3U2SB

Crystal structure of pg9 fab in complex with v1v2 region from hiv-1 strain zm109
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
211
structure length
211
Chain Sequence
SALTQPASVSGSPGQSITISCQGTSNDVGGYESVSWYQQHPGKAPKVVIYDVSKRPSGVSNRFSGSKSGNTASLTISGLQAEDEGDYYCKSLTSTRRRVFGTGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords PG9 heavy chain
publication title Structure of HIV-1 gp120 V1/V2 domain with broadly neutralizing antibody PG9.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 211
sequence length 211
chains with identical sequence L
ec nomenclature
pdb deposition date 2011-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u2sB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u2sB02
3B9AA 1NUFA 5CGYD 2XZZA 2YPLE 3QUMA 3TH3T 1HXMA 2PTUA 5C09D 2BHZA 1MCWM 5HI4C 1NDMA 3AU1A 1KIPB 4PB0H 2X4NB 3IDGB 1IGJB 3QPQD 4ODUA 2VYRE 4DGIH 2MFNA 1I7TB 5D1ZD 5GJTH 5ECJE 3WFCH 2EECA 1P4IH 4CDHA 3GKWL 1TTGA 2DJ4A 4OV6F 1JGEA 4E0RB 4ONFH 4PJCF 2JIXB 4KHTH 3TIEA 4L8SA 1DLFL 4HHAA 2J8UA 1CD1B 5J57B 3SCMC 4OLZL 5EBMB 5KZCD 4KTDL 4JFXA 2OR9H 4PJCE 1DQJB 4AMKH 3FT3A 1ZWIB 4NBYB 5SWZD 3RY5A 4F7MB 3FN0H 5KS9B 1MEXH 3CX5J 4HUVB 2XZQH 3ARRA 3BWAA 3QCTL 2Z31A 2OZ4H 4XBPA 1OW0C 3M1BA 1B4JL 4LNVA 5TQ2L 1MI5D 3TBTA 1P84J 5HI4D 2R15A 3MJ7B 3R8BB 3OG6B 4WO4C 5D8JL 4QRSA 3OWEA 2AEPH 4FZ8L 1IGYA 3P2TA 1WIOA 5IKCB 5I8KH 3BZEB 3O9WA 1DQLH 2FRGP 2YS4A 4QHNB 4S10A 3SCMD 1DSFH 5IJKA 3LKOB 1FGVH 4JQVA 4PJ5E 2EDKA 1ES0B 3WIHL 4EBQH 4LIQL 4AL8L 4UOW1 5C86A 3QP3A 4XP1H 4FQHA 4X99B 1A3LH 3N50A 4NQDB 3BHBA 4ONHB 4TPRH 4P99A 5C0JA 5EU3B 3F7PC 3P4OB 3MJ8A 4WO4D 4LPVA 4JZJB 2E27L 3RWJB 4L4TD 2D7OA 3IFOB 3DGGA 5TDNB 1A6ZA 4F2MB 2MQ0A 3FCTB 5IB4B 1I9IH 1QP1A 4WI5A 2HLAB 4LASH 4UT9L 3VWKA 4BUHA 5HYEA 1EHLL 4NQSB 3SKJH 1F90L 4NQDE 2Y06L 5I8CB 3IDXL 2QKIA 2BVQA 3LCYA 4NC0B 3V5DA 1YEDA 4PJHB 2UYLB 3LY6A 2BOCB 4YDJA 2W07A 2VH5H 1T03H 3DSFH 3H7LA 1YMMA 4LP4A 2ADGA 1HXYB 5EPMB 4KPHL 4PJHF 4X5LA 4XWOC 4AY0A 2YD9A 3WHXA 5CEZH 1BJ1H 4JFPA 4LSTH 3GSXB 3HZMB 2ATKA 4Y16B 4X5WB 2HA1A 2XZAH 5C8JA 3GHBL 5JOFB 2YD5A 1JZ6A 4PJHE 4GAYA 3BKYH 3PQYD 4WFGE 2VZSA 1AQKH 4WV1C 2VLKB 3WO4C 4LRIA 1VKXB 4OB5L 4XNQA 3SBWC 2FBJL 4YXHL 3NPSC 4MD4B 5FKAB 2HRPL 2YSSA 1KCRL 4DW2L 3BP4B 5BOPA 1HQRB 3U30B 1NBYB 4XVTH 2CXGA 3EOBB 5T3ZD 5E2WH 5KSBF 5GGTH 3VGEA 1A21A 4G8GA 5MEOB 1BIHA 4QRPA 2DRUA 1LEGB 4K07A 1R0AL 1BLNA 3LKPB 1S7XA 2QQNL 3S3PA 2LTQB 4S2SA 5KSBE 4RCAA 5F93C 2DI7A 1XCQB 2VERN 3NIDF 1MHPL 3BD4A 4EXKA 4UTAH 3WJJC 2FD6L 4XWOD 3ZO0A 4FP8H 3D9AH 2V5TA 5C09A 3S4SA 1YEJH 1DQML 3TJEL 5J7CC 3NIDE 1JPFA 1JWSA 4CN1A 2VISA 5E0QA 4A6YB 3U4EA 4FMFA 5D1XC 5D1ZA 5I1IL 3UJIH 3CCHA 3V5HB 3PXJA 3MROB 3PUCA 3UYRL 1YA5A 4FS0A 5BV7H 1A6WH 4G6JH 2PKDA 3WFBL 5ESAB 3K80A 5DD5L 1PW3A 5JO5A 4PRHD 1QFHA 3BX7C 5BZDA 3RHWK 5E4IA 2ZUVA 4UIMB 4Y5XA 5SWZA 4FMKA 2QSTA 5AZEL 4KU1A 3SKMB 4EIGB 4YHNB 4JRXD 2B2XH 2VDKL 5DSCB 1MRDH 1ZLWK 2R0ZH 5LG1A 4WGWB 3MGOB 5C0BB 5HD8C 4M6MH 1MI5A 2I24N 1H15B 2PYFA 3BQUB 1XMWA 3VMPA 4QHUB 4PLJC 1JGLL 5FK9B 3LMJH 3UTOA 1YUHA 4EEEA 4PV8B 1JF1A 1Y0LA 2QTEA 4LMQI 1FRGH 5D1XD 5IP4A 2C1PB 3QDJB 4MS8C 1PG7X 5JLZB 5D70L 1QFUH 2Z92A 5C0BE 3KHOA 3QEUB 4JCLA 2MPAH 4LU5H 2FR4B 1ZT4A 3UEZA 4XCFH 4M5ZL 3UBXA 5A3IC 3NCJL 1D3CA 4RWHA 3WIHA 1OT2A 5FHBL 5EC1B 5EZOH 1MFBL 3QPXH 1AXTH 4QRTA 3MOBH 3JVGC 3VFGH 2WUBL 2YPLD 3MRDA 4X5XA 5D2LA 3DRQB 1OW0A 1CFSB 4U6YB 5HD8D 1XEDA 4KKCC 1TTUA 5DA4A 4YR6B 4UILL 4Y1AB 1I3RB 1UVQA 2XWBB 2WBWB 5B21A 5DLMH 2XA8H 3FO2A 4WO4A 1F2XK 3L3JB 3H3PH 4PLJD 1NGXB 4Q9BA 2P43B 4L4TA 5KTEL 1CTNA 3CMOH 1UYWH 1I8KA 1MHHA 3B5HA 1J0ZA 3P77B 3TCLA 1WF5A 4NM8H 4MS8D 4Q9RL 2P42B 1G7QA 3EJJX 4UT7H 5FA4B 3B5TA 4HBCL 1JGUH 1PKQE 3HC3H 2XFXA 3GMPA 3PWNA 2X4OA 4RMVA 3ILPB 1BQHB 5A3ID 1E6JL 1NGZB 1MJUH 1UCBL 4JFOB 4WNQA 5FYKL 3THMH 3UTPE 4LSSH 2Q3ZA 2AQ1A 3TH4T 5JW4Q 3IFNL 1IKNC 4UINL 2XQYK 2B1AL 1CL7I 2WW8A 5CILL 1D5BB 1YC7A 3LEYH 4FNLH 1GHFH 3WL9A 3MR9A 4JEGB 4KKCD 5CP7A 2I07A 1MF2H 1NANH 3STLA 2EDHA 1MFCH 3BPNC 2MKLC 4LQFL 1DE4B 5IR1A 1QQDB 4TUJA 4HZLA 3PQYA 2YA0A 1SEQL 1B3JA 5FECA 4PRNB 4NWUL 1S3KL 3FB6B 1XGQB 4PJ5D 5D9SB 3AS0A 3HPLB 1QSZA 2EYSB 3BDBA 4IOFC 4YHML 1S7TA 1HNGA 2LU4A 4JR9L 5ACZB 1F13A 1WZLA 1QSFE 4ODSH 5FYJE 3QXDB 3W39B 1S9YB 1P4LB 1EXUB 1HIMH 4XRCA 2IADA 1VFMA 2GIYA 2MOVA 3FO0L 4OLXL 3R4DA 2MTPA 5JIPA 2VRAA 1N4XH 2NZIA 1ULVA 2IPTH 3DSNA 5E08H 1OHQA 3T77B 2Q8AH 1KJVB 1MOEA 2H41A 3TWCL 1TENA 3T09A 1DBAH 3C9NA 4UT6H 3O3AB 1FG9C 2P1YA 3MLWL 1EJ6A 4WV1A 5I74B 1JGVL 5F9JA 3LS5L 3SBWA 3LB6C 4NQDD 3QO0A 5A2LH 1QSEE 1L0YA 4XPHL 4OCXL 3EGSA 4PRHA 5FM5O 4G80B 1BM3H 1OVZA 3VRIA 2DTML 3HZVB 3FOLB 2Y5TB 1TZIB 4HWUA 2G2RB 3C8KA 4JRXA 1KB9K 1GGCH 5IV2B 4MCZB 1Q9WB 1QKZH 1ZVYA 4HCRL 1KJMB 3U36A 2YEZA 5GGRY 5FB8B 4RFNC 2WP3O 1HHGA 5J11C 3CDGB 4WFGD 2OJZL 2LTQC 3EYUL 5D1XA 4LEOA 3QG7L 4I1NB 4OGYL 3ROOA 1B6UA 3LB6D 2A2QT 1J1OH 1BBJA 5C0FB 5EO0A 3PG2A 1BQLL 4NYLA 3QQ4B 1QR1A 4OLYL 1R3HB 4NIKB 1I9RH 4DTGL 5LGHH 4F7CA 4YQXH 2A6DB 3QXTA 1SYVB 2YPLA 3VJ6A 4QRRB 3GIZH 1L6ZA 4GAJL 5CBAB 3P9WB 1JNNH 3O6ML 