1I9JL

Testosterone complex structure of the recombinant monoclonal wild type anti-testosterone fab fragment
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
219
structure length
219
Chain Sequence
b'DVVVTQTPLSLPVSLGDQASISCRSSQSIVHSNGNSYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RECOMBINANT MONOCLONAL ANTI-TESTOSTERONE FAB FRAGMENT LIGHT
molecule tags Immune system
source organism Mus musculus
publication title Structural insights into steroid hormone binding: the crystal structure of a recombinant anti-testosterone Fab fragment in free and testosterone-bound forms.
pubmed doi rcsb
total genus 50
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2001-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1i9jL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1i9jL01
5IOPA 1A9BA 5GS0L 4UDTA 4UNUA 1W8OA 1EHAA 4L8DB 3PNWA 4LSVL 1F4AA 2HT2C 2Y36L 1N4XH 12E8H 2H3NB 1ZHLB 3LQAC 3V4UL 4HSQA 5KW9H 2YD4A 2EKSB 2HRPH 3F12A 2VLKB 4GSDL 3S34H 1YEFH 3MTRA 3VFNA 3D6GA 4PJ8C 5CSBA 5D7LE 2Y25A 1WBXB 1K9TA 4OM1H 1XGQB 2AJ3B 4FQ1L 1DQLL 1G9ML 1MI5A 1C7TA 2APVA 4HWNA 3ZE1F 5ESVB 2HJKA 2A73A 4OZHF 2J8HA 4XMKH 1OCWH 5D1QA 2YRLA 3MUY1 3H9ZA 1UWGH 4QXTA 3ZT6A 2W9EH 4H88L 4C56D 3WYRA 2FDBP 1RZKH 4LSPL 3L3OA 3CFJB 3PHOB 3W11D 1UWXH 3DMMA 4K07A 3TZVC 1NC2D 3RY6C 4UTAH 5I1GL 1IC7L 2NMSA 1RAMA 4JFEE 4U6TA 2APBA 3KG5A 2Q6WB 4I2XE 3UROR 3TESA 4JQIH 1JHTB 1YEHH 1UXWB 3MRQA 2W9LA 3UJTL 3WN5C 2YA2A 4KPHH 4JFOB 1FIEA 3ZHLA 1SMOA 4M43H 1MJUH 3ARBD 5FGRA 3MRIB 3RNQA 1MPAL 5JW4R 4FQIL 3BDBA 4EQ2A 3BRFA 5F1IB 5HVFB 2ENSA 4PJIE 3W0WB 2BCKB 1A3RL 3RWJA 2HMIC 4M62H 4PJ9B 4QCIA 3GSRA 3MRKB 4GRWF 1YNLL 2IH3A 2BVQA 4M1GH 3RWHB 1T2QH 5CJQL 1U8LA 4OZFA 5FYKE 2UZYB 3T09A 1U92A 4P23D 1XF3B 1HXYB 4MCYA 5D6DA 4ZUSB 1GPOH 4PB9H 4YBHA 1VADA 3BPNB 4WFFD 4DGIH 3TN0C 1ZV5A 3R06A 1J1XL 1A7NH 4KDTA 3L5XH 3C60D 1ITBB 1VPOL 1AO7E 3LCYA 4OGXH 5DYOB 3V5DA 1IZKA 1LO3H 3GBMH 4TYUA 1PX4A 4LKCB 4UTBH 1BOYA 1JNJA 1NFIB 1KEGH 4PBVC 1YPZA 4CU6A 3D85B 4WTXA 1MCLA 2MHAA 3SGKA 5H37H 6CGTA 1A5FH 3L7EA 5CILL 3PIQA 3U4AA 2WMPA 1MHEB 1S3KL 1T83A 4XXCA 4QRUA 1GGUA 3ZKNC 2HN7A 4Q9QH 4GMSH 4XNZB 3FFCE 5I76B 4XP5L 3LDBB 5KSAB 2X44D 5D2NE 1RZFL 3FKUS 5ITBH 4MJ6A 5L2JA 2Z92B 3BX7C 3VA2C 5F7NC 4U2ZA 4G6JL 2Q8AL 4K71C 3SO3B 2FGWL 1OPGL 3TIDB 2FNBA 4NKIL 4F7PA 2AQ3A 5JW4M 4AEIL 4JM2B 1BOGA 1AFVL 5TDPA 3SY0A 3X3FH 4YBLC 4DFIA 4LPWA 3QWRD 2XZAL 4JO1H 4PV8B 4EEEA 1JGVH 4NHCH 1RUMH 3FB6B 3HNSH 3FRUB 5C0FB 2ZUXA 2XZCH 1RIVL 2NLJB 4ONFH 3MQIA 3EJYC 2ORBH 4JKPH 2HAZA 4KK5C 4LSUH 1KCUH 5B39A 4LSTH 5IIEB 4X6DB 5FHBH 4HS6B 4ZNEE 1LO2H 4ZAKA 2I5YH 4Q97A 1E4XL 2BC4A 3NMEA 5JW5A 4P99A 5EOTB 4MD0A 5EBMB 5JORA 2WBKA 3F7VA 1CL7L 4GKSA 1ED3A 1QP1A 5IVOA 3VFWA 2EC9T 1BFVH 2VMFA 4TTDD 1J9CT 2ATKA 4ZUTB 1CDBA 4LFHD 4QF1A 5HTSA 1OB1B 3MJ9H 4RAUA 3SDDB 3BP7A 5E2VH 4ENEC 3HG1E 3MYJB 5D7JB 1A6UH 4JRXE 2SEBA 2A77L 1CR9L 4PJFA 2PR4L 3BMWA 2AJYH 4OJFL 1KB5A 1A7OL 4I4WA 4N0YH 1G9NL 1D5BB 2QHRL 2ZG2A 3EOTL 3QUYD 1QRNB 3CXHJ 4PJCB 4XVUD 2CSPA 1I1AC 2VDKH 1IKNA 2WQRA 3UYRL 3T04D 2BRQA 1T5XB 2W07A 3CFKB 2YPVH 3G5VB 1AO7B 3T0WA 1PG7L 3RKDC 5KVGL 1KIPA 4C55A 3QEHB 4WI7A 3QXDB 4OGAD 4NDMB 3VRLE 2GFBB 3I02A 1TQCC 3I6GA 4ODVH 3Q3GB 3R0NA 4L4VE 2DWDB 5E5MB 1EHXA 4XP9L 1FN4B 4I3SH 1N7ML 4QHKJ 4EDWH 4FABH 1R5IA 2VQ1A 4ORZC 2ICEA 4S0TD 5DJZA 1LE5A 4TVPD 2VABA 1UCBL 1MWAB 4Y19B 1U95B 5KVFL 1IC4H 4NQCB 3RZWA 3AS0A 1NSNL 1FO0B 3INUL 3QDAA 5BZDA 2HT3D 4WV1C 2PO6A 4PRHB 3T4YA 2OI9C 1A6ZB 3D85A 3ULUH 4GAYA 3QDMA 1TPXB 4RMVA 1ETZB 3SDDC 4JHZA 2ZOLB 3D18A 4LSSH 5ILTH 3U0WL 2ZUTA 5T33H 3UJTH 5EZIL 1FH5L 1CFTA 3THMH 5CLWA 4HW6A 1JL8A 1VADB 4PRPE 4PGBB 3CDYA 2QQLH 1YQ2A 5HYEA 1XF1A 4IRZL 5I1HH 3BEVB 3TT1L 5HDQL 1ZWIA 1DEEB 2BNRD 1N6VA 2FD6H 5I15H 5JOFA 1LMKA 1MFBH 3QBTB 3MLUH 3TBVA 4JAMA 1FSKC 2K7PA 4UMGA 5T5FL 3TJEH 3E1F1 4LASH 3UTQB 3ZDXE 1MH5A 2C4FT 4B5EA 3C2AH 1Y18A 2HTLD 4KJPD 5BV7C 3VXME 2X1PA 4PJHE 1X5IA 3D0LB 3AAZA 1MLBA 4HMEA 1YJDH 3T0DA 5FUZL 1FLRL 3TVMC 1K85A 1A7NL 1IAKA 1PKQE 1KENH 4LCCA 4WI5A 2PYEB 4LF3B 2A9NL 4FTVA 3W0WA 3TGXA 4M61A 2LTQB 1R5WB 3EOAA 1L6ZA 1OTTC 4IRJC 5GS0C 3BEWA 3U1SL 4GT7A 5GGSA 1T04B 1F97A 3V9FA 5I19H 1XIWB 4I77L 1KPVA 1NDMA 3VXSE 1MRDL 5EZJB 2V2XB 4XPHH 4KVNL 1MCPL 1UJ3B 4KROC 5GRJH 4LPXA 2VN7A 5KSUB 4RFEA 3OXSA 2F54E 3VXUE 4WO4B 5DVKA 3IAGC 4IDLA 4ZS7L 4OI8A 3NPZB 3PE9A 2Z93A 1A7RH 4WEBL 5IF0B 2WM0A 3PV6B 1WGOA 4RNRB 3BXNB 3L7EB 2FH6A 5D7IE 2XWJA 1XGTB 4WI4A 2OLDA 4ERSL 2BNQB 2MTPA 2OM5A 3MRJB 5D1XD 4GQ9H 2WIMA 3N85L 4F33A 5ABDE 4JHAL 2FIKA 1FYTE 3MLTB 2EC9U 3I9GL 4MZ3A 2MQ0A 3LMJH 2DF3A 3HNSL 1I7ZB 1FO0L 3F7YA 4DKFL 5A2FA 2CDFA 4UU9B 3AXLA 2HLFC 3MLYL 5EC2A 3T4AA 3U7WH 3RX5A 4WY7L 5DA0B 4S10A 1BIHA 5EZLB 1EEYB 2UWEB 1F4WL 3RGVA 3ARXA 4WENB 5INCA 2OJEA 3FO1B 1NAMB 3IGAA 4XP6L 5DVOA 4AM0B 2EXYD 4YPGB 1JV5B 3IKKA 5CAYB 3KWWA 1XR8A 4PJ5B 4Z18A 2XA3A 3CMOL 1RZKC 4UIMA 3HUJA 2AJZA 5JOPE 3UBXA 1C1EH 4YNYA 2XN9E 3QIUA 5T3ZH 4PJ7F 3RTQA 1ZLSL 4LLMA 4AG4H 4RIRB 5IGXH 3ZKXC 4AH2A 1KJ2A 4AENB 4OJFH 5F1OB 3LEXA 1A7OH 1EZVX 3ZKQD 2EDRA 1I1FA 