1I9JL

Testosterone complex structure of the recombinant monoclonal wild type anti-testosterone fab fragment
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
219
structure length
219
Chain Sequence
DVVVTQTPLSLPVSLGDQASISCRSSQSIVHSNGNSYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into steroid hormone binding: the crystal structure of a recombinant anti-testosterone Fab fragment in free and testosterone-bound forms.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords RECOMBINANT MONOCLONAL ANTI-TESTOSTERONE FAB FRAGMENT LIGHT
total genus 50
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2001-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1i9jL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1i9jL01
4FG6D 1U8QB 5E2UL 2O5YH 5SX5H 4JVWA 4QRPE 1CR9L 4QRSA 2DLFH 3HNVL 4JM2F 5IGXL 3MA9L 3PP4H 2K7QA 1T83C 3GRWH 4PJHF 4OZGE 4G9DB 1FCCA 2M8XA 1I1YA 4JHWH 3HPJB 2O5ZL 2VZ3A 3REVA 3WFDH 5ISZA 5FUOL 3BP5A 4GRWF 2F53E 5EU5A 1BQUA 2XQBL 3FMGL 4XBPB 3MRFB 2EIZB 2VN4A 2AV7B 5SV3A 3OPZH 1JHTA 4U2YA 5GGVY 3BP4A 2DWDB 3EJZD 1MCKA 1TTGA 32C2A 1YN6B 4ETQA 1AHWC 4YQXH 4J4PC 2RR3A 2VLLB 4LCWA 4OLUL 2PYFB 2MOVA 3C5SA 5LGHL 1WEJH 1XF5A 4H88H 1YJDH 4Q9RL 1I1FB 1INDH 3L95A 4P9MH 4RDQF 1DVFD 1HH6A 3LKPB 5GJSL 3VG0H 3BFOA 1OL0A 2EO1A 3CDGA 1TLKA 4JN2A 2EICA 2ZKHL 1Q9LA 1NEZG 3TCXA 1XAUA 2NTFA 2ADGA 1IILE 3G5VA 1D6EA 1MUJA 4K3DL 3QUYD 5GGSA 4NKQB 4Y5YB 1KC5H 3V0VA 5LCVH 4K55A 2IAMC 4GG6B 4LASH 1MCRA 2WIIA 3CC5B 4XP9L 1P4BH 2CPCA 1FAIH 1H5BB 2X1PA 3IFOB 5E8EA 4K23H 5FHBH 4NDMA 4NO0B 2BDNH 4OSUH 1F6LL 1G0DA 4QWWD 1H3XA 3GFUA 1T80A 1J9CT 2GSGB 5DSCA 1U3HA 4M6MH 5KG9A 1P1ZA 3DVGA 5L2JB 3O6ML 3BDBA 1U8PA 3TNMA 1IGML 4ZO6A 4JAMA 4DTGL 4DKFL 1FE8L 1C08B 3CDFA 3VWKD 2YPKB 3MRDB 3REVB 1HHHB 4YHIA 3TBSA 2DQEH 5JO5A 2ERJB 1S7UB 5D2LF 4HS8H 5KW9H 1KCUH 2OP4H 3P3YA 3EYSH 3VCLA 4ONGH 4X9GA 3TNMB 3ZT6A 1HWHB 3QQ3A 5I19L 3TO2B 4NZTH 4OIBA 3TV3H 5CSBA 3KYNB 4PGEB 3K1DA 3R06B 5GGRB 5BW7C 2F15A 3CH1A 5C08A 4M5YL 1U8MA 2BC4B 1T1YA 4BQBA 1JHKH 1NEZB 3BESR 3RL2B 3S8WA 4KK5D 4TVPL 2HRPH 2FJHB 2HVJB 2ICWI 5LGKA 1JZ7A 4D8PA 5J12B 3QRGL 4OCYL 5C0IA 1YEDA 3O6KL 3ARGD 1CFNB 1MNUL 5HGHB 5D2LE 5HI5D 4ZMAT 5FYKU 4M1GL 3EJJX 3LB6D 4PJBA 4HIJA 5GZND 5SWQB 2FZ3A 3MOBH 1VACB 3TIEA 3HMXA 1CL7L 4YHNB 4XZUA 2W65A 4HPYH 4P23B 4FXGB 5DLML 3CFIC 4FQHB 4DUXA 3IGAB 3CDYA 4PBXA 4KDTA 5I9QB 4G8EB 3FT4B 5J6HB 3ULVE 3F5WA 1KCVH 1RZGB 1N26A 1OGAD 1NGPL 1FO0L 1VFMA 1X5XA 2BY2A 1TZGH 5ICXA 2PYFA 1YN7B 2Z9TA 2V2WA 1LD9A 2CDGA 2IBZY 2CGRH 3SJVB 3U0WL 2FBOJ 1JNLL 3O8XD 3QUXA 2C3GA 3IJYA 5CCKL 4YXLH 3VXME 5T1DH 2DF3A 3WL9B 4JEGB 4G9FA 4JFZL 5D72H 4NN5B 1I7UA 1ZGLM 4X6DE 5BZWA 3PIQB 3D85B 1B0RB 3RZCB 4JANA 1A6AA 2J8UE 5FO8B 2XA3A 1S9VB 2H8PB 1D5IL 7CGTA 5HHQA 4PJ8A 1I8MA 2X4PA 5GGSY 3QDMB 3FO0H 3RWEA 3RNKA 3CSBA 1YNTA 4XHQA 3OX8A 4RQQB 1G7QB 4OJFH 1QBMH 4I0KA 4Z7UA 4F57H 3UTSB 1P5UA 1LP9F 1NBYA 1CFTA 3L5XH 1FZOA 2L4OA 1DSFH 3FO1A 4H0IA 4LRNH 3TH2T 2DLIA 5D1ZD 1CGSL 3ARFB 4YHZL 4G6AD 4LLWA 4MNQE 1NAMA 5SWSE 3HN3A 2QADB 3SQOL 4BQ6A 4Z7NF 1FNHA 1M7DB 3K2MC 4C56D 3RPIB 2XKNA 3CXDL 1OGTB 2JB6A 5K9OB 5DQ9A 4MNHB 2DQDH 5IFJB 4HCRA 4JG1L 3PGCB 4WHTB 1NAMB 3LOWA 4QRRD 1LP9E 2AV1B 3FJTA 1LDSA 2ZCKH 1N59B 3ARDC 3MLRH 4L4VD 4OZFH 4P2OD 3CJJA 2XG4A 3RRQA 1CTNA 4OZHE 4UBDD 5F9WB 1DQMH 2GW5A 1WC7A 3WUWA 4DUWA 3S9DB 5GJSH 3UEZA 1KLGB 1MCWM 3P4OA 4HGKC 4ODTL 4QXGL 4L3AA 1J18A 3KYKL 4DGIL 5C0ND 4MJID 4JFDA 3N1MC 3GMMA 1NGQL 1A7PL 2RFXA 1JFQL 3TBTA 2WBJC 4QHUB 4WFGE 1S5IH 1TZHB 3UZVB 1J8HB 1BQHB 4NQEA 3I75B 3WHE1 4V1DE 5HBBA 1QLRA 4HK0A 4XH2A 1A9EB 2HN7B 1PAMA 2CUIA 1V3MA 4ZOEA 4DGYH 3DXAA 3VW3L 1XR8A 5D6CB 2FATL 3D39A 1ZVSB 1IGFL 4KVCH 1OTTC 4LLMA 2D0HA 2E6JA 4OKVA 4YHKL 1A3RL 1NC2D 4P23C 5E7BA 5IB5B 4XP6H 3ZKND 2DQHL 2H3NB 3GMRB 4LLVA 4XNMB 4EVNA 2XN9D 3REWA 1B4JH 4JDVA 1NCDH 4MX7A 4ONFH 2IWGA 3WHXB 1ZA3B 4HWBL 3K8LA 2HFFA 4LGPB 1EAPA 1FL5A 1BBDH 4AENA 2BY0A 3Q1SL 2FL5B 2IBBA 4JDZA 1KSRA 3HZVB 2P44B 3A6CL 4YR6B 5C0JB 3GIVB 4L1DA 4XB8A 1ZTXL 3SCMB 5EIIB 5AZ2H 4B0MM 5I73B 2CKBH 2FECL 1EBAA 2XWBB 1JTOA 5BZDA 3RPKA 3MLTA 1RMFL 1SMAA 5CP3A 1N4XH 4RMRA 1DQJA 5JW4N 1WTLA 4HUXB 3SGKC 5SWSD 1B0GB 2V2TB 3QDMD 1D5MA 3BISA 4YEEA 5HGAB 4JVPA 3O3UN 2RGSA 3QHTC 4LHUA 3MX0A 1KB5L 5CSZB 4ZAKD 4G3YH 3L5WB 2ICWJ 4HGWA 1YEFL 4WW1B 1YEKH 2DL2A 3LQZA 3FQUA 3V5KA 4H1LG 2CIKA 2EIBA 3OXRB 3N1FC 1D5XB 2E9BA 1A3QA 4LVHC 1FQ9C 4IMKC 5DMJB 4L8BB 1HIML 1A4JB 5GSVA 3BD3A 3T77B 3VGGA 4KV5E 3HMXH 5CBEB 5JPNB 5INDB 1HSAB 3N1PC 3DROA 3FKUS 3MRMA 4G6AC 4J3TA 4F9PC 3CXHJ 2VLRE 1I7TB 1Q0YL 3VI3E 1SYVA 3LEXA 2JK5A 3HZYB 2VLJB 4RAVB 1UVQB 5CGMA 5ITFB 2ARJB 2QQKH 1OY3B 4X80H 4MCYB 2OJEA 4J8RB 1KCSH 4ZXBA 3DOSA 5C0CE 4KKLD 3L1OH 4PUBH 2H41A 3GSVB 4CVZB 1G9EA 3OKDB 5IB4A 4UDTB 4BSJA 2VLKE 4Q9RH 2O26U 1I3GL 2H32A 4Z8FH 4BM7A 2AJVH 4IRZH 1FVEB 3SGKA 5FA4B 4PRAA 1V8HA 4ZUTA 5A2FA 2Z35B 3B5GA 5HYSB 2D3VA 3D39B 3MC0A 4O9HH 2F54B 5ETUB 5CD5C 3FRUB 1QEWB 5DVMA 4ZAKA 3KNBB 4MQ7B 4AIXA 2GFBA 3JWNC 4JY6A 5I66A 3DJ9A 4XRCB 1F4HA 4P2QB 3V2AR 3VG9B 4DAGH 1LEGB 1EFQA 