3RPIB 4OUOA 2PCPB 4L5FL 2R29L 4G6MH 4LLYB 4U31A 1A6TA 3NAAH 5I66B 3HTLX 4YE4H 2VN4A 5BXFA 4NBZB 3UTSB 5KSVB 4XNMA 3V4UH 1ZANL 2F74B 4TSCH 8CGTA 4LLMB 4RZCA 3SE8H 4OCLC 5BZWB 3AROA 1YEKH 1J8KA 3IFPB 3LHPL 1OPGH 1NCBH 1JZ4A 4PJCA 3VFRB 4FQQB 4W6XB 1T6VN 1ZMYA 4H0GA 5GGVH 2C3HA 1I1AC 5E4EB 4HIXL 3QXUA 3JVGA 1HNFA 4P3DB 3SE9H 3Q1SH 5F3HA 2YXFA 4E0RA 1C5BH 3GM0A 3QWOB 1CQKA 4V1DE 4YXKH 4PLNC 3AXLB 1IM3B 2MNUA 1N2RA 3BAEL 5JHDB 3G6JB 1CICB 1KIUA 4ONGH 2DIJA 1M05B 4OIIL 4TUOB 1FH5L 3PABA 3TT1H 4Z7OF 4XBEL 1B2WL 3HZYB 1H3UA 1MCIA 2VDPH 3PHQA 4NNXB 2P47B 1RULH 2MHAB 5C0BD 4DKDC 3GMOA 3U2SB 2CIIB 4Z7OE 4PJ5A 3HMWH 4P9HL 1MIEH 1KGCE 4NKIL 4Q2ZB 1IEHA 3VGDA 1Z9MA 1G6RL 2PW2B 1I1AD 1U3HC 1XGYH 4JZOB 1IKNA 2GT9B 4LSPH 2GKIA 1G9EA 4TUKL 5IKCA 3BZEA 3RRQA 2GITB 2BFVH 3P9LB 4M5YL 2BHUA 4NNYA 4GRLB 1X7QB 3LKOA 1NC4B 4PBWD 5DZNA 5CSGA 4NOFA 5KANI 1ES0A 3PJSA 2VDML 2ED8A 4M6NH 1JZ7A 4H1LG 2DQDL 4G9FB 1YNLL 4X99A 4HJ0C 4NQDA 2D0GA 1QACA 4XBGA 2GAZB 4D0CB 3UTPD 1J0JA 3P4OA 1CXFA 5TF1L 1JPSH 3MUY1 2AJ3A 4OLZH 2HFGL 1BZ7B 1U3HD 4KTDH 5JDSA 4F2MA 4BZ1L 1YC8A 5IB4A 5TQ0L 4ZS6D 2HLAA 1G1CA 3NMEA 1QPPA 7CGTA 4X7SL 5I8CA 3QXWA 4HIEB 4QTIL 5TQ2H 3HE6C 3VDCA 2IPKB 2W60B 1FDLH 2BOCA 2X4PB 3BT2L 3NCYP 4K8RC 3QZWB 1IC5L 4FZ8H 1HXYA 2DLTA 4HJ0D 3EJYC 1E4WL 2Y1VA 1IAKB 5IEKB 3AS2A 2AQ2A 4X5WA 5SWQA 3CDYA 5EU4B 1NBQA 2RFXA 1I7UB 1KIQB 1QSFD 5FYJD 5JOFA 3S36H 1P1ZB 1DUYB 4HKZB 3KYNB 5FYJL 5KSBA 5I74C 3PDOA 3WIHH 5I6XB 4LIQH 4PB9L 5KVFL 4AL8H 2IH3A 4IDJL 1HQRA 5CSBA 1N8ZA 3LRHA 1YQVL 3WEXA 1H3TA 1FNLA 3QA3A 5EFIB 2EIZB 4FFZL 3HE6D 3BPCB 3EDJA 4LL9A 3FAWA 4WWKB 2NX5B 1VEOA 4K8RD 3HNSL 4OGXL 5ESQB 2OP4L 2E27H 1QSED 2VDNL 3EJYD 2HTKC 4CN4A 3MNZB 1BVZA 3KPNB 3ZKXB 1EHLH 4F3FB 4IRZL 4M3JA 4XC1H 5DJZB 1F90H 1BIIB 1OF2B 4FXGB 3KPOB 4M1GH 1I75A 3VFOB 3IDXH 4A6YA 4H26A 1H0DB 1TQCB 3ZSTA 2GCYA 4YGVA 3V5HA 4MQTB 3SDAB 3H3BC 3MV11 3SDXF 4MSWA 3P73B 5D1QC 3CZFA 2JB6B 2W9LA 1FP5A 2KZ1B 2RR3A 3BP7A 1AQDB 5INDB 4ZNEE 4UIMA 3SDXE 3D18B 3SKMA 2APFA 4ESKA 4YO0B 4HBQA 5BVJA 5C0CB 1IC4L 5E56A 4Q97A 5SV4A 1XGPB 1DLHB 3ME0A 1EUTA 2HTKD 3LKQB 4OB5H 3VG9B 3DWTA 1LE9A 2BRQA 5JMRA 2FBJH 4YXHH 5JR1L 1KCRH 3SGDI 3O3DA 5DJYB 5AG9A 4IIQB 1CD8A 4JJHA 3VXSB 1I1AA 5T3ZH 1ZLWH 3MOAL 1EDQA 5FYKU 3PHOB 3MLUH 1R0AH 4NZJA 1FNSH 4R4BB 5JLZA 2QQNH 4OCSL 5C0CE 3D25B 2JKXA 5IVOA 5D1QD 3EO1B 2Y5EA 1KG0A 3QEUA 5I1JL 5E5MA 2D7TH 2FD6H 4DKAA 5EC1A 4UDUB 4X8XA 3MRNA 1G7LA 1DQMH 2WQ8A 5IOPB 2W0PA 3OKNA 4NO5B 3B9DA 4GFTB 1PKQA 1CFSA 3F6LA 4LBEA 1FLTX 2XKNB 4YR6A 3EAKA 2ARWA 2C4XA 1J12A 3WFBH 4TOYH 5IEHB 4AG4L 4XXDB 3HCVB 4GBXC 5JW3H 5DD5H 3EDKA 1U3HA 5CINL 5T1KB 5AD0B 4V1DD 4KXZI 2GJ6E 2VXQL 5AZEH 5FA4A 2BRRL 1J10A 1KPRA 5DD0L 4HFWB 1GGTA 4CW1B 1BQHA 1DJSA 1G1YA 3BW9A 4PGEB 3WCYA 2YD2A 3B9VA 5IQ7L 1RJLA 1T22B 2W9DH 4KMLB 1JGLH 1Q9OA 2YD7A 3MXVL 4NDMA 3OTTA 5DRWB 5A1AA 4H8WL 2MJWA 1KGCD 5K93A 4QRUA 2WINB 5D70H 5EOTB 1J0KA 2DQHL 4MAUL 1QSFA 2RJMA 1S8DB 3TBWA 4GBXD 1QQDA 2DB8A 4M5ZH 3NCJH 2I5YL 5DUML 1B4RA 1NDGA 3GSQB 1FZJA 4NHUB 2OL3B 1OM3L 5DWUH 4PRNA 3FB6A 1YY8B 2H2SC 2X1OA 2NYYC 3TN0C 2P5EE 1Z9SA 2WUBH 3T1FA 3NCFB 1I1CA 1DUZA 2DMCA 2ZSVB 1IGTB 4P5TC 5J6HB 3HE6A 5ACZA 4JHAL 1ZSDB 3W39A 4HC1L 2A74B 2LAGB 3KNBB 3W5NA 1NGWA 4DZ8A 4K71B 4HS3A 1A7NH 1QSEA 5J12C 3MRPB 4Q9RH 2P8LB 4L1HA 4HBCH 2OXGA 35C8H 1KJVA 4L29A 4NN5B 4JY6A 1KB5A 5I17A 4YFLI 1E6JH 4H20L 3RI5F 1UCBH 5FYKH 1IARB 4HIJB 3SKOB 2YA2A 3IFNH 4UINH 2EICA 3WHE0 3TN0D 2H2SD 2NYYD 2B1AH 5CILH 3QULB 4QHLB 5T3XL 5ITBL 1URLA 5TDOA 1MWAA 4P5TD 1I4FA 4YHIB 1WSST 1QUNA 4OZHA 3FOLA 2Y5TA 2FJFB 2G2RA 4ZPVB 4LQFH 5IB5A 5SV3A 3KLHC 4ZFZA 3NZ8B 5LGJA 3B2VH 4GXVL 1CFVL 2JK5A 4HGWA 2APWA 1FFNB 1S7VB 1CR9L 1FNAA 3CDGA 3E1F1 2D03L 1HDMB 4LDLB 4WWKC 1MQKL 4YHMH 2ORBL 4FQ1L 2CRZA 4JR9H 2D31A 4LVOB 1DBJL 2EDDA 3ZSSA 3IS1X 1DDHA 5DRZA 5D1QA 3P4MB 3FO0H 4OLXH 1HHJA 4OZ4B 3WDIA 3WS6C 4Z7UB 5J13C 3BH8B 4YHKL 2FYYA 1R3HA 1SHMA 3WS3A 4PLKC 1VACA 4HXAL 5E99L 1KJ2B 1MUJA 2HG5A 5FUZL 2A6DA 1SYVA 3TWCH 5ADOH 5DI8B 3SDAC 3KLHD 4CU6A 4K94C 1S7WB 1ZA6A 4JZNB 3MUGB 2XOTA 1JGVH 5CBAA 3IJHB 3P11L 2QEJA 1G7MA 5EORL 2C9AA 2EC8A 4JM2B 1CVRA 2VXSL 2YPVL 1SBSH 4XPHH 4OCXH 3LSOA 3MRMA 4ISVB 3JTTB 3L7EA 4ELKA 5HGHA 1ERNA 3ULUE 1SVZA 4NQEE 4V1DA 2DTMH 1NJ9A 2ZUXA 4KRLB 1A2YB 2Q86B 2AJZA 3T65B 4P2OB 4HCRH 1ZHBB 4IIQC 4PLKD 1ZS8A 1R3KA 1MHCB 4P3DA 4DFIA 1P5UA 3T0WA 1JYXA 3SDAD 4Z7VB 2OJZH 3EYUH 1IM3A 2NNAB 1PVHA 3VI4F 2ITDB 4KDVA 4OGYH 3BYTA 2BSTA 3V2AR 4TUOA 4FQJH 1BQLH 4GBXA 4R0LB 3VD7A 4N1HB 3P40A 4DOHE 5FF6B 3VI4E 4OLYH 2DMBA 3GUTB 1RVFL 3VFMB 4OFDA 5C0CD 5MERB 4NNXA 4DKEL 2A1WH 4DTGH 2MHAA 1CLCA 1F4WL 2DKSA 3WV0A 1G0DA 4U1JB 3IGAA 1GC1C 2HAZA 4Q2ZA 4GAJH 1FL3A 2B4CC 3O6MH 1M7IB 2Y7QB 3V8OA 4MD5B 3K4ZA 2R29H 4R4FL 4JZOA 1BZ9A 2X42A 2GT9A 1JWMB 1AHWB 3MOQA 1GSMA 2BSSB 2GITA 1ZANH 1X7QA 1MLCB 4JFZH 3UO1L 4P2CG 3LHPH 4CVXA 4ZUVB 2GFBB 2Q20A 1HK6A 2GJ6D 3BE1H 4HIXH 1NLBL 3T2NL 3KPLA 1CLOL 3RX7A 3TN0A 4R97C 2Z8WC 4D0CA 2A83B 2AAVA 5CJXC 3BAEH 4P5TA 4P2RB 2PR4L 2PW1A 4PRPB 5LQBL 1QFWH 2XWTB 4R6UA 2P49B 2J88L 4OIIH 1K8DB 1FH5H 