPIB 3LEXB 1IFHL 1ZKAA 4JFOA 4XWOD 3WEXA 3WNNA 5BZWA 2XKNA 3GMMA 3F62A 3WS6C 5B3JF 1FIEA 4XCYA 5EOCH 2AJSL 4ZAKB 5KTEH 1JWSB 1QOKA 4Z7WB 4Z76A 1FZKA 3BYYA 3IF1B 2VIRB 4OLUL 1FRGL 5IP4A 4MHHI 4NNYB 3QH3B 4APQA 5MI0B 3QDJE 4OLZH 4OCRL 5F7DB 3QIWD 1GVIA 1CVSC 1W72B 2D31A 4POUB 3KLHC 2APFA 4G42A 4LHUB 2EO9A 2AABL 4IIQB 5SV4A 3MSPA 4N0YH 4NP4L 1HQ4A 3QUKB 4ZSOE 1KJ2H 2CDFB 2ITDA 5JMOC 4UT9L 2VDKL 4BQ6A 2UY6A 1H0DA 1WAAF 4J23A 4Q6IC 4AM0B 4BH8A 5HDQL 4ONGL 2DQCL 3KPPA 2QQLH 4XC3H 2XTJC 5TDOA 5E03A 1OARH 1MCCA 5DR5H 3ULUC 1TJIH 4NQEB 4DVRL 5J11B 2CUIA 4H25B 2VQ1B 4RDQF 3KPRA 3BEVA 2KBGA 1CLYH 2BOCA 3GMNB 3G6JF 1YNLH 2X10A 5EO9A 1KENH 3GSNL 3PQYB 2YKLL 1D5MB 1FVDB 1NCDL 2AS5M 4Y5YB 3CFEA 1NANH 4V2CB 5FK9B 1SYVA 2CLRA 3DETD 5KSVA 4QT5B 5DS8B 3F7YB 3MLRH 4KK9C 3VRJA 5B39G 1FLTX 1B3JA 4RAVB 4XCNA 4GKSB 1N6VA 4WO4C 3RBGA 2AEPL 1F4HA 3L5IA 5HYSA 3QEQB 3MLZH 5GPRA 4G6KH 5JHDD 4LEOB 3PV6A 4MCYB 5FXCH 1EAPA 1V3LA 1K2DB 5JHLH 5DJ8A 1YEDB 5BW7C 2I27N 1PSKL 2IAMD 4LFHG 4OUUA 1UA6H 5IIEB 5IW6B 4YHML 2R0WL 4K8RD 3OKNB 4J4PA 3L3HA 4B5EA 4QRRE 1MF2H 1WT5C 4WUKH 3BHBA 4DW2H 2ORBH 4HWBH 1FO0L 4GO6B 5E6YA 3U9UB 2FHBA 3LHPH 3L5WA 4AIOA 3V8CA 1CFTA 3G5ZA 2HJFB 3BH9B 2ZCLH 4XBEL 2NW2A 5DGQA 3CSYA 3FO0L 3NCFB 5J3HD 2MSPA 4RGOH 2EKSB 4Q6IB 3SE8H 2JJUA 4N0UA 2H9GB 2VXUH 5HBBA 1KCSH 1SJEA 4BQBA 2XTJB 4X4YA 1A6WL 4X80L 4U1MA 4XAWL 5JO5A 3OR6A 5CSZB 3O6KL 4I3RH 3LKRB 1NBYB 3BDXA 1MIMH 1HOCA 5FIEA 2HH0H 3QRGL 5AZ2L 2EE6A 1S7VA 5IBTL 3UO1H 4M7LT 3LEVL 5K9OA 2PYFB 1R3HA 1UWEH 4U6YA 5BZDB 1SMAA 3TN0C 4HEPG 2CKBL 4WTZG 5ESAB 4WDIA 3WFCH 4KMTL 3HC3H 1VFAA 2A77L 3T4AA 4ZPVA 5DD3L 3UDWC 2DM3A 3EFFA 2VXSL 3I2CH 3IFPA 1FQ9C 1MIEH 2A1WL 5EH1A 5ANMA 4PJCB 1AD0A 2ED9A 3CLEL 3IFNL 4G6FD 3QRFM 4WO4B 1XZ0B 3TF7C 2QBWA 1JIBA 1CLOH 3TYGH 3K46A 5F3BA 2JKXA 2F5AL 1ULVA 4UNUA 1U8HB 3IS0X 4KUZL 1AI1L 1C5BL 5MEND 3S4SG 2X6MA 3K1KC 2ED7A 1IKNC 5C8JA 3HCVB 4WHCA 5ALBH 4RRPG 4EN3A 3SE4C 3QCUH 2DTML 3VI3F 4NDMB 1S7XA 1W0VA 3HAEB 2AEIT 1AE6H 1MRFH 2JCCF 1U8MA 1WBXB 1VERA 1A0QL 2QKIA 4YBHA 2VR4A 3IDXL 3EDFA 1LO4H 4JN1L 1DANU 4I48A 4HEME 4JQXC 3S5LG 1PLGH 5DEFA 4JM2C 1GGBL 4OF0A 4UDTB 1DQQB 1KIQB 1LP9E 1I7TB 2MTPA 3PWVB 5F3HB 4ALAH 2B5IC 2IANB 3EDJA 2ZCKL 1NDGB 3LQZA 2HKHH 5I8KL 1NFDE 1I9EA 3L3KA 2I60L 4LOUD 5HHVL 1RZJC 2ICEB 3PP4L 1Z5LB 3JV6A 4ZFOL 1OTTD 2X4OB 5DK2A 2EDTA 3U83A 2FECI 5J57B 4HUVB 3C09C 1U3HC 3MC0A 4OF8A 5FCSH 1JZ4A 1WBYB 3GSOA 4U4BA 1YPZB 3SCMC 1DLHB 5EOQL 5CJQL 1CZ8L 1U95A 3CU7A 2MCPL 4XMLL 5DTFA 3FOMB 3TN0B 1PKQA 5GZOD 4K9EL 1MJJB 4L3EE 3DMMA 5JHDE 4G8GD 4PGJA 3MJ9A 4O4YH 2ZG3A 2YBRB 4G6AC 1U8JB 2IFFL 3DV4A 3QPQD 3UBXI 4UDUB 2VQTA 3RGVC 3V2AR 1UCBH 1G9EA 5DFWH 4XXDB 1YNKL 2VN4A 3UJTL 1RUML 3LN4B 2VUYA 5FM8A 3D3VA 5LCVH 2PXYD 3RRQA 3ARBC 3QQ4B 4HJJL 2GJ6E 3EJJX 4JRWA 4H1LH 1DFBL 5FHBL 3MRHB 5GRZA 4OFVA 3RWJA 1UACL 4M7JL 2ZG2A 1ZAGA 1Q9KB 3GSVA 1DE4A 4CADA 4MQTB 1QSFA 1I8KB 2Q8BL 4ZPTB 1K8DB 4YGAB 5DJDB 2XQBL 5SWSB 2P8MA 5TE6H 4XZUA 5T3XL 1UZ8B 4X98B 5A2IH 1RJLA 4EI5D 2C3XA 4L8BB 4GAGL 1FFOB 3QUYD 1N8ZA 1HSBB 3GMOB 4KZEH 2DMBA 2EYTA 4MDJB 4UQ2B 2O5XL 5LXGL 1I7UA 3BZDA 4JAMA 2IH1A 3ABZA 2BSED 5DFVC 1S7SB 2A6KB 3KPSA 1WLHA 5JW3L 2B5IB 1NEZA 1YEIL 2YK1H 3DGGA 1P4LA 4C83B 4PJ5B 4Z7QF 2DKMA 4N90D 4HFUL 5D7JC 4MJIE 3RA7L 1I8LA 5JMRA 1AXTH 2WP3O 3I75A 1IC4H 3TV3L 1WWAX 3RJQB 1PX3A 2FH8A 2QHLA 5KSBF 4HKXB 4TNWF 3C09B 3A67L 4KRMB 5ESQB 1F3JB 1U3HB 3QEUA 3MRIA 3LAFA 4Y2OA 3SCMB 5DMGC 1AQKL 2X4NA 1CK0L 3KJ6L 1PYWB 3HPLA 4QHLA 3FT4A 3EO1A 2R39A 2DOCA 2EDRA 2YPVL 3ME0A 3MA7B 3BT2L 1TPXC 4MA8L 3MOAH 3RUGF 5L7XL 2UZYB 5B3JE 1XF3B 3BGMB 2V17H 1PG7W 1YMHB 2WLZA 4G6JH 1OOAA 5J1SC 3TBYB 5IFHH 1Z9LA 2Z8RA 2QQKL 1Z9OA 4X6BA 4U1HB 4WI6A 5HGAB 3ARGA 1KTDA 2NXYD 2BNUB 3RGVB 1UYWH 3DHJA 3OGCB 5DD1H 2F19H 3IU3A 2P5EB 4EXPX 1CXHA 3ARBB 3VD4A 4F3FB 1IEAB 1FPTL 5KBNC 4GOSA 1N4XH 3T1FA 5FUCE 5E1AB 2W9DL 2R4RL 2BJMH 3CX2A 5FUZH 1JGUH 5K9JH 3BIKA 1A7OL 5E00A 1FLRL 2W0FB 5CMAA 1T89C 2ICES 2Q87A 3KYMB 1X5YA 3UAJC 2K7QA 1ZTXL 1I1CA 4JN2B 5FYJD 3CLFL 5FOBA 1IM9D 1YEKH 4HUWB 