4NO5B 5L6YL 4EVNB 5FYLD 5E6IA 1DVFB 4I0PA 2YD9A 1AR1C 4E42A 4MA7H 1T20B 1P6FA 3DBXB 3BVNB 3QUMB 4Y8AA 2FO4B 4UUJA 2E8ZA 2FJFA 1DQJB 2IFGA 3DIFA 5MENB 5F7KC 4M8QB 1JYWA 3ROLA 1DEEB 1IT9L 3HG1B 1VB9A 1Z5LB 1ONQB 1TQBC 3C60A 3IXTA 2KQMA 5J12C 4Z78B 1BVLA 4I18C 2NX5E 1CT8A 4PRPB 2B39A 5DMGD 4PB0L 1C08A 4HKJA 1IC5H 2FD6L 3GHEL 4EBQL 3QDGA 1AIFA 5D71L 3I6LD 3MREA 5JLZA 3DV4B 3AU1A 3UPAA 3ES6A 3O8XB 3RNQA 3BMVA 3VFWB 3QG7L 3KYMA 3HHRB 1DBKH 1BLNA 2AK4B 1BQSA 4N0YH 5HYSG 4YPJA 1FVCB 1MF2H 4EI6A 5F7UA 1NBYB 4M6NL 1VEOA 4YO0A 4D94A 5CIPH 1FFPB 5J13C 3MXVH 4GKOA 3P4NA 4M7LL 2NNAA 4JFFB 3WIIL 1S7UA 2Z31A 4ZG1A 1V3LA 2DDQH 2R0WL 1U3HC 2CR3A 4L3CB 3RKDD 1VKXA 5IM7B 1Q0XL 2WUCL 4IOFC 4NRZA 5EU6E 1MCEA 2EDFA 1DQML 4PJCE 4KI5E 4AZ8A 4HWBH 3VW3H 5D5ME 5EZLB 2MMXA 2D9QB 1EMTL 2YUXA 2AV1A 3SE8H 5CP7B 3SJVA 4N9GA 1T2JA 3LS4L 3OR7B 2MKLC 3I6KA 2W60B 4KZEL 4KROB 4F37F 4FQIL 4FQ2H 5E8NB 4AH2B 4LFHD 4ZNEE 1GJIA 3GMMB 4OTXL 2O61B 1LO0L 2VXTH 4ZFZB 1X7QB 3GBLA 2VZSA 2OTUB 4QRRB 3QYCA 5B21A 1ACYH 1WSST 5GS0L 4ZFGL 4NOFA 5IQ7L 3HUJF 3MLPA 4XH2B 3LEYL 4C57C 1OF2A 1OAZL 4JFEB 5GGVH 1X5YA 1AQDA 5GSRB 4Z76B 4WUKH 1Y0LA 3UO1L 5B38B 4HUWB 1MVFA 4J23A 3WIFB 3QUXC 4Z7WE 3VFSB 4KTYA 2ID5A 2OBGA 3S4SB 2ATPB 3MO1B 5CD5D 3RWIA 1ZV5A 4OLWH 1AXTL 3G9VA 5EOTA 2NY5C 3B9EA 1ZEAH 1I8MB 1CE1L 4HV8B 5T1KD 1F3DH 5EUOB 3TT3L 1MFDH 4EN3D 5MEND 1CFBA 3QFDB 3DGGB 4YK4B 5D7KD 2UZIL 2A1WH 3VI4F 3MV8D 3QWQB 5C8JA 2OI9C 4NHUB 4QRQB 3VFOB 3O6FA 3RU8L 2FEEI 4M8QA 3NZ8B 1A2YA 5JLZB 2PO6B 5C3LD 5CEXA 3AM8A 3P4NB 2CGRL 4GT7A 3C8KB 3PF2A 4JJ5A 4R97B 2ITCB 4FMKA 1OAKH 1G7QA 1XF1A 3OGCA 1JPTH 5C07E 4W4NA 4OZHB 3KDMB 5HHOA 5E0QA 2YEZB 3VH8G 1LQSR 4L4TD 1RJLA 3OF6D 3S35X 1CDUA 4QF1B 3MCLL 1P6AB 1KBGH 2QHRH 3C8KA 5HDBF 1S7TB 5JPMA 5DRXA 1QBML 4PGBA 1DQLL 1XIWB 3O2WH 1IKFH 4Y2DB 2R9HD 4LSRL 3E8UH 3S7GA 3KYOA 2VQTA 3EJYC 1S5HA 3O3BB 4L9LA 4HZLA 4HDIA 1A3LL 1W0YT 2EDJA 4MCZB 5ENWB 3BEWB 5I16A 3MYZA 1EH9A 4RFNC 4LLAA 2PW2B 3QWRD 4NRXA 4R0LB 1AY1H 1U8OA 4FP8H 4PJIE 1CDGA 4KY1H 2OMNA 4S1DC 4YC2B 1N2RA 4P4RA 4MA1C 3CGTA 1WBXB 4NGHH 4C56A 1QFUH 1YN6A 2W9EH 3IDMB 3QT2A 1MCCA 2CRIA 3HCVB 3K81A 3TVMB 2HMID 3LKSA 4LEXL 3WLBB 5HYJB 3T4AA 1WWBX 3BH8A 3QRGH 4AL8L 1NC4B 3MODH 4KAQL 5A2KH 4PJ9B 3NA9H 3TNNB 3H9ZA 3FAXA 4LAJH 3R1GH 1TZHA 4Q0XL 5DVNA 5H94A 1A7PH 1PG7L 1KGCE 4MA7L 1MVUA 3WEXB 4Y1AB 4P3DB 2A38A 1JPSH 3LN4B 1K4CB 4PRHB 4S10A 2JF1A 3HC0B 4GG8B 4CW1B 1S7WB 3BGFB 2H1PL 3DRQB 5E2VL 3K0WA 5DHYB 3VXMA 3DSNA 1HYRC 5DGQA 5EZJA 3NTCH 3TFKC 3U79A 4PGDB 4PTUA 4NFDA 1CBVL 1EHAA 4M1DH 4NHCL 1W0VB 1RQ5A 4G9FD 4DN3H 3C2AL 4M61A 1V5JA 4WW2C 5FM5O 4Z95L 1VGKA 2SEBB 5E4EB 5AYUH 4NP4H 3QUXD 1XGYL 2HG5B 2H26A 3FO2B 4JJ5B 3HE7A 1U6AL 4JKLA 1XGTA 2JJTC 4JM4L 4Q7DA 4DKDC 3MGTA 4KDWA 1MRFH 3OG4B 1O0VA 5A2IH 2PW1A 3WNMA 3VCLB 1A6ZA 4PFEA 1WF5A 2R8SH 1F97A 5JDJA 1FNSH 2X4OB 2PUQT 2OL3A 3ARBD 2KDGA 1JYXA 5JO5B 5I1IL 1I1AA 2NLJA 5DK0A 3SDDD 3KPTA 3VFVB 4K94L 2H9GA 1MFNA 1Q9KB 4JG1H 4OZIE 4HWZA 2LABA 1UZ6E 4M3KB 3DX9B 3PV6B 3E3QE 3GSQB 1BGXH 3O4OC 4ZUUB 1FLTX 4WCYL 4Q6IB 4ETQB 4XMKH 3V8CA 3VI3F 5FM5M 2F58H 2WANA 1H8OA 1FO0A 5IJKC 5KS9E 2AXFB 3V5DB 1BJ1H 2APTA 2HT4C 5LXGL 5DURB 3JV4A 4RIRA 5GS3A 3QWOA 2ESVB 5L2KA 2R1WA 1MCOH 3S36X 1XGQA 1TJHH 4LPWA 3C60C 3DXAB 3GJFB 3BP6B 2OZ4A 3WXWH 1YEIH 5HSFA 3VRJB 4EUPB 4RAVA 1FG9C 43CAB 1GVIA 3N50A 1CXHA 4ERSH 3WV0A 4NUGH 1U3JA 2EYSA 2RFXB 5HVWA 3D18B 3RHWF 2X9YA 3NFNB 4LK4A 4KTDL 4XP1H 4IRJD 4UTBH 4JKKA 3MBED 2DI9A 1BZ9B 4UOW0 5TDOA 5FF6B 1MWAL 4DN4H 2R2EA 1WAAF 4UIKH 3VFRB 2BNRD 4OM1L 2ICWA 5MEOB 3ULVL 1NLBH 5CHNB 3VWKC 4OGAC 4Y4HC 5E8PB 4WEMB 3KJ4B 5LQBL 4JREB 4XBEH 3V6ZA 5T3ZL 2J5LB 1FNGB 1YEJL 2DRUA 4MWFA 1HI6A 1IFHH 3T0EC 2G2RB 5GRUL 1F4XH 3UCRA 2J12B 1PKOA 5I1GL 4X7CC 2OTWB 1QNZL 3B9KD 3DV6A 3VXUE 3E6FB 1BVLB 4GXUM 3RBSA 2C26A 4Z7UF 4NZRH 1IQDA 1E4KC 3VGEA 3D69B 4JHWL 1DEEA 2F5BH 3FTGB 3QIUA 2XZZA 1FDLH 3BPNC 5D9SB 4CBPA 4JFFA 3GBNH 3DX9A 2P5WE 2IANE 2PKDA 3KLHD 1ITCA 2D31A 3WJLA 1WZMA 2BSED 4M6OH 3RVXC 2A9ML 3MACH 4MXWL 4Z78A 3LB6C 1NQBA 5GGUA 3WO4B 2EKJA 3B3IB 4WUUE 2NLJB 3LRHA 1LMKA 4MAYC 5B39A 3IFLH 4NN5C 4LLWB 3NFPA 2ADJA 2DI8A 2MJWA 4OZ4B 3WKML 3RIAK 3ARFD 5FECB 4NYLA 2ILLA 1XGRB 2GJZA 3UJIH 3LY6A 2CK0H 4M5ZH 4U1NA 1RURL 5E94A 2PYEB 5L8KB 3HE6C 1KXTB 1SYSA 4WU5A 5I1CH 4MJ4A 3LKRB 5FDYA 4I4WA 5JIHA 2RJMA 4LAQH 4C54A 3O2VL 3ZE2E 2YPLE 2Y6SC 2OXHA 3ARED 5ESQA 2FX9L 3ARGC 1TIUA 1UH3A 4P2RE 5AD0A 5I15H 5FO7B 2XFXB 5E94B 1DBJL 1DLFL 3EHBC 2GTZA 5ITFA 4KAQH 3ZE2F 1U8HA 3VXNA 4UILL 4JO4L 3IAQA 4O58H 4POZC 3IDUA 3BOVA 1OT1A 2Q8BL 3NCJH 3EDEA 3OKDA 5DZLA 4L4VA 4D0DA 5LWYL 5EC2A 1P7KB 3C60D 5I1KH 1WBYA 3E2HB 1JWMA 2Z8WC 4TOYL 1RZFL 2C1PB 35C8H 3OKEB 3UTTA 4WENB 4GRWH 4PBVC 3EOBB 5DEGA 1MJ8H 5I74B 3VXQA 3WLBA 5HYJA 4X6EA 4U1HB 1GPOH 3C5ZA 1FL3B 1TQCC 2HH0L 1Z6JT 3P0GB 1ACZA 3DVGB 2FLRT 2EC9T 3E6FA 1SM3L 5IKCA 3K80A 4YXHH 3SN6N 1UB5A 5EFIA 4P59H 3LS5L 4EZMA 1NCWH 4HUUB 3P30L 4HWEH 2FHCA 2X4PB 3VRLE 2A6JB 5T3XD 5JIIA 4Y4KC 1UJ3C 4POUB 3S88H 1YY8A 4JY4A 3V6OA 4G7VH 4Y4FD 1A7QH 2Z91B 1S9XA 1V3KA 1BP3B 1BD2E 3ARDA 