2OJZL

Anti-dna antibody ed10
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
218
structure length
218
Chain Sequence
DILMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPTLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHIPLTFGAGTKLEVKRSDAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab ED10 light chain
publication title Specific recognition of a DNA immunogen by its elicited antibody
pubmed doi rcsb
molecule tags Immune system
total genus 49
structure length 218
sequence length 218
chains with identical sequence M
ec nomenclature
pdb deposition date 2007-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ojzL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ojzL01
2YXMA 5D7KD 4YR6A 4N8VB 3RJQB 3UC0L 2MJWA 3BP5B 1PG7H 3HE6C 4HCRL 35C8L 2V17L 4G3YH 5IHZB 2ORBL 3SE4C 4HWEH 3CXDH 4LCWD 1BJMA 1KULA 3HAEG 5K59E 3EO9L 4RGNB 2YN5A 3N0PB 4LOUC 2P1YA 2X4QA 3FMGH 3JVGA 2B5IB 5EU6D 4WJ5B 4MWFB 1J0HA 4CKVX 1EUTA 4FXLA 1YMHA 4V2CB 4TVPH 3U2SA 5D70H 4HZAA 1Z9MA 3PNWB 2XN9A 5JA8B 3C6SB 1OD7A 3P73A 1MQKL 4N68A 3K74B 3V5DB 3ZKSD 1ED3B 2F53E 3GSXB 3PQYD 2BNRB 5INDA 1BEYL 2XXMB 3FT3A 2I25N 2EDDA 4FA8A 3WJJA 1FIGH 4UTAH 2MMXA 1J8HA 1QD0A 1FVEA 4UTBL 1MCKA 1UXSA 1WFUA 1WBXB 2LU7A 1OOAA 3QXDB 4LSSL 3KYMA 4P59L 3VXSD 4K3EL 4FFYH 2XOTA 4FQXA 3QUXC 4JO2L 4X4MA 5C08E 4DN3L 1CIDA 2B5IC 4CVWA 1NDMB 2ZSWA 3VFMB 5DD0H 2CDGB 2X4NB 3BAEH 4DN4H 4EKXA 1CGSH 5B38G 3OX8B 4P46A 2ZNXA 1BFSA 2AXGB 5IQ9A 3V7AG 3F6LA 1CTNA 2NXYB 1Q9KB 4WFED 3O3DB 5C0DB 4QHLA 1P84K 4OI7A 3ZYOA 3UDWC 1H3TA 4PJXA 2NY0C 3QO0A 1KPRA 2IH3A 5E2TH 5HHVL 3WHXB 4QT5A 2ADJB 3S97C 5F71A 1JF1A 2GTWA 2P5WE 2W9DL 2FWOA 3K1DA 1XCTB 3OKMB 4JJ5B 5GS0C 4HMDA 1PKQA 5MEPA 2ESVB 2QTEA 2WV3A 1Q9LB 4HIXL 4DGVL 5E7FA 1KPVB 3REVA 1DR9A 3EFFB 5HI5D 1T2QL 1A47A 3ESUF 2DJ4A 1S78D 1M05A 3NN8B 3TIDB 1A3QA 1GGBL 1O7VA 2YK1L 3SBWC 5GGTH 3W2DH 1C5BL 4M7LL 1CI5A 3OBAA 3IVKA 2FX9H 3BIBX 5EUOE 3TCXA 5C0RL 2EDNA 3QPXH 1U95B 8CGTA 1RJZB 2H3NB 3O8XB 4K3HA 4LLUB 1GAFH 4CU7A 4PJGA 3BGFC 4LRIC 5J3HC 1A3LH 1JYNA 3I6GA 4AENA 5HYEA 1R3IL 4R3SB 5H37G 4OTXL 4WFFE 3MRMB 32C2B 4EBQL 2V7HA 4P2OD 1DQQA 2CIKB 1EZVX 4QGTA 4JFDA 4PB9H 2JB6A 3NAAL 1X5XA 3A6BL 5C0GB 5LQBL 3QCUH 3IKCA 2UVFA 5EB9A 1ZLUH 2EXYD 5T5NG 5ID0B 4M43L 1KIRB 3R06A 3VXMA 4HLZH 1NBVH 1U2CA 4OLYL 4ZXBD 1LEGB 4D0DB 2DQIH 4UOW1 4LSPH 3RI5K 4BSJA 3NCCB 5BV7L 1HSBB 3WFBH 1SMOA 3MOBH 3WXWH 5FECB 1KFAL 1T22A 1ND0B 4JRXD 5INCB 5DUML 1QHPA 3BP6A 5C09A 5C3LD 2ZUYA 1CICC 4RISH 3TCLA 2LFGA 2GFBB 3S4SB 3DOSA 3U0WH 5D93B 3QEGL 3PP3H 3D25B 3QPQC 1B2WL 2YEZA 3MO1B 1BJ1H 1UA6H 3KWWA 3X3GH 2I60H 1K5NB 4PBVC 5BRZD 3QIWB 4Y19B 3TNNB 2B0SL 4GS7B 3RVTD 3OR7A 3KPRE 3RIAF 3KS0H 4CVXB 3FT2A 4WTZA 5IVNA 3D1MC 2DBLH 3OQ3B 3VFNB 4ONFL 2FCBA 4NWUH 4EUPA 2Y5TA 4MD4A 2C7UA 2XZAL 4RFEB 2Y23A 3OZ9H 4FQHB 5GS0H 3DUUB 3WDHA 1G9NL 2B2XL 4AT6A 1YEFH 5I1JL 3DTXA 4EN3B 2NY7H 3VGGA 5IR1B 1NGZA 4OIIL 1FAIL 5AAWA 3HC4L 4WWKC 3RU8L 2D7TH 2Q86A 3ZTNH 2BY0A 4I2XE 1P53A 1I7ZB 1T21B 3VFPA 4ELKA 3BDXA 1YC7A 3Q6FB 1F58L 5CBAA 4XRCB 4K3GA 1OL0A 1C5DA 2VO5A 2OJEA 2OI9B 3Q1SH 2BMKB 3W5MA 4E0RB 3L7FA 4ERSL 4X0KA 2VJXA 1FCGA 4B7LA 2FJGB 4ONOA 5EIVA 1JJUA 5E2JA 4GS7C 4PJHA 5ENWA 5FM5M 2HKHH 5IB4A 3JV4A 3QQNA 1NMBL 2G2RA 3P9LA 4LVOB 1S9VA 1LD9A 4XGZA 3MXWH 1ZSDA 3SE9L 1H0DB 5IF0A 3BD4A 4R4BA 4PJBA 1RZGB 5I0DA 1A9BB 4OCRH 3ARPA 4WVRA 1TMCB 2EYRA 1MJ7H 2Z31D 2QQNL 5GS1A 1F42A 1NLBH 1OGTB 1CE6A 2EC9T 3NABL 3LAFA 1U8IA 1E27A 3PUCA 3U46B 1WAAF 2FJFA 2RHEA 4E42A 5E1HB 1K4CB 3O45A 4XVJH 2MOVA 2PCPA 3STLB 4G6AD 4OGYL 1FE8H 1TQCC 1LHZA 2IH1A 3NZHH 3S36X 3BMWA 1B0RA 3IRZA 1KOAA 1SVZA 5DT1L 2R2HB 3DBXA 1BJ1J 4LVOC 3ZE2F 1JPTH 4AQ1B 4X6DB 4GRWF 3EOAB 4NGHL 2ZNWA 4HKXA 5IMOB 1GZPA 3QDJB 1IM9A 4EI6A 2AQ1A 4AIZB 2UUDK 3KS0J 3O6ML 3MLVL 3CU7A 2X9WA 2XN9E 5JTWA 2F5BH 1ZVSB 3V7MA 5C0NC 5I15H 5JLZA 3NH7L 5DRZA 2O93L 1MFEL 1LEIA 2WBWB 2DOCA 1DANU 4MLIA 3QUMA 2AEPL 4Q9QH 5D7JB 5DUBA 4BELD 1QBMH 3T09A 5D2LB 4HBQA 3C6LC 5SX5H 1I85C 5GQBA 2VWEE 5H94B 2VAJA 43C9B 1J8HE 4NC2B 2QADC 2HT2C 4UBDC 3T2NL 3WIIH 4MCYB 3WEXB 3DGCR 1G7LB 2ZUTA 1G7PB 1HILB 1VB9A 4J4PD 4X4ME 5C2BH 1RHHA 4HK0B 3L5WB 3RDTB 1NCAL 4EDXB 1U3YA 3QNZB 2F53D 4JREB 2NMSA 4WUKH 1IZJA 5FYLL 5I1GL 3JWDC 2QQLL 4NO0A 1U8MB 2C3HA 2X70A 4R7NA 5TE7L 4C55A 3GSVA 5D1ZA 5CBEB 1KCRL 2BVQA 2A74B 3NFSL 3UZVB 3F12B 2E6QA 2HAZA 4M7KL 5K33A 4HD9A 1DL7H 1MF2H 1QRKA 4I5BB 4KKAD 1MCBA 4UT6H 5HHME 4RGMB 5D7JC 4PJXE 4OGXH 3MFFB 5EZJA 2ZOLA 3VWJA 4N9OB 3G08B 2YN3A 5A1AA 2O26U 5C08D 3HKFA 3WFHA 1EO5A 4Z5RA 3T0VA 4F15B 5FM5O 4U3CA 1J0JA 3RWHB 4OLXH 3GHBL 1HNGA 5CEXB 2ADFL 4PG2A 3S6CA 4NYLB 1N26A 3F7RA 3D18A 1QSFA 2XZCL 1G7IB 5SV3A 3P4LA 3BEVA 4APQB 1IQWL 1JWUA 4PV8B 3E3QE 5C7XL 4OV5B 2ICEB 3VXRB 3LIZH 1I7RB 4YFLF 3C5ZA 3OKYA 5IB3A 2P5WD 3ARDA 1JWMA 4NNPH 1BFVH 2B1AH 3QHZL 5E2WL 4MLSA 1KB5B 4RFOL 3PABB 4DUWA 2HMIC 2CH8A 2OXGA 4HFWB 2VH5H 1OGAB 5CILL 3RP1A 2EDOA 4XXDA 2VDRL 4PJGE 2V7NA 2BRQA 2ENSA 4IHOB 3E6FA 4Y4FB 1MAKA 3MOQA 4LU5L 3IDXH 3W9EA 5IVXB 1BQLH 3T2PA 1T0NB 1VENA 4D3CH 1FGNL 5SWSB 4PG9B 