2HUHA

Crystal structure of a duf2027 family protein (bt_2179) from bacteroides thetaiotaomicron at 1.54 a resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
147
structure length
147
Chain Sequence
b'RQPEVRGGDTLNVFLAYVPEDAKAMMTTPFEAYLVNDSNYYLYYTYLSAEGKAWNNRSHGLVEPNTKLLLEEFTKDVLNEMERVAVQLIAFKDGKPAAIKPAVSVELRIDTVKFYKLHTFSASDFFEEPALIYDIVKDDVPAKQVYV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative DNA mismatch repair protein
publication title Crystal structure of putative DNA Mismatch Repair Protein (NP_811092.1) from Bacteroides Thetaiotaomicron VPI-5482 at 1.54 A resolution
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Unknown function
total genus 32
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2006-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1600 Mainly Beta Sandwich Immunoglobulin-like Smr-associated-like 2huhA01
2HUHA
chains in the Genus database with same CATH superfamily
1RUKL 2R23A 3ZY7A 3G6JB 4XZUB 5B3NA 3IDNA 1RZJH 1TVDA 3QNZA 4JHWH 2ZTBA 1LMKA 1RMFL 3MYJB 2HLAB 4WJ5B 1DVZA 3HLKA 4PJEB 3ZT7A 4NQCD 1CMOA 4YHNA 1GGIL 3PLYA 5GRVL 1QVOB 2QFRA 2IGLA 4AMWA 4KH9A 3FONB 1DCLA 3C6SA 2OL3H 4TQIA 3FCGA 3U9UB 2Q2LA 4XP4L 3L5WA 3LKRA 3FYEB 3O4LA 3VXUD 1UOWA 1SVZA 4FFZL 1BIHA 1UJ3A 2AI0L 4ZXBB 3H9SA 4MYPA 2OYPA 1RZQA 4JRYD 1MCIA 4ACTA 4FN0A 3VD4A 4XVTH 3AW5A 3QPXH 4OLUH 3KYOB 4B6ZA 2CBMA 5I16B 2R1YB 4MQXC 4XXCA 1JZ7A 1A47A 5JW5A 5F6IB 4QXUL 3ISRA 3T0DA 4OV5B 3KCWA 3I9GL 1NCGA 3ALXA 3HI1B 2MOQA 4DO4A 3AS0A 4QRRB 2WYZA 5ACMA 3JZ7A 3GSNA 3FU7B 4PJ5B 3QXAA 4JY6B 2DM7A 5LNEA 2WQSA 5ID0B 4WENB 1M71B 5JO5B 2YA0A 3BP4B 2X1QA 4HC1A 1T83C 1EERB 3SE3C 3P77B 4DNLA 5F9OL 5JIHA 3TCXA 4F7CA 4F33A 4LP8A 4XNZC 2BY3A 2UVEA 3C12A 2IFGA 4J4PD 3JT2A 3LKNA 1DQJA 3ULUH 1OY3B 1PX4A 2MEJB 3HUJA 2A3TA 3QWOB 4RZCA 3BUTA 1BIIA 3MJ6A 2HRHA 2H8PA 2J55A 3RVVC 4NOFA 1WRFA 4DK6A 1DUYB 3VI4E 3HE6B 2ZWYA 2DQIL 3MCKB 2FD6H 1HXYA 1BAGA 1SY6A 3EJUA 4AYGA 4MKMA 2OTPA 3UPRA 2DI7A 2EO1A 1WFUA 3NOIA 1YEWA 1B2WL 1BMGA 5DUMH 4EZLA 3NEOA 1OARL 3FFCA 4FXTA 3C6LB 3K6SB 3VRLE 4P5KB 4DGIH 1BV8A 2C1OA 3QULB 1MNUH 2RQEA 3WO4B 3LV3A 3PQYD 3NTCH 3EG9B 3EJYD 1VCBC 3HJ0A 4FQ1H 3KWUA 4FYQA 2XOTA 3L2LA 3MMEB 3NJXA 2VWEE 4JJ5A 2K3TA 3DHPA 2QLVB 3QIWC 4MNQD 4GKSA 1JYWA 2FEDD 5DHVH 5IMOB 2NYZA 2XFGB 5E8EA 4ABUA 2WANA 3JVGC 4RGOH 1E67A 3GZPA 4A7GA 1QLRA 1XGPB 2JVUA 1XCQA 3APCA 4HDIA 1AO7A 1ZTMA 3LH9A 5I6LA 2VW7A 5JPNA 2Y7NA 4L3EA 4MZ2A 3VTTA 1RZ7L 3IKKA 3TURA 5EZJA 1MI5D 3OF6A 1H8LA 4BSWA 4BKSC 1V7MH 1SDAB 4OZGF 1JV2B 4PGBA 1B0RB 3VXUB 2BP3A 5K9KB 4TNWK 4C83B 4LLMA 3W0WD 3T0XA 1E40A 5F3HA 1KLGB 2FR4B 2ADJB 4KMQA 3C87A 2A6IB 2BVQB 3R06A 3CXHJ 5EC2B 2HLFC 3C8KA 1NM9A 5KVFE 4BZ1A 1HCZA 1TETL 2DIAA 4B96A 4PRIE 5IROD 3FO1B 3U4KA 1A4BA 1P4UA 3SBRA 3B8SA 3MLUL 4WCYL 4RGMB 3AM8C 4XXWA 2XYBA 1KN2H 1BX2A 2EC8A 4O9HL 4TOYH 5GISH 5CLXA 2A7BA 3GPSA 1E50A 5IOPA 1HQRA 4YC2B 5JPMB 2O61A 1RULH 4K9EH 1Q0XH 1V3KA 2BOBA 2ZUYA 4NQDB 5DLML 2AEQL 3F05A 5CLWA 4K23H 3V4PH 1ZEAL 4LLQB 1U4EA 5D7JD 3GSUA 4I7ZC 3S35L 4K3DL 2X4OB 3ECVA 5HDBB 3KLDA 4YLCA 3ASNB 1UFUA 2ICWJ 1E8YA 4ODWA 4DP2X 1PJ9A 4FEMA 4F37F 3SDCA 5EFIB 4HH8A 2VDOH 4UNIA 1T7YA 5L9DL 2ZX6A 1PLBA 3BPOC 2COQA 2XZAH 3VE0B 2WKOF 1LO4H 5KANI 1EEQA 1P5UB 3BGMA 4G7YL 4HJ0C 4GP5B 1KPRB 1JYNA 3ARFD 1MUJB 1TFPA 4S1RH 4TM9A 1SJHA 1ACCA 2HFFA 3UAJD 3QYNA 2QHRH 3PQYB 4NQCA 3RAJL 4Q6KA 5DYOA 5I0VA 1E27A 2PYEB 1AC0A 1R3HA 3TBTA 4MNQB 2WLJA 4LSQL 3UBFA 4N6RB 3HCVA 1NIDA 3DPBA 2XN2A 2GBUA 1JI1A 1IAKA 5E6IC 1U92A 3UBHA 3WEXB 3I74A 3RIAF 3SBWA 3HS0C 4PJBB 3S88H 2G5RA 2R4RL 2VDMH 4KOCA 3FQUA 2QLYA 2CK2A 5D5ME 4GB9A 3IGAA 3LAFA 5FOBA 5T3XD 3B9VA 4IMLB 4KTEH 4JRYA 2X4QA 4FQJL 5HHMD 4XMVA 4YHLL 4Z6AT 2W0PA 2X1PA 2XPGA 3Q8EA 1LNUB 2DKUA 3GGWB 1AKJD 4KK6D 3N1MC 3F58L 4S1SL 3SY0B 3W0WB 2QQNL 3VXMD 5JHLH 1RJLB 4QMEA 5CKAA 1J86A 3UO8B 4X6DA 5G2NA 3LRKA 4OLZL 3ZTDC 4ENED 4PR5B 1OK8A 1PFCA 1F6AB 4JFHE 3TO4C 4XBMA 4LSVL 5TF0A 1T2QL 3D39D 1I1CA 3U0TB 3Q7JA 3HN3A 1CTOA 1MOEA 5HDWA 4JN2A 4R26H 4Z95L 5IGXL 4HK0B 1A6ZB 2I5YH 2WLMA 3K2UH 4KRPB 2QVTA 8PAZA 1IZJA 4FMKA 3NK4A 4HJTA 4J4PA 4Y19D 4PQXA 3N44F 1BWMA 1E6JH 1GOHA 1HIMH 1CF8H 1U8OB 5E9DD 4AYMC 2YOCA 3TZVD 1VADB 5EOTB 1IGMH 3BH9A 2IMMA 5D1XA 4QT5B 5IVXA 4BFKA 2LVCA 2J3SA 1YEGH 1KCVL 1L7TH 4Z7WA 1HINL 1KELH 1VDGA 2QMJA 4MQSB 1OAJA 3O2VL 3OKNB 1SBBA 4YL9A 3DVNA 3ISWA 2MPAH 5TE4L 4W1TA 4AGNA 5HJ3A 3RI5K 4Z7OE 2GTQA 4CL7A 3CBRA 4XTRD 4UM8A 3X11A 3IAQA 5F7KC 4QEGA 1HDMA 1TTRA 2WXRA 2A74A 2FX7H 3QXUA 5EO9A 1NAKH 5HGHA 2ATAA 1EJFA 3PWJA 3ARFB 4QLWA 1A2YB 4HIHA 5JHDB 3H6JA 4WRLA 5I71B 5EU7C 1UXWA 5I8KL 3IJYB 1MLBA 4HETA 1WA2X 3BDXA 1YEHL 4HKXB 2ZP9A 5KSBE 5ESAA 4KITB 1ADQA 4RRPG 3VFWB 1YEFL 1VPOH 2FVNA 3VFMA 1B6DA 2OLDA 3ZKMD 1MI5A 1QQDB 3G6DL 1KCSH 3LD8B 3NPSB 2AANA 1N0LA 4OAWB 4BFIB 4XMTA 2XX1A 3PNWA 1S7RA 3RUGA 2HTLD 3OHXA 2GK2A 3MLZH 5MHSD 1P9MC 1YPZF 2R69H 1IGFL 5EU3A 5HHMB 5TQ0H 3ARTA 4M6ML 3SE4A 5T1MA 1UACL 1J9CT 3GSQA 3X1EA 4Y4HC 5ECGA 4E41A 3ROOA 4WGWB 1AKJB 2UX6A 4K94L 3VXMB 4R7VA 3SKJL 1BECA 4O4YH 2CNYA 1F13A 4U1HB 1KBPA 3SCMC 4N5ED 3OKDA 3LXAA 3EJCA 