4V2BA 5CILL 3IT8D 3RTQA 1CDBA 1MNUH 3CDCA 1EJOL 1IC4L 4NJAL 4FA8A 3IVKA 4DW2L 2OP4L 4R3SB 2VKXA 4JQIH 3GSUB 3B8YA 1IL1A 1U8OB 3WO3B 1KLUA 3AROA 4QHNA 4NBZB 1D5ZB 5D6DA 2APBA 3NIGE 3OGCB 4MGXA 1KIUA 5KSAB 5IWLA 5F6IB 5D7LD 5IVZA 4R26H 3HE6A 1T0MB 1JTTA 3SKUD 3OHXA 4JZOA 1BBJB 3LKRA 2JE8A 3G9AB 4PREA 2VLLA 4DKEL 1KB5B 3W81A 3MPCA 1E28B 5F7DA 4CGTA 5CP7A 1U8JB 2ENSA 2H32B 1LVEA 1AI1L 1RHHA 3MV9E 6FABL 3BEVA 2F5AH 3T65B 2AABH 4RFOL 5C0NC 1WZ1L 1EFXA 3EO9L 1G7HA 2BNUB 3SCMD 1B88A 1CDYA 2EDKA 2WBJD 4GMTH 3TP4A 1YNKL 1FRGL 1WFUA 4RNRA 1CLZL 2LV4A 1CF8L 4K9EH 2EXWD 4X6DF 4I1NB 5IVXB 1XGUA 5J1AB 2RBLA 3BQUD 2DM2A 5FM4A 1EFXB 2MCPH 4MA8H 2J8UB 4K7PL 2Y06L 2ATKA 3RDTB 3D2UA 4ELKA 5BS0B 2IQ9L 1NGZA 4X6DB 2BY1A 5CKGA 3PQYD 3X3FH 3JSSA 1UB6A 2KL6A 4RBPH 1DJSA 1NMCB 4NZJA 4EKXA 4WFFE 4E41E 5GHWL 2ZKHH 5EZOL 1ZANH 4LEXH 1OSZB 3X3GH 1YNTB 4JM4H 1HSBA 3OJMB 1F4WH 4U1SA 3GHBL 1CT8B 4HCRH 4OLXL 3SO3B 1A2YB 4TTDD 3GSNL 5FA3B 5F89A 5AEAA 1YEJH 4LSQL 1A1OA 1X5IA 3LN4A 4W70A 2XWTB 5F7EL 3Q0HA 3NA9L 3GMQB 1IGIH 2V2XB 4X9HA 4LP5A 5F7YC 5HDBE 1S7RA 5FOJA 1WFOA 1HKLL 3HAEA 2GJ6D 3FB5B 4Z7UB 1JF6A 2JB6B 5K9OA 3QIBB 4KXZI 4EDXA 1M7DA 1EEUA 1DBML 2EH8L 3ULUH 1G6RB 2F19L 4WGVB 4MB5A 1K9TA 4JM2C 1J7VR 2JLLA 1YNLL 3GUTA 5HYQB 2RB8A 4NPYA 4OI8A 3DUSA 1OAQH 4H25A 4MJ6B 1LEIA 2K7PA 4HG4K 4UT7H 4R7DB 3QUZA 1A3LH 1E4KA 3BRFA 3MRIA 3OJ2C 3TM6A 3KXFD 2NY1B 3FHAA 1BJMA 4OZGF 2W07A 4JGMA 4M7JL 2OSLA 5GGRY 2DN7A 3SDAD 1VFAA 1UKTA 5FKAB 4BZYA 3AGVA 3ZKQD 1T22B 1ZLWK 2UVFA 1DVFC 4G8GB 4J1UA 4L8DA 2G60L 3HAEG 1JFQH 3RWCA 3QUZB 3HI1B 1RZ8A 4MCYA 3RL1B 1C5BH 3EOTH 2W9LA 1CL7H 3K4ZA 4ZSOA 5HPMB 1MUJB 4HT1H 1EK3A 4OI7A 1JN6A 2R29L 4TQEH 3HI5L 3IRZA 3FFDA 4PRPD 1GGCL 3WFCL 5HD8C 4P4RB 4OV6F 4P0DA 2J2ZA 4JO4H 4YXKL 2LFGA 5AUMA 4KI5C 3HNSL 1EGJH 5SV4A 4HLZG 1S8DB 1QA9B 2HLFC 1PG7X 5T5FH 4QCIB 5CEZL 2F54A 4OLEA 1KJ2L 3UP1A 1IEBB 1B9ZA 4AEHL 1UC6A 2OZ4L 4NM4H 5J56B 2NY6D 1GIGL 1CFQB 1A7NL 3IRPX 2YC1A 5E00B 3WFEH 3QBTB 4AQOA 5C92A 3C09B 5BV7B 3ISWA 2GQHA 3D0LA 3SKMA 3MRNB 1KCRH 5FDWA 3ARYA 1P9MC 5BZDB 3MO1A 5KSBA 1K4CA 4S2SA 4J4PA 1A02N 4U4BA 2Q3ZA 3I6GB 3VXTB 2ARJQ 2V2XA 3GMOA 1U3HD 1JCKA 1XCTB 4HUVA 3DXAD 5C0BE 4WTWA 3IFLL 3QIUC 1D5IH 4HUMB 1R3IL 4IOFD 2Y36H 3GO1L 1UB5B 5EFIB 4D2NA 6FABH 2Q6WA 2PTTB 5GSVB 3ZYIA 2P5WB 1INQB 4E0RA 2QQKL 4UAOB 1VCAA 5IF0A 1YNKH 2GJ6B 4U6HA 3TJEL 1E4XI 1IM9A 4RMUA 5DHVB 2UYLB 4IRJB 3DHMA 3RIFF 3RI5K 4K2UL 1UEYA 5EH1A 2KBGA 3WN5C 4HHAA 4KQ3L 1HILB 4XP4H 1SBBA 1CICA 3SGDI 1UJ3B 3P77B 1WBZB 4WI5A 3H9HA 3RIAF 3DMMC 1JNHB 4KKCD 1U8IB 2QTEA 4L29B 4NO3B 1GGIH 3QQ4B 3VFGH 3RVVD 3VXPA 4RIRB 4OZIA 1QR1A 1UM4L 4G80B 2DQTL 4MD4B 3GSWA 3QWRA 4DK6A 3MRKB 4OFKA 1WZLA 4HS6A 5E95B 2Q87A 4L9DA 4RGMB 4M9PA 2V5TA 2DWEA 2Q76B 2AK1H 3CDGB 3N1GC 2RAMA 1CK0H 3R0NA 2YZ8A 3QQ4A 1TPXC 3VXPB 1V7NH 3V4VL 3LCYA 1GZPB 1CD8A 4PGCB 3EFFA 1J8HA 2ADIA 3MRHA 5IBLC 2NY0D 3VXMD 4CDGC 5HHNB 4BZ1L 3IDJB 2BERA 2D4DA 1QFWL 1XGPA 4FG6C 4QT5A 3Q5YA 4A6YA 1UG9A 5EO0A 4GBXB 3ULVH 4Y5VB 3PWPD 5JORA 1GPOL 1DQQA 1DUYB 3ORJA 1SEQL 2Z92A 4Y4KB 4DAGL 2QLVB 2GJJA 3IDIA 5C0JA 3QCUL 4JY4B 4I3GA 3ILQD 3MR9A 4ZFOB 3BHBB 1JV5A 1P5VA 1OM3L 5DEGB 1G9MC 1KACB 5EA0H 3VU2A 4YEFA 1AO7E 2VUOA 3IVKB 5CJBA 4HUWA 1N8ZB 2DKMA 3IJSA 1CDHA 1KBGL 1L4IA 4KRPC 3U36B 4IRSD 3HZKA 4OAWA 1MJ8L 3NIDE 3QP3A 2YC1B 5F7EH 1D5XA 5D70L 4K07A 35C8L 3FQTA 4OD1H 5I8CA 3DURB 5FHAH 2VDKH 4HJGA 4I3RH 4MAYB 3T8XB 1JNNL 2FHBA 3T3MF 1KJVA 4X9IA 5F1SA 3QJFB 4I9WD 3U7WH 3UPRB 1L0YA 5EBWB 4JFFE 5IOPA 4XMPH 5DJDA 2NZ9C 2ZCKL 4YHMH 3VD5A 3AUVA 3JV6A 5A40E 3ARSA 1EMTH 2YUVA 5DQDH 5EBMA 1BVZA 1CG9A 1ZWIB 4F7MA 3ARTA 3LMJH 3SY0B 3MQIA 3I3EA 2Z8SA 4Q9QH 5H8DA 4HX1A 4F37K 5B39G 5FO7A 4WUUB 3K74B 1I8KA 2P42B 2D03L 2A9MH 4GMTL 5HHVH 3PUCA 1IAOA 3MGOA 3Q2CA 2ITDA 4XCCL 1FZKA 3OKOB 1S5HB 1S78D 4ZOBA 3CH8A 5CZXD 1H3TA 3TJHD 5IIEB 1BZ7A 5EU7E 4OKVB 5IEHB 5FKPA 4JFDB 3LS4H 4TVPD 4XVTL 1UM6L 4FQPA 2K1MA 3GJEB 1G0XA 4YXKH 3IS0X 4X7EC 5F9JA 5E2VH 1XF3B 4NN7C 3JWOH 4G8GA 1IAIH 4MD4A 3QUXB 3GSRB 4H5SA 3D0VB 3FQWA 5IVXE 2CSPA 4H1LA 3FCTA 3NABL 4DKEH 3MRRB 4XC1L 1NEUA 2EDHA 3QI9A 4WO4D 1DFBL 4U7SA 4IOSD 4N8PA 2FD6H 3GHEH 1DANT 3RNKB 3F7VA 1QFWI 2VXSH 4I77H 4FNLL 1AO7D 4YDIH 2YRLA 3SDDB 3T3PE 3RGHA 15C8H 3VFPB 2BNRE 3V7AE 2W0FA 2NX5D 3K46A 1I7UB 2J6EH 3NZHH 3TWCL 2DJSA 2VL5B 5CFHA 1FNLA 5GS0D 3GB7B 5GS2D 2RIKA 2RCSH 1NCDL 1LK3L 3H0TB 5HI5C 2EIEA 4JREC 2P7TA 2DLHA 3TO4D 5K9QI 1S7RB 4S1RL 5F1OB 4W6WB 1CXFA 3GI8L 1FORL 1UQSB 3MLWL 3D69A 4TUOB 5CS7A 4IM8A 1PZ5B 1U8MB 2M26A 2V2TA 1GL4B 1PQZB 5IV2A 3LQMA 5C07B 1NPUA 1NAMH 1WWWX 3DV4A 4HK3J 1V7NL 4LFHG 4N1HB 1JMZA 4J3UA 4O02L 1IC5L 3C87A 1BD2A 4MA3A 3U46B 3PXJA 3N85L 4OF6A 5EZOH 4Q9CA 4WY7L 2CLZA 3TZVB 4YE4H 5DYOB 4GUPB 1FZKB 4GFTB 4WU7A 1AGCA 1BHGA 3WXWL 1PDKA 5E9DE 4YDKH 1M71B 1UM4H 1YPZE 4LSQH 2HT3D 3CMOH 2VLKD 3GSXA 4LKCB 2LU7A 3KPQB 4X4XA 1GGIL 1CDIA 4PJCB 4MHHG 3H6JA 3EUUA 3KLSA 1AE6H 1HHIA 5A43C 5E2WL 1IC7H 3DSFH 3EDDA 3CFDB 5TF0A 1AGCB 4O00A 3BIKB 5I1EH 4F9LC 3THML 1NJ9A 3O6FD 3GEWB 5F1KC 2XXCB 3HMXL 1A7OL 4MQSB 3SE8L 1ZVSA 5JTWA 4UDUA 