2YPLD 3OAUH 1TJGH 3I6LD 4OLWL 1EBPA 4BYHA 1JNNL 4MA1B 4U6HA 5FYLD 1J5OL 1JWMB 5HGBB 4TSCL 3R8BB 2G9HA 2DWEB 5FECA 1U8NB 3Q2CA 3ARBA 3LH2H 1QFWI 3CFBB 2BDNH 1PZ5B 4XNUH 4RMUA 1Q94B 3FL7A 4TSAL 5CD3B 1MRCH 5IBTL 3O11A 4XCCH 4X8XA 4LKXB 5KN5B 3T3ME 5IESH 1Z9OA 2VZUA 2NTFB 1DP0A 3CSYA 1NLBH 3PG2A 3WKML 5JHDB 2DIBA 4IRSA 4I0PD 2C3VB 3T08A 1JBJA 1FV1B 4JZJA 2Z8SA 3FFCA 1AD0A 3MV9B 4Z78A 4U1NA 3LAFA 5CIPB 4R4NC 1WBZB 3F7RA 2LAGB 5B38A 4L8CB 2CUHA 3CFIC 1ORSA 1CVRA 4U0RC 1TQCB 1INEL 1IGTB 3X3GL 4NO0D 2NY4B 2OJEB 1MREH 2J5LB 4IIQA 5JHDE 2I07B 5F9JA 1ZTXH 1A14L 4IJ3C 4KRPB 4WFGD 4F58L 1FH5H 1PYWA 3TPUB 3L3DB 1UJ3A 2V2WB 5B3JF 3HI1A 5IB5B 3IDGA 4GRLB 4X6CA 5C0RL 5DMYA 4NRYA 1MCFA 1R5VB 3VFPA 1YEKL 4MA3B 1D9KA 2R69L 1OQXA 5DHVA 4H5SB 4NQEB 3AY4A 2IPTL 1W72H 3IDUA 5IB2B 1RJZB 5T3XE 5EU3A 4PJDF 1BFSA 1LP9E 4KHTL 4HG4J 1ND0B 1ZSDA 4A2MA 4XNQA 1MCSA 3QUXD 3FONB 5JQ6L 1HSBB 4CKVX 1U42A 3VGDA 1CGSL 1N0XL 4TOYL 4F80A 1OSPL 2VDNH 1GL4B 3E2HB 1HOCB 3O4OB 3S98A 2OTPA 2YRPA 4Y5YC 3CAFA 2ZCKH 3A6CH 3ULUL 3B2VH 3VFTB 4AM0A 2PTTB 1K4DB 5D8JH 4MA7L 5F7DB 3EYUH 3JVGA 3WHXB 1CGXA 4WFED 4E5XB 1YMHB 4ZFZA 5HDBF 1A6TA 2QKIA 1U8OA 2H2PC 2J2ZA 4XAKE 4H26A 5B38G 5IVXE 4RIRA 4YDJA 5LGHL 5I1LA 5E9DD 2X4OB 1JPST 1J05B 4D8PB 4GLRH 5EUOB 3BHBB 4G6MH 4JEGB 3I02B 3EOAB 1YY9D 4Z7UB 5EH1A 3DSFL 2XOTA 3KYKL 3O2DH 3BKML 4IIQB 3C5SB 3KYNA 2EYRA 4H1LB 4ERSH 4CBPA 2J8UE 4L1HA 1ZHKA 3HC0A 4DVRH 1UZ6E 4QRRB 1MHCB 5H94A 2G5BB 1WFUA 1QFWH 1SJVA 1FLRH 3VFMB 3SKJL 4GG6A 1YPZF 3ZLQC 1EGJA 5J12C 1KN4H 4GRMA 4UQ3A 3RI5K 1ACYL 3IFOB 3C6LC 3FO9A 4IMLA 5JIHA 4KMQA 2WINB 4PTTB 2R2CA 1MFEL 1CE6B 1Z9MA 2A9MH 3CC5B 3MNVA 2VLMD 3R8QA 5HVHC 2EO9A 1EEZA 2IPKB 1AO7A 1WAAA 2NX5D 4PD4K 1LD9B 1VFAB 1UACL 3EFDH 3VXQA 5F7KC 2R8SH 2DYPB 4OLUL 1KLUA 5HGDA 2OXHA 2CMRH 1NEZB 1V5JA 1KOAA 4W6WB 4XC1H 2WSKA 3EJZD 1GH7A 4HS3B 4JZOA 3LPFA 4KKAC 4MCZA 1QLRB 3QUZC 1T04A 2XN9D 4PGDB 1JRHL 4GQ9L 3WLWD 1NGZB 4OD2A 1LEGB 3PHQA 3LRSB 3I3BA 1AQDB 5C8JB 4Y5XB 4Y19A 1ZXQA 4MNGB 5CP7A 2R0KH 1P2CB 1WWWX 2XG5A 5DVLA 4JVPA 3D39B 3BQUB 4WUUB 4Y4KA 3BPNC 4O58L 3J8F7 4U6VL 3N1MC 1P6AB 2AJSL 1UWXK 3X13B 5JLZA 3RQ3A 1MF2L 4I18C 4OZGB 1JPGB 2J6EA 3OKYA 4XWGL 1AKJB 2RB8A 3QCTH 4HIJA 2ZOLA 4YX2L 1TQBC 1TIUA 3BP5A 3T2PA 1NQBA 2V5TA 4M7KH 2BVPB 2DD8H 1Q9KB 2DQFA 1J1PH 1MHCA 3T0EC 1ORQA 3BYYA 4MQ7B 1U8NA 3FRUA 1JPSL 2E8ZA 1KCVL 2IH1B 2R0LL 3B6SB 5EU5B 1PD6A 4U7KA 4M03A 3KNBA 3SGDH 3H0TB 4Z7UE 1S9XA 4NQDD 3ULVC 4HXBL 5EUOA 2YRZA 4HCRL 5EOTA 3BO8B 5JORB 4OGYH 2WBJC 1JFQL 1JNNH 2Y36H 3HC3H 2HKHH 4JANA 3QZWG 4OD3H 1JGEA 3ARPA 3PXJA 3L3JB 4XPTH 1HXYA 1DQQA 5E9DA 1JN6A 5MENA 2W59A 4R26L 3WEXB 2HRPL 1WTGT 3MJ9A 2Z31B 3REWA 1EAPA 2GUOB 2J8UF 2Q86A 4O2FB 4GLRI 5C09A 3QIWB 1IAIH 1Z5LA 2ADIB 4DAGL 5I8KH 2IADA 1KBGL 5J11C 2Q7YB 2VITB 5DF0A 1LP9F 1S5HB 4LCIH 4XMKL 5K9KA 1OHQA 3NCFB 2BNUB 3P73B 5CBEA 1YY8B 5CEZL 5L9DH 5E7FA 5D7IA 2I9TA 4GRWE 4LOUC 4GMTL 2XTJC 1TVBA 1I9EA 3C6SA 5J89A 3NAAH 3QRGL 1P4IH 3JWOC 2NXZD 4ZG1A 4AIZA 1X5ZA 2CIIB 2XT1B 1OTSC 3PL6B 4POYA 3RWJB 1SM3L 1MAMH 4GAGH 3F7VB 4N0CD 3W39A 5JW3H 1A02N 4HS3A 4JZOB 3WCYA 5KVEH 3V4UH 3D2UD 4M02A 3H9HB 4PRIB 2YS4A 3JWDH 5CJXC 4PIRF 5FUCC 2P5WD 1CXKA 2V9QA 2VC2H 1EAJA 1A7PH 3FO2B 3CU1A 4TNVK 1WK0A 1YECL 3MRLA 1D9KD 1DCLA 5DD3L 1NGQH 3C6LB 1FJ1A 3SEPA 5ESQA 4Z7VA 1JPTH 4OV6F 3D5OF 3D18B 1JYXA 1ZT7A 3EYSH 4YHYB 1QVOA 1U3HC 3ULSA 1XEDA 4M7LL 1MAKA 1DVFC 3SCMC 1SEBA 4Q0XL 4MS8D 5J4MA 5LJYH 3G6DL 2ESVB 3ZTNL 1TVHB 1DBBH 3O6FD 3CDCA 4LLDB 3VFPB 3DTXA 3BMVA 1D5ZA 3BP6A 2X4OA 3G5YA 1CTNA 5FEBA 1MJ7H 1EJ6A 1WCBA 3PDDA 4J2XA 4LSDA 4C4KT 1TETL 1DUYA 2NCMA 5T1KD 3RZCD 5C0ND 2E6JA 3E3QC 5SWZA 2X5PA 1MFEH 3SGKC 3Q1SH 1ZGLA 1NGWA 1VGEH 3DX6A 3MZTA 4C59B 3VD7A 2P5EB 3BW9A 2M2DA 4HGWA 1FVCB 5ACMA 5ISZB 1Q9OA 1EEUA 1L4IA 1NKOA 2BSTB 1CFSB 1KCSH 5H2BA 5IMKA 1I7TA 1HEZA 3I6KA 3OF6D 5CHNA 4Y4KB 2C1OB 3HZVA 2WWMD 4G9FE 1FAIH 2Q6WA 5CCKL 4DN3H 4KZDL 2C4XA 4BH7B 1F11A 2JJTC 2XXMB 4TNWK 3CLFH 1JRHH 4AL8L 1Q1JH 5FF6A 1UKQA 4WW2A 5FYLL 3O2VH 5ECJE 3WEXA 2DQFB 4U1JB 5BO1L 3OGCB 1VEMA 2UZIH 3L5IA 5FHAL 5I73C 5D1ZC 3DYMA 5GS2D 4K7PY 2X4QA 4S2SA 1VPOH 4V2BA 2VZVA 4JPIB 2R56L 5HGDB 4LLAA 1IAII 5I75C 2DJUA 3EKCA 4GW4B 1EMTH 1WLHA 1N6QH 4WW2C 4PGZA 3JVGC 5IEHB 4YWGL 3GHEL 3WMSA 1N26A 3D69A 1KNOA 4KJWC 5C0CA 5IB4A 4LCUA 4YHML 4PJ9D 4NWUL 4X7TA 5H94B 3WIHH 4PG9A 4OB5H 1J11A 5CKAA 5CJXA 3CFKA 4AYFA 3EFDL 2W92A 3QUXC 1JPSH 2P24B 5B39B 3WDIA 5GGRB 2ZJSH 5CD5C 1CF8H 3KPPA 4O9HL 1J18A 2VRAA 1WIUA 1SJHB 2P8PB 1DL7H 3BZEB 3RWEA 5B8CC 1RK0B 3PJSA 4U1GB 4J3WA 1IEAB 1INQA 3P0VH 5HSFA 1BQLH 1DZBA 1GSMA 1P7QA 1SMAA 2EO1A 5GGUA 3B9AA 4MQXD 5L2JB 4LSTL 4YGVA 3UBXB 1H9VA 4XI5C 3O9WA 2VOTA 5CHNB 1U2CA 3RVTD 1IGIH 2I5YL 4HV8A 3EW3B 1T03H 1NMBL 2XPGB 4UNVA 3MREA 4FTVB 2BMKB 3IS1X 4N1EA 3K4AA 5DJ6B 1HNGA 2P5EE 4U1SA 3JV6B 4LCWB 4ZO7A 5IQ7H 4IDJL 2WW8A 2VIRB 1VDGA 4QHMA 1T6VN 5ALCL 1HN1A 2B39A 4HUVB 4FQ2H 1TVHA 2PYEE 5FGCB 2DMBA 3FT2B 3UC0H 1QR1A 1CICA 1PZ5A 4MHHI 4K3JL 1RMFL 3DVNB 5KSUA 4D9QE 2HT2D 2HTKC 4NZRH 1NCTA 4XZUA 3IXAA 5C92A 3CK0L 3MSPA 4QXGL 4G9FA 3HC3L 2NY4D 