4N8VB 5ACLA 2LAAA 2C7UA 5C9JA 4YPJA 2WUCL 4HIJB 4KJYA 3NABH 4P3DB 3MRRA 1RK1B 1G7IA 3W9EA 2XXMB 4QRTA 4D8PA 4K23H 4YK4C 2OYPA 2FO4A 2QJDA 4NHCH 2ADIB 3GO1L 1I4FB 1K8IA 1MI5B 3VD9A 3BD4A 5D7JB 4B41A 2Q86B 1A6VL 4NM4H 2XQYK 1S8DA 1BM3H 4LCIL 3WFDH 1K4CA 4FXGA 1V7ML 1P1ZB 4FFVC 3T3PF 3UPRB 3DSFH 3WKML 3TFKC 1LO3H 1QEWB 1XGTA 1KELL 1Q72L 1JHTB 2ZCHL 2DQJH 1I8MB 2D7PA 4HKZA 1WC7A 2PW1B 4K2UL 2R9HC 3MZGB 2ZP0T 4NQCA 2AJYL 1FNGB 1HE7A 1HXYA 5EZIL 1PQZA 1AR2A 5E5MA 1N7ML 1LO0H 3VW3L 3U0WH 3F12A 4ZUWA 3V0WL 4BK5A 1B2WL 3R06A 4GG6B 1MJUH 2AKRA 3WNKA 1BFVH 4K8RH 3BQUC 4MQ7B 3VFVB 4Y8AA 4XMKH 3SDXE 2YD7A 1J1PH 1RURH 3OTTA 3UBXB 4V2BA 1EGJH 1CE1L 3MNVA 4G3YL 2NPLX 4HF5L 1I8IA 4OM1H 3SDDD 4ODWB 3EW3B 4GLRI 5F44A 4LSQH 1S3KL 4HXBL 4UTAH 2AK1H 3LZFL 4LRNL 5JNYA 1CE6B 5KW9L 2V5MA 1GAFH 1ZLSH 4K55A 4DZBA 2X5PA 4N90E 1ZHKB 1UWGH 2IJ0C 4WI4A 2DM7A 4PJGF 5AG9A 2UZIH 2E9IA 5KVMC 3QWQB 4CMMA 1ZK9A 1NGYA 4OAWA 1E6JL 2DQDL 5CD5C 1DUYA 4PRNB 1K3IA 5A2FA 4P5KB 1S5IH 3WN5C 4GKZB 4XBPA 5CP3A 1HDMB 4WV1C 2C1OA 5TDPA 4YK4B 8FABB 3EDDA 1NCUA 3ZE2E 2VLMD 3OXSA 5CUSL 3IDIA 5JLZB 3DNKA 4PGEA 3BMVA 4G8FB 3AXLB 4OIIH 1ZMYA 4WW2C 5ALCH 1H5BC 4JPVH 1TQCC 5JIIA 1OAKL 5JQ6L 3DTXB 2VZOA 5T1MA 2IBZX 3GSUB 3GB7B 3SDAD 4L29A 3EOBB 4ZUSA 2GJJA 3NCYS 3QUZA 3VFRB 1BZ9A 32C2A 1V7NH 4O51B 5DHYB 4QLRA 5H37H 1TQBC 2NXZD 3KYNB 5B39A 2HRPH 5EBGA 2RGSA 1W0WA 4QTHB 3QHZL 1KN2H 1Y6KR 1CG9A 3CFBB 4N8PA 1EBAA 4N1CA 3FN3A 3TVMD 4M6MH 4POZC 4MLSA 2B7DT 5F1NB 5CS7A 1EFQA 4PJBB 3HPJA 1DBMH 1JGVL 5FYJE 4K7PY 4P3CH 5B4MD 1KN4H 3VI3E 3QQ9C 1FVCB 4NKQB 4F7TA 1MUJA 5DUBA 2BCKB 2WSKA 1NGZB 1UJ3C 3MNZB 3UJIH 2XG4A 4OZFH 1E6OL 4X4ME 4NRYA 2ZOLA 4L1DA 1EEZA 3PL6A 4HGWB 1L6ZA 4JFFB 4DOHE 1KYOJ 1QP1A 2ED8A 4UZGA 1NL0H 3MR9A 4L8SA 3U4EB 1T3FA 1BOYA 3H0TB 2BFVL 4DGYH 4TNVF 2YEZB 3WHXA 4JKWA 4TOYH 3VXMB 2UWEA 5F1OB 1TENA 3WYRA 3WJLC 3H6JA 1MVFA 2CMRL 4QTIH 3KAAA 4U0QB 3GKWL 3WN5B 3CNKA 3CDFA 4KVNH 1KNOB 4WV1B 5I1DA 4J8RB 2R69H 1HXMA 4P2OA 4G8EB 1I1RA 5F7LB 4MA7H 2A73B 1LEIA 4MNHB 4PREB 4NZUH 2QSCL 3BDYL 4WW2B 4WTZA 1H5BB 3HNTL 4EOWH 1TQCB 4NZTH 5H37G 2R0KH 2XA3A 3G5VA 2JE8A 3AM8A 1P84K 1OAXH 1N59B 4ZS7L 1H3PL 1NDMB 2D03H 2YN3A 1VEOA 4HLZH 3QQ3A 3TJHC 4Z8FL 4R2GC 4W81A 3VWJA 1TQBB 3I50H 4JFOB 2ICWJ 3SQOH 1BGXH 5BZWB 5ITFB 5KS9E 2P24B 3D39B 4XP4L 1T22A 1OT1A 4N8CH 5J6HA 1WF5A 4Z76B 5A2KH 4PR5A 3S3SA 3VJ6B 3VXUB 2J88H 1FC2D 3S4SA 2M2DA 1B0GB 3ZT5A 5GGQL 3QEHB 5DT1L 1ETZA 2V5YA 4RRPA 4XBGA 4JHWL 4R96B 1O5DT 5LAXA 2PTVA 5A16A 1NC2A 1RUPH 3L5JA 2EH7H 5GS1A 1UJ3B 1WWBX 3X3FH 3CCHA 2W38A 4EIZC 2NNAA 2ENYA 1UWXK 4P2QD 2VLME 2CGRL 1M05A 4PYGA 1KC5L 3S5LA 1CQKA 1F6FB 4AYFA 1KJ3L 3P4MB 2AV7B 2EXWC 3KG5A 1A02N 4LF3A 3T0ED 3G5XA 4Z7QE 3NIGE 3ROLA 4RDQG 5IVXA 1RUKL 2JB5L 3W0WA 4WHTA 3WSQL 1KCVH 3C60D 5TDOB 2CKBA 1BHGA 5EZJB 2EE3A 4TUOB 1UJTA 1OM3H 1JZ7A 3STZA 2DQIH 3DLQR 1JJUA 1Y0LA 1J8HA 3MGAA 3CGTA 3N9GL 1T7XA 4UAOC 3BKYH 3BGAA 4IS6A 4E5XA 4ZTPH 1ZA6A 5C07B 2C1PB 4JQIL 1UWXH 4OCMC 3B9KC 5EO9B 1YYLH 4B53A 1TJGL 2XFXB 2NX5B 1E28B 3JZ7A 4PRHB 1X44A 3SDCC 2Y1VA 3OR7A 1TETH 5E8NB 2Q20A 4KQ4L 2DDQH 3QXDB 3STLA 5JW4R 2NY3C 4G8IB 1H3UA 1P7KA 3L95A 1KF9B 4XT1C 4WRLA 4FQQB 3VRJB 2P48B 2ADGA 4PJEE 4XCNB 3B5HA 2XT1B 4AENB 1U8OB 5CZVH 1IGIH 5GJTL 5I6XC 4LSVH 2PF6A 1LNUA 4P9MH 5CJ5A 1AD9A 2BVUA 1R5VA 1YEJH 4XXCA 5EZOL 2MHAB 3O6FA 1J5OL 2Y6SD 3MNWB 3CFKB 2P42B 1EAPB 5MEQA 4GJTB 4HZLA 4JGMA 4YGVA 4OUUB 3CSGA 1I3GH 2VZVA 3D6GA 3TNMB 4EN3C 4JE4B 1FORH 1MCQA 2DQHL 4YUEL 4DZ8A 1S7RB 4K7PL 4Q9BA 4AEEA 5F1IB 3WLBA 1A4KB 1JI2A 4JO2H 2Y07H 4ZUVA 5J4MA 4NIKB 3HG1A 2VDLH 3FOLB 4ZFOA 1DEDA 1CFTB 1I85C 1IAMA 3G5ZB 1K4DB 1N0XL 3CPLA 3DVGB 3CSYB 5H2BA 1GC1H 3MJ7A 2APXA 4O2FA 4NO3B 2BOBB 4TUJA 3VFMA 3FN0H 5L2JA 4K94H 5DD0L 5J12C 4UOW1 1P2CB 4O5LH 4IOFC 1MHCA 2BVPA 4F37F 4MJ6A 3OR6B 1FGNH 3CC5B 3FMGL 3T3PE 4JKKA 3PDOB 4Q0XH 3P0YL 1R5WB 4N68A 5FB8A 2G9HB 5DQ9A 1S7VB 4RGMC 1YJDL 4UAOB 5EOTB 1MPAL 3F65A 3STBA 2WUBL 2MOVA 3ZKNC 5JXAH 2VR9A 4XNZC 4FS0A 5KN5A 2FJHA 3VD3A 1WICA 3B9KB 3W9DB 3DMMC 3SDCB 3N1QC 3V6BR 3T4AB 