1RK1B 3ZE2F 4NO0B 3DUUB 2FX8L 3A6OA 1P7HL 1TVHB 1B2WH 4X7DC 3UBXI 4WI2A 4JJ5B 2HFEB 4HIEA 3B5GA 3ZE2E 5HSFA 3EOAA 1F97A 1KFAL 2AV1B 2W60A 3QR2A 4PUBL 3MV9B 2FLRT 2W0FB 1FQ9C 5DYOA 4PRPE 1OCWL 4NKIH 3BRGC 5FAAA 2A0LC 2P5ED 2WWMC 3P30L 3QDHA 5EZJA 1CFTB 4U1NB 4IEFB 1KYOK 1ZVHA 4TUKH 4YHOL 4O2EA 1XT5A 5EU4A 2RGSA 3DVFA 4NN5C 1DUYA 1FPTH 4JVPA 4LGPB 4W4OC 5IFJB 2A9NL 4MAYB 3NOIA 2GJZB 5CMAB 5AZ2L 1PQZB 4U1GB 2VDMH 4WI9A 5ICYA 3CFIC 1X5IA 1FVDB 3MMEA 5EFIA 2EIZA 1O5DT 1D6EB 3BPCA 4X0KB 4KKAC 3D39E 8FABB 5TF1H 1NLDL 4N90E 3DGCR 5F6HI 4GQPH 2P8PB 1LGVA 3G5VB 4AEIL 2HFGH 2A0LD 2WWMD 3FT4B 2VOTA 7FABL 3H9ZA 1A0QL 3MNZA 5TQ0H 4HK0A 2FB4L 2HT3C 4NKDB 3WS6A 4ZNEA 3KLAB 5DJZA 3DUSA 1BIIA 4X7SH 5F7KC 3SDXA 3MNWB 3VFOA 3TBVA 4JPIA 4AQOA 3MA7B 3LEXB 4KTEL 4LVOC 2EIDA 3SDAA 5I16A 3BT2H 3REWB 1K6QL 4XB8A 3MJGX 3L3KA 3P73A 1EAJA 4PREB 5AAMA 4LHJB 1IC5H 2JB6A 2VMFA 2P4AB 1AQDA 4GKNB 2C7UA 1E4WH 1J0YA 1A64A 1MCRA 5DTFB 4CJ0A 1LQSR 4KKAD 4TQEL 1I3UA 1RUKL 4U1LB 4YO0A 5C0CA 5FYJH 4K9EL 1CFBA 5L8JB 1DLHA 3QYCA 2R1WA 4RAVB 3CLFH 4PJ7B 4PB9H 3O6LL 2HT3D 1T5WB 3A67L 4IDJH 4HK3N 2F53B 1KOAA 2QSQA 3NFPA 1YQVH 2GW5A 5DUBB 5JDJA 3F7RA 4LLAA 3C08L 1OP5K 3VXTB 3S35X 4FFZH 3PWLA 1VENA 3RI5K 1YEFH 4LAQL 3U0PA 1JZ2A 3NFSL 2BC4B 3HNSH 1EX0A 2OP4H 4YK4B 1ZT1A 4K8RH 2CH8A 5DR5L 5FXCH 4D9LL 2AJVL 2VDNH 4P2OC 1HH6B 1NKRA 4UDUA 3IAGC 2RIKA 3BDYL 3L5WA 3ULUD 4L8CB 1MJ8L 4NQED 15C8L 4XVUC 4R26L 4IRZH 1F6AA 1WVZA 5IOPA 3ULUL 1G0YR 2GJ6A 2FIRT 4UZGA 5D2NE 4NRYA 3T4AB 1GCFA 5DJAB 1KB5H 3MXWL 5KN5B 3BMWA 4I77L 4PP2A 3ESVF 1U2HA 2JELL 4RMTA 4XXDA 2CLRA 4R0LC 1U8OB 1V05A 4O2CB 4OCMC 3WXVL 4FXLA 4M7LL 4JREC 3KPRB 3QXAB 2IAMB 3GMNB 1MWAH 3EOTH 4PY8J 2Y25A 4UV7H 1YDPA 2F5AL 1JYNA 3VFVB 2XNAA 4GUPA 4HFWA 3OKDA 2ICWJ 2UZIH 3IU4L 3FFCA 5MP6L 4PGEA 4WW1B 5CEYA 5KAQF 4ORGB 5JR1H 1A7PL 4XVUD 2LAAA 3KPRE 3BEVB 2P5EA 4LFHD 3MOAH 4OFPA 1X6LA 4QXGL 1UKSA 5DRWA 4HWZA 4OCSH 3FRPA 4QRQA 3DROB 3WIIL 2M1KA 2JJTA 4OLEA 2D0HA 3MRCA 4LSQL 1DVFB 3PV7A 2YUWA 2OX5A 3V6ZA 4AEFA 4U1SB 3CU1A 3GSQA 4D0DB 3GSUB 2OL3A 2XPGA 5I18H 5JW4M 4J7RA 2HLFC 5D7LB 4PG9B 2IMMA 3UROR 3P0VL 2ZSVA 2I60L 1FFOB 1RZIA 1W72L 4XMLH 3LIZH 4PS4L 3KNBA 4GXUM 4AG4H 4ERSL 5CCKL 1L4IA 1AR1C 5MEPA 1VFAA 1C5DB 5CINH 3GSWB 5D4QA 1MCJA 1KCUL 3MRPA 4CBPA 4HF5L 2CKNA 5DJDA 2BRRH 5D7LE 3NGBB 4FQLH 4P9ML 4Q74A 3B9KC 3KVQA 3WFHA 1NBZB 3Q5TA 4Y2DC 4MCYB 2BVOA 1AP2A 4HIJA 4JB9H 5TH2B 2F58L 4NT6B 3SKOA 5IQ7H 5LWYH 5BCAA 2M8XA 5IFHL 4HJGB 3DO3A 4XB7A 43CAB 4DVRL 4FG6C 2KL6A 2HLFD 4XHJD 5TDPB 2ZNXA 5IMMB 5MI0C 3MUJA 5F7YC 4OFKA 1JNJA 3QB7C 5JXAL 5F7WC 4YHIA 2GTWA 4H8WH 4PRPD 1U8JB 1X3DA 3WFEH 1CG9A 4MAYC 1S5HB 2DQHH 4ZPVA 4MAUH 3HR6A 4NO0D 2R1XB 4RMUA 3NIGF 5C6WH 1HHHB 2VQ1B 4HLJA 1H5BC 4U1GC 3NZ8A 2PYEE 3N0PB 2W65A 4HT1H 3V0AC 1T66D 1EFQA 2DTSA 2I5YH 2DWDA 4L3CA 4MNGE 2QLVB 3GSOA 4JFDE 4B0MM 5F6IB 1OM3H 5IHLB 1X4YA 1F6FB 3HUJF 3TZVB 3VWJB 3NIGE 3C5SB 1R3JB 1U41A 3B9KD 3CK0L 3GBNL 1EBAA 5BRZB 5E8NB 1KV3A 4CADA 2XA3A 4Y2DD 2R0KL 3WN5A 3HRZA 4AIOA 2ARJB 3HUJE 4JHAH 4Z0XB 4MXVF 2R2EB 1DEEB 3TPUA 4HC1H 2X4QB 4FG6D 3P4MA 5C0IB 4LLDB 3RWIB 5DMJB 2DJUA 1L0XA 1P5VA 3BH8A 4P23C 2X4TB 4MXVE 1V5JA 3IDYB 3S37L 3D39D 1C16B 4RFOL 1KJ2A 4N90D 3ZHLA 4MAYD 4NQEA 5BRZE 5EZLA 2CDEA 3DBXA 3HNTH 2QQLL 3R0NA 4WIQA 2HT4C 3INUL 2DS4A 1S7WA 1T21B 4H20H 1Q38A 3QFJB 3TC9A 4EVNB 5JQ6L 3NIFF 4XC3H 1HWGB 5EIQA 1QBLL 5C0RL 5T3XH 5ITBH 1BOGB 1XF3B 4U1KB 3NIFE 5HYJB 3IDNB 3DX6A 2Q86A 5LBSL 5I15L 2CUHA 4GXVH 1CFVH 4JLRA 4P23D 3L5XL 1ZHBA 1X5KA 4G42A 5EBLB 5FO9B 5D2NC 5HXMA 4O2FB 1CR9H 1JBJA 5F1OB 5IF0B 2HT4D 5J4MA 4L3EE 1MQKH 2ORBH 4FQ1H 4MNHB 4YK4C 3N9GL 4XCNB 1JWUB 1XF5A 3MREB 2APTA 4KRPB 5I76B 1DBJH 4YGAB 5SX4H 4ODVL 1UB6A 5FDWB 3CVHL 4NNPL 4YAQB 2P7TA 1J1PL 3GSVA 4R0LA 5IB1A 4HIHA 2VZTA 4YHKH 4HUWA 2CR3A 4ZFFB 3GUTA 5B3JF 5EG6C 1JZ3A 1UWGL 4OZIF 1F4XL 5GRVL 3L7FB 4BUGA 3D3VB 1A4KB 1RZGB 1MRCL 1T80A 2ZCKH 1N59B 1W72A 2R0LL 5B3JE 4OZIE 5D7JB 1MLBB 3KAAA 5H94A 3P11H 3BISA 4MD5A 3TNNB 2KKQA 2VXSH 4D94A 1JWMA 1LE5A 2YPVH 4OT1L 1CFQB 1AJ7L 4H0HB 5DQ9B 5IBTL 3I6KA 3D3VE 3HB3C 4G6KL 4W4NA 1G0XA 1MLCA 3MRJB 3QFDA 4OLUH 5DFVC 1U8PB 4ZUVA 1T0NA 5IK3B 1NBVL 2DM3A 5K9OA 1ITBB 4LSRL 3T4YA 3GJFK 4IOIB 4I9WE 3MJ6A 3KDMA 1AGBA 4XVSH 5TPWH 5F96H 1T7YA 1YJDC 3M07A 4GW1B 1ADQA 4I3SL 5ACLA 5GQBA 1MCHA 3CFKA 1JV5A 5K9JL 2ZCHL 5GRVK 4N0FB 1NMBH 4PRPA 3CH1B 2XWTA 4S0SD 2QQKL 5DMGC 5GGRB 3KPRD 1CBVL 1RK1A 4NO0A 2GTZA 3C5JA 4JFYB 5LCVL 2O5ZL 3HB3D 3L3IA 2NZ9C 4JJ5A 2HFEA 4DKEH 2BNUA 4PGBB 1F4WH 1LO4L 1S7UB 1WEJL 2AV1A 4UTBL 3B9KA 1X44A 1BVLB 4OZGF 4Y2DA 1JN6A 3FQWA 4F37F 1JNLL 3ULSB 3ZZ1A 4TVPL 4R4FH 2OR8A 2O61B 2VLLA 2ZP0T 2F19L 3F58L 4OZGE 2NW3B 3CXDL 1QFPA 2NY0B 3BSZH 2DQCL 2AGJL 3VXRB 1ZEAL 3ARBC 3MRFB 4XMPL 5FO7A 4C56B 1PX3A 3D39A 5DMGD 5AWNH 3KPSE 1A1MB 4MAYA 5A2IH 3QXVA 2GJZA 3MBEB 4Y19B 2L7JA 1PG7L 1H5BA 1LK3H 4D8PA 1FGNL 1WFUA 4OF3A 5D7LD 2NZ9D 2WBJB 1FVDA 1CDIA 1NLBH 3T2NH 1CLOH 4PJFF 1K8IB 4F7TB 1GOGA 3VXRE 2HYMA 3LS4L 3FQTA 1AGEA 1Q9LB 2P24B 2PR4H 2F15A 2P8PA 1CFNA 1GC1H 5LQBH 2CQVA 4PJFE 3TBYB 2J88H 1Q8MA 