1I9JL

Testosterone complex structure of the recombinant monoclonal wild type anti-testosterone fab fragment
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
219
structure length
219
Chain Sequence
DVVVTQTPLSLPVSLGDQASISCRSSQSIVHSNGNSYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RECOMBINANT MONOCLONAL ANTI-TESTOSTERONE FAB FRAGMENT LIGHT
publication title Structural insights into steroid hormone binding: the crystal structure of a recombinant anti-testosterone Fab fragment in free and testosterone-bound forms.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 50
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2001-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1i9jL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1i9jL01
3BT2H 2X10A 4MA7L 2BJML 1KACB 1RIUL 2VXUH 4G9FB 4MCYB 1LO4H 3VXSA 1U36A 3OWEA 2W0FB 4Z7QE 4OI8A 3MV8A 4LNRB 3NZ8B 1G7IB 1QHOA 4UOW0 2BCKA 4KROB 2QQNH 3U0PB 2IANA 3WIFA 3ZO0A 4V2BA 2VSDA 3UC0H 1IQDB 4L8SC 1JGUL 1OP3K 5CP7A 3RU8L 4NO5B 4P9HH 3LEYH 2OBGA 4V2CB 2G9HA 2VZ3A 3RA7L 1MJJA 1WWCA 4DKEL 4J3WA 3QUML 4QHMA 3OKMB 5KN5A 4O02L 2AQ1A 1I75A 3K0WA 4UUJA 2NY5C 4Z7WA 3BN9C 2VQ1B 4YUEH 3LS5H 4URTB 1J1XH 4PP1C 3FQXA 4JN1L 2G60L 1H8OA 1YY8A 5F96L 4LCCA 3QO1B 5GJTL 3GSXB 1Z3GL 5E4EC 3P0YH 1B3JA 2X4UB 2E5EA 3MO1B 1GPOH 3MR9B 3ARVA 2GSGA 4XPBL 3OAZH 5CP3H 2V5RA 1EHXA 2XZZA 4FQXA 1T5WB 4J8RA 1TETL 4QNPE 4WI3A 4BFIB 3QEUB 4X4MA 2MSPA 3P3YA 2YUZA 3EAKA 4BYHA 4HULB 2KQMA 4P46B 4N9GA 3T0EA 4YZFE 1RUPH 1A6TA 2FEEL 3O3DA 4ZPTA 3B3IA 2AEQH 4MWFA 2FECL 2NY7H 1WZMA 4LSQL 3GMRB 2K9UA 2WANA 3CC5B 4NRXB 3QFDB 4QXTA 5D72L 5KVMC 5KVDL 5C0IA 3V52L 4MAUL 5IBLD 3BKJL 4XVSH 2X9YA 4HKBB 3C5JB 4JQIH 4QXWA 3C60A 1MVUB 5JORA 2K1MA 3L1OH 2W9LA 3MRMB 4JGJA 5IFJA 15C8L 2FATH 4MQTB 1TVHA 5HD8C 1ONQA 5KSAB 4Z7VE 3ARQA 1JI2A 4RWYL 2FH6A 4JREC 5F7NC 5T3XD 4RAVA 3QNXA 3LSOB 2KQNA 1D6VL 3S35L 2X5PA 2XN9A 4JVPA 3HPJB 2B1HH 5BQ7B 3FT2A 3MC0A 3KYMB 2RCSH 2ZCHH 4KVNL 4QEGA 3WXWH 1R5WA 2YD2A 2BSSB 4RMUA 4WV1C 2MNUA 5D7SL 2F53D 3OG6B 4PGCA 3GMLA 4QHLB 4K9EH 2CR3A 3FB8A 3FOLA 4PJGB 5IVXF 2JJSC 1EEQA 4GQ9H 3F7QA 4G7VL 1Q0XH 1U8LB 3SDCD 2YPLD 1JWSA 3QDME 4DKAA 1MEXL 4U7KA 3WE6A 3MLYH 5MP6L 2E9JA 3WNPA 1IQWL 1AGBB 2AK1H 2W65A 5F1OB 4YFEA 4JFZL 3N9GH 2HLFC 4WNQB 5GGRB 3RWJB 4FN0A 5IB5B 1PVHA 5IOPA 4ZQKB 3QEHA 3DHJA 3ARSA 1NJ9B 5JLZA 4JFFE 5C0CA 1U6AH 3VE0B 5D7KD 3TN0B 4QRRA 5IKCA 2FX9L 1FYTE 4LCYA 1XCQB 3SGEI 5CSGA 1UB6B 4YDKH 2R1YA 5F7EL 4ZO6A 1S8DB 5EUOE 3FQRA 4YHNB 4M61A 2LABA 3DMMD 1NCWL 3QQ3B 5HHVL 4N0UE 5D4QA 4EIZC 4OGXH 2SEBA 3ARGB 3TCLB 3ARDB 2ICEB 2IPTL 4M3KB 3S4SA 4LF3A 1WBYA 1I3GH 3T0WA 2F19H 3WKMH 5IEKA 5DD6B 4NQCE 3IDNA 3VGBA 2CRMA 5MEQA 4ZPVA 4MB5A 1U58A 2BOCA 4K07A 3BGFB 3ZLQC 3L5XL 4IHOA 1VADA 4Q2ZB 4TVPH 1ZEAH 4G8GB 1I9JL 4GKNA 2P49B 4LL9A 1WAAA 3CPLA 5A1AA 3TVMA 2NY1C 4QGYA 4F7MA 4FNLH 4F15B 5L8KB 3GMMB 2X41A 5IGXL 1FZKB 2VUOA 3WIIL 4P9HC 3U0TA 1MPAH 1A3RL 5C0DA 5A16A 3JUZA 2EIZB 4GJTB 3S37H 2WWKO 1YEJH 2VDRH 1JF1B 4X9GA 5GZOD 3UTTE 3BIKA 1JRHH 4XGZA 1T20B 3CFCH 4FQQA 3AREA 2DQJH 4OZHE 4LVHC 4MZ3A 4MD4B 5JUEL 4X4YB 1R3LA 3ILPB 3UMTA 4ODSH 2P24B 4Y0GA 3CVIL 3OGCB 2BSTB 2ATPB 1FBIH 5I0ZA 5IWLC 5JNYB 1RZKH 2AW2A 4ISVA 5F7YC 5HSFA 1F02I 3RWIA 1INDL 1MCSA 4Q6IA 3TCXA 3O2VH 5CUSH 1KCUL 2ENYA 2CLZB 3L3OA 1TCRB 2GY5A 4S1RH 4GRLC 3QIUD 5IM7A 4NZDA 2DI7A 5ETUB 3S36L 1FIEA 5DJ6A 1IT9H 3SCMD 1II4E 3O4LD 3OJDA 2AV1B 1OW0C 5L6YL 3JBG7 1J8HA 1D5XA 1Z0MA 4IRJD 5I74C 4MCZB 5KS9A 3LV3A 3QWOB 4OI9A 1NMAL 4NM4H 1KXQE 3RZCA 3MNVB 2V2XB 1MCHA 3B9KD 4LFHG 3V8CA 4NNPH 2Z31B 3VMPA 3I3EA 1XF1A 2OK0H 4LASH 4P57A 3MXWH 1I1AB 5IB1B 1A6AB 4NGHL 4NP4H 2IQ9H 1U3HA 5CEZE 4PJBB 1CLZL 3FN9A 5I30H 3U1SH 2QADB 4KZEL 2J8UB 3GKWH 4LMQI 4EVNB 4KK6C 2H3NA 4RGMB 1NMBL 2MWCA 3KLAA 5D2NB 4R96A 5HGHB 2ENSA 4XPFL 1GSMA 1TNMA 1K4DA 4JFXB 4PV8B 4KROD 4WDIA 1DVFB 1LO2H 5HI5C 2PO6B 3EDJA 1CDHA 2EDWA 5FHBH 5EH1A 1IMHC 1MIEL 2K7QA 1OT1A 4RGNC 5DJ0A 3ARBA 3SEPA 2BSRB 1JF5A 4YHZL 1QFUL 3C09C 5EBWA 3VWKC 4XC3L 5B39B 4UI2A 5DEFB 3QPXH 1P84J 2FLBT 4UOJA 3H0TA 3MUGB 1KB5H 1KXTB 3ZKXC 5C0RH 5T5NF 4Y16C 3N50A 3GNMH 4U3HA 5K59F 4H25A 1MHEA 1YPZA 2FRGP 5DJ8B 5GGVL 3RHWK 3QXUA 5DJ2A 2B1AL 3RVTC 2FJHA 4OBSA 4C83A 1NCTA 1PSKL 1CFQA 4MJIA 4HQQH 4XP6H 4XWGH 3GK8H 4WEUD 4RQQA 4N8CL 3FB7B 3BEVA 4LPUA 4ONHB 2OX5A 3BPNC 4JKLA 4M6AA 3RY6C 1A14L 1YEKL 4GMSL 1AR2A 5HGBB 1IAIL 5AYUH 1I7RA 4P4RB 1DN0B 3SDDB 3C08L 3DWTA 3PQYD 5HY9B 3NFSL 3SPVB 3NABH 1HHGB 5DK0A 5AD0B 4PY7A 1Q0YL 4QTIL 4MXWL 4F9LC 3P9MA 5B3NA 1D9KC 2BVEA 5I71C 1P7QA 5E99L 1NUDA 1ZA6B 3BUYA 1OGTB 4PJ5E 1FGVH 3C5SA 1EV2E 1JPGA 1EO8H 4P46D 1QEWB 1H3VA 5D9SA 3SKOB 3MBEA 2VR5A 1MREL 3KPQB 4WU5A 1EA9C 2DLHA 1ZHBA 5EU6E 2CLVA 1XZ0A 4J6RL 1NCAH 3RGVC 4PRPE 1GH7A 3DXAA 1CDGA 1FV1A 1J0HA 3FKUS 3MLZH 5C0EB 4OZIF 1ZT4A 2H2PC 1OSPL 4IOFD 4YIQA 5I1GL 4U1JA 1JGLL 1T66C 1NLBH 4K3DL 4DWHA 3QG7H 1HYSD 1HH9A 1U8NB 3WHE0 5IJVA 4QOKB 4IDJH 5L88H 32C2A 3GMPB 2HFTA 3TNMA 4JY5H 5GSRB 1CDIA 3Q6FB 5J7CC 2E7BA 4TSBL 5ID1B 3O81A 1G1CA 1P7HL 4E41E 1FNEA 4PTUA 5A43C 1KELH 