4ZXBC 4XH2B 4MJ4A 1UB5B 2VH5L 2ADFL 4Q9QL 1NCCH 1QRKA 4QRPB 4K3HA 3VXNA 1Q9LB 2F5BL 2NY3B 1U92B 2QHRL 1KIRB 4ZUTA 3HRPA 1G1YA 2M26A 5LWYH 3FT2A 2VDNH 3P0GB 5I6XB 3HMWH 1MCPL 1KBGH 3L3JA 1GOHA 3FZUD 4JG1L 1HZHH 1TZIB 5F3BB 5F7WC 4P2QE 3UTQB 3GSXA 2SEBA 1INEL 3RX8A 3Q6GL 5JORB 3LB6C 3P11L 2VISA 3HE6A 3MBED 4WHYH 5HVHC 4U1JA 5L6YH 1A1OB 2QTEA 4P5TA 4NUGH 3SE9L 3T0EE 4NJAL 4EN3B 3O3AA 4F57L 4ZFZA 2VDOH 5AEAA 2XTLA 3OPZL 2D7MA 1NSNH 5HHNA 4RAUA 1S7XB 1W0VB 2CDGB 2DS4A 1ZV5A 3HC0A 5EA0H 1A7RL 2N7AA 1U8MB 3GHBH 5KSAD 1JUFA 3VXRA 4V1DD 1GOFA 3NCEB 2ZOKA 3OX8A 2H3NA 5AAWA 1ZHBA 4YH6A 2B8OT 5DEFB 4PJHB 4DAGH 1JWMA 1P5UA 5F7NC 3RZWA 1ZLUK 2Y5TA 1GHFL 4PJAF 2PTUA 1KPUA 3N85L 5EUOF 1URLA 2I25N 5J12B 4WEUD 5IK3B 5CD3B 3RKDD 4TTDC 3GMQA 5DK2B 4BZ2L 1KYOK 5SWQB 1Y6MR 2ZJSL 4OF6A 3JV5A 3W2DH 3NBNA 15C8L 3BP4A 4TUKL 4C4KT 1OAQH 1ERNA 4RFEA 5E9DD 4RGMB 3U1SL 4R90H 3L3IB 4YNYB 4HQQH 5TE7L 1PKQB 1BJMA 4AY0A 1LILA 4MXWH 3DMMB 2BNRE 5ADPH 4KRLB 3I6KA 3VG0L 3HI1A 4LU5L 4ZXBB 5D7LB 3CFDA 5ACZA 2R1XA 1T7WA 2WINB 2OTUA 2VO5A 4OFYD 5AWNL 4JRXE 4FQHA 4IDJL 3ZYJA 1KJVA 2UUDK 5F9AC 3U30C 4NNPH 5AYUH 5JW4N 3VCLA 1TVBB 3DGCR 3D3VB 5SWZA 4PP1C 3CXHJ 4PV9B 3OL2A 1OSPH 4GAYA 5FO9A 2EZ0D 2A74B 3CK0H 1GGIL 3RWJB 4Z7UF 3ARDD 1HCVA 4MX7A 1AKJB 2PO6D 1TCRB 3MV8A 4ONHB 3TP4A 5HVHB 1EDQA 5LGJA 4LLUA 3S9DB 4D3CL 2A83A 3HB3D 3UJJH 3MBXL 2H2PC 3FQXB 4XZUB 1U6AL 5E2JA 1G7JA 1MELA 1NCAH 3QXTA 1JHLL 3TA3D 4HBCH 3RAJL 1FAIL 1BQSA 5BS0B 5HYFA 5IMMB 3U7YH 2UUDH 2FBJL 1BPVA 3TLRA 3NGBC 4YDVB 2AK4A 1IEBA 1F2QA 4DKFH 3TZVC 4NGHL 1R24A 3BPLC 2G75A 1S9WA 1KCRH 3SDYH 5GQBA 2VMFA 1CFQA 5AAMA 3UTSA 4X6CB 1IKFL 2ZKHL 4K07A 4WI9A 2WWMD 1YEFH 3HR6A 4YHKL 2VDRL 1AO7E 3DIFA 3QNYB 4EI6B 4O2EA 4LPCA 3QEUB 1OGAD 3MRIB 5IMLB 2CKNA 2HKFH 5A3ID 4RNRA 5LKNA 2RR3A 4U6XA 2OJEA 3HPLB 2HTLC 3FRUA 4MJ2A 4EVNB 4JKLA 4P9HH 3MXWL 1KEML 3VH8G 5D6CA 3VRLF 4HFWB 3D87B 4XPGH 2VC2H 5BRZD 3KPNB 4OZHE 5FGCB 2NR6C 1G7LA 3I3BA 1CD1B 4LVNC 5FCUL 5T1DH 3BD5A 4JFQB 2JELH 4G7VH 5HTSA 1EFXB 5IB1A 5DEGB 1VFBB 3U30B 5CIPH 3ZYZA 3C6SA 1RHFA 3QDMA 4ENED 4KK6C 3RI5F 4V1DE 4MB5A 5FUOH 2GI7A 5JUEH 1EHLH 4RMSA 5F9OH 5C08D 2HT4C 5F88A 4K3EH 1AFVL 3P2TA 1D5IL 4JFZH 1ADQL 4JEGB 1BAFL 3T1FB 3GRWL 1MREL 5DQJA 3PWPD 3U46B 4Y0GA 5E00B 1G9NH 1CU4L 2PKDA 2A9MH 3K8KA 5CMAB 4NQSA 1DBJL 2YWYA 3C9NB 5HGHB 4RAHA 4G80B 1CN4A 3V9FA 1NFIA 2EDYA 5TF1L 4YXLL 3WJJC 1T2XA 5KVFL 3PJSB 1F6LL 2ESVD 1S78C 1YQVH 3IDNB 4JFEB 5C9JB 2XZQL 2ATPA 1F4WL 4QXUH 4UV4L 3NGBB 4GBXA 5E94B 5E9DE 1G7IB 3EO9L 1NANI 4JFPB 4JHZA 2BC4A 3TZVB 1G9ML 3BPLB 2MKLC 4K3JH 1X4YA 3CVHL 1FG2A 3PWJA 4PRPA 1OQXA 1MHPH 5ESVA 1ORQA 5EBMA 1S8DB 1NMAH 2UY7A 4OLVH 2VLKB 4FQXA 3MLSH 3B6SA 1Z3GH 1W8NA 3L1OH 2VL5B 3PWLB 1CI5A 3PHOA 1NGQL 4OJFH 3LKQB 5IBUB 5C0JA 2FR4B 1JWUB 5D7SH 3CDGA 2LFGA 3FFCA 2YPLD 4HKZB 4JR9L 5MENA 3NA9L 2IBBA 4JJHA 4M7ZC 4S2SB 3GBLA 2EH8L 3VA2C 1JYVA 1P4IH 1ZT1A 2EYSA 3MODL 4JFDD 1ZEAL 5L8KB 3S35L 4HT1L 4UU9A 1IILE 3BSZL 4TNVK 4LVNB 4JG0L 3TIEA 3F12B 4ZUWB 2H26A 4OLWL 3R06B 2WK2A 4QNPF 4S0TD 4KROC 5BV7L 3C8KB 4LCCC 4OZFA 1CXLA 5F7EH 5IOPA 1DVFD 1FIGL 2V7HA 5HD8C 1JRHL 4LSRL 1QD0A 4XPTH 2NTFA 1BFSA 4DW2L 1PDKA 5EU6D 2AEQL 1WAAA 5GS0L 3PL6C 1WGOA 2OS7A 5M94B 1TVHB 3QXAB 4M9PA 5HI5C 2XNAA 3ECBB 2W59A 5I8OH 1JF1B 4JFXA 5DVMA 3DYOA 5ID0B 4CMMB 4FQCH 4FA8A 3OKDA 4R4FL 5TH2B 1NGYB 4FQIL 1KEGH 1MFEH 1J05A 4WGVB 1UXWA 1L7TL 2WBKA 3HNVH 4FQ1L 5C0IB 2AGJL 3T8XA 3UTTA 2BSRA 3G6JA 3ZKMD 3V6OA 2NYYD 3W11D 2Z8WC 4G8GA 1D7FA 2C1OB 3D0LB 4I18A 4HJ0D 3OKEA 4LSUL 4MZ2A 4K3DH 3S3PA 4P2OC 3JWDL 5I30L 3IDIB 2P47B 3WFBH 2HH0L 1MH5A 3RPKA 1YEEL 3MCKB 5BRZE 4ONFL 2FJFB 3UO1L 1I9RH 2DN7A 3GGWA 2GSGB 1M7DB 2G5BA 1BBJB 1DQJA 1XEDA 1S5HA 4HXAH 1A9BA 4N1EA 2J8OA 1MHEA 3HUJB 1IL1B 3AFLA 2OR9H 2GFBA 4MLIA 2X1XR 1A6AA 1T03H 2EE9A 1HKLL 3VWJC 1DZBA 4TSCH 3VGHA 1HHIB 1MCHA 3MCLH 3RWDB 1ND0B 2JJVA 4EJ1C 2DICA 2DQFB 4NHUB 4M7ZB 4Y1AA 3EYSH 4N0CC 3BZFB 1RV6X 1OAYL 1U8IB 2AJUL 2Y36L 1YN7B 3PWPE 3AAZA 4WCYH 1CYGA 1PZ5B 5JXED 2ZUVA 4Q6YA 5C0DB 3GBNH 5I76A 4PJ8D 3QUYA 3H2WA 5ISZB 