1CGXA 2FX8H 5F6IC 1WCQA 4NKDA 1U58B 3NACH 3TZVC 3VWJC 3DV6B 3MUZ1 1P53A 3ARBD 4P23A 5IVXF 5EIIA 1G7PA 5KG9A 2NTFB 3B3IB 4WU7A 5GSRB 2PYED 1KFAH 3VXUE 4PUBH 2E7LA 2A77L 3UPCA 5IVXE 1OCWH 4JFDD 1U8MA 4PREA 3GJFA 4W6WB 4FQXB 4OF6A 1RUPL 5GHWL 1QO3B 3P30H 3QZWG 1CXLA 5FA3B 1A1OA 5DTFA 2C26A 1BD2E 4I2XA 4YHOH 4G6AC 4YFEA 9CGTA 4GMSL 4ZXBB 4U1LA 5EU7E 1F6LL 1MFEH 2A9NH 4RAVA 2N7BA 5HHPA 5HVFB 2IH1A 3QBTB 5AZ2H 5EBWB 5EOCL 1WC7B 3TZVD 1ORQB 1KPUB 1UEYA 5IMOA 5BRZD 2D0FA 5DUBA 1D7FA 2AKRB 4ZD3L 5C08B 5D2NA 1XGRB 1A6AA 4X6EA 1RMFL 5KVMC 1KNOA 2EKSA 3ELAT 3GZKA 4LLWA 2EDXA 4FQCL 4GKZB 1NLDH 3AM8C 3UJJL 4P48A 4AEIH 3OJMB 2H32B 3OGOE 3K46A 7FABH 2A38A 1LMKA 2FB4H 1BFOB 3TT3L 5T33L 4K3EL 4G6AD 1WTGT 1EGJL 5C08E 3T4AA 3BEWA 3VI3F 5CP3A 3C6LB 4KTEH 1BWWA 5KN5A 2ILLA 2X44D 2PNDA 4KRPC 1K6QH 3D0LA 2Z0BA 1LEKB 2N4IA 3DO7B 5IFAL 2N1KA 3VI3E 1D5MB 1U8OA 1MNUL 4I0PC 4MA7L 3QH3B 3KPRA 3L95B 3GMNA 4L3ED 2XN9A 3CU7A 3V6FB 4PRIE 3REVB 3BO8B 1A3RL 1AGCB 1RUKH 2UY7A 4A2LA 2VO5A 3S7GA 2R23A 2ZOLB 4PD4K 3J7HA 1SY6L 5I1HL 3H0TB 2ICCA 4Q7DA 3RU8L 5HI5C 1FFRA 4XTRC 1QG3A 4Z5RB 4X7TB 3O6LH 3A67H 4OFYD 4R8WL 3T0XA 1JE6A 1Y6MR 5B39B 4XHQA 3Q5YA 3C08H 5BMFH 1E27B 2AJXL 1OOAA 2CDFB 4U05A 1S9XB 1AY1L 2DLHA 4ZOAA 3LQZB 5L7XL 4KRPD 2BVPB 4LAQH 4KZEL 2UZYB 3NFSH 4DUWA 5FKPB 4PYGA 4P5KA 2YUZA 3CXHJ 1QHPA 5DR5H 4I0PD 4M9OA 3FQXA 3BKMH 4O4YL 1MJ8H 4PGCA 15C8H 2NW2B 3D3VD 3ULUH 4QOKB 5JUEL 3U6RA 3NCBB 5D7LA 3MXWH 2DM7A 1OGTB 5HI5D 4XTRD 1S9WB 4HV8B 4M3KB 4JRWA 3GI9L 4I9WD 5C7XL 1UM5L 2L4OA 5EZIL 1XCTA 3WXVH 1Z3GL 2NY5C 2OTWA 4M7LH 1C5DA 1FZKA 1K85A 3MLXL 3H8NA 1QEWB 1RJZB 2F5AH 3SPVA 5C6TL 2H9GB 3JV4B 1RHFA 3ARBA 3CFEB 3UPAA 4PJXB 4DUVA 3MYJB 3DPBA 4MCYA 3IU4H 4CU7A 3EO9L 2XQBL 5MP6H 2PYEA 2Y4SA 5K9QG 4MNGA 5CSZB 3NFNA 3SGJC 3HAEG 1A7PH 1U8KB 4JFDA 1JHTB 2NXYB 5DHVH 1KN2H 5E8OA 5IMMA 2NY0C 1YYLL 5GJSL 4HG4J 4IS6A 2BSED 4QXGH 4NO3B 1IBGL 4DVBB 4BZYA 3NCYS 3BJ91 1S5HA 1AH1A 4YXLH 4MA8L 3HUJA 3WIIH 3MBEC 2R1XA 4LSQH 4YHZH 1PJ9A 3PIQB 4YPGB 4IJ3B 5GRWA 4UU9B 2UVEA 3WE6B 2ZOKA 4MJ5B 5HGGS 1TJHL 4F7EB 3LH2L 2BSRB 1INDL 2VLJB 3TZVA 1OY3B 2DLFL 3WLWC 1R3JA 3KPSD 4PRDB 4RGOH 5IIEA 3K1DA 3P0VH 2I60H 1W72H 3JSSA 5B8CB 1FZOB 2ARJA 2FIKB 1FC1A 1V3JA 5EU5B 4PS4H 4DGVL 4RRPG 4NZRL 2V9TA 4RNRA 2YD1A 1G7JB 5CCKH 1IAMA 1ETZB 5C0IA 3UTQB 4PTTA 3GK8L 3QIWC 3E6HA 3T3MF 2EDLA 3VXRD 4U49A 4U1HB 1KCUH 4HF5H 4Z76B 3QUXC 1EGJA 1BEYL 5EU7C 3MCKB 4P9MH 2I9TA 3MBED 2Q6WA 3RL2B 4EUPA 2GK0B 3MLZL 3T3ME 3TYGH 5I1DA 3UX9B 5JMOC 2JJSC 1T1XA 2K7PA 2G9HB 4FQXC 3EUUA 2F58H 3VCLA 4ODXB 4LARL 1G9ML 5LJYH 2YC1B 4Y88A 1P2CB 4KUCF 2DWEA 4Z9KB 4DVRH 4R7DB 5MENB 1ZHKA 3QEGH 5C0GA 3VXUD 5AYQA 1DQTA 3BVNA 5AAWA 2FZ3A 2VLRB 3IKCB 4JFQB 4L3EA 4XH2B 1ZK9A 3B4NA 4H25A 5F1SA 4KVCH 3CUPA 1TDQA 1I1FB 3AM8A 1NUGA 4HJJL 3QIWD 4D9QE 5F88B 1BD2D 4QTHA 4FQIL 3VFNB 2VXVL 3QUXD 4G8EB 2Z4QA 5MENE 2YUXA 3AGVA 1HE7A 4O2FA 4OFYA 1ZE3C 1AR2A 1NGYA 3CK0H 2ZNWA 3HG1B 2AXGB 4GG8A 4QXTB 3MRKA 5TJWK 2DICA 2OMNA 4FQXD 3MREA 5I2IA 4NKOB 4OZIA 1FNFA 4WDIA 2FATL 1UB5B 1AGFB 5D72L 3OR6A 4I0PA 1M71A 3SDDB 1FO0B 4OCYH 2E7CA 3S37H 3O2VL 4RFOH 5EWIL 4LF3A 4M6OL 1EHNA 2IBZX 2W0LA 2WQRA 3D3VA 2QQLH 4GW5B 1SM3L 1YEIL 3AMKA 1N59A 4PJAF 4O02H 1NFDB 5IB3A 1MLBA 4P4KC 5JQ6H 4I48B 1PSKH 5C08D 3MRBB 2X4UB 2E9BA 1QBLH 4OKDA 5IHUL 1OLZA 5DGQA 4KRMB 2Z9TA 2I27N 4PJAE 4XZUA 2GSGA 1CFQA 3D48R 5DQ9A 2OTUB 1LVEA 3PWUB 4WFHE 5JW5A 3B8YA 3L5HA 2CLZB 3MRJA 3TBSB 1QPXA 5LBSH 4OM0H 3GSNA 4Q6IB 5IK3A 3CSYB 4PRID 1LO0L 3MGAA 4PR5A 5CKGA 1KCLA 1YNTB 2V2WA 5CUSL 1KELH 4XXCC 2X40A 1P9MC 1VGEH 3MLVL 1MJJA 3GI8L 5C0AB 1U8LB 3HMXL 3N85L 1U92A 4P4KD 3DHJA 3GJFH 4JPVL 2BNQD 4ODVH 1BFSA 4O51B 2DI8A 2V17H 5CAYB 3CVHH 3AC0A 2GY5A 4NNPH 3K2MC 4AM0A 1J1PH 1XH3A 1J7VR 1HHKB 1FSKB 4OZGA 2VIRA 2VKWA 4O5LL 1F4XH 2C4FU 2C3VA 1VADB 1BZQK 4P3WA 4PGBA 5D7SH 5IW6B 2EKJA 1MQ8A 5C0AE 3UZVB 3KPSA 4X4YA 4L8BA 4PBXA 2R0LH 4M4PA 2IALA 4GG6B 1C7TA 3K8MA 5E24E 4OQTL 5HHNB 2ESVE 3KWWB 3GGWB 4W6YB 1IEBB 3SGJA 4YDVA 3OXRB 1BREA 2YHGA 1CD9B 3RVUC 4GG6F 1YECL 1AJ7H 2FL5B 4UI2A 3MV8B 4WJ5B 4LHUB 5IBTH 3VXRA 4G6KH 4OKVA 5GIRB 1PEWA 1G7HB 1OB1B 1HWHB 3A6CL 1CIDA 3MBEA 4GG6E 4PJFA 4Y4HB 1JPGB 5L9DH 3VRLF 3UP1A 1NBVH 1S7RB 2GK2A 4LSRH 3VRJA 3OKOB 4ZQKA 3IRZA 3JTSB 4I3SH 4ZUUA 5CP3H 5HPMA 2ZUUA 2H2PC 3VRLE 5HHOB 5JORB 3P9MA 4P2YA 5B22A 2GEEA 3VXUA 5K9JH 2ZCHH 3L3GB 3ZLQC 2HJKA 1G9NL 3IU3A 2QV2A 4QT5B 5IVXA 2QQKH 1QHOA 4XP4L 2LVEA 1CBVH 5GS0L 3MNVB 1M1SA 2EDOA 3RVUD 4R3SB 2C5DC 1U58A 3QIWA 2O5ZH 3DV6A 1UC6A 2VDQL 3FO9B 1I8MA 3X3GL 4E41B 1BD2A 2XZCL 3N1MC 3QUYB 3VD4A 3QUXA 3B3IA 4QGYA 3G5XA 5DJXB 5D5MA 3EYVB 1LO4H 5CLTA 3QDMB 4P2QD 5BOZG 1J1XH 1KJ3H 1WEJH 3HS0B 3I50L 3OQ3B 4UTBH 2PXYC 2JJSA 4MJIB 1JNLH 4FQXA 3MRLB 1IL1B 4TVPH 1FV1A 3NVQA 4L9DA 2FNBA 1YJDH 2H2PD 2BX5A 3F58H 4MB5A 3CXDH 1XIWD 3FB8A 1T2XA 5C6PB 4WHYG 3EO0A 2AGJH 4NPYB 1ZEAH 5F7MC 3ES6B 4ZDHB 1MREH 4XMPH 2ZCLL 3K8KA 3QDME 3U82B 4HLZG 5DRXB 1S7QA 3HZKA 2R39A 4PJGB 4MJIE 1PG7H 5EBWA 3HPJB 1ORQA 5B38G 5CEZE 1FGNH 4ODWB 4U6XB 3DOSA 3CX2A 3RWCB 4DWHA 5DJ8B 2DQIL 5C08A 1TQBC 