4G6KL 4B41A 1A9BA 1AC0A 2UUDH 4QRTB 4PJ9A 2AV7A 1MIEH 3BP6A 4MVBD 4WFHD 3ZSTA 3CLFH 3V4UH 4L8DB 3T2OA 4K3JL 3CZFB 4BYHA 1QLRB 3T2QA 2GAZA 2R29H 5FGRA 3IS1X 3KPRD 1YY9C 2NY1C 1OP9A 3HCVA 4KJQD 4G42B 2E27H 5FEBA 4LCIH 2VLME 4ALAH 5ACLA 3MRLA 4UQ3A 4K8RD 1RZIB 3TBWA 3JWDC 3FQXB 5JNYA 4OZGA 3OKMB 5AYUL 2WNGA 1N6VA 4F58H 1FYTA 3PHQB 4PRNA 1G7PB 3PV7A 2DM3A 4F80A 3OX8B 5ERWA 4EIZC 3SCMA 4U6VH 2VXTL 1N6QL 5BVJB 3HI5H 4CMHC 4HBCH 4AENB 2LQRA 5DMGC 4BSVA 3UAJC 4K9EL 4HJ0D 5BS0E 4R2GB 2EC9U 2GK2A 4H0GA 3QEQA 3PHQA 4PRNB 4D3CH 4KUCF 1NMAL 2FIRT 5E8DL 3QNXB 1GZQB 5FCUH 1UYWL 1HH9B 1Q9OB 2B4CC 3FN9A 1RVFH 3PWLB 1GGYA 4JFHD 4U33A 1JGUH 5ADOL 2P49B 4IJ3C 4NP4L 5K9JH 3HE6D 3QUZD 4O02H 5F93C 5TDNB 3UBXA 1UZ6F 4YQXL 3RGVD 1TNMA 3R8BB 5C6WH 3I2CL 5D7LB 5FA3A 1OARH 2I9LB 1LNUB 4HXBH 3MNVB 2G9HB 2PF6A 1T21A 1UM6H 4PJXA 5FUZH 3UYRL 2C3XA 5IMKB 4IJ3B 1C16B 5DJ8B 3CXHK 4KI1A 1JHKL 4Z7WA 4JPKH 1UH4A 1UWGL 4M5YH 1GGTA 2GJ6E 4HZLB 2O5ZH 1PYWA 5FUOH 4POZD 2DMCA 4M62L 2MSPA 1FNEB 4R4BA 5DD5H 4ZQKB 1MQKL 5TE6L 3VFGL 4MB3A 4RX4A 1IGTB 5CJ8A 4S1QL 4I0PC 4XNQA 4JO3L 3FN0H 4XHJC 4NJ9L 2G5RA 4G8FA 4NPYB 1P4LA 5D7LE 5IW6B 2IMNA 3BEWA 3T0WA 1OW0A 4NWTH 1OSPL 3E8UL 2EKSA 4XNZB 5IMLA 3VRJA 4P2QA 3MLZL 2NW3A 5T1KB 1K5NB 3KPRE 4P2OA 5J8OA 4HKBA 2YPLD 4WI7A 4QOKA 4FQHA 4U0QB 1FFOA 1BMGA 1JGLH 1NFIA 2BVOB 4QTHB 1Q9WB 2HJKB 1MCQA 4OF0A 3JTTA 4TRPH 2CMRH 2EDNA 1PSKH 2B4CH 4ISVB 2C5DC 1EZVY 4R96B 3BZEA 4LRNL 5IJVA 4M8VA 1TETL 1N8ZA 4PJ8C 2A73A 5DJAB 2G75B 1ZHBA 4MVBC 5DS8B 2QEJA 4RQQA 2B20A 5DZOA 4ZNCD 4JFEE 5IR1A 1YUHB 4L8SB 4Y16C 3MRNA 2GSIB 2WBJA 1EV2E 3WYRA 1T89A 1SQ2N 4Y2OA 1WWAX 4Y5XA 5E8PA 2CDEA 4G42A 3O3EA 1P4BL 2XV6B 4C83A 3UBXI 4OD1L 4WV1B 3SKJL 3DYMA 4DTGH 1OAKL 4KK8C 3MGTB 4GRLD 3O6MH 1YMME 4O2CA 1KYOK 2UVEA 2Q7YA 3L5XL 1UCBL 4DN3L 1F02I 2R0LH 1FFPA 2Z31C 5GGQH 2BVTA 5T3ZD 1EO8L 1WK0A 3T8XA 4HJJL 5FYJD 5BVJA 4EI6B 4HC1H 4LSTH 4NHUA 1U8QA 4WO4B 3HRPA 4Y4FC 2XWTA 1C12A 1UZ8A 1A4KA 4BFIB 1SHMA 1CE1H 1HCFX 2YD2A 1LEKA 3ULUF 3AXLB 4DQOL 5I1CL 3V6OC 2BVYA 4F7CA 1H8NA 1GAFH 3RWGB 4FXKA 3WJJC 4F9LA 4ZDHB 4KV5F 4F33A 5CBAB 4NZUH 4R9HA 3G5ZB 4PJ7B 3KPLA 3QZWG 1SY6A 2OJZL 3U0WH 2C1OB 4YHKH 1R3HA 4YHOH 2EXWC 5IBTL 2WWMD 2DQJH 1NL0H 2W1NA 3RFZC 1A47A 4PJXB 3BP4B 2XQBH 1F3JA 3MYJA 4TSCH 2ZJSL 1FFOB 1RZKC 3C6LD 5HYSA 4XBGB 1E6JL 4KVNL 1VFBA 2XZAH 5IROA 1P53A 1JBJA 1B2WL 1R5WB 2EDOA 1AJ7H 4EI5A 1RZFH 4Y5YC 3MRQB 4PREB 1KJ3L 1NLDL 4PJEA 1HHIB 1YC7A 2EE6A 4F7PB 1V3JA 5K9KA 4UTBL 4WV1C 4G8FB 3T1WA 5B4MC 4KH2A 3KHOA 3SCMC 4X6FB 4OZHF 1JJUA 3UTTD 1G7JA 1J8HE 2W65B 3IDIB 1PY4A 5JW4Q 1WFNA 1JZ8A 2CD0A 3LN9A 5L88L 2BVPB 5JW3L 2BSTA 1AHWB 5EIVA 4HUKB 1G1CA 2QSQA 1NLBL 1PD6A 2Y5TB 3CX5J 4YIQB 1ZVHA 4WFED 4JDTH 3TFKD 1PW3A 5DD6A 4JVUA 3PHOB 5D1XD 2J6EL 4OCRL 2EEAA 3GJFK 2BMKB 3RWFB 3L5WA 1MCSA 4FQXC 1CD9B 3MOAL 3ULSA 3TPKA 3I2CH 3KJ4C 4HC1L 4LSTL 4OCXL 1NMBH 4UT9H 2VSCA 4MAUH 5CD3B 5KVDH 4Y16D 2EDYA 4LPCA 4AQ1B 2GUOA 1QSVA 1GGBH 1KTDA 2RHEA 1HOCA 1D7FA 5KBNC 4ZODA 3EOAA 1LGVA 2VKWA 1MLCA 5FV2A 5B8CA 5JOFB 5L9DL 3KYAA 4NHCH 4KGJA 3I50H 1T6WA 3LKNA 4DOHB 1YMHB 3WHE0 5C7XL 3DXAE 5IJKA 2CRZA 1OAYL 9CGTA 3DNKA 5CZKA 2ESVE 1X5HA 1DLFH 4Z5RA 5DK2A 5IFAL 4PP2B 1KTRL 3ZDXE 8FABA 3WS6A 2G60H 4WW2B 4UTAL 2A83B 5B8CB 3V5DA 3X11A 5JR1L 4OCNC 3BWUC 2NY3C 3SQBA 5CBEA 4JFFD 3RUGF 1XZ0A 2X5PA 4NQCA 3BPCA 2J4WH 4YHPA 2AXHA 3MUHL 1S9WA 1F00I 2GTZB 2MKWA 3PV6A 5D5MF 3RVTC 5SX5K 3RWCB 1KYOJ 3MBXL 3WE6A 3BGFC 1LDPH 4MDJA 5TE6H 3SDAC 4PJAF 4BFGA 1T66D 1YN7A 4H8WH 4PJEB 1A22B 4GQPH 2CXKA 2A6KB 2AEWA 1L9MA 5E8OB 3IJHA 1I9RH 3KYOB 3G6JA 2DJUA 1X5GA 3OL2A 3OZ9L 4ODXA 3PGDB 1U93A 1CU4L 5I2IB 2EYTB 4X7SH 3VDAA 1I9EA 2OLDA 4BK4A 2IAMB 4MNGE 3VRIA 3NPZB 2W9DH 4APQC 1Z2KA 2W92A 1AP2B 4G8GE 1YQVL 3QCVL 1CGXA 3RHWK 3MSPA 4NQCD 4D9RE 3HI6H 3KHQA 1B4JL 3IU4L 4NC2B 2L7JA 1X3DA 1G9MH 2YD4A 5GRWA 4D3CL 4PJAA 7FABL 2I60H 3ETBF 4MZ2A 1MI5E 4WW2F 3NN8B 2H3NA 5T3XE 3WFHA 2AI0H 3LZFH 3W39A 1F90L 1KT2A 2DJ4A 1EAJA 3GMOB 4HUVB 1EERB 3OR6B 3VWJD 2Q86B 1PEWA 4WW1A 3QEUA 1IE5A 1YNLH 4WWID 3MV7D 1H5BA 3IFOA 4HWUA 5CIPA 4XC1H 3DMMD 4KTEL 2UZYB 3S3SA 4JFPB 3E6HB 2A9NH 5HYIA 5D1XC 1NH6A 4BH7A 4DQOH 4HBQA 1V05A 1JF1B 2XIDA 2XRAL 3P0VL 4YWGH 1Z5LA 15C8L 3MBEB 1TZIA 4QYOB 5BOPA 5HGDA 3WSQL 1DP0A 4R97C 4X6CE 3PJSB 4UBDC 3PGFL 3LN5A 4X7TA 5FV1L 4H26B 1MREL 3UTSA 3TLRA 2VUYA 3CUPA 3R0MA 4IRSA 1FNEA 5TPWL 4BK5A 4LAQL 3P9WB 3KR3L 1E28A 5F7DB 1A6VH 3L3OB 3S6CA 5BQ7A 1KIQA 5MI0B 2VAJA 4YBHA 3H9SE 4XNXH 1ZLVH 3M1BB 1MCFA 2HKHL 3RY6C 3T1FB 3T2PA 5E9DA 2EH7H 4F33B 1I8IA 3M8OL 4WI8A 2FHFA 2PYEA 2VXVH 4AK1A 1DANU 5AWNL 3MLRL 4UDUB 4XPAH 4YHZH 3BI9X 5JQHC 5FKPB 1QRKA 2AJVL 3SE9L 3MRKA 4WHYG 5KZCB 4PY8J 3WNKA 5KVGH 2EYSB 3PWJA 5CP3H 5GRVK 5EBLB 4MJIE 2AXGB 3CIQA 4Z8FL 4M43H 5FGCB 1Z0MA 5GQBA 2F8XC 4YGVB 3DVNA 2B5IC 3L95B 5EZLA 2UY6A 4Z77B 1CFSB 3EO9H 1RUML 2BK8A 4P57A 5IBLD 4WV1A 3GZKA 3KPOA 2VDQH 1MI5D 4QTHA 2R0KL 4NKMA 4E41D 2FNBA 3L7FB 2BNQE 4NM8L 5EBGA 5GIRB 3LZFL 3HUJE 5FYJL 1BF8A 2CXGA 2VE6B 3ZLQC 4FQJL 4JO2H 2R69H 1YY8B 3QHFH 3K2UH 3W11D 3C5ZB 3WBDA 4ODHL 4HQQH 