4KROB 3HPJB 4LCCB 4XTRD 5K59F 3MRMA 5CILL 5IFAH 4FFZH 4NKOA 2F54D 3LKPB 4F7TB 1KJ2B 5DUBB 3QFDB 1XCQB 2XOTA 5GS1C 3BMWA 3KXFA 4LLDB 1B4JL 2IC2A 4FRWA 1FHGA 3PL6B 4OI7A 3LEYL 4XP9L 4HULB 3UX9B 1JPGA 3CXHK 1BZ7A 3P9LA 3L5XH 4NQEE 5EUOE 1EX0A 1VACA 3MLXL 2J2ZA 3CIQA 4PY7B 3VFSB 3WHXB 4KHTL 3QT2A 5J6GA 3CFJA 4S1RH 1ZT7A 5E95B 4U7SA 2DJUA 4XP6L 3P0VL 2LU7A 4XWGL 1OGTB 4QHNA 3GK8L 2LU4A 1EXUB 5D71L 3OB0K 4W6YB 4YBLC 5C09A 1F97A 1YC7A 2EDOA 1NGPL 2FGWH 3VXOB 4S11A 3PQYE 4P2OB 1N5AA 4R3SA 4L4TD 2OR7A 1A14H 1A5FH 1D3CA 4D0BB 1CDGA 5JIPA 2X1OA 2E27L 4M6OH 3ZHDA 4CVUA 3C5ZC 2AEWA 2AP2A 4JFDE 4E0RB 3O0RL 3QIBD 3AY4A 3QZWG 3DRQB 3F6LA 4KUCD 1JPTL 4YDLC 4AT6A 4LSTL 1KACB 3SGDI 7CGTA 3CFIC 3WO4C 5CEZL 1AR1C 1G7PA 3QQ3B 5I1EH 4OZGF 3VWJB 4XNMA 2J8UB 1NQBA 3PV7A 3OB0H 2AV1A 4JDVA 4TRPH 4UBDC 5DF0A 3WNLA 2Y5EA 2GAZA 2DB8A 3LH2L 4MMZC 4QHUA 2DRUA 3MX0A 3TT3H 5J6HB 5DURD 5EU6E 1Q8MA 1YUHB 4I0PA 1FL3A 5E2VL 3WFHA 3TNNB 4EXKA 1D5XA 4LLWA 3RWCA 3GJEA 3ULVF 4OQTH 3UMTA 3C2AH 1KFAH 2DD8L 3ET9F 4S0SD 4XCFH 2JCCA 1LEGA 4X6EA 2A38A 3ARPA 4U6TA 1UKSA 1BF2A 4F37K 1RIHH 3JTTB 5CZXC 4XGZA 3T2QA 1UM5H 5LAXB 5A16B 1IGFL 1NC2B 5HYJA 4M7LH 1T5XB 3PWUA 4RISL 3SKNA 3WD5L 5E08H 3Q1SL 5TQ2L 4MD5B 3CCHB 5D7IF 2D3VA 3FO2A 4LVOC 1BFOA 2R8SH 1GRWA 1ED3A 1P4BH 4HWZB 3S35X 1WZ1L 2CR6A 2JF1A 1VFUA 4HKBA 3T0VA 1IAIH 3ZO0A 1IGJA 4ZTOL 3DUSA 3S3JA 4YXKL 5CWSA 4FTVE 4DN3H 3ROLB 1LE9B 3MUGA 4NBZB 1CGUA 3BIBX 5E2UL 4JM2D 1RMFH 2DIJA 2V5RA 2MCG1 4G5ZH 4AIZB 5LQBL 5DLML 1IRAY 4YBLB 3SO5A 1OL0A 5E56A 2W65A 4G9FD 2EEBA 4MAYC 4N5UA 4WFHD 3VWKD 4Z0XB 2QADD 3RZCA 1F90H 4UV7L 4OUOA 2QQNH 5CGTA 1ZA6B 4KJWC 4N0FB 3VRLE 4OKDA 1NCBH 5EBLA 1RQ5A 3C5ZB 4PJCE 1QFUL 3MACH 1SM3H 1KG0A 1JV5A 4QGTA 3C08H 4J6RH 3VA6A 4YDLB 2W0PA 2YPKA 3T0WA 5BO1H 4P23A 3WO4B 1JNNH 4UUJB 1CF8H 5GSRB 4ETQB 2F54E 1M71B 3A6BL 5IFHL 4HUKB 5EIIA 1SVZA 1LNUB 1KXVC 2X9WA 1DQLH 1CLZL 1SBSH 4G6AD 1R5VB 3ZE0F 5D7KE 1YMMA 2KQNA 2YRZA 1ZANL 4A2LA 4BUGA 1QRND 5DUML 5IKCA 3QDJB 3HE6C 5DQDH 2R2EA 4YGVB 3HNSH 4P5TC 3QNZB 3BKML 5KVDL 3HE7B 1J9CT 2AJXH 2OBGA 3UYPA 3VFPB 2XIDA 5E6ZA 4Q9RL 5GGRY 2NLJA 3ARED 5EFIB 4LCWA 4OF3A 3BKJH 4ZUVB 4ZSOB 3WBDA 1U9KA 2IANE 4LVOB 1SMOA 4UILH 5F9JA 4B0MM 4BFIB 5IQ7H 2R0LH 3QULA 3ZKXC 4JM4H 5KSBA 1G7QB 2BY1A 5EBWB 3VFMB 1KLUA 3X13B 2X9XA 1GIGL 3MO1B 4QRSB 3MRCB 4NC0B 5E6IA 3SDAA 5L2JB 1R3JB 4H0HB 4PBVC 2GSIB 2FYYA 4DVBB 4UT6L 5HHQA 2E7LC 5TE4L 4CN6A 2Q76B 3VD5A 3OKYA 4XWOC 4MAYB 1I7RB 4BUHA 2HVKB 2ADJA 1A3RH 5IGXH 5FHAL 3OJDB 3RUGA 1KPRA 4LLMA 4ZD3H 3QI9D 5ITBL 5F1KC 4OTXL 4EZMA 3DXAA 1KB5L 3SOBL 4FN0A 5KN5B 4NZDA 2OJZH 1LHZA 2R4SL 3CUPA 1XF4A 3NCMA 2AXJA 1W0YT 3BH8B 3BPNC 1MCDA 2OMNA 4HMDA 2BVYA 4M43H 1C7TA 5DJYA 1T20A 3FHQA 1K9TA 5FA3B 3QIWC 1RU9L 2FX8L 4YR6B 1EPFA 2WQRA 3RWEA 5IJVA 1AJ7L 3FCTA 4QNPE 3NIDF 1ZGLA 4H1LB 1AXIB 2P4AB 4ZUTB 1INDL 4AQOA 2IH3B 3TH3T 4IRSD 2X41A 1WWCA 4GS7C 4QYOA 3UTZA 5DZOA 4EUPG 3L3JB 3JSSA 3GSWA 2XZCL 3QIUD 3ALWA 2OMBA 2NCMA 2EDBA 2SEBB 1WIUA 3RTQA 4FQLL 2JTDA 3HE6B 3U7WL 2CLVA 3ULVD 3CZFA 1MFDH 4P5TB 4QRRB 5CGYD 5DZNA 2WZPD 4U6VL 3EJYD 3O3AB 4XX1E 4ZFZB 2G2RB 4P5MA 1Z2KA 5DJ0B 4NQXB 3WLWD 4ZO9A 1MCWW 4ZFGL 4RZCA 3SO3C 1FBIL 2ZOKB 3OX8B 3P3YA 4G9FE 4PJFF 1ZHLB 2H3NB 3VFWA 4MNGE 5I66A 4WGWB 5HHOA 1ZHBB 4ELMF 2XWBA 2OZ4L 4HPYL 2W91A 3MYJB 3V5HA 3QSKB 1P7QD 1JWMB 2HJKA 3ZKXB 4OBSA 3OAZK 5J9PA 1RFDL 2HFEA 5FDYA 2IGFL 2I26N 2APBA 2DLFL 1M7IA 4Z77B 5EZLA 1NAKL 3V7MA 1MCNA 1MY7A 3DETC 3LKSA 5ERWA 4L4VD 1XFPA 4BH7B 1WITA 1YY8A 5HY9B 1BEYL 5I19L 3WFZA 4WWKD 2ZG1A 5D2LE 4YQXH 12E8H 1KCUL 4CU7A 3NCBB 5I75C 1MCFA 3RI5K 2F74A 2FIRT 2HWZL 1LDPH 1AC6A 3FRPG 4HV8B 4U3CA 2MMXA 2R23B 3FAXA 3IXAA 2BDNL 1RIVH 43C9B 2CRMA 4MD0B 2P7TA 5GRWA 1VB9A 1F8TH 2IAMC 1ZE3C 3OXRA 3O8XD 5TQ0L 4DK3A 4E41D 3BPNB 3NCJH 3OAZH 3EYQD 4FZ8H 4OB5L 4K8RC 2V9QA 4P2RE 3QIWB 3KYKL 5IEKB 4TTGA 2OTUB 1KN2L 5IFJB 2X4RB 2EO1A 3S96A 1FYTA 1ADQA 4PV8A 2OX5A 5A40E 5DHVH 3V52H 3KLAA 3NIFE 4GS7B 3VCLB 3V4PL 2PYEA 3WE6B 1D5BB 4HSQA 3BXNA 5J3HC 3TO4A 4OT1L 4U1SA 2E6QA 5J1TC 5INCB 5GRJH 4PJGA 