3S3JA 1XGRA 4LSVL 4PJGF 1N3NA 1IM9D 4MX7B 4N8VB 5IUSA 2PXYD 4KK8C 1C5CL 4C55A 2YD4A 1R5IA 4PY7B 4PJGE 1AO7E 4PRAA 3WBDA 4DEPB 1KBGH 2O5XL 5DVMA 5BVPH 4GLRH 1Y18A 2APVA 4PRIA 1E4XL 4NJ9L 1CTOA 4KUCD 3GIVB 1JMZA 1RJYA 1CGWA 4KK5C 4PJDB 4D9QD 5BV7B 1F45A 5DD6A 3ULVL 4Z7WB 3UPRA 5EA0L 2OYPA 5MEND 3O6KL 4P4KA 2A9ML 3Q6FB 1OSZB 4RDQG 4XPBL 2BNQA 4U4BA 3SDDC 4GMTL 1SQ2N 4Z7WF 2ICWA 4U1MA 4IRJB 1Z6JT 4JCMA 4WI6A 3REVA 4KK8D 4S1QL 4S1DD 3BO8A 3HE7C 2LU3A 1TJIL 3SDYL 1NEZB 2ZOLA 4Z7WE 4TSAL 3M17A 1FVCA 5DK0B 1CI5A 5EOCH 1T7WA 2YPKA 1EPFA 2OMBA 1BX2A 2H8PB 5GXBB 4X6CB 1RURL 5B39A 1OGAB 1HINL 5CJQH 1RIUL 4ZD3H 4OIBA 4XCCH 4KK5D 4N0YL 1E27A 2CDFA 4HFUL 1RMFH 1S9XA 4K23L 1KF9B 4XXCA 1P9MA 1XF4B 3LQZA 3U9UB 5FIEA 1FE8L 2D4FA 4NC1C 4FQCH 5I1AA 4X6CF 4BSVB 3UJJH 4R4NC 1KIRB 1I3GL 2V7HA 3O41B 4HKJB 3TF7C 3VFPA 2BDNH 3IETB 3TT3H 5T33H 4X6CE 4K3EH 1R5VA 2NW2A 2F8VA 1EGJH 3HE7D 3HC0B 4WFHD 2AJYH 4EUPH 3CPLA 3MV7B 1KPVA 5IBUB 5KOMC 4TN9A 1OGTA 1Q72H 4X9HA 5SWSE 4QHMB 4HV8A 3L6FB 1MY5A 3OKMB 4WHTA 5IFAH 5GS1B 2WNGA 3LDBB 5EH1A 1QFWM 3U46B 4FXKA 5H37G 1MNUH 3W81A 1QR4A 1D5ZB 2CRYA 4MA7H 2DLGA 1FSKC 2OR7A 5DJ2A 5KSUA 3HI1B 1BVKA 4DN3L 2X4RA 1QEWA 1RJZA 4YHPA 2H9GA 1A3RH 1K3IA 3JWOL 2APXA 4R4ND 3RDTB 1OARL 3MV7E 5E70A 1RIVL 3OKEB 1SY6H 1CT8A 5I1HH 1FVEA 3NABL 3L9RA 4P2QA 4ZAKB 3RU8H 1UXSB 2J6EA 4J8RA 4NC2B 1BBDL 1Q94B 1U8KA 2JF1A 2HVJA 5E7BA 3BI9X 3FRUB 3BUYB 4MHHG 4LLVB 1QBML 3DRTB 3MGTA 5C0AD 4P49A 1AY1H 2FJGB 3GJEA 4NO3A 5L7XH 1G84A 4KZEH 4D3CL 4V2BA 1XIWA 2ESVD 2V2TA 3RTQB 4FFYL 3I3EA 2ZUQB 3BP6A 3JV6A 1W8OA 4YPGA 5CHNB 4BQ6A 1WFTA 4ZMAT 5I1CL 4MQ7B 4RAHA 4O4YH 3RZCD 4LGSB 4JO2L 2ZPKH 3DTXA 5HJ3B 5D7KE 5JUEH 1QRKA 4PRDA 3RWHB 3WNMA 3QO1A 3LRSB 2VL4A 1IM9A 3GI9H 2PXYA 5C7XH 1IJ9A 5IHZA 4Z77A 3ROLA 1LD9A 1UACL 1ETZA 5EZIH 32C2B 1TVBB 1Z3GH 4I4WB 5E5RB 4QF1A 4LHUD 2FO4B 4UOW0 4U1HA 3MLXH 3QUYC 1MIML 4Z76A 4TULL 3MCKA 2M2DA 1UWEL 5CS7A 1NDMB 3L3DB 3AU1B 2DQFB 2GK0A 3X13A 4RFEA 3GSNH 2XQBH 1ZGLA 4ODXA 2Z93A 5HGBA 1JCKA 2VABA 1P2CA 3HAEA 1GOFA 3P0GB 1AC6A 5EC2A 5MENA 1H9VA 1JYWA 3TIEB 4DKFL 1YYLH 3DXAB 4L8SB 1VESA 3QIUB 4TNWF 5GJSH 4HHAB 2V7NA 2J8UB 4JFQA 4XNZB 4M03A 3A6BL 2VXTH 1L9MA 4JFXB 1PY9A 4MA8H 1I1FA 3V4PH 1YY9C 4JPKL 3BWAB 1TJHH 2NY5H 2Z31B 3QUYD 3VFNA 3U0WL 1INDH 4OAWB 3ZE1F 3QDMD 2DLFH 1KCVL 3DXAE 2EZ0C 3PV6A 5CD3A 1RAMA 4JE4B 4MJID 4U2ZA 4GH7B 3ZE1E 1FG2A 1AD0A 5CEZD 1KB9J 2DD8H 3C2SA 3SOBL 4NZRH 4DGVH 2X4SB 4DEPC 3VD9A 4MD0B 1U3ZA 3S96B 1I8IA 3GK8H 5MEQA 2ED9A 3O9WB 4UOJA 3D2UD 5F71A 4LQ1A 4PJAA 4S1RL 1A7OL 2GSIA 2OS7A 2UWEF 1MSPA 1BQUA 3HE7A 1D5IL 3A0OA 4GW5A 1AO7D 1YY9D 1WWCA 3BIKA 3MLZH 2CLVB 1NCAL 4RQQA 4ZPTB 4FQHB 1MJ7L 5IQ9B 2UWEE 1UM6L 4LARH 3Q2CA 1RPQA 3U4BL 5CEXB 1G9MH 2R2CA 3MRBA 3BHBB 1FL6A 3UDWC 5C0JB 2EZ0D 1PFCA 5CKAA 3F62A 3QUZB 5EOQH 1A14H 3MJ8B 3QSKB 3VGHA 1FZMA 4GS7B 3SN6N 3RFZC 4M9PA 3DGGB 3PWUA 1TZHA 4P3CL 2CLZA 4N9OB 2FJHA 5HYFA 1V7NL 3R06A 4HJJH 3K4DA 1BP3B 3MZGB 2VXVH 1Z2KA 2QKIB 2BVQB 1YNTA 1KTRL 3IJYA 4G3YH 5FHAL 3T2OA 1K9TA 4JFFE 4RISH 2NR6C 1YNKL 4JG0L 4XPGL 2ITCA 1IAII 4YDJB 2UZXB 5C0AA 1KC5L 3QI9B 5CJ8A 1X5YA 1YMMB 2PN5A 3W2DL 3FHQA 2ESVA 3WHXB 2FATH 3GFUA 4JFPB 4APQD 2ATKB 5D72H 1MCSA 1U0QA 1K4DA 5C8JB 4YWGL 2OZ4A 1SJEA 3U79A 3O2VH 4GAYB 5EWIH 3DHMA 3LPGA 4CAGA 3RZCA 1VADA 4M6OH 4XNQB 5IW6A 1NGPH 1SM3H 4AEHL 1YEIH 1UZ8B 3B8SA 4HGMA 4M1CC 3ECBA 3OZ9H 4GG6A 2VSCA 3GNMH 3CFDA 3W0WE 1JGDA 3BKJH 2CPCA 2P5WE 4GSDL 1IEBA 5IHUH 2B39A 3OXRA 4OZFG 3QCVH 4QRPB 4GOSA 5KBNC 1BLNB 2J8HA 4J4PC 3DETC 1J86A 1N6QH 5SWSD 4LHUA 2ZG2A 3CIQA 1OB1A 4ZG1A 4YUEL 4NGHH 5C09B 3S4SB 4PJBB 3VU2A 1J88A 1JPFB 1JWSB 1LO0H 1QYGH 1GIGH 2VISB 2H6PA 3U4EB 2Q8BL 3OKOA 5CUSH 3MV7D 4PPTA 3CCHB 1A7RL 3WNPA 1NMCC 4PJBF 3GHEL 4ODTH 3MLVH 3GI8H 1RUQL 5IVZB 4M1CD 3RTQC 1JRHI 3HMXH 2DJSA 3N85H 3L3GA 1F42A 1LO5A 4Y89A 4JPVH 5KZCB 3OR7A 5BZDB 2G5BA 4X83A 2XG4A 5FO8A 4PJBE 5F7EH 1X5FA 5TE4L 2YD8A 4Y5XB 5SWZB 4R3SA 4HH9A 4J4PD 3DETD 3DX9A 3FB7B 3FO9A 3STBA 3MRGA 1IGML 4O5LH 4XCYA 3QNXB 3QUYA 4EXPX 1CE1H 5DJXA 5BW7C 4NN6C 3QDMA 1MCNA 1MI5B 2PYFB 4NKMA 5HI3C 5EO9B 2C3GA 4M93C 4MJIA 4IRSC 4WI7A 4OQTH 2DI9A 4LRNL 1NCDL 4WTZA 3I3BA 1YUHB 4JANA 1JF1B 5D7KD 3WUWA 4QY8B 4XNUH 1GZPA 5HGAB 1YECH 3RTQD 3D2UA 1ZT4B 2BJML 1U2CA 4MNQB 1XF1A 5DRXA 2ATPA 2VAAA 4QRTB 4PJGA 1AO7A 2CUIA 1OT1A 3IAPA 5F7LB 3TJHD 3HPJA 1T7XA 5GGTA 3CSPA 4ODWA 4OCWL 1A5FL 3MRDB 1L7IL 4LCIL 3RWCA 5DJ8A 2VE6A 4ZUSB 3QIUC 2HRLA 3PXHA 1VGKA 3KJ6L 3F12A 1YEHL 1VCAA 2X9XA 1UVQB 4ZOEA 5HI3D 4N8VA 4BZ2L 3ARGC 3PP3K 4F8TA 4XWGH 4WCYL 4ONOA 1OWRM 4IRSD 3FO2B 4JDZB 4MNQE 5HPOA 4LIQE 1HOCB 4L4TB 5A2JH 1QNZL 2ZWLT 5BS0E 2IG2L 4PGDA 3TCLB 2ED7A 4KJWC 4LVEA 1ND0A 1G7QB 4M1DH 1VEPA 2EO9A 3SGEI 2XFXB 2VDQH 5DDHA 3X3GH 2X4OB 3GIVA 3HKFA 4N8PA 5DD3H 2Q7YA 4WNQB 1JUFB 1O7VA 3GB7B 3I50H 3CDCA 2APBA 1LWRA 1WBZA 4K7FA 1IGIL 4Z7WA 4L4TE 4G9DA 3RNKB 1JTTA 3AAZB 1PZ5A 2FLBT 1OSZA 3DXAD 3WL9B 3QIUD 3MR9B 3ZTJG 3DX7A 5CP7B 2I07B 1MRFH 3S36X 4APQA 3QDGB 2D9CA 4JQVC 3ARGD 5K33A 1JRHL 5IR1B 4N9GA 2ZCLH 1H3XA 2DYPD 3FFDA 1YN6A 4KJWD 1CGVA 2XACC 4FA8A 