4J8RB 5EBGA 4QPEA 3O6KL 5GZND 1PZBA 4M8UA 5LCVA 4UTCA 4MYWB 1WICA 3ETBF 2BXYA 4M1DL 4YDNA 3AY2A 3FUFA 3P1VA 5D7JA 4OLXL 1MIEH 5EU5B 3KYNA 3ELAT 3MODH 5E9DB 1DQDL 1B3IA 3DJRA 1JOIA 3TZVB 4YSPA 5L8JB 1KXTA 4U0QB 3ZRFC 2BIHA 1F90L 1IRAY 2WLIB 5CJ8A 2HJKB 4HPYH 4FQLH 4LDEB 3GSXA 2WYIA 3TN0D 1XR9A 3RNQA 1SM3H 2O5YL 3IBEA 4NYLA 1I8UA 4PJ7F 5HHPB 1TKWA 3CLEL 1JWMA 2VR6A 2MMXA 3ESUF 1GGBL 4OVVA 3VWKB 4LDCA 1XH2A 4UUJA 5DMGD 1C12B 2VDKL 1OE3A 3N41F 2Y3NA 4MS8D 1OZTG 3UAJA 3H85A 5CILL 3W9EA 4O58L 3OJMB 5C0ND 1LDSA 2H45A 4FQ2L 3G3LA 4ODXA 1FRGL 4LLWB 4I13B 4N28A 1MG2C 2CJUH 2EP6A 5FF6A 3QIBC 4W9FC 5F71A 2X6BA 3UJJL 5D6DA 3KGRA 4JFEA 2HVJB 4B60A 3WIHA 3C5SB 1MFCL 4OZIF 2A73B 3MRFB 4TF4A 5AZ2L 1IT9H 1EZVY 5FYKU 2IO5A 5TE7L 3DX3A 3F5WB 4N2BA 4X5XA 4QHKI 5E1AA 2FB4L 4KOBA 1GGYA 4V2BA 5BW7C 4BZ2A 3O8XA 3ILEA 4ACPA 2CU9A 4CKQA 1QBLL 5AAMC 5KS9E 3HRPA 3K1KC 4KTDL 2PR4L 1TJMA 3HG5A 4D7BA 4KVNL 1PIGA 2EO7A 3O0RL 3CVIL 4Z7UF 4ZNEE 3MO1A 3KLQA 3D39A 2AQTA 1RJCA 1SJXA 3QDHA 1QP1A 1U3ZA 2P24A 4K3EL 4JO1L 1VEOA 1U36A 2R2CA 3KLAB 4TYUA 5I30H 2XG5A 4BZYA 4U0RC 2ADGB 1ANUA 4K71C 4Y19A 5DXWA 4WZ9A 2DLHA 3D0AA 2A99A 3KW8A 5M95B 1DTUA 2BFVL 1P1VA 3G6DH 3AWFA 4AMKL 4F1ZA 4L4TE 1E5YA 4JO4L 5G4MA 4W81A 1P4BL 2Y6SD 3GRWL 5E5MA 5ICYB 3NSDA 3LN5A 1M57B 3PXJA 5T1DL 1OAYH 4IEFA 5IM7A 1NCNA 1CWVA 3X14A 1NGPH 3PHOB 5INCA 4EOWH 5D1ZD 3THML 1TSRA 3OD3A 4W68A 5IT2L 3LS5L 2V3DA 1R17A 3TN0B 2GSIA 1XFPA 1QA9A 1J8RA 1FNHA 2W9EH 3PWLB 3BX7C 1DQLL 4H8WL 1T1YA 3STBA 4QXTB 2GTZB 3B9DA 4OFDA 5C08E 5FEBA 3KVPA 1G7IB 5HI5C 3QEQD 3V6OC 5T33L 5CINH 2LT9A 3D18A 3T9WA 1E9QA 2WBJD 2AJXL 3ZDYB 5HVHC 2ZOLA 5IJCC 4GJTB 1UVQA 4TULL 4XP6L 4FI6A 3HPJB 4Z18A 2E86A 4HH9A 2MHAB 4XX1G 2V2XB 3CN2A 3KPOA 2JCCA 1Y6KR 4UV4L 1YQ2A 1QZ1A 5DZOA 5F88B 2JJVA 1TO5A 2QKSA 4RISL 5JLZB 3U2SA 4HS3A 3BWSA 2Z3FA 1IC0A 4ZUUB 1CDGA 1NIFA 3WJJA 3BZ5A 5BCAA 3QUXA 3WIFA 5I1LA 1WIPA 2VYRE 3TV8A 2X7LB 4DEUA 2W80C 1CVSC 4FKEA 4NKIL 3UERA 4YDLB 1BJMA 4UBDD 3VFGH 3DXAE 5ITFA 5MEND 2XV6B 1OZUA 5IZ7A 1BFVH 3OAUH 1VKXA 2RCSH 1I1FB 1FIEA 5BO1L 4I3GA 4LPYA 2GJZA 3QHTC 1MSPA 4C4KO 1JN6B 5EPMA 5BUAA 4PWGA 5CGYC 3CHSA 4JFVA 1M2VB 5CP3A 5FM5M 1SHWA 3W2DH 2WP3T 3CSYA 1I9RL 2NR6D 3V4VB 5EZOL 3NJHA 3BEVA 3MUGA 2ZOTA 4KX9A 9CGTA 1N6VA 2CUIA 4H8HA 1UH3A 2DYPD 4V2CB 2MNWA 1U95A 3KDPB 3ZKNC 2X4NB 1CJYA 1HXKA 2ZX5A 3FT9A 3MX0B 3ARWA 2X05A 2BP0A 5T8IA 4W6WB 4XXDB 4J6IA 3MRLA 1TPXB 5D7IB 5ICUA 3MOBH 1GS6X 4XP1H 3ARYA 2WIMA 3ECBB 2NSQA 3S98A 3SD5A 5B39A 1JHKH 4HXBL 2EDDA 4GAYB 1L3NA 3VD1A 5HHNA 3MRQA 4G2AA 1HEJC 4OKVA 3X3FH 3ROLA 4YS4A 4ZMWA 3HC3H 5D1ZB 4DH2A 1NA8A 3EH4B 1ZGLP 5I1EH 5IEHA 5LQBH 3SDXF 3WTTA 5DO2D 2C9RA 3HRZB 4HKJB 4QHLA 4U6XA 4OGXL 2ZXQA 3D85B 1SDDA 3VRJA 1AXTL 2B5IC 4NN6B 5I17A 2G5BA 4ABQA 1HEHC 5KOVC 1P7KB 1LL1A 1DVFD 2EH8H 1S3RA 4GNKB 4GW1A 4UM9D 1JDAA 1FN4A 2VABB 3HLAA 5I73B 1GAFL 3SQBB 1UCBL 4B3VA 3T0EA 1GS7A 3IDYB 2BSDA 1EIBA 3ATAA 1FL3A 1E5ZA 2QSQA 5J9PB 3ZGIA 3PP4L 2Y5EA 4J3OF 2P5EE 1J9RA 3CHRA 43C9A 4MX7B 3D69A 5F2FA 3ZZ1A 1NC2B 1O6SA 3P3TA 1PZSA 1I9JH 4I4WA 1OE2A 1CO1A 4PRPD 4A67A 3OZKA 2V33A 1JPEA 4ADIA 4R90H 3ARDA 4H8WH 4XI5C 3T0AA 4X7SL 1CDYA 3CVDA 2AJSL 3HZYB 1G94A 1FVCB 2FIKB 3FTZA 1I3GL 4OUUA 2X5PA 1ESOA 4XNQA 5J3HC 3SB3A 3OR6A 4G6FD 4OT1H 1MAMH 3ZGHA 2W1NA 4X4KA 2VLLA 2H32H 2QR0B 1RLBA 4MXVE 3RY4A 5CXPA 4HUXA 1GY2A 1O9VA 5FUOL 4BQCA 3GMNB 3V6FA 1B6UA 2FSDA 2NXYB 4ICXA 3SIKA 1AY1H 2WV3A 4ZBJA 4FMVA 1XB3A 4UV4H 3T3PF 2N0MA 3DSNA 2WGNB 4PH8A 2HN7B 3SKUD 4R4BA 3TESA 1N6QH 3R18A 4I0PC 4DHLA 2JKWA 3VFTB 4JVPA 4IKKA 2UZPA 3EYFB 4UT9H 3Q05A 4B97A 3CH1B 3SJVB 1RI8A 1F6LL 5C2BL 1QLFA 2IWFA 5JTWA 3ML9A 4PBVC 4BFNA 1WAEA 4RMTA 3WKPA 4LOEA 1NCDH 3A22A 2F58L 1A7PL 3BUQA 2CJTA 1H3TA 2IFFH 3IAGC 1MFNA 4RAVA 4RNRA 4IIQA 4JHVA 4D2NA 3OJDB 4Z3GA 3QEQA 2ED7A 5MP6H 1TYJA 3G5VB 2XQBL 4HOXA 4Z0XB 4P3DA 2DI9A 1DVFB 4TUJB 2WBJA 3DOIA 2MOVA 3NQIA 4NKMB 2EEFA 4UM9B 1T83A 3SE3A 2FO1A 2OAAA 2EKJA 2QKIC 1H6TA 2XKNA 2RFXB 2EDJA 4FQXB 5DRWA 3TYFA 3CFBA 2HUHA 2YJLA 1GCFA 3PUUA 3HI6L 4HXBH 4ZT1A 4DZBB 3CFJB 2CLZA 4PJDB 2XACC 2X42A 4HMCA 4A7TA 1UD2A 4ZJ9A 1P53A 3LYRA 5DA4A 4PRNA 4NO5B 3ME0B 5ALBL 1WA0X 1AQ8A 2BZ7A 1KTBA 2HP4A 4CN1A 3D3VA 4Y2DD 1X7QB 4KKNA 4PRPB 5MENA 2MCAA 3L1GA 4TQEL 2UZXA 3BKJH 4UQ9A 4X8CA 4NT6B 1E6OL 1LJMA 4M6OH 3MACL 4GW5A 5J13B 3OX8A 1UENA 2ROYA 4R84A 3GMQB 3NFSL 4G6FB 4HQQL 1S9XA 4HFUL 2XV2A 1I1YA 4GUCA 4NLHA 2HRPL 2WUCL 5H8DA 3ZTNL 3AMKA 2EYRA 2QVMA 4GRMB 2WBWB 3QQ3A 4JY5H 4ZXBC 2F54D 2NNAA 4XAWH 1P2CB 3W82A 3MRNA 3ZMNA 3JTSB 2DYPA 2CK0L 1DQKA 4JFTA 1HX0A 3SGJC 1ZKAA 1FAKT 2X2YA 2YQGA 2B77A 3FDWA 4ZFGL 2GUOA 1GSKA 1FH2A 5AOLA 4X6EB 2WLYA 1TJIH 2Q86A 3NN8B 4QRQB 1IGTB 1PL3A 1RK1B 3CJJA 3NIGF 1XD1A 4XBPA 2P8PA 4GT7A 1DZ0A 3QDJD 4Z7QE 2EXSA 1NJ9B 2E9GA 5K9QG 4PRID 4PMFA 1OSZB 1J8KA 1R5VB 2NW2B 3RNKB 4E9RA 4J3UA 4AYSA 1JGEB 1VA9A 2P43B 3TBSA 4BCZA 4WHTA 5GRXG 3VFSA 2RD0A 3HZ3A 3VXTA 2BVEA 3DHMA 2VDRL 5T5FL 4XP5H 3MLVL 4E9YA 2B59B 5DJ2B 4NRZB 4I1RA 3QRBA 2VISA 4BIKA 4JQXA 1KG0A 2HZHA 7FABH 3UOAB 3AM8A 4X0KB 4CAGA 5E4OA 4DCQB 1CLZL 1D5ZA 2X0VA 3HE6C 4PJXE 1KV7A 3HNVL 