4QHNB 1ZHBB 2R0ZL 3KPPA 4I0PD 5IVZB 4JFDE 2M8XA 1X6LA 2YKLL 1UFUA 4JKLA 3NVQA 3VMOA 4U3XA 4NZTL 5CZXD 4PJDA 1LO0H 3DRTB 5EULV 3S37X 3LZFH 3VXME 5KVFH 5L7XH 4KRNA 1XGUB 2DQGL 1EX0A 1WFTA 4M1DH 3RUGF 5JNYA 3DX8A 3AVEA 1WZ1H 1UT9A 4WFFD 3HNVH 3R4DA 4JO1L 2JK5B 5I66A 4NQCA 1A14L 5ITFA 3D0LA 3TPUA 4MAYA 4Y4FC 2A73B 5C09E 4Z18A 2OR9L 1FGVH 5ETUA 1AD9B 4OBRA 2FDBP 2H32A 2CLVA 4Q7DA 4F57H 4D2NA 1CZ8L 4P2RA 1IEHA 4O9HH 4F7EA 4M3KB 4HJGB 3IDMB 2YPVH 2YR3A 3RX7A 4KV5E 1OP9A 4N5UA 5D7SL 2R39A 4RMUA 2FRGP 3CLEL 4TSAL 3DVIA 4NNYA 2O5YL 4C56A 1F4WL 4KROD 3H9SA 5IOPB 3AXLB 4M5YH 2AK1H 3QULB 2R56H 4JKMA 5C0EB 5J0BA 4M6MH 3SDAD 2BC4A 4OLUL 4G6ML 3RY6A 3H7LA 4N90D 1S9XA 3FB6B 3MLUH 5BZWA 4ODUA 4KQ3L 2CD0A 3RGVB 4LPVA 4OQTH 3QJHA 2GSIA 5DWUH 5ESQA 2M2DA 2C3WA 3N9GH 3KPRD 3X17A 4BSWB 5AZEL 3I3EA 7FABL 4QRUB 4Y5YA 1MH5A 1KELL 1I3GH 2W60B 1HDMA 2IJ0C 1BMGA 4PJHE 43CAA 2ZP0T 3KYNB 3SQOL 3ZDXE 3F7QA 2PKDA 2DQTL 5DMGC 4FQJL 1VCAA 5KJRH 5FB8B 3A0OA 1U0QA 1RU9H 2R2BA 1A6VH 4CVZB 5AZ2H 1JNHB 2VXUH 2SEBA 1GOHA 3GNML 4PJBE 5CHNB 5JZ7C 1MCJA 4O4YH 1MVUB 5GGTA 4RZCA 3WS3A 5SWZA 3CCHA 3OHXB 2MKWA 1OTTD 4HC1A 4D0CB 3D69A 4L29B 3MRNB 3QIUB 4HKBA 2EEDA 4UT7H 5E7BA 3SDDA 3P3YA 4B41A 4ZDHB 1MJUL 4OJFL 4HG4J 1HHIA 5EC1A 1KB5H 4IIQC 1DTUA 2Q1EA 2VN4A 4HGKC 3X14B 3EZJB 2E8YA 1BREA 1CLZL 4JHAL 1F8TL 4ZPVA 3QEQB 5ILTH 3LDBB 1PY4A 4IMLB 4X6BB 3ZKMC 1B90A 4N8VA 3BP5A 3MLSL 1JI2A 3S35L 4GAJH 2BRRH 2QSCL 4U7KA 3SJVB 4OZFB 5IHZA 5C6PB 3T3PE 2PXYB 4Z0BL 2X89A 3TT1H 1YECL 1CT8B 3QIBB 1E0OB 4PJCF 1BQHB 4GMTL 4YDJB 5FHAL 4XCFL 4TQEL 2XN9D 4PLOB 5I73B 1CIUA 1HH6B 2BNQE 3ABZA 4XWGL 4KMTL 4TOYH 4PRAB 3C6SA 1IEAB 3S36H 3V5DA 1NANH 1ED3A 4WI6A 3GSXA 2BNRA 1UM5L 1SM3L 5F7DA 4DKDC 2E5EA 1CXFA 2O5XH 4PRNB 1RFDH 1J8HD 1N0LA 1AY1L 3U6RB 4YHLL 1E28B 5DGQA 5DHVB 5GGRY 3C8HA 1DQTA 4JPKL 4FTVE 4D8PB 1A7QH 4G3YL 1WBXA 3LRHA 4KK6D 3QXDA 1JNLL 4QF1B 5B39G 1WT5C 4S1DC 5JIKA 5IG7A 1OAYH 5T1DL 4D9RE 3BD5A 1H3PH 2FJHB 1KTDB 3R8QA 1D5IH 1TFHA 1UCBH 1X9QA 4DVBB 4ZYKA 1NDMA 5E0QA 5E99L 2ED9A 3VFMA 1OTSD 2CDGA 2X4NA 4PJAB 4P46D 1QSFE 5GHWL 3O2VH 3GKZA 4XCCH 3OX8A 4XAKE 1EHLH 4R2GB 4TVPL 4JM2B 2AXGA 2AABL 4Z7WF 1Q9KA 5HHMD 3O3DA 4XX1G 5C0DA 2O61B 1AE6H 1MFCH 1MRDH 2AJSH 3WHXA 2ADJA 4G7YH 5EUKB 1X5LA 3CX2A 3VU2A 4F7PB 1XCTA 3WNLA 3OKMA 3DSFL 1FIGL 3TFKC 4BSVB 1KN2H 4TUKL 3C5SB 3RVUC 2ZCKL 4LSUH 2ESVA 5EOCH 1Q9LA 1QFUH 2Q6WB 2XZZA 3LOWA 2MWCA 3MJ7B 1KPVA 4UIKH 4P4KD 3EFFA 4OKDA 3BRDA 3ARYA 1R5IB 3VJ6B 2DQDH 3FT4B 5I71B 2HFFB 1CDBA 1EVTC 3NN8A 5IROC 4UOJA 4JFFA 3TIDA 3FTGB 3CH8A 5DD0L 2R2EB 4ISVB 1YY8B 5CJBA 3KNBB 2J4WL 4RGOH 3T8XB 5DRXB 4J3TA 4LDLB 4M03A 2VDOL 4PJDE 5EBWB 1U95A 2D7QA 1OCWL 3ZYJA 5BVPH 1RJZA 2BXZA 2VNCA 4XP9L 4R4FL 5MP6L 1Q0YL 2H3NA 3O8XA 2C3VB 4TVPE 5DMJB 5DO2C 5IHUH 4LLUA 4P9HC 4KJWC 3JV5A 2A0LC 1SYSB 4KTDH 5DVLA 1CICA 4NQCE 3TJHC 1MAMH 2FB4L 2A6JB 2J7LA 3MRMA 32C2A 4QCIB 2XZQL 4JFDD 3QRGL 1KEGL 1KIPB 1NBQA 3MNZB 5I71C 3FQXB 3MYZA 1G9MH 4TN9A 5C0GA 2EDJA 2UV3A 3VXMD 4P2RE 5E5MB 3VFRB 4WV1B 5J8OA 1K6QH 5GZOD 1KIRA 2BK8A 3QXTA 4OZFH 5GGTL 3TJEH 2QJDA 3EYFB 3LD8B 3MRJB 3BX7C 2DKSA 4E9LA 3W0WB 3MOAL 1TJHL 1LEGA 4D0DA 1P7HL 2JJSC 4ZODA 1D9KB 5EOTB 4PBWD 5I2IB 1HSBA 4HC1L 2X1OA 2XWTB 1F6AB 4C56E 3DSNA 4HUKB 3H9SE 5DZOA 1UYWH 5F8RC 4WWKA 3S37H 1SJEB 1ND0A 5C09D 4EOWL 5IWLC 3MLZL 3U83A 3RVVC 3IFLL 5I1IL 2DD8L 1A3LL 4G6FD 2GFBA 5IBLD 3S4SA 2NXZC 1QR1B 2AJYL 1BM3L 2APVA 2R23B 3D25A 4NHCH 3MO1A 4HWUA 1QRNB 1A7BA 3O0RL 5EOCJ 1K5NA 1BF8A 3QIWA 4Y19A 3TNNA 2Z91B 3X3FL 2JKXA 4U2YA 5IB2B 1MCOL 4Q0XL 4CVXA 2R9HD 2IANB 4NZJA 2YRPA 4LFHD 4N0YH 2D0FA 1RIUL 3VD7A 2CMRH 5FGSA 3VFNA 1F4XH 3V8OA 2F19L 4RFEA 2FD6L 4FQHA 5L2KB 1NBVL 1J8KA 1H9VA 1HKLH 2DQIL 4EN3A 1DVFC 1EMTL 4CJ0A 3BSZH 2ZUVA 5CEZH 1A6WL 4LKCA 2DQHH 3Q6FA 4XRCA 5SWZE 3UZEA 2DIBA 5C0JB 2BMKA 4E0RA 3RTQB 1UZ8B 4LQ1A 1UA6L 2FJGA 4OF8A 1CFSB 1KJ3L 4WGWB 1OP3H 5FM4A 4ZUUB 3HPLB 3DVGB 5C70A 5IFJB 1QNZH 3U30C 1I8LC 3K4DA 4OLVH 2YS4A 3N50A 1H0DA 3MZGB 5GS0L 1N4XL 5F96H 4W6YB 5LBSL 1RZGA 4LBEB 1Y6MR 1A9BA 3LPGA 1YEFL 1MQ8A 3O4OB 1FPTH 4M8VA 2VZSA 1OGTA 3EJZD 4IEFB 3QUZB 3ETBF 4EDWH 3V0WL 1I85A 3JUZA 3DXAB 2FR4B 3U46A 4G6KH 3DVFA 1K4CA 3VDAA 1N3NB 4JCMA 2EIZB 3STLA 3QG7L 1CLOL 4RGNE 2I27N 4ZO8A 3TN0C 3C08L 4AIXA 4NO3B 2YUWA 3ARUA 5DK2B 3UAJD 5DZLA 4BFBD 1IM9D 4X6DA 4NUJB 3EOAA 1XMWA 4QXUL 1U3HB 3CDFA 3NTCH 5IMOA 3QDJA 3T2OA 4JPVL 1MWAB 4OD1L 4AIZA 1H3WM 4ELMF 4WO4D 4X7CC 1T2XA 2F54B 1ZVSA 3BPNC 4LGRB 1RUKH 4L4JA 4MNQB 3ZT5A 3INUL 3O4OC 5GGQH 2Y07H 4ZS7H 1DCLA 4M8QB 2BNRE 5D7JA 5SX4H 1XCQB 3FQTB 2M26A 4K3JL 1NLBL 5L0QC 5D2LA 1SMAA 43C9A 2VDNL 5H94A 4WEBH 1YQ2A 1CYGA 1KYOK 1OAZL 2GTZB 1JFQL 3FB7B 3OF6A 1ZT7B 1WZMA 3CSGA 1MCWW 2KUTA 4MCYA 3BE1H 1S7UA 1G7LA 1X4YA 3BKJH 1G7PA 1EO8H 1DN0B 1HILA 2V2TB 1HHHB 2BNQD 4HK0A 2E27L 5DK3A 2CGRH 4Y16C 5EZLB 3L5WA 3RDTA 4EDXA 4OQTA 1DBBL 4NO0D 1U3HC 3QNZA 4RDQG 5D1ZD 1U8MA 4GW5B 1ZANH 2NTFB 3SE3C 1UXWB 4GBXC 5CBEA 2A74A 4RMWA 3CVHB 3R1GH 3F12A 2F5BL 3QA3B 4FTVD 4JG1L 2X4RB 4I5BA 4PGDB 3VWJD 2DTSA 2H45A 4OF5A 1U8LB 3LKSB 3T0AA 3BOVA 3MFFA 