5ITFB 3C09C 4ZO8A 1E28B 3VFTB 2AEQL 4HPYL 4X6CA 3QUZC 1MFNA 1S7TB 5E8PA 3QDGE 4LSVH 3VDAA 3LKRB 3QWRD 4PJ9B 3EHBC 1X5JA 2EDYA 4RMWA 2G75B 3PWJA 3ZDYF 5SWSA 4XRCB 2IADB 3U1SL 2FH8A 4HKJA 4LPUA 5HHXL 2H1PL 3ZDYE 3O3BB 1E4XH 4NJ9H 2F9BT 1IFHL 1INEL 4Z95H 4JKKA 3QI9C 3MV7A 4WV1B 2ADJA 5F9JB 3ULVH 2XKUA 2EH8L 3OKMA 2VN7A 4C59B 3QO0B 4JFEB 3MYZA 2RAMA 4BKLB 3HAEH 4UAOC 3U46A 3QUZD 1M7DB 2A9MH 4JFFD 1LO3L 4PRHB 5I0DA 4XPBH 1D5ZA 4POZC 4GMTH 3VRIB 3WLBB 1QLEL 3EHBD 2EDBA 3PGCB 2LE9A 4J4PA 5JZ7C 4S1QH 5HDOA 2DQUL 3C8KB 4JRXB 3RVTC 4HEPG 4C83A 1TJIH 3W9EA 1IVLA 3OKEA 4AYFA 3U36B 4YNYA 4HDIB 4JFEE 3AVEA 2X9YA 1Q94A 1HHGB 3BUYA 1MCPL 1DBBH 1RURH 1HINH 1RIUH 4N0YH 5D1XB 4LEOB 3QI9D 4HFUH 3ZTNL 2R2HA 3ROOB 3N1GC 1F4YH 4BFBD 1XF2A 3W0WD 1FE8H 1BBJB 5CJOH 5EO0B 5TGBA 3RTQA 2P5WD 1ZLVK 4NYLB 2LQRA 4MXWL 1I3GH 1CGUA 3HNVL 5CHNA 4POZD 2LFGA 3HR5A 3VGGA 2HJLA 4HKBA 1YPZF 5JZ7D 3B6SA 4F7CB 1BFVL 4XP6L 1DQDL 2YPLB 3RVTD 1BAFL 4JY4B 3O11A 5FGCE 5BW7A 3VA2C 5K9KA 3SDCC 3OB0K 1YPZE 1GGIL 4WEBL 1M4KA 4BQBA 4ENEC 4ZSOE 4IRSA 3SGKC 4Y5XC 32C2A 5BXFB 4UV4H 4XNMB 2FO4A 2Z91A 1JNHA 1XGUB 3DIFA 4DN3H 3NTCL 3C8HA 3KLDA 3Q3GB 4RZCB 1KLFA 5D6CA 4NCC1 2EEDA 1OARH 3L3DA 1RIVH 1A02N 1WZKA 2DQFA 4PJCB 3FHAA 3NABH 3TFKD 5DS8A 3T0BA 1HYRC 4EN3A 1CDUA 2HH0L 5DO2C 1BBDH 5F3HB 1CYGA 1QBMH 4D2NA 1ROWA 2YR3A 3GSRA 3G6DL 3NZHL 3DXAA 1N2RB 1B0RA 3MO1A 3O6FD 3QIUA 3SDCD 5IWLC 3KPPB 4D3CH 5JW4R 1OL0A 4RGNE 4ENED 5I1EH 3ARGA 5FYKE 4FFYH 2E5EA 43C9A 3PABB 2DYPA 3BH9A 3RX5A 5HY9B 1BHGA 5MHSE 3UYPA 4F7PA 3PHQB 5GZNC 4Y4FC 5HYSA 4OAWA 1AI1H 2CIKA 3GMOB 2HP4A 5JIHA 4NP4L 4PJ5B 1J11A 5E9DB 3QWRA 1HQ4B 1BGXL 5DO2D 2HVKA 2V5YA 2MQCA 2X4SA 1RQ5A 2UWEA 3T0EE 2X05A 4MD0A 1UACH 3S96A 3P3YA 4XT1C 4PJ8B 2CKBA 4PYHA 3CJJA 1AXIB 4NNYB 3MJ9L 4TULH 4MNQD 1MH5B 2FHBA 3BPNB 1UWEH 5BS0D 3PJSB 1PG7W 4WVRA 5E9DE 2EE2A 4R7NA 4UQ2B 2CLVA 4RIRA 3TO2A 4ZPTA 4HAFA 1XFPA 5IQ9A 3BN9C 5GZND 4Y4FD 5CEXA 1GPOL 2WIIA 3VW3L 1ZHLA 4XBGB 3VE0B 3LKSA 3DLQR 1RHHB 2J3SA 2VZ3A 4DKFH 3QUZA 4JFFA 3RJDA 1F2QA 4C58B 1ZLUK 2AJ3B 1X9QA 5JDSB 3C87A 2D7PA 1MPAH 2OK0L 2DDQH 2X1XR 5FFLA 5FGBC 5JXEC 4WHCA 3QCUL 4M8VA 3NBNA 3MUHL 5DEGB 4G7YL 3U0WH 4K7PH 3K1KC 1A6VL 2ZJSL 3H6JA 4ALAL 1RUAL 4PJ9C 4E9LA 1KCVH 1JFQH 4MJ2A 2VZ1A 3FAXA 3O3UN 3QI9A 3GMMA 1KXTB 3S5LA 1G7IB 3BN9D 3O2DA 3W0WA 1NCWL 4Z0BL 1WJ3A 2P5WA 2KQMA 3QDGD 3IKKA 1MFAL 5SWQB 2RFXB 3D85D 2AV7A 3C2AL 4UQ3A 5KSBB 2EH7L 3PDOB 3KPMA 1D5IH 3ETBF 5TE6H 1NCCL 1PDKA 1IQWH 1UZ8A 1JF6A 2IH3B 5JXED 1NCAH 3V5KA 2W1NA 3VH8A 4L4VB 1MJ7H 1N8ZB 2ADIA 3KYMA 5H2BA 1UM6H 3WEXB 3U4BH 3QA3B 4RFNB 3UZEA 1TJGL 1DBKL 4U6HA 4GW4A 1WBXB 4PJ9D 5J11B 1QTYT 4PY8I 2GQHA 3WDJA 5L2KA 2BY2A 4NRZA 3MQIA 4U33A 4Z8FL 2M26A 4L4VE 4PJBA 5IGXH 2BOBA 2UUDK 2KDGA 4H26B 5CZVH 2GCYB 3MACL 5FHAH 4YGVB 3TVMD 3EFDL 1N64L 1RI8A 1VFUA 5EN2A 2AXFA 1KC5H 4MSWB 5IVZA 3O6FA 4JFED 3CZFB 3SDCA 3VXQA 4OLWL 2X70B 3BP7B 3BIAX 2MSPA 3SGKA 5TE7L 4OLVL 3TA3B 1W0VA 4LKXA 4YWGH 3FB7A 1PX4A 5BVJB 1OP9A 3QNXA 4G5ZL 4WHYH 1W8NA 2XWJB 3GEWB 4UDTB 3ARVA 2QADB 4LCUA 1RZJL 3UMTA 5F9AC 1LE9B 4AEHH 2NY2C 5E2UL 5EO9A 3O3DB 4ZOCA 3JWDL 1FL5A 2WM0A 5ESVB 1I1AB 2HWZL 1ED3A 2FHCA 4XX1G 4QY8A 5HGAA 1KG0B 4X8JA 1CDYA 5E5MB 5F44A 5IWLA 3FJTA 3IDMB 2IANA 5I30L 4YUEH 4MNQA 1LDPH 1EH9A 1HH9A 3MRNB 1WT5C 4X4ZA 1G7LB 3RAJL 5BS0A 5DMKB 3MLTB 3OJVC 2EYTA 5BJTA 3OKNB 3ABZA 5L0QB 1PKQB 1KYOJ 4Y4FA 4ZUSA 4LBEB 3EYOA 3GHEH 4S0TD 2NY2D 3D0VA 3D69A 1XR9A 4JDZA 4PGJA 5GZOC 4M7KL 4K2UL 1HOCA 3KG5A 1T0MB 4NFBA 3T0EC 3QJHB 1U3HB 3U7YH 4YC2B 1LHZA 1NCTA 4HQQH 1KTLB 5KJRH 1KPRB 3PP3H 5KVGL 1IGMH 4RGND 5FYKD 5KANG 2W59A 5LXGL 1JUFA 1NMAL 3BW9B 3GB7A 1R3LB 1RJLB 4CVUA 5MHSD 3QAZC 3RNKA 4LRNH 1NCDH 1Q9OB 5JTWA 4NDMB 3AAZA 4D0BA 4PJ8C 5C9JB 2JB5L 4IMLA 2WZPD 4QRUB 3QDGA 1WWBX 1QSFB 3J8F7 3TBWB 1FBIH 3D85A 5GZOD 2IPUG 3T0ED 2BJMH 5AYUL 1EEYA 1FYTE 3MLYL 5B4MC 1NDGB 5J0BA 4TNVK 1FZJB 5JPNA 3RWDA 3R0MA 5ITFA 3VD3A 5FGBA 5JXEA 1FNGA 3T1FB 1E28A 1MCCA 4NUJA 1A5FH 1OTUC 4OCWH 1L7IH 3VFTA 4LCIH 1DUZB 2YUVA 1KTDA 1U3JA 3VXNA 3MLSL 4IHOB 3HE6B 5E9DD 3LKRA 3Q5OA 4PJ9A 1GGYA 1YEHH 2P45B 3QRGL 4BZ2H 4HX1A 1FJ1A 4M4RA 4WCYH 4FFWC 2G75A 2NPLX 3IDIA 1QBAA 1NGWB 4DZ8B 4HS3B 1N6VA 1QSEB 1QNZH 5EUOA 4PJ8D 2IG2H 4QCIA 4KY1L 5H37H 3K74B 4BH8B 3WSQL 2FCBA 4L29B 4H88H 3O3BA 1A1NB 4JY6B 1KB5B 4PJIF 5I17B 2EDTA 1U8NA 2OLDA 5B4MD 3TVMA 1WV7T 2R4RH 4CNIA 2P46B 2D7NA 3OHXA 4JFEA 4ELMB 4PJIE 3VXOB 1OTUD 4BKLA 4M62L 1M7DA 5TDOB 1MWAB 1I4FB 1RZKL 5ETUA 2MCPL 2MCG1 3WLBA 4OZHB 3PGCA 4JQIH 4WUUE 4ELMF 2WK2A 3VFUA 4FFWD 5I71B 4HIIA 5IB5B 4ZFZB 5C0DA 1HI6B 2YBRA 1FIGL 5LGJB 1FN4A 5T1MB 2JK5B 4XGZA 4CL7A 3JV5A 4HGWB 1U42A 4OZHF 4HDIA 5EB9A 4ELME 1NEZG 5KSAB 4NFCA 4XPTL 4N0UE 4PJEF 1IAIM 2AEQH 4KHXH 1E0OB 4XNYL 4OZHE 1C08B 2D31B 4FTVB 1YPZA 1DBML 1DDHB 4PJEE 5DRZB 5D1QB 1CL7L 3U1SH 4LSUH 4ZSOA 1HHJB 4HWBL 4YBLB 1TTFA 1A9EA 4BFIA 2QSCH 2FYYB 5HHXH 3WS3B 1VACB 2CKBH 1MUJB 3DURA 4NN7C 4LPTA 2HG5B 3L1OL 2I9LB 1ZLVH 1IFHH 1INEH 1ZA6B 4JY4A 4LSDA 4X7CC 4FTVE 1S78C 4L4VD 4I8DA 1G7MB 1MCKA 5IB2A 2EH8H 2BY0A 5IBUG 1YYML 3LSOB 3MRMB 