1TU2B 2WYHA 5DC4B 2R83A 1UTDA 4Q9BA 3D09A 2HFGL 2XN9A 2Z35A 4GMSH 3BLPX 2VIRA 3RU8H 3IDIB 4ZMAT 1WBZA 4LBEA 4R9HA 1RZGA 1JK8B 4I3SL 3BAEL 3C6LC 3W9DB 2J8UF 3LQAL 1GZPB 3FSAA 4EVNA 4Z78B 1DBAL 1MFDL 1MWAH 1A7OH 3FO9A 1IGIH 4RSVA 5TE6H 4GFXA 3AC0A 1HKLL 4IOSD 1GZQA 4H1LA 3TH3T 5JMOC 1AZRA 4WI6A 1XCTB 1SEQH 4XO5A 3QUMH 5F0MB 2JI1A 1V05A 4WNSA 5EOQL 5IFJB 4ADGA 2B2XH 4AYDC 3CFQA 5F9WC 1QHPA 4LLVB 4G9DB 1AHWB 2JKJA 5AYUH 4IOIB 5F9AC 5CEZH 4WO4D 4KZEH 1DEDA 4BSJA 2HJLB 3LN4A 2EIKB 3NSXA 1KIQA 3MV9D 3U4AA 2SEBB 2BNUB 1TJHL 1XQ4A 2F54B 2BMKA 2XSKA 4RZKA 1I7UA 4K8RD 1WG3A 2B0SH 2X70B 4HHWA 2C3VA 4Z8FL 3B43A 5BVPL 4AQEB 1T89C 4B9GA 1FFOA 3HS0A 4MCZA 1JGLH 3BHBB 2CG9X 1TZIB 5DMJB 3R7RA 4RGMC 4Q2ZA 3ARBD 2ADFL 3U4BH 4EUPA 4O5LH 1MW2A 2MFNA 4NO3B 4TL5A 3P0YH 5GRJH 1ZXKA 4PRIB 4JFHD 2IBBA 1KOAA 2AXGA 2QPUA 4JGJA 5JPMC 1DVTA 4C47A 2P1YA 3U0PB 3QDGE 5C0EB 4ZDHA 1FG2B 3RWHB 3WNJA 3BE1L 4FFVC 1HHGA 4QRAA 5I1DA 3S3PA 1ITCA 4CA4A 3B2VL 4S10A 3CC1A 2VDQL 1H5BB 2Y1AA 3GS0A 3IXAA 2BLFA 3Q44A 4KHXL 4PWFA 3T8MA 5T1LB 4PJFE 5BZDA 3KJ4B 4OZ4B 4S0TD 1X9QA 4HXAH 4Y9CA 4YXLH 1OTUC 3EXLA 1L9OA 3CLWA 3UC0H 3GPEA 1A1OA 4OZGB 5KVGH 5KYXA 5D2LE 4K07A 4L1DA 3PL6B 1P6WA 3TWCL 2G4GA 4JR9H 5ENWB 3WS6C 1LYQA 3VM5A 5C3IA 1P5UC 3DIFA 3B2UD 1K4DA 3BVNB 2DQFB 3KWXA 5GHWL 2HKFL 2Q8BH 2AAVA 2YMXL 1S7XA 5C0FA 2PUQT 1JPSH 5SV4A 4U1KB 3EJYC 1J1PL 4A6YA 3WDIA 1XL6A 3MGOB 4Y2DA 1NFAA 2VDRH 1DDHA 3QCUH 3KBFA 3LEYH 4A2MA 4KNTA 2X0UA 2RJMA 3ZT5A 3MROA 3L7EB 1QFWH 2JK5A 1RIVL 5FUZH 2CKNA 1L4IA 4J28A 3TF4A 4KY1L 1TQTA 1X5JA 4N1HB 3V0WL 1I1AD 1G9ML 4HZ1A 4CW1B 1JPTL 2UY6B 4AE1A 3MNWB 4ZTEA 3QFDA 1GH7A 4HIPA 2VXQA 3P4MA 4N2DA 4WO4B 2QVKA 5D5MB 1YNTB 4DP1X 3DX8A 4R7LA 3AU1A 3I84A 4QJ5B 5EUOE 1T22B 4GO9A 5ESVA 3TNNB 1BEXA 2BSSB 3ZL2A 4Y4FC 3QDME 3QDJA 3HG0A 4NQVB 5E4IA 4X4YA 1G1CA 5DZPA 4E0RA 5IROC 1YVLA 2MSPA 3CSBA 2VXUH 1P84J 3GO1H 4FQQB 2R7EA 3WN5A 1GHFL 1ETB1 4DP5X 1QWNA 4HEME 5AW8B 3OKLB 3IM1A 3MBWB 3L5XH 1I3UA 3QXDA 4KK5D 4YJZL 1P9MA 5ACZB 1WO2A 3L9RA 4I9WE 1BYNA 1CYXA 1ODAA 4KRPC 4G8EA 4WQOA 5I5MA 2CGRH 3AB0C 1OEZW 4GP4B 2X2HA 1OTTC 2WO3B 4ZUWA 4I0CC 2FDBP 1QI3A 1VGKB 2RHEA 3BO8A 4YE0A 3T65B 4GSDL 4FABH 1MAKA 1FF5A 1NKOA 3LKPA 1J1OL 1R3KB 3QUKB 4HC1L 1NMBL 3AWGA 2J6EL 2BWQA 1ACYL 3ARVA 5EO1B 3SCMA 4BFJA 5BV7L 4M1CC 5C86A 4OM1L 2PP7A 32C2B 4LZKA 3TGXA 1FVEA 4N6QA 3TYGL 3NEXA 3HNTL 4DJMA 3GJEB 1J9TA 2ICCA 4QXGL 3ZBMA 2J1KA 4PP1D 1U2YA 2YPKB 1MJ8H 5TD4A 2OK0L 3OJVC 5BQDA 3QE5A 5AOJA 2IPUK 2DY2A 4Z7OB 5EHFA 3ZE1F 4FQHA 1ZGLA 2O6EA 2X1WL 3UTPE 4MJHA 2YBRB 3BAIA 4L18A 1GGCL 4LFHG 5A6LA 5I71C 1DFBH 2EDBA 3BE1H 1MFEH 5B3JF 2Y5TB 4TV3A 2GEQA 4PW3A 3OGCB 2BVPB 4H40A 4FXGB 4CC1A 3ECWA 2WTRB 2NQ3A 4GAGH 4ZD3H 2A9ML 2FT6A 4UF7C 2IPTL 3V5DB 5F9DC 4YOKA 4A04A 1MVUA 1A14L 2FSEA 4IKJA 3AREB 3CSGA 5DK0A 3Q5OA 4XR8C 4LP5A 4JFDE 1MCOL 5AAPA 4AJWA 3LD8C 3NPSC 5KSBB 2TAAA 2Z4TA 4KI1A 4OGYH 1TTUA 4ZTOH 3MV9A 3D2UD 1TCRB 5D7KD 4XC1H 1ZHKA 1I1AB 1BQ5A 4HWEH 4LFHD 4TNGA 2V2TA 5HDQH 4Y2LA 1G6RH 4PGDB 2WKOA 3QIBA 5IEKA 1D7CA 3GZOA 4KJQD 4WEEA 1I4FA 4PJCF 5E9AA 3OWRA 5TFSH 3ARBA 3HE7D 3RVTC 3WOVA 5DDHB 3IFNL 4NQXB 4P3CH 4MD5A 3QUZD 4GEIA 3UADA 4KDVA 2ARWA 2MCPH 3L4ZA 2CIIB 3O9WB 4PIBA 5C3TA 4PSRA 1RIVH 5I1JL 1ML0A 4P2YA 2ZWSA 4ZMOA 2J56A 4IU2B 1BFTA 2AABL 1UWGH 3QJQB 4NWTL 4KMTH 1II4E 5AAMA 4AENB 2WZ5A 3F85A 3N43B 1YQVL 1MHEA 5E4EB 3T5WA 4P4RA 4G3YL 2GCYB 3PHAA 3RFZA 4B5EA 3BJLA 3RGBA 5EBLB 1KFAL 1N8ZA 4MXWH 1FORL 2PCYA 1UB6A 2G3NA 2G30A 3F12A 4OLYH 1R47A 1BJ8A 5C0JA 2DBJA 3P9MB 2F5BH 1Q0YL 1ITBB 2A9AA 1NFIB 4LXFA 3WSQH 4AQ1C 4PCKA 4NWUL 1CG9A 4W6XB 1ZT7B 4GSQA 1T1XA 5ILTH 5G4OA 2F9BT 3T4YA 3BEWB 4MB5A 3L3DA 3FB7B 3UABA 4U1IA 2NUTA 3ULVE 3JV6A 4GP8B 2B39A 1KT2A 3VWKC 3X12A 2Q5BA 1IO4C 2OW6A 4AQAA 5KVEL 3GBNH 3GBDA 2OMWB 3OQRA 5IHUL 3HR6A 4NM4H 1BD2D 3OPUA 3AADB 2CD0A 2DJSA 3GSNH 1YEEH 5GJSH 5M94B 4CVZA 5A2LH 3OC8A 4H8UA 4HOZA 4TTDD 1MNNA 1FFPB 1RURH 1XH3B 1ZTXE 4UIKH 2AK1L 4K7PL 4OV6F 5DEJA 1HKFA 3NIDE 4L4VE 2AJ3B 4B9ZA 4WV1B 2QDWA 3RKPA 2XRAL 3GMRB 1U8IA 4Z7NF 3HB3D 5J8OA 2HTLC 3D2UB 1E9OB 3EJSA 4GT0A 5D72L 2J2ZA 1WHOA 1SY6H 3BP6B 3MGAA 3HZKA 1A7RL 3ZDXE 3CN4A 1E9PB 4N2OA 1QBBA 1J9SA 1M7DA 3WFDH 3BRDA 3DXAD 1F58L 3WTSA 5KS9B 3V0HA 4W9DC 4HF5L 3HE7B 5LO7A 5HGBA 4JPVL 5DEFA 4KUZH 3QR2A 1YMMD 4KTYA 2VTFA 4N5EC 4APQD 4Z3TA 3PYCA 3K72B 1NPNA 1ID5I 2WWKT 3AS3A 4TVPH 2JIXD 1ZAGA 1YDPB 2ZKXA 5GZNC 2ICES 2WOYA 3Q8AA 1QTYT 1DE4B 1K8IB 1WGVA 5FYKL 4NSKA 1C5BH 3FN9A 4Y7MA 4L37B 2PN5A 3S34L 3DO4A 1FJ1B 3AZUA 2XTJE 4M7ZB 1BAFH 4HBQA 3GI9H 1ID2A 4MNGA 4PCTA 2WN3A 1PCXA 1YPZA 5DZVA 4CADA 4L4TB 2QGDA 1Q94B 3WXVH 1HZHL 2P52A 1TJGL 4YHOH 4P9HL 1JNLL 3PAUA 5SWQA 2LW3A 3TN0C 3SKMA 4ZQKB 3UTTA 4C55A 1R24B 1DLHB 3U7YH 4EDXA 1DVQA 2XBDA 1SXNA 2R29A 5CWSB 2Z7ZA 2LOEA 5TDPB 4BZ1H 4WHCA 1CXFA 3GMMB 4EDWH 2EYTA 4GIOA 3SPVA 4NUMA 3ZXAC 4MS8C 4BH7A 3EOTH 3V0VA 1V7NL 4EXKA 3L9BA 3GSRB 3EDDA 5E7BA 1JMZA 1X4YA 1A7QL 5JNYA 1Z5HA 1S5IL 4XCNA 5C08B 2X4UA 2K1MA 2WQAA 2YSSB 4JM0A 1EZLA 4EIUA 1BM7A 2JLPA 3OG6B 1DN2A 1VFUA 4FLOA 3ABGA 5JIIA 2DQEL 2PWEA 3BPLB 5DD0H 4M5ZH 2L7JA 4G43A 1G9NL 1LILA 