2PN5A 3BQUD 3GMLB 4PJIF 3BP6B 5IESH 1A6TA 5FV1L 3OF6A 2AJVH 1DQDH 2ARJB 2YD2A 4UB0H 4WNQA 2W9LA 2VWEE 4RA0C 1BWMA 1AQDA 1VEMA 2WBJA 3SJVA 2Z0BA 3O3BB 1IQDB 4HCRH 3CVHA 5FM5O 3SO3B 4KJPD 3MRGA 1LE5B 5GHWL 2B0SH 2Q7YB 1LP9B 1MI5E 4ZODA 1FNLA 3CXDH 4NQDA 4PRAA 5D9SA 4M8QB 3F8UB 2P1YA 3PDDA 1FG9C 1NLDH 1PY9A 2X7LB 2DWDA 3NFNB 5T1KA 5DVOA 4UTBH 5FKAA 1KB5B 3WL9A 1XT5A 2ZUSA 4GXVH 4OCSL 2F9BT 3U9PH 2OTWB 3GIZH 1CS6A 4O2EB 2X70B 5J1AA 4F58H 3LQMA 3WIIL 2HJLB 2XZZA 5I75B 4RNRB 2OXHA 2OL3H 1HEZA 3HRZB 3UC0L 4OZGE 2R0KL 5JHDB 4ZS6D 3VRIB 3FRUB 4KKBD 3NZHL 3ILPB 4JQVC 3KR3L 4MGXA 5F89A 5FO7A 4AMKH 1CBVL 2IAMB 4FOMA 5H35B 4CGTA 4QCIA 4GG6E 3CSPA 4QKXB 5CFHA 4I2XA 3LS4L 2HG5A 4YO0B 1KIUA 3TC9A 5DRNA 1HCFX 3SQOL 3U4BL 2IADB 5GGVY 3DI2B 3MLWL 5DC4B 3B3IA 5I0ZA 1ACYH 2A6IA 3OBAA 1T1WB 4RGNC 2NW3A 1CL7H 5IB1B 3VMOA 1VDGA 5FUCC 3I84A 1U91A 5FKPA 1MCEA 3PABB 5FGRA 2PNDA 5D7IE 5IEHB 1X5AA 4XP5L 1MAJA 5TJWK 5F88B 2MNUA 3G08A 1MJ8L 2VE6B 4FQ2H 4LOUC 1J1OL 4APQD 3G04B 3N06B 4YFLF 4U49A 1JK8A 3ARFA 2Z8SA 1JP5A 1OTTC 4NQSB 4XNYH 4Z5RA 2VLJD 1S9VB 3BN9D 5C6TH 4X6FA 1SYSA 1MQKL 4PJXA 5DK3A 2PR4L 4AG4H 2LABA 1QR1A 1LK2A 4LLYA 1FZJB 5GZOC 2VDPL 3RDTA 1I7ZA 4M5YL 1BIHA 4NKMB 4RMWA 1C5CH 4PGBA 2MPAL 4F2MB 1QBML 1AXSB 1ONQA 1DL7H 3FONA 3O4OC 4E41E 5JPMA 3PIQB 4X5LA 2BXYA 5C0CD 4F7MA 5ESVB 5EBMB 4ODSL 5HJ3A 5IB2A 4KQ3H 4G6FB 1CFNA 1SJVA 3KPRD 3S34L 3TPUB 3IYLW 2X4QB 3M8OL 3I02A 1TXKA 4OLYL 5FYKD 2BSTA 3QZWA 2PXYC 5HHMD 4R4BA 1OSZA 5D2NA 2H45A 2HFFA 1J1XH 3CDGB 4UOW0 4LNRB 5MENB 3RVXD 3L7FB 1E4WH 4OGXH 4U2ZA 3ZE0E 4F33A 2XZAH 1A6UL 5I18H 1PG7L 3Q3GB 3O11A 1E27A 4OCLC 1F11B 3EYUH 1JGDB 1JVKA 1A4JA 4TQEL 2K9UA 4EI5C 4Y4HA 2D7OA 4NUJB 3U36B 1SY6H 5TFSH 3QUYC 1YDPA 2MFNA 3MXVH 1RHHB 1T2QL 1ZWIB 2VDML 3B5GA 4OZFB 1AY1L 3DX6A 3P30H 1BLNA 1U3ZA 2GTWB 4JDZB 2X05A 3GEWB 4H88L 4DN4H 1T4KA 2A9NH 4QRUA 5CBAB 3G9AB 3HFML 4PGZA 1RJZA 5FYJL 3HA0A 3IKCA 3HZVA 5IT2H 1AGCB 1RK0B 5BMFH 4HH8A 4G6MH 3M17A 5DMKB 1RVFL 2XI9A 4J4PD 1DBBH 3U6RA 1A7QH 3D18A 4E9LA 2XNAB 3PNWA 2ZSWB 4OD1L 3V0VA 4JFXB 5F96L 3ES6A 3LPGA 5EORL 5IB3A 2D4FA 5B22A 2UV3A 5E7FA 2XV6B 2NY5H 1DQML 2R2BB 3FQWB 5D1QA 1MAML 4ACPA 1VKXA 4X7TA 3G6JB 5I1AA 3K4AA 1S9XB 2NY6C 2NY4D 5DVLA 2FJGB 1OB1B 4RIRA 4K71C 1B0RA 2HN7A 3ETBF 1IC1A 3IJYA 4HHAA 3MOBL 3BI9X 3O4OB 5D5MF 4OFYA 4XPFL 4LKCA 4LASH 3RVWD 4DTGL 5I1GL 4N9GB 2NXYC 3N1GC 4BA8A 5HYEA 3ARWA 1S5HB 1CGSH 3T3ME 1L0YA 3AY4C 4YHNB 4NFDA 3NAAL 5CZKA 3P77B 2PXYB 3HLAB 3EFDL 4OF5A 5CSGA 5DUPL 3ZDZE 2VN7A 1QFWL 5MERA 1N5YL 4UT7L 3G6AB 1IZJA 2R1WA 4KDVA 4NM8H 4Z7WF 1T1ZA 4JFHD 4M4RA 3RU8H 3ARRA 1WQVT 1A7PL 5AUMA 3X3GH 3AAZB 1NBVL 5C2BH 3EO0B 2FLRT 4J1UA 3WFEH 2BSSA 4MXVF 3TA3A 4EI5B 3ULVH 4LAJH 3V95A 2Q7NA 3QUYB 3SDXB 5DVKA 1QA9B 4W6WB 3MRMB 4LLVA 4ZQKA 3H7BA 5K9KB 3FT3A 5LBSH 4GRWF 4JJ5B 3ORJA 4P59L 4U1GB 2DAVA 1BBDH 3QA3A 1GC1C 5BCAA 4J3OC 3OSKA 4HC1H 5GGTL 3D2UA 3HR5B 4Z0BH 5ADOH 2F58H 5EA0L 5CJXA 5EPMA 4K94C 5B38G 2P5WA 1FGVH 1P7HL 2JB6B 3LSOA 4XVTH 3P9LB 3IRPX 3TBSB 1VACB 1OGAA 3PWNA 1HSAA 9CGTA 5GISH 1IC5H 3O3DB 3KPRE 3ARVA 1VGEH 5C92A 2AXGA 5FYKE 1VADA 3FQTA 3LIZH 4NN7C 5C0AA 4K71B 4OD3L 3B8YA 1JNLH 3VFTB 4R3SB 3QG7H 3O2VL 4PB9L 2F15A 3ELAT 5E8OA 1QBBA 1S9YB 4QXTB 1QNZH 3TEUA 4EDWL 2NXYB 1SEQL 1PKOA 5CP7B 5JZ7D 2FX9L 1XGQA 3ZKND 1R5IA 3NH7L 1F58H 5C08A 4Y2DA 1QSED 4OLXH 5ABDE 1TTUA 2OQJB 3SDDC 1OF2B 3MZTA 4PLOB 4JANA 5T3ZD 4J3TA 5JOFA 2AV1B 1RUAH 2DBLL 2G5RA 3GKZA 4LPYA 3O45A 1FE8L 3AU1A 4QHUB 2FSEA 4YIQA 3VXQB 3GSQA 4EUPA 2VR5A 3QUML 1BQHG 1OP3K 4IJ3C 1NH6A 2EXYD 3UYOD 1D5XB 4LLWB 4YHIB 5FYLE 1IM9B 5GSVB 3H3BC 4LLAA 2ESVA 1O7VA 3W82A 2ZPKL 1HNFA 2D9CA 4JVPA 3NPZB 1HHKA 4OCWH 4U6HA 1XGUA 2BY3A 1KT2A 4JO3H 5F8RC 3MRFA 4H5SB 1FNSH 2ICWI 4MSWB 5E8DL 3S37H 2Z4QA 4DOHB 1GGCL 1QSFD 3EHBD 4PJAA 2Y06H 3B5TA 2F8VA 5CKGA 2DMCA 4N0UE 3HI6L 1PG7X 3GMRA 1AP2B 3QB7C 1NLBL 4PG2C 4Z95L 2BHZA 1MFCH 1MFBH 1SEBB 1DTUA 1IGJB 3BE1H 5CWSB 3SDAC 1OAZH 3MUHL 4NT6A 2DWEB 1YN6A 3QPXH 4CDGC 4DUVA 3FFDB 3TGXA 2DLHA 3QDGD 1A9EB 3MRJA 2YPLA 2NXZC 5EWIL 4X6DA 4NN7B 