3TA3C 3LPFA 1LO3H 5DZLA 3L7EB 4ELKB 3HFML 2EIBA 5HGHB 1HILB 4V1DB 1XGUA 2DL2A 1QLEH 3O81A 3EIFA 3Q3GA 1NJ9B 5DJ0B 5I1GH 1QVOB 2DQUH 2WLYA 2QADC 4YFDB 4P9HC 1FFQA 1CLYH 3OKLB 2AJZB 5AUMA 5FUOL 3WXWL 1ZS8B 3BN3B 1WT5A 1ZTXH 1R3KB 3ZYIA 5ILTL 3ZE0F 1CGSL 1L7TL 2RHEA 3I02B 1S78D 1WZMA 3V4VH 1ZT7A 3ZTNH 1VFOA 2EDJA 3OJDB 3KPPA 3T04D 2BSTB 3ZE0E 3ARDC 1WIPA 3O2DH 2A73A 1J9CT 4GBXB 1A47A 1KLGA 4MXWH 4Y8AA 5E2VL 1EV2E 5J1AA 4RAUA 3TA3D 3HNVH 3T0EA 5EU6E 4L8DB 1J5OL 5HY9A 1PEZA 3T8XB 3MFFB 5E95B 5L0QC 4FHBD 3N1QC 1W0WB 1BFVH 3O4OC 5I8EA 4OFIA 4XP6H 2QADD 1DQDH 4X6FA 1BAFH 1FO0L 3IGAB 5D71L 3V7AG 3U9PL 5D7IB 5E9DA 1FL3B 1D9KC 1HQ4A 1GGIH 6CGTA 4WEBH 2DQJH 1N7MH 1BZ9B 2PF6A 4YC2C 4ZS6C 4DGYL 5D7IF 4PJ8A 1F11A 4PRBA 3NTCH 1ODAA 3DVGA 1MH5A 3GKZA 3ARDD 2P48B 1P7KB 2XY2A 2IFGA 5D7IE 4CVXB 4OD3L 4F80A 4RX4D 4UQ2A 4YBHA 1F58L 3QISA 2A6KA 5LAXA 5JA9A 2OI9B 3K3QA 2HH0H 3AFLA 4PB0L 3KPLB 3KR3L 3TN0B 3VE0A 1HSBB 3GKWH 3CH8A 3QJFA 1RHHA 4KJPC 1T20B 4NUGL 3NZHH 3TCXA 3G6DH 4P5TB 1DLFH 1D9KD 1P4IL 2PW1B 4KHTL 1T1WA 4OF8A 3WIFA 3F5WA 3W9DA 2VL5A 4YHLL 4X6DB 4HCRA 5J12B 3MRHA 1OSPL 2OR9L 5DEGA 3QCTH 5T3XE 1OD7A 5EULV 1ZLUH 4KDTC 1B4JH 3EOAB 4X6DF 2W0KA 2XZQL 1A9BB 4DK6A 1FYTD 4OIAA 3STZA 3N06B 4LLUB 5DYOB 5D8JH 3WNNA 5DQDL 2OM5A 1G7IA 3WMSA 4X6DE 5IW1B 2Z35A 3DARA 3KXFE 4GRWH 4HWBA 5EZJB 3BUTA 4KJPD 5E94A 4OZFH 4O2EB 3GDBA 3LOWA 1RZ7L 3L3OA 4WHDA 4KRNA 5CIPH 1C8PA 1P6FA 3MJ9H 4WW2B 1B6DA 4FN0A 3RIAF 1DQLL 2E6QA 2DM4A 1ZGLP 3V7AE 5ICYB 1DSFL 1IZKA 1JHKL 4L4VA 2EE9A 4WW2F 3QNYB 1GPOH 3MMEB 3VW3H 1WBXA 4JKWA 2HN7A 2NTSP 1A3LL 5I71C 2W9EL 2WLZA 4G8FA 4TPRL 4Q6YA 2V2XA 1QBBA 4EOWL 4N5EC 4JRYB 2VZOA 3KYAA 3AREC 2VXUL 2DF3A 4HK0B 4Q58C 4E42A 1FORL 3PF2A 4UT9H 4KDWA 5J13B 1C1EL 2BNRE 3DUSB 4PLOB 5KSAC 3SDXB 2Y06H 4WUUD 4G7YH 3E2HB 1WBYA 1I9IL 3I84A 4J3WA 3TBVB 4KGLA 4JPIB 1A6VH 2ZJSH 4ALAH 1RUAH 1K2DA 1NAML 2X89D 4PP1C 5I16B 1TVDA 3EYSL 3MTRA 3L3KB 4JRYE 1BJ8A 5BQ7B 4YBLC 2X70A 3QHTC 4KPHH 1YZZA 2UUDH 3MODL 2C7UB 2VH5L 4YFLF 4YHYB 4IBLT 5DJ6B 2VLME 3ARPA 1MFAH 3TA3A 1KACB 4J1UA 3GHBH 5I1KL 3E6FB 3C2AH 4LSTL 4ZTOL 2EH7H 1T6WA 4N5ED 3SKNA 4R90L 2XZAL 2R1WB 2XWJA 4UDTA 3ARED 2AK1L 1SYSB 1EIBA 1NCCH 2RQ8A 4F9PC 2HRPH 4DW2H 1G6RA 4NJAL 1JTOA 5KSAD 3NFPB 5J89A 2R9HC 1SMAA 5ESVA 3RGVC 1Z5LB 1TJGH 2D2OA 3RX8A 1DBKH 3PWLB 5DK2A 4R96A 1H3VA 3LD8B 3BZFB 4FTVD 3U0PB 4PP1D 4O9HL 2FO1A 1AD9A 1ZT1B 1MHPH 4C57C 3IDMA 4F15C 5DHYA 3D87B 4Z8FH 3LN4A 5CZKA 3OX8B 5J6GA 2XTLA 3ARDA 3CFJA 2ZSWA 3L5WB 4FZEL 5DMKA 3TJEH 3MLTA 2B0SL 4RX4A 1F6AB 2GJ6B 4NQXA 4NCC2 4NRYB 3S4SG 4EKXA 4OTXL 1CE6A 3IYLW 1TCMA 1YEJL 4H8WC 5CBEA 1MFDL 3MACH 5I1IH 3EFDH 2NY4B 4PP2B 3UYRH 4KH2A 2DKUA 1CVSC 1CXIA 2IBZY 3UJIL 2CLRB 4HAGA 1NANI 4OLWH 1D9KA 2R9HD 1T0MA 3O8XA 3RGVD 3QJHA 3FQNA 1SVCP 5CFHA 3Q48A 3LKNB 4G6JL 3QT2A 4CMMA 3ZTJH 2Y07L 1YDPB 5TE7H 4OLVH 1KTLA 4ETQA 2XNAB 4GUPB 3TM6A 1VA9A 2VDKH 1U8IB 4G5ZH 1DCLA 2IQAB 3OKDB 2IEPA 3FFCB 2EDFA 5GISL 5CEYB 5EU6D 4J3VA 3PGDA 1FYTA 1R3LA 1DZBA 2B2XL 4NQVA 5E2UH 2R0ZL 3BGFC 3ZL4L 4M6ML 1IEAA 1Y6NR 1RSFA 2HWZH 2P5EB 1EA9C 5C9JA 4R97B 4HWZB 3FOMA 4QRQB 1UXWA 1EAPB 3DI2B 3MRCB 5ADPL 3FFCE 2AXHA 4Y5VC 2AXJA 3V6ZB 1VHPA 5FHBH 1U36A 4QNPF 1MFBH 2OI9C 3D1MC 3ARTA 2F54E 3UBXG 2XPGB 3W82A 4WU5A 3O3EA 4X98A 3QPXL 1HCVA 4KDTA 4I3RL 1LP9F 4QNPE 1RZIB 4X9IA 4IHOA 2F8OA 4UILH 1INQB 1X4ZA 1LILA 4LNRB 5HDLA 1JPST 4M7KH 4K2UH 5KTEH 1LP9E 5MEPB 1VFAB 1PGRB 3HRPA 2VITA 4PJIA 1E4KC 4BH8A 5DJDB 4ZFOL 3TNMB 5KVGH 3U4AA 1A1NA 3R1GL 4WUUA 3WFHB 4BM7A 1NAMA 2BVOB 1AP2B 1C12A 1NMAH 2W38A 3TYFA 3I75A 2X89A 5GS3A 5T3XD 4ELMA 1MJUL 3VXOA 2BVUA 3OPZL 1U3YA 3OKKB 3QIBC 1GGUA 4N0UA 1SJHA 2JB5H 2GTWB 5FCSH 1E6OL 2PTTA 3SE4C 3LEYL 1CG9B 1WWAX 4WW2C 5T5NG 4YZFF 1HI6A 3KXFD 2W65B 4PJEA 3MLYH 4L3CB 5F1IA 2DWDB 5IROC 1MFCL 1SEQH 5T1MA 3AREA 3GSOB 3F7QA 4UUJA 4X7FC 4NWUH 5J56B 1S3KH 4X7EC 4YZFE 4MVBC 5KSAA 1F5WA 5EOCJ 4CADB 1C08A 3MLSH 3WN5B 3HRZB 5HHVL 1SEBB 3I2CL 4FTVA 4MGXA 3OG4B 3TPUB 3QRGH 3UYOD 4PD4J 5C0EB 3K81A 2DKMA 3ZHKA 1N5AA 1WFOA 3QIBD 2PUQT 4KY1H 2NY6D 3E2HC 3WSQH 1JIBA 4NRXB 2O5YL 2HFFA 3HA0A 4NQEB 5EZLB 2CDEB 2FEDC 2I9LA 3DBXB 3FZUC 3KPQA 2G60L 4V2CB 1N0XL 2IC2A 3E0GA 3MLWH 2Q8AL 3G6AA 3QUML 3LS5H 3ULUF 2BNRD 3H9HA 4F9PA 4UT6L 2BK8A 4MVBD 4YHYC 4X4ME 4PG2C 4EI6A 2R0WL 4M62H 3RGVA 3W11C 1FNEB 4N0CC 1QA9A 1HILA 1RZKH 3ARQA 3IDJA 4QEGA 1BECA 5F7NC 5DJ0A 4JRYD 2GHWB 1QVOA 3DX6B 3G5YA 3OKLA 4RMSA 4LDEB 1FIGH 3RVWC 1P7QB 4JLRB 2VLMD 4UIKL 3I6GA 4DOHB 5FGRA 4G42B 3M45A 5EU6A 1WFNA 1GGCL 5DHVB 1K5NA 2A6IA 2FEDD 3LD8C 1T4KA 3FN9A 3FZUD 4JGJA 2KH2B 1WUNT 2DQEL 3RIAK 4XNYH 3I02A 5HTSA 2DQGL 3QG7H 3RL1B 5I8OL 4K7PY 1XF5B 3OJDA 4M43L 2FWOA 3F65A 1UB6B 1DBMH 1CL7H 5ID0A 2P7TB 3GSVB 5IB1B 4HWBH 2JJUA 4HIHB 3T0VA 1NUDA 1UEMA 4L8DA 4HUWB 4JREB 1T89C 3W11D 1J1OL 4N0CD 4ZTPL 3T8XA 3MFFA 4ODBD 2XXCB 12E8L 4EIZC 1W0WA 4P5MA 3L1OH 2NY4C 4GT7A 1U95B 3RVWD 1W72B 1A7QL 4YQXL 1NFIA 5D7IA 5H94B 4HC1A 4MDJA 1QLRA 3P4NA 4L5FH 1DL7L 4UNUA 1U8HA 2NY3B 3GIZL 2YZ8A 1LE5B 1YYMH 4XCEA 3HFMH 4TRPL 3I6KB 3NAAL 2CO7B 1TLKA 1IAOB 3QFDB 1WISA 