4IS6B 5FKAA 4YPGB 3EH1A 3BXNA 4W4OA 1JZ5A 3VFOA 1ADQL 4LNRB 4G5ZL 4Z1PA 2NUPB 1AZCA 1SNRA 2KI6A 1LWHA 3ZPDA 3EBIA 2WQRA 4PJ7A 1SFHA 3UGEA 2AW2A 4GAAA 3HB3B 3R0NA 4YFEA 1ACZA 4ODHH 1L6PA 2XA8L 3MR9B 3SOTA 1DJIA 5FK9A 3K71B 1Q9LB 5AQ0A 2YA2A 4GO8A 3II2A 3QUZA 4J3OG 3C8HA 5I28A 1A9BB 4OCYH 4E42B 2HRLA 3A0OA 3DXAB 1NICA 2W65B 2D03L 4PJAE 1GYCA 4ABWA 3B2PA 2FJHB 3CWGA 2QTVA 4APQB 4ZUSB 1G0DA 3P2BA 3ZYOA 2IXQA 5I8OL 1ZHNB 3FQWB 2OX5B 4QYOB 1OP3K 2JIXB 4Y5VB 4GUQA 1MFAH 3SE8H 2F0CA 3KLKA 1G9EA 4LESA 4IJ3B 4OZIA 1ZXQA 5ECJE 3FFDB 1W0VA 2ZF9A 3ABMB 4JG0L 1LO2L 4J3OD 1TPXC 4DO5A 3LKOA 3GXPA 3SOBL 4X7TB 2E75C 4FNLH 4H2AA 3QG6A 3E0GA 4OF3A 2JELH 1AJ7L 1FWXA 1OP4A 3DVGA 3RGVA 4J2QA 4MCYB 2WSDA 1SYSA 1C16A 3VJ6B 4OJEH 4JLRA 2B1HL 1I8LC 2APWA 5GRZA 5F3BB 3HRZC 1DJXA 5E00A 1E2ZA 4DSYA 1G0XA 2GSGB 4Z7UA 4AT6A 4H25B 5I1GL 3BKYH 5CUSL 3S96B 3VFVB 2QQQA 1WP6A 1KIRB 4LSRH 1BD2A 3HS9A 3TTSA 4NN6C 4XH2A 3ZZQA 3WMQA 1L5GB 1G7LA 3A21A 1GC1H 3FF8A 2KZ1B 1JUFA 3PWUA 1E5BA 1H15A 4BRJA 5EOCJ 5I73C 1PD0A 2AJVL 5FYLL 3D9AL 3IDYC 1VJSA 3ASOB 1W8EA 4AKOA 5BQ7B 5EDSA 2GIXA 5L2KD 2H41A 2R1XA 5F7EL 1TG8A 4XMPL 4NRYA 4G6ML 2LAAA 5A3ID 4U1NA 4NUJA 2C7FA 3AAZB 1J5OH 2YC1A 5E0FA 3BC9A 2R4SH 3L1FA 5F89B 5CJXA 3JQOB 1TQCB 1MWOA 1UZ6E 4OB5H 2HPTA 4YSSA 2R8SH 2C1PA 2P5EB 4KJWD 1O7DE 3JWOH 4ICWA 1O7VA 1PLGL 1MHCA 1JVOA 4AQ8A 3RWEB 1FZMA 2IOIA 3KPSE 2FHBA 4LU5L 2XG4B 4Z7VF 1DL7L 3TS8A 5AZEL 4BZ2L 2DWEA 4QOKE 2IADB 5F7HA 1I8IB 2Y22A 4YWGH 2IF7A 1IL1B 4KO9A 2WWOA 1K6QL 4NQQA 1YMMA 3SGDI 2BW5A 5F72S 4N0FA 2VR7A 1TZ8A 3QC6X 1J8SA 5IF0A 4YVUA 3AT8A 4ZAKB 4OF6A 2NXYC 1CXEA 3FMGH 1CFQB 4CMHB 3HHRB 4ZW5A 2NR6C 2BINA 3WEOA 3QCVL 3NZSA 4ABVA 1ED3A 2GITB 4F7PA 4E9LA 1SQMA 4LHUA 4PWIA 5AB9A 4DK5A 1GSMA 1BXUA 1FZJA 1S7QA 4YR6A 2HKHH 1BOGB 4FG6C 2NY4C 2BRRL 1NFDE 3ARPA 3VD0A 2AV7B 5FO9A 1M6UA 2XA8H 2CO3A 4GKLA 4F1SA 1MY7A 4LLYA 4ALAL 4A2HA 2PPCA 3GB7A 5I16A 1WZKA 4LL4A 3TTYA 4N8UA 1MREH 2CAKA 5I26A 5SX5H 3T09A 1B0WA 4ZSOA 3FQ4A 3MTXA 3ULUE 1T04B 2NRDA 4OV5A 2WXHA 3HG1E 1AD0A 2IDQA 5HHOE 3SO3B 5JHBA 3U0WL 3JTTB 4UQ3B 2EE2A 1KEML 1NGQH 1PSKL 3HIZA 4QHNB 5F7AA 3HI5L 4Y1SA 2D7TL 4XO8A 4QHMA 5GGRB 1N70A 4F7MA 3BP4A 3ABKB 1WCQA 3KS0J 3L3JB 4FLHA 5LCVH 1T1ZB 4D7PA 2EABA 3AQZA 4LF3B 2VUOA 4AJVA 5MEQB 4LVNB 4H5SA 2IGFL 4M43L 3DJZA 3EGXB 4FQXC 3MOAH 1FZOA 3AU0A 4OZFG 3WUWG 1QUNB 2QQKH 5I1HH 3GLZA 2P8LB 2G2RA 2G3XA 1BLIA 1F86A 1AQMA 1QEXA 2EIMB 3PWVA 2YEQA 3L3IB 1CLYL 5DK3A 4BH8B 4RWYL 5JIKA 3HNSL 4PUBL 1NBZB 5C0DA 5C0AA 4M7LH 1JHTA 4NNYB 1VIWA 1S78C 1PTZA 3PWNB 3C6LA 2UWEA 4OZHE 2FLBT 5J13C 1NKGA 4FP8H 5HPMB 3C2SA 2R0ZL 1AMXA 3BZFB 5GJTH 3B3BA 2WPGA 3T3ME 2PP9A 3EO1A 1UOLA 3TJHD 4JPIA 1C9SA 1KENH 5IQ7L 2NY5H 1IZKA 5IMOA 1X5FA 1VRSA 5F7EH 2YGVA 1KCWA 3MUUA 4WFGD 1HL5A 1K3ZA 5F7LB 4NJ9L 4UOZA 1DQVA 4IBLT 5AVYB 1JFQL 2VDLL 4WSGA 3V0DA 2VN3A 3WIHH 4G11A 3VU1A 5T3XH 4DN3H 3W3BA 1T21A 3EYSL 4OI8A 1RUQL 3RDTD 2V5SA 1HL4A 2C9PA 3LXBA 3NAAL 1AH1A 1JZ3A 2C9QA 4LU5H 2TRYA 4UZSA 3DX6A 1DN0A 3T4AA 1TNMA 1O5DT 4RFEA 1S9WA 3EOAB 1KLGA 3FRPG 4XWGL 5KBNC 2P4AB 3CFDB 4GH7B 2DYRB 5HYJE 1KDIA 3VW3H 2KQMA 4ONGL 4ANWA 2Y7MA 1T89A 3QDGD 2CGZA 1IM9D 4NBZB 3QRGL 5K39B 1L9NA 2IWKA 3DO7B 1ZLSL 5DJXA 2BP8A 5JR1H 4HUVA 1S7WB 4XNMB 3O3DA 4CVXB 1CFMA 2J43A 3NIFF 4YUEH 5EUKB 1GRWA 4LLUB 3LS4L 2DEWX 3FHEA 3M8OL 1KIUA 3CBJB 2AZAA 2BIQA 3V52H 2XLLA 4CU7A 1U8MA 3FB6B 4QRTA 1INQA 5L2KA 2YWZA 4P23D 5D1QE 1CFNA 4PCSA 4PJXB 3IVKB 3RBGA 3SBPA 4GW4B 3OC5A 1KJ2A 1EMTH 2IG2L 1FGVH 4JVUA 1A6AB 2X6MA 1UXLA 3IJEB 2WSKA 2FBOJ 1VAHA 1F4WL 2EILB 1TNNA 4OCSL 1IGYB 4JQIH 5D7SH 3H7BB 1KEGL 4WW2F 1N5AA 1O5PA 1UEYA 3STLA 2NPLX 1H9DA 2VWEC 1XSOA 2LGNA 1EUTA 2XZQL 1D2OA 3AUWB 3WS6A 5FHBL 1EHNA 2J6WA 3LVEA 4HIIB 1HZKA 1WYJA 5EU4B 4PRHE 2QPSA 4Y8AA 4P49A 4OZFB 1HN1A 3BW9B 4GQPH 1OCCB 4AZUA 1LM8V 1MRCH 2HFEA 4LDOB 5AYTA 5IR1B 4OIBA 1HEZB 2QFPA 3L4TA 1HYSC 4IRSB 2OMZB 4KY2A 1QWHA 4NO0D 1E8WA 2NY2C 2JB5H 1MCKA 4AUUA 1MQ8A 3LN9A 1PD6A 1Z5LA 1PG7L 4OW6A 5I5IA 2CR0A 1XGUA 2VXVH 4I88A 2Z4QA 3WHXB 4NFBA 1HILB 2H7WA 1JRHH 2OJZH 3LNIA 5IG7A 4JM2F 3QSKB 4I48B 3SKOB 3FKUS 4PMEA 4Y2OB 4DVRH 1NINA 3W11D 3KM1A 4AM0A 3SY0A 4AIZB 1TT6A 3FQNA 1SF3A 2AGJH 2F19L 4N0CD 1IBGH 3EO9H 3CG8A 4GRLD 5EV7A 3TNMB 1H5BC 3L2MA 4Y4FA 1DBJH 1YUHB 1Z9SB 2V8MA 3K7UA 1AGFB 3E7JA 4OCRH 3QDGB 1MJUL 2EEBA 4UZGA 1IM9B 2AITA 2IANE 1Z9NA 3KH4A 1IFHL 3EZJB 3PUCA 3CZFA 3KJ4C 4OUOA 2DLIA 2AXFA 1FC2D 2EXWD 5E2VH 1VEMA 2OW7A 2NT0A 5CHNA 5CP3H 3I9AA 2A4ZA 1BFOA 3FHAA 3L1EA 1JFQH 3PU7A 4W6YB 4FNTA 3PL6C 4PJFB 4XVJL 4PV9A 1PAMA 1MHHA 1XGYH 5AVRB 5DRZB 1RLWA 1UZGA 3C60B 1XV8A 5DZ9A 5D96C 3FRPB 1VADA 2EYSA 3FN0L 3GKWH 3VUAA 5D2LB 1ETZA 1RUQH 3WGVB 3RVUC 1OW0A 4X9GA 2DQGH 3A23A 5BZZA 2R9HD 1CU4L 4LEXH 3RKDC 4JDEB 3HEIB 4YZWA 1KGCE 4HU2A 3ZQ9A 1YEKL 1WWBX 1LP9E 2BDNL 2VQ1B 4DN4H 4DP6X 1T5XA 1J18A 2EUVA 1NC4D 2ADIB 4NX0A 1IQWL 4JZNB 5DJ6A 3S5LG 3F2LA 1D7DA 1E30A 2QPFA 4DUVA 3WUWA 1WZ1H 5HGAB 3OXSB 1VGEH 1D5BA 1T4KB 2IOMA 2ZJSL 1GGTA 2GPZA 4E5XB 1K4CB 3H2PA 5IQ9B 1F6FB 1PD1A 1BP3B 3MBEC 2V5TA 2XWBB 3WHE0 1PZ5B 4G1EB 4YDVA 1EFXD 4G8IA 4G9FD 5H2BA 1D9KD 2UZYA 