2FGWH 4M7KL 5HHOB 3QH3B 5MEQA 4UIMB 3STBA 3KYMB 3UBXB 4OUOA 4JAMB 5HHXL 3CFKA 2VE6A 1Q1JL 2HT4D 2CLRA 3F6IA 4JRYA 3UJTL 1X5AA 2GSGA 1JPFB 5DTFB 4OFIA 1U95A 5LBSL 4DZBB 2IADB 2CJUL 2N7AA 3LDBC 4OQTA 4ZS6C 3QEHB 5ADPH 4HAFA 3GIVA 1OQXA 3JV5A 3QFDA 4P46B 3EYVB 5T33H 5D2LB 1I9IL 1NC4D 5E1AB 1U8KB 1T2QH 5F9DC 3PE9A 2R4RH 4HIXH 5D5MB 3CUPB 5FK9A 3H3PL 5ESQB 4HEPG 1NMAH 5FCUL 2I9LA 5C70A 2IALB 2FJHA 4L4TE 3W0WD 3DO7A 1HXMA 4Y19A 2YHGA 5KVEL 4K2UH 2VYRE 4QYOA 2ZCHL 3NGBC 5HGBB 2B1AL 3CFDA 5E9DD 4BZ1H 3BPOC 4UT6H 4NWUL 3F5WB 1VFOA 4OLZH 2P8MB 4HFUL 2EIDA 1U8LA 2F8VA 1MHCB 1R5IA 1JE6A 3B9KC 3KPSD 4XVSL 2AJZB 3RDTC 4QRTA 1L0XA 1M1SA 1OD9A 3IFPA 3PP3H 2ZUWA 1SYVB 3P73B 1I8KB 4FRWA 1SYSB 3IAPA 4PJGA 5CZXC 2FZ3B 1AC6A 1PVHA 2DYPA 3CPLB 3JTSB 1LDPL 1ZLWH 4ZO8A 3QO1B 5DVKA 4IDJL 1HN1A 2VN7A 2BNQD 4FQ2L 5DMIH 2NY2B 4NRXB 1QBBA 4PLJC 1WGOA 2XFXA 1FL3A 4OFDA 5IHBA 1HH6B 1CDJA 3LKPA 3W2DH 3CVHB 4HKXB 3S36H 3QDHA 4HFWA 4WNQB 4TULH 3NPSB 4HMDA 5C2BL 2GK0A 3LAFA 2DD8L 4XPHL 4ZTOH 5AG8A 1KTDB 5D96C 4MA8L 2MCPL 5JORB 3SDAA 1J1OL 5IHZA 1AHWA 4GAGL 4Z7UE 5LAXA 1NDMB 3GMQA 5F8RC 2YXMA 5IB1A 1KCUL 3FQTB 5E24E 1BLNB 2AK4A 2AQ2A 4ZSOE 4E42B 4WGWB 4WDIB 5I6XC 3HZKB 2MHAB 4ZXBD 2XPGA 1Z9LA 2ED8A 1ES0A 3MNWA 4NN6C 3GI9L 1WT5C 1HHKB 3ILPA 2BRRL 1CE6B 4DOHE 3KS0H 1CXEA 2OTPA 1KCRL 3RZWA 4ZPVB 4FQQA 3PGFH 4JLRA 2HFEA 1RIHL 1C5CL 5ILTL 4C56E 3MXWL 3LEVH 4LKXA 4JM2D 3DETC 1FSKC 4NQCB 4CN6A 4LEOB 4NKIH 5HGBA 5D71H 5EU4B 2HFGH 5BRZE 2PCPA 3C6SA 5DJ6B 2A9NL 4HX1B 5KVEH 3IFNL 4PY7A 4K3GA 5ID0B 5EU5B 2QSVA 1TNNA 3BGMB 3JBG7 4CU8A 3PWUA 4NQEB 4XPTH 4EQ3A 1K4DB 2DI7A 1T5WA 5I73C 3C2SA 1CLOH 2R0WH 3NCEB 4MNHA 3UC0H 1IKFL 1DBMH 2EH8H 4XPBL 1CR9H 4Y2DD 8CGTA 3T77A 3AS0A 2DL9A 4V1DA 3VFVA 4JRXE 4TQEL 3VMOA 4JN1L 4N5EC 1S9WB 4K8RL 4XCNB 1H0DA 5E03A 4HS6B 5D7SL 3D39E 1T4KA 2VDPH 5I75C 3KPPA 1A9EA 4L3CA 3VXSA 2ORBL 4PGJA 4LVHB 1MY5A 5IMOB 4M00A 1TXKA 4XGZB 3UAJD 4GW1A 1KFAH 2NXYB 5J57B 4KK6C 4OZFB 3GK8H 2FIKA 4ETYA 3CZJA 4TSCL 2Q7NA 4FQJH 4AJ0A 4WFHE 4X0KA 2D2OA 2Z0BA 4WNQA 2AJSL 2VDQL 1DBAH 4Y16A 4MYWB 2Y4SA 3PIQA 1N7MH 3VFPA 3G5XA 3KXFB 4Y0GA 5CGTA 2FL5A 3SDAB 1CFSA 3ALPA 4MMXC 2P7TB 4J3SA 4Z0BH 4JLRB 1NBZA 3JVGC 4ZTPL 4PPTA 2EC8A 2OS7A 2VO5A 1MLBB 2UUDK 4FQLL 4N8VG 4XMLH 2C4XA 3L3JA 4G43B 4LHJB 4MLSA 3OSKA 1RURH 3MFGB 4X7FC 4L8CA 3UROR 2C7UB 2X4OA 3ARFA 4APQB 5FM8A 1YECH 3TBYA 4NNYA 5F7HA 4Z18A 2DQDL 4X6BA 2FYYA 1WTGT 3MODL 3U48A 5DSCB 3X13A 5IHZB 1KN4H 1MI5B 4U1MA 3EYQC 1FCGA 4YLQT 5JUEH 3BO8A 3KLAA 5EU4A 3UDWC 4S0TD 1A0QH 2X4QA 4MDIA 3GNMH 2I27N 2SEBA 4P4KD 2A83A 1JPSL 5ICYB 1VADB 5F97E 3VFMB 3HZMB 3FONA 2P5WD 2FH8A 2VITB 5IMKA 5JZ7D 3X12B 3DX8A 1CE6A 4X4YB 1MI5A 3KXFE 5DD1H 4CRPA 3G6JF 4MJ2A 1MJJA 1M7IB 4QHKI 2ESVA 3MLYL 3NTCL 2EDDA 4H26A 2JK5B 5BXFB 1AO7A 4NWUH 5BJTA 4HDIB 2ESVD 5DRWB 2IPKA 4ZPTA 4R4BB 3DUHA 1WITA 4BQ9A 2D7MA 4QLRA 1KELL 1KTLB 5IHLB 1ZKAA 3GSVA 4CVZA 5EORL 5CJXA 1T2XA 2VXQL 1MJJB 4XHJD 3V0WL 4W4OC 2AAVA 3FFCD 1UXWB 5C6TL 1CFNA 4BH8B 2XY1A 2DM7A 4R4NC 2DQCL 3CSGA 4OBSA 3Q48A 1E27A 4X5XA 3VFNB 3VFUB 4WU5B 3JVGA 3MOBL 4JFQB 3BKYH 4LPYA 1VACA 4FQCH 3UTSE 3BKJH 1C1EH 5I8EA 1IGYB 5EPMA 2IANA 2NCMA 4N5ED 3PWNA 3MUGB 3RGVA 3MRLB 4UQ3B 1MCPL 2UWEA 4W6YB 1RVFL 3MA7B 5FO9A 3SKOA 3G5YA 5IG7B 1OQOA 3SDXA 3VFUA 2YA2A 4NUJB 5F88A 3K4AA 1YDPB 3B9KB 1NCTA 4LARL 1QHPA 3I3DA 5H35B 3PHOA 4BSWA 3CCHA 3OXSB 1B0RA 2QSCH 3N9GH 4XNYH 1ZLVK 3JUZA 3MV01 5CKAA 3O0RL 4AMKH 1JGVL 1BECA 1P1ZB 2GI7A 1NUFA 1OWWA 2VZTA 3OAZH 3RTQB 5I18L 4XTRD 3D0LB 4KRPD 1XH3B 3U4EA 4PJAE 5I1AB 4MJIA 3O3EB 3DI2B 1J0HA 4MQTB 1Q1JH 4BSWB 1GOFA 4JPIB 2IF7A 3TH3T 5EOTB 1UA6L 2OR8A 3C5ZD 4LLQA 4RWYH 3EDFA 4PTTB 1UJ3A 3P77A 1X5JA 5D8JH 5HYJD 5C0AE 5KG9B 3NH7H 4OIIL 4MMZC 1G6RH 3MLTB 1OB1A 2H2PD 2XWJB 5ESAB 1MRCH 3TBVB 1QD0A 3VFOA 2EE3A 2J88L 3VFTB 5A3ID 2WZPD 4L4VE 1QO3A 2HRPL 3MUY1 3FQNB 4NQDD 4U31A 1FE8H 4OZIB 1HINH 1I3GH 3H7LA 4ODTH 4QXGH 3QRFM 4TSAH 5DJ8A 3QAZC 4PRHD 2BVUA 5I1IH 2P47B 5JOPD 1TJGL 5TGBB 5D5MA 5D93B 2JIXD 3WXVH 1OPGL 2EECA 4TUJA 4GW4A 4P5KB 3LIZH 2HVJA 1GHFL 3SJVE 3TC9A 1KNOB 1N0XL 3L3KA 1MELA 1IM9B 2P5EB 1BGXL 3NAAH 5INDA 1FG2B 4KHXH 1XGQB 5F9AC 4YFLI 4DVBB 1J87A 4OLYH 4DK3A 3IGAA 5L88H 3V4UL 3WUWB 1JI2A 1WIPA 3GMLA 1NANH 5TDPA 2V5SA 4KKBD 1T2QL 1JNHA 2IFFL 1A6PA 5IM7A 1DZBA 1G7MB 1CZ8H 1J05A 4K3EL 3V6OE 2MPAH 2QQNH 1KB5A 1H3VA 4PJBB 1BQLH 1A6UH 2CQVA 4X6CF 4JFOA 2YUZA 1JGEB 5INCA 1IM3B 3L3DA 2ZG1A 2Q8AH 1KCLA 4LCWE 4WWKD 1S7QB 4PJHA 3HC3H 1N5YH 2VQ1A 5T1DL 1S9YA 2AK4D 1KIPA 2X4RA 1L0QA 1OCWL 1T1XA 2IAMA 2PTVA 2KZWA 3HG1A 5FYLH 4YFDB 4NO0A 2VDMH 4QXUL 3Q1SH 4N0FA 5EU6B 1YEEL 1YPZF 4JO2L 3BWAB 3TNNA 1S9YB 3O2DH 4LOUD 1GZQA 3QNXA 1IFHL 3MRPB 3PQYE 4PJ5E 5CGYD 4HKJB 5F7FA 3BVNA 3RVXD 5GRJL 4HGMA 4UQ2A 2IG2L 1IGJA 2O93L 1LO3H 5DRZA 1A7QL 3SKNA 1S9VA 2CR6A 2H8PA 4EEEA 3B9KA 1CIDA 3FTGA 3IDGB 5I0ZA 3DMMA 3INUL 2NY3D 1MF2L 4I9WE 4FTVA 3P30H 5IKCB 1TTFA 3BP7A 3QXAA 3F8UB 4FZ8L 4F15B 3WD5L 2G5BB 5I1KL 1CFTB 5ADPL 4JHAH 3RVTD 3QA3B 4HBCL 3CK0L 4UOJA 3PJSA 2RCSL 4XCEB 3T4YB 5T33L 3C6SB 3DMMB 1PYWB 1R24B 1WCBB 5BV7C 2YXFA 