3AC0A 2UY6A 5LBSL 3TIDA 5C0BE 2ZP0T 3F7YB 1IAII 3SDAB 4OF7A 5SWZE 3IKKA 1J1OH 5ESAB 4TPRL 5JZ7C 3NN8A 4U1IB 5JR1L 1YN7B 2J8HA 4YDIH 1A3LH 1OGAE 2ZG1A 4PS4L 5FUZH 1KB9J 4KH2A 1A1NB 3MRRA 5TPWH 1KENH 4XPGH 1FNSH 3KPMA 4AEHH 3I50H 4K7PH 4IRSB 1X4YA 4RBPK 5FUOL 5ESVB 1WBZA 4YNYB 4PY8I 4K94H 4ZAKB 3VXRB 3BDYH 2RQ8A 3D3VE 3VRIA 3NTCH 5LGJB 4LSSL 1JZ8A 4KRPB 3IT8D 4PGBB 2ORBH 4BJLA 1RZKC 2YUVA 1EHLL 4PRHE 2NLJB 2C3GA 1YN6B 3FT4B 5CWSB 3LZFH 3DGGA 3VJ6A 5L7XH 1JV5B 3VFSA 1AXTH 2WSKA 5DI8B 4XP5H 3MMEA 3HI5L 5E56A 4A2LA 4PTTA 3CDGA 5L0QC 2DYPB 4XTRC 4KJPC 3L6FA 2BNQA 2N56A 5BV7H 1LE9B 2PW1B 3RAJL 3SGJC 1U8IB 3R1GH 1QOKA 1T7YA 5LVEA 4HLZG 4U1KA 3CFIC 2HTLD 5KSVA 1BVKA 5C7XH 2RB8A 3SQOL 1B9ZA 1NANI 3BRGC 5CJOL 5DT1H 4LPCA 1WFNA 5ANME 3ARGD 2V17L 3QIWC 1KCVH 2VABB 4HXAL 4AY0A 3QA3B 4LPVA 1GJIA 2NW3A 2GFBB 3AY4C 2VDLL 2OI9B 4GAGL 4JKKA 4L8BA 4OZFG 1H15B 4QY8A 1E28A 2AXFA 4ZXBB 1ZOXA 3O2DH 3QXTA 4OTXL 3P77A 3STLB 2Q1EA 4U1SA 4X4XB 3P4MB 3MRPB 5EORH 4NZTH 1UCBH 5DTFB 4D9LH 1S7WA 2ZUXA 5I1LB 4MQ7B 1QP1A 1WT5C 4NWTH 1UM5H 1CICC 4MAYB 4NJAL 1YYMH 4NQED 4UAOB 4PJIF 1NBVH 3KAAA 3C5ZB 5TQ0L 1QHPA 3GMQB 4BKLB 1Y0LA 1MCDA 5F6IB 4WFGE 1MY5A 4U33A 1XF3A 3RVXC 2YA1A 4PJIB 2MKLC 3WNMA 1YECH 4PJ9A 1GGBH 1HSBA 2H2SC 1G9EA 3U2SB 2D0HA 2DQHL 4OGZA 4UB0H 1X5IA 5H8DA 1O7VA 3HPLB 4HPYL 3EDFA 2PUQT 4MB3A 2EEBA 4LSPL 4NN5B 2LE9A 1ZS8A 3LN4A 2WBKA 2D7TL 4Z0BH 2YEZA 4K3EL 3FCTA 1EEYB 5JOPD 1IAMA 4FFWC 4LCWA 5I1IL 3FMGL 3EOTL 4LIQL 4LSVH 5HHOE 1J0YA 1TNNA 5BRZA 4HEME 4NQXA 4PR5A 4Y7MA 4EDXA 3G08B 3LQAH 1FCGA 2XTJB 4GG6F 4YWGL 1T21A 5HYSB 2NXZC 3DX8B 2GSIB 3FOMB 1WC7B 5DZNA 3V6OA 3K1DA 3BE1L 4L3CB 2UWEF 4KPHH 4XNXH 4HFUH 2Z31D 3WS6A 4YQXL 4GAJH 3EO9H 4PG2C 5FGBC 1N59B 2I60H 4MS8D 1I1AD 5T1DH 4K23H 4WCYH 5DURB 1FORH 4P2YA 4NPYA 2EO1A 5FM5M 3WJJA 1KTLB 5GPRA 4JFQA 3Q5TA 4OCSL 2OL3L 1I7UB 4Z7OF 4WWKC 3U79A 2ZUQC 5I1JL 1BBJB 5C0JA 3O45A 5J1SC 5F7WC 4L9DA 3OAUL 4FQLH 3MODL 1DVFD 2CIKB 2JJTC 1H3PH 1E27B 2PO6D 4ZDHB 5I2IA 5EU7E 4PB0L 3F65A 1T1YA 3KPTA 1UWXK 4KKCC 3I75B 3R0NA 4P3CL 3DYPA 3GSUA 2DAVA 4NSKA 1TZGH 1ZE3C 5HDBE 3QRGH 4L4JA 1AE6H 5FGRA 3H7BA 3PDGA 3IDXH 1KIPB 2BMKB 5HHNB 1DFBL 3IDUA 4N8VG 4NCC1 4GRMA 5F3BB 2JK5B 3QDGE 1GZPA 4XPAH 5EDXA 2V2TA 4Q74A 3SGKA 3W0WA 4NQDA 5MI0C 4XHJC 4ONFH 3FHAA 4EN3C 3T77B 4CN6A 2WQ8A 1PG7L 3QUXD 1KN4H 1IC7L 4L4TA 5GGTH 4DGIL 2PYEB 1ZLSH 4TUOB 3FQUB 3BGAA 3DRQA 3HZKA 4PJDF 5LQBL 1KCSH 4XNMA 3VXPA 4LPWA 3V4PH 3LH2H 3MA7A 3BAEL 5EBGA 2P7TB 2D03H 2CXKA 3IDGB 3GMOB 3PWPB 5EO0A 4UTBH 3UJJL 3PUCA 4HS3A 2R9HC 4P49A 1T04B 1J05A 4RMQA 2VKWA 3IYLW 5BV7C 4R2GB 1GVIA 1EEZA 4Z6AT 4OJFL 1CTNA 3MNZA 5HYFA 4BUHA 2VDOL 4PRIA 3P4OB 4FMKA 1KNOA 4GG8A 4LAQH 1H8NA 3JTSB 3M8OL 4F3FA 3QAZB 2ESVE 3FRPA 4CUCA 3ULVF 1A7PH 2CKBL 3LN5A 1RZGB 5K9JH 1HKLH 5IB4B 4WGWB 4LAJH 4QOKD 1PGRB 3DVNA 4LSUH 1F58L 4OCRL 4ODHH 3IJYB 2EEDA 4KRNA 2YOCA 2JELH 4YHIA 5FCSH 2VQTA 4PJ8B 3P9LB 1XF4B 4NUJA 1I3UA 1W72H 3NCMA 1RJZA 5I18L 2I07B 5DK2A 4KI5F 5C0AB 2WIMA 3HAEG 5BZDA 2H6PB 3O41B 1G7LB 4MSWA 3SDAD 1YUHA 2X4NA 3TYGL 4BK4A 2E6JA 1PLGH 1DE4A 1JHLH 1TJIL 3N1FC 2DQCL 4AT6B 4QHNB 4HGWB 1AKJD 2IPUG 3H9SB 4YX2H 1E4KA 3VXQB 1CE1L 5L2KA 1G1YA 2E27H 3EUUA 1K4CB 1RZ7L 1PKQE 3QISA 4F7EA 2DIAA 1UJ3A 3I6GB 5E70A 5AYQA 4ZAKD 3VXRD 3DURB 1NBZB 5T3XL 5D6DA 3HI6L 1IVLA 1D5MA 4X5WA 3KPPA 4KRPD 3SJVB 6CGTA 4OV5A 4HT1H 3Q1SH 1VENA 3T4YA 3V4UH 3HG1B 4IMLA 1FG2B 2NZ9D 5HYQA 4M7KL 4P2RA 4DW2L 1R3IL 1SEBA 5GS0L 2MOVA 2OP4H 1H0DA 1I4FA 3MROB 2CK0H 3VXNB 4JDZA 3VDBA 3NFPA 3O3BB 2H26A 4JDVA 3LQAC 4OCMC 5JOFA 4S1SH 1EO7A 2P5EE 4LRIC 1OCWH 4CMHC 4KKLC 4D9RE 5DMKB 4ZOCA 4MJ5B 1HQ4A 3D39E 1I1FA 43CAB 2AKRB 1XT5A 3DX6B 5E6ZA 2G2RB 2R4RH 4M43H 1FNGB 3U0WL 5EZLA 1T1WA 2EYSA 1CFSB 3VA2C 4Z95H 4D3CL 4LHUG 4JFOB 4HS8L 3SE8H 4M1GH 3TBSB 1B0WA 2AAVA 2XWJA 2DMBA 4ZXBD 4HJJH 3BP7B 4NCDA 4KRLB 5C0GA 1FYTA 2X89A 4I0KA 3GJFK 5ID0A 3TPUA 4GW4B 3X14B 1MHHB 4OD2A 1IEBB 3SY0A 1UH4A 2JB5H 2QSTA 4XXDA 3CH1B 1U8OA 5EUOA 3CNKA 4QKXB 4MAYD 4ELKB 2IH1B 4NDMB 1I3VA 1ADQA 1ITCA 2ZCLH 4F7PA 4PBWD 3CFBA 4UZGA 4P2OA 4LGRB 4O9HL 3QCVL 1SYVA 3VFGL 1F3JB 4LSTL 2WBWB 1FRGL 5IVZA 1IKNA 1F4AA 2E3VA 4OQ1A 2GJ6B 3ZL4L 3C5ZD 2HLAA 1LP9E 4KC3B 2QSQA 4JPIB 1IC5L 5IK3A 5ILTL 3MLWL 1NAMH 1QUNA 4L5FH 4NNYB 5DR5L 3ZDYE 2DI9A 4IOSD 5ESQB 3KS0J 3GHBL 3HE7A 3HZVB 5GGSB 2AJZB 3PGFL 4PG9B 1A4KA 2WINB 2Q6WA 3WNNA 4TN9A 2PXYA 2DKMA 3QQNA 1JPSL 1W0YT 4G8FB 4MNQB 4M6ML 4Y4FC 3ZHDA 4YDLB 5BXFB 4D0BA 3ULSA 1CFVH 2FJFB 2XA8H 3L3DB 4TSAH 2DTML 1B4JH 3DPBA 5KSBE 4NRZA 4Q9QL 3IFPB 1UQSB 3VXUB 2RJMA 1LDPL 4HK0A 1IM9A 1A6WH 3E2HC 5F3HB 2XTJD 5T5FH 4IIQB 1JZ7A 1WICA 1A6VH 3ZE2F 4CU7A 3CU1A 3OR6A 3PP3H 4Z9KB 5BVPH 2VC2H 1DQLH 3S96A 4HWEL 2WUCL 4M7LH 1N2RA 4WW2C 4U6YA 1PFCA 5I1CL 4WUUA 4DTGL 1I8MA 2Q8BH 2VLRB 5DURD 3PNWB 1GIGL 1E6OL 5I8KH 1X7QA 3MXVH 4KKNA 3BT2L 4WTXA 3OTTA 1KCRH 3QNYA 4FFYL 3C6LB 4JFEE 2AV7B 3K2UH 3JTTA 1LO4L 2WBJC 4MLIA 4KHXH 1IILE 5TDPA 3QPQC 2A83A 4WHDA 1GGIL 4HWNA 1RAMA 2A6JA 4L9LC 2IMMA 3BOVA 4J4PA 3PDDA 4JZJB 5I75C 1QFPA 2J12B 2QQNL 3ARFA 5C09A 2KUTA 3NCFB 4RMTA 4FQ2H 