3G08A 4MDJB 4D9RD 1INDH 4CDGC 4HS8L 1U8PB 1V7ML 1UM4H 2ESVE 1QSFD 4PV9B 5CEXA 3WIIL 2ICWB 1NUNB 5B3JF 4NYLA 4XAKD 3QXUA 4HPYL 5ADOL 5D4QA 1G7IA 5F9AC 5C2BL 8FABB 4ZQKB 4XBPB 5F7FA 4APQA 5IFAH 1VHPA 1WCBB 5TF1H 5L9DH 1WICA 4PV8A 4OV5A 3C5ZD 2ICEA 3VXRA 1QFWL 5DMKB 4KJYB 1I7RA 3ARDD 2PN5A 4U4BA 2OLDA 3FB8B 5K9OB 5E9DB 3BPCB 2UWEF 4OQ1A 1AR1D 5HHNB 1KJ2L 4N0CD 4X80H 3TBTB 1G84A 1KB5A 4H20H 5FA3B 4UT6L 3PABA 4PS4L 2NW2B 3B2UC 2R0WL 4XPAL 3GIZH 4HFWA 3HI6H 4ZOAA 1AFVH 1F90L 4LAQL 5DMIH 1PW3A 2CDFB 5ITBH 4IHOA 3NPZB 4Y4FA 3LKNB 4FZ8H 4RMRA 5IVXA 4PGBB 3MRCA 1ACYL 1T0NA 1NC4B 1GGTA 2WANA 4QY8B 2EC8A 3FN0H 1OD9A 4OIAA 5SWSA 4PG9A 4QHNA 1ZHBA 5DC9B 5IVZA 2DBJA 5GRYA 4JAMB 1YEIH 2NY2B 2HRPL 3FAXA 3S88H 4XAWH 3LIZL 3DRTA 2I07B 1A1OB 4ODSL 4LP5A 3RWJA 4H8WC 4NNPL 2W0LA 1X5ZA 3AREB 1XGUA 3VG0L 3V95A 4R97B 5E24E 1P84J 4MS8D 4Z8FH 3MODL 4NQCD 4G9DB 4KDTC 4JFPB 4MAYD 3WE6B 4OM1H 4R0LC 1IGJB 3ALWA 3H9YA 5GSRB 3U0TB 2A73A 3ZDYF 1AD9A 1IC5L 2ARJA 2HKFL 1MWAH 5DFVD 4P2RD 4M7ZB 1PDKA 1LDPH 1FBIL 4WHCA 1I8MB 2AXHA 4Y19E 3ILQD 4HJGA 4NDMB 1YEKH 3IDMA 3D9AL 4GKOA 2ZJSL 1U8OB 4FQQB 5FXCH 5FYJU 4C56D 2DAVA 3HC0B 4OZIB 4LHUB 1LO0L 3H9SD 3B8SA 4H88H 5DJ2B 1TENA 1VGKB 2PO6C 2LV4A 3FQRB 3QULA 1R3KB 1TIUA 1P1ZB 4X4XB 4Z77B 4M48H 3FB6A 4XBEL 4I3SH 4PBXA 1WZ1L 3U4EB 3RGVA 5DHXB 5JR1H 4BSWA 4BFGA 3H7BB 3JWDL 4YHMH 5I6XC 3ARGC 5JW4Q 3CVHH 1A3RH 1CXHA 4F57L 3VWKC 5CIPB 2W60A 4IS6B 2D7NA 2COQA 4NZRL 3KYNA 4ZFZB 5J13C 1J1XL 1W72L 4MD5B 2FYYB 5J9PB 3ALXA 1I9IH 2AS5M 1SVCP 3MJ8B 4CVZA 5I8OL 4L4TB 1JNHA 5CHNA 2IPTH 2R56L 1MVUA 5SWZD 3WXVH 5I1LB 4ODBD 1QFOA 2B7DT 5TDNB 4KJQC 2QKIB 4W4OC 4BA8A 3OHXA 4D0CA 3BGAA 2EH8L 3MRNA 1U3ZA 2LAGB 1ZT4A 3EHBC 3QIUA 3HPJB 4MB5A 1UCTA 3SDDD 2IPKB 3O6KH 3H2WA 2JB5L 4H8WH 5EWIL 3E6HA 4OLWL 3LSOA 3O3AB 4M5ZL 1JMZA 3X14A 2NY6D 1WWBX 3LEVL 4X6DE 3K8MA 3NOIA 3KPSB 3QDJE 4P9MH 4MA8H 3P0VH 3QEQA 1A1NB 2E9JA 3PXHA 4IMLA 4E41A 1CR9L 2D0GA 3VXUB 1AP2B 1QSZA 1CLYL 4LQFL 3ZTJH 3P4NB 2APXA 4J6RH 2P47B 4OZFA 4NKDB 3KHOA 3MJ9H 2PXYA 4RGND 4S1SH 5D2LE 5ADPH 1WT5A 3SGKC 4C83B 4H1LG 5HDLA 2R0KH 3HZKB 2Y6SC 1CT8A 3CAFA 3QIBA 3MV8B 5HGBB 1X5KA 1MFNA 2BVOB 4KQ4L 4P57B 3SGJA 2XKUA 4FXKB 4JFYB 1KB9K 1BQHA 4YDJA 5E00B 4MA3B 4ZPTA 2A83B 1I1CA 3RBSA 4PPTA 1HH6A 3CFIC 4PRAA 4HJ0C 1CVSC 2BNRD 4JR9L 5TE6H 1NMAH 1BZ7B 4L4VB 3PHSA 4PRNA 3MRLB 2VERN 1X7QB 3U6RA 3VG9B 1E28A 2BZDA 5DHVA 3MRDB 3BH8B 4TPRH 4D8PA 4NJAL 4QF1A 1HNFA 2ICWJ 5D6CB 4R4NC 3TT1L 3MGAA 1UJTA 4OKVB 4XPGL 2LQRA 2FJHA 1KTDA 1TQBB 4K7FB 4DVBA 5HPMB 2AV1B 2FHCA 1QYGH 5IROA 4OT1L 4PJAA 5E6IB 4OD2B 1NGXB 3KDMA 4OF7A 4FQIL 3BFOA 2QR0A 1JNNH 5AUMB 3QNYB 2NXYD 1QLFB 1WVZA 4JM2A 2D0HA 4X99B 3SO3B 2DQUH 1EEZB 1JUFB 3VXRE 4FNLH 4I77H 2O61A 4P3WA 2A6DB 2EDRA 4W68A 3BXNB 4U6TA 4LCCC 5EUKA 2DYPD 4F7PA 2X05A 4F9LC 1L0XA 1RZFH 1Z9OA 2XV6B 3AGVA 4L9DA 4YHKL 3O3UN 1CBVH 2ESVD 5J3HD 4BSVA 2EXWC 5CIPH 3C5SA 2Q6WA 5DR5H 5EZOL 1OGAE 3TNMB 3MJ7A 4OI9A 3ESVF 9CGTA 2XY2A 1TQBC 2D7MA 2EYTB 3BKMH 1R5IA 3MRHB 3VJ6A 3WFZA 1D5IL 2EH7L 3FT4A 4NQSB 5IVXE 4X7SH 2HFFA 1T66C 3E0GA 1CXIA 4IRSC 3FTGA 4Z7UB 5SWSE 3B83A 4KKLC 2R2EA 1PAMA 4ISVA 1YY8A 3O2VL 1YDPB 4YHIB 3KNBA 4UB0H 5J1AB 4XVSL 5EPMB 3T8XA 5DRXA 3VW3L 1NGWB 1E6OL 2VDLL 1N59B 3SKUD 1EGJL 4HZLB 5EBWA 4G42B 2CRMA 2K7QA 1SYVB 4GQ9L 5MHSE 3ZMRA 3RHWK 3FO9B 3O8XD 3K4AA 4M6NH 1YNLH 2C3VA 5AYQA 4HXBH 4S2SB 4K9EC 5GRZA 1SYSA 5HD8C 1DLFL 2WBJB 4O2EB 5EOCL 2IQAB 2A6JA 4QCIA 5CLWA 4UIKL 5DHYB 1KIPA 3MNZA 3FQXA 1CGUA 4WTZG 5IIEB 1VFMA 4EUPG 4LFHG 5F70A 1W0YT 2VSCA 5E5MA 3VFRA 4WV1A 1JGLL 3UBXB 4XCEB 4QHKJ 2ZZUT 3EYFA 3MRJA 3OGOE 3W0WA 5DEFB 1D9KA 5EOTA 4JVWA 4K94C 3TWCL 3WN5C 4DWHA 5I1EL 1N64L 5I2IA 2XWTA 1F6AA 1DVFA 2CRYA 2W07A 4L3CA 3GMMB 5FYKU 1SJEA 4XHJD 4JO4L 3H3PH 2Q76B 4HFUH 3OWEA 2CO6B 1QR1A 1KSRA 1RIVH 2R23A 3NCJL 1QRNA 4XWOD 3QIWD 1NGPL 2BVUA 4ODVH 4Y19D 3P0YH 3ROOB 5F7UA 4NPYB 3U1SL 2VLMD 1A5FH 2Z91A 4MXVF 4WI2A 4YBLB 5CJQH 5IB2A 3VFUB 2IANA 3ZSSA 2AJ3A 3OAYK 1L7TL 5D1XB 1A9EB 2P8PB 1CWVA 5L2KA 2IQ9H 2VXQH 5D6DA 5GGRB 3SN6N 2GEEA 5DS8B 3HFMH 4EN3D 4J1UB 1P6AB 4KRPB 1U6AH 5FK9B 5DXWA 3O2DL 5FUZL 1B88A 4F3FB 3MGTB 4ZSOA 4BH8B 3OPZH 5HHQB 4AMKH 5FOJA 1MIML 5HXMA 3EAKA 5C0JA 3ISWA 3ARQA 1ADQH 3RTQA 3KPQB 1NCCH 5CJ5A 1UZ8A 1IAKB 3NA9L 4YBLC 1CFSA 1IGMH 3HA0A 4YFDB 5D5MB 5E5RB 4ZUUA 2ADGB 3HPLA 1RZKC 3DVGA 1L9MA 5IFJA 5KAQF 5D1XC 3T0EC 2C3XA 4XPTH 4YFEA 3EOTH 4KK5D 3JV6B 4QXWA 2P7TB 4KRPC 4LBEA 3B9DA 4S10A 5C9JB 3QEQE 1UB6B 3G6DH 3O41B 3QUZA 1NCWH 2ATKB 4UBDD 4O02L 4LPXA 3SJVE 1QLRB 3DXAA 3K8LA 2FR4A 2EE6A 3VI3E 4NNXB 1J1OL 1I1RA 1N3NA 4KI1A 4M1GH 2ZCHL 2EIZA 3WO4B 1FZJB 1JPFB 2APFA 4KH2A 1VFBB 4NO3A 1OAQH 3MV01 4X7DC 5DK2A 1ORQB 3UO1H 3QDJD 4NUJA 4GG6F 2R4RL 1EJOH 1U3HA 2D31B 2PR4H 3WV0A 1MWAA 3SE3A 4MVBC 4BZ1H 4P9HL 2F54A 4GBXA 1G0DA 4S1RH 1ZEAH 2QQKH 5KZCB 2VLRB 2DLIA 4NP4L 4M8QA 3CFKB 4K8RC 1XCQA 3FQTA 4PLKC 2WAHA 5HVGB 3SE8H 3OF6D 5CSGA 2GTZA 5KVGL 5GZND 3NIDF 3FB7A 1XEDA 1ZT7A 1H15B 1X5AA 4Z7OF 3WO4C 5EO9B 3VD5A 1HXMB 3CFBB 2F15A 3IFNL 3PDOB 1DN0A 3RDTD 2V2TA 1HHHA 4WW2C 3H9ZA 4U1GB 1FVDB 