1CU4H 5ILTL 4BUHA 5IW1A 3CVHL 3F7QA 4HWEH 5GHWH 2YOCA 1I9RH 1FVCA 1FL5A 4M4PA 4TQEH 3RWIB 2VAAB 3BFOA 3UP1A 4XGZB 1E27B 5D6CA 3LN9A 1J8KA 4QTIH 1KELL 1OD7A 2W65B 25C8L 4FNLH 1XGUA 2YMXL 2IQAA 2EXWC 5F6IB 3EFFB 3QFJD 3L7FA 1JK8B 3KPOB 5CGYD 3MLXL 4JPKL 5EUKA 3VXUA 3WO3B 4LL9A 5T5FH 4G9FD 3ARED 3QQ3B 2YWZA 4JQXC 3L6FB 3S36L 4YXLH 3QFJE 1IBGH 4P2RE 4AMKL 3PL6D 3V8CA 4GS7B 3GHBL 3OGOE 1EFXB 5GGUB 1JMZA 1KNOB 4XMPL 4KJYB 3OKKA 4KRLB 2VTFA 2NY7L 4P0DA 5JDSB 3BJ91 4HGKC 3DPBA 2DJ4A 5H2BB 2Q87A 1K5NA 3OXSB 4O02H 5DC9B 32C2B 4U05A 3KJ4B 3MRLB 2X4NA 2OYPA 4H5SA 2C3WA 4U4BA 1CT8B 5C0CD 1DFBL 4PJFF 2PYFA 2V6HA 2DLFH 4K8RL 2XWJB 1EO5A 5F9DC 3GKZA 5J6HA 3WFCH 4P5KB 2E3VA 3U30B 4JPVL 1MJ8L 3H3PL 1TDQA 5INDB 4PY7A 3TO2B 3RUGE 2QQLL 2PYED 3OGCA 4GXUN 1G7MA 5E9DB 1MCOH 2EDDA 4LLDA 1SVCP 4NQDA 1IGTA 1J0JA 1NGQL 5J1AB 4OAWA 5KSVB 2NY2B 3ULVD 1OF2B 1IAIM 3BISA 4JCMA 5GS1C 3QDGB 5D70H 5K59E 4KH2A 3CLFL 3TN0B 1KB9J 1NGWB 3DX6B 4M5ZL 1MH5B 1Q1JL 3CDGA 4JHAH 4JPWH 4EDXB 3VXOA 2EDWA 4OLVH 3KWWB 1J8HE 5DJ2A 4C83B 5ISZA 2A6JA 3AROA 3VXSD 3SOBL 1YN7A 1IMHC 3RTQB 4U3HA 3WE6A 1CZ8L 1JE6A 1I3UA 4N9OB 2R4RH 3HMXA 5FA3A 4YO0B 4NCC2 3E2HC 3GMQB 3N9GL 2ZPKL 5DRZA 4UBDC 3W39B 4Y4HC 1F58H 3WIHL 5HGBA 2YXFA 4JRYD 1KTKE 3KS0J 3QCUL 5LQBH 5IQ9A 1IQWL 3CMOH 4I0PA 5CIPH 5D7LB 5ACZA 4J12A 4EBQH 1T0MA 3WS3B 4PR5A 1WZKA 3VCLB 5CEYA 4U6YA 5MEQB 2W91A 3B3IB 5GS1B 2IG2L 1NCCH 2R2BA 5LKNA 4G80A 3U4EB 5B3NA 5F3HB 4JM2F 1ED3B 2BNRE 5ESAB 3SDAA 3ETBF 3O2VL 4JY6A 1MY7A 4DVBA 1K3IA 2R29L 5TGBA 2G5RA 2APXA 4ODTH 4P59L 4RAVA 4RMSA 4YGAB 4CRPA 3VXMA 2B5IC 4R4BA 2AK4B 3ES6A 3B2UC 2ADJB 1OB1A 4KGLA 4OF6A 3T77B 4I2XB 3EYFA 4JZNB 5J06A 1S78D 3HPLA 1G9NC 3IVKA 1QRNE 2H6PA 4F9PC 5ANMB 3V5DB 1YEIL 1IT9H 3PWUA 2AEQL 4YZFF 1A1NA 1FLTX 2OSLA 4XPBL 5TE7L 2HLAB 4HUNB 3LRSA 3NBNA 4LDLB 1XF4A 3BW9B 5T5NG 5D7JD 2JJWA 3GSNB 2ICCA 1BLNA 1JGVL 2HN7B 1B2WL 1XR9A 3C5ZC 5J1SC 3VGFA 1KIPB 1LK2B 3QUYC 4A6YA 1X5FA 1BJ8A 5B4MC 4NZRL 1RIHH 4YHZL 1HWHB 4HC1L 5BJTA 1ADQL 2Z8RA 5FM5M 3ROLB 3GMPA 3L6FA 3AB0B 3RZCC 5E8EA 3VRIA 2D9QB 1I9RL 4TQEL 2XKSA 3WSQL 2W9DL 4ACPA 3VGGA 3NFPA 4P2YA 3QIUD 3T65B 3MRHB 1VKXA 4YHIA 2RIKA 3FFDA 4OCRL 1MRCL 3D39D 2D7QA 5IBTH 5TPWL 4GSDH 4L3AA 2YC1A 1YEFL 4ZD3H 1CXEA 3FOMA 3LRGA 1IZJA 2Y07H 2Q8BH 2CUIA 2J4WH 2JK5A 2WANA 3ARFA 4FFVD 1S7UB 3HR6A 3MA7A 1HINH 2PF6A 1UH4A 5DEGA 5IW1B 4PG2A 2HJFA 5GJTL 5C0BA 3WHXA 3E6HB 1CD1A 2YBRA 3HPJA 1X6NA 5FOBA 4WTZG 5INDA 5IMOA 3GEWB 2OJZL 3HE7B 4Y2OA 3MUGB 5D1ZD 4DGVL 5DQDL 1PEWA 2FX8H 2H41A 1UZ6F 1AY1H 3RDTD 1IC7H 3Q3GA 5ANMA 3BDYH 1HHGB 3SE4A 1FFOA 2F53E 4EI6B 3VFRA 1UG9A 5T3ZD 2A74B 5GS1A 1QRND 1U8PA 5C6TL 4OZIA 2RCSH 3LIZH 4GXVL 3SDXE 4JM2A 2Y9RT 5IHZA 1JHLH 1UWEH 1ZAGA 2AK4E 1JHTA 1IGFH 1JF6A 2P47B 4N0UE 4RGMC 4F2MA 3ABZA 5IHLB 5AYUH 4DVBB 4HPYL 2QBWA 4HIHA 4NQSB 5DMGD 2YWYA 3V5HA 3O4LA 4J4PD 4C56B 3AM8A 3UX9B 3H9YA 1YYLH 1YQVH 5FYJL 5I8CA 3QEHA 5L8LB 4IOIA 1G9MH 1G7QB 2IALB 5BRZD 5C0JB 3BAEH 5GSRA 3SGJC 4D2NA 1NAKL 4X9GA 3C8KA 4JZJC 5F72S 3KYKH 2ARJA 1IBGL 4AMKH 1DBMH 1GOGA 3FN0L 1CDJA 4Y5VA 4IEFB 4LIQL 2H9GB 2HA1A 3OZ9L 4X6CE 4F37F 3HE6A 1JNLH 3QIBA 4U1NB 3VG9B 4G6KL 3HCVA 3WS6C 4H0GA 5B38B 4IRJD 4NNPH 5GS0D 4M6OL 2DWDA 1HDMB 5L6YL 1NEZA 4YFLI 5HPOA 5E6ID 4NQTA 4XHQA 3HAEA 4EOWH 1SYVB 4NP4L 3QO1A 5EBLB 3S9DB 4R97B 5IROC 1XF2A 1NC2B 4Q9CA 4L4JA 2R0ZL 4FQLH 5D2LF 4ODUA 3U48A 3CDFA 5CEZD 3BQUC 4EUPG 1BEYL 3VXRD 2PW1B 2YPLA 4QRPD 3ES6B 5EU6E 1KC5L 4NRYB 2WK2A 5FO9A 2XQYK 3ORJA 1NEZG 5I1LB 4XP4H 3TV3L 5IROA 4YO0A 5E5MA 3O41B 3QWQB 3Q5TA 3PXHA 2Y5EA 4NQCE 2APWA 1I8IA 4EN3A 2QQQA 4DVRL 4K94C 2HLFD 4YHOH 1RUML 3KYOA 1HILA 1N64L 4NKDB 3VFSB 5SX5H 3QFDA 2JIXB 3GJFB 1UB5A 2BVEA 4Y88A 3SQOL 3WS3A 4XNXH 1QR4A 3CFJA 2FR4A 5TQ0H 1MCPH 3ARDB 4DZBB 5HHMB 3OAYH 5EO0B 1BVLB 3BKYH 4P23B 3SDXB 1FNAA 3EGSB 3RP1A 1U8KB 5AUMA 4ODXA 1CLZH 4N0UB 5I1JH 1EJOH 2PYFB 3AREC 1A4JB 1LO5A 1NBYA 3H42H 4H20H 1R0AH 1WJ3A 5BXFB 2D4FA 1IAMA 2XRAH 3OR6A 5FGBA 3QEQE 4GMSL 3RWCB 3U9PH 1HWGB 4JN2A 4MXWH 1BVKB 2YUXA 3AUVA 5EU4B 5F7EH 3DTXB 1BAFH 5JR1L 3K74B 3T4AB 3KR3H 3ULUD 3DBXA 3FO9B 2IG2H 2XKNA 5T1DH 4XAWL 1KJVA 2ED8A 2HP4A 4CDHA 1VSCA 1NCCL 2Z35B 3T0AA 3U7WL 4ZNCD 1B9ZA 4GG8B 4LARL 4CGTA 3TIEA 4D3CL 2JB5H 3HZMB 5DJAA 5D7LD 2CKBL 1UVQB 2V7NB 4CUCA 1U8LB 4OZFB 2Q7NA 2NX5A 4KI1A 1XR8B 4YZFE 3VD3A 5B8CA 1HIMH 1UYWL 4XWOD 4K7PL 2A6IB 43CAA 3O0RH 5JDSA 3P4NB 3RFZC 3DUUA 3O9WC 1OT1A 1T7ZA 2CLZA 4XNMB 1MOEA 2VLLB 1YMMD 3RA7H 5F7HA 4AK1A 4KV5F 2EH7H 2FLBT 5I2IB 5ICZB 1IGMH 3UTTB 3DV6A 4J3OC 1KJMB 5CJOL 1I85C 1IM3A 4HH8A 2DYPD 1T4KB 4YX2H 2A1WL 3UJIH 4PBXA 4P48A 4WGWB 2FJFA 3N1FC 1FL6A 2P8MB 1AGCB 3QNXB 1MI5D 4M6NH 4KDVA 1NAMA 3EJJX 5I74B 5JIKA 3DX8A 2YUVA 2ZSWA 4X99B 3QJHB 2FSEA 5DURB 4J8RB 3HUJB 1KCKA 3LH2L 4ETQA 2MCPH 3RPKA 2BDNL 2DQJH 3BDYL 1X6LA 4AQ1B 5JPNA 5FYKL 1KV3A 3TBVB 4UIKH 2CPCA 2VDKL 4MX7B 4X7TB 4JFFB 3IJHA 4RRPG 5ENWA 4XPTL 4DKAA 2AXFA 4KRPD 3ULSB 4FQXA 5J11B 1NJ9A 1QSFB 1DTUA 4WV1A 3MNZB 4HPYH 1AGFA 1NEUA 5JNYA 2FWOA 3HUJF 1EXUB 2I9LA 5DJDB 5C3TA 4DAGH 2YD9A 3ZMRA 4Y4FC 5GPRA 2GJ6B 1A9BB 3QYCA 4LRIA 