3Q2VA 5DS8B 1E4XH 3L6FB 5TGBA 3TBWB 4MWFA 3PRZA 2J8UA 3ETBJ 4JO5A 4EAEA 1GYUA 5JNYB 3N85L 1V3MA 1UEMA 5MEPA 2XWJA 4OCSH 2XICA 3BVTA 1B4TA 3QI9B 1D6EB 5EUOB 2BERA 3RDTA 3BRFA 5IQOA 5L4MA 5JIMA 12E8H 1TEGA 3BLKA 3KNBA 3Q6FB 2LU3A 2J7LA 1UA6L 3QDMB 3FCTB 4X9HA 1H6FA 2DPKA 2YK1H 3MYZA 2WCPA 3WD5H 1B4JL 4F5CE 1NL0H 2DRUA 4U1MB 4WHYH 5AUMA 5LKNA 3IKCB 5DTFA 1WAAF 1EXUA 5C0CE 1I85A 2EXYD 4H20H 3I50H 4GRLB 2QGCA 4NQUA 3F6IA 5DVNA 2KDGA 4GXUM 4Y4KD 2A1WL 4MQ7A 3K8LA 1E0OB 1L9PA 2ZWZA 3FCSA 5CEXA 1U42A 4PGCA 4OBSA 2GAZA 3DV4B 1JXGA 4K5LA 1DLFL 5J6SA 3S3SA 5FGBC 1KGUA 3PFUA 4P23A 1N2RA 1OTSC 2M83A 3VXQA 3DX7B 2CPCA 2NX5A 4LB8A 4RA3A 3WLBB 4GG6A 5K59F 2DM3A 1LEGB 3D0VB 3ZOAA 5CCGE 2Z7WA 4PJIA 4XWOC 1JGUL 3FOLA 2BNQA 3MLWL 3N0PB 5ETUB 4G8FB 4AYFB 4LIQH 4ELMF 5JXAL 5CLTA 1FG9C 2D0HA 5TQ2H 1EPFA 1U6AH 3SPJA 2BNRA 4AQ1A 4YAQB 1EAOA 3VRIA 1JV5A 4LKCB 2ZP0T 1R1CA 4FXGC 5LXGL 1OANA 2K6ZA 1OGSA 2PTVA 2WW8A 4JFYA 2EH7L 4HV8A 4RAUA 1SLXA 4ZPTB 4AVIA 1DSYA 4IMKA 4MJ5A 3AREC 3LEXA 4Q0XL 5B1AB 2VSKB 1FYTE 3K0WA 3QW9A 1TZGH 1I8MB 3PJSB 2IH3A 2NY3D 5IJDC 3HR5A 4L5FL 2NW3B 5AZUA 1C5CL 5IVZA 1MZYA 1NDTA 1NDMB 3NZ8A 1EFXB 3PP3H 4NO0A 4WFED 3U2IA 5BS0D 4JFDB 2XDHA 1IC4H 1IC5L 2C9XA 3CIAA 3DRTB 3AQYA 1XCXA 4TUOB 2PYFB 2FECL 4CNIB 4JE4B 1PS3A 3FB8A 4GQRA 2PCPB 2EDMA 4KI5F 2O1AA 3FZUD 5D2NA 4ANVA 4WW1A 3U46A 1SOXA 3B1UA 2E56A 4AEFA 1PF3A 4Q89A 3O9WC 2Q76A 1FUNA 1SBSL 1DBKH 1YJDC 3M17B 5HPOA 4KK5C 4ESKA 1EEYA 2D0GA 5EC1A 3ALPA 4WKZA 1JG9A 1LQSR 1OT2A 1W72A 2AC0A 2DTMH 1EO8H 4H8QA 5E4EC 4X6FA 1PU0A 3C8DA 3EJZC 2WLZA 4P0DA 1UM5H 2B4CC 3B3IB 5FYJD 2P5PA 4P59H 2P7TA 1HAWA 1OAQH 4RMWA 2XXMB 2CDEB 1G1OA 4YDJB 5FDYA 1SJEA 4A7SA 2GABA 2A83A 2BZCA 2VMEA 1FL5B 3O41A 1ZT1B 4WO0A 5LG1A 5EBMB 3FYIB 5DVMA 1AD9A 5AVUB 1OOAA 1GPOL 1PZAA 2XVBA 1SYVA 3F00A 1IB5A 4TVSa 5ICYA 5I24A 1VCAA 3KL3A 1IGCL 5JORB 3I02B 4X5RA 4F80A 3D1MC 1AACA 1NC4A 1CICB 1H3PH 3B7UX 4JGMA 3R1GH 4NFCA 4A6YL 3GTTA 1KY6A 4RDBA 5C7ZA 4L1LA 1BA9A 4P2QE 5DZLA 2NLJB 1NBVL 2ODHA 2UY7B 4AL8C 1CGYA 2HA1A 3MNVA 1ORQA 4G9FA 4LSUL 4MAYC 1G7IA 3VFUB 5BXFA 3WNLA 1JNHB 2NY3B 1D9KA 2Q2EB 4L29B 4WSKA 4YQXH 5KVDH 4J39A 4OH2A 3J07A 3NIDB 1H3UA 2FUTA 4FYTA 3I9IA 4L4VB 4TLUA 4DPBX 5EEYA 3S5LA 2JKRM 4ZW6A 3WTYA 4XO4A 2VM4A 4YHML 4LASH 2EE6A 4OIIH 3Q1SL 4L3AA 5JXAH 2CBQA 1BQHG 4Q4EA 3D06A 5F88A 4RBPH 2FX9L 4F57H 1E28A 2V17L 4OCMC 1UZ8A 5KANG 5I8CA 4LLAA 2P5WD 4JDZB 5LXGH 1IQDB 3C9NA 1X9RA 4XNYL 4JRLA 4LEOB 1CLOH 2WUBH 4KU1A 3G5YA 4YSTA 3O3AA 2Z0UA 1TUPA 4JAMA 1DQMH 3L3GB 3BGAA 5I19H 4L5FH 1BM3H 1I1FA 4F3FA 1SN2A 5ISZE 3NSFA 4M7ZC 4Y4KA 3CXDH 3FOMA 3NCBB 2XC8A 3A6CL 1J0KA 4YDIH 4PY7B 4N5UA 5E4AA 1UT1A 3IGKA 5C09D 3CH8A 4G8GE 3QPQD 5E08H 4GQ9H 2XTJB 1JZHA 3UYRH 1JERA 4WTZA 3VFRB 3DURA 1FHGA 3FRUA 3FT3B 4Z7NB 1S9VA 3PWPE 1QBAA 4HLZG 4ZS7L 4A2LA 5HYSG 2J8OA 4PJCA 2PW1B 3S8FB 1MDAA 5SWZE 4EI5D 2KPNA 5IMMB 4Y5XA 4JRXD 4L1TA 3EYVA 1A6WH 1LTXA 1PZUB 4W9HC 1NPJA 2ZD0A 2W9DL 3RB7A 5EOCH 1WIUA 4LCWE 5DJYB 1LK2B 3CPLA 1BF2A 3VGHA 4GPVA 5E8NA 3C6EA 3B2XA 4CJ1A 3KPLA 2HMIC 1X44A 3H3KA 4HG4K 3B83A 1CD1A 3MXVL 2OTWA 3BPLC 2H1PL 3NZHL 3UYOD 1RH8A 3QH3A 2OQJA 5DWUH 3NFPB 3PREA 3WKMH 2JJWA 4I77H 5I2IA 5BS0A 2JV6A 2BOCA 2IQAA 1N67A 2OM5A 5AKSA 2YAHA 1U3JA 3RPIA 3F62A 4HUWA 1W0YT 5K9OA 2WK2A 2FRGP 4JUSA 4Q74A 1WE5A 2H9GA 4DEPC 2Y36L 3C5JA 1HU8A 1CK0L 5HJDA 2DQCH 2AKRB 1XMEB 3ZVVA 1AGEA 1MFBH 1K85A 1YEDA 2AJZB 1T7VA 4ZFZA 2YPVL 3CXHK 4HKZA 4QOKD 4XC3L 3SN6N 1MCBA 3F65A 1Z3GH 4AZ8B 2J4WH 5FIEA 4L1HA 4LCCB 4FYRA 1XXFC 3D7PA 3MI6A 4APQC 1S5HB 4MJJA 5A2CA 4LKXA 1J11A 1RXLA 3ZE0F 5DSCA 4PJAB 1HH6A 1YN6A 1IMHC 2AQ1A 2HFTA 2JQZA 1DSFL 2B16A 5DJ0B 2Z34A 4K7FA 5E7FA 4F7TB 3IJ9A 5KSVB 3QQ9D 3DMMC 2J5WA 4ONHA 4FTVE 2TSAA 3P9LB 1WC7B 2VLRA 1BQHB 1SHXA 5EN2B 4KROD 7CGTA 3ESPA 4HKBA 1HNYA 3TH4T 1QD0A 3EW3B 4MASA 5IHBA 3BZDA 3BUPA 2VXQH 2ZKWA 3F7VB 2AQSA 3N50A 3TT1H 1KTLA 3APFA 1OPGH 1T66D 5T1KD 3VFPB 3GS7A 2MOGA 3K91A 4Q9RH 4N20A 4PRBB 5B38A 1DJGA 2E46A 4EI5B 1XD0A 3WJMB 2NZ9C 2Y4SA 1EEZB 1JPFA 1L9SA 1BXXA 5D8JL 1F4YH 2ZUWA 1U8QB 3NDYE 1AQKH 3A4EA 3FUDA 2A6KA 3MNDA 5CZXD 4BFBD 4LPCA 4NGHL 5EZLA 5LBSA 1OAUH 4Q6YA 3ILPB 1QSFE 3EIFA 4U1GB 3MNZB 5CSZA 4AIEA 1KYOJ 5I76A 4JN1H 3CFKB 2FBJL 3CMGA 2EKSB 4D0CB 1LK3L 1NM4A 4Z7AA 1KXQE 4L9LB 5HYSB 4WGKA 1V27A 4AM0Q 3O11A 1JGDB 3OJDA 4OCXL 4QRUB 4G71B 1NEZB 1A66A 3RX8A 1TQCC 1A3QA 4WU7B 3LPGA 4LAQL 3KW7A 1RZPA 5E94B 3LPOA 1EHLL 4TTGA 2Q3XA 3BT2L 4G1MB 4Z5RA 1M7UA 5ESQB 4A2FA 1JTOA 2HT2D 1UWEH 2Q1EA 2VERA 5D7LE 5ICZB 1KULA 5DJDB 1WZLA 4LCYB 1RQ5A 1Q9KA 3CSPA 4HIXH 4N22A 3T04D 5H35A 4DGUA 4TPRH 1UYWL 2P5WA 3KPSB 3KYKL 4KXBA 3OZ9L 1EZVX 1FZKA 3EO0A 2IBGA 2OL3B 1KJ3H 2GIYA 4QOKB 2DBLH 2B15A 3JVFC 4WVRA 4ZAKC 1UGNA 4H44C 3V0EA 1LEIB 5EBWA 1M3JA 3MREB 2AEPH 4U49A 4WFFE 1ACXA 3F7YA 1F18A 1KCUL 1NGZB 4JRWA 3RWIA 2F18A 1NDGB 3TH2T 3UBXB 2CDFA 3DGGA 1WEJL 4MNHA 2HWZL 3TF7C 4OI7A 1FFNA 3ETTA 2CQVA 4HHAA 3RIKA 5C09A 3NRPA 1PDKB 4YO0A 2LU7A 3QHZL 4BKLA 5F0JB 1GR7A 2A9NH 4KKCD 2VZTA 3QISA 3VXSD 4KKLD 5CM1A 4AGQA 3QS2A 4HT1L 5HYEA 3EOYG 4K8RH 3ES6A 1NFDB 2PCFB 3HFMH 1HI6A 4HUUA 3WY1A 5E8OB 