1Q0XH 5EZLA 4GAGH 1TJGH 5CEZE 2FBJH 1RPQA 4PJAE 2W59A 2WW8A 4FG6C 2NTFA 4GW5A 1F5WA 1UXWA 1VEMA 2FO4B 3MRRB 3CVHA 4U3HA 1FNAA 2NQCA 3QA3A 3T4YB 2AERT 3LKOB 5J06A 3O3BB 5JIHA 2X4RA 4PGDA 1WWCA 1MREH 4D9QE 2YPLB 1U8LA 3LKSA 4OZGB 3MNVB 5DJ0B 4MDJA 4KKBD 2EYSB 1OSZB 3CIQA 2LAAA 5D2NC 1TTGA 1RZKH 3DO3A 1U8PA 1UH2A 1CFVH 1NCTA 4PV9A 2H2PD 1AKJB 4MHHI 2ICWA 4DUXA 4H26B 3BKJL 5KS9B 3KYKL 4APQD 3ULUC 8FABA 4FOMA 4ZQKA 3FFCB 4NM8H 4XBPA 1K3ZA 3VXRD 1WCBA 3KR3H 5C6TH 5SX4I 1DP0A 1NEZA 4WI9A 4M62H 5DMKA 4KJYA 1T89C 4ACPA 3WS6A 3FB8A 2IMNA 5K9OA 1H3VA 5E9DA 5GRJH 1I9RH 3BPCA 3LQAC 5HHNA 1M6OB 1S7VB 5IW1B 3TBTA 1U92B 2XTLA 3TA3C 4UU9B 2J8OA 2NW2A 1OGAD 4KHTH 4M02A 1YNTB 4XC3H 4PREB 2HT4D 4KDTA 2B4CC 2CDFA 3U48A 4UAOC 4LPCA 3LKNA 3M8OH 2MNUA 4RA3A 4PGBA 5SWSD 1NC4A 1F4YL 4RBPH 3TZVB 5ACZB 1KTRL 4QY8A 3DLQR 1XF5B 4LCIL 1C5CL 1NQBA 4AEFA 1Z5LB 3MJ9A 4JAMA 3D85D 3DX7B 3G6JF 4K8RH 1JTOA 3C60C 5MHSD 1DZBA 4U1KB 1RK0B 3LHPL 2I07A 1A1OA 4BQBA 4YDIL 4NCDA 1NLDL 3WFCH 4XB8A 1GRWA 2EE9A 2ITDB 4AEIH 2XY1A 3FL7A 4UZGA 1DFBH 3W0WE 5ACLA 2WZPD 1IMHC 2PO6A 5ID1B 2W0FB 1RUAH 1JGEB 4G9DA 1KV3A 4JFPA 5B3NA 2NY5C 3WE6A 1AFVL 5DJAB 5E8EB 1IGJA 1NBYA 2GYSA 5GSRA 3U0TA 3IAGC 4OB5H 4M00A 4NN6C 4FZ8L 5D7LB 3TZVC 5IGXH 1D5BB 3OAUH 2P4AB 5EORH 5JHLH 3FN0L 1QRNE 1T7VA 2HFTA 5I1CH 5DD6B 1I8MA 1HYSC 3RZCB 4NDMA 1IGIL 2GQHA 2IANE 1U8OA 1ZVHA 4FQQA 2PETA 3HC0A 4ZOEA 4OZIA 2R1WA 2UVEA 4XAWL 4LHUA 2WIMA 5DJ2A 3L95B 4Z7VB 1JZ7A 5GXBB 5E8OB 1YEGH 1VGKA 5DEGB 5I8CB 4JRWA 5JMRA 3FQRA 1YEJL 1N6QH 2RQ8A 1R3KA 1P1ZA 2HTKC 3SDCC 4Z77A 3EO0B 3RGVD 4Z8FL 5AWNH 3U4EA 3ULUH 2VDKH 1MFDH 3IF1B 4W4OA 4MNHB 4DFIA 4OM1L 1KUMA 1TJIL 1YEEH 3H7BA 1GZQB 4ZD3L 3Q2CA 3LQAH 3RWFB 5JXEC 5CIPA 4IS6A 4OCXL 3AB0B 3RZCC 4G6JH 4ZFZA 2KZWA 3BT2L 3W82A 1AGCB 4RWHA 4UT9L 4OCMC 4KY1H 3ARXA 4MD5A 2FYYA 4AG4H 2YMXH 4XP1L 3NIDE 4N8VG 5E2UH 1TETH 5IUSA 5TQ0H 2Q8BH 4ZUTB 3MJ8A 4L4TA 1MRFL 4HLZG 4XVUC 4WCYL 1XR9A 5I1LA 5I75C 3V52L 4XVTH 3AY4C 5TDNA 5HVFB 4NQDA 2YUXA 2QKIA 4XP5L 1P7QA 1MNUH 3QIUD 2IF7A 2FNBA 4I8DA 2R4SL 3RBGA 3DXAE 3SGKA 3UPAA 3HPJA 4YH6A 5EC2B 4LASH 3GBLA 2IPKA 1J5OH 4P2QB 4F58H 1A3RL 4CDHA 4LARL 3O3AA 1MCDA 1G7MB 5ABDE 4A6YL 3MC0A 2P49B 4WIQA 2K7PA 3QEQD 4U6VL 1FLRL 1UJ3B 3KPSA 1DBJH 3HR5B 3ORJA 1A1NA 2BSRB 4LRNH 1HI6B 4YBHA 3B3IB 3BPOB 5DRNB 2F54E 4PR5B 3VXUA 1AP2A 4LLYB 4MNQE 3SJVD 5FGBA 3FN3A 3P4NA 2JIXB 4FS0A 2KZ1B 4PRIA 1G6VK 2PXYD 4NKDA 2VXVL 4GXVH 4GW1A 4HEME 4I18C 3QIBD 4R8WL 2C1PB 4C83A 1CDUA 1EEQA 3HZKA 3BZ4B 5T3XH 4EI5B 2DIAA 3MV8A 3QUKB 5HGBA 2BVOA 2JJTA 4P57A 3P30L 3O6KL 4FXKA 3GRWA 4JFYA 1CXEA 2XXCB 4TSBL 5E00A 4MA3A 1I1AB 3E8UL 4H8WL 4DK6A 1AJ7H 3NFNB 2A83A 2ICWI 1YYLL 2JCCB 3JTSB 4BZ2H 2IPUG 2BHUA 3CZJA 3HTLX 4QWWD 5GRVK 1GH7A 3BZEB 4Y5XB 1UJ3C 3HHRB 1MFBL 3PIQB 3RWDB 1WUNT 1INEH 1I9JL 2ARWA 1MCRA 1R5VB 4CN6A 3P0VL 1BZ7A 4NUGH 4GSDL 4L4VA 3B5GA 3MRLA 2Q3AA 3JWOH 1X7QA 3MACH 4F9LA 3MRDA 1UKSA 4J6RL 4U1IB 5ICXB 1NSNL 5I17B 1MCPH 2Q20A 3MJ9L 5D6CA 2J1KA 2CUMA 4R26L 4PGJA 4L3EA 2NY3C 5CEZD 3QWRA 4K7FA 4G8EB 4DAGL 5HPMA 2MPAH 3BDYL 5HDQH 2AV1A 4TSCH 5E6IA 4OD2A 1NGXA 2BFVL 4R2GD 2FX8L 5AUMA 4JM2D 5CWSB 4QRRB 3GSRA 3QNYA 1QLFA 4OCSH 5DJCB 3HN3A 1ADQA 3I75B 4X99A 4QHUB 1EEZA 1L9NA 4D9QD 1WSST 1JUFA 2H26B 5IB5B 1V5JA 1UM6H 5GGVL 3V79C 5DD3L 3CVIH 1QR4A 4Y88A 4MXWL 2A6DA 5E9DE 2AJUL 5C8JB 2X4UB 4Y4HB 3BXNA 3D3VA 5DO2D 5ACMA 4FABL 2F8VA 5DQDL 3DMMB 2XQYK 3NGBB 2WMPA 3VD4A 3TNMA 1OPGL 2IADB 4WHTB 5BXFB 5I16B 3UTTB 4L8SB 5JA9A 2VRAA 2EYTA 3MRHA 3U7YH 4NQSA 1KCSH 4PD4J 1JK8B 4Z7UA 2Z4QB 1QYGL 4WHDA 3HRPA 1YDPA 2AJXL 4YHIA 5EPMA 5J12C 2UZYB 5E95B 1T5XB 2W1NA 1NGWA 2DQEL 1N59A 5D96B 3OXSB 4HZLA 3I9GL 4G42A 5HPOA 4FQ1L 4Y2DC 1SYVA 4W4NA 2BXYA 3FO9A 4Y4HC 5DGRA 2EECA 4M1CC 5I1HL 5FUOL 1I1YB 1OP5H 4FRWA 3O6LL 4QHKI 1OAUL 2YD2A 4S2SA 4QRTB 3DMMC 1VPOL 3S4SG 1PZ5B 4ZG1A 2WBJA 5I74B 4O2EA 2IQAA 5DHYA 5DQ9B 5F7WC 3WLBB 5IIEA 4KRLB 1MJJB 3VI4E 2XA8L 4KK9C 5K9JL 5FYKH 3W0WD 4HH8A 3UBXA 4XCEA 1ITBB 1D9KD 5DEFA 1T0PB 2IG2L 3MA7A 4OZIE 1EUUA 1V05A 4FP8H 4IJ3B 4M7JL 2N1KA 2Y9RT 1JYXA 1FL6B 1HZHH 5E8DH 4N5EC 4XP6L 3ALPA 2YZ8A 3GMMA 1BVKB 4UILH 3B5HA 4PYGA 1OAXH 1F3JA 2Q76A 4J23A 4Z7NE 1QRND 1S7WB 3WIHL 2V5TA 3WKMH 5IESL 5TPWL 2GIYA 4OM0H 3CFCL 3B8YA 4TTDD 3UYOD 4M7LT 1WBYA 3ROOA 4DKEL 2IAND 4NPYA 4PGEB 3GO1H 3BPLB 3VFUA 3RVXC 3M45A 5M94B 4ALAH 5D1XA 1A9EA 2P8PA 4PJIB 3ULVF 5GGRA 2W9EL 5DS8A 4IJ3C 1DDHB 1HYRC 4J1UA 5FK9A 4YXKH 3EKCA 3HS0B 3MLXH 4KVNL 4L4TE 5F97E 4P3CL 3BYTA 4F3FA 1FO0B 2AW2A 3MGTA 4R7DB 3GRWL 4JM4L 3PP3K 4LSVL 4BH8A 1LEKB 3PV6B 4PLJC 3RTQD 3QQ9C 1H8SA 5J6GB 5DSCB 3QBTB 3KPQA 3CFJB 1IAKA 2W9LA 3W11D 5D5MA 1OSPH 3P0YL 1PX3A 2C4XA 5JW3H 5ESAB 2ADGA 3GZKA 5T1LA 5HDBE 4HCRH 2GCYB 35C8H 2WNGA 3DVNB 3F62A 4G9FB 4F8TA 3JV6A 3V0VB 2V17H 2IQ9L 1ROWA 2VXQL 3HCVB 4WTXA 1SJVA 4Z9KB 2P7TA 3G6AB 4KTEH 4AH2B 3KPSE 1DQDH 5C9JA 1FLTX 1U6AL 3QUZD 4AL8L 3CMGA 1UB6A 1M7XA 3HLAB 3O41A 2DM2A 5BV7B 2Z8VC 3BKCL 2Q3ZA 3DI2B 3VXUE 3JXAA 3DXAD 3GIVB 1U8QB 2ATKA 2R1YB 1G7HB 4NCC1 1QPXA 4WI3A 5TDOB 2A6IB 3HI5L 4NNXA 4I4WA 2P24B 2UZIL 