1I85C 1S9KC 4M48L 2DOCA 2AJYH 4UT7L 3LKOB 2HT3C 3H3BC 1OVZA 1J88A 4NZUL 5HHXH 3VG9C 1R5VA 4RZCA 3HAEB 5CLWA 5JA8B 1KLGA 2ARJA 3RL1A 3VGAC 2K9UA 2IH3A 3V0WH 5I71C 2HJFB 5F72S 1T1YB 2X1OA 3TF7C 1KJ2B 2CRYA 4I5BA 2OQJB 4HIJB 3VI4E 2IFFH 1U3ZA 1K4DA 2JCCB 2BJML 1IAKA 2JB5H 5EUOF 2E7CA 1X44A 5BVPH 4ZXBB 2VR5A 3VE0B 3DGCR 4NO2B 3L1OL 4PUBL 2AKRB 2JIXA 2FJGB 1M05B 1T1ZB 5E7FA 4QHMB 3HA0A 3O4LB 1Z3GL 1YEHL 2BOBA 3E1F1 3F7RA 1J0KA 3KPSE 1HXYA 1U92A 1FYTB 3NCJL 4KROC 4G8IA 3VXMB 5C0EA 2BCKA 3VWJA 1YC8A 4ONHA 1YUHA 4GRWB 3MLZH 4ODXB 1FL6B 2J5LC 5HVGB 5I0DA 4OGXH 5CLTA 1IARB 3OG6B 4MAUL 2YSSB 1VHPA 1WCQA 2N1KA 3GGWA 2XXMB 1GOGA 4G9FE 1WICA 2VZ1A 4FFWC 1KV3A 2R2EB 3NMEA 3JWDH 4X6DA 1F6FB 1EEYB 3O6FB 5EZIH 4CADB 2R0ZL 2GITB 4MHHI 2OR9H 3S36L 3HZVA 3LH2H 3FHQA 3IXTB 1QKZL 3MLVL 2V6HA 5C09E 2A6DB 1M7IA 2A74B 3OV6A 1BWMA 3KVQA 5FYKL 2WBWB 5TJWK 4LHUG 4AY0A 4OFYA 4LDOB 4UV7L 1E6OH 2ZWLT 1U8KA 2CLVB 1MHHA 3B2UD 3NCYP 2DDQL 4PJ7A 1UKSA 1FO0B 3G08A 4I5BB 4XVUD 1HSAA 1VEPA 5J6GB 1T7WA 2HAZA 5JHDB 1CI5A 1HZHL 4PLKD 1YEGH 1KPRB 2CKBL 4LLUB 4YXHL 3T0EE 4J6RH 2QSTA 5DFVD 5ECJE 4BZ2H 4LSUL 3MZGB 2JELH 2VITA 1PLGL 4HXBL 5FGBC 1EPFA 2XACC 2VLJD 4P46C 2FWOB 3V0AC 4LSVL 2ZUXA 1I1AB 2I25N 3HZYA 1AD9B 5KJRL 1GC1L 1XZ0B 2WLYA 3DROB 3BQUC 2VLRD 4ZPTB 3GJFA 5IVNA 5F96H 4LSPH 2W9DL 3AB0B 3HI6L 5DGRA 3RUGE 4U1KB 3QDJB 2QQLL 4JFXA 3UZQA 2NX5B 4LCYA 1BX2B 4YJZL 3KPQA 2EZ0D 5KN5B 4E5XA 4PJEF 1L7IH 1T04B 3VXRD 2N7BA 3BHBA 1P9MA 4JFYB 1RJYB 1W72B 2YPLB 4X7SL 4L8SA 2VOTA 4PJDE 3CVHA 4NQUA 3HLAA 4YUEL 3C5JB 2VMFA 1FBIL 2EYTA 4MA1B 5IROC 4TTDC 3ROLB 5C71A 1N0LA 4MD5B 4L1HA 4RAUB 3VA6A 3O3DB 5E2TL 1HDMA 2BSRB 1KT2B 5IB5A 1E0OB 3HC4H 4ZS6D 1WQVT 4TRPL 1AXTH 3TN0C 3E2HC 3EAKA 5EC1A 1IT9H 4G43A 4YHLH 4IIQC 4EUPH 5CJXC 4U1SB 1GH7A 1CGYA 3G5YB 1AKJB 3SDCD 4RMTA 1EHXA 2H26B 3FO2A 1HI6B 5GZOD 3LEYH 1FNAA 3A67L 2J88H 5TQ2H 5CWSA 1QTYT 5EIIA 4MD0B 2OM5A 3C8DA 1U0QA 4WEUD 3NFSL 1T0NB 2YKLH 4Y4FA 5I76B 4M1DL 5FUCE 1KPVB 1LEIB 1ZSDB 2EH7L 4RWYL 3RIFK 4PP2A 3S37L 2R1YA 4TNWF 1IGTA 1IQWL 4Z0BL 4N0CD 1FIEA 4X98A 1YJDL 2BHZA 4WHTA 3RDTD 1K8IB 1BJ8A 2YN5A 5T5NG 1EA9C 4C55A 4PRDA 4ZUUA 1EVUA 3PG2A 4HMCA 1T6VN 1I3VA 3TZVD 3PWUB 2WWMC 3U82B 1A64A 3WE6B 1AY1L 3CFBB 3GKWL 1I75A 5JPMB 1QPXA 4PJDB 4LDLB 4X7DC 4GW5A 1ZOXA 1BAFL 4XBPA 2Z8RA 2ADJB 2PXYC 1F6AB 1R3HB 1AGDB 3I84A 4OI9A 1JNLH 1KB9K 2XN9A 1T0MA 4KUZL 4NGHL 4XP1L 5EU6D 4R7DA 4HH9B 5DDHA 3U1SH 2VL4A 2OR7A 1T7VA 5JXAL 4CJ0A 2X44D 4ISVA 3JV4B 5JXEA 4AL8H 1OWRM 5BMFL 2X9XA 3KPPB 5E00A 3MLVH 2VLKA 2H6PA 3S37X 1ETZA 4NKDB 4Z0XA 1RK1B 3UMTA 1F2QA 3T0AA 4NC1C 4DKFH 1KIPB 2X4RB 5LGJB 4P3WA 3VJ6A 2HFFB 5BV7L 4UUJB 4LCCA 3RWIB 3ZKMD 2X89A 3B4NA 3D25B 3VH8A 1FFQA 4O2CB 1QSFB 3KG5A 4TSBL 3NZHL 4NM8H 2VDRL 3QH3A 4KGLA 4NQTA 4JFOB 4TTGA 1AQDB 5GSRA 1F90H 3VXOB 3O2DL 2VC2H 2NW2B 5KW9L 5MP6H 3ARVA 1X4XA 5TDNA 4IOIA 4Y5XB 3WO4C 4KHTH 3K2UL 3LMJL 4Y5VA 4KQ4H 4HUXA 2NY4D 5FYKH 2PO6A 1G9NL 5CEXB 5T3ZE 1MPAH 4QTIL 4Y5YA 5IW1B 4PS4H 3QJHB 4CAGA 4RRPA 2P8LA 4P3CH 4X8JA 2BOCA 2O5XH 3BX7C 3HC3L 3OKLA 1N5YL 1ZT7B 2YMXH 3WCYA 2XY2A 5HHVL 1Y18A 1MHPH 1YMMB 1JP5A 2YPKA 3MRDA 1H3PH 2VDKL 2LVEA 1MEXL 3C9NA 1F3RB 4UV7H 2AJ3B 5F3HB 1I4FB 3MROA 4ODWB 1K3IA 5DQDL 1LEKB 2NY3B 1Y18B 3QDGE 2ZCLL 4NRZB 2DTSA 1A6ZB 3C2AH 5IFHH 1HXMB 4Y19B 1CTOA 5IWLC 4LEOA 5SWQA 3AVEA 2HT2D 4JZOB 5DRXB 2PTTA 3WNLA 5IOPB 1PQZA 5IV2B 3LIZL 4U6TA 4XPAL 1FAKT 1BIIA 4KK6D 1Q9KA 2P4AB 5DRNA 1RIVL 3QZWA 5D8JL 3ARQA 1BQHA 2R8SL 3VG0L 4R4FH 1SY6H 1H15B 4IRJA 5DJYA 3IB4A 4FTVE 3EYUL 5CBAA 1A7OH 2XTJB 1HHGA 5LGHH 2FBJH 4JG0L 3EZJB 3KR3H 3J7HA 3Q6GL 3MJGX 1WIUA 5I74C 5GS1C 5T3XH 3CSYA 5JW4M 2CO7B 3LV3B 4LBEA 4PJCA 1RPQA 4CNIA 3QNYA 1T3FB 1SJHB 2KUTA 1NGPH 5ISZE 5H94B 1MHEA 2RQ8A 3GI8H 2XICA 1I1CA 2AJUL 3DTXA 2NYYD 1U58B 1TVBB 4KY1L 5D7IE 1NUNB 1NC4A 3GMNA 5I75B 1A9BB 4ELMF 5EUKB 3BWAA 4OLVL 1HH9A 1Q9OA 4K7FA 1J0IA 4XPGL 2Q86A 2YRPA 3KPMB 4PLNC 4X83A 3DVFA 4DZ8A 1OF2B 2I07A 2ZUSA 1U58A 4LSSL 5MEQB 1EJ6A 1BBDL 3QEGH 3OMZA 2A6JA 4IMKA 3UTZB 4DVRL 4PJAB 3ARBA 5ACZA 1BFOA 5JW5A 4P9HC 5DD5L 4NT6A 1G9ML 4OZGB 3C6LC 1G7IA 5KS9B 3PQYA 1DQDL 3IDNB 4DJMA 4GS7B 1R3JB 2R0ZH 3KPSA 4QRPD 5DUPH 3KWWA 2X4QB 4MDIB 4WTZG 3RWDB 1AGEB 1KJMB 2D7OA 4M7KH 3FFCB 1E6OL 1S7VA 4JM2B 2ZG2A 2E7HA 4U7MA 3QIWA 1RZKH 4KRMB 3ZO0A 4ODWA 1RJCA 4NRYA 1JWSA 2R1XA 4IEFB 2IJ0C 4LLQB 4ONOA 4YH6A 5D1ZA 4X4XB 2VXSL 4I77L 3WIHL 3IAGC 3H9SD 4ORGB 5C0IB 3M1BA 3QPQC 3BPNB 4YFEA 3KJ6H 4NFCA 4M62H 1VADA 2VABA 3GIZL 2KKQA 1D9KC 4O4YH 4B7IA 3ARRA 3GM0A 4R4FL 5DK3A 3HKFA 1JWSB 2R1XB 2NY7H 4QRSB 3QWOB 4PBWD 2N4IA 4P23A 1ZLSL 3VD7A 4JRWA 2VNCA 4U1JA 3D9AH 4TVSa 3QQNA 2Q8BH 5E8NA 2JIXB 2VJXA 4WI2A 5BVPL 1QYGH 3OHXB 3G04A 4UB0H 3W82A 3T0XA 4O58L 3TBTB 3RJDA 1S5IL 3RX7A 1MPAL 2G75A 3MRIB 4QTIH 4S1SL 1QUNA 2NXZB 4KXZH 3B43A 3BW9B 1IM3A 2VXVL 3DRTA 3T08A 4LQFH 5MHSD 2E27L 5H37G 1W72A 5E2JA 1MJ7H 1HCVA 1UACH 2CDEB 4Z7VA 3LHPL 4K3JH 4Y16B 5I1DB 1GRWA 4X8XA 5TE7H 5ALCH 2OTUA 4HIEB 1T5XB 3CMOL 3K8MA 2DICA 4LCWD 1TFHA 2OTWA 3RX5A 2Q7YB 3TO4C 4ALAL 2X4SA 4HLJA 2NXYC 3QXVA 5L8LB 1ORQA 1F42A 