5JHDD 2P47B 3QUYA 3VXME 3UC0L 3V6BR 3E1F1 1NFIB 4P9HL 3V7AG 4MA3A 3LEYL 2EXWC 1KJ3L 4R4BB 4I4WA 1UZ6F 1ZK9A 4I9WD 1BEYL 4S0SD 5EOQH 3FO2B 2OJZH 1N5YL 1NGYA 3WMSA 4YUEL 3LS5L 2BVOB 5TE6L 3GMNB 3HRZA 2D7OA 2PYFB 1D7FA 3HKFA 3G5YB 5DHYB 3P0YL 4JO4H 1NMCC 3QZWB 4B0MM 3X3GL 1GPOL 3LEVL 2R2EB 2ARJA 1UA6H 1X6NA 4Y2DA 5F97E 4HUXB 3IAQA 1C08A 1CFTA 3VFRA 3PWPD 4H1LG 4P5KB 1KJVA 1DZBA 5CHNB 3LKNA 2N7BA 4HBCH 5J13C 1JZ4A 4R2GD 4JDTH 4P5MA 4HS6B 1RUPL 1X5KA 4D0CB 2FR4A 5FYJD 3GSNL 3MRBA 4K71C 2FBOJ 3SBWC 2NY7L 1HEZB 1CXIA 5J9PA 1YNKH 3PXJA 4MDJA 1I9RL 3ARTA 3K3QA 3HHRB 2ATKB 1A6ZA 4I0PB 3UPRA 1G6VK 3KLDA 3TBYA 3GO1L 4XVSL 3L7EB 1Z9SA 1JZ6A 4JFDA 1HKFA 2IAMB 3MGTB 5C2BH 4PJ8D 1X5AA 3ULVD 1BX2A 1XGUA 4OF3A 1CDUA 3O2WL 1S7XB 2P5WE 1O5DT 2NTFA 5TDNB 5C0AD 5SX5H 2Z4QB 3JWDC 4XPHH 4L8SA 4C56B 3OAYH 2DQIH 3DX9B 1M71A 5C07B 4UINL 1AY1H 2GCYA 2B1HL 2FEDC 5HJ3A 4KI5D 1Y6MR 2ZCHL 3H9SD 3HS0B 3WXWL 1YEFH 4UQ2A 5SWQB 3L95B 1KC5H 3DVGA 5ISZE 1INQB 4MQXC 1AO7E 1U8QA 1ED3A 4K9EL 3EDDA 4KFZC 1B90A 5F6HI 3IGAA 5AG8A 5HHQB 3BZEA 4GQ9L 2AXJA 5HDLA 4L4VD 3SKUD 4E41A 3OZ9H 5DEGB 4J2XA 1J0ZA 3MYJB 4X99A 1MWAB 2RIKA 3X12A 2ITDB 5GRJL 3OF6D 3LKRA 5ENWB 3S8WA 4Q58C 3MLYL 4Y19E 5D6CB 3HG1D 1BVLA 1FSKC 1G7HA 1OF2B 1GXEA 1JNLH 2PW2B 2NW2A 3WEXA 4ESKA 3VG9C 3N9GL 3IDYB 3HNTL 3MQIA 4UQ3B 4JPKL 1DL7H 1FZOA 1UKQA 5LXGH 1U6AL 2FHBA 1BF8A 4YFLI 4ETQB 4XX1G 1KT2B 3L3GB 2AJSH 3IKCB 4FQHA 4QT5A 1L0XA 2HJFA 3D2UA 4L3EB 3D3VA 1HIMH 5IBLC 4AQOA 4YDKL 1NDMB 1K8IA 5E08L 5J12B 1JPFA 3U4BH 3GRWL 4W6YB 4MYWB 4KV5E 4RFNC 4YHKH 4BFBD 4MX7A 3W9EA 4DN3H 1T6WA 4OLZH 2F19L 3WKML 5J6GB 3C6SB 3DVFA 4HKXB 1J87A 3E6FB 4RCAA 4PV9B 4JFPA 5DC4B 4TVPL 2QHRH 2R2HB 1ZEAL 4PGDA 5KAQF 5DA4A 3FONA 5DRWB 3CUPB 4X6DA 1RU9H 2X4RB 1Y18A 2CO6B 3TJEH 5TH2A 4PB9L 2NY6C 4P2CG 2Q76A 5E00B 2QSVA 4HEPG 4RGOL 5ANMA 4FNLL 4AH2A 4ENED 4G42B 2UUDK 5JQ6H 4HH9A 3CFJB 3RNQB 1MPAL 3SO5A 3SDCC 1QFWI 4KJQD 2GJ6D 3S37L 3JZ7A 1YEJL 1XF5B 2VDRL 2JJSA 2NY0C 3WFHB 3CFCL 3QXDB 5C1MB 3ETBF 1KFAH 4JKWA 5ECJE 2ZUWA 4ODSL 1HHHA 1S5HA 4Z7VB 4KJWD 1K8DB 3CSBA 4MNQD 1FBIL 5D7IF 3V5HB 1CE6B 3LY6A 2R56L 1MJ7L 3O2VL 1DQQA 5CUSL 1FO0H 1FVCA 1MFAH 1T0PB 3QH3B 4EUPH 4S1RL 2VDQH 2FYYB 3DMMC 4LP4A 5DVLA 1WCBB 5I17A 1MELA 1IT9L 4BQ6A 1JUFB 3C8KA 5CKAA 1F6AB 2B39A 1UM4L 3DSFH 2WWMD 2CDEA 3IDJA 5D7LE 4I3SH 4Y4HB 4B50A 2EIEA 3HE6B 3PABA 5HYJE 5D2LF 1BQHG 4NM4L 1NFDE 3QDMB 4YO0A 2R69L 4BH7A 4GMTH 3CFKB 1NKOA 4J1UB 1BPVA 2C4XA 3ESUF 1B4RA 3KYOA 5I1HH 4EI6A 2OK0L 4XCEB 1TVBB 2VLRD 2VB5A 3MXWL 3UTSE 1XCTB 5IMLA 4NP4L 1IGFL 2A0LD 5ADOH 3O6FC 5HHOA 5I30L 1LGVA 3U1SL 3C6LD 4MQSB 1JRHI 3CU7A 1EO5A 3GKWL 4R4NC 4JFFB 4LDOB 3HR6A 1ZGLB 3LKPA 1T0NB 1F45A 2HWZH 5FKAA 3BIBX 1FN4A 3ALPA 1EZVX 5F7MC 4Z7NE 5FA3B 5J8OA 1DDHA 3KYNB 2Z8VC 3VXOB 3ARWA 5EIIA 2EYRB 4N0UB 3MJGX 4Y5YC 5GZND 1DCLA 1HE7A 5FHBL 1DP0A 3RUGF 3TLRA 4NKIH 3T0BA 2WIIA 3BKCH 1U8JA 3O6KH 4ORGB 1B0RA 1A6PA 1WITA 3LKSB 3L5HA 4JR9H 4N0YH 4R4FL 2Z8SA 1U8PB 4NQCB 3CMOH 3QPXL 1QLFB 4TRPH 5EOCJ 3ZYIA 1JZ3A 4PP2A 3MRFA 1KB5L 3MACH 3AVEA 4I1NB 1NGXA 1N6QL 5F88A 2X4SB 3MRHB 1IC1A 2ZKHL 3FO9B 2DQTH 3QIUC 3DV6A 3WCYA 35C8H 1WISA 4UDTA 1BOGB 5IWLA 4HQQL 1KJ2L 4XWGL 3GK8L 4IRJC 2AJ3B 2EDBA 1S7SA 3HI1B 4ZFOL 4GRLA 2G75A 4JM2F 5CP3A 2J6EH 2AEPH 5AYUL 5BO1H 3LS4H 1XGQB 5FA4B 3QUZC 2HMID 4TUJB 1HZHH 1MVFA 3WUWA 3UTTB 3FO0L 2PNDA 2UUDH 1LQSR 1ZVYA 3MZTA 1DANT 2OMBA 4OZHB 2FBJH 1G6RL 5J1AA 1WFOA 1FGVL 1EO8L 1FVDB 5DS8B 4ZSOA 4LIQE 5CSZB 1NSNH 4NQSB 3S97C 5FGSA 3RZWA 1FL6A 4P5TA 3VXTB 1RI8A 5E8OA 3NPZB 1CTOA 3TBTA 3DLQR 1NCAL 1RK1B 1DBBL 3PIQB 4KROC 4ELMF 1EJOH 3LB6D 4X7DC 4PJCA 3MGOA 5SWSB 4I0PD 1S5IH 3QG7L 1S7RB 3NCEB 3NFNA 3T3PF 3IXAA 2IAMD 4HUMB 4POYA 1J86A 4JY5L 1L9NA 2ICWJ 5FV1L 2H32A 2CDGA 3MGAA 1RFDH 4O5LH 1CU4H 1FLTX 2FGZA 2XG5A 4DKFH 4AIZB 2QQKH 1T4KB 2IG2H 4WIQA 4C56D 1BQLH 3I3DA 4TNVK 5J57B 3MV7B 4FG6D 5CS7A 5MEOB 7CGTA 3NAAL 1WIOA 1A7QL 4CJ0A 4I8DA 4LBEA 1J1OL 2BVQA 1VGEH 4HV8B 3EZ8A 4X6FA 4YDIL 2I5YH 1A3LL 1JGDA 4NKOA 4ZD3H 2HYMA 3K8MA 4Y16A 1Q1JH 4CN1A 4NZUH 2XV6B 4XPGL 4JO2H 4AEHL 3I50L 5E8PB 4G6ML 5LJYH 1M1SA 2BRRH 4LU5H 4K94L 2WW8A 1Z9MA 3BDYL 5EULV 1EUTA 3VRLF 1JP5A 2XNAA 3GSOA 3H42L 5E7BA 4P46C 1ZVSB 4M5ZL 4KMTH 4KDWA 5T33L 3LZFL 5L7XL 2XIDA 1AXTL 1RV6X 2VITA 4TULH 5T3ZH 4XP5L 4F9LA 1D9KA 2YKLH 4YHMH 4CNIB 3O6MH 5E2VH 4UNUA 1I3RB 4I18B 1TZHA 1T0MB 3G5VA 2W9EH 5L2JA 3TO4B 4JANA 1NEZB 5BV7L 3EYQD 4IOFC 5HI4D 7FABH 3FT3B 4A6YL 5FO9B 3R1GL 3UYPA 4L3ED 1T2XA 1QVOB 2FZ3B 5C7XL 3IS1X 3L5JA 1VFBA 5DT1L 1V3KA 4EI5B 3GZKA 3OB0K 2HAZA 2JIXB 2VZOA 4Y88A 5F9WB 5C08B 1LILA 4TOYH 1X5HA 2Q20A 1KCVL 2HFGH 5DQJB 5KSAC 3W5NA 2W60A 3D0VB 3ECBB 3CXHJ 4U3CA 4L8CA 4XC1H 3G6AB 3OXSA 3S34L 2MQ0A 2OMNA 4HJ0D 1MRCH 5C70A 4PJ5B 2EIBA 3GM0A 2D0GA 5DMYA 1JWUA 4R8WH 3EYFA 2P5EA 3U9PL 4NO2A 5EORL 4NZTL 4D9LL 5IHUH 1T2QL 1I1CA 5EU6B 3NIDE 4JRYE 1FC1A 1NDGA 3IFNH 4K7PY 5BS0A 2C1PA 4D0DB 5CJXC 3G04B 4I3RH 4FOMA 1AXSA 2X4TB 1YYML 4KXZH 3BRDA 3O9WB 5GQBA 2EXYD 3V6ZB 5TF1H 4J3SA 3KPSE 4NC1E 2DJUA 1S9WA 2XG4A 1JTOA 5FYKD 1MCEA 3U6RA 3TNNB 5KW9L 1XIWB 1YECL 