4JQXA 3MREB 1FZJA 1JPFA 2XTJB 2V6HA 3ARFC 1GOGA 4N9GB 4W81A 1VFBA 5C2UB 1MQKH 1WFNA 4WW2A 3MV8E 1ORQA 1U3HD 4PJ8B 2HTLC 3KPOB 3O6FB 5BW7C 2D31A 1BEYH 1QQDB 1INQB 2F54D 2GY5A 4MNQD 5E6ZA 5CS7A 1ZVYA 2C1OB 2PUQT 3BMVA 4K9EL 4UTBH 5HGAB 2MQ3A 1BZ9A 1TZIB 5LGHL 4LSSH 3P9MB 2VC2L 2VLRA 4P59H 4B5EA 1OM3H 4K3EH 3CFKA 1KJVB 1N7ML 4L4VE 4DN3H 3TH4T 1QKZL 2FIRT 4YHYC 5EU7C 2X4QB 4U6HA 5D1QC 1UENA 3TBSB 5E2VL 4UIMA 2QLVB 4JG0L 1H15A 2AEQL 1F2XK 5EO9A 3H8NA 5JOEA 1HXMA 4Z7QF 3PDOA 4YC2C 2XWBB 1FVDA 2P5EE 3B9EA 4PJ8C 4K94L 3GDBA 4P2YA 3CD4A 5HHVH 4NJ9L 5CINL 2BNUB 2FO4A 3AMLA 3ROLB 3WSQH 2W9DH 1D5MB 3MRRA 1Q9OB 3WNOA 3T4YA 3UJIL 3LKOA 3ULVL 3O3BA 4JKPL 4HIJB 4S1RL 1ZEAL 4HIXH 2J8UB 3OJMB 5SX5K 2YPLA 3TA3A 2NR6D 4OZGA 4WW2F 3MNVA 5DJ0A 4UINH 3NCFB 2EYSA 3SE8L 1OSZA 1T2QH 1ZA6B 2XPGB 5F9DC 4H25B 1X5JA 1MHPL 4NRYB 5BVJB 5GIRB 2VL5B 2VR5A 4H1LB 2A2QT 4JHZA 1KPUB 1K8DB 1GGBH 3KJ4B 1AKJA 2YK1H 4H26A 3STZB 3LN9A 4M7LH 4TNVF 3ZO0A 5KS9A 3K3QA 3FFCA 5IEHB 2C26A 4NM4L 5C0RH 2FBJL 4LVNC 4Z7UE 5A16B 4WI5A 5D71L 1FO0H 4GH7B 2RCSH 2LTQB 2R1XB 4PRBB 1M6OA 3IFOB 1S7VA 1VSCA 3UBXI 5IW1A 1G0XA 1U92A 4LLAA 4UU9A 1EA9C 5LWYL 3LMJL 1YJDC 3OGCB 3L3KB 1YNTA 4PREA 4EBQH 1HKFA 3HMXH 3CX5J 3LY6A 4ZO9A 3KLAB 2DKUA 3RWEB 1N5YL 1MEXL 1MCWM 3A6BH 1RZKL 5LQBH 3KJ4C 5C0FB 4JFHE 5DK0B 4I3RL 5ACZA 3TZVA 1MFAL 4EXPX 3STBA 1XF5A 1LE5A 5CP3H 4OLYH 3RIFK 1MY5A 4JANB 4M3JA 3V8CA 1Z5LA 2NY2D 1C7SA 1KXTB 3DX7A 5BV7H 4NQEB 2QSVA 5C6TL 3MRIA 3PL6C 1K4DB 3H9HB 4M62L 4U1KA 1RK0A 1KFAH 4NBZB 2EDBA 3N1GC 3ARED 2QBWA 2ITDA 4LSTL 4S11A 1BIHA 4N0FB 4MDIB 1A6AB 2FL5B 5ID1A 5I30L 3R0MA 4AENB 4C4KT 1JGEA 4RWYL 4YAQB 1B2WH 4XC3L 3QJFA 1T2JA 2HJKB 1NMCB 2F58L 5DJAA 5E8EA 1P4IL 3EYSL 4PJEF 3UJTL 3MCKB 5GS3A 1ZMYA 4JHBA 4HS3B 2YD3A 5D7LA 3MNWB 1CFNB 3REWB 3C5JB 1D5BA 4ONFH 4HULB 2FEDC 3MBEC 4X8JB 1QBLL 2XZAH 1UB5B 2NX5B 4OCWL 2V5YA 1G9NH 4PRPB 5JXEA 1FDLL 4P99A 2B2XH 1A7RL 2CPCA 3EOBA 3RZCA 5I1JH 1ZHKB 4LHUD 2H1PH 4OIIH 1FAIH 4K8RL 2A9ML 3HC4H 5CUSL 3K0WA 5JQ6L 3RU8H 3L95A 3MCG1 4Z7VA 5E8OA 5DEGA 5IP4A 5I8CA 1C8PA 3BWUC 3KYAA 3S7GA 1F58H 2DM4A 4EQ3A 1RUAL 3TCLB 4KJQD 1ZE3C 1UKQA 3AY4A 4PJ5B 1KG0B 3IF1A 3ARBB 4HG4K 5JOPE 1AGDB 1CTOA 4HUUB 1TVHB 2VR9A 1Y18B 1NMBH 4GQPH 4FQPA 1GZQA 4O58L 1OQXA 4ZAKB 3RWFA 1GL4B 3EJYD 5E4EC 2HRLA 2E9IA 3SE9H 5D5ME 4IMKC 4X6CA 4QOKB 4POZC 1AGCA 4KDVA 5J4MA 1U9KA 5F7NC 3HZMB 2QQNH 4KJPD 1VKXB 1A0QH 4JQIH 3I50L 3NIGF 4L4TD 4AYFA 1RZJC 4ZUTA 4H1LH 4GRWB 1CGWA 1YEGL 3M17B 4OZFG 5CP7B 4YJZL 3WIFB 1MIEL 5F6HJ 4P4RA 1I8IA 1H8OA 2AQ3A 5T1MB 3ARBC 4OGYH 1NL0L 3RVWD 2XYCA 4R6UA 1VEPA 4JLRB 2DWEB 4UUJB 4OIBA 1RK1B 5DD5L 1MCSA 2L0DA 2OL3L 3SKJL 5DT1H 3UTQB 4A2MA 1BQHG 4ZAKC 2GT9B 4NGHH 1W8NA 5EC2A 4D0BB 4W6XB 2J88L 1MCFA 4WI4A 2YD4A 3QXAB 4P2QA 3MLVH 3LQAL 3Q3GB 4GRLB 5EH1A 5IF0B 5CD5C 1G7MA 3NH7H 4G6JL 1MFEH 3B9KB 1B9ZA 3EYQD 4ZFOL 1GOFA 2CKBL 1I4FB 2AEPH 2DQCH 1UJ3A 3HR5A 3LRSB 2BSRA 3VXUD 1TETL 1HI6A 2B4CL 2ZUUA 5DRNA 4PR5A 1I9EA 4LLYA 4BK4A 3BRFA 2JIXA 1M4KA 3T2NH 2VLRE 1VFUA 2BDNL 2Y5EA 2PCPB 4X6CF 3ZSTA 4MA1B 3NBNA 3IDYB 3WO3B 2C1PA 2I5YH 5B8CB 3MV8D 3NA4A 3BZ4A 4EI5A 2DMKA 4XI5C 4JCLA 5I1GH 3AS3A 3QUKA 5FYLH 1A21A 2QQLH 5TE7H 1AGEB 3WNKA 4Q6IB 1IKNA 1KCRH 1I1AA 3BZDA 4F58L 3NFSH 3NFNA 1NUGA 5ECJE 3B9KC 4M7KH 4DQOL 3ULUE 2JCCA 5DJYB 5JLZB 4U33A 3BZEA 4Y5XA 2ICCA 5T3ZL 3PIQA 2M1KA 3RWDA 3DV6B 2NY5L 2RFXB 4L4VD 3LKQB 1QO3B 4ZS6C 1R5VA 5AG8A 3S98A 4LPTA 3GSWB 4Y8AA 1M71B 1QZ1A 2P46B 3UTPE 3ZDZF 2ID5A 2EDTA 2Q87A 1YZZA 4MZ3A 1IEBB 4QRSB 4U1IA 2YPLE 2ADFH 5ICXA 4OZGE 2WWMC 3LV3B 4XT1C 4LLVB 5LGJB 5I17A 3QUYB 1RULL 4ENED 2XZCH 4GXVL 1IQWH 5J1SC 2P5ED 4GW4B 4G8EA 5C7XH 4P23B 3G5ZB 5E6ID 3L3OB 3X12B 3T3MF 4YQXH 1JE6A 1RZJH 2X70B 4QXGL 5KS9E 5IQ7L 1NCBL 5CWSA 4QRRA 5C6WH 2BVQB 3QHZH 4J3WA 5E2WH 3FFCE 3S3PA 2HJLB 5DJCA 3OKDA 1UWXH 3I75A 4U0RB 1UZ6F 4QHUA 4RFOH 1TCMA 1WZLA 5IB5A 2H26A 2XG5A 1DBML 4O2CB 5CILH 4NBYB 1DUYB 5C8JA 2VDRH 3FFDB 2X4UA 4HS6B 5JHDB 4Y4HA 4MHHG 1NFDF 5FV1L 4QRPB 1IFHL 4LU5H 1C08B 4HCRA 1MCIA 3OB0H 5CZVL 1MHCB 1FGNH 2CUIA 3DMMA 3WLWD 3GMQB 1T1ZA 5DEZA 1QFPA 4YHOL 3RUGB 1J0IA 2WQRA 2IADA 3LKPB 4WHTA 3TVMC 5BXFA 5I16A 3IFPB 3UTTA 4L8SA 2YKLH 3NIFE 5I8EB 1IC7L 4KZEL 4NZTH 2MPAL 4GRWH 1JK8A 2YUZA 3MJGX 1I3RB 3FHAA 3O9WB 5DZNA 1UGNA 1KBGL 3O81A 2DQGH 4OCSL 3IU4H 1L7IL 2AP2A 5F7EL 1T5XA 5T3XE 3DURB 2GUOB 5I1DB 3OXSA 4JO1H 1A14H 1F11B 2BSSA 4YO0B 1I1YA 3CPLB 3MA9H 1R6VA 2OR9H 4XNYH 2WBJD 1CL7L 4JFHD 4QRTA 1PZ5A 4ZO6A 1MY7A 4JFZL 4WWID 3AAZB 5TDPB 2DQFB 1YYML 4P5TD 5DQ9A 1L0YA 3V4PL 3WLBA 5D7LE 1U93B 5D7SH 4GRMB 1F45A 3CLEH 1MJJA 4TSAH 4WUUD 1U91B 5T5FL 2OP4L 4YHNB 2O5YH 4Q2ZB 4HXAH 1F4WH 1EAJA 1CL7I 2V2WB 3SCMC 2C9AA 5J11C 1YN6B 4U6XB 4KQ3H 4FFWD 5I66B 4Z7VE 1FL6A 1BF2A 3DJ9A 1GGIL 3D0LB 2CUHA 2WUBL 3QAZC 1BVKA 1H3XA 1KCKA 5AZEH 1JN6B 3RL2A 1A6UL 1FQ9C 2H32B 2CLVB 3SPVB 1KELH 3DX6B 1S7WA 2EC9U 3GHEH 4H0IA 2DDQH 3SQOH 4LGSB 2P42B 5F1OB 4PGEA 2DQTH 3QI9B 1JHTB 4FQJH 1II4E 5D1XD 5CEYB 4Y1AB 2UY6A 3GNMH 4PJIA 4YPGB 3V6ZB 3GK8H 4KRPD 3ES6B 3OMZA 3RI5F 3O2WL 1DDHA 1I7TB 1BGXL 1UWGH 4WFGE 