5CFHA 4JZJB 3SO3C 5FFLA 1KTJA 3A67H 4P05A 4TSAH 5LAXB 1JF6A 5HTSA 1R0AL 4LRNH 4PJGE 2CR6A 1Q9OA 1I7RA 3PPSA 3B8YA 3HG1B 4NB7A 5F7MC 2AK4E 2O6FA 1KZQA 5HHOB 4PW9A 5LDSA 3ZTCC 3G5ZB 2GFBB 4BJLA 2H2PC 4JW3A 4MD4A 2LLNA 1FH5L 1G7HB 4E9XA 4BQ8A 1RSFA 3KGSA 1LDPL 4PJHE 1VLXA 5IB1B 1EA9C 5D1QD 2VE6A 1IAIH 3BPNB 4Z0BL 1V3JA 1ZA6B 1WVZA 5F3FA 3TIEA 2FECI 1ETJA 2CM6A 4G7QB 4P4KB 1A22B 4N2CA 2KZKA 1SVBA 4UT6A 1R3LB 4WUUE 3IFPB 3OGOE 4PLKC 2OSWA 3WLWD 2Z8SA 2EAEA 4X83A 2JKXA 4OTXH 4NZUH 4JO2H 3VI4A 3P0GB 3TCTA 3CHPA 3WI9A 1N7ML 1MELA 1KTDA 5DHVB 1QFUH 3DRQA 4IDJL 5FFGA 3EDKA 1U8PA 3TFKD 4Y8DC 4K55A 4XPGH 1PCSA 3RRQA 4PRHD 5T3ZL 5KZCD 3MRKA 2BSCA 3VI3F 4YDMA 5C0IB 2WVVB 3QNFA 4RDQG 3N1QC 2G4EA 3C2AL 4HOMA 2X4RB 3ZL1A 4PVLA 5DD6B 3T3MB 4NUGL 3ZDZE 4ODUA 1JZFA 2GK0B 3WDHA 1JVKA 1PY4A 5DHDA 4M48H 3EXJA 3G04A 4LLVA 4G9DA 3FU9A 3TONA 3V7MA 5BZWA 4I5BB 5HI3D 4F2MA 1OF0A 1VACB 4IOFC 5F21B 4AC4A 3D4ZA 3GMOB 4R8WL 2RB8A 1SMAA 4MD0A 2P48B 3NESA 2XY1A 5DUPH 5L6YH 3DK2A 3L08A 4JGNA 3G5XA 3DBXB 1A0QL 3ZUCA 1OT1A 3UL4A 4Z7VA 4JQVA 3CX2A 3DI3B 5T1KA 2R51A 2L7EA 4NP4L 4YLQT 2WNGA 1KB5A 1X5MA 3CMOH 3HAEG 1M53A 2H6OA 3NCJL 3QUYB 3KWWB 1T7XA 1P4LB 3T77A 4BM7A 1AXSB 4BV1A 4KQ0A 1NCAH 3QXTA 5HYJB 3ATFA 4NC1C 1UGKA 2PPFA 3N42B 2VLMD 4UMGA 2IAND 4YHYB 1JF5A 1FBIL 5KVGE 1RUPH 1G7PA 4F9PA 1QLEH 1M05A 1UA3A 3Q8CA 1FNEB 4JKKA 5BO0D 3QNYA 2C4FU 2HYMA 3TA3D 4XMUA 1T0MB 5FGCE 3CZKA 1H0DB 4ZX6A 5EEXA 3O3BA 1NCJA 4I18A 5HHVH 2VDOB 5IVNA 1A3LL 3H8NA 4OD2A 4OCWH 1WA1X 3O4OB 4GXFA 5D1QB 5T1LA 5IFAH 4JM2D 1URZA 4QRSB 1AMYA 4HD9A 4U6VL 5K69A 3IDGA 4JM4L 2H0EA 2JF1A 2NQCA 3GMLB 4H88H 4AG4L 2E0PA 4FQCH 1IEHA 1PQZA 3BQUD 3MJ8A 2R0WH 3OAWA 1W6WA 4WTWA 5MERB 3GSWA 1X7TA 1I8KB 5I0XA 1KBGH 2R29H 2C7UA 1N0XH 4GG8A 4IYKA 2B1AL 5EO0B 5D4QA 1IKNA 1Z9MA 3MLYL 3V5HA 1CT8A 5IB2B 4IRSC 2Y1ZA 4BDVB 1TO4A 2PCXA 1IBDA 2VDMB 1SMOA 3ERXA 3GWJA 1G4MA 1FH5H 4PP2B 4PRHB 3PV6B 2XWTA 1XF1A 3NJIA 1YY9D 3B9AA 4U3HA 4GAJL 3QZBA 4M61B 3RVXD 4YSAA 3ESNA 2WXJA 3B9KB 5FV2A 2G3ZA 3VQ1C 3OQ3B 1GOFA 1OE1A 3MBEA 1MJJA 3V6ZA 4FGMA 2DWSA 2XETA 1RL1A 4OFYD 1CE6A 1Q1JL 1QBMH 2I60L 1Q72H 3VXSA 4L8DA 5I5RA 1R75A 1S3KH 1YY8B 5BVJA 4FFWD 4NQED 1TZOA 2B1OA 3L7FB 5CP7A 1YNTA 5GSRA 4X50A 3OKKB 3MA7A 1Z7JA 1IAOB 4XOAA 3RE0A 3VXRA 5AOIA 1BYPA 4KJYB 2VSDA 1INDH 3U6RA 5T3ZH 2EZ0C 5DI8A 3WKYA 4FFZA 2GBTA 5SV3A 4CMMB 1DJYA 4JCMA 5FDWB 5K9JH 4WI3A 1CGSH 1EHAA 2H2SC 1RZIB 1UURA 1HXMA 1QW9A 3MLRH 4HMEA 5J12B 1PNCA 3MRRA 2IANB 4WI0B 4XHJC 2A5UA 3C60C 4YL4A 1AC6A 4D3CL 2A0LD 3WEBA 1VFBB 1MEXH 4Z3EA 3H4FA 1G6VK 2XZCH 5B1JC 3BISA 3UO1H 4ZOBA 3FQTB 3QGVA 4MJIA 4ATWA 3V5KA 3HMWL 2CLVA 2ZONA 3PGCB 3TEWA 4NP4H 4HJSA 1OP9A 3LIZL 3CXFA 4DGYH 2VLJA 4ZFQA 4QRPD 3I6GA 3TEXA 4OM0H 5E8DL 3APMA 1MVFA 2ICEA 5KTEH 1LP9B 2IALA 3BQUB 1BVKB 1QRKA 2BWIA 2L7UA 2Y7SA 4X6CE 4C56D 1MFUA 2V5YA 5EIIG 4GS7C 1FYTD 5KEZA 5DT1L 5GZOD 1F1GA 4R3SB 1SUHA 5H94A 5EH1A 4IU3A 4UQEA 2F8OA 5JMRA 4LMQI 4UV7L 2OULB 2DW5A 3BI9X 3QIUA 1XF3A 3REWB 3I75A 3MLSL 1NGXB 4N9GA 3WMSA 1KC5H 3NJMA 4XOBA 1M6OB 3QI9C 5LWYL 5KSBA 1PLCA 3EH2A 1MG3C 4HWZB 1JWUB 4LHJB 5CD5C 4WW2A 4WGVB 3EGSA 3BDBA 1J10A 1QG3A 3B37A 4C4BA 2FJFB 5HY9B 2RH0A 5DMYA 2VRQA 4YBQD 3DV6A 5I8EB 1GMIA 4HGWB 2ZX9A 4KZDL 1ZHLB 5DEGA 2X0WA 4DKEH 1JHLH 5AG9A 2YN5A 3QEGH 1KNOA 3BZ4A 1D5MB 3ETSA 3GIVB 3FH8A 1C08B 5C0CB 4JFPB 2BCKA 1AFVL 2EXWC 2DLFL 3F7QA 1FO0A 3L17A 3H9SE 4HFWB 4OGZA 2PPDA 3TA3A 1RZKC 3VXOB 1KUMA 3SDAC 4FHBD 1CFSB 5DJZB 5AW9B 2R0KH 2PXYC 3HAEA 3U7WH 1K5NB 3FU3A 4XBEH 3FO0L 4BELD 4EIBA 4KI5D 1B9KA 1HWWA 3P40A 1IEAB 1YNKH 4PG9B 1AE6H 1TXKA 3JV4A 4A7QA 4MB3A 2VNCA 2BHFA 3BKMH 1QSVA 1HSAB 4JHAH 4XE0A 1WBYA 3KPPA 3UZVA 3FB7A 2OR9L 4UILL 3W1ZA 2ILLA 4PTTB 4QHUA 4P46C 3MLPA 3SD2A 1S46A 1AGCA 1FDLL 1GOGA 2A77L 4FI8A 4HD5A 3N40F 1U8NB 1S7UA 5HJBA 1TVHB 4NRXA 4P2QD 1EDQA 1XEUA 3HUJE 3UJTH 3ZKXB 4OLWL 2ESVD 2EIBA 1FYTB 2IAMD 3VO0A 4OJFL 4A68A 2ED6A 2PETA 1IM3B 4PSPA 4FADA 2YEZA 3QG7L 4TRPH 4U6YA 2C4XA 1FFPA 1HL8A 4NHCL 1U8CA 2ATKB 2OMBA 4G6KL 4DEWA 4MDJB 3VFNA 3SZKC 1JD9A 1NAMA 5GS0C 2NXZD 4NNXA 2W81C 3DX9A 1FI8C 4JFFD 1RUML 5AW6B 4MAYA 4D9QE 1CTNA 1KCRL 4ZW3A 1FNSL 3O2DL 4NQEA 4M1GL 4DGVL 5EIIB 4R7NA 3BWAB 4TVPE 4FFYH 3VA2C 3RGHA 5F8RC 4PRDB 5CCJA 3W5MA 1Z9OA 1IC7H 1G7JA 3QNXB 3KPRD 3QHFL 4OFVA 4PREA 1TVBA 4FQIH 2QSTA 4UDUA 3RWGB 1AO7E 3K2IA 3ZR5A 1CYGA 5BRZD 2EUXA 1J9QA 3A4FA 4L3EE 4TUUA 1YEIH 1IAMA 1A3ZA 1BEYH 2VLKD 2P8MA 2EXYC 2DL2A 3CN3A 4YIQA 4ZYKB 1LD9B 1A8JH 2J25A 4R7XA 3X13B 4WHDA 5ERWB 5AB0A 2YR3A 3CPUA 4ZNEA 1BG1A 4ZUVB 4HIQA 4HS8H 4ZX5A 1UXSB 1DVSA 3IDMA 3DTDA 3MTRA 3FQ1A 2ZYSA 4WEBH 1HHHA 3HHMA 4GFTB 4L37A 3BFOA 4DPCX 1PX3A 1KTCA 4Q6IC 3UTZA 3PWPD 4QRRE 5FGRA 5C9JB 3AGVA 4J3OH 4AH2A 4XMLH 4F24A 4B0MM 3VCLA 4D8PA 5C0RL 5SWZD 5J6GB 3ULVC 3B2MA 2BJMH 4KVPA 3K3QA 1HCFX 4M9PA 1ET5A 1CICC 1QW8A 3CBKB 4QRPA 4R96B 1G43A 3B6SA 3WV0A 1N4XH 1WAAA 4FZEH 1ZLEA 2ENSA 3LOWA 4XCEB 5AW1B 3Q6GH 2WKLA 3X1GA 2VO8A 4C56A 1GYAA 2QVIA 3RWJB 4OQTL 3WELA 3CSFA 1DO5A 3WIIH 3OKMA 1XF4A 3GHBL 3POHA 1R5WB 4HJUA 4O2EA 4P2QB 5E2WL 1EAQA 5IW1B 1U8LA 2OP4H 1CDIA 2EQDA 2FQDA 2CLRA 2IAMB 