5I8OH 4L5FL 4WI4A 5FGBA 3PNWA 5DD0L 2PTUA 1HHHA 3SBWC 5MP6L 2NYYC 4LHUB 4PD4J 5CHNA 3B5HA 3TEUA 1GYAA 1DSFL 1RIUL 1NSNH 5C0AB 1DUYA 3FB7A 4UINL 5C0BA 4GLRH 3W9EB 3OKMA 3ES6B 3M07A 3MXVL 3OBAA 1H3PL 4K71B 3HR5B 3O3DA 4LGRB 4HC1A 5IMMA 3LN5B 1TCRA 1I8LC 2Q20A 3D48R 1TZIB 4J4PD 1NCWL 1FBIH 3HPLA 5KANG 1CD1B 3TBVA 6CGTA 1T66C 1RFDH 3KPLB 2D7PA 5FCSH 3SGEI 5CAYB 3GSOB 3DWTA 4FQQB 1U8NB 1XCQB 3TGXA 4GLRI 1AGFB 1NCAH 2OXGA 2DLGA 1IAIM 2DQUH 4OQ1A 1T7ZA 1F5WA 3U9UA 2W0PA 1BFTA 4KKBC 4YHOL 3L9RB 3IFNH 4J6RL 3ZE1E 3AB0C 3CFJA 1R5WA 4OFYD 1KNOA 3B3IA 2EKSB 2AJXH 5DJCB 1G6RA 3O11A 3MROB 4XCYB 4X9BA 2E5EA 4RISL 4NN7B 2LTQC 4HPOL 4X98B 3EZ8A 2WAHA 1WBZA 4HK0B 1CL7I 1OD7A 2CDFB 4M03A 5ENWA 3T65A 4NN6B 2Q76A 1ETZB 4NKDA 3UTPD 4F15C 2FX8L 1G7MA 4KJQC 4ZQKA 5C0FA 4PJFA 2X42A 3MV9B 5JPNA 2P8PA 2ADFH 1OTUC 3HE7C 5ID1A 2VZVA 3QUYA 2E6QA 5F9OL 3TBWB 1JHTB 1CN4A 2OK0H 2BSTB 2FIKB 1CF8H 5CEZE 1INEH 1ZGLB 4AG4L 4KVCL 3ZZ1A 1X4ZA 5L2KE 5KSBF 4N0UB 4IRZL 2FJGA 3EFFB 5D7JD 4QXTA 4YAQA 1TPXB 3D25A 3GSNH 3WFHB 5FGSA 3QDAA 1Q72L 4XAWH 3OAYH 4U6YB 3S97C 4OCLC 4GQ9H 4ZUWA 1QR4A 3FQRB 2XWBA 4HD9A 5EN2B 3EGSB 2X40A 3WFBH 1SJXA 1G6RL 4YHLL 4BSVB 3GNML 4YAQB 1MCLA 1H3GA 2Y25A 3TBSB 1LEGA 2WIMA 1GIGH 3VXUA 5IR1B 4F8TA 4PGDA 4PTUB 5E5UB 5HPOA 5H2BA 1HINL 4LVNB 5T1LD 2A6DA 5BRZD 5KVMC 3KS0J 5C9JB 2A0LC 3EYVA 4FQ1L 2O5XL 2X7LB 1TENA 2VDLH 2Y07H 4DW2H 1R24A 3QDGD 4KJWD 4XMLL 1FV1B 1GHFH 2V5MA 4RWHA 4UV4H 1TMCB 5ACMA 1FPTH 4JFHE 3VFTA 4JQXC 1TJIL 5JUEL 3DLQR 1QLEH 2R2HB 4Q6IC 5E08L 3IDNA 5F70A 4R7NB 3HR5A 4ZUVB 2APVA 2I26N 3W0WE 5KSAA 3BDYH 3DUSB 4FQIH 4NFBA 3FMGH 4LPVA 1LO2H 4EXPX 5I16B 3ARWA 4I4WB 2APWA 3STZB 1IEAA 3A6CH 4ESKA 2J1KA 2OQJA 1DDHA 4HS3A 1U2HA 3KLDA 4WUUA 4BQ8A 4KROD 2MCG1 5CILH 1LE5B 1FSKB 1U8HB 4WTXA 3U2SA 3VXNB 1QRNB 4H25B 5IEKA 5J9PB 1KEGL 1IC4H 2ERJC 2EDTA 4TVPE 4E41B 2GTWA 4AYFA 2DAVA 1U3YA 3T0EB 1M05A 1T1ZA 1I1FA 1XF2A 4P2RB 2E7LA 5C6TH 1QFWH 3QFJB 4OCWL 4E5XB 3QIWC 3CVHH 2V5RA 1FZJB 3QNYB 4NQVA 1NFDE 1UWGH 5EORH 4B50A 3HNTL 4H8WC 2QQQA 2X70A 3ESUF 3MV9D 1UM5H 5HHOD 1LO5A 1EVTC 4GSDH 4XVJH 5J11B 4XPBH 3D0VA 2IPUG 3KXFA 3CPLA 4P5TA 2PNDA 1HHGB 1OM3H 2BHYA 1F11A 4LARH 3U30C 2OJZH 5H35A 3S5LG 4X6EB 4WWKA 1HDMB 2DKSA 3VXRE 3JUYA 3RWFA 5D7SH 3IU4H 1KN2L 2ZP0T 1F58H 5IG7A 2VQ1B 4KUZH 1PKQE 1QHOA 1OSZA 4Y5XC 4JHZA 3MRRA 4EI5C 1NSNL 2Z31D 4EN3A 1VGKB 1FNGA 5C0DA 4H5SB 4D0CA 3UYPA 2XTLA 5IK3B 1CLZH 4NQCE 3QXDB 2GKIA 3ARDD 1MCBA 1URLA 5SWSB 2R56L 5I1JL 2WV3A 1BF2A 4GAYB 4OUUA 3QA3A 4HEME 3RWGA 5B8CC 1NCCL 2WM0A 3JZ7A 2IQ9H 4MJ5B 4LVOB 3EW3B 1QLEL 2GIYA 1F4YL 3VD4A 1CD0A 3TA3C 5I19H 1H3WM 2VLRB 3ULUD 3LKOA 4PYHA 4G5ZH 1ZANL 4GKZB 4L3ED 2MQ3A 5BQ7B 2AEPL 1GGBL 3IDYB 1UT9A 2BOCB 3BGMA 4Q9QL 1XIWA 3GM8A 3O6LL 4I48A 1Q38A 1NCBL 1KLUB 1ZSDA 1OW0C 1ES0B 1KULA 1OTTD 2DBLH 4WHDA 2DIAA 4FABL 2JB5L 3QSKB 1I7RA 1NEZA 2CK2A 3EBAA 4KKAD 4PLJD 4R3SA 1U8NA 3BSZH 3BKMH 4RFEA 3RTQC 2E6PA 4YDJB 4PRDB 1Q0XH 4Z7WB 4NJAH 2JJSA 4XAKE 2X1QA 1YEHH 2UWEF 4TUJB 4GQ9L 2XKNB 1QBLL 4ORGA 3OPZL 3SDXF 3UDWA 2H45A 3ARPA 3FB8A 5DI8A 4HT1L 1PG7H 4TSAL 3NIGF 3MRBA 4KZEH 4GRLA 4XCNA 1KCVL 5IQ9B 1I3RB 1ZT4B 1OP5K 4YX2H 3D2UB 4RCAA 3O41A 3L3IB 2WLZA 1LE5A 4P2RD 3EO1A 4GG8A 1CU4H 1DUZB 4OIAA 4PV9B 2NW3B 3WEXA 5DQJA 4M7JH 2V2WB 5D1QC 3GGWB 3L3DB 4U1HA 1NGYA 1JPGB 2W9EL 3UPCA 5JMRA 2YN3A 1X6LA 5HHQB 1SEBB 4KK9C 5EU6A 1X5LA 5J06A 2N56A 3ZMRA 3FFDB 3W39B 3BZ4B 1G7PA 4P2OC 1CK0L 3E0GA 4YHYB 5I1AA 3FOMB 4EIGB 1ZA6A 4MD5A 1LK3H 4RAUA 4ELKB 5BS0A 2M1KA 2EDQA 5MENA 5C09B 1JHLH 2APFA 2B5IB 1RULL 1P69B 4O5LH 4TVPH 3TN0D 2JJSC 4WFEE 5E6IB 1XIWD 1ZLUH 2BXZA 2VDLL 2PYEE 5EOCL 4Z7OE 1DBBL 4FZ8H 4Y4HB 4BZ2L 4Y2DC 5DZNA 5E70A 5JMOC 4EI5D 3S96A 4LCUB 5I6XB 3BDYL 4Z7OF 2H2PC 4Z7VE 1EHLH 1MFDL 1LP9B 1RV6X 1TDQA 1HKFA 3RA7H 4RFEB 1QFPA 5A16B 3VGHA 4XPFL 4AM0A 2DLFL 5KJRH 2BP3A 4RMWA 1IRAY 4H0HB 1V7MH 2DB8A 4PRHE 1IJ9A 4C59B 4S0SD 4LSVH 4LSRH 1IGMH 4UNUA 4N5UA 5JW4R 2Y07L 4N0CC 2WINA 3TBYB 4KQ3H 4XP4L 3RI5F 4TUOA 3W9DB 2BFVH 3V4PL 3BP5B 4NC0B 4PJXF 3LQZB 2VXUL 5D7LA 4GKZA 3O4LE 1KPRA 2IPUK 2JTDA 4UAOC 4NZTL 1RU9H 1FVEA 3TYFB 2AVGA 4I18A 5I1LA 5DRWA 1JZ2A 4PGEA 3R8QA 1BBJA 3JWOL 5KSUB 2I5YL 2WP3T 3MJ7B 1C8PA 5C2BH 3D3VD 4JKMA 5CEZD 2Q3AA 4LIQH 1B4RA 1XT5A 5EG6C 3L3HA 2HTLC 1N6UA 4D8PB 1AP2A 1UVQA 4P57B 1ADQH 4X0KB 3V52H 3DSFL 1FVDA 5DMIL 3IKCA 2C1PA 3FZUD 4B7LA 1DUZA 3SKOB 5FO9B 3QCTH 4MSWA 3VFSA 1MCWW 3ZYOA 2DLTA 3R4DA 1BM3H 3BT2L 2NY7L 4U1KA 4DFHA 4MWFB 2W38A 4GBXA 2GCYB 4JFED 4M43L 1W8OA 5I8EB 1HXYB 2WWKO 4KU1A 2XZQL 5KAQG 4U3CA 4TULL 4PP1C 3H8NA 3BZ4A 2X05A 1Q72H 3VWJC 1IAMA 1CBVH 3DHJA 2GSIA 2WBJB 2C3WA 4NUJA 3Q5OA 2FX8H 5F6HJ 1EAPB 1FL5B 3KNBA 4MQ7A 5CGYC 5B3NA 1HEZB 4U1LB 3TN0A 5D1QB 3VH8B 3MV8E 3G6AA 1QG3A 1WAAE 3PWNB 5LJYH 5D7IB 3RVWC 1EX0A 3B9VA 1RHFA 1D6EB 4QO1A 1F58L 4IBLT 3L7FA 2PO6D 3H3KA 5C09D 2Z93B 3BO8B 3UJTH 4PG2A 1EHLL 3FOLA 4HIHB 4XCEA 3DGGA 4NDMB 5GXBB 2IBGA 5CEZH 4JZJA 1WIOA 4N9OB 4GKNA 5C9KA 5E6ID 3W9DA 4IOIB 1P7QB 4WHCA 3X14A 2J7LA 4M48H 3HRZB 3X12A 4N8VB 1FLRL 2B0SL 1GOHA 2VISA 1HILA 3NCMA 3PL6C 1DR9A 1A1NA 