1QLEL 4N1HB 2V5RA 2OZ4L 5BZWB 3HS0A 5JOPD 1WEJH 3AU1B 1FO0A 2IBZY 4R7DA 5FGRA 2X09A 4JVPA 3V6BR 3C9NB 1LEKA 3PV6A 1MJUH 4JHWL 1E4JA 4OJFH 3G5YB 5J6GA 2XACC 1FNGB 2EIDA 3CFJA 3MLWL 5HYJB 2AXFB 2E7MA 3OR6B 1CLZH 4JFQB 4JHAH 1F8TH 1TVBB 3QI9C 3HMXA 5K93A 3PGCB 5ESAA 2DRUA 2ZKHL 4ONGL 4P2QE 1FCCA 3D0VB 4Q9CA 3MLSH 4ALAL 2GCYA 4PJCB 2QSCH 3DVNA 4G9FA 5F6IC 3V0VA 3WHE0 3HE6B 1JHLH 3HCVA 1A7NL 3G6AA 5CP3A 4AH2A 3WS3B 2VZUA 4WENB 4Z0BH 4NC1E 1FYTB 3HLAA 2D9QB 1YECH 5DVMA 5FYKE 3GIVA 1U8QA 2R1YA 5F44A 3U4BL 5DURB 1G7HA 5ANMB 2X41A 5KSUA 2A38A 4GMTH 3CMOL 5TDOA 5F7KC 5FHAH 4XCFH 2P24A 4PTTB 3MREA 4JPWL 3WFDL 3DO7B 1NKRA 2OXHA 4XWGH 1VDGA 4KMTH 4N9GA 2E7LC 2RAMA 3BO8B 2VDQL 1UKTA 4PJ8A 2XQBL 2PTUA 2YD1A 3O6FA 1UM5H 1LO2L 1SM3H 1QQDA 3C8KB 3S5LB 5E03A 1INQA 1AY1H 2JCCE 4YHLH 1J1PL 4JDTL 1ITCA 3BJ91 2C1OA 4JPKH 5KZCD 2VLRD 5HGAA 1FL3B 1TNNA 1TZIA 4KTEL 1FG9C 3P9MA 4HSQA 1JNLH 4Z7WB 1DQDL 1KJVA 5T1DH 1PG7W 2HT3D 3QUXB 2IALB 2FEEI 4XCYB 2H2SD 3DIFB 3MUHL 2VTFA 5E99H 3L7EB 3TBSA 5TE4L 5F8QC 4NKOB 5GHWH 1CGTA 4GUPB 3V4UH 4ZOBA 2J5LC 5HI5C 2XWBA 3ULUD 2IWGA 2AABH 3EYUL 4BQ6A 3MR9B 4LIQL 3F58L 1NEZG 1Q1JL 5JO5B 3BI9X 3T0WA 5FUCC 2QSQA 3DRQB 2I24N 1DSFL 5F7DB 4QRRE 2NY0B 1FH5L 4QNPE 2NPLX 2EDYA 2BNUA 4GXUN 3ROLA 3ZE0F 3UTPD 1D5MA 1JCKA 2H32H 1Q9OA 3DSFH 1AHWC 4RFNB 5KSBF 4TUKH 2YPLD 4HIJA 2ZCKH 2FHBA 2J8UA 1WTGT 2VE6B 1OM3L 2Z9TA 5IG7B 1KENL 1ZA6A 2XPGA 4HIEB 4H25A 5DC4B 4NRYA 4ZYKB 5BVJA 5GIRA 3IAQA 1F3DH 2VL5A 1WCQA 4H1LA 3ZTJG 2OK0L 1AKJD 1KPUA 1K8DA 2RIKA 1Z9SA 4K71B 4NC0B 3STZA 3BD3A 3ZKXC 2J4WH 3FFCD 3UTTE 2PW1B 5GSVB 5IEHA 2E7CA 2VDOH 4JZJC 4L1DA 1IAIM 3KJ6L 1O5DT 2EXYC 5A16A 1OCWH 4OFKA 4XP9H 5CJOH 4C4KO 4R4FH 5MP6H 4ZXBC 3RY4A 1Q0YH 4RFNC 3WSQL 2R1XA 4PRBA 3IFOA 2Q8AL 4KI5E 5CCKL 5MEOB 5CFHA 3BGFB 4Z95L 1NCNA 2A1WL 2FB4H 3OGCA 2X4SB 4TRPL 3KHQA 1DJSA 3L3KA 4XNUL 2XZQH 3GI9L 3QRGH 4KXZI 4UINL 1KEGH 1E4WL 2HP4A 3QG6B 3KLAA 3RWEA 1CD0A 2WBKA 4OZHF 4JFFB 5C0FA 4K71C 5DK0A 4FFVC 1LO4L 1IBGL 4K7PY 3VRLF 5L88L 3SDYL 3MOAH 1TJHH 1T1WB 2J8UF 3AS1A 4JANA 4UV4H 3RVTC 2H6PB 2HLFD 1JPST 3VCLB 5KVMC 5T3XD 4LHUG 5J7CC 4NQEA 4HC1H 4XTRC 3MUJA 3GJFB 3AM8C 1K4DA 4PJ9D 3H9HA 4ZFFB 1EV2E 1OTUC 1RZ8B 3KVQA 1HCFX 1FO0L 4XPFL 3IXTB 4YPJA 2RCSL 4EOWH 3MLZH 4N0FA 3IFLH 3BH9B 4M9PA 4MDIA 5I1IH 1A6AA 2DD8H 2FL5A 1N0XL 3GM8A 4KHXL 3MPCA 3VA6A 1NGYB 2AJYH 1BM3H 1CICB 4YAQA 5IFHL 3QHTC 1ZWIB 3O0RH 3VD9A 2HJKA 3DYPA 3HMXL 3HZYB 4JDZB 4XXCA 5D7LD 5L6YH 3X3FH 1R24B 2ZG2A 1MCOH 3MCKA 4Q0XH 5T5NF 4HS3A 1OF2B 3MNWA 2NY1B 1CFNA 3REWA 1RIUH 3C5JA 4X8JA 5M7QA 1J88A 1F3DJ 2F19H 2FD6H 5JXED 1UB5A 2BY3A 2NX5A 1PYWB 4PRPA 4QXTB 5JW4R 4JO3L 3P77B 2VQ1B 4WY7H 4ODHL 4XP4L 1ZHKA 1WZKA 3PWPB 1E4KA 1EMTH 2HVKB 5A2FA 4DTGL 1A6WH 3QRFM 4PJIE 4WWKB 2BOCB 4ZUWB 3U0PB 2DJUA 1KJ2B 2Z31C 1TZHB 2BJML 4HDIB 4PP2B 5IBUB 3FRUB 1ODAA 4PJ5A 5DQJB 1KG0A 3ARBA 1AGDA 4I1NB 4AY0A 4HUUA 2B8OT 1TVHA 1KJ3H 3RGHA 1Y18A 4M4RA 2NY1C 1YNKH 3T2QA 4GO6B 4JQVC 1MVFA 1MCEA 1QSEB 4ZAKA 3AC0A 5F6HI 2AI0L 1WAAA 1N4XH 2OTUB 5IW3A 3THML 2YD8A 5C07B 4QOKA 5LBSH 4WFGD 3G9AB 4PIRF 1BD2B 3QCVL 1FIEA 3HZMA 1AIFB 2H1PL 3OKKB 1VKXA 3LS5H 4XC1L 5J1TC 5TFSL 5KW9L 2BOBB 1O7SA 1H5BC 4G9FE 3V0WH 3GSQA 4LKCB 3M17A 1MRCL 1FYHB 1S7QB 5CP7A 3WIFA 4UQ3B 1CG9B 4ELMB 3BRGC 1NUDA 1P5VA 4I0CC 3T77B 3QG7H 5EU4B 5T1MA 1CLOH 3QP3A 4Q97A 3C08H 4JLRA 12E8H 1RJYB 2DWEA 4UUJA 1TQCB 1RK1A 5EU7E 3KPTA 3UTQA 2FH6A 1X5YA 2GT9A 4QXUH 4D0BA 4JZNB 4P2QD 4J4PC 3QXAA 4JPVH 4OD1H 1WGOA 3HNSL 2XTJE 5JIPA 3Q3GA 4GRLA 2WLZA 2CDEB 1A7PL 5ELIA 4GXUM 3B9KA 3JBG7 3INUH 1V7NL 4HPOH 1YJDL 1I4FA 4RRPA 4J3VA 4K3JH 3LRSA 1A0QL 3FRPA 4JQIL 2VDNH 4LEOB 1ZK9A 5FYKD 1EPFA 1Z2KA 2JIXD 4KKAC 3PG2A 1OAZH 3C6LB 1JFQH 2OCFD 4UDUB 2ED8A 2ATPB 2QADB 3IDNB 5L8JB 2YUVA 1GXEA 3K8KA 3ZZ1A 2EDHA 2Z35B 4MA7H 5DA0B 1IGCH 5GGVY 5ALCL 1LK3L 4XPHH 2E27H 3IGAB 4EI5D 4YHZH 1ZHNB 5B8CA 3GJFH 1DBBH 1A6ZB 2VKXA 3B5TA 4ZOCA 1CD1B 1M7IB 2X4OB 2FHFA 2YBRB 3UPRB 3VFOB 1I1AD 1FC2D 1AGEA 3FKUS 4JE4B 4Q6IA 1NEUA 3SEPA 1TVDA 1YY9D 2PF6A 4M61B 5DJYA 4JG1H 4PJ7F 1W72B 2ERJB 1AXIB 2EO1A 3DV6A 2DQCL 1U8NB 4CJ1A 2RFXA 3LKQA 1QO3A 2XKNB 5SWQB 5ALBL 1IE5A 2D3VA 1NH6A 3GSWA 1PSKL 1M71A 4HS8H 1V7MH 3U7WL 3L5HA 1REIA 2XICA 1IEBA 2J8UE 2UWEB 4QRSA 3DECA 2FLBT 2ARJQ 3LV3A 4LLVA 1S7UB 5LGJA 4HPYH 5ADOH 3QUYA 2VISB 4OSUL 4BUGA 4Y4KB 1A1MB 2EKJA 4JN1H 4GW4A 2I5YL 1G1YA 4P23A 1VADB 3G5ZA 1QFWH 3L3OA 3X12A 4KZDH 1D6EB 5EFIB 1QOKA 5I0ZA 4QRRD 4I0PC 3D39B 1U41A 3GBML 2X2YA 3QHFL 1C7TA 1KJ2H 3MROB 4GMSL 4E5XB 4XPBL 1JGDA 2HJLA 3QB7C 1F13A 3CK0L 4I13B 5CZXC 3GKWH 4PS4H 4NKIL 2ERJC 1SJXA 2R0WH 4XPAH 1S8DB 4O2CA 5I1KL 3L1OL 4ZMAT 4Y4HD 1F90H 4YZFF 4LAQH 4CNIA 3N85L 1DUYA 3FFDA 4HS6A 5JHDA 5LKNA 4BH7B 4QRPA 4KKNA 1PKQE 1C08A 3DMMD 1ACYH 4OCYH 1QFHA 2HWZL 1MHCA 2L7UA 3GMQA 4Y4KC 3UTTD 3RUGA 2VLLB 1LO5B 3LKPA 5E5UB 4L8CB 1W8OA 3IFPA 4CGTA 5I8EA 4K2UL 4L5FL 3GJEB 2HRPH 4YQXL 3UBXG 1T7XA 1RZJL 1G6RL 1FNEB 2R8SL 4ODSH 1I3RA 3B9AA 3O9WA 1IJ9A 2B39A 1RUQL 3VG0H 4KI5D 3DHMA 3T0BA 5BZDB 3MV11 4NQEE 2CJUH 3MODH 3HE7B 3DURA 2GUOA 5I1DA 4KROC 5KBNC 