3KPRA 3PJSB 2J4WL 1RVFL 2GT9B 1P1ZB 1BVLA 5C1MB 4X6EB 4XVSL 3WUZA 2ZUSA 4G9FB 2OL3B 4Y16C 3ALWA 2AJVL 5E6IB 3WIFA 3VFSA 2FZ3A 5I18H 5F9WC 5GQBA 3I85A 3GDBA 4KK8C 3ZTNH 1MWAA 1BVKA 4H8WC 4LVHB 4KFZC 4K23H 2HFEA 3BD5A 3EUUA 4N5EC 4BELD 4HIEB 2IALA 1S78C 2HFGH 4GAGL 3RUGF 1AD9B 1WC7B 2DKMA 3MRNA 4XCNA 1QRNA 2BSRB 3TEUA 2K3TA 2HWZL 4XC3L 5LCVH 1NLDL 3QISA 4U1GC 4UV4L 1RFDH 4OBRA 2CK2A 1T5WA 5D1XA 3MOBH 4GXUM 1I3GH 1I7ZA 4LP4A 4E9LA 4M9PA 1AJ7L 1W0VB 3NGBB 2JIXA 3ZT5A 3UTTE 2CK0H 2X4QB 4S2SB 4WUKL 3AREA 4GKZA 2LTQC 3ZDXF 1AP2A 2Y7QB 4FQHA 1LO4L 1YZZA 2X41A 3QIWA 1L7TL 2CQVA 2YD8A 5KN5A 4KC3B 1P4BH 2X9WA 3QI9C 2VXVH 2Z8VC 1J0KA 5IEHA 5DK0A 1B0GB 4X6CF 3RJDA 2DQCL 3IFPB 5DJ0A 1F4XH 3CCHB 5E8DH 5E00A 1XIWA 2X05A 4PB0L 4K3GA 3QDGE 5DJZB 3IJYA 5SWQA 1T2XA 2OR9L 5TE6L 3MRJA 4NQSA 3SE9L 2KDGA 1JYNA 3BH9A 1FVEB 5DI8A 3VXQB 3MLYH 1KCRH 1MWAL 1WT5A 1FVDA 3C8HA 5ADOL 1S7WA 4PP1D 2P5WB 3I6LE 1F4WH 4LCCB 3EYQD 3U36A 4Z7VB 1CIDA 1OP3K 3PWPA 1KUMA 2EDTA 4UDTB 3U9UA 4CW1B 1PY4A 1FZKB 4LHUD 3ARFC 3S4SA 4L29B 5M7QA 1MAJA 2B4CC 2R0ZH 4HIIB 3ELAT 4KUCF 3F7YB 5ENWB 1JV5A 2DM2A 1HK6A 3MX0A 4TVPE 2NX5E 1L7IL 2VR4A 1LHZA 2QADC 4I3GA 4HIHB 2H8PB 2NY3D 5FOJA 2E8YA 1MIML 2CO6B 4EUPB 3NA4A 1FAIL 1CFNB 4TVPH 3W9DB 4WIQA 3WLWC 4GBXB 1H8SA 3RDTC 4LEXL 4YXHL 3REVB 3DMMC 3TZVA 3OAUL 5KANI 3DXAB 1R3IL 3JTSA 3B4NA 4HH9A 3UTSB 1NBYB 2C1PA 1A4JA 4D3CH 3MXVH 5IG7B 4F3FA 1JZ5A 1WAAE 1UEYA 3C9NB 5A2LH 4GW1A 3ZDYF 3HS0B 1I8LA 2VE6B 3KPQB 4O51B 3TYGH 3LQAH 2BFVL 2HVJA 3BGFC 5KSBA 1RK1B 3BE1L 3T2OA 3MJ8B 3MODH 3OKNA 3UBXG 2WP3O 3Q6GL 4NKOA 4K7FA 4HLZG 2QQNL 4Y2DC 2D9CA 2E7MA 4PGEB 3O8XC 1CDCA 4P2RB 3STBA 5L7XH 1N6QL 3MCLL 1IC5L 1GGIH 1FCGA 4LAQH 4G7VL 5DURD 4QRSB 5D2LE 1EJOL 1M4KA 4S1RH 5L2KE 5A43C 2NNAA 3L3IA 5FA4A 4ZPVB 3OX8A 4LRIC 3T2NH 5C7XH 1KPVB 1NDMB 5ALBH 3MV8B 4X4XB 1GGBH 3WLBB 3LSOB 5K33A 2R39A 2ZJSL 1BAFL 2IWGA 3CSBA 3SKUD 1WISA 2X9YA 3VFGL 5HYQB 1T1YB 3FQWA 3U7AA 1E6JH 1NCUA 3JWDC 1INEH 3S37L 5ICYA 4W81A 1TCRB 3BZFA 1DQJB 5FYKH 4JRXB 4YXKL 4PJ9A 4RX4D 2WIIA 4PJGB 1BVZA 2AJSH 5CINL 3TBWB 4I18A 1BFOB 3OG4B 1G7IB 2BVQB 4Z7UF 4HEME 4BH8A 2EDKA 3RWDB 3SY0B 3RGVD 3AY4C 3QCTL 1C16A 4UDUB 1IQDA 1KIRB 5AD0A 1MVUB 1QEWB 1I1AB 5EC1A 3NH7H 4XCCL 1CICC 4QRRE 4POUB 3DO7B 4CVXB 2DS4A 2Y4SA 1XFPA 1XF5A 3QDJB 1K6QL 1NMBH 1JNHB 1I8MA 2NXYC 1UM4L 2VXSL 3F5WB 5DFTA 2A77H 1DQLH 2P7TB 3AMKA 4OFDA 4GAYB 4RZCB 3CZFB 4NQDE 4EN3D 4O2EB 4G8GE 4L4VB 4KWUA 4N5UA 1SY6H 2NXZC 4DW2H 4FXGB 1E4KA 2C3GA 1YEGH 3MOAH 1ZLUK 1Q9KA 3LB6C 4Q6IA 3ZT7A 5HVHB 1VACB 2O5YL 3MRGB 1LE9A 4FG6D 5EIVA 1KLUB 3E8UH 4NKQB 4OAWB 3D3VD 4TUOB 3LKQB 3BP5B 4NN6C 4P4KC 3HI5L 3H9SB 4MA7H 5MP6L 1IKFH 1QFOA 4P2QE 2OSLB 4HJ0C 3SHSA 4U1KA 1CDYA 4JRWA 4QRRA 5E4IA 5H8DA 3AGVA 3F7PC 2CR6A 4WUKH 3BH9B 3VI4E 2C3XA 1HQ4B 2Y6SD 4UQ3B 1I9IL 5C9JB 1FDLL 1V7NH 1KGCD 3SGJA 1YNKL 4LPUA 3RVUD 3IXTA 1FORL 1YNLH 2H45A 1J0ZA 3RPIB 4HWBL 4IRSC 3G08A 1FZOA 3PGCA 3KJ6L 2HKFH 1TJHH 2WUCL 2KUTA 3NIGE 1MCCA 1PDKA 1QSZA 1G7MB 4QF1B 4F57H 5ACZB 4LNRA 3JWDL 3NCYP 5DJDA 2VZTA 3L1OL 5I8OL 5CSZB 3ZYIA 1EV2E 1OAYL 3BHBA 1NUFA 4R2GC 3SDCC 1I8MB 5DK3A 4QHUB 1ORSB 2XI9A 4LVNC 3PWVA 1U9KA 5HHOB 2N4IA 3DYPA 4B41A 1B0GA 3JV0A 3EYUL 1CT8A 3ZDZF 3P30L 4P57B 3U4EA 5E95B 5DRWB 1V8HA 4HAFA 4PJ7E 3CSGA 1AR1D 1KPUA 3MROA 4LLYB 3V4PH 4BK4A 2AJXL 5E99H 3DJ9A 1YMHA 4ZFZB 2FL5B 2HFEB 3BQUA 3ZDYE 2E27H 1GHFH 1ZE3C 4MLSA 4R8WL 3ULUF 1LO4H 3T3PF 1BWWA 4UAOC 4JY4B 4K7PX 1IEBB 3U36B 1KENL 3RTQD 1JNHA 3TC9A 3WBDA 1LO0H 3VXUB 1B3JA 4L9LC 2BOCB 4F7TB 4ESKA 4QRPB 4WHCA 4OLVL 4OFYD 4L29A 5SWSE 1CL7I 2W1NA 1JF1A 1QACA 3RVXD 3WN5B 2G60L 3BPOC 5DVMA 4PJ7B 5HDOA 3BE1H 3DX8B 4W4OC 4RFEB 4HKJA 4A6YL 4K94L 4CJ0A 4QT5B 4OTXL 5D5MB 5IJVB 2D2OA 4KVCL 3GMRB 1JHKL 4F7EB 4AH2B 3F58L 3FCTA 2BVOB 4Y5VC 5EOQL 1F02I 1WIPA 1HI6B 4LRNH 1B0RA 1TXKA 4L8DA 4MVBD 4PRIE 5D96C 3PWNA 4M6ML 1H5BC 3G6JF 3C9NA 3QQ9C 4JFHD 5E2JA 5EFIA 3QCUH 2J88H 4JRXD 4OCYH 2E7LC 4Y5YB 5CUSL 4K9EL 2KQNA 5TQ2L 2PCPA 3ARGC 3MRPA 3C09C 3TYFA 3IFLL 4JFDB 5HYSG 1EPFA 1FVDB 1EGJL 3HNVH 5IFJA 5BO1H 5F9WB 3QEQB 3UDWA 1BF8A 1WF5A 3JWNC 2LV4A 4GKZB 2EYTA 2ADFL 1QBAA 4N0YL 1RURH 3CJJA 2VJXA 1PVHA 4NFCA 1E28A 4X83A 3AMLA 3FTGA 1IEHA 4JDVA 4Z76A 1U3YA 2OL3L 4MD4B 5MEOB 5DJ0B 3B8YA 4HIIA 5IW3A 4AEEA 1YEEL 4X7DC 4XTRD 1G0YR 2VNCA 1SEQH 5EA0L 1FG2B 3LKNA 3MODL 1PW3A 4RBPH 4AEHL 1Z3GL 4PJXB 3WNMA 3JWOH 4PRPB 2GW5A 1C1EL 3BWAB 3REVA 4I0KA 3VG0H 2VXSH 4M9OA 4HWZB 3RWGA 2AK1L 5KTEL 3IDMB 1D7FA 5H37G 3P4LA 3ARDC 3PWPB 2DBLL 1S9WA 1FG9C 1K3ZA 2BSRA 4JB9H 2PW2B 1YMMB 1J1PL 4KQ4H 4X5LA 3C09B 4UQ2B 5C07A 5CEZH 3QUXB 3UPCA 3LV3B 4G3YH 4LSVH 3ZTJH 1W0WB 4IHOB 3GJFA 2NY6D 3ZKMD 3CFCH 3ESVF 4PJHF 5DQJB 2DL9A 4GAJH 4DQOL 1CXLA 3JV4B 4KAQH 5ISZE 3Q0HA 3WUWB 2FX9L 3PF2A 3HE6D 3AS3A 4G42A 4WDIB 1WBYB 1B4JH 3E8UL 4KKLC 1SJHA 5DJ6A 1FIGL 3HI5H 5I30L 2O5XL 4P5TC 1CFQB 1G9MC 4R26H 3MV7E 3MLTA 3JZ7A 5AYUL 1A6AA 3S97C 4Q6IB 4F15B 1WZMA 5GGTH 5ALCH 3TH2T 3CFBA 2P8LA 5FK9A 4GQPH 3FJTA 3PL6C 3O9WB 3NCYS 2R15A 2NZIA 3KXFA 5BV7H 5EU6A 4WI6A 2GY7B 3Q6FA 4ZS6C 5TDOB 4Q9BA 2NYYD 1YNTB 4K8RC 5IMMB 