4PUBH 4LHJB 2A6JA 4YX2H 4NWUL 2C9AA 5FV2A 5I0DA 1JZ6A 3T0AA 1CGXA 3IXTB 3K4DA 1H8OA 3FRPA 4R0LA 2DJ4A 1P5VA 3ZL4H 1CGWA 4YC2C 2WBWB 2WWKT 5ANME 4NQVA 3TVMC 2ZSVA 4R8WH 1TDQA 1QLEL 3I3EA 5B4MC 3LN5A 3KDMB 4OM0L 2HMID 2VLLB 3V4UH 3SGJA 1VHPA 2HTKC 5KS9B 1J0HA 4NRZA 3SDDB 1S7UA 5DRZA 3SPVA 3OG4B 3SY0A 4UI2A 4Z7UA 2R1YA 4YAQB 2YD3A 1XCTA 3KYAA 5HYQB 5I9QC 4PY8J 3ARGD 4U7KA 1W2KT 4MA1C 4IJ3B 2VXVH 1ORSA 2XN9A 3CFCL 2NTSP 1NFKA 1UM4H 4R7DA 3FB5A 1ZS8A 3WIHH 2R2EB 4H8WH 5EO1B 5DJAA 1PEZA 2OP4H 4HK3J 4PS4L 4O2CB 3SKUD 4MWFA 4X0KA 4X99B 2OZ4A 1DCLA 3BGFC 4MS8D 1CT8B 1UH4A 4QY8B 1EIBA 4Z7VA 1WIOA 5DMIH 5TGBB 4ODVL 4M1CD 1SJHB 1T0NB 2YA0A 5FGSA 5CHNA 4PB0H 5IG7B 3ZT6A 3NVQA 3WUWG 5FO8B 2J7LA 3RP1A 3QULB 2BERA 5KSBB 5KVGH 4O02H 1I9JH 3KPQB 4CU6A 3SDAB 5I8CA 1F4YH 2FYYB 3QO0A 4JCMA 2BZDA 2BY0A 4CKVX 3CVIH 4KFZC 1QLRA 2NXZB 2NZ9D 1PKQE 1DBKL 1CD0A 1E4KA 3QDAA 5T3ZE 4IMKA 1FCCA 1B6UA 2IQAA 4U1LA 4FNLL 1DN0B 1GPOL 1Q1JH 4LLMB 3MLSL 4M3KB 5IW3A 4HJGA 4MA3A 3L1OL 1QFOA 4LAQL 1IAOA 1U58B 4YC2B 3CUPB 1LD9B 3DX9A 4K7FB 4OJFL 5EUKB 2RQ8A 4S1SL 3TVMB 4L8DB 5DHVA 1MLCB 3U82B 4DKEH 4CVZB 3QP3A 4LHQB 3HZYB 1OPGL 1JHKL 3QUMB 4QXGL 4PJEB 2JK5B 2PUQT 4NO5A 2Z93A 2X1PA 3D3VE 5I1JH 4JO4L 4JFYA 5INDA 3U2SA 1S7WA 2AJ3A 5JDJA 3OKLA 3MROB 4OD2A 3OV6A 1BECA 4NQCD 3H8NA 4FQJH 3GI9L 4OCYH 3UTZB 3GM8A 3F58H 1RUQL 5EC2A 1QSFE 4URTB 3TBTB 4PJ7F 1G9NC 3IFOB 5I9QB 1X4XA 1BOGB 4NRXA 1JF6A 1UM6L 4MA1B 3T0EC 3CMOL 3TIDA 5KANG 3ZTJH 3T4YB 5GGRA 1KIPB 4NQUA 5EU4B 1EMTH 1FFNB 5CKAA 3C60C 2VABA 3OJ2C 4ZFFA 4E42A 1JPFA 4DK6A 2M1KA 3KPSE 4JDTH 3VDAA 3RX5A 4L4TA 1KB9K 3A6CL 3S88L 2XWBB 1T0MA 3GSRA 3PHQB 1BD2A 4PPTA 2HJKB 2ICWB 1FH5L 2HFEB 4QWWD 2H8PB 2Q8AL 4KVCL 3EUUA 4K3DL 4QOKD 1YY8B 2OL3A 4JZNA 1JGLH 4UNVA 5EG6C 4DFIA 5IW1A 2YSSA 2GT9B 3QISA 3RFZC 3D9AH 4XNQA 4RWHA 1QBLL 5DD6A 4AEIL 2FX7H 4BQ8A 5C6PB 43CAB 1I9IH 2B2XH 2Y6SC 5GGUB 3O2WL 1DEEA 4F15C 3MRKA 3G5YB 4JKPL 3IXAB 4YXHL 1WWWX 4LARH 5FGCE 3MUJA 2P7TB 2GK0B 2EDXA 3OXRB 4JVUA 4PRIA 4TSAL 4BJLA 1F4XH 3DECA 4GG8B 4JPWH 3RKPA 5IV2B 2APTA 3QUZD 4YLQT 1MNUH 5CIPB 3THMH 2ATKA 4M1GH 5EU7C 4LSPH 2FZ3A 4PV8B 5GRUH 3U0PA 1A6ZA 2EDHA 3UYRL 3M1BA 1AGFA 3R1GH 4KDTA 5E99H 4GRWE 4P2QB 1DBAH 5GXBB 4BYHA 3CH8A 2XWTB 3T77A 4KAQH 3GI8H 1MCLA 4CL7A 1S7QA 3BPCB 3T0EB 1WEJL 3F5WB 4LFHD 3S36L 3LQAL 5A2LH 4CW1A 3O6LH 1XH3B 4YDKL 3C60B 4NO0A 2D7TL 2F53A 5D6DC 4A6YL 1YEHL 2G60L 1UKQA 5D1XD 1MJ7H 2DYPA 3LMJL 5IWLA 2LU3A 1IE5A 3ZZ1A 2JLLA 4P3WA 3BZEA 4IDLA 2XACC 4LPVA 3C5JB 5C1MB 2I9TA 4PRAB 1UVQB 2BVOB 3RDTC 1CDCA 4LBEA 1KJMB 1NMBL 4WUUA 4ZO8A 2YUZA 3QCTL 3QXVA 1BJ1J 2DM2A 3RNQB 1NGXB 3E6HA 1GZPA 3TPKA 4PP2B 1MCWM 2RBLA 4YDJA 6CGTA 4O9HH 5GJSL 2NY7L 3BO8A 4WEBH 3C8DA 4XI5D 2JJSC 2ITCB 4HAFA 3NACH 25C8L 4AH2B 1T04B 3FZUC 1HEZB 3QJFA 4YHOH 4NQCE 1JNHA 3FQRB 2GUOA 5T3ZH 5HGBB 2OK0H 4F15B 3NCYP 1QRNA 3QR2A 5D70H 3HC4H 1RZ7H 3PE9A 5F89B 3VXTA 1X7QB 1WCBB 5JTWA 2R2CA 4M1DL 4NC1E 1FL5A 1AGEB 4GW1A 4YFEA 5MEOA 4JY4B 1M7XA 3JWOL 5KSAC 1C5DA 2NW3B 2ZUUA 1RIUL 1OCWH 2Z91A 3I9GL 2EC9U 4W4OA 4M02A 2LVCA 4QHMA 2DQTL 1I1YB 3MRNA 2EYRB 1U8KB 4DJMA 4YHZL 3V5DB 1J8KA 1BF8A 3I3DA 1RZFL 3MUZ1 1HHJB 1Q9WA 5I1KH 3D69A 4UINH 1IC7H 1JK8B 1FNEA 5TPWL 1NUNB 4F7CB 1HILA 3RKDC 5B38A 1OP5K 3HMXL 1ZT4A 4YDIL 4BSVA 2W0KA 3LCYA 2X44D 1LO5A 3IDGA 4KTEH 3ZSTA 1MEXH 4RFOH 4HWNA 5SX5H 3DVNA 3QI9A 1LK2B 3IFLH 3DX7A 1RZKL 4Y4FA 5D72H 4YHLH 1NAML 2V2XA 3T2NL 4D2NA 5I1CH 2LVEA 3Q6FB 3SE3C 1EK3A 1Z9SA 3W0WD 4GMTL 4AEHH 3OJMB 2R2HB 1UQSA 4L1HA 1G6RL 5GZND 1VPOL 3IDYC 2APVA 5L8JB 4WU7B 1XF2B 5IB2B 7FABH 5EU3A 2QQNL 2YR3A 2XY1A 1OP5H 4GAJH 4D0DA 1J8HD 5CINL 1IAKA 2W9EL 3D0VB 3I02B 3IGAA 4MB3A 3GHEH 4OFPA 1FL6A 1A3LH 3K3QA 4R4BB 2EZ0C 1IGML 2E9WA 3ARDC 4ORGA 5ETUA 6FABL 5KAQG 2PO6C 3MBEB 4X9BA 4HIEA 4OZHB 2DQGL 3HB3C 3O4LA 3FTGA 5FA4B 3OAUH 4M5ZL 1U8PB 1E27B 1ES0A 1BQHA 1A4JB 3FO1B 4WTXA 3TA3C 4YJZL 2K3TA 4GRMA 5KSAB 1GZQA 1YDPB 4V1DB 4IHOA 2YD9A 4NYLA 3QWOB 4HC1A 1W72H 3VGBA 4YEFA 3O6FD 3ZHLA 1I1AA 1BLNB 4R9HA 5DQDL 3HKFA 4GRWH 1D6VL 2CIIA 1P7QA 3MV7A 4TVPL 