5FYLE 1F11A 1RUPL 4X4ZA 4YO0A 1BVZA 4CBPA 3CPLA 3SDAC 5BJTB 4F33B 1IC5H 2HKFH 3MRCB 1T6VN 1DBKL 5MI0B 1JZ4A 1FBIH 5E08L 2A77L 3AAZA 2X40A 5TDPA 2DQFA 5I9QC 3GUTA 1ZT1B 3D9AH 3R0NA 2ZJSH 4NBXB 1U93A 2X1QA 4GRMA 4NQXB 1U91A 5HBBA 5JW5B 4YHNA 5J6HB 4Q2ZA 5CMAB 2NX5E 4U7SA 3M07A 3M1BB 3RWJB 5F7LB 2V2WA 4PRPE 3DYOA 3VXOB 4KGLA 1YN6A 1FRGL 4M93B 3IU4L 2J3SA 4NOFA 4U6XA 3HE7C 5L8KB 1HWGB 3CFDB 4EIGB 4XBEH 1P9MA 5F1NB 4TYUA 5HGHB 5DF0A 1JZ6A 3MA9L 5DVOA 1OWRM 3JWDH 1BJ8A 2ARJB 1JN6A 2GW5A 3NCBB 4XMPL 4XNYL 5DFWH 1PFCA 5MI0C 2YD7A 4PLJD 3SPVA 4DVRL 3N1PC 1OTTC 3W9DB 3DX6A 4PJ5E 3TLRA 1JNJA 1JV5B 5IJKC 4YGAB 2K3TA 1T5WB 3DETD 4NZRH 1T0MB 1J1XH 1W72H 4KPHL 1Q72L 3ZHDA 4OGAC 4UQ2A 3UYPA 4YX2L 2YOCA 3QI9A 4NQTA 1JHTA 1MOEA 1XGPB 5CEYA 2CK0L 4Y1AA 1WAAE 4HXAL 1IAIL 5I8OH 2VITB 5GJSH 4M93C 4L8DB 4QOKE 3CC5B 4IOFD 4YPGA 3V6ZA 3FONB 4EVNB 4DUVA 4RSVA 3ES6A 1LQSR 1DEDA 1I7TA 4K07A 4KUCD 4HWZB 3KLDA 1A6PA 3ZE2E 1AXTL 2FATL 3QXVA 4GRWE 2EH8H 4FMFA 4DKFH 1EEUA 5LCVL 3AU1A 1EBAA 4WHYH 4IDJL 1T7WA 4MAUL 1DQLL 1IAII 3C9NA 2IBZX 4IRJB 2JB5H 1HOCB 5EWIH 3JVGC 3G5YA 4OLWH 3IXAB 1FNGA 3GHEL 1JZ8A 1NAML 3AS0A 4M5ZH 2AXFA 1W0VB 5HYJA 2DDQL 2ZG3A 3OR6A 4IIQB 4JFQA 3LEVH 1TVBA 4NN7C 2E7LA 1BECA 3PGCA 4IBLT 5I19L 1P4LB 4PGZA 3PHQB 4KAQH 3D0VA 1CR9H 4G9FD 4LVHC 1CLYH 4OF0A 4LQFH 5DD1L 4PJCA 1F6LL 1XF1A 4NKMB 3HE6A 3GK8L 1WC7B 4XMKL 1UWGL 3SE4A 2VWEC 3WJJC 1FYTA 1TITA 4WEMB 1ZT4B 2APBA 1OWWA 1WEJL 3UYRL 4KK6C 4IRJC 4KQ4H 4YFLI 5ANMA 3U9UB 3LKRB 5EG6C 2ZUQB 2XTJD 4PTTA 3E6HB 3PF2A 3TO4B 3LSOB 1EH9A 3VXNB 3DO7A 3KPLB 4KUZH 1QFWM 3ARZA 2WINB 3BO8A 1OTSC 2OQJB 4JR9H 3O6FD 4P46C 3QWOB 3WNNA 4TNWK 1GHFL 3C8KA 5GPRA 3S5LA 3IDGB 4E41B 2JLLA 4JN2B 1AGFB 1AH1A 3UEZA 1FL3A 4NJAH 1JHLL 4HUXB 5DLML 4O5LL 1RZIB 3NCEB 1OY3B 4Z7WA 4HF5H 3U9PL 4C59B 4CRPA 3KPMB 4XPGH 3QUXA 2IALA 5E8NB 1J7VR 3DIFA 4URTB 4XCYA 4MYWB 3QEHA 5BOZG 3VMNA 3L7EA 4MQ7A 4MMZC 4OT1H 2ZUQC 4OAWB 4NKOA 2EEBA 4FQIH 5A3ID 3TO4C 4P4KC 4GUPA 4ZPTB 2GY7B 2BY2A 3AROA 3E3QC 1QUNA 2ZPKL 3MR9A 4WI7A 4YNYB 1WISA 1X4XA 5JO5A 3BJLA 4B7IA 1BZQK 3FZUC 5FIEA 1IKFL 3DRQA 4HUVB 1BOGB 4JJHA 3VGHA 3UDWA 4XNZB 1YPZF 5HHXL 4J7RA 4ZXBA 4YHKH 5DYOB 1AC0A 4UI2A 1XGYL 3WHE1 4LEXH 4FQXD 4NO2B 5EZOH 4NZUL 3QZWB 2VE6A 1EO7A 3CFEB 3HUJF 5JHDE 4HIEA 4QRPE 2EH7H 1ZHLB 1B4RA 3FQUB 1CDYA 1P2CA 1FORL 5EO0B 3KDMB 1P4BL 3RUGE 1AO7B 3WYRA 2QR0B 3V4UL 4XVSH 5IV2B 4RX4A 1N5AB 5FYJL 2GK2A 2VZ1A 2PW1A 4YXHL 5GSVA 3SBWA 1VESA 3AUVA 4KC3B 3VW3H 3RZWA 1D5ZB 1E6OH 2VDLH 1EGJH 4U1LA 4H5SB 4GQ9H 5GZOC 5FV2A 3MMEB 1RIHL 3AM8A 4XNZC 2AEIT 4PJFF 3OKNB 2X5PA 3BN9D 2RBLA 3MBXL 4N0UB 1DLFH 1ONQB 5MEOA 2NNAB 3GMPB 4LRIA 5F9OL 1U42A 1D6VL 2X4SA 2BVPB 3F7VB 5EOQL 2ENYA 1KACB 3QG6A 5CSZB 3MLRL 3WFEH 3WMSA 5F9JB 5DUPH 2RB8A 3Q6GL 4P5MB 1LP9F 4ONHB 1JGLH 4LGPB 1DBAL 1KIQB 4K7PX 3SY0B 5DJZB 1PY9A 1T1WA 2H6PA 3BKYL 1WIOA 4NQED 3QFDB 3VCLA 3TWCH 5I1EH 1N64H 2IFFL 3GJFA 5FYLD 4ZFFA 1RZ8A 1UH3A 5CJOL 2DIJA 4YHPB 3IXTA 5I1AB 3T08A 1XAUA 4JO4H 1IAOB 1MJ8L 5C0AB 3BH9A 4OFPA 4EZMA 1NGYA 2Z31A 5HYIA 4LKXB 2MKLC 3IB4A 3NCJH 2NXZB 1ZWIA 1NGPH 3LS4H 2B1HL 1CE1L 2HVJB 3HZYA 4JDZA 4RBPK 5ESVB 3U1SH 5L2JB 1R24A 4NFCA 4G5ZL 1OF2A 3UTZB 4LLMB 3PGFL 4FZEL 1XGQB 1L7TH 2R0LH 2NX5D 4MXQD 4PP1C 5HY9B 4JGJA 4PRPD 1P5UA 4DGYH 2AAVA 1PYWA 5HI3C 5HJ3B 1QP1A 4QXTA 4WU5B 2X10A 4UV4L 1NAKL 2G75B 3P77A 2VQ1A 1HEZB 3PWPA 2WK2A 4S0SD 4GKSB 1SBSL 4Y1AE 5D7IF 2HVKA 1DVFB 1XF3B 3OG4B 3O2DH 2AGJL 4JEGB 3CU1A 4L3CB 5FUZH 4Y8DC 2PYFB 1F4AA 2BOCA 5JUEL 1HSAB 4ZUWA 5C0IB 3U0PA 5GS1C 3L5XL 1KJ2A 1MIMH 1J0KA 3I6KB 1TZHA 5BO1L 1LE9B 4HDIA 4PP2A 3EJZC 3Q48A 4PJ5D 3ARBD 3FRUA 1ZLVH 4Q9RL 4PGCB 5DQJA 1CK0L 4NO5B 2PTVA 3NA9H 5L6YL 4ZAKD 4K3DL 4YDVB 1BLNB 2XA3A 3P2TA 4TNVK 3VA2C 1QSEA 1XGRB 5LXGL 3C2AL 2AJ3B 5DHVH 1S3KH 3FO0H 5HYJE 2IBGA 3U30B 5FCSH 4QOKD 5JDSB 3SHSA 1XF4B 3UAJC 2OTUA 5C07A 3TH2T 1WITA 2F53A 1BD2A 2VXTL 4WY7L 1T1XA 3OKKA 1AIFA 2DTML 2D2OA 4WO4C 2BOBA 1X5GA 4GG6B 4PJCE 3ECBB 4O02H 2EZ0D 4U0QB 1S7QA 1DN2A 4ZSOB 2BVTA 3C87A 4UQ3A 2CXGA 3UROR 1CG9A 5EDXA 4ELMA 1X4ZA 1MSPA 5EU5B 2JE8A 1J1OH 5A2KH 1FYTE 2ZCHH 5T1KB 3T77A 3LB6D 5EU4A 1YEDB 5I18L 1XZ0B 1VEOA 1RJYA 3K4ZA 4HX1B 1CQYA 1HQRB 1K9TA 1S7TB 3SKMB 3TN0B 1PLGH 4XI5D 5ANME 1YNKL 4X9HA 4KVCL 4OUUB 2R4RH 4JZNA 4GRLD 2KKQA 3VMPA 3MJ6A 3PP4H 4POUB 3CNKA 4P9HH 5F89B 3B9KD 2CDEA 5I76B 1M7DB 3F65A 5K59F 3BPNB 1GPOL 5D1ZC 4EQ2A 4NP4H 1BAFL 1EEYB 2A9NL 2WLYA 4Z0XB 4ZS6D 4DGIL 3LS5L 3MLTB 3GBNL 4LEOA 1J86A 1IT9H 5L0QB 1UWEL 3EFDL 4QTIL 3C6LA 2ED7A 5KVGH 3VWJC 4UDUA 2ATPA 3BVNB 1QVOB 3IDNA 3RKDD 4UV7H 5FCUL 4Z7WE 2WWMD 2Z35A 3P0GB 1LGVA 3IFNH 3IYLW 4F37F 3QEUB 1Z3GL 3IGAA 5HYFA 12E8L 1ZHNA 3QQ3B 4Y16B 1A6ZA 3RAJL 1CD1A 1M7IA 2X4OA 3UPRA 2YBRA 3EYOB 1L6ZA 3VFOA 1G7JB 4XNQB 3VXPB 2OMBA 5IT2H 3VE0B 4GBXB 4M61A 3U4AA 3ARRA 3C5ZC 3ARDC 3WCYA 4HPOL 1VFAB 3MX0A 1W72A 3I3BA 1HE7A 1U8NA 4J3UA 1AR1C 2XKNA 2DQJL 5SWQA 4N0CC 4LPUA 4CN4A 3ARSA 2NZ9D 3BP7B 2UWEA 2C4FT 3QUYD 1A7OL 2W91A 4PD4K 2VQTA 4ODWB 2NY4D 4MA7L 2R29L 5LAXB 3KLHD 1KC5L 2VISA 1IGCL 3KYKH 4Y4KA 4XPHL 1A1MA 4RDQF 4P23D 