2M8XA 4KKAD 2Z31D 3S5LA 3W11C 4ELKA 5DWUL 3PDOA 2X4PA 3UAJD 3MOAL 2DIJA 1RI8A 12E8L 3LS5H 3MJ7A 1QLFB 3DGCR 4JY5H 1A14H 1QVOB 3MGOB 3GJFH 3M1BA 5CWSA 3UCRA 2AJZB 3TVMA 4WRLA 3BZ4A 4LGPB 1HQRA 2GY5A 3C6LA 1ZANH 4JGJA 4LVEA 3RWGB 2XQBH 1JZ3A 1U3ZA 5DT1L 3LIZL 3LEXB 4UV7L 4MDJB 3O41A 5HHME 5MP6H 5DRXA 1U8HA 3QDME 3CLEL 3CXHK 5F44A 1BZQK 4GBXC 4N8CH 2FZ3B 3LKOB 5DR5L 1UB6A 3K3QA 4UU9A 3HLAB 4H88H 4HS8L 2Z91B 1DN0A 5DHYA 2GTWB 4LSPH 5L8JB 1AHWB 1V7NL 1MCWM 3WO4C 2EIZA 3OAZK 1RZGA 2VDNL 3L5XL 1A6WH 5CZKA 4J3TA 5BVPL 3QHFL 5HHMD 4HWZA 3KPNA 5DEGB 3N85H 4OZFH 2ARJB 4BK5A 1N0LA 3BT2H 4TRPL 4HG4K 3QNXA 5IK3B 3T2QA 3MROB 1A2YA 3ZSTA 4J3XA 1WCQA 4PJXA 2BSTA 2HH0H 3DI3B 3T1FB 1GC1C 4XNXL 3B5TA 3BUYB 2AI0L 4S1SH 4MD5B 3C08L 4DGYH 2H26A 3GB7A 1FFNB 1X4XA 1EMTL 4ZFOB 3ZE1E 4M6AA 5DGRA 1OSZA 1YMMA 3U0PA 1DUYB 1TJIH 2VZ1A 2H9GA 2N7AA 4IBLT 4PY8I 2NX5B 4G8EA 3V8OA 3WN5A 4ZQKB 5E1AB 4XCEB 4JPWL 4RFNB 4PJEF 1KJ3L 1EGJH 3HNVL 2FECL 3QULB 1RULL 5ETUA 2ESVD 3OKOA 4TNWF 3P4OB 1KJMA 1E4JA 1ACZA 1TJGL 1C5DB 1OD9A 4W70A 3QJFA 4CW1A 2WBJA 2HFFB 1KB5L 3S88L 1TTGA 3O2WL 2D0FA 5ELIA 1XF2B 4XH2B 5F96L 1JWUB 5JMRA 4MJIB 4ZUVB 1G6RB 1M7IB 2CDEB 1NCWH 1R3LB 2VABB 5E94A 4Q9QL 3OR7A 5IFJB 4OZGF 3LKRB 6FABH 2OP4L 1II4E 4HKXA 3E6FA 2DMCA 1U3HB 3SGDI 3QO0B 5E2VL 1KJVB 5CJOH 3HMXH 3NVQA 4BZ2L 1CLZL 2HVKA 4LCCC 4JHWH 3GMPB 3QO1B 3U9PL 3MJGX 4Y89A 3ZL4H 3PGDA 4XVJH 3L95A 5TQ2H 1MHEA 5BVJB 5EUOF 2K7QA 5CWSB 1RZ8A 3MRFB 4O2CA 3U6RA 3A6OA 1VKXB 2R29H 4DEPB 4EVNA 3O6FC 1I7TB 3I6KB 4GKOA 3GB7B 4JN1L 4QNPF 4LQFL 4OQTA 1MHPL 1B4JL 5GZNC 1JPGA 4P46A 5GIRA 1DUZB 2YR3A 2VITA 3RY4A 1Q9LA 3P0VL 2A73B 1E4XH 1YA5A 3SJVE 4K3EH 2RHEA 1ZTXL 1KTLA 2BNUA 3P73A 3BGFB 4XWGH 5CBEB 4WEMB 2W0FA 1TMCB 3STLA 2VDQH 3SKNB 2YK1H 1EVTC 3EO1A 5SWSB 3B8SA 5EU5A 3VWKA 1RUAH 1QYGH 1IGML 2NY1D 2GIYA 4L4TD 4P9HL 4XP1L 3EOYG 1E6OH 4QTHA 3O45A 4PRID 5I0DA 2VLRA 4JO3L 4FMKA 4PJDB 3RTQC 2OX5A 1E4WH 4OZGA 4LU5H 3B9KD 4JFEA 4FQ2L 1A1NB 2W9EL 4OF5A 3UZVB 5J3HD 1M7IA 4JFPB 4NC1E 5HY9A 3SE8H 5CZVL 5T33L 3ZSSA 4Z7WE 3S35H 4DQOH 4ZO8A 2ZOKA 1T0MB 1FFQA 2R1WA 3BKCL 3CIQA 1NUGA 1W8NA 3KXFB 4NPYB 1BBJB 5CJBA 4HIXH 3PP3K 1KB5B 4OZHB 5I8KL 5ICXB 2Y07L 3WFCL 1HHHA 2CR3A 4PJEA 1QZ1A 2ZCHL 2HWZH 4TUJB 4D9QD 2NY2D 4KTEL 4G6AD 3RL2B 1I75A 2I26N 1ZS8A 3ZHKA 5L9DL 5EO1B 4FQIH 1JZ7A 5CP7B 1FG2A 3LKNB 1FAKT 2DQGH 3UBXI 1FRGH 1P4IL 2B5IB 4MAYC 1TCRA 1WCBB 3IVKB 3P11L 1C7SA 2HFFA 3QO0A 4QHNA 1Q9LB 1G1YA 4M1GL 5GRUH 4HIJB 1RZIB 1NGXA 3TIDA 2FRGP 1S5HA 2VUYA 5DVNA 4GXVH 4F2MB 5C0BB 4M1CC 2GJ6D 3KPLA 2DQHL 4ZPVA 3GSNH 5C0BD 1I4FA 1QD0A 2DQIL 2ERJC 3BRGC 4LPVA 2ZSWB 4X99A 1XR9B 3TVMD 5GRJL 5D2NC 4FP8L 2MFNA 4HQQL 4F7PB 2Y5TB 5IFHL 3X14A 1JZ4A 1DQDH 4G7YH 3RNKA 3UTPD 1S3KH 4HPOL 1JPTL 4PJXF 5C6PB 4PGJA 1MCJA 3WFZA 2Q20A 2VQTA 1JRHI 4CN1A 3SKOB 3H9HA 1NC4D 3RAJL 5J12B 3NFPB 4OIBA 5IUSA 4H25B 1BPVA 3ECBB 4K2UL 4U6XB 5GRZA 5JXAL 2FWOB 5LXGH 1FL3B 2OBGA 3GRWA 4H8WL 4WTWA 1L7TH 1UJ3C 1UT9A 1A6WL 3VCLA 4ZFOA 4ZFFA 4PLJD 1J12A 4PS4H 4U31A 2ZZUT 3RKPA 1U8KA 1NDGA 4GRWH 4OIIL 2A6DA 3JTTB 5F96H 1G7PA 3DOSA 3PP3H 4ONFL 5F8RC 1DQTA 3CDGB 1IE5A 1TZIB 1G7JA 3JXAA 4LFHG 4NIKB 2ATPB 4NJ9H 2X1QA 1YUHA 4UB0L 4CVUA 2BXYA 5KOMC 3G04B 4OZHE 1HKLH 1C08B 1KTDA 2CH8A 3G9VA 5JPMA 5DRNA 3T77A 5F71A 4HIEA 2ZPKH 1IAOB 3P9MB 2GQHA 4IRJA 1YDPB 5CCKH 3ZYOA 4LCYB 2GSIA 4PJBE 4KDTC 3QUYB 5DUBA 3KJ4C 1IL1B 5C0EA 5ALBL 4PY7B 3D25B 3VDCA 2BXZA 3KLHC 3QXAA 4XHJD 1AI1H 5E5RB 2FR4B 1P53A 1J8HA 3HN3A 1RULH 4JFDD 2JB6B 5K59F 4LHUB 1CCZA 5GZOC 4NNXB 5DJXA 2VWEE 1NMAL 1UCTA 2VYRE 1LEKB 1X7QA 3TBTA 2KQMA 1WBXA 1MHPH 2ZCLH 2HKHL 3N50A 4HXAL 4OD3L 3GI9H 1EO8H 1V7ML 3TBSA 4UT6L 5F89B 3LQAL 3O4OC 3DUSB 1ZLWK 1F8TL 4NWTH 2JELH 3JBG7 1X5GA 4M1DL 2Q3AA 3VI3F 2ITCA 4YFEA 4P2QB 3WNPA 5JZ7D 4GBXD 4XNYH 1I1CA 1WBZA 4WEUD 4NUGH 5KSAC 4HHAA 3LQZA 2UWEF 4CDGC 3R1GL 1JTPA 5GSVB 1G84A 4JVUA 4O9HH 5D7IF 5J6GB 1E4KC 5EZLA 3WHE1 1CI5A 4RGNE 3K8KA 4MDJA 1TZGH 2EDYA 4GRLD 4PJHA 3PWPE 4ORGB 3T3PE 4MB5A 3W82A 3PHSA 1GGTA 5DC4B 5KVFH 2I60L 1BFTA 2B8OT 4FTVD 1NBZA 1N4XL 4P3DB 1NUDA 2PO6C 4Y5XC 3MOQA 2EH8H 2AQ2A 4RA3A 4QO1A 3S35L 1HZHL 2PKDA 2Z9TA 5EG6C 1QKZL 2P24A 4WHTA 3CUPB 3GK8L 2C4FU 4HC1H 4L3EE 5A2KH 1IM9A 2VXQH 2Z93B 5KAQF 2Z8WC 5IW6B 4PJBA 4X8JA 5I1DB 3L5WB 4Q2ZB 5E4EC 1N5YH 3A67H 5DQ9B 1LWRA 4Z0BH 3WL9B 1CLYL 3QXWA 3MBEB 1KGCE 1IEAA 1J1OH 3Q5YA 2M26A 5FYJE 2VDQL 4NO5A 2WWKO 2VISB 2VERN 5KG9A 5IKCA 1SBSH 2DQGL 2C3HA 1YQVL 4POZC 5FYJH 3RBSA 1AXTH 2E7BA 3HTLX 3MV7B 4JR9L 4KZEH 5TJWK 32C2A 4I8DA 4G8FB 3RGVB 3QFJA 1QSFD 1CK0L 1NAKH 3TNMA 4FOMA 1MLCB 3C2AL 5I1GH 2DQJL 1S7UA 2ZCKL 3A6CL 3EYSL 5IF0A 5EZOL 3VMNA 3FN0H 3DVIA 4OUUB 5A16B 1PLGL 1NAMH 2UWEE 1UZ8A 4JQIL 4JFYB 4RGOL 3VMPA 4ZOCA 4JN2B 4M3JA 3SKOA 2ZP0T 1FZMB 4LLUB 3RY5A 4PJ5E 4HFUH 3CU7A 3QIUB 4YFLF 5K93A 3MLSH 3PV6A 4ONHA 2PTUA 4W6YB 3MRBB 4MQSB 5F1KC 3KLSA 4X7CC 3MFFB 1KLGA 5BJTB 4PRHE 1D5IL 2HRLA 5HYIA 3MLXH 1RVFH 4F7CB 3P4MB 1QO3B 1W72L 3TA3D 3WFDH 2P42B 5IHZB 2ESVE 3BSZH 3MGTB 4FZEL 4HT1H 5E99L 5GRYA 1AHWC 3DX9A 2JJTA 3MNZA 3RZCB 2EICA 4NYLA 4U1LA 1QFPA 1XF5B 