2ZUSA 3I6LD 1F11A 3CSPA 4DGYH 1GGBL 2DDQH 4EZMA 4UB0L 5C0BB 4N1EA 3TN0C 4K7FA 1CVSC 4HIHA 1YJDC 4O2FA 1RY7B 2HN7B 4ZUUA 5SWZB 3MV8B 4U0QB 3NMEA 3SDYL 4Z0BL 2HTLC 3WIHH 3NGBB 2BCKB 5T3XE 1NAKH 3BO8A 4LSVL 5K93A 2HJKB 1JE6A 3ARDC 2XPGA 1LP9A 4KUZH 4X7SH 3V95A 4Z7WF 4Y4HD 1G9ML 2F53E 5F9JB 5JXEA 1ZLVH 1PQZA 3QDMD 5FYLH 2ADJB 4P9MH 5AWNL 3IJHB 4KPHL 4XNXL 3MOBH 4PRHB 4HFUL 3NCYS 3QIWA 4GAJL 5CBEA 3EO9L 4LQFL 3ZKMD 1QSZA 1S9VA 2YPLE 4K23L 1FORL 4JAMB 3FFCB 5KSBA 5TE7H 3AY4A 4Q9RH 1T1XA 5F7FA 4V1DA 4F15C 5CEYB 4JFFD 1Z0NA 2M1KA 4CVZA 3EOAB 3H9HA 1AGDB 3K8LA 5IB3A 5EN2A 5LWYH 2XRAH 1RHHB 2OJEA 1ZANH 1PDKA 3TA3A 1WT5A 1FHGA 4NKMB 5D7KE 1EGJA 1H3PL 3VG0H 3QI9C 1XGTA 4R7DB 3U30B 5FO7A 1RZ8B 4X6CE 4OFYA 1A1MA 2WP3T 3S5LA 3QFJD 3WHXA 4N9GB 4FXKA 3OKKA 1T1ZA 1TZGL 2YA0A 4UIKH 3OB0H 4NQCD 1AD9A 3P0VH 3PDOA 3QRGL 2BERA 3RJQB 3WNLA 3V0VA 4JFEA 3IDXL 4PJXA 1H5BA 4C57C 5EU4B 3BFOA 1IGIH 4HK3J 4XPAL 2E7LC 5I1EL 1VHPA 2JTDA 1MCCA 3QULA 1UYWH 2AEIT 3MSPA 5FK9B 1KEGH 4P23B 3KHQA 1BIIB 3CK0H 1MI5B 1LEIA 3MUJA 1IBGL 3VI3F 1C5BH 2CUMA 3N1PC 5GGTL 3EYOB 1DLFH 3GBLA 1ZLSL 3BH9A 1UEYA 3FFDA 1LHZA 2CDFA 3D85A 2FL5A 2ZG3A 1FFRA 1CLOH 2BX5A 1Q9KB 3CVHB 3JUYA 2I24N 5E6IB 5GJSH 1WCQA 4QRQA 5I8CA 4X80H 4JM2D 5GIRB 1SJEB 1NBQA 2BNRB 5F9DC 5ITFA 3MCLH 1VESA 2H9GB 2QADC 5DXWA 3T09A 2C3VA 4K2UH 4G43A 4RGMC 5FGBA 5JTWA 1P2CA 5D2NC 3PWLA 4LKXB 4DOHB 4LDLB 4LAQL 2PO6C 3TC9A 3WS3B 5IQ7L 4XVUC 1MCJA 5SWSD 3QJHB 1HKLL 2VZUA 2QR0A 4YXKH 1UXSA 3WD5H 3DO7B 1WJ3A 2F8OA 3STBA 2DQGL 1S7VA 3WN5A 2R1WA 4H20H 3O4LE 4XX1E 1P84K 2JJTA 5FYJL 1W72L 4OCXL 3BI9X 4HDIA 2NPLX 1K5NA 4YBQD 5DUML 3T0DA 3CZJA 3MV7D 4YH6A 5JDSA 4HW6A 4XNUH 1JK8A 1WVZA 1UKTA 1YEHH 4HX1B 3FQTB 4XNZB 4R90H 3C9NA 4HIXH 2PF6A 1MHPH 4YX2L 3ULVL 3OX8A 1M7IB 5TDOA 3ZT5A 2LU3A 5T1KB 3VCLB 3R8QA 3SDDC 5SX4H 2EDJA 4KTDH 1Q9WB 3HMWH 4XRCB 4UT9H 5HVHB 1CG9B 4F9PC 1WAAF 3SKJH 2ICWB 1PYWB 3T0AA 3CZFB 4LGPB 3ALXA 5C6PB 2GT9B 3KJ6H 4C58B 3M17B 1XR9B 3VD4A 4HT1L 4G6KH 3Q1SL 5JPNA 1I1YB 1FL5B 4EBQH 4JG1H 1XF2B 1IAOA 4U49A 5E2UH 4M5YL 2A6IA 5E8NA 2IADB 4P4KB 3IDMA 5K9KA 3K4AA 1VFOA 2ZJSH 3QDGB 4OLUH 4YPGA 3T1FB 3HB3D 2IH3B 2ADFH 4UV4H 3TO4D 3EJZD 3IU4H 5A2FA 4DCQA 5D1ZB 3GJEB 1WBXA 3CX2A 3SE9L 3VMOA 4XP1L 1OD9A 1KBGH 1KPUB 4EI5D 2R4RL 2NNAB 3Q48A 5IW1A 2JIXD 4PRNA 1BOYA 5C08D 1XGPA 4Y19A 4M43L 4N5ED 1OAYL 3BSZH 3KNBA 1MCOH 5LG1A 1G84A 4Z95L 5EU5A 2H1PH 1YDPB 1NH6A 3L7FA 4M1GL 3SDAC 2VXQH 3PQYE 4PJ5D 3O2DA 5DJXB 5FIEA 3O3EB 1KB9K 4JQXC 5KS9F 5DMGC 4XWOD 4U05A 3S6CA 4ZOAA 3UAJD 2GUOB 2JB5L 1N3NB 1MCBA 2R29H 3T2NH 4IRSC 3W82A 1BWMA 5KJRH 2X7LB 4HUUB 4X7FC 4U6HB 3LRSA 3PWNA 2DBLH 2ESVB 3MRDA 4ZAKC 8FABA 2DQFB 4JHAH 1HH6B 3BXNA 1ZAGA 1LD9B 3QR2A 1MFEH 3RZCB 3M1BA 1B6UA 1YMMD 1HI6B 4XMKL 3BVNB 1Y6NR 5BZWB 2NZ9C 2OR8A 4OZ4A 4FZ8H 1NAML 1XIWD 3T4AA 4U1HA 3VGFA 1UWEL 4XPTL 2FWOA 5IHBA 2WNGA 3GIVA 5C0BD 3VXSD 5JW5B 1AGEB 4WI6A 3MJ9H 5SWZD 4X83A 3T0EC 2QL1A 3BPOB 3MV8D 1CFVL 2XA8L 4TSAL 1J12A 4HWZB 3MA9L 4JY6A 3QQ4A 1G0XA 3TYFB 1IGJA 3B8SA 4NWUH 5D1XB 3VDCA 4FHBD 2VXVH 4KMQA 1DQMH 1PKQB 4Q6YA 5GHWH 5ICXA 5T5FL 4LRIA 1XFPA 3VH8A 2JJVA 3QUMB 3P73B 1A6VL 2OI9C 1MCIA 2Z91A 2VC2L 4X6EB 2R39A 4M7LL 1WZ1H 1EK3A 3BDBA 4PY8J 1ZWIA 4WJ5B 3CX5J 2A38A 1BGXH 1OAXH 1AD0A 2Q8BL 2HVKA 2VAJA 5T1LA 3FFCD 2APFA 5IVXE 3A67H 5T1MA 3MXVL 1PBYA 4X5XA 3E6HB 2FIKA 4KAQH 3K2UL 3K4ZA 3F12B 4XCCL 1HQRA 3TFKD 4KHXL 4UAOC 2ED7A 1SBSH 2A1WH 4FQXD 5CGTA 3D39B 1I9IL 4X8JA 3C5ZC 1HHKB 4OI7A 3BZDA 4LLYB 1G7QA 3EYSH 4CJ1A 1D5ZB 2HJLB 3D69A 1MHCB 3DETC 4WHCA 5JQHC 1N26A 2QBWA 5FM8A 1BECA 3UTSA 2R0WH 4HCRH 4YHPA 4NO0A 1U8MB 3NA9L 4JM4H 3MLTA 3L5WA 4M7JH 5E5RB 1T5XA 3K4DA 1PZ5B 5F1IA 2H41A 1MJ8H 5EOQL 2OJZL 3TJHD 4JO1H 4ONOA 5LCVH 4TQEH 1MCPH 4JJ5A 4XBGA 4YEFA 3FN3A 3BWAB 3I3BA 4Y4FA 4R9HA 2EZ0D 3O0RH 1ZA3A 1UT9A 1MI5D 2XTJC 4LSRH 5TE4L 1CD8A 2O5YL 1RIHH 3C60D 4WFHD 5HHXL 2JF1A 4CAGA 2VDMH 3EO1B 4LVNB 1OTSC 1JL8A 2EDXA 4HUKB 5E6ID 3MRNB 1WF5A 4NQEE 1RSFA 2YUWA 3GI8H 4O2CA 3UXFA 2BNRD 1F3DJ 1EEUA 4HBCL 4MNGA 4FQ1H 4YR6A 1EERB 2Q3ZA 4JDTL 3VA6A 1KF9B 1VGKA 4WW2A 5DHVB 3ZTJH 2APVA 1HILB 3VU2A 1HYRC 4PLJD 3MV9A 3HCVA 1DTUA 1YNKL 4AG4H 3PHSA 3TVMC 4G80B 3BHBB 2IBZX 3A6BH 5ICYB 1CVRA 1U93A 1BZ9A 5F7UA 5HBBA 2WBJA 5IF0B 5JOPE 3HZYA 1DR9A 3RI5F 4ERSL 1IZJA 2B0SH 2J88L 3VJ6B 4F7TA 1T2JA 4L9LA 2Y4SA 3RTQB 5D8JH 3T2PA 4LLUB 1ETZB 3BPCA 3OKOA 3CJJA 4ZNEE 4XPHL 4NUGH 3QUKA 4GKZB 4B7LA 5JXAH 4AL8L 4EIGB 3MJ7B 4LLVB 3MRLA 2RBLA 3LHPH 3STZA 1VDGA 4Q6IC 3QWRA 3VWJB 5HPMB 1YEFL 4NT6B 4N1HB 1EFXB 2VQUA 1KC5L 1NGZA 2VE6B 5T1KD 2UV3A 5DD5H 2YSSA 2X70A 1S7QA 3EYVB 4Y4KC 3P30H 3K2MC 1BJ1J 4QHKI 5ELIA 4WY7H 5JO5A 1F4WH 3HC3H 2GW5A 4ZOBA 5C0ND 3VXMB 3B2UD 4WGVB 1S3KL 3SGDH 2Z93B 2AXGB 5IEHB 1JNLL 1R5IA 1QBBA 4YBHA 4S2SA 4G9DA 4OKVB 4AQ1B 3FO1A 4R3SB 4LEXH 1DANU 4P4KD 3UJTH 3UTZA 2AK4A 3RDTB 2NX5A 3TBVA 3QDGD 5MENB 3QAZC 1QSVA 1DL7L 5LXGL 4RDQF 2A74B 4F7CB 5D1ZD 1V7NH 4O51A 2AJSL 4PJAA 1C16A 4EXPX 1AGCA 1WK0A 4ALAH 1AQDA 4HIEB 3KHOA 3U4BL 2LU4A 4PJ8C 4PRDA 2DQEL 1SMAA 3FQWB 2LTQB 4Z7UA 4RRPA 4JKPH 2AP2A 4YHKL 2P43B 5K59E 