4GW4B 1TJHH 3FHAA 3D1MC 1JFQH 3V6ZA 3B2VL 2BRRL 3NZ8B 2UWEE 3M17B 4L4VA 1S7TB 5GGSY 1MCOH 2WWMC 1TFHA 4XRCB 4JKMA 3RL2A 3D18B 1C7SA 4WWKA 1A1MB 1P9MC 5IB3B 3HG1D 5A3IC 5CBEA 4LGSB 5E9DB 2IMMA 2VLRA 2Y23A 1YECL 1TNNA 5DJXA 4ODTL 3TT1L 2RCSH 3BISA 3SBWA 2AAVA 3O8XA 1CIUA 3QUXA 4L8CA 4ZNEA 3S36X 2HN7B 5J7CC 1EJOL 4PG9B 4I8DA 3ZDXF 5L9DL 3GIVA 3NTCL 3UZQA 5HDBF 1QTYT 2FHFA 1YYML 3IDYB 4LKCB 5A43C 1BWWA 1JN6A 3BWUC 4HS8L 3MLUH 1TZHA 4CBPA 1R3LA 1LGVA 1HH9A 4WJ5A 3VFOA 1JGEA 3X14A 5AZEL 5KSUA 1EEYA 2L7UA 1L7IL 4ENEC 1FDLL 1BP3B 1G7MA 4Y2DC 2B4CH 5I1LA 1HHHA 4RMRA 2WMPA 3ARDB 2Y72A 5MERB 2OSLA 4RX4D 2PO6B 4XCEA 4UQ3A 3MGOA 1DSFL 5C7XL 4JY6A 3R0NA 1T1ZB 3IU4L 5AUMB 3UEZA 4KI1A 1EH9A 3PGFH 1T83C 4DQOH 4LHUG 2EDFA 2BSSB 3TA3B 35C8L 1HINH 4ERSH 2FWOA 3PUCA 2J6EL 4LLVB 4ZQKB 4YE4H 1HQRA 4PTTA 2JJTA 1KUMA 4IRJB 3KPOB 2DI7A 4LQFH 5MEPA 1K6QL 5C0EA 4PRBB 3RY4A 2Y7QA 3CAFA 3O6ML 3WDIA 4NWTL 1JTTA 1V3MA 3U0TB 5EC1A 1G6VK 5JR1L 3D85A 5IVXE 1RZIA 1TVDA 2B1AL 1HIMH 3VE0A 3W0WE 2CK0L 1NAMB 1CDIA 3LSOB 3WUWA 3VXRD 1OGAB 1D9KA 4YWGH 4R26H 4LK4A 4P46D 1CDBA 1J8HE 5J56B 3VDBA 3ARYA 2AXGB 3VI4F 4Q9CA 3ULUL 1XF5A 1NC4A 1WFOA 5BRZB 1INQA 4PGDA 4TPRL 2O61A 1BVKA 5I2IA 4HIIA 1IFHH 2OXGA 5DRWA 4C56A 5J06A 3SGEH 2VDQL 4R0LC 4WI2A 1E4XL 4JZJC 2YD1A 4NNXA 5AD0A 2AJSH 3KWWA 1D5ZA 5I8EB 4OZIA 4OLUH 3RY5A 1V5JA 1FRGH 4PJ9A 1DVFC 4XVJL 2CDEB 2YC1A 2V7NA 5C08B 3SGJC 1HNGA 4LCUB 4OCRH 2FCBA 3J7HA 3VXSD 3FQUA 3PWPB 2CJUL 3X12A 3IDJA 5L2KA 4PBWD 2KZ1B 2VXTL 3WIHA 2FSEB 4GW5B 2VLJA 2AABH 4ODXB 4XB7A 5FF6A 2BVEA 2Z92A 4H26B 3CDYA 4NP4H 4KHXL 5DD5H 2FL5B 4LLQA 2P8LB 1FFPA 4JCLA 2HT3D 2ESVB 5B8CA 4UT9H 3N50A 5SWZD 2W60B 5M95B 2BY2A 3DO7A 2WIIA 3EZ8A 1HHKB 3HG1E 5DK0A 5HDQH 2EKJA 4GXUM 2DQCH 4ONGH 4PJFA 4X7SL 3T2OA 3ZKMC 2NYYC 3FB6A 1BJ1H 2FDBP 5D96C 3W11C 4ELMA 4HJ0C 2H1PL 1YNTA 1LEKA 3MV8D 3MFFA 2Z4QB 4DVRH 2Y9RT 4PJAB 5KG9A 5F8QC 3D25A 4JFFD 3QJHA 4OGAC 5C0CA 1HI6A 1AIFB 4UIKL 4N1HB 5EUOB 3KS0J 4I0CC 4MQSB 3O9WD 4HCRL 1PGRB 5HYIA 3E3QC 2D2OA 4KV5F 1I1FB 5F72S 3H9HB 5IHUL 1N26A 3GSNH 4KZDL 1LK3L 2YKLH 2YUVA 5DHXB 3QWRA 1NCDH 4JB9L 2AK4D 4LCYB 4OZ4A 2YPLB 1ZXQA 4KK5D 1E4KC 3UTSD 2AQ2A 1H9VA 2ARWA 4JFDB 4KPHL 4GRLA 4F58L 1CL7I 3UTOA 1Q0XL 5JXEC 4R0LB 3DX8B 1MCJA 2AEPH 4CMHC 4JZJB 4PJ8C 5I1HL 4M61A 1X4ZA 2FLBT 5J89A 2HRLA 4TYUA 4WFGE 5C0BD 2ZUWA 4B7IA 4XTRC 4HDIA 5JW4Q 3NOIA 1PSKH 3ZSSA 3OKOA 4HX1B 3HS0B 1DVFB 3EYOA 4WU5A 3KPMB 3JBG7 3QFJA 4YHMH 2R0WH 4NRZB 1LWRA 2ARJQ 1C8PA 4ZUUB 2O5ZL 2R1YB 5EU6B 3TYFB 5DRXA 1FO0H 2X89A 2IBZY 4EBQL 4PJIA 2EDKA 5IM7B 2APWA 1AGDA 1U93A 4S1QL 4MHHG 2UYLA 4XBEH 3FB5B 3FO0H 5DJAB 3QDMD 3VXRE 4X0KB 1C08B 5D96B 4LDEB 1J0KA 1A6WH 4X80H 1QO3A 3DJ9A 4XAWH 3O6KH 2ZUXA 3E2HC 3MRPB 1MVUB 3QRGH 1QVOB 3RWFA 5AZ2H 4KU1A 1J10A 3T04D 4DGIL 1BIIA 4FTVB 3ZMRA 1KTLA 4L3CB 1ZLVK 3QIBC 3V0AC 2CKBH 1X5LA 1IJ9A 2IEPA 2ID5A 4P49A 4X5WB 4XNUL 4O58L 4KMTH 5SX4H 1RZJL 2A77H 5BXFA 2GCYA 3H3KA 2P45B 4GBXD 2DMKA 5DD3H 5IMOA 5T5NF 1OHQA 2P43B 3RHWF 4XP1L 2VXSH 1QLRB 5DC0A 2A1WH 4C4KO 2VITA 4HKJA 4QRQA 3CLEH 4GXUN 4PRPD 3IFNH 4HMCA 1BVZA 1F6AB 3E6FA 3MV9A 4HJGB 4JGJA 3HI5L 4PRHD 1N64L 4L5FL 4FQXD 4HH9A 4CMHB 4PTUB 5BQ7A 4PJ8B 3G6DL 2F5AH 4I3SL 3MRQB 1ZLVH 4KUZH 1AI1H 1C5BH 4HS3B 2FRGP 2F54B 2Z93B 5SWZE 3FFCD 3U2SB 3VFGL 3CX5J 4JRYA 3F7RA 1DDHA 2DTMH 3I6GB 3EYUL 1HHGA 3BEWB 3MV8E 3NFPA 4A6YA 3W39B 5EC2B 1A0QH 3IS1X 5I1IL 3IDXH 5HHPB 3WXVL 1CFVL 3BZ4B 4JN1H 1NBZA 3QCVL 2EECA 3TIDB 4RGND 1GGBH 2QSTA 4UIMA 1P53A 3L3GA 4XX1G 1A8JH 3MA9L 3JTSA 4P4RB 1J7VR 2ZCKH 3ULSB 1CLCA 5I8KH 4LSSL 2I60H 5HHVH 1XGPB 5CEYA 3PP4H 2CPCA 2AK4E 4NQTA 4XC1L 3VWKC 2QADC 1DBBL 3P73A 4Q2ZB 1GOGA 2H2SD 3E2HB 5JOPD 4HPOL 4H20L 4KI5F 3UTSE 5ICXA 5BJTA 2IG2L 5EOQH 1CZ8H 2MCPH 3IJHA 4XMLH 3QIBB 3ZDXE 5K9QI 3GUTB 1MLBB 4XNXH 4K9EH 5GS2D 2VQUA 1UB6A 2GTZB 3T65A 3CSBA 3UTTD 1IVLA 4JZNB 1QSEA 4ESKA 4GQ9H 3FN9A 1IM3A 2EIZA 1B0WA 4F9PC 2IFFH 4XNQB 3SKMA 4HWUA 4Z7OF 4IOSD 3OZ9L 4HWEL 4MMXC 1YNKH 5DURB 5EN2A 3UJTH 1DEEB 1RUMH 2FECL 2I9LA 4PLNC 2A6DA 2DLEA 3IETB 4WVRA 3TBWA 1ZVHA 