4TOYH 1HEZB 3SGEH 3KYAA 4LMQE 4BFIA 1HQ4A 3BIBX 4HUXA 1T20B 1J86A 4I13B 3IGAB 1REIA 1ZEAH 1BJ1H 4LIQH 3UPRA 2H1PL 1FV1A 5GS3A 1S9WB 1CD1B 2BNQA 5D8JL 5T5NF 1CDGA 5FHAH 5CEXA 3SDYH 4F57L 2CXKA 4LIQE 4FFWC 4JPVH 2KH2B 1RFDL 3SQOH 1ZT1A 1N59B 4JM2D 3X11A 2CDFB 4BQ8A 1NL0L 5BMFH 4OCWH 3M07A 3V6FA 5HPMA 4LDOB 2QQKH 3AS2A 4OLUH 4NPYA 1H3WM 1OGTA 5EO0A 1S7TB 1FFPB 2XN9A 3BIKB 3FQTA 4GFTB 2ICWB 3VXSB 1UM6H 4H20L 4XC1L 1U8IA 1MFCH 1VEPA 5GGSB 5DHXB 1T0PB 3GSOB 1DANT 1B90A 1SQ2N 4I9WD 4LGSB 4M5ZH 2BHZA 5D1QC 5MENB 1WZ1L 1BD2B 4LPTA 1EUTA 4CMHB 9CGTA 5DGQA 1IM9B 5D2LB 1G7QA 5C0JA 2VLRB 3MRRA 2GTZB 3OKMB 1MNUL 4M7JH 4OLYH 3RNKB 2AEPL 3HZKA 1ACYH 1CXFA 1M7XA 2F53D 1FYTB 3EJZC 1FGVH 4HXAH 3NCEB 2OL3H 5EOCJ 3QWOB 4OF3A 3GI9L 2F5BL 2XNAB 4GW5B 1U41A 5T1MB 4ZUTA 3TO4B 4LLWB 1LE5B 5LAXA 1GGCH 1P7QB 5FCSH 1XIWD 2IH1A 4KRMB 2ZSVB 4K94H 2B0SH 4J4PC 1IQWH 4CL7A 5HJ3B 3I50H 3DX7A 5HYSB 3MJ9L 2R0LH 4QRTA 1J87A 3GSXB 5I1EL 1H3XA 5BW7A 4MSWA 2NZ9D 4G6JH 4Y7MA 1OTUC 3VRJB 4QRPA 1P69B 2P45B 1HHHB 4PJEB 1ZT4A 1CWVA 4FQJH 4JY6B 2AV7A 4K9EH 3NCJH 5F89A 3D9AH 4HCRH 3V7AE 5C0AB 1D3CA 4E0RB 2AABL 4LSRL 4O5LL 1KG0B 5SV3A 3S4SG 4G5ZL 4Y4FA 1VHPA 2WBJD 4P2OB 1T1WA 3VD4A 3SBWC 4OCMC 1BIIA 4X98B 1KJ2B 4XBPA 3LHPH 3RGVC 4UIKL 1FFPA 2XN9B 3BIKA 3QEGH 4RZCA 4TULL 4KHXL 3DYOA 3FO0L 4L1DA 2YHGA 4G80B 2BOBA 4R90L 1C5CL 4G8EB 2D0GA 2YBRB 1F8TH 4NWTL 4P3CH 5ID0B 3RGHA 4RGMB 3MNWA 4XNYL 3HG1D 4DCQB 4MB4A 5F3BB 4P9HC 5DTFA 2VDMH 5IJKC 3WNNA 5CP3A 2CDGB 1UGNA 1AGDA 1SBSL 3CX2A 3D39A 4LVOB 2R2EA 1YN7B 4PJBF 1WUNT 2H26B 1LGVA 2OTUB 1Q0YH 4PGEA 3UPRB 3L3KB 4FXLA 3LKQA 1R3HB 1MEXL 2HVJB 5C2UB 4K3HA 3T0EA 2F54A 5DD5H 3VWJB 1CGSH 1N0XH 2IMMA 4PRDA 5HI4D 3EO1B 5SWSA 3WLBA 2YA0A 4YHPA 2G5BA 1QKZH 4LOUD 1EA9C 3FB8A 3ARRA 3HI6H 4EUPH 1SYSB 2SEBB 4PJFB 1PY9A 4RA0C 1BM3L 4A6YB 4IOFC 3RDTA 3HE7D 1RJYB 4Y1AA 2D7PA 2HT4C 1BX2B 4Z77A 2PTTA 3KPRE 3MLUL 5E6IA 4X6DE 2J6EL 2X7LB 4MNGE 5J6HB 3BSZL 1U3JA 1DVFA 5TGBB 3MUGA 4B7LA 3MV01 4HDIB 2ZKHL 5BS0E 1W2KT 2F8OA 3BUYA 3EO9H 4F7MA 3TFKD 2NY0D 3GMLA 4PJEE 3MRBA 2IAMD 2WINA 3MRDA 1OSZB 5SWZD 1Y6NR 3WXWL 1P5VA 3CPLB 3MNVB 4XVTL 5DJYA 1KIUA 1T5WB 2NW2A 3BT2L 4TRPH 1KACB 3RIAK 1BOGB 1YY8A 1G6RH 1ULVA 4MWFB 4ELKB 3VE0A 1L9MA 5TFSL 3SDYL 4ZUSA 5L2KB 3P40A 1NGZA 2OK0L 2NXZB 4BFEA 3DX7B 3KVQA 1IFHH 2P43B 2HG5A 5KSAD 4U6YB 2HFGL 4NNYB 1MI5E 2OTUA 4UV7H 2AGJH 2WNGA 1VA9A 3QJFB 2G2RB 1ZKAA 3KPMB 1QUNA 1HH6B 3DXAD 1JGEB 4F8TA 5F9AC 2OMBA 3MGOA 4PJGE 5JOPD 4X6FA 5EOCL 4AL8H 5D5ME 1U8OB 2R8SL 1KULA 3F8UB 1WEJH 2YSSB 5FUZH 5HGGS 3SDDA 3FT4A 3O6LL 2VXVL 5HI5D 1JCKA 2R2EB 3O3DA 1Z9SA 5J1AA 1MJ7L 3U46B 3RHWF 5EU6B 2J8UB 2QR0A 3U0PB 3O3BA 2AEPH 2IPUK 1XGQA 2AJ3A 3OB8A 5HYFA 1A3QA 1S9XB 1MLCA 5KVDL 1FGVL 2J1KA 3QA3A 2FX7H 3EAKA 4KK9D 3S3SA 5ID0A 1WSST 5CJ8A 4OUUA 1VFUA 2F5AH 4ONGH 1I3VA 1TZHA 3CMGA 1VGEL 4ZOBA 2ZUUA 4QHLB 2CO7B 1LDPL 4YDLB 2OQJB 1QR1B 4BFIB 3ARBB 1QPXA 4E41A 4UT7L 3NIGF 4BZ1H 3AVEA 3SDXF 2GFBA 1S9VA 1I9JL 2AV1B 1QNZH 3QXUA 1MFCL 2NQCA 3W5NA 1R6VA 4XVJL 2F54D 5J13B 3SO3C 1P7HL 1Q9WA 5LAXB 4LLWA 4N9GA 2NR6D 4JDZB 3MCG1 3QQ4A 4MXQC 1AIFA 4WO4D 1Q9OB 5IM7A 4JKMA 2DTSA 5DD1H 5LBSL 2DN7A 3DUHA 3TNNB 1RIHL 5I2IA 4KJPC 4OLYL 1JK8A 2X4RB 1G0DA 3N0PB 5FO8A 2AERT 4BQ6A 1EBAA 5DK0B 3IJSB 2X10A 2HJLA 2ARJQ 3WHE0 3H42L 1R0AL 4WUUE 1ND0A 1ZSDB 2RR3A 2BHYA 5CIPA 1S7XA 2ESVA 1VESA 2EE3A 4FZ8L 3MA9L 4LDEB 5GJSH 2FATH 1D5MA 1IAIL 3TCLB 1FYTD 2XKNB 3VGHA 2CLVA 2D31B 1ZLSH 3DRQA 5HD8C 4QT5A 4JO3H 2NY5C 5HPMB 3KLAA 4YAQA 1NDGB 1U8PB 4OZIB 3OJMB 1MCNA 2ICWI 1JF1B 4GUPB 1FL5B 1L9NA 2V5RA 2NY6B 3QEUA 3UYOD 3L3DA 5J1TC 2AABH 4O5LH 4X9FA 1W0YT 5ID1B 5CEZE 1VFMA 3S37X 43C9B 5IR1A 4LK4A 4F58H 4WU7A 5KW9L 4NFDA 1ZHNB 3VH8G 2NTSP 2A0LC 4PUBH 2GCYA 3HAEG 3S37H 4MA3A 2F9BT 3PABB 1J05A 3MREB 5ETUB 4D8PA 2BMKA 3L3GB 4X5XA 3CNKA 1EDQA 1RY7B 3BXNA 1YDPA 5DS8B 5F6HJ 5EU3B 2EDHA 1OF2A 2IANB 2DMKA 2XG4A 2DKUA 1PQZB 4HKBA 5SWZB 3TP4A 3HC4L 1CDUA 2CD0A 5F7DA 1A7PL 2VLKD 1ROWA 3QDJE 1DDHB 4R2GB 4G3YL 3KLDA 2NY7H 3FB5B 5CS7A 4JRYE 3EO9L 5C0DA 1I9IH 4GRLA 3P77A 1N3NA 3WJJC 4XZUB 5F9OL 3K2UL 3IU3B 3SDXA 1A7BA 1TITA 3DV6B 4HWUA 1QLEL 4L8BB 4XPAH 4NCC1 3V6OC 3QAZB 2W38A 4MNQB 2O93L 5F6HI 2C7UA 2CRZA 3FFCB 4HUUB 2C26A 3QRFM 5I30H 4E5XA 1HYRC 3PGCB 4L9DA 4JKLA 4LLYA 5F7LB 5GISL 1U92B 4NBXB 5E5UB 2BSSB 2X4SB 4H25A 1F13A 2OZ4A 3MYZA 1CS6A 4Y1AE 4PJAF 5KS9E 5F70A 1FFRA 5IM7B 4ZFOL 1MPAH 5JXED 4FNLL 25C8H 3VU2A 4RWYH 5IBUG 4AEFA 3VFVA 3BD3A 1R3HA 2QHLA 2R23A 1EERB 5MI0B 3T3MF 4JPKH 1OTUD 2V9TA 1HH9B 1XGRA 1GAFL 3PNWB 3BVNB 1P5UA 3O6FB 4OLXH 4U1JA 4W4OA 4U1KB 2VB5A 4WTZA 5EOCH 3RL2A 2R0WH 3DUUB 3VXMB 4U1HA 5CD3A 1WEJL 2D7TL 3ZTJG 4HX1B 3O4LE 4OGXL 5DHVB 3IRPX 5D6DC 3HZVB 3EYOB 3WXWH 1VFBB 5CZXC 3BOVA 4E42B 1CZ8H 4QHNB 4KMTL 2DDQH 4ENED 2GSIB 5CSGA 1I1FB 4R4ND 1UFUA 1RQ5A 1NGXB 3QI9A 3D3VA 3S5LB 3S3PA 2HLAA 5HGHA 2FJHB 4JFPA 5HY9B 1VEOA 4NJ9L 1S7SB 3MRCB 4PJGF 1T80A 1CICB 4YDIL 2G75B 2OZ4H 1P7KB 5D96B 2P8PA 3BZEA 1F3JB 5EC2B 4OCSL 3CUPA 3ARGA 1UH2A 1P9MC 3FAXA 4GBXA 3N1PC 5J0BA 4GW4A 1A3RH 3VFNB 3IF1A 3KS0H 4LRNL 3DROA 2NTFA 5DJAB 