1X5ZA 3W9DB 4MMXC 5BJTA 1G7MB 3HUJA 5D5MA 4HC1L 4LCUA 4OLZL 4E0RA 4X9IA 2QKIA 2EDEA 1C5DB 5DJAB 1MRDH 5FB8B 2YR3A 1AIFB 4GSDL 4XB8A 1R0AL 3PHOB 5CZXD 4MJ4A 3EYUH 3DUUA 2V7HB 5IROC 2QHRL 1FG9C 4YDVB 2I9TB 5C8JB 5GRUH 4UTAH 1OTTD 1X5JA 3TJEL 1J8HD 2Y06H 5E8DL 3QJFB 4ZO9A 1SYSA 1JFQH 3F7VA 2XFXB 5IV2A 2F9BT 5DRZA 5JQ6L 1P4LA 1BFOA 5E2JA 3RZCD 3MJ8A 4K8RH 4IOIA 2KH2B 4LARH 5DUPH 2YK1L 4NN6B 1I1RA 2HG5B 3RJDA 1NAMA 2CRZA 5FF6A 5FUCC 4JEGB 4U1NA 1K2DB 1J5OL 4QOKE 1KFAL 2P5WB 2ZOLA 1Z5LA 3V0WL 3VFOB 1QBAA 2ZSWB 4NFBA 4XVJH 3RVWD 2VAAA 4OAWB 4I5BB 4PJFA 2JCCA 1NCUA 3C8DA 4OZIE 3L3IA 4Q0XL 2BOBB 2DF3A 2XZQH 4ZFZA 3B6SB 4MDIA 4RZCA 5FFLA 4PJEA 4PLKD 2P8LB 3MBEC 4J3VA 1RJLA 4ODWA 4WI4A 3U9UA 4O58L 1FO0L 5KG9A 1FZJB 2JJWA 5I8OL 2VDQL 4QRUA 4OZFB 2BP3A 5I1AB 2GAZB 5FYKL 5AZ2H 1O7SA 3BZFB 3BH8A 5ISZB 1AO7B 2R2CA 1RJCA 1TPXB 3OJ2C 3RX8A 4AM0A 3DSFL 5CINH 4I3SL 1M7DB 2FJGA 3GBMH 5DJYB 2HT2C 4N0FA 4QYOB 4GMTL 1CFNA 4JRXA 4Z78B 3H9ZA 3VXRE 1CGXA 4NM8H 1QSFA 1UWGH 1A1OA 2M8XA 4GW5B 3IVKA 1YQVH 1LNUA 1AP2B 4CMMB 5F9OL 3OR7A 3QBTB 1RIVH 1IL1A 3G6DL 1BD2A 5I1DA 3UO1H 4JCMA 4FXGB 3LMJH 1UH2A 2VXTH 4OM1H 3CD4A 2HWZL 2UYLA 4DVBA 2XQYG 2XY1A 4NYLB 3D39D 4KJQC 4OD3H 4BQBA 1OHQA 2IFFH 2Y07H 3I2CH 4P2QA 2IJ0C 4G6AD 5D1QB 3S37X 3QO0A 4S1DD 3UEZA 5F21B 2X4PA 1P7QD 3WL9A 4XB7A 5KOMC 3L5IA 4BSVB 2AVGA 3OXRA 3BKCL 3O6KL 4BSWA 2C1OA 3SDCA 2YPLA 4N0YL 5M95B 4XAWH 3ZMRA 4KJWC 1H3UA 1KLGA 1E6JH 5IIEB 3QHTC 3CMOL 5JDJA 4TRPL 1KLUB 2XT1B 4ZTOH 1WZLA 5LAXA 1RQ5A 1YNLL 2DQTL 3RWFB 3KPRE 2V7NB 1F90L 35C8L 3DSNA 4M8QA 4LFHD 2XOTA 4RNRA 4LNVA 2ICCA 2DWEB 3GJFA 3VI4F 4JVUA 2QLVB 3EO0B 1F8TH 2WWMC 1TVDA 4DN4H 4R0LB 4ODVL 4ZOEA 2VWEE 3D0LA 2Q7YA 5J3HC 2J6EL 4ZO7A 3DMMA 5BO1L 3I02A 3L3KB 3LS4L 5IBTH 3EFDH 3KWWA 1HZHL 1CBVH 4HHAA 3N85H 4IM8A 4ZUWB 2FBJL 3U4EA 5EC2A 5M94B 1FCCA 3I85A 4I2XA 3ULUF 3MCKA 2W0LA 1IEAB 3C6LC 1NSNL 3B9DA 1MFCL 4LGSB 2ZNXA 4PJIE 2EDDA 3GSRA 4TNWK 3VGGA 3LQZB 5B21A 3QIBB 1CLCA 2R15A 2HT4C 4MXQC 4JZJC 1DQJA 3O6FA 5IW6A 3DROB 4GXUM 2VLME 5GISH 1EJOL 5GZNC 1JZ2A 1DUYB 3U36A 1TIUA 2X1PA 4N8VB 1S5IL 5DVNA 1SY6A 5E95B 1CN4A 3ZTNH 5D7LB 3OKNA 1A7OL 2YMXL 1G7PB 2EDTA 5EO1A 1MQKH 3RTQD 3U7AA 5HYJB 5HYQB 2Y7QA 1S7UB 1NFDB 2BC4A 3D9AH 4XAKE 4O5LL 4Y5YA 2XTJE 3ULUH 2NYYD 5CIPB 4WU7A 5FDWB 3WFCH 4BZ1L 3G6JF 1G0DA 3U4AA 4JFHD 5GGRY 2BNQD 4GRWF 1ZT7A 3QQ9C 4XCNA 4G3YH 1FVEB 3RP1A 4ODUB 4Z0XA 1VGEL 3THML 4GG6E 3WLWC 2DWDA 3TT1L 2I5YL 4OCYH 2F8VA 2GITA 5KAQG 4IMKA 2HFFB 3G6JB 1EFXD 5BCAA 1Q1JL 2OQJA 3T65B 4NZUL 3QIUA 4JO2L 4NJ9L 3PV6A 4ZUSA 4OKDA 2UWEE 1ES0A 4U1LB 1JBJA 4PRAA 4EQ3A 2VKXA 2HMIC 2BRRL 4LU5L 2B4CH 1XH3B 4EUPG 4IRJA 4OLEA 4DZ8B 2YPKB 1JGEB 5GRYA 4Z8FL 2ADGA 3UJIL 5EUKA 2W0PA 4KMTL 3B9KA 3QUZA 4OZGF 4Z7OE 3VD3A 5JHDE 2NY2B 5T3ZL 1D6EA 2Y5TB 1AR1C 1F6LL 3RDTD 4K3GA 3O6ML 5E2VL 4XH2B 5MEND 4OZGB 1YY9D 4I9WE 2VL5B 4MHHG 4G9FA 4MCYA 2DM3A 3UBXG 2W0FA 3HAEB 4LNRA 3NZ8A 1G7IA 2HLAB 5DC0A 2PTUA 5GS2D 4ZFFB 2B2XH 2VH5H 3U0PA 4PJ9D 3QRFM 3UX9B 4BUGA 2HFGL 2GY7B 1IQDA 1ADQH 4O00A 2VISB 5F1NB 3RKDD 4NO5A 2FO1A 1QFHA 4HAGA 1JHKH 1FQ9C 4D2NA 3OKMA 1LK2B 2JB6B 4LCWD 4R8WL 3ABZA 2VZTA 4PJDE 5BRZD 1NC2B 2VQ1A 1FFOB 1FDLH 5JW4Q 4OFIA 4WHTB 2IALB 3IFNL 4PPTA 4K7PX 5HPOA 4I3RL 3KVQA 3QO1A 3QG6B 3UTQB 5FYJE 1BFSA 4FTVB 2VR4A 2Y1VA 3GSXA 4M7ZB 4W4OC 3QDHA 4KTEH 1I7ZB 2X4UA 3S96B 2XXCB 3MO1A 5TF1L 3TIEB 3RWEB 3MR9A 4U31A 3MOAH 1A3QA 4WUUB 1T5WA 1AQKH 3A0OA 1JNJA 5DVKA 2NY4B 3GSQB 4BFIA 2P5WD 3QEUA 5CLWA 3E3QE 1I85C 4DGYL 2R0ZH 25C8L 3REWB 3RWHB 1KXVC 3KXFB 2OL3B 3ULVE 4P46A 1HSAB 3ARPA 4YXHH 3UTPD 4P59H 1GHFL 3EYQC 4OFDA 5HI4C 1KPVB 4LHUB 3DBXB 4GUPB 5EWIH 5C0AE 3GB7A 4EUPA 2KZ1B 1KPRB 3LEXB 1UFUA 3WIHL 5J12C 3LPGA 1I7TB 2AXHA 4OUOA 2IBGA 4JPVH 3RGHA 1AO7D 3GMRA 1IFHL 1N0XL 3CC5A 3MV01 4KI5E 4NRXA 3QDJE 3QFDA 4X7SL 2VDNL 4HKBA 2BVPB 3MLVH 3C5JA 1MVUA 4HJ0C 3MRMA 1SHMA 2AABH 2K3TA 5F6HJ 5FYLL 1TJHH 5IVNA 4L4VE 5CJ8A 3NACH 5DD1L 1IGCH 5KSUB 5KSAA 4KXZI 3W0WD 4NQDD 4PD4K 4LOUD 5TE7L 4WHYG 3LSOA 5B38G 3HG1E 3TH2T 3FB5B 4R7NB 4CBPA 3HPJA 5BQ7A 5CEZH 3KYMA 1NBYB 3DTXB 3GKZA 4EOWH 2BSSA 5LWYL 3WSQL 1UXWA 2XRAL 3E8UL 2D3VA 1ZANL 4QHLA 5D1QD 4PJGA 1CD1B 4HUWB 5CJXA 2DM7A 3OB8A 4AENA 2O93L 4OCNC 1SVCP 4BSJA 1U8LA 4CRPA 4UIKL 1E4XL 3V8OA 1B88A 3P0VL 4E9LA 1NUGA 1AGBA 5GGRA 4WNQA 3RWJA 1IGIL 2NZIA 4CL7A 5IB5A 1FZMB 2CKBB 4ZQKA 1NJ9A 5I6XB 1UYWL 3TN0A 4JRYB 2EE6A 3TBYB 3CK0L 1XCQA 1C5BL 1UB6A 4QRSB 3HE6C 1S8DA 3NH7L 1XGYH 4YHNA 3QXAA 3SKMB 4GKSB 4OGYH 4X98B 4KZDH 3ARGA 5IFAH 1RZJH 3KPSB 3QCTH 3TCLA 3ARDA 2ICEA 3RIFF 1YEGL 3NVQA 4M9OA 4NO3B 3Q3GB 3ZKMC 2AJUH 2YHGA 1T7ZA 2GJ6E 5DD6A 2DQDH 4XMLL 4KJYB 1S9YB 4Q2ZA 4G8GA 5KOVC 1WIPA 3UZEA 3O8XB 4RMRA 4RA3A 4LHJB 3RBGA 1H3TA 2YRZA 3GMMA 5DWUL 1CF8H 1FZKA 1I8LC 5DF0A 5EOCL 3VFWB 3L3JB 3CIQA 2EICA 3TGXA 2MJWA 4RSVA 3WD5L 1T3FB 2E6PA 2EIZA 1L6ZA 1K3ZA 1I8KB 3QEQB 2F53B 2YWYA 4H20L 5A3IC 4P2RD 1JF1A 4NNXB 1T20A 3KPOB 2ZSVB 4MD4A 4X4YA 3ILPA 4GOSA 3CLFH 4DJMA 1FE8L 2P24A 3CFEB 4XNUL 3OGCA 4ZTPL 2ATPA 1DLHB 1YEHL 4ZUTB 2PXYC 2FSEB 2VZVA 5JNYA 3OBAA 4QT5B 4QRPB 4R90L 1DSFH 2VO5A 