2ZXGA 4QTFA 5B4MC 4DKFL 4BK5A 4PS4H 4GO6B 2OZNA 3DETD 1U0QA 5J1AA 3RTLA 1JPST 3DVFA 4P5MA 1AANA 3KEDA 4URTB 1KJ2H 4ELMA 2VDKB 4N4YB 4L23A 4QIRA 5AD0B 1NLBL 3MRCA 5F7DB 2E7LC 3N9GH 1V3LA 4NQCE 4WTXA 2OYLA 3SBQA 2EE0A 4QWWC 1PZDA 2DOCA 1FLTX 2CUAA 5TDNB 4EQ3A 1RVFH 3HMXL 2KC0A 5E5UB 5BUGA 5ADPL 5GGSB 2L04A 4RSYA 4Q9QL 4WI4A 3MLXL 3ZW3A 3WO3B 3KPRB 3ZQWA 4CBZA 2IPKA 5DQDH 5KYUA 1KFGA 1UWFA 2BSRA 1AQDA 1EGJA 3VXUE 3RWFB 3Q3GA 5BRZB 3CNKA 3BAJA 4G42B 3WIAA 4YSOA 3CD4A 2PPAA 5SX5K 8FABB 2XTJC 3JWDC 4FTVD 5D71H 4JRYE 5ISZB 2FX8H 1AR1C 2F53D 5KBKA 2HRGA 2Z93B 3OHMB 4BINA 5DJCB 1HH9B 4Z7WF 1XXDC 4CDHA 1P7QD 2WB7A 2NSMA 4G8GB 2BZDA 1F3JA 2WY3B 4ELKB 1J48A 3BPCA 4I3RL 3FFOA 4X6DE 5L7XH 1IGJA 2D3VA 3DMMA 4NC0B 3UTSD 3PWPB 1ZV2A 1E8ZA 1RHHA 1H3XA 5SWZB 1LEKA 1PZ3A 1XF5B 1YNLH 5FYKE 1BMZA 5HP5A 3GLAA 3T0BA 1IJNA 3QWRD 3VDAA 2HG5A 2V9UA 2Z8VC 4S11A 2X2IA 4NQSB 3CQPA 4QKTA 3IFOA 4LCWB 2I7OA 5INDA 2XI9A 4PTUA 5KN5A 3SPHA 2HSIA 2R0LH 5EORL 5F1IA 5D1XE 3BH8A 5IVXE 2BS71 1JZ8A 2ESVA 2DQTL 5A2BA 1LO0H 2ZKYA 4IHOA 4Z7WE 4U7MA 5IWLC 5E6ZA 4KRLB 4YPJA 2ZAGA 3VG0H 3CCHB 5J0BA 1KGIA 1NBQA 4PCYA 3GMPA 4LK4A 3ZRSA 5C0GB 5JA9A 4JPWL 1A64A 1UM6L 1Y6NR 4POZD 4TSCH 3ARGC 4UQ2B 4JFFA 4CC0A 3FTGB 3GXMA 4YGAB 1V8HA 2IDUA 3NCCB 4QF1A 3SDYL 4PI2A 4UOJA 3WXWH 1U58A 5DMIH 4MQTB 4RFOL 2GYSA 3OKOA 5BJTB 5IBLD 5GS2D 4DTGL 3F6LA 5DK2B 2ZF8A 4LCCC 3MRGB 2P5EA 2DDQH 2Q8AL 4PJ8D 1GIGH 4QRFA 1VFAA 4L8BA 2VW4A 4YSCA 1I31A 4N2MA 5KJRL 2C3HA 1JXDA 2DEYX 4TSBH 1SOSA 5IV2A 2J1YA 2XJLA 2IADA 3LZNA 2VLKA 5SX4I 5KBLA 3FTVA 3L9YA 3LSOB 1MI5E 3ZUNC 2Q3AA 4DKFH 3RUGE 3S3BB 4ZAKA 4F8NA 4R5XA 4FTVB 1J1XL 4FLSA 4HX1A 2BC4B 4NZDA 4E41E 5BRPA 3C5ZD 1T3FB 1NBYB 4W4NA 1A4JB 2X2UA 4GXUN 2OI9B 3UDWA 4OLVL 1M7IB 1O75A 3UTSB 2J21A 2UXVA 5KW9L 5JW4R 4E9WA 2FGWH 2AJUH 5DA0B 4UOW0 5D7HA 1XZWA 4L4JA 1AIFA 4XZ4A 1VESA 3GRWA 2LTQB 4X5WB 3KPMA 4L9LC 3S5YA 3DX2A 3WTXA 3WBDA 1UJTA 4U1SB 3TBVA 1A5FH 2CUMA 2FZ3B 2CO6B 1RZJC 4R97B 4F2EA 2XKUA 2P80D 1BREA 2CKBA 3QJTB 3H3PL 3OPZL 2VO5A 2IWEA 3BD5A 4IK7A 5CCHE 3JTBA 3NG5A 4M5TA 4AY0A 5ALCL 1PIFA 3UZEC 5IBUG 5CZVL 4U6HA 5DFVC 1O7DC 4XVSH 2WXNA 4PRAA 2YAMA 5F1OB 1E3FA 4QTHB 5D4JA 1YN7B 2Z6FA 1WS8A 2ZUXA 4O2FA 1C1EL 3HOGA 2X53A 4JFZL 4YK4C 5D7LB 4P9ML 4LQFL 1BYOA 5DQJB 1GJUA 4U4BA 4R5TA 4WNQA 5B8CA 4M7JL 4ZOAA 1QKZH 1ZANH 3EHBC 1P84K 3TPUB 2WQUA 4ZTPL 4NNYA 5AL0A 1KGWA 4NKDB 4PJ8B 4NIYE 4LPWA 5IB3B 5DJ8A 4K2UH 4Q14A 3O2WH 2F61A 1RJZA 3PJLA 1MRDL 1RFDL 2GTWA 1FFTB 1TF4A 1D5XB 2OJ1A 3QCTL 4LLDA 4YNYA 4J1UB 5T3XE 2GJ6D 4G70B 2Z92A 2XQYG 3VXNB 4ODTL 5EDXA 5HHME 2F53A 4HPOL 3BDYL 4E9VA 4HIJB 1PNDA 1P7QA 3AG3B 4PJ9D 4IHBA 4JHZA 4WWKD 5J11B 2WIIA 1S7TA 3VXME 1OLZA 1U3NA 2PW2A 3S37X 1U8JB 3V4VL 1EAPA 3O45B 1LE9A 4JZJC 5CBAA 5TK2A 4AGPA 1OB1A 1FAIL 2D7MA 3L3HB 3OKEB 4M8QB 2VR8A 3C5ZB 2DQUH 2QGEA 1C5DA 3U9PL 1W80A 2UV3A 3K74B 3D39E 2DQJL 5CJBA 3WFHA 3ULUC 1FSKB 1BBJB 1L3WA 1X6NA 3AG2B 4M8RA 1OAXL 4G80A 5DVKA 4MDRA 1E4WH 3RWCB 5CZKA 4NQTA 1YYMH 3RIFF 1EO7A 3RQ3A 2J71A 1BGXL 4PJGB 4P07A 3L4CA 4Y19E 1FIGH 1BVZA 5DC0A 3TIDB 2FO4B 4YHPB 5FO8A 2AK4B 2WXKA 1W72H 3HPLA 1KN4L 5D9SB 2ROXA 2VXTL 3WS3B 1RJYB 3BPNC 5DHYB 1HZLA 4U31A 3TT3L 5FM4A 3MQIA 1AAJA 3UGUA 4MMXA 3UYPA 5ITBL 4NC2B 4P4KC 3MZGB 15C8H 3B5GA 4XOEA 4DETA 4FKHA 1FPTL 4WJKB 3JBG7 3ARQA 1FFRA 4XPHL 2FNBA 1MWAB 1UOKA 3L13A 4Y16B 5JDSB 2P9RA 3OLEA 3IPEA 1RZFH 3P2TA 1NWOA 3X3GH 3LCYA 5DUBB 3IVKA 4WUUB 1S8DB 2PPEA 3MBXL 4N2KA 5GGVL 3DK0A 4F91B 4HSQA 3FU0A 3FCUB 4WDIB 3QUMB 4N0YH 3C08H 4DW2H 3RY6C 2ERJB 1SQ2N 2A4EA 4Y7OC 1F8TL 2LFEA 5I1IL 4G72B 1KJVA 2HJFA 4U1LB 1DUZA 3WNIA 5I0DA 1ZT4B 1WTGT 1BZDA 5E8PA 3LHAA 4XP9H 5ICXA 3RL2B 4RQQB 1F4XH 4Z76B 2DI8A 1XGQA 2OMUB 2PNDA 3P73B 4XCYA 3V7AG 1AYOA 4O51A 1AP2B 1BSIA 3NBNA 3O6FC 2YKLH 2NY0C 2ITFA 5IMLA 3DGCR 2FJUB 3L95B 2FEEL 5DD3H 2VXSH 1SEBA 2BVOA 4UTAL 1CGWA 4XNUL 2ZPKL 3T0WA 2IV9A 2H26A 1K2DA 2JCCE 2ZQKA 3FUIA 4Y2NA 5IBUB 3BCDA 2H3KA 3G08B 3GSOB 3IAPA 3ZDZB 1CD9B 3PY9A 4DT2A 5DZAA 4TN9A 4ZZFA 1OWRM 4Q8BA 2H6UA 1HEZA 4WUKL 5AAWA 1FV1A 4B9IA 4KV5F 5MHSE 4MA3A 2HT3D 2HT4D 4P5TB 3V6BR 2YUXA 2PTTB 1J88A 1MQKL 5CEYB 2UXTA 4KKLC 5CCKL 2KL6A 2GBAA 2QVFB 4S1QL 4ORGA 4WWKB 1NEPA 1ZK9A 5J57B 4QO1A 2OXHB 4YE4H 2W0FA 3VU2A 3LKQB 3QUYC 4Z3IA 4K9EC 5C97A 4YHKH 5F44A 3U48A 1MF2H 3EF7A 1ETA1 4FNPA 4XMKH 2PLTA 1WS7A 2V3EA 2WZPA 3HZMB 4YHYC 3H9HA 4P2OD 1N5YL 1JYVA 1AGBB 3TEUA 1ZSDB 2HB0A 5GIRB 3FO2B 2Y1YA 4Z9KB 5AVWB 3EFFB 4FNUA 4FZ8L 3FUKA 5LBSL 2X3CA 1J5CA 4XB7A 2AHIA 1BBDH 5D1QC 5G5DB 4KHTL 3LRHA 5FGCB 5FGSA 3GDBA 3NFNA 5JW4M 5JHMA 4IRJA 4PM1A 2BY2A 1BG9A 2V7HA 2VZ3A 4D0BB 1BF5A 2IJ0C 2OMVA 4Z7IA 3FB5B 2KKQA 2PO6D 3IMWA 4UIMB 5FOJA 3REVB 2QEJA 1AS6A 1RIUH 3KVQA 3NH7L 2VDRB 3PP3K 1E5UI 2IPUG 3OZLA 4V1DD 5J5EA 2R2EA 2ID5A 2JQAA 2KLSA 4HZLB 1ZSHA 3H6AA 3JXAA 1NCBL 5ADOL 7PCYA 1S6NA 3GSVB 4BQ9A 4H8VA 3RY5A 4R4FH 5EIQA 1UUNA 1K8DB 2EVJA 1A1NA 3NMEA 2VDPH 2OMNA 4KNUA 5DD1H 1CBVL 2E9IA 3IRCA 3TBYB 3B9KC 2X87A 2WZ6A 5IW6B 4HZAA 3QZMA 4E5XA 1WBXA 3KR3H 3H42H 3EADA 4HIEB 2GJ6A 1KJMA 2FHFA 5EF0A 5IREA 4PLNC 5K93A 3AXHA 2MQ3A 4WSJA 2QSCH 2GG1A 3L3OB 4KDTA 