5JIPA 2XRAH 1GC1H 4J12A 1MFEL 1HK6A 1ZT7A 2R4SL 1DE4A 1BFVL 3O4LD 4RA3A 4UILH 1SBSH 3FT2B 1P7QA 1DCLA 4OZIF 3HS0B 4GW5B 4NBXB 5TE4H 2YWYA 3KYKH 3WFDL 3GUTB 3GSXB 4LKCA 5F3BB 4YHNA 1A4KB 2VRAA 3QHZL 5E1AA 4JPKL 5HD8D 5JHLH 1OB1B 5ESAA 5KS9F 2AEIT 2F58L 4UV4L 4JE4B 8FABB 4EUPA 3O6KH 5IVZB 3S34L 1TJIH 4Q58C 3VDBA 5IHUH 1U8IA 4L29A 4EUPG 4PRIB 4YX2L 1IGYA 2GJZB 5EPMB 4Y1AE 3TA3A 2AGJL 3BE1H 3FN3A 2VDNH 2NY6C 4LP4A 4PB9H 1XF3A 4U1JB 4NKMB 2ICEA 2OX5A 1T4KB 1FIGH 1JK8B 2DIJA 2HYMA 4G6JH 4IIQA 4PJ7E 4FQLH 4CL7A 4JFXB 4QGYA 5DMKB 1XMWA 4WRLA 4RSVA 3UTPE 3X3GL 4AG4H 4NIKB 2D0FA 1SJEB 4HH9A 5DDHB 3C5ZC 3QQ9C 4GW1B 5DS8A 3NIFF 5E8OA 4KJPD 4L4VB 4I0PB 1T0PB 3QDMA 5I1EL 2DD8H 4LDEB 4XPHH 4ZTOL 1N7ML 2DQGH 2H6PB 1RZGA 3RKDC 1CLYL 5AWNH 4FXLA 4XXDB 5DD6B 3W2DL 1IQDB 4OCMC 2BSRA 3K3QA 3HB3D 1MEXH 1S7SB 5L7XL 3O2DA 1CGVA 2ZSVB 4PJHB 4K9EC 4BQCA 5DJAA 3BUTA 4X5WB 1C7TA 1OTSD 5AAMA 2X7LA 4XPFH 1YECL 5DK2B 5JW5B 1Q94B 1FDLL 1NAKL 5EWIH 1G9NH 4G7YL 1IZJA 4DUVA 4P5MB 2E7LC 2VZOA 1K8DA 1Z9SA 4ZD3L 3FQNA 4I3SL 2DKUA 1ZHKB 3VDCA 1AQKL 3CFCL 5ANMA 1NFKA 1YQ2A 4WDIA 4R2GC 5F9WC 5TH2B 1YEFH 5EBMB 2V5YA 4HF5H 3RY6A 1W72H 3O3AA 5C0BD 1RUKL 3STZA 4BH7B 1K8DB 1ZXQA 4NO3A 3P40A 4EDXB 1WZ1H 1UYWH 3HE7B 3UPRA 2QKIA 1AGFA 1MHCA 1KOAA 5C0RL 2R1WB 5KANI 2H9GB 1IL1B 2HRLA 4XNQB 4R7NA 2NY0C 1MH5A 4OCYH 3T0BA 4N68A 1D9KD 1UWEL 2BVQA 3GKWH 1CLOL 3AM8C 4OGYL 1QFOA 3CH1B 4PJFF 1W0WA 1NAML 3ZYZA 3HR6A 2HJLB 4LOUC 5C0EB 3OWEA 5DVOA 2EZ0C 3FB6B 3IJHB 1X5ZA 3PP3K 5DFWH 4K3HA 3TO4A 2NXYD 1EXUB 5DJYB 3QXWA 1MFCL 4O51A 1EIBA 2YSSA 4GXVL 1E6JH 4KVNH 1BEYL 4K7PX 1F11B 4WFGD 2X4TB 2XT1B 2ATPA 2MWCA 4LCCB 2NX5A 3SGJA 2ED9A 1F4WL 4KZDL 4UMGA 1QBLH 2JCCA 3OAYK 2VWEE 5J0BA 1NCUA 4XPTL 4WEBL 2ICEB 2J8OA 1E27B 3VFNA 3WNOA 1OP3K 3SKJH 3BRGC 4R0LC 1ULVA 5IB2B 4V2CB 3VXUD 1W0VA 4NBYB 4DN4L 1OOAA 2FSEB 1QA9A 4P5MA 3C08L 3I6GA 3SDCC 2NR6C 3MLSH 3WDIA 2IGFL 5IP4A 2ITCA 2A74A 2XN9E 5GZOC 2G2RA 2NZ9D 4UNVA 5IB3A 3L5HA 2BNRA 4D9QD 3ZKSD 3FRPG 4URTB 3DETD 5F1NB 1FJ1A 5I30L 2ZUQC 2DMBA 4ELME 4KMTH 1ZT1B 1G84A 5IFAH 5GGQL 4E0RB 1R3KB 4NQDA 2PETA 5CSGA 2WK2A 4MQXC 1MHHB 1MJUH 2HFEB 2HKFH 1NDGB 3DX8B 3LQAL 3GSNB 1YEKL 4QRPA 5HGDB 1VEMA 4QHNB 1FC2D 3HMWH 5IT2L 2LTQB 1T03H 2KH2B 5IFJA 1FV1A 1EUTA 1QYGL 5C08B 4IRSB 1CICD 5I1HH 2YMXL 1F45A 1I85A 5D4QA 3B9AA 4KKNA 5IHUL 1AD0A 4X7TB 5HY9A 2Y1VA 3QFJD 1UEMA 1BVKB 3O81A 3S5LB 5CMAB 4JO3H 3WLWD 1Q0YH 5GGTA 4JQIL 2P24B 4N90D 4PJIF 5DQ9B 3T04D 2ZOLA 3L3OA 1R6VA 2AEPH 4WO4C 2OSLB 5JXAH 3WIIH 4G3YL 4OZFA 4U6XA 3RWHA 4LCYB 1FRGH 4JRXB 5FOBB 1XF4A 5EOQH 3SE3C 3LV3A 4LBEB 1YEDB 4XXCA 1HIMH 3NPSC 2DQIH 5CJOL 2IPTL 4TUKL 3SJVD 3P0YH 4XCFH 5EBLA 4DGVH 3VWJB 3IXAB 5C0CD 2B7DT 4Z7VF 3QCVH 4DEPC 1UKQA 4LQ1A 1NUGA 4RGNE 2F8OA 2B8OT 2BVQB 3VFRA 2NY2C 5ICZA 3OKKB 5GGTH 1YYMH 3SDDC 4DVRH 2YPVH 2YD8A 4BH8A 3OB0H 3CAFA 7FABH 2IH1B 3ZKMC 3U7AA 4M1CC 3BXNA 4MX7B 2JKXA 1T20A 5JW3H 2AQ1A 3Q6GH 1HNFA 3ARUA 3L3IA 2GY7B 4F3FA 4OM0L 1RK1A 5GZNC 4D9QE 4YNYB 1U91A 4XRCA 5BZWB 4QKXB 1CIUA 3X14B 1NDGA 1MAMH 3FQXA 1EDQA 2FR4A 4DGYL 4HS8L 1AFVH 5DJXA 3ZL4H 4ZD3H 5E08H 1L6XA 1ZHNB 4L5FH 1HKLH 5TF1H 5EU3A 5F71A 3RWDA 3PNWB 1FYTE 4GOSA 5ICYA 2XWJA 1A3RH 1ADQA 4LPXA 5J13B 4WI9A 4PJ5D 5EBWA 5JDSB 1ONQA 4HCRL 1XEDA 3L5JA 1C16A 2LU3A 3MNZA 3RU8H 4UTAH 4U1MB 3HG1D 1BD2B 1KTKE 4OCSH 2IQAA 3I9GL 2WMPA 2A1WL 3EKCA 3QEUB 2Y36L 3GO1H 4L9LC 1KN4L 1FVCA 3NACL 2ZSWA 2DQTH 3OAZK 3EO0B 4KJWC 4JPWL 1RFDL 4BFIA 1S3KL 3X3FL 4OGAD 3GSOA 1EEZA 5C6PB 4W4OA 1FGNH 2HT2C 1JF1A 5JR1H 1MWAA 1JGUL 1K8IA 1I1RA 5IW6A 5KVDL 4F8QA 1SY6L 1F8TH 1SJVA 1NC2A 3OGOE 1IM9D 3PDOB 1CICB 4R4ND 5EDXA 4QRUA 5CEYA 4LMQI 3C5SB 4M7ZC 1QSED 4D0BA 3WNPA 1CG9B 1ZWIA 4J3WA 1PG7W 4LNRA 1BX2A 2GJ6A 1P4IH 1RK0A 3L6FA 3WXVL 1R0AL 4JQVC 4X5LA 5TQ0H 4K8RC 1QRNA 3TA3B 5IEKB 5HXMA 5J9PA 3MUGA 3RGVB 4LNVA 5ISZD 4P2OB 1ZK9A 3BXNB 3TYFA 1QBAA 4XAWL 5DURD 2XKSA 5DR5H 2ADFL 4J8RA 2V17H 3R1GL 5DJ2B 1Y0LB 4K94C 4LRIC 3QXUA 3D9AL 5I1DA 4CDHA 2DMKA 1BEYH 3IU3A 4NJ9H 3QIWD 4HJ0C 5JHLL 3ZHLA 4OTXH 1UXSA 2Z92B 4Y4KA 5JNYB 5TDOB 1NDMA 5IB1B 3U9PL 5CZVL 1PJ9A 2J8UA 3DIFB 4F7TA 3C08H 4S1RH 3QUZC 4C4KO 1NLDH 4OF3A 5J3HC 4PR5A 2OZ4H 4X4MA 4N8CL 1TITA 4QOKD 3RGVC 3EYOA 4AH2A 3CCHB 4Q97A 2FCBA 4QHMA 4NZDA 1MCDA 3QG6A 1UJTA 5TF1L 4JDZB 4NZRL 2VQUA 3MV11 3DV6B 1WBYB 1QP1A 5E5MB 4WJ5B 1VESA 1CS6A 1VGEL 4LF3B 1AGBA 5DEFB 3MCKA 1RUQH 3RDTA 2QSCL 3N9GL 1ITBB 5KOVC 3LPWA 1C7SA 4JFEA 3HC0A 2E8YA 4CW1A 5SWSA 3DX6B 3QUMH 3WJJA 3B83A 3TV3L 2PXYD 4OLVH 4J2XA 3GMPA 5L6YH 3SPVB 5IK3A 2WUBL 4R8WH 1LO2L 1JRHI 1J12A 4Y89A 1I4FA 5KS9A 1MCOL 4MNQA 5TGBA 2NQCA 3QEGL 1J10A 2AERT 1CLCA 1YJDC 5IW3A 2ARWA 1UQSA 1F2XK 1MCHA 4HUNB 2XPGB 3LVEA 2P5EE 2ZCHH 3LKNB 1VFAB 4HG4J 5DD3L 4XMKL 5LKNA 1UWEH 4NCDA 4X8JB 1CFVL 1C5DA 1M7XA 4DZBA 5JHDA 5J6GA 3O8XA 4L3EE 3GRWL 3SEPA 3RQ3A 1Y6NR 1N2RB 1P4IL 5C0RH 4NKOA 1J0ZA 4ZS7H 5T1MA 3ECBB 3C9NB 4NSKB 1ZLUK 2HFTA 3D39D 3RTQD 5L9DH 2EXYC 4MS8C 1TJGH 3EFDL 1T04A 3QEQD 1T7XA 3VXSE 4ERSL 3RKPA 4IHOB 1KPUB 1A5FH 5T1MB 5EULV 1A14L 5ANME 4X9FA 3ULVD 3MV8B 2YD5A 4U1NB 2NY4C 1I9RL 1A21A