2W9DH 1AHWB 2R0KL 3ZE2E 2VLRE 1R5VB 1MHPL 4H1LB 1QQDB 2CLZA 4OQTA 1TCRA 1QLEH 4TYUA 3FZUD 2E7LA 5ETUA 5BMFL 5J89A 2HT3C 2FX7H 2AV1A 4KTDL 2EH8H 3W9EB 1I9EA 4CVXB 1U92B 3ISWA 4UT9L 4X6DF 4MCZA 3SHSA 4JE4B 5ACZB 2R8SH 4ZNEA 4X6CB 1QG3A 5MHSE 4BA8A 3QWOA 5DJDB 3KJ6L 3BESR 1JNHA 5I73B 4KQ4H 3MNVA 4G6KL 2V2XA 3OJVC 4EBQL 3IFOA 4JG1L 4KQ3H 4X6DB 1PY9A 4NHCH 2DL9A 5IB1A 1A6AA 1MH5B 2C7UB 1IM3B 4PJBA 4U7MA 2FX8H 4JZOB 4OLUL 4F58L 5FCUH 2J8UA 1U3YA 4P2OD 5DMJB 3IU4L 3G5ZB 5JMOC 3OKDB 3SDXB 4EVNA 4WV1B 1SMOA 4HZAA 5D2NA 5HGHA 1U8HB 3EGSB 4X9FA 1BBDH 5IHZA 4OSUH 1UZ6E 2BRQA 5FM4A 4JFXA 4PV8A 2AS5M 1DVFA 2PO6A 2R1XB 2ZNWA 3HE7D 3BSZL 5IESH 4RIRB 3KPLB 2GEEA 2H1PL 5D70H 1FFNB 3B43A 3EBAA 2BSRA 1GC1C 2VXQL 1VB9A 2VUYA 4P0DA 5E1AB 5SX4I 3WO4B 4DVRH 5B39A 5DEFA 4PUBL 5B4MD 3MUGA 5GRVK 3ILQD 4KKBD 4CU6A 4Z77B 1HHIB 3HMXH 1NC2D 3H3PH 5DJ8A 3WXVH 4N0RA 1S78D 1U3JA 3M07A 5KJRL 5FDYA 1DUZB 2CJUL 2DBLL 4HWBA 1T22B 3PABB 3ZHLA 3B9EA 4FTVD 4ONHA 4CDHA 5INDB 4RWHA 1MFEL 2BHUA 2DJSA 4YDJB 5HGBA 4P4RA 3BDXA 3H7LA 1DN0A 3SDDA 4DZBB 5B8CB 5BOZG 4WUUD 3SPVA 1HHGA 3O4LB 5AD0A 1JNNH 1YEEH 2NY4D 3CVHH 4KK5D 4FZ8L 4F9PA 4IJ3B 4WUKH 1LEGB 1XEDA 2DRUA 4QXGL 3CCHB 3ZE0F 1ZA6A 2V2WB 1OGTA 1FPTL 5CEXB 3KXFD 3HB3C 1QEWA 5DVMA 1DBKH 2EE2A 3SKOA 3EJZC 4OCLC 4WEMB 4LHUD 2PTVA 3KPQA 4X7CC 1I8IB 3BP5B 3IJSB 2WV3A 3ARFD 5J0BA 5E9DB 4NWUL 5C0EA 4YGAB 5F9WC 2EDHA 3TWCH 1DQML 2WIIB 3GUTB 5B3JF 1U8NA 4GXVH 4QOKA 1BFVH 3K46A 1E4WL 2J7LA 3GMPA 3BZ4B 5EBMA 1A7NH 1U91B 2WP3O 4YPJA 3JWOL 5GSRA 2W92A 3Q6FA 2DM2A 5IB2B 3HNSH 5ID1A 2R0LL 3V5KB 5J11B 3ZE1F 1BGXL 2EC9T 4FS0A 4RA0C 2BY0A 3UAJC 1YEDB 3F7YA 3SDAA 4KDVA 1ORSB 3O6LH 1CXLA 5ESAA 4U1IA 4KAQL 1YN7A 1V7ML 4I48B 4JQXA 2QQQA 1KJMB 1A1NA 1NCDL 1SBSL 2AJVH 3O9WC 4ZS7L 5IT2H 2A1WL 4MJ2A 4RAHA 2XACC 1MAML 1JJUA 1OT2A 3MRJB 4Y2DD 4IRSA 4GLRI 5IUSA 4D8PB 5ESVA 4OB5H 4YNYA 5FO8B 3EOYG 3EYSL 3EFFB 4L3EE 4ZAKA 3VXRA 1QLRB 5E2WL 4OF6A 3IF1B 1FC2D 5LGJA 2ICES 5DUBB 2A9NH 2FCBA 4PGBA 2R0WL 5DFVD 2FHCA 2NLJA 2OTWB 1L7TL 2N4IA 1YN6A 3FT4A 3GSNB 4GBXB 3E0GA 2PCPB 4PJCF 5CWSA 4JM4L 5FM5O 3PQYB 5DFTA 1JV5A 4M7JL 1VFAB 1REIA 5DI8A 1Q9LB 1MRFH 5E94B 3NGBC 5JIKA 1BQHB 4JO1L 2DYPA 1IC4L 5DZLA 4EXKA 4TQEL 4YFLF 2JLLA 1T6VN 4JRYD 1LE9A 2XY2A 1A0QL 4U1MB 2PW1A 3BGMB 3O0RL 1TTUA 1U8IA 4JFDD 1QO3B 4LSRL 3S4SG 1G9NL 2ZUUA 2D7QA 2IGFH 1JHTB 4Y1AE 3MNWB 1NCCH 2VDML 3KPSD 2X1XR 1R24B 5IW3A 2VABA 3DVIA 2BVUA 3TV3L 3QA3A 5CBAB 3MYZA 1LO5B 2BDNH 2GFBA 3VWKB 1H15A 2GTWB 5HGAB 1CT8B 3FTGB 4ZXBA 4JFYB 1QD0A 1HOCB 5FYKE 2H32H 1A6UH 3WLBA 3TFKC 3PF2A 3STLA 3I6LE 5KVFH 3GGWB 1TJGL 1MFBH 3P4MA 4X4XA 3VDAA 5DTFA 5I1LA 4PP1D 3U7WH 4YE4H 5DA0B 4MQ7A 5EBLB 3O8XD 1QBLH 2VDPH 2ZG2A 4KY1H 4AG4L 4MAYA 5IMMB 5CLTA 1TTFA 1MNUL 3L9RB 4MJ6B 3U30C 3BPNB 3MTRA 3X13B 4H0GA 5EA0H 5A2IH 3P11H 1GRWA 5TF0A 3QEQD 5D7IE 4H88L 2B0SL 4RMWA 5GS0D 3C5ZA 3GMQA 4BKLA 4L8DB 4CVUA 2BFVH 1AFVH 4PJIA 4KI1A 1ULVA 2XI9A 3Q6GL 4M1CD 4MA7H 3TJHC 3U2SA 1W0WB 2FO4A 1ITBB 3FB6B 3HPLA 5JXAL 5IVXB 4RAUB 4P23C 4R97B 2AGJL 4QRPD 1XMWA 2EZ0C 3LHPL 2D4FA 1F13A 3RL1B 5D2LE 3RGVB 1EEYA 4CKVX 1OP3H 3P0GB 3RVUD 2O5XL 1QFWH 2X09A 5CCKH 5DD5L 3BW9B 5EB9A 1AI1L 3P30L 5C0FB 3RU8H 3G08A 2DBJA 4WY7L 5E6IC 3MCG1 1F4WL 3HC3L 2FDBP 5HYSA 3DX8A 2GSIA 3FOMA 5D93B 3RA7H 4DKEH 3FAXA 1WC7A 3ZYJA 4L3CA 4I77H 4O02H 5IFHH 2CXGA 5HD8D 1BZ7A 3VGDA 4NO2B 3GSVB 3PL6B 1MF2H 3ARXA 4UBDD 1JPTL 1N59A 1OAZL 3T04D 4LEXL 3QFJE 3UJTL 2F74B 4JN1H 4PLJC 5F96H 3JV4B 3WJLC 3SOBH 1KTLA 1QR1B 1G7JB 3LIZH 3RUGE 2Y36H 4PJ7F 1V7NL 1BZQK 1RURH 2XKNB 1I7UA 3DRTB 3WV0A 3ORJA 4NHUB 1BBJA 4XPBH 1QSEE 1DN2A 3MBXL 5AZEH 3ZSSA 2CIKA 1E27A 4PJ7B 2VTFA 4ZDHA 3PWJB 4JKPL 5J06A 4B53A 4LLDB 5H35B 4NQEB 3I75A 2VLKB 3ZKND 2NY3C 2D7NA 1MRDL 3ZDZF 5GGSY 2A6DB 4HFWB 2HLFD 1UZ8B 4HH8A 1KIPA 3EYUL 2BMKA 5HHNA 1QKZH 4MNHB 1QYGL 2JK5A 4OLVL 5F3BA 5FXCH 4PRBB 1FJ1B 5GRUL 4UTAL 1KULA 1IARB 5TQ2L 3SGDI 5D72H 1J0IA 3PJSB 4U1GB 3DYMA 3T77A 3KPNB 5DD3H 3AGVA 1JFQL 4HUVB 1KUMA 2F54E 2YN3A 1G0YR 2UY7A 2XWBB 4FQIH 5EU7C 4WEBL 4TUKH 3WFDL 1RMFH 2PYEA 4TUOA 3FQUA 2X2YA 4K8RL 4H8WL 4UNVA 4G8IB 15C8H 3B2UC 5DUPL 2ZOKB 1GCFA 1GOGA 3RNKB 3PG2A 1ZHKB 2BHZA 5ITBL 4Y4KA 5SWSE 5CD5C 2Z8RA 3F6IA 2P7TA 2IFGA 3F7PC 3IDGA 3GMOA 4E5XB 3PWPA 4ACPA 5A2JH 4XVJL 4KWUA 3RPIB 4ELME 1K6QH 1T04A 4OIIH 3MJ9A 2XZQL 2EDRA 1EBAA 1ACZA 5H94B 3W39B 5IB3B 5D1ZC 4P5TC 5D7SH 5EU3B 3P4OA 3MV7E 2ZCKH 3ARUA 5JW4N 2NY1D 3C2AH 5E9DD 3R06B 1CICB 3BYTA 3JTSA 5AZ2L 4G7VH 1HK6A 4PJXF 4RFOL 1RZGA 5IB4A 4FXKB 1MEXH 3RY4A 3MRKA 5I8EB 3IJYA 5MP6H 3GBML 1YNTA 2V9TA 3VFTB 2OM5A 4MD0A 1KB5B 4PJ8A 3P9LA 1XF4A 3Q2CA 1OAKL 3MRQB 3QNZB 5CZXC 1KSRA 1GZQB 1EGJH 4NM8L 4MVBC 3A6CL 3AMKA 2I07A 5C0AA 2KKQA 2NQCA 1YQVL 3BUTA 4QLRA 3O41A 2H6PA 2LQRA 1G7LA 1KJ2B 5DDHB 3S98A 1RIVL 2EDNA 4G8EB 3UO1L 2AJYH 1ZT1B 4ZFOB 5F7EH 4QHNA 4HGWA 2Z0BA 5IROA 3VRLE 3H9SA 2OYPA 2R4SH 5HHVH 5GXBB 3VXQA 5IHLB 3CAFA 4IRZH 5CD3B 4ZNCD 2V6HA 5EFIB 2Y07L 5I19L 1WQVT 4N8PA 3I2CL 1PAMA 2HKFH 1K4CA 2MHAB 3HZMB 3I6GA 1G6RB 3DURA 1NBZA 4JLRB 1ZSDB 3QUXB 3RVWC 1HNFA 4HCRA 3SJVA 1BQSA 3OF6A 