1I85C 1P7KA 3JWNC 5KW9L 1GZQA 4K55A 4ZNCD 4Y5VA 1T0NB 5K9OB 3T4YB 3QQ3A 3KDMB 1AGBB 4P59L 2J5LC 1IILE 2WWKT 1YN7A 1HSBA 3IJSB 2NY4D 5E6ID 4DCQA 1CGSH 1L7TH 5JHLL 1T20A 2MMXA 3CVIL 1T5XA 3CFKB 1YEGL 1JV5B 2JJTC 3ZT7A 4M48L 3SE9L 1UH4A 5GS2H 5IESL 4GAGL 3FB5A 5FCUL 5HYQA 1I7RA 2GTZB 1LEIA 2VUOA 4X6DA 3C5JB 5GGSB 4XBEH 3KXFA 3S9DB 1XZ0A 1J5OH 1CCZA 1VDGA 3QDAA 1E4KA 1CS6A 2WBKA 3L3IB 4HS6B 4KK6C 2DIBA 2N7AA 2BNUB 3UTTE 2Q76A 3LEVL 3FFCD 3EYFA 4Y5YB 1A9BA 3B9KB 4KZDL 1KXQE 3RWGB 4POYA 4LLUA 4P9HH 3BRDA 4Y2DB 1JN6B 3FQWB 3S98A 3U9PH 1G6RH 2F54D 4JKMA 3QHZL 1V3KA 5IW1A 2AI0L 2VLLB 3MFGB 5MI0B 2Q7NA 3CGTA 4NQCE 3QIBA 1BMGA 1TCRA 4EDXA 4M5YH 2CD0A 5FO7B 3D39B 3SE4A 2NXZC 4WW2A 5ERWA 2CRMA 5J06A 2BFVL 1H5BB 1PD6A 1H3PL 4M61A 4OD3H 2QQQA 4D8PB 1F58H 5IROA 2DQDH 2R2BA 4H1LA 4KK6D 1YNLH 1YMHB 1ZGLM 3QNYA 2BNRA 2K3TA 3KR3H 3B43A 4H0IA 4M6NL 1IQDB 2LVCA 4OV5A 5CGMA 3ESUF 3ZDZF 4NUGH 3FQTB 1AGEB 2QR0A 3IXAA 2Q87A 4K9EC 5J9PA 2J1KA 1CFNB 1NL0L 1ZHNA 4K3DL 4JRYA 4BZ1H 5ALCL 5F3BA 2VUYA 3ZDZE 3U0TB 4YHLH 1EZVY 4X80L 1JPSL 4RGMC 1U91A 4P23B 5EIIB 1OSPH 1G7PB 5KG9B 4U1IA 4QTIH 2NXZD 4Z18A 3QUKB 4QWWD 3HC4L 4WU7B 1OQOA 3WN5C 3F7YA 1JK8B 2B5IB 1U8MB 4I5BB 3FMGL 3GJFB 1A3QA 5DQDH 1TETL 5BQ7A 5KS9F 1FDLL 3CVHB 3AUVA 1X5HA 4CVZA 5CD5C 3LQMA 4JVUA 4PG2A 1LO2L 4YDLC 1A1OB 5DJ6A 3S37X 2LABA 5FOBB 4A2MA 4I2XB 3ULUC 1HEZA 1RZ7H 3E6FA 5KS9E 1I1YA 1AGDA 5HHPB 2IH1B 1SYSA 3S36L 5IM7A 5KVFH 2C1OA 1OTTC 2NMSA 2DL9A 1JHKH 5IMOB 3X3FL 1Z5LA 3QG6A 5D2NB 3WKML 1A6AB 4X6EB 4I2XE 4RA3A 3OGCA 3BZFA 1KNOB 2EKSB 5J8OA 5DFTA 4LLWB 4KKNA 2ZUSA 4TSBL 4OGXH 1A4JA 2XIDA 2W9EH 1CN4A 4Y0GA 4RBPK 4EOWH 5CD5D 3OX8A 3IVKB 4MLSA 2VXUH 1JI2A 1FORH 2FSEA 4I18A 4QXUL 1C1EH 1NSNL 1T89A 3QEQB 2H26B 4KI1A 3BEWB 4RMQA 4ZO6A 5E1AA 1K3ZA 1CIUA 4XC1L 1X5LA 5E6IA 1NAMH 5JOPE 4M1GL 3D0LB 4X6BA 1JHLL 3T1WA 1DN0A 1OTTD 3EYSH 1D6VL 2EC9T 2NY1B 4MJ6A 2DAVA 4Z7NF 3MODH 3BGMB 2XN9B 3LKNA 1MCOL 4P0DA 3QEQE 3HN3A 2LV4A 3FT2B 5I1KH 4Z7NE 5FM5M 4N8CL 1U8IA 5DEZA 5T1LD 1IC4H 2R23B 4ZTOH 5GSVA 2IQAA 2HKFL 1P7QD 4R90H 3NN8B 1I85A 2AK1H 2FH6A 4NM4L 4U3CA 3GMQB 5E6YA 2NY3C 4NJAH 1A6UL 4HUKB 5M7QA 1I8LC 2F54A 2XN9E 2RBLA 3G04A 4MZ3A 3U83A 3RIFK 3Q0HA 1AE6L 4O9HH 5T3ZL 1EAPA 4P5KB 4JDVA 5HDQL 1EEZA 5I1JH 3MLUL 1FNSL 3C6SA 5L2JA 1LP9A 3FQXB 4B53A 4TVPE 2VLKE 4FZEH 4PGCB 2B0SH 3VXPB 2D7TL 3U6RB 4JM4L 4XHJC 1NCUA 4OTXH 4P46C 4ZYKA 5DGRA 5BO1L 2FHFA 1MFDH 2C4FT 3EKCA 1INQA 2NY3D 4LNRA 5LVEA 2CSPA 1XCTB 1F3DH 2OTWB 4BA8A 1T66C 1FZKB 4X9BA 1E4JA 4TOYL 4NO2A 1TITA 5JW3L 1BF2A 2Y07H 2VXQH 1WTLA 1UENA 3SPVB 3TNMA 5DD0H 2HJFB 3ARBB 4Y5YC 3U7WL 3VFSA 5C71A 3FTGA 4WGVB 1ZLSL 3MRRB 4U0RB 2AJSL 2IWGA 5C07B 5GISH 2PYEB 1RD6A 4YBQC 5F7DA 4MNGB 1M7XA 3NFNB 1BQHG 4JFDB 3ZL4H 3UTTD 3JUZA 3MXVH 5E8OB 4P46D 1FLRL 1WAAA 4GKSB 4ZUWA 5GGVY 3OKKA 4IS6B 2GY7B 1ORSA 2W9DL 5ID1A 1R24A 2Y6SC 3HUJB 5HDBF 3BZ4B 4G43B 5C07E 5ADPH 3GMRA 1UQSA 5DUMH 2ZOKB 2O93L 2QSVA 4NQCD 3CC5B 4Z78A 4YX2L 3SCMA 4YPJA 2MQ3A 5HDBE 3UJTL 3LV3A 4G6FD 5IIEB 5ICXB 5DWUL 4I3RH 5DVNA 1SEBA 5CJBA 5GGUB 3HLAB 3UC0L 3QHFL 4HUMB 3EDEA 4YBQD 3EFFA 3QDJE 1UM4L 5C0EA 3SGDH 4RNRB 4AH2B 1T1ZB 2VC2L 4PTTB 3RNQA 4X4MA 3E6HB 1Q9KB 4W70A 1J8HB 4KUZL 2GUOA 4NRXA 2Y6SD 1A7NL 2I9TB 2Q6WB 2E7LC 4EUPB 3R1GH 1I3VA 2B5IC 5I1DB 3DV4A 1T1XB 3C5ZB 2ZUYA 35C8L 3KGRA 1LK2B 3VCLB 4H5SB 4JO1L 1RFDL 3MSPA 1UH2A 4M8QA 1EUUA 4J3SA 3RUGB 2NQCA 2D9QB 1CGYA 2DWEB 4Y1AE 5I9QB 1J8HE 1ZHKB 3BMVA 4PTUA 3OPZH 5C0GB 3BVNB 1FNEA 2FZ3B 2F8XC 4L3EB 1E6OH 2KBGA 4H25B 2JIXD 3RUGF 3CUPB 4JGMA 1GOHA 2BMKA 4G8IB 5T1LA 2YOCA 5I0ZA 5L6YL 1P7QA 2LU7A 4QTHB 3RUGE 4KXZH 2MKWA 2CGRL 2Z4QB 2Z8VC 3RY6C 5DHVA 3B2VL 1NGYB 2D03H 1AIFA 4GG8B 3MRKB 3RWEA 3RL1A 5HHVH 1CXKA 4U0QB 5I2IB 3I2CH 1M6OB 4LK4A 4HUXB 4IOSD 4OZIB 3C8DA 5DK3A 4WDIB 1J0HA 4JZJC 5DC9B 1CDJA 3OR6B 2WUCL 4I0PB 1M71B 1K4CA 1WK0A 4HXAH 5E99H 1ACYL 4LF3B 2O5YH 5FUZH 1UT9A 4MA3B 3IRPX 2G60H 1N0XH 1U95A 1W0YT 2NY1C 3KYOA 1SMOA 4QHKI 5ENWA 5IB3B 5EORH 3QUMH 4KVNL 5ADOL 4H1LH 1R5WB 2C3WA 4OUUA 1WZ1L 1I8LA 1CDHA 2R0WH 4XZUB 2GSGB 1QFWI 5JOPD 4F9LC 5TF0A 1GRWA 1D5XA 1U8QA 4Y16C 1MAML 1SBSL 3K4AA 1IAOA 5JW5B 4IOFD 3OXSB 3S97C 4OFVA 5DC0A 3GSNB 4UIKH 5IG7B 3QEQD 4PR5B 2V2WB 2V6HA 4JPWL 3WJJA 1KLUA 3JBG7 3IJSA 3U30C 3UTTA 2DQEH 1HSAB 4EQ2A 4P46A 4U6TA 1MJJB 2IGFL 2NY1D 2DQGH 1U92B 3PWVB 5I8OH 3G9VA 4KAQL 3K7UA 4M43H 1KN4L 2XN9D 1ONQA 3VFWA 4AM0B 5GGSA 1XH3B 4ZTPH 4OZGB 1RVFH 2VIRB 4NQCA 4HS6A 4FQJL 2C3VB 4Y16D 12E8H 2EXYC 4Y5YA 3KPSB 4X4YB 3RWGA 4L8BB 5DRNA 2IALB 1A7QH 2A1WL 2EE3A 4TVPD 2VLKD 1Q0YL 3TIDA 1DL7H 4YDVB 2DLIA 3WD5L 1A8JH 3B83A 2OBGA 2HTLC 4TRPH 5AEAA 4MLIA 4OKVB 1P6AB 5EUKA 4LCYA 4U0RC 1NEUA 2JLLA 5F9WB 4PJFB 3UO1H 5KW9H 1IC1A 4YJZL 2ICES 1PYWB 2VAJA 1MHEB 4TYUA 3K0WA 4QRRE 2H3NB 4RWYL 4HZAA 4JFZL 4P59H 1YMHA 3EOYG 3BQUC 4ZQKB 5H8DA 3VRJB 4EQ3A 1KIPA 2AABL 2YWZA 2X4NA 2EXYD 4ZUUB 5HPMB 1IQDA 3IDGA 5JHLH 4GQ9L 1IGJA 4BK5A 3CVIH 3P9MB 3VXUB 3BE1L 1YEGH 1I7TA 4L9LB 3LAFA 2HJKB 3IU3B 4M48H 4A6YL 2VDOL 3UTSE 5IVXB 4QYOB 5IESH 3RBSA 4GAGH 2JIXA 5HGDB 1G6VK 5GPRA 5FCUH 1AXSB 2AP2A