4YHZL 3ZKND 4HWBL 5FEBA 4XNXL 1VADA 2D4DA 1D6EA 5EFIA 3ZLQC 1ZGLP 3DX9B 3B9VA 3D39A 1BX2B 5MEQB 4DZ8B 1JPSL 3MROA 4E5XA 1UADC 5CAYB 3OL2A 4A6YB 3MCLL 5BMFL 1S8DA 3VGEA 5JHDD 1ZXQA 3G6JB 1R5WB 1AXSB 1RJLB 4QRPD 4YK4C 4QHMB 4BH7A 5JPMB 4CU6A 2DM7A 2CO7B 2FX7H 1F4YH 4MAYC 4RMVA 3B6SB 4PRHB 2FSEA 2V2XA 4LCIH 1C5CH 1LO5A 2VLLA 3V4VL 3R8BB 4L8CA 2HH0H 2LABA 3T1FA 3H6JA 1JRHL 4JN1L 5DFVC 1A64A 1FJ1B 3GJEA 4JFFE 3AFLA 1NEZB 4U1JB 4KZDL 3LHPH 1MAJA 2YWZA 1DQML 3O9WD 4YDIH 1NLDH 1FNEA 1V8HA 3ILQC 3DROA 3J7HA 3RWIB 4NWTH 1IGTB 1JYWA 1K3IA 3ZL4H 5BZDA 5KG9B 4R90L 3GKWL 3HE7A 4CW1B 4Q9BA 3BEWB 4JY4B 3TV3L 3RY6C 1IC4L 5T33L 4NN5B 1QFWI 4UNUA 4R0LB 5BJTA 4F33A 2X7LB 3MRQB 4AQOA 4OCYL 3A6CL 3BHBB 5TF0A 3P4MB 1KTKE 3TF7C 1ZT1A 5KSVB 1IGIH 1S9WB 4Y5YC 2VXSL 5HI4D 4NQXA 1KCVL 1Q8MA 4ODXA 5JW5A 5J6HA 5CMAA 3CGTA 1LO3L 3DPBA 2R69L 2LVEA 3FB5B 3M1BA 1T80A 4TVPD 3VXOA 1A4JA 1YEJH 2AV7B 15C8L 1FFRA 2IEPA 2PO6B 4K7PH 3PWPE 1RURL 5IKCB 1FNFA 3CFDA 2CJUL 4RA0C 1OP5K 4NN5C 5F1NA 5EZIL 3RHWF 5HGHA 2OM5A 1NBYB 4DK3A 5CGYC 1TJIH 2AXJA 1JPGB 1FHGA 1ZTXL 4ZD3H 1JGVL 2UYLB 1FVCB 5I6XB 3W9DA 1PEWA 4NT6B 3ARGB 1JV5A 5KTEL 4OCXH 5DRWB 1EERB 4RIRB 1T5WA 4X4YB 3SDDC 3VWKB 1K8IB 3BT2H 1T0MA 4JKKA 3L3DB 3NPSC 3QI9D 3S3SA 4UT9H 3IU3B 2F8OA 5J13B 4W70A 1QSEE 1RMFL 4KKCD 4Y1AD 4XP1H 2R1WB 3CSPA 1XGPA 3LQMA 4U31A 4KK8C 5GISL 3VGAC 1JTTA 2NY6C 1JTPA 1MRFH 2VITA 4MJIB 4MQSB 4L8DA 1CDHA 5C9KA 5C07E 4WCYH 3CC5A 3OXRA 1BD2E 3FONA 4EVNA 3V52H 4RAVB 4EXKA 3L6FB 5C0BB 2E7BA 1PVHA 4HWZA 4XP5H 1CU4L 1EGJA 2R4SH 1H3GA 3MUY1 2E7HA 4N0RA 4ELME 2Z8RA 1N8ZA 3LPWA 4RGNC 4IRJA 5DA4A 1HOCA 5D8JL 5HYJD 4LARH 3IXAA 5FAAA 2EICA 4X7TB 3F8UB 1RUML 1W0VA 4A6YH 1KCUL 4IIQA 5C86A 3VGDA 4ZTOL 1RI8A 5C1MB 4U6VH 1FLRH 1FZOB 1P4LA 1RV6X 2R2CA 2AEWA 3PHQA 4HK3N 2W65B 3MV7B 4YDKL 3HE6D 3U36B 5GJSL 2DLEA 4NKMA 1XR9B 1WLHA 5LVEA 1WC7A 1FYTD 3OAZK 3OJ2C 4NQDB 2VXVH 1OARL 3I2CH 1P7QB 3HNTL 4R8WH 2DYPB 4DKFL 4LOUD 5DURD 4XHQA 4JZOB 2NW3B 1BFTA 1V3MA 3P30H 5GGSY 3U9UA 4TSBH 3LKRA 3T04D 3E8UH 3UPCA 1S7SA 4LLQB 1QACA 1YYLH 4P4KA 3TO4A 3UJJL 3VXNA 1AQKH 4YLQT 3KPLA 1B3JA 2WINA 5H35B 1U58B 2OQJA 1MFBH 5HGGS 4RMQA 3QWOA 1I9JH 1TZGL 3QDMB 5I8KL 1H3UA 1MELA 2X4PA 2NXYC 1XIWB 4GSDH 5CJ8A 3IDGA 4KAQL 4JN2A 2CSPA 2XFXB 5B3JE 4MNGB 1AGFA 3O3EB 4K23L 5EIIB 2VZTA 4PRIB 4HUXA 1NGQL 4Y2OA 3LEXB 1RZIA 1NSNH 2X89D 3QUXD 4GW1B 4R26H 1C1EL 3AMKA 3KPMA 5E8NA 2P8LB 1GIGL 4DAGH 1S5IL 3BDYH 3O2DA 25C8L 2DWDB 3D6GA 2UWEE 4LLWB 2VR4A 4OAWA 2BFVH 2FX8H 3UTSB 2G5BB 1T7YA 3F7PC 4PJXF 4F80A 1WBZB 1NFIB 1UEMA 1I3VA 4KUZL 1OLLA 1WIUA 4YNYA 1WWAX 5GGVH 2IGFL 5DD3H 3SOBL 1T03L 3RX8A 1F02I 4MXWH 2NY0D 1XIWC 3D39E 2IBBA 4HUVA 4N1EA 1B0WA 1BOGA 2AJUH 1HIML 2YA1A 4HK3J 4FQCH 3CSBA 3I02A 3CX5K 4FABH 2CR6A 1KCLA 5DYOA 5E1AB 4LCCB 5GS0D 3ZE1F 5DQDH 1T04B 1LK2B 4LSQL 3O8XC 4NO2A 1TDQA 3FCTB 3FOLB 3QZWA 2ZCLL 4NQVB 1OPGH 4XMLL 4HF5L 3CFEA 4L3EB 1ZHLA 3FQUA 3T0DA 4N90E 1QBAA 1RAMA 2J6EL 4FFVD 5EO0A 5ICYB 5MERB 4IRSB 4RX4D 1AO7A 1VERA 4FMKA 2AJXH 2GJ6B 3GSRB 4GAFB 5IV2A 1N5AA 2CR3A 2WM0A 1JMXA 1D5ZA 2DQEH 2D4FA 4XTRD 3WJLC 4PJGF 3I9GH 3VXTB 4FQ1H 4H5SA 3ZDYE 1OTUD 1Y6KR 3MMEA 5I1HH 2W92A 5FUOH 4QTHA 1IM3B 3OKNA 5DJ8B 3D3VB 3O6LH 4N0UA 5D72L 1OAUH 2JJUA 1VPOH 2YPKB 3ULSB 1ONQA 4HGWB 3QYCA 2NNAA 3GMPA 5EO1B 3LEYL 3V2AR 4LEXL 2JTDA 3S96B 2BVPA 3G5XB 3G9VA 3F7VA 3WD5L 1SEQL 4F8QA 2Y36L 4QYOB 4XHJC 4IRZL 5CSZA 5F9JA 3SO5A 5KSAB 4JFFD 5D93C 1FFPB 4JB9L 4P5MA 1PEZA 2XA8H 5K9JH 4TUJB 1X5FA 4XWOC 4ONHA 2Z93B 3QIWC 2JELL 2O5ZH 3GMLA 4OLZL 1DQJB 1KGCE 1KIQA 1PD6A 3SY0A 5DJZA 1QSVA 3HG1B 2IG2H 3QFDA 2OJZL 3L5JA 3MGOB 5F88B 2JJSA 2F5AL 4M7JH 2VDML 1A4KB 4ODTL 3WN5B 2XIDA 4XP6H 3SDXB 4YHPA 5I1AA 3PWVB 4EN3C 5JPNB 1F00I 1WIPA 5IWLA 1CD9B 1IAOA 5C0AA 1KN4L 2BSTB 1CICD 4G7VL 3BW9B 3BGMB 3WIHH 4KV5F 3QPQD 4LKXA 4NRZB 5IESH 1IGFL 5TPWH 1GC1C 3CFCH 5KSAC 3NFPB 2HVJA 2OI9C 2E9WA 4DKEH 5ESVA 3WFEL 5L2JA 2NY1D 5DUPL 3UTZA 4LLMA 4J3XA 1XGQA 2NLJB 1OAKL 5HY9A 4ZFGL 5AYUH 1SQ2N 3IKKA 5HJ3A 4KTYA 4WU5A 2W9EH 3PWPD 2G75A 4UNTA 1S7XA 3MA7B 3FQWB 1HEZA 3QQ4B 3QWQB 4HQQL 4GKSA 3P4OB 4QLRA 4KVNH 3SGDI 4R96B 4V1DB 1XF3A 4WWKD 4P3CH 4KK5C 5EN2B 4WO4A 2PYFA 1HSAA 5D9SB 5C0IA 1DUZB 3GRWH 4JM4H 3MRBB 4LSVH 4PJHF 4U1SA 4NSKB 3ULVC 1F3JB 4OD3H 3I6KA 1LE9A 1MCLA 1RHFA 4HT1H 3ZDXF 1B4JL 4PGCA 1E4XL 4NO5A 3LS4L 1WBYB 5F9WB 1QSED 4XBGA 2VN7A 4YDVA 1BLNA 5JOFB 4PJBF 2F9BT 1XGRA 4HJJL 4OV6F 2YC1B 2R0LL 4H0GA 3T0EB 2BNQA 5C07D 1I8LA 5FGCB 5JDSA 4DGYL 4F9PC 1XF4A 1BD2D 3CXHJ 2HN7B 4RRPG 3H42L 1FFOB 1E4XI 3FRPG 1JZ3A 4AL8H 2MQCA 5GJTL 2G5RA 3LN4A 3BKCH 5FDWB 5KN5B 5DFTA 4DOHB 4O51B 3GEWB 3K7UA 4GG6A 2A6KB 4QGYA 3ECBA 1EFXB 4MB4A 3PWUB 4FTVA 5DJ6B 3D2UB 2HFGL 5EU5A 3HI5H 1YQVL 2UZIH 5T1KA 3S34L 1YEDA 4KFZC 4RAUB 2OMNA 1XZ0A 1N6VA 5GZNC 5F9WC 3Q5YA 4HX1A 1HQRA 1S7TA 4YBQC 3SKMA 3TN0A 4TUOA 2DICA 3RWGB 4OUUA 1U8KB 3DUSB 3ZE1E 3RDTC 5T1LB 1ZLWK 2G60H 1NFKA 1S3KL 3L3JB 2QHRL 3FO0L 5F89A 4JREC 3T3PF 2D03L 4K9EH 1J0YA 4HUMB 5C0ND 1M7DA 3U79A 5I76A 3GI8L 2H9GB 5LGHH 4CAGA 2VC2H 1RVFL 1EEYA 3HC3L 4P0DA 1N7MH 4Z0XA 1GC1H