5CILH 3L5XH 5C08E 4GBXD 1A64A 1X5LA 3HG1A 4ZFGL 3BPOC 4JHZA 1TITA 4PLKC 1FG2A 1DBAH 3U82B 2YBRB 2EDLA 2NXYB 2X4QB 3MROA 3VXNA 5D1XC 5F8RC 3O3BA 4I0CC 3WIIH 1A3RH 1UXSB 4WWKB 2PTTA 4C4KT 2WAHA 1F8TL 5DMKA 4DN4L 4MJ5A 3RFZC 1F4XL 3DI2B 43CAA 4KGJA 3WDIA 2AKRA 3DX6A 2G2RA 1RUML 5IBTL 4JZNB 4DUVA 1FNGA 4RGND 4M6NL 2APWA 1CFSA 3REVB 3X11B 3IAGC 1RJYB 4JFOA 3N85L 3TBSA 3VWKD 4YK4B 1YMME 2WUBH 2EEAA 3BP7A 4OZIB 1V05A 4Y16D 2HFEB 4GW4A 3S36H 3X14A 1MHHA 1IEBA 2G5RA 4MD5B 3CH1A 4EN3B 5L6YH 3VXSE 4ELKA 2IH1A 3PWUB 4NDMA 3MV8E 4RDQG 2VMFA 1NMAH 1AKJB 1F3JA 4QCIB 1INEH 4CADB 1GGTA 3AXLB 4Y5VB 2IANE 2GJ6A 1MQKL 4J3OC 5H37H 3IXTB 3D9AL 4JPIA 2MCPH 1BAFH 1YEIL 4NNYA 3ULUL 3RHWF 5ESQA 2D0FA 1CLZH 1RK0B 3D48R 3HZVA 5GGSA 2AJZA 4PG9A 3WFCL 5BV7B 2WINA 4A6YB 4G3YL 1ZTXH 4G8FA 4MNQA 2P42B 3UPAA 1NMBH 4XNQB 5BXFA 4Z7WE 2FJFA 3L3DA 4XPFH 3RGVD 1FGNH 3FFCE 3IAPA 4HG4K 2H2PD 1MIML 3IFPA 1UQSA 3BP4B 4LVNC 2HTKC 3VXUA 3KNBB 3T1WA 1T66D 3KJ4C 5F3HA 2B4CL 4DUXA 3LKQB 5IJKC 4IIQA 1QFUH 4OCWL 3D6GA 4TVPD 5JXEC 1WV7T 5EOTB 1FL3B 4UILH 4X4ME 1XGRB 3PL6D 4C54A 2VLRA 1QR4A 4DGVL 3PNWA 4WTZG 4Y5XB 2VN4A 3KPRB 1JTTA 3EDEA 5F44A 3C6LA 4M4RA 1UEMA 2AV7A 2VDKL 1B0GB 3VRJB 4KRMB 1A14H 1YEKH 2GJZB 4JVWA 2YZ8A 4HKJB 2YD8A 4FP8H 3TA3C 3RTQC 4JZJA 3F58L 4QTIH 2VH5L 5MEPB 1MI5E 5E99H 4WFHE 4FQCL 1ADQL 5DYOB 1NFIA 2AI0H 4XP4H 2VLKD 2R2BB 4EDWH 1NC4B 4R4BA 3IB4A 5JIIA 1MREH 2YRLA 3V6FB 3DV4B 3VI3E 1U8KB 2A6KB 3MRIB 3VWJC 1H5BC 2G5BB 3L3HB 3FO2A 2FGWL 4XTRD 4KJPD 2BNRE 1FDLL 5KVGH 2BVOA 1N0LA 3GMNA 5I1GH 2WLYA 1JGLH 2XWTB 4X8XA 1CDCA 1MFDL 3U46B 1B2WL 2EE9A 3G5YA 4CN4A 3BKYL 2IPUK 1QFWM 5DHYA 4OM0H 4QHUB 3S3PA 4LCIL 4F2MB 4DOHE 1OLZA 3QZWA 1E0OB 2MQ3A 2P8MB 3MOAL 3KLSA 2R2EA 1JZ5A 1NGQH 1AQKL 2HKHL 2GYSA 4H0IA 4HUXA 2CLRB 2HVKB 4U2YA 4P5KA 2R0ZL 3PGDB 3QHZL 4U0RB 5CHNA 3RDTC 2Z92A 1P69B 1EAPB 5JR1H 2OZ4A 3FRPG 4YXHL 1AJ7L 1YY9C 4HS6A 4PS4H 4J3XA 4RBPH 3RWCB 4C55A 4D0CA 1F6FB 1CL7H 5GRWA 4GG6B 5EWIL 1HDMA 5C0CE 3UZVB 4QRRE 1HEZA 3CXDL 5FUOH 1CICD 1DBML 1HXMB 1RUQH 4JPVL 5E24E 2LTQC 2UWEB 3RIAK 4OFYD 1BLNB 5J6HB 1EFQA 2ATKA 4I0PA 5JPMB 3L7EA 3MLVL 1HNGA 4D94A 1E4JA 2IAMA 4Z7NF 3MGTA 2EYTB 2CGRH 3WN5C 4WTZA 2AABL 1MUJB 5DSCA 5C6TL 3LPWA 3TO2B 2CUIA 1IGMH 3HI5H 1S7XA 5TDNA 2I9LB 4JG0H 2Z4QA 1IGCL 5JHDB 4C56A 2UZXB 3EJJX 4Z5RB 5CIPH 2P8PB 4R6UA 3P9WB 1IZKA 5C07A 4FABL 1TQBB 1WAAE 4FFWD 3SQOH 3HS0A 3K80A 3D85D 5SWQA 3L95A 4YAQB 5ERWB 3OPZH 1KTDB 1INQA 2C3HA 2V17H 1C7TA 1MCWW 4N1CA 4NN6C 3E2HB 4WW2F 4X6BB 4ZYKB 3W5MA 5HHQA 4IS6B 4XBEH 1C12B 2VDLH 4GAGH 5DEGA 2UVEA 4W4OA 3MYJA 4Z76B 1MWAA 3MRCB 5GSVB 2ITDA 5DC9B 5ENWA 1YYLH 4J3UA 4LPYA 5D6CA 3JV0A 1OF2A 2PW2A 5D7JB 1CGVA 1MAKA 2NXYD 2QV2A 1I85A 2E7HA 5IMOB 4PJDB 4H26B 4UQ3A 1EH9A 4NJAH 1FLRH 4ETQA 1KT2A 3L3GA 4WWKD 3IKCA 4L3EA 5DZOA 3W2DH 1NDMA 2JKXA 1W72B 3HAEH 4QTHB 3RX5A 1J8HE 4NRYB 3BPCB 2X40A 5AUMB 4OGYL 2JJUA 2DKSA 4W6XB 1RZJL 5KS9E 2C3WA 3ZHKA 2X1WL 2DQHH 3TZVB 2AJUL 3VFMB 2ZUYA 4HPYH 4XVTL 4LOUC 2VLLB 4AZ8A 1Q94B 5J6GA 1L7IL 3C6SA 4KUCF 4OFPA 3TH3T 4HKXA 2J8OA 3E6FA 2YPVL 4ZS6D 4PV9A 3EOTH 3GIZH 5A40E 2QEJA 2R2HA 3KDMB 5DRWA 3CUPA 2EC9U 3S88H 2X4RA 2GI7A 3OKLB 4XHJD 4EN3D 5IG7A 5D1QC 2YXFA 1TZIB 4W81A 4APQB 3NIFF 1CF8L 4G42A 2C4FT 3GHEL 1CK0H 1NMCB 3CFJA 3LQMA 3RNQA 3RY5A 3QDJB 5HHPB 3VW3H 3RWGB 3BE1H 5I66B 1IGYB 1S7TB 4KK8D 4YQXH 4FFZL 2NY5L 1XF5A 3VGHA 4XXCC 3RWDA 3WFHA 4PJAF 3QXDA 1A2YB 4KKAD 5HGDB 4L4VB 5FAAA 3CLFL 4LLWB 5J13B 1QFOA 5J1TC 4LLQB 4TSCL 4Z7VA 1RULH 3CFDB 1K8DA 1YZZA 4Z7UF 4OCSH 3V5HA 2OL3H 1FFQA 3C87A 1RZIB 1DSFL 1AGCB 3BX7C 4K71B 4HJGB 2FLRT 3HUJF 4R0LC 1D3CA 2WMPA 3OAUH 5D5MF 3QH3A 1RUAH 4NCC2 1UWXH 2FYYA 5ADPH 3BYYA 1GGCL 1WCBA 3RL2B 3ALWA 4LPXA 3LRGA 4PB0H 3O4OC 1JUFA 2EH8L 2APTA 5JIHA 1BF2A 1DBJL 1YC8A 2R8SL 4Y4HA 3HE6A 1OWWA 1U95B 4WI9A 1KIRB 4N5UA 4PREB 3QDMA 3HC4H 5F7DB 3CFKA 4J1UA 3WUZA 4G6JH 3IU3B 3ES6B 4KQ3L 3NIGF 4NHCL 4W68A 1D5BB 4XCEA 1TVBA 3QIBC 3IDIB 3MJ6A 4KTYA 1FP5A 4XCYB 1XCTA 1N8ZB 4XZUB 1EHAA 1YC7A 3KPRD 5FCUL 4NQUA 1IC7H 3BQUB 2B8OT 4JFFA 4XCFL 1A4JB 4DGIH 4M3JA 4PGJA 3C8HA 1ZGLA 1BQUA 1T0NA 3DXAE 4PJFF 3VD7A 3KLHD 2JCCF 4ODXB 3QEGH 1BBDL 4OSUL 3JV6B 2C3XA 3JWDH 5FA3A 4LVOB 1NAMB 3KYNA 4BQCA 2VLJB 4RMSA 3MLSH 4PJEF 3VXOA 5F1SA 2EYRA 4N0UA 43C9B 1Z5LB 3PHQB 4O2EB 1I8LA 5IESL 4MZ2A 4OLYL 5D70L 4ORGA 4YJZL 3LKSA 1JYWA 4LKCB 5A2LH 4ETYA 1NC4D 2BXZA 4HIJB 1U8PA 3ROOB 5ICZB 2VDOH 4NQCA 1P4BL 1QLFA 2VN7A 1BWWA 5DEZA 2P46B 2X4SA 3MRHA 3FO9A 3H3PL 3SO3B 3W11C 3WXVL 4BK5A 3FZUC 3VMNA 1P7KB 2CKBH 1BOGA 1QRNB 4KKLD 2MCG1 2W38A 3GSWB 4OCRH 2VLMD 3NZHH 3VGAB 2AJ3A 2ITCB 3HI1A 2VIRB 2XYCA 4GO6B 1L0YA 6FABL 1NEZG 5I18H 1XGQA 5FA4A 4OBRA 4TUJA 2GK0B 3UTTA 5DLML 4XAKD 2NY2C 5T1LD 3W81A 1PG7W 3K7UA 1X5XA 4OZHA 4XHQA 1TJIH 2DD8L 1MAJA 4LQ1A 4Q9BA 1FVDA 5DS8A 1ZHLB 5CSZA 4NQSA 1LMKA 3VXTA 3CSYB 3SE3A 4JFHE 4GW1B 2BNQE 1C1EH 4NFDA 3IFLL 1RK1A 1LE5B 1IAKB 3PIQA 5FOBB 1ZKAA 5T3XH 3TWCL 2VXUL 5SWSA 1Q9OB 1O0VA 1S7RA 2M26A 4GXVL 1BFVL 4NZRH 4F33B 3AS3A 1A7NL 2NY0B 4JQVA 1KLFA 3SKNB 2XQBH 1R3IH 3HNSL 4AIZA 1T4KA 1W0VB 3ILQC 3MV7A 