3ZZ1A 4PJCA 3P9LB 5MERB 5BVPH 3DARA 2XA8H 4RFNC 3VRLF 4OIAA 5C08B 4N1HB 4C4KO 2A83B 3LB6D 4NHCL 5IEKA 5LXGL 3G6JB 4WUUA 5CMAB 5HI4C 4N8VA 3KR3L 2XZCL 3GKWL 5EU4A 4JZNA 3LQZB 5BV7B 2L4OA 2IMNA 1LO3L 1A0QL 2ZCLL 1BD2E 3MV8D 1G0XA 3IKCB 3D2UA 4GS7C 2AXJA 4L3EB 4L5FH 4D0DA 1KEGL 3UTSD 3G08B 4ZFGL 1YEIH 2BVPA 5KSBE 4RX4A 3OHXA 5FF6B 3L3IB 3UJJH 4R7DA 4YUEH 5TH2B 2W60B 2JJVA 4PRBB 4PJ5D 5HXMA 5DMIH 3ULVL 2VLRD 3VFMA 1QSEA 1G7LB 4HULB 4EI5C 2EH7L 4BFBD 3FQNB 3B2UD 1J88A 1F3DH 1B2WH 4X7FC 1CR9H 5I74C 3DVFA 3V6OE 3NFNA 3CD4A 3ARVA 1AQKL 2IAMC 4NKIH 2L0DA 5C0AE 2WIIB 4PJGA 4M6NL 3TBWA 3LRHA 4LPYA 2V2TB 3HS0A 4H1LH 2JCCB 3RJQB 4DZ8B 1XH3A 2L7UA 4CMHC 2P4AB 3P0YL 4OZFG 3WSQH 4Z0XB 5KSAA 2VDLL 3BP7B 5JPMB 5HYSA 1RURL 4B50A 4FQXC 2IADB 2VXQL 4P3WA 3BN9C 3PGFL 2PXYC 1QBMH 3P4OA 4N1CA 3NTCL 1GGIL 3FT3B 3K7UA 2J8UA 4H0IA 1RV6X 2QR0B 4RSVA 3C5SA 3KYNB 1QSVA 2H32H 4QGYA 3W0WE 2WBJB 4P2OD 1YPZB 1YYMH 5ESAA 3LKSB 2DD8L 15C8H 4E0RA 4YDVB 1T66D 2VE6A 1T6WA 4BA8A 5GGTL 1EX0A 7CGTA 3T2NL 4XGZA 5D6CB 1OAZH 4FTVE 3KXFE 2OJZH 4NSKB 5JA8B 1OTTD 2ZOKB 3RVVC 1NBVL 4BQ9A 3GMRA 4WWKD 3LKRA 3GM0A 1AC6A 5AG9A 2GJ6A 3S36H 4XVSH 2MHAB 1R5WA 1LNUB 1TZGL 2A74A 2FB4H 4JFFE 4FXKB 3MFFA 4Y8DC 5MI0C 5EULV 1S7TA 1CE6A 1R24A 3VXPB 3GSRB 1OP5H 2HVKB 1YEDB 5KVMC 2DI9A 2EYRB 4H1LA 3BZDA 4CNIA 1Y18B 1A21A 3CFCL 3D39E 3OJ2C 3KGRA 1VCAA 3WFEL 5HYJE 1HZHH 2DL2A 4PUBL 3ZHDA 2Q76B 3VJ6B 3FB6A 3OBAA 3DX9B 3VWKC 2Y7QA 3I2CH 1RUAL 2DKSA 4JFXB 4B53A 3B3IA 1GIGL 2PTVA 4OD1H 1FQ9C 1ADQA 3O8XA 2O5XH 4MNQA 4LCIL 1BZ7A 3CXDH 4FFYL 4OSUH 3VXOB 4Q9RL 2JCCA 1I3GL 4ZXBD 1AQDA 5C8JA 2VAAA 1VGKA 3LN4B 1SBBA 2YA1A 3D3VB 3L3JA 4G8GA 4HT1L 4DTGH 2AXGA 4JFZH 2NR6C 4YIQB 3MRHA 1IJ9A 4NC1C 4BSJA 3NAAL 5DMGC 3CSPA 3L3GA 4X5XB 5F9OH 4LP5A 5DA4A 5C09B 3IRZA 5HHPA 5LWYL 3LEYL 2O5YH 2DQUH 4PYHA 2Q7YA 1BECA 4M6OH 4QRSA 1I1YA 3IDXH 1SHMA 5DWUH 2FHBA 5E03A 5FYJU 3S35X 4R0LC 1X5HA 2RCSL 3VFWB 4PRBA 4RGOH 4AZ8A 5I1IH 3GJFK 1QSED 1J0HA 3U1SH 5F3BA 3NACL 1ORQB 4MQ7A 1H15B 4EDXA 1QSEB 4OFYA 3HLAA 3SDCA 1KG0A 3MV7A 1CD8A 1ZANL 2RJMA 2V17L 5EUOE 4HX1A 1X4YA 5IIEA 1YYLL 5IVXB 1N2RB 3QHTC 2E9BA 3DXAA 4XCFL 3QNYB 4XP4L 2B2XH 2B1HH 2EZ0C 4MD0B 5E9DE 4J3UA 5FDWA 2XIDA 5T1MA 1S9KC 1K8DB 2FJHA 2X89D 4WHYG 2Z31A 1N64H 4EI5B 3GSNL 3BQUD 1FFNA 3HA0A 3LPGA 3GO1H 4NYLB 4PJDE 2GITB 3B9EA 2FHCA 4JRYB 1ZLVH 3IF1B 5DO2D 1TETH 4UUJB 4CVWA 4WFHD 2ZUQB 1CN4A 3X12B 2HJKB 3GHEH 3MGTA 4Z7WB 3NABL 1INDH 2UVFA 4I1NB 3ILQC 4JFYA 1RUPL 4EZMA 1U91A 4JDTH 3FN9A 3AS1A 3RVWD 3TVMB 2EDNA 2FLRT 3B83A 4MDIA 5MEND 4QY8A 2N7BA 1Q94A 5JR1H 4HZLB 3VXTB 5EN2B 4V2CB 1U3HA 4D0DB 3GMQA 2Y72A 4S1RL 1CLOH 5HDBE 1BQSA 1W72A 4I48A 4K8RD 3GIZL 1OOAA 5INCB 5KJRH 3EOBA 1JI2A 4F7CA 1G6VK 3CVHB 5C7XL 5E0QA 4UT9H 4MNHA 5ESVA 1CVSC 2XTJE 3X11B 1YN6B 4L8SA 2UZIL 1N5AB 1MCBA 3HFMH 2WUBH 1WT5C 4JG0H 5L88L 2G60H 4WUUD 4IIQC 3EDJA 4DKDC 1UQSA 3BPLC 2ITDA 4A6YH 3UPAA 2AK4D 1OGTB 3NIDE 1A0QH 5HDLA 5HYQA 4NQEA 3LHPL 1BGXL 1AE6H 3PGFH 1U3HD 2FIRT 1JHKH 4NRZB 5TF0A 4FFZH 4HK0B 3O3EB 3OKMA 4BJLA 1BD2D 2IH3B 3MV8E 4E42A 3KAAA 4UILL 5F1NB 3UJJL 2CGRL 1F3DJ 5CEXB 4P49A 5FIEA 4IM8A 3GSUB 4E41E 4XWOC 4PJ7A 1S7VA 1GZPA 1MCRA 2GAZA 5HHPB 1YUHB 5C0NC 1CF8L 1KXTB 4X4ZA 3ARDA 1L0QA 4N8VG 2Y23A 1JIBA 1NMAH 3HHRB 4HJGA 4NM4H 3FO1A 4PTTA 4ZPTB 2VH5H 1GOFA 3KPMA 4ZODA 3WFBH 4LSRH 2CKBH 5DK2A 1BQLL 4QRUB 4YH6A 1A6TB 2WWMC 3KYMB 5JW4Q 2XY2A 3TYFB 3MJ6A 3QT2A 1GC1H 5EWIL 4HKZA 4U6XA 2FJGB 4NO0B 3QXVA 3RWEB 1EEQA 4QCIB 2X9XA 3I3EA 3QQ3A 3GBNH 5IWLA 3IDJB 5EIQA 1UWEL 1GGYA 1FNGB 1C5CH 3L3HB 2BOCA 5E8PA 1VFOA 4CADA 1IILE 3CPLA 3F62A 1YYML 2J6EH 5EU7C 4Y4FD 3VD9A 2ERJB 1GRWA 1JWMA 5FUOH 4H0HB 4NKDA 1H3PH 1T7WA 5DJ8A 5IR1B 5E2UH 4LHJB 1TLKA 1NBVH 1FHGA 4NC0B 3V95A 2ED7A 5D5MA 5IJVA 1X5JA 4PRPA 5FO8B 1KXQE 4QXUL 4LLMB 3KPSE 3H3BC 1PSKL 2HKFL 1OAXL 1B0RB 3G5ZB 4QWWC 2WUCH 3LKSA 2DLFL 4K8RH 4MZ2A 1X5KA 1JNLL 2EDLA 4PJ5A 4F9PA 1U91B 4NO5B 4QOKA 2XTLA 3TCXA 2EDFA 5BRZB 2FL5A 2F8VA 1NBZB 5CFHA 1HILB 1GZPB 4KK8D 2FCBA 4Z7NE 3QDGD 2XWBA 2ADGA 4LNRB 5L6YH 4YHPB 3DETD 4OLEA 2CK0L 3TA3C 4HQQH 5HI3D 4EIGB 1IGCH 5HHXL 4LKXA 5AWNL 2IPTH 3V0VA 1AGEA 3VDAA 1P4BL 5C07D 3F6LA 1DBJH 4JDVB 4MD4A 4Z76B 3O3EA 5AUMB 3BP4B 3JTTA 4YHLL 4P3DA 4UZGA 4L8SB 1WZLA 2AP2A 2RFXA 2W0PA 1NAML 1ZHNA 2FEEL 4PB9L 3SDCB 5A3ID 5HHNA 1CTOA 8CGTA 5TE6H 2ATKB 3SPVB 1PG7X 2D7MA 5DUPL 4F7EA 5D1ZB 3CFDB 2DQTH 5FK9B 4UTAL 1FL3A 4PS4L 1N2RA 5JHDA 3W5MA 2XQBL 3EBAA 3QI9D 3KLAB 3LS4L 2VIRA 2R4RL 2QSCL 1N8ZA 2FX7L 1FBIH 4X4YB 2XYCA 1IL1A 1PEZA 3DURA 5AG8A 1ZLUH 3EYQC 4R96A 4N9GB 3LN5B 2IC2A 3SDAB 3WFDL 4PBWD 1EVUA 2DWEA 4N8CL 2DM7A 1CDHA 3MYJA 3TN0D 5LQBL 4MYWB 4PJCF 1J8HD 3ARFD 4V1DB 4HKJB 1L7IH 3WUWA 5EDXA 4L9LB 2B4CL 2YPKB 4NKMB 4JRYA 2CMRL 3OWEA 2VZOA 4NNYA 3EYVB 2Q8AH 1K4CB 1QQDA 4JRXA 2ZNWA 3OSKA 1CD0A 4IRSB 5KJRL 2Z4QB 3M17B 1FNGA 4CADB 3CGTA 4UT9L 3PWJB 4MAUH 4PJ8D 1KIRA 1TTUA 4QRQA 3FRPA 4H8WH 1RIVH 4TUKL 2BFVH 5LBSH 2HFTA 5EPMB 4XAWH 2R1XB 5HVGB 1CQKA 1IAOA 1T2JA 1LK2A 4HJJH 2CJUL 1AE6L 2AV1A 3O3DB 1LO2L 4A2LA 1FJ1B 5I16A 1GOHA 4YE4H 2MCG1 4X4MA 1JUFB 5DSCA 1D5BA 