1N6UA 4HJJH 4M00A 4MDIB 1DFBH 5FHBH 2FATL 5CCKL 2D0HA 4ODBD 5E24E 4M7JH 3MJ8A 1JTOA 4DEPC 2V2TB 1L6XA 3QDME 2ATKB 4MD4B 2Q8BH 1A1NA 2CXKA 3AREC 3EYVA 3H9SA 4Y1AD 3LRSB 2XQBH 5T3XH 3RY6C 2VAAA 1R3KA 3M1BB 5FYJU 3CH1A 5IQ9A 3PGCB 4W4OC 4OBRA 1CDHA 1QZ1A 2EEDA 4OIAA 5TF0A 2FIKA 3GMPB 3T77B 3LDBC 1EHNA 4HUNB 2X2YA 1K5NA 4YPGB 3AB0C 1S7QB 5DJ2B 2O5XH 5LXGH 1OAUL 3E8UL 1CWVA 4N8VG 5DDHB 3E1F1 5JW3H 3V5KA 1UG9A 5CSBA 2VWEC 5GS3A 3DRTB 4JM2B 2NY5C 1YEIH 3QDGA 1RJCA 5E8EB 4HFUH 4CNIB 3RA7H 3KXFD 5HGDA 1ZA3B 4G9FB 1P84J 3VWKB 4YZFF 3NFSL 2QADB 3TV3H 4MNGB 4NFBA 2Q6WB 3QI9C 3A67H 4X8JA 3QEGL 2ZNXA 4F7EA 4PRPE 1AQKH 1IC5L 2BNQD 2IPKB 3KJ6H 5D5MA 4FXKA 5JW5A 1JPST 1DLFH 5J8OA 1XGYL 2YPVH 1GGUA 3BT2H 3ROOB 1FZOA 4HK3N 4MA8H 2D0FA 3P4OA 1QLFA 5D2LB 5L7XH 3BP7A 2IALA 3IJSB 5C09D 2NY6D 3N0PB 3RWHA 1VA9A 2EE2A 5IB5A 3RPIA 3LEXA 3BO8B 3BKCL 4IRSC 3FFCE 5MENE 4HMEA 2QQKH 5MP6L 3MLYL 1F5WA 1IZKA 4WENB 3QJFB 5IR1B 4ZAKA 3QIUC 4Z7WA 3KLDA 3IF1A 5TDNA 1QRNB 2VIRA 5CGMA 1FN4B 4U3XA 4BZ1L 1EERB 4QO1A 4P2RB 1FPTH 5CEXB 3ULVC 2NY2D 1RZGB 3QH3A 1FL5B 4XPAL 5CGYC 2R29L 4M3JA 4RGNE 5F7DA 3EJYC 3UBXG 4I3GA 2HA1A 2R4RH 1W72A 2W9DH 4DEPB 5MEOB 4OCXL 1A7OH 3WLWC 1FLRH 3AREB 3TWCL 5DI8B 4ZYKB 5JPNB 4IIQA 3KS0H 3MMEB 4FP8L 3O2DL 1H3WM 2IPTL 3QUKA 1MFAL 2CDFA 3CLFH 4OGZA 1WAAE 1T1XB 4I0PD 3LDBB 2X4TA 3ARQA 5JOPE 2OR8A 4MNQD 2WUCH 3AB0B 4AM0A 1EO8L 1MWAL 1Q9WB 3UZEA 1C16A 3D69B 5C0RL 5MHSD 3G9VA 4KV5E 3GO1H 5HYJD 2QR0B 4WWKC 1KLGB 3UTTE 4HD9A 4BSVB 4H25A 3G6JE 2VQ1A 3TJEL 3V6OE 1A6VH 4LCIH 4G8GE 5C0ND 3GMNA 3P4NB 4OFIA 1V7MH 3QI9B 1NBQA 4DGVL 5E70A 3WKMH 3LPFA 1D5MA 4KI5D 1FVDA 4WHDA 3O8XC 1KELH 5EU5A 2GJZB 1Q72H 4F8QA 2ZCHH 1F2XK 3EYQC 4Z78B 2HLFD 2KUTA 5FK9A 4K2UH 4U1KA 4QT5A 3L3DB 3DROB 3F7YA 1C1EL 2AJYH 1TPXB 3WS3B 4RAVA 4GKSA 3RZCD 2VB5A 5EZIH 1F42A 4IRSB 4OZGB 1N7MH 1IAKB 3BDBA 1ZGLP 3VFUA 3QEQA 1MHHB 4Y1AE 2E9BA 3V0WH 1B2WH 1FL6B 2O5YL 3QIUB 1K2DA 1VSCA 1YEDA 3O3EB 1G7HA 3UPCA 1DUZB 1CE1H 5IIEA 3QNXB 4G3YH 4HF5H 2J6EA 3OKNA 1S3KH 4P23D 5GRXG 1ZSDB 4HXBH 4MJ5A 4FABL 2X4UB 3LZFH 5KW9H 3U9UA 3IT8D 4M62L 3HN3A 3IDMB 4KJPC 4HIHB 3OGOE 3H42L 3KXFE 2H6PA 1YMMD 2HJFA 5D7IB 3BH9A 4XPBH 3ARSA 3BVNB 3HZMB 1P7QB 4X9IA 5H94B 1E6JH 2DQDH 2EKSA 1R0AL 4Q6IA 2GK2A 2E7CA 3SKJL 3CX5K 3W5NA 3WHE1 2H9GA 3MJ6A 5ILTL 3LKOA 3RJDA 2F8XC 4QOKA 1ODAA 4AZ8A 5FGBC 3OHXB 5CSZA 3VGAC 5CUSH 3LKRA 1A7NL 4LCWD 4QF1A 4WWKB 5C09E 2AERT 3DUHA 2PYFA 2XWJB 1OAKH 5BZDA 1OWWA 3BWAB 4ZS6C 3INUL 5JQ6H 5ESAA 4KKBC 1EZVY 4Z7NF 2V2WB 1DANT 1K85A 3O8XB 4E41B 5E6ID 3MOQA 5IVZB 4GSDL 1UZ6F 5FYKL 4HBQA 3GIVB 1HH6B 3CJJA 3QHZH 3S8WA 3EJZD 4XVSL 1YZZA 4P57B 4NZRL 3ZHKA 1AHWA 1NJ9B 3BESR 4ODHL 4HS6B 3KHOA 1XZ0A 1EEYB 4WO4A 5KSUB 3DXAD 4ZO6A 5E1HB 1XR9A 1QFPA 1U8HA 1JGVH 3Q5TA 3QDHA 4LEXL 4CVXB 5BW7A 4D9LH 3WXWL 3EGSB 2DQUL 3BQUB 3KPLA 3HCVA 4APQC 4UQ3B 3MGOB 3X11B 1RD6A 4JY6B 2BK8A 4H8WC 2JCCE 1E6OH 1WT5A 2HTKD 1MSPA 3BN9C 2X4PB 5D1XA 5MHSE 4OCYL 4PJDF 1NPUA 1MWAB 1REIA 1WBXA 2DKUA 5BVJB 5HYJE 4R7NB 3SN6N 2BFVH 3EOTL 4WW1B 4KH2A 4PTTB 1KIQA 3PWVA 1I7TA 3V4VL 2C5DC 5FYLL 5GGSA 2F8OA 4LIQL 1NDGA 3RTQD 3L7EA 2CMRH 3ZLQC 5HHXL 3GKWH 1G0YR 4KI5E 2ICEA 2LQRA 1Z5LA 1BQLL 4CUCA 5EC1B 3BD3A 4KMLB 5T1LD 3GSNA 2E7MA 2X4OA 1FNHA 2ZWLT 1RZIB 1RULL 5I71C 3VGAB 3VXPA 4OKVB 3OKKB 4HUVA 4PJXF 5EO0B 3V6FB 5GS2H 3BX7C 4HUUB 1BVLB 4I5BB 1WBYA 3E0GA 1YPZA 1DLHA 2EDEA 2QSCH 3BDYH 1TITA 2YMXL 1CTOA 1FJ1B 3HNTH 3B9VA 4RFNC 2CD0A 2A2QT 5HHOD 3FOMA 3TN0A 4OV5B 3T2PA 1MJJA 4J7RA 1MQ8A 5DJCB 3RVXC 4ZS7H 3IVKB 1H3PH 4U3HA 4Z7OE 1D6EA 1LO2L 3UDWA 2R0ZL 1JGLL 4Z8FH 1INQB 2O61B 2YBRA 3J8F7 3MLVL 1WBZB 4D0CA 1U8JA 4RQQB 3S37X 3GJFB 1EJ6A 4UDUA 4XP4H 2FX7L 3WEXB 5AD0B 2XKNB 3GMMB 3QHFL 4PYHA 2VXQL 4XCYB 1EUTA 3MRHA 1FZKB 1RSFA 4CVWA 5GGQH 3V8OA 1FO0A 5DT1H 1CR9L 4YFLI 1YMME 4PJ7A 2IMNA 2YHGA 4NJ9L 4JHWH 2WQ8A 3THML 1IKNA 4C55A 4APQB 1I8KA 2J4WL 4ZPTA 4J4PC 5DJDA 5SWSA 4Q74A 4CRPA 5IF0A 1UZ8A 2D31B 2VLJB 1T80A 2ICCA 4NKIL 5FF6B 1FYTD 3R1GL 2WNGA 4X98A 4G42B 2CGRH 1KC5H 1VENA 4LLQB 1FFOA 4U31A 1HSBA 4MXQD 2IQ9L