4KX7A 4PJ9A 1MJ7H 1VFOA 4L8CA 2BFGA 3A6OA 5DS8A 2FT7A 4YZFE 1KXHA 1TMCB 3GJFB 1JJUA 1TMQA 2F5AL 2H3NB 2Q7YA 3MRJA 4IGBB 1GJIA 1A6TB 1EVTC 3PFQA 2I9TA 4YXHH 3LQZA 3LQMA 3CVHH 4X4XB 2M8XA 1JL8A 4LOUC 2QADD 2EEDA 1XIWD 3MRDA 3EYOA 5HI4D 1ZK5A 3FSZA 4QTIL 2VR3A 2RAMA 4KQ3L 2Y06L 3VI3A 1QFOA 3QDMA 3MGTA 5J12C 3O4LD 1ORSB 5EB9A 1CE1H 5IESH 4ES8A 1O6VA 1T80A 3CDZB 4PWEA 1A6VL 1D5RA 1IC1A 3R4DA 4F58L 4NPYA 3KGUA 3P0VH 1XGTA 2A6DB 5FYJH 3P4NA 1XGZA 5AVZB 3VGAB 4ZUTB 3GNMH 2WOBA 2X4TA 4MHHG 4PV8B 1MH5A 4FJZA 3MRIB 1A4KA 1PGRB 1U91A 2ZX8A 4M7KH 3OB8A 1F2XK 3LVTA 1A6UL 4R5VA 5I1CH 1ND0A 2D7QA 1ULVA 1QR4A 3MRBA 5LGHL 4XHQA 5T5FA 3N04A 3SPCA 2LABA 3FF7A 2ARJA 3DUUA 3SDAA 4GRWF 2AJYH 2PO6B 4GEJA 3NJNA 2PXYA 3P30H 5HHQA 3KLHD 3HHSB 4PLOB 1T5WA 2VDQB 1SXCA 4AVHA 2I9LB 4V1DB 4G8FA 4AYFA 5L8KB 1X5HA 1F4AA 1FNLA 3TO2A 2ZSWA 4UU9A 4X80L 5L4IA 3QEQE 3UZQA 2AFNA 5JW3L 5KSUA 3ZE2E 1AI1L 3GK8L 5L8LB 4X6CB 4RBPK 3NCXA 3RZCB 2E27H 5HVWA 2Y2WA 4PWJA 4FAAB 2VR5A 4P46A 4XVUD 3K6FA 4MSWB 4NJAH 1G6RB 2WWNA 4HWBH 3ZL4L 2K3HA 3GEFA 4OR1A 4E2OA 4BSVB 3DYPA 5I1KL 1OSPH 2CIKB 3D4GA 3FFCD 4F7EA 2R23B 3IDNB 4HJGA 4MXQC 3O6LL 3QNZB 3L4YA 4Q58C 2Z31D 3PHQB 3KJ6H 1ZRUA 2YAQA 1KLFA 3D3VE 2B3RA 5GGTL 3LB6D 4MAZA 5MENE 3EFDL 3KHQA 3WNNA 2VQ4A 3CFTA 2DMCA 5TF1H 1MRFL 1QI4A 2KBGA 4NZ8A 3COOA 4XX1E 3BH4A 4DAGL 4YHNB 5L88H 2YSTA 5DZJA 2QADB 1QPKA 3O6MH 2FJSA 4M6NL 4N2EA 3AMLA 2CBPA 3G7TA 3US9A 4HEPG 4S0HA 2J20A 3UTQB 1KB5L 1RUAH 4L3ED 4P2OA 1H19A 5KYYA 3C6SB 3BJ91 4ONFL 3L3KA 3D12B 4XPAH 1MCFA 2ZUQB 2X09A 3FT4A 2EVIA 4GSRA 1CL7L 1UH2A 3L5WB 3LKRB 3O4LB 4DESA 2VL4A 2ZCLH 3FXIC 5F1NA 3A24A 5KVFL 3G5WA 3GRBA 1UJ3B 3JUZA 2E7MA 1ONQA 1J7VR 3H9SB 3T6WA 3L4VA 1ZV5A 2O5ZH 4BA8A 4WJG3 2DQ6A 4OKDA 4QHPA 4GINA 4GXVL 5JW5B 1F11A 5FAAA 1YEJH 5FC9A 3FNKA 3GSNB 3MV8D 3ZU8A 2YEVB 3QXAB 3MAWA 4KQ3H 4JRFA 4Q6IA 5EF1A 4PLJC 2FATH 4UYQA 1MCQA 2H6PA 3BWUF 3EBHA 1DVXA 2WC7A 3GHEH 2YAEA 1TCMA 4F7CB 2ZKHH 4F33B 5I18H 5D4HA 4HUMB 4IRZL 3WFCH 3LKNB 1DQJB 5CD3A 5GZOC 3VQMA 4D9LL 1OV8A 3IXTA 3HUJB 4RZCB 5A43C 5EA0H 1BIIB 2XN9E 4PU2A 2VC2H 4KVCH 2H8PB 3P54A 2YGOA 4V33A 4HLZH 1MCPH 1CC3A 2N1TE 1LGVA 2ITCA 3MRMA 2FWUA 4L3FA 4X98A 2X88A 2IQ9L 4U1JA 3QORD 1M3IA 1HXYB 1JZIA 3APNA 4XN1A 3UPRB 2YGPA 4XGZA 5HGGS 2MCMA 1D5IL 1WF5A 4PB9H 3KCPA 3WFEL 4PRPE 3FFCB 7TAAA 4UT6H 4D8OA 3M88A 1A3RL 1P4IH 2C1OB 4YEEA 5ANHA 4CC4C 1YMHA 3LV3B 4DKTA 4O2CA 3IRPX 4JJ5B 3LEVL 4ZFOA 3I2CH 5HYIA 2FWOA 5IJKC 1XIWA 2FAUA 4MMZB 4L5FE 2NY7H 4GKSB 3BP5A 4XCCH 4B3EA 3W56A 3L1OL 4UQAA 3U36A 2EC9T 5E8EB 4JZOA 2E7LA 2O5XL 1UM4L 5EWIH 1EJOL 1QLRB 1XCQB 1MPAL 3NJVA 4UTBH 4HDIB 1AO7B 2L7QA 5JPNB 1DBBL 4L3EB 1OGTA 1UASA 3LZFL 4PB0L 4NNPL 4YHIA 4BEIA 5EZJB 1OP5H 5JZ7D 3RPBA 2CO2A 2IH1A 4BSWB 1FL6A 2ZXBA 5JQ6H 4PGBB 4Y5YC 5DO8A 4GUPA 3GBML 3IS0X 4G7VH 2X12A 5GGQH 4LARH 5AOMA 1OGPA 4LLMB 3S37L 1EHKB 2OS7A 2VDNL 3MRHA 5F3HB 2F7QA 3KL5A 3R06B 5FO7A 2XVKA 3C8KB 2CMRL 5CFAA 2F1AA 2ZSVA 1DJZA 4OQ1A 3DECA 1KPVA 5IIEA 1E4KC 5FYKD 1E4JA 3D25A 3H7LA 3QZNA 1BX2B 4FCHA 5FXCH 2OMTA 1HHIB 2YGQA 4RVBA 1TQVA 2J6EA 3DTXA 1R46A 4QDGA 2DQHL 2A9DA 4OJDH 5IOPB 1HQRB 2N7SA 2EVHA 2R1WA 2O61B 3INUL 3TJEL 2WGXA 4LPVA 5CN1A 2BOBB 1QR1A 3H0TA 2OTUA 2YPLD 5BMFH 5FA4A 1KLUA 5D1XD 2ZCKH 5K1JA 1DBML 2FEEI 1FGNL 5H37A 1XR8A 1G7QA 2EIZA 3GSUB 3T0VA 4U33A 2OMXA 4FFTA 2FL5A 4AV4A 3NJLA 6FABH 2W38A 2J88H 4S1DD 1OM9A 4ZMXA 4ODWB 4EZJA 4JDTH 2GQHA 2P47B 2R56H 3SDCB 1CURA 1A1MA 2ZXEB 2Z31A 1Q0EA 3BGMB 4NI3A 2Y3AA 2I27N 3JWNG 3PJNA 4HG4J 4HCRA 1SJHB 1TLKA 3V0JA 2HFFB 4HBCL 3KAAA 4NQCB 5F7UA 2XZZA 5DYOB 1HCVA 1E27B 3ARGA 4M03A 2Y7QB 2NYYD 4B95C 1R3HB 1ZLUH 2VZSA 4YEFA 1ECZA 3TBTB 3E8UL 2NY6D 4CDGC 3HCVB 3DPBB 1RK0A 1U41A 3VWJC 2RR3A 3ILQD 1IAKB 3ZK0A 1P5VA 4HAGA 1U92B 2VAJA 2F54E 3US0A 4WY7H 4GKNA 4ZO7A 1J8HD 3NCYS 4JG1L 4A63A 3FQUB 3LPWA 2OCCB 3VYPA 4EIZC 1N68A 1ZDQA 1RUKH 3IGAB 5FOBB 3UAFA 1SXAA 3V10A 2Z1KA 4JRYB 2X4QB 1YJDL 2GHWB 4QYAA 1FO0L 3P69A 5DD5L 5KYWA 4Y1AD 1RMFH 1QNZL 5F9JA 2FEJA 2FYYA 3IWUA 3QDJE 4HEPA 3ZKQD 4E41D 5I23A 3DOHA 5IHWA 2XPGB 1L7IL 1NH6A 3T2NL 1WWAX 4NM8L 2CPUA 5I6OA 2ZT9C 5FKPA 1GGIH 3RIAK 2B4CL 1JZ6A 3Q9PA 4X6DB 1EDYA 4CKVX 4J3BA 3EH5B 4LQ1A 3B4NA 3I6KA 4EN3D 4KAQL 2VN4A 3MV8A 5B7MA 2W88A 1KACB 3ISYA 5C7XL 4K4KA 3ZZSA 1U8KA 4X8JB 5I5JA 2JJSC 2HVBA 3GZKA 4JN2B 4XP4H 4IBSA 5A6IA 2APFA 5FECA 1Z6JT 4R7DA 1TLMA 3NA9L 4FFZH 1CIDA 1R3IL 2XY2A 4OZGE 2AI0H 2JE8A 1X9LA 2ORBL 4KPHL 3BH9B 3LH2L 5D1XB 5IVXB 3G6AA 4RWHA 2LAGB 3FK3A 2JFCA 1W91A 4Z7WB 3TASA 4S2SA 4DP7X 3PXLA 4QXUH 2Y0SA 3QORA 3QO1A 3BWUC 1LO5A 3I9GH 3DVNB 4GBXD 4LSSL 4Z77A 4XN8A 5CR1A 2WXOA 1CXIA 4QRUA 5HJ3B 3VTMA 2J1ZA 3LMJL 2ITDA 2I25N 3N55A 1ZJAA 4UM8B 3X11B 1NAML 2Z7YA 4AL8L 1HDMB 3CN1A 1MVYA 4R4ND 5I1AA 5FYLD 2A74B 2E9WA 3BSZL 3LXCA 5HGHB 2PF6A 5EO9B 3CK0L 5F9OH 5A2AA 1T0OA 5L2JA 1QSED 3PWJB 4UINL 3B56A 3UZEA 4HIHB 4WU5A 3GS4A 1KIPA 5DJDA 5DYFA 3RWDA 5CZRA 1UXWB 4N2IA 1DJHA 2AV1A 1MLBB 4M62L 5JYLA 2CNZA 2HVKA 1NLDL 3NABL 1DHKA 2V7NA 3NUKA 4JFED 3QZWA 2NY6B 3BT0A 3MV9E 1NGWA 2DQIH 2RACA 1ZIAA 4FHKA 1HAUA 2OXGA 4W9LC 1M56B 3VFMB 5B22A 2CO7A 3X2QB 4ZMNA