4ZPTA 5T1KB 4L4VA 3MC0A 4WU5A 1UM6L 4AY0A 4KV5E 2VXTH 3LSOA 1ZK9A 3VFOB 4WI2A 4J6RH 5GJSL 5KSBB 3EJYD 1VACA 2LE9A 1M71A 3CVIL 4KK5D 3R1GH 3VD5A 2VLME 5BZWB 1PFCA 4Z7VF 4I2XA 3BEVA 2YEZB 4M61B 3FCTB 4NGHL 3X14B 1A7QL 2VDRH 3O8XB 3FOLA 4J3SA 1UH3A 2ICWA 3TO2A 1CGYA 1RK1A 5KS9B 1AI1L 4KUCD 4N90E 1G1CA 1D9KC 4TTDC 4Z8FH 2V2XA 2P49B 3STZA 5I9QC 1CFSA 3GK8H 3GI8H 3HR5B 5IJKA 4P23C 4EJ1C 3RX7A 4R3SB 4NQED 1DVFD 3V6ZA 3MCLH 4Z0BL 2E7HA 2X70A 5DLMH 1XGTA 1FFOB 3CVHA 2KKQA 5FA4B 1OL0A 4P9ML 4WNQA 4RQQB 3C60C 1LEGA 3PHQB 4GJTB 5TE7H 4DZ8A 5C3LD 5I17B 1CFTB 5FYKU 1PZUB 2IBBA 2F54B 1JN6B 3VWJA 5FAAA 3QB7C 5D9SA 1IC4L 2P48B 4ELMB 4R0LB 5EBWA 4KZEL 5I76A 3VH8B 3DGGA 2VLJE 4JO4L 3N06B 2GTZA 2KBGA 5DFVD 4WGVB 5DHVH 4CVXA 5C9KA 2DYPA 3L7FB 2QJDA 4HXBH 1BMGA 1H5BA 1IGJB 1WFTA 2QV2A 1PKQA 2MSPA 4M93C 5JOFB 1CLCA 3WUWG 5TF1L 1JUFA 2VH5L 1MAML 1QO3A 5DSCB 1C16B 1RD6A 4P4KA 5D7SH 1MFNA 4FG6C 5F21B 5FDYA 4Z7VE 5DRWA 2BRRH 2D03H 3GSOA 4YDVA 2NY5L 4Z7OE 3HE7C 3ULVF 3RX8A 5KVGH 3B9VA 2XTJD 4PR5B 1B88A 5DHYB 3R06B 4YDLC 2HT3C 4OI7A 4EVNB 3GM8A 4EUPA 4NQCD 4PRHA 3S96B 3T4YB 3B5GA 3IXTB 5B22A 5C0GA 1E6OL 4X6DA 1KBGH 3WE6B 5E08H 4I3SL 4ZSOE 3O3AB 3CCHA 5JLZB 5A16A 2C1PB 4P4KD 2EE2A 4YHLH 5GGSY 3MBEA 4RRPA 1T5XA 5F7FA 3TFKC 1J10A 5BRZA 3TO4A 3FFCD 2GYSA 2XZZA 5CP3H 4X80H 3OZ9H 4ZDHB 1U2HA 4HD9A 1F5WA 2P5WA 1HDMA 4APQD 1JMXA 5T3XD 3RIAF 1DN0B 4TUOA 1QLEH 1A1OB 3HI6L 1WFNA 1UA6H 1FZJB 1OAYH 3BKCH 3RVUC 4G6FB 4X6EA 3OKEB 2BOBB 1K4CA 1QQDB 1DBAH 3LS4H 3VFUA 1FBIL 1MCKA 3CZJA 3SDCD 3TPKA 3K1KC 3V52H 5DJ8B 5GGRY 2MPAL 4HLZH 1GVIA 4HFUL 4WFFE 3EHBD 3G9AB 3MRFA 3O81A 4FQLL 4RAVB 4Y4HA 2AJXH 1OAKL 3W9DA 5C0IB 3OKNB 3CH1A 4I0CC 1KT2A 1YECH 4QHKI 1DLFH 1KJ2H 2FD6L 5D2LA 4R97C 4Z7QF 4ZS7H 3QPQC 1PX3A 3HZKB 4FMFA 1WC7A 4GRLC 3RL1A 1QPPA 4KJQD 1FN4A 4N0FB 4XI5D 2UV3A 4MJIA 2ZUVA 4XCYB 4ZUVA 2DLHA 3ROOB 3RVTC 1OM3L 3K0WA 1A6VH 3C8DA 4LCUB 2PO6D 5FYLH 2J7LA 3LMJL 1CE1L 5DD0L 4J23A 5TFSH 4ZTPL 2E7CA 1ZA3A 3KDMB 5FYLE 1AHWA 4KK9C 4RCAA 3GBLA 4HFWB 3M8OH 3QIBD 4ZO9A 1R3IH 2H1PH 1GJIA 4KK6C 1AGEB 4JJ5B 1CD9B 3BKYL 4L8BA 3K81A 4RNRA 3TH4T 1KEML 3P9LA 5MERA 3RBGA 4KTYA 2F5BH 1FYTA 4XP6H 1UZ8B 4WCYL 4XNZC 3K46A 1GGCL 2BVUA 3U4BH 1V3KA 1BFOA 2HTKD 4C56E 1MRFH 3OAZH 3P2TA 2OZ4L 4HK3J 3U0TA 4G8IB 3QUMB 4NRXB 3QJHA 4R7NA 3MRCA 2Q1EA 2V5SA 3JV4A 3PQYB 3PWPD 5I1EH 4X7EC 2YPLE 4C57C 4XBEH 2R9HC 3TIEB 3TV3H 4K3DH 4DN3L 4KKNA 4KZDH 5T1LA 3MRMA 4D0BA 5D2NB 3V5KA 5MEOA 3VXSA 4KI5C 1G7PB 3D9AL 2P1YA 1GGBL 4JFFA 4WU5B 3FN3A 2BHUA 2V2WA 2EXWD 2YZ1A 4P2CG 3QIWC 5D72L 5HYJD 1YEEH 2UVEA 3ARGD 5FUCE 4X5WB 5IV2A 4U1HB 1V3JA 3ARGB 3GI8L 4M7ZB 5DUMH 4JFDA 4TSAH 3BKJL 3RRQA 5DMJB 4X4ME 1T20A 5EN2A 4TULH 3NTCH 1RSFA 1C5DA 3FO0H 3PWNB 3O2DA 4GH7B 4WI8A 2LVEA 4U6HB 2NW2B 2VXTL 1HHKA 5ID1A 2KPNA 4W4NA 4AT6A 4MQXC 3I50L 1ZT1B 2COQA 2Y06L 4WW2F 3C60A 2R1XA 3CVIH 3ARTA 4YGVB 5JUEH 4CMMB 4AG4L 3DV4A 4G42B 5EB9A 4Z9KB 3BZ4B 4GO6B 1DL7L 1EXUA 2I9LB 1J7VR 1JGLL 3SJVD 3OAYK 5C86A 3PIQB 3OKDA 4N0UA 4HGMA 2FJFB 5IHUL 5JOEA 2X7LA 3GJEA 4UQ2A 4KKBD 3TWCH 1K8DA 4K7PH 2ED9A 5KOVC 5TE4L 1DJSA 3HRPA 5GGRA 4R7NB 3VA6A 4XRCA 3FZUD 1C8PA 3WD5H 3I2CL 4HF5H 5CEYB 3AU1A 3CFEA 5C0AD 2EYTB 2AXHA 3VG0L 4FQ1H 4KKLD 5KTEH 3HZMA 2D0HA 2DBLH 5FM8A 3ROOA 3AFLA 4HBQA 1QFUL 3HRZB 3PDGA 1V05A 1NC2A 2VL5B 1K2DA 1KFAL 3MMEB 1FRGL 4PRPD 5LVEA 1RJCA 4TPRH 3RU8L 3W9EB 1F6AA 4ODUB 2DICA 2EXYC 4MGXA 1Q0YL 3LEYH 4O02L 1BP3B 3E3QE 1BQUA 1UA6L 1Q8MA 1VENA 1FPTH 3DRQB 1BJ1J 3M45A 1LO5B 3B43A 5IB2A 3IU4L 2GK0B 2YD3A 4G9DB 3C5ZB 3RL1B 4HKBB 2A6KB 5IB3B 3A67L 1IGYA 3QUXA 4KXZH 3QPXL 1I85A 2MPAH 1AGBB 3L5HA 4UV4H 5E8OA 1J1OL 3EDKA 3GNMH 4IOSD 1DQMH 1AIFB 3KPPB 4N90D 2PO6B 3ZYZA 1FSKB 5IFHH 5L0QC 3U46A 5BS0A 4G6ML 4N68A 1DSFH 3BH8B 4UUJA 1CK0H 3CSYB 3UZEA 4TSBH 3VFUB 4FQCH 4F9LA 1EHLH 1FYHB 1OGAE 4TVSa 5HYJA 1T2QL 5CJQH 1A9EB 4KHTH 5I8EB 5F1NA 5JDJA 1GPOL 4P2QA 2ITCB 5JXAH 1ZVSA 3G6AA 3F12B 1YC8A 1QA9A 3NGBC 4I5BA 4ZTPH 3LOWA 4MDIB 3TH3T 4NO0A 1KT2B 3CH1B 4I3RH 2E6QA 1KN4L 3ALPA 3B2VL 1HSAA 4IRJB 2RBLA 3HAEH 3RIFF 1DFBH 2KZWA 1A22B 3NCBB 3ZKSD 1YY9C 4DUWA 2Y1VA 1PKQB 2YD1A 3ILPB 4RWYL 3O4LD 3BGMB 4N0FA 4F7TA 1JGUH 3L95B 4ZMAT 3U4BL 5HGAA 3VE0B 4X7SL 1TZHB 2VKWA 1G7JB 1SJXA 4FZEH 4OCLC 1P6FA 2CKNA 4YC2B 4LEOA 1A4KB 4KMLB 4QHLA 3D85D 1RZ7L 4ZSOA 1LEIA 3UO1L 1M05A 1KJ3H 5E8NB 4W6XB 3QDMD 4XBEL 1KSRA 4PRAB 3QWRA 5DRNB 2BVOA 3GSWA 4R4FL 3VI3E 4LSQH 1U58A 4PJAA 3FHQA 4UBDD 2IANA 4UI2A 1F4XL 3QNYA 1JWUA 1RJLA 5TDNA 1AC0A 2BY1A 3O2WH 2VDPH 4J1UB 4Y5YA 5F88A 3QQNA 2OR9H 5D7IB 3TJHD 2I9TB 4XAKD 2QL1A 2XWTA 4XMLL 4YIQA 3VW3H 1GCFA 4DOHB 3O6LH 4ELMA 2GAZB 4OCXL 4LHQB 3QDJA 4NO2B 4YJZL 3PQYA 1I8KB 2AI0H 4JY4A 4S1SL 3H0TA 5D71H 3NFSH 2GJZA 2OP4H 5FKPA 4ZFFB 4WVRA 3MO1B 3MRKA 1RUQH 5B39G 5EO9A 3BZFB 1OAQL 3V0WH 1HHJA 4PV9B 2EDJA 1MUJA 2AEQH 4MNHB 8FABB 4Y5VB 1C12B 2DM3A 3TO4D 1Z3GH 5AAWA 4U0RB 5L2KA 5ADPH 1R3JB 3HCVB 1A6UL 2AK1H 4Z95L 1BBJA 1HI6A 3B9KB 4KQ4L 4LHUG 4LQFH 3U9UB 3QHZL 2IFGA 3B5HA 4YQXH 4L4TB 3MA7B 1NKRA 4KTDL 1OLZA 1TFHA 3SCMB 3WFBL 4NN7C 4LLVB 2IJ0C 3HKFA 2WUBL 4JG0L 5L88H 3WJLC