4KK9C 3V7MA 4NKDB 1S78C 3BP6B 3O6LL 4HV8A 5I0DA 5DRXB 2CPCA 5JA8B 3EHBC 4POZC 5IT2L 5MENE 2J1KA 1FNLA 4HIIB 5E8PA 1J1XL 4D3CH 2QQLH 2P4AB 4OB5L 1R3HB 1NQBA 2NY4C 4KK5C 3O3AB 3GJFH 4LMQE 2E7MA 5HHME 2KDGA 1P1ZB 4CW1B 1ZVSA 4PGEB 5GS1B 3WNKA 5D7JD 3NOIA 3MV9D 1MRFL 1EIBA 2CKNA 4P48A 1KCLA 3O6FB 3OAZK 4CNIA 1I3RA 4I18A 1T0MA 3LN9A 1PKOA 3OMZA 2L0DA 1SJHB 1MLBB 1OB1B 2WBJD 5B22A 3TO4A 1A9EB 3QCVH 1NEZA 3QPQD 4LCWE 3O11B 4LSTH 5CGYD 1FRGH 3FT3A 1BM3H 5GRVL 4UDUB 5BRZE 3MFFB 2AEQL 3ZL4H 1QVOA 2IGFL 2FZ3A 2O5ZH 2RFXB 4ZODA 5E5UB 1ORQB 3FRUB 4EI5A 1NCCL 1KG0B 2JIXA 4HZLB 5C08A 12E8H 3GHBH 4X7TA 3TZVD 5DQJA 4QF1B 2EXWD 3V6OE 5F89B 3BEWB 3D0VA 3ECBA 2BDNL 3G6AA 1SY6H 1UB5B 3ZZ1A 5M7QA 4JQIL 4TTDD 1CR9H 5EZJB 4PJ5A 3L1OL 4YXLH 3AB0C 1A6UL 2V5YA 2MPAH 3PV6B 4ZUSB 5KVFL 2FATL 4NBXB 2X4OB 1MFBL 3TF7C 3U7WL 4YE4L 4KUCD 5EU6A 3OJMB 5KZCB 4KY1L 4DEPC 4PRPA 3UTPE 4X9BA 1HXYB 5GRXG 4QRTB 4D0DA 3G04A 4APQD 2DJ4A 2X4TA 4Y2OA 2RCSL 3QDJD 2EKSB 5EA0L 1ZHNB 3O9WA 3P11L 3V6ZA 2WUCH 2DN7A 5GGUB 1CDBA 5DFVC 1WGOA 3NPSB 2DMCA 2CIIB 2D7PA 3J7HA 1D6EB 5DRNB 2AK4D 2BFVL 1GIGH 1E6OH 3TNNA 3MREB 2NX5D 1XIWA 3K1KC 1Q0XL 4L29B 1MQ8A 4FFYH 5I6XC 5C0BA 2MTPA 3I6KB 2EDFA 4XP9H 2ZUTA 5SWZA 2HN7A 1GGIH 3D18B 3IETB 1WWBX 2AK1L 3W0WE 4NQDE 4TVSa 1OGAA 5K9OB 3DX7B 2RGSA 2WK2A 1QFWL 5CCKL 2HJKA 4D9QD 4L4TE 4NC1C 4M93C 1MCKA 1KYOK 3D25B 1NUFA 1KJ3H 5AEAA 5I15H 5F9JA 4N90E 1WEJH 1BEYH 2ADJA 4I77L 3IJHA 4OGXL 4PRHA 5IFHL 4ODTH 1N5YH 1MF2L 4P3DB 1ND0B 5I9QC 5TE6H 5KBNC 4OLXH 2NR6D 3CGTA 3CDFA 4JAMA 2CSPA 3FFCA 1I3GL 1PX4A 3O8XC 1K3IA 2J4WH 2FEDD 2CRYA 2H8PB 4PRIE 1JWMB 3SOBL 5CEYA 3BQUD 3LIZL 4HD9A 2Y36L 2BSED 3EOAA 1AGDA 1RURL 5CJQH 3X3GH 1T83C 4RFEB 4MQXD 5F9AC 3LEVH 2HVJB 1RHHA 4WW1B 3OHXB 1HHJB 2ADIB 2VLJD 1CLYH 4Y1AB 4NKMA 5AZEL 5GS0C 3P4NB 4R7DA 5MERB 3RRQA 3IRZA 1RZ8A 3HC0B 4ONGH 2X9XA 1QPXA 1QZ1A 4M1CC 2Q8AH 3VFVB 4OUUB 3D87B 4UT7H 2UZIH 3CSGA 1LEKA 1FO0B 1IEHA 3VI4E 3GB7B 3GSNH 3TBWB 4EUPB 1AHWC 1JRHL 3UYRH 5EU4A 1QKZL 4JHWH 3HMXA 3T2QA 2DQJL 2Z9TA 3RVUC 1I9RH 3T3MF 5FK9A 1HN1A 1QRND 1KIQA 4P23A 2CD0A 3PGCB 1FFPB 1RZKL 2X1QA 3WUWG 4E42B 1BIIA 3GO1H 5CMAB 5DD3L 5L2KE 1MI5A 2CRIA 3BD5A 3BPLB 1XR8B 4FQIL 3EYOA 4FZEH 4TUKL 5INCB 1RMFL 3DARA 3ULUE 4JRXD 5I73C 3O2WH 4YHOH 3BD3A 3ZKQD 5D7IB 1QSFD 1TDQA 4KHTH 1Q9KA 3CVHA 1S9XB 3UBXB 5E6IA 4UBDC 1J0KA 3BJ91 1NL0H 1BD2D 4UINH 5GIRA 1SJEA 2BNRA 1K6QL 4PJGF 4OIIL 1Q72H 2H9GA 4P2RE 3KG5A 1JI1A 3WFEH 2XZAH 4NNPL 4ORZC 5E8EB 5TGBB 1UXWB 2MQCA 2ZCKL 4LASL 4P2QD 3MRGA 4LKXA 4LLMB 2NY6D 5HVWA 5D2LB 3V5DB 1YMHB 3C2AL 2FEEI 1WIUA 3G5XB 5JMRA 2IQ9L 4AENB 3WJLA 1DEEB 5GGQH 1M6OB 3WS3A 2FECI 4W4NA 3QJHA 3G6JE 5GRJH 4YGVB 4GRWE 3DO7A 5DD0H 1NCNA 1YA5A 3ZKNC 5MHSD 2NY0D 3I9GH 3WO4C 1PEZA 5DJZB 5EPMB 2BXYA 5GZOC 1LO2L 5F7KC 1EGJL 2OSLB 3LKOB 4UIMB 2IQAB 4XBPB 3HNTH 4JPKH 4JN2B 4NN7C 3QFJB 4WFFE 4HX1A 3H3BC 3FQTA 1OQOA 2AJYL 4HSQA 5I76B 3HR5B 5E08H 3RUGB 3HNVH 3QXAB 2R4SL 5C0RL 4IMKC 1M7IA 3GNML 2D31B 3GRWH 4IRZL 5T1KA 3VCLA 1CYGA 1BJMA 4OZGE 1QSEB 5B8CC 2HKFL 1L6XA 3SCMC 5BVJB 2YC1B 3MOQA 1Q9WA 4GS7C 4XRCA 4XP6L 1VA9A 1KCKA 5EZIH 2A9MH 1CG9A 3MLXH 1YJDH 2ICWA 4IJ3C 3FQNB 1PYWA 4M02A 3B5TA 3CZFA 2GT9A 2DM4A 3M17A 1XR9A 2N1KA 4M1DH 5CILL 1I1YA 1FL5A 1JN6B 5ALCH 4MB4A 3B9KC 3NABL 1XF2A 1N4XH 2IPKB 2VOTA 4G7YH 4JRWA 1DBAL 4PB9H 4M62H 2IADA 3O6FD 4P4KA 4GH7B 1R3JB 4RGOH 4JM2B 4R4ND 2JE8A 3HN3A 2EH7H 3QDGA 3T1FA 1JTPA 2IH3A 3AAZB 1OSZB 3F7RA 5JOEA 4HKZB 5DFWH 5D1ZA 2DLEA 3GJEA 5KTEH 5FECB 1NGWB 1KGCD 4UU9B 2F54B 1LO0H 3T8XB 5B38B 1KPUA 3QI9B 2EDQA 3TPKA 2NNAA 3MLZL 5J11C 1A9BA 4FTVE 1MCFA 4CDGC 3MUHL 5E4IA 1YDPA 1NLBL 2DLGA 4IDJL 5L88L 2J5LB 4QWWD 4ZO8A 4J23A 2R56H 4X0KB 4WUUE 1MJ7H 2WUBL 4ELMB 3MLRH 5DJXA 3O3EA 4PJHF 3SE4C 5L8JB 4MXVF 3OKEB 3INUH 1JPST 1H3XA 9CGTA 1KELL 2GUOA 5C9JB 1N3NA 5KZCD 3KXFE 3DUSB 3GEWB 3J8F7 3P4LA 4EQ2A 2DB8A 1UM4H 4PJHB 4ZUVB 2X7LA 4HUUA 3EOBB 1R3KB 4U6HA 2ESVA 2DQFA 1HH6A 4LSDA 3I84A 3ZDXF 5E5MB 2RR3A 5FKPB 1LD9A 1ZMYA 3KGRA 1JNHB 1VACB 5FUZL 2R69H 1TENA 1INEL 4PJBF 2EDYA 2Q86B 3QUZD 5TPWL 1KENL 4OQTH 4GAYB 1OAUH 1FNSL 2J8UF 1X9QA 3IFOB 4H5SB 5C09E 1HI6A 4GBXC 4K7PL 3EIFA 5IR1B 3BVNA 5BZWA 2GTZB 2MCPL 1BAFL 2A73B 4WO4B 2XXMB 1TXKA 1QACA 1IGFH 3EZJB 4NQVB 3NTCL 1JCKA 1QA9B 1C5CH 1VSCA 2O61B 1QBMH 4G9FD 2ORBL 3JVGA 5JW5A 1ZTXL 1AGEA 3UP1A 3RQ3A 1BVZA 4HWZA 1EZVY 5IHZB 3ROLB 1FGNL 2Z35B 3TYFA 5D1XA 3EW3B 5E0QA 3VFNB 1BIHA 4DFHA 1PKQA 1JVKA 3DIFB 1EXUB 4R4FH 1HYSC 3OV6A 3F5WB 5IQ9B 3QUMA 1L4IA 3P73A 5CSBA 2E6QA 5EC1B 2X05A 1CI5A 4X6EA 1A21A 4UILL 1VKXB 3S3SA 3VFUB 1F42A 1N6QH 2ZKHH 4K9EC 4WJ5A 4S1QH 5F93C 1P53A 4N9OB 2NMSA 1KJ2H 1AGFB 1MLCB 1RZFH 3BISA 3E6HA 3ZYZA 3F12A 3O2DL 4F80A 1N5AB 3S5LG 2VJXA 1Q38A 2ERJB 1UCBL 1MCRA 2UZYB 3D39A 4FP8L 1EHNA 4Y1AD 3FO0H 1HHKA 4U6XB 2BNUB 1X4XA 4NWTL 1UM5L 2DLTA 1VEPA 4LLYA 4TNVF 4JFDE 5EO9B 1D5ZA 2HJLA 2C4FU 1G6RH 4JY4B 2IMNA 2Y25A 1MHCA 4HWBH 1Z6JT 4R26H 2AI0L 4XP4L 3VFPB 4EDWL 4WWID 1NBVL 4RX4D 1U8MA 4R97C 1YMMB 2CUHA 4K55A 4N0CD 1UVQB 3AU1B 1PZ5A 5DJCB 1DBBH 4JPWH 1EDQA 5KVGL 4QO1A 2W91A 5GRZA 3BWAA