4PP1D

The crystal structure of der p 1 allergen complexed with fab fragment of mab 5h8
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
220
structure length
213
Chain Sequence
EVQLVESGPGLVAPSQSLSITCTVSGFSLTGYGVNWVRQPPGKGLEWLGMIWGDGRIDYNLVRKSRLSISKDNSQSQIFLKMNSLQTDDTARYYCARAYQRYDYYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Peptidase 1
publication title Structural Analysis of Der p 1-Antibody Complexes and Comparison with Complexes of Proteins or Peptides with Monoclonal Antibodies.
pubmed doi rcsb
source organism Mus musculus
total genus 36
structure length 213
sequence length 220
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pp1D02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pp1D01
4K7FA 5HYSB 4FTVE 1FP5A 1ZSDA 3BZEB 3I3EA 1MFNA 4MJIB 1MH5B 1MHCB 3DSFH 1U8HB 5GS1B 1L0YA 4PJHB 3EDFA 3GHEL 4D0BB 2D4FA 3EOAB 3HZMB 5FA3A 1EEYB 3DLQR 4J8RB 1MQKH 5JW4N 4C55A 2CXGA 4OSUH 2Y36L 4ODHH 4WFFE 3MNVA 3U79A 4IS6B 2X42A 5ESQB 5FIEA 1JRHI 2Q6WB 2B0SH 2VR4A 3X11B 1J11A 3O3DA 4WFFD 4N1EA 5EZLB 5DK3A 5GRJH 1P7HL 4Y2DC 4NWTH 2LAAA 1FJ1A 1J1OH 4AEIL 1JWMB 2HTKD 5ADPL 4Y5VC 3OJDA 4JHWL 1C7SA 3KPSB 2NY3B 1B9ZA 4DKEH 4JRYD 4UI2A 4Z7WF 5IHZB 5J6GA 4OZ4B 1I7UA 2XOTA 2AK4E 2ZUWA 3IFOA 3ZT7A 4AH2B 5K9QI 1KTLA 4QCIB 5C09E 1X5HA 5KZCD 4X4XA 3A6BL 2HJLA 4OV6F 3T0DA 2A74A 3TC9A 4WWKA 5C09D 2VL4A 5C07B 3T09A 4HKJB 4L4VB 4N0RA 4KWUA 2XA8L 1A3LL 4F7PA 1YN7A 4J7RA 4ZAKB 1NDMB 5EUKA 3QDJB 3WEXA 5D1XA 3H7BB 4ZXBA 3FT2B 3FQNB 3RVVC 1HWHB 3CVHL 1L0QA 4GBXB 3DRTB 1MCRA 4MA8H 5DJ0A 3MRGB 3B9KA 1I8KA 3SJVE 4QXWA 3SOBH 2J6EH 3O9WC 4LU5L 2A73B 4PJXF 5LQBL 5IQ9A 5IB5A 2W0KA 4OCLC 2OTUA 4NYLA 5DJDA 3VXSB 5T5FL 5B38G 3VE0A 3JV6A 2PTUA 1TMCB 3W9DB 1UYWH 3NPSB 4EDXA 3S88L 1YEGH 5I1HL 3NIGE 1QD0A 1LNUB 3TPUA 2DM7A 4ODSL 2IWGA 4M93C 5MENA 4AQOA 4F3FB 3W39A 1R24A 2EYRB 1Q0XH 1Z5LB 4U1SA 2YPLD 1BECA 5A2IH 3FQWB 4ZUTA 4KFZC 4WGWB 4ZUSB 4YDIL 2WIIA 2GSIB 2HLFC 5JO5A 3BQUC 4S1RH 4RFNB 2AQ1A 3MLRL 5GRWA 3VXME 1WIPA 4YXKH 5AWNH 1D5ZA 1QR4A 2ILLA 4JDZB 1UJTA 4NNYA 3LPWA 3MJ8A 4MJ2A 3VXMD 1UEMA 4HMEA 5E4IA 4XNYH 1VFBA 4Y4HB 1OAKH 3U30C 3W5MA 4ZNCD 5I1AB 1YEHL 1A1OB 4UDUB 1UB6A 4AEHL 1U8OB 4IRJC 2DD8H 3L7EA 1P4LB 3SGEI 1NQBA 3FQXB 4G43A 1IT9L 3EZ8A 4NRXB 3TVMD 4ELME 1AI1H 1T1ZB 3O45B 3GMQA 2Y72A 4UV7L 5J13C 2VLRE 4JFXA 3LH2L 5DUBA 5JPNA 2IPUK 3BMVA 1KIQA 1CIDA 1KCVL 1UXWB 2LQRA 1CFQA 1GGUA 4K9EH 3RGHA 1HNFA 5D5MA 4MMXC 3QWOA 1RHHB 3A67L 3TIEB 3ZTNL 3CX2A 2A6DA 3INUL 4R7DA 2VSCA 1T03H 1WWWX 1FL6A 4L5FH 3MRFA 1XGUA 4PRIE 3RAJL 3U6RA 3W9EB 4G6FD 1MI5A 3QEQD 2AJVH 3F12A 3MA7A 4DW2H 1FFNA 5IHLB 4PJ5E 4XB7A 2HTKC 1X4YA 4HIEB 4LASH 5CP7A 1DANU 4QRRD 5F3HB 3WLBA 2YSSA 3MJ9A 4X9GA 4PJ5D 2OMNA 3HMXH 2VE6B 4M8VA 1IAIM 2ICWJ 3F7PC 2HKFL 2VLKD 1QOKA 3MLWL 4KJPC 1D3CA 3Q1SL 3QUXA 1SBBA 2GT9B 3B8SA 4ZSOA 1I7TA 2FJHB 3OXRB 3IJSA 1T66D 2NY6B 4L8DA 5CEZE 3CUPB 3LKQB 1F13A 3CVIL 3L5WB 4PREB 4WDIB 5C0RH 2Y5TB 3QFDB 1UZ8B 5CEZD 3IETA 4XMLL 4K23H 2BVPB 4KDWA 4IMLB 1J0YA 1MFEL 3MLSH 3KYMA 3OKEA 4FXKB 4JPWL 3V5DA 2BVEA 2VOTA 4G8GA 4XPFL 1ONQA 5F71A 2UY7A 4I48A 4GG8B 4V1DE 2BVYA 1Q9LA 5A2KH 4Z77B 4NQVA 3R8QA 3KPPB 5ANMB 5IBUB 5IW1B 3C60C 5DJ8A 5E9DE 1OGAE 4JM2A 1KFAH 3HPJB 4OZHF 1D6VL 5F1IB 4BFIA 2Z93A 3W2DL 3PWPA 1OQOA 5JW5B 4LSSL 4HSQA 2Y06L 1OGAD 4QTHA 3VXUA 3ETBF 3UZEA 1KB5B 4PGZA 3PDGA 2NYYD 2J8UB 4R90H 4U6VH 3MLZH 2OK0L 5IF0B 1U2CA 5TDPB 2CPCA 1OD7A 3BKML 4HUWA 1JPFB 5AAMA 1PLGH 4ZNEA 4XRCA 5IJVB 3NH7H 4G5ZL 3VW3L 2ADIB 4NQEB 1NANH 2NXZB 4GAYB 1UT9A 5LWYL 3RY4A 5IEHB 4MNGA 5HPMB 1HSBA 2XI9A 2R0ZL 5JHDA 5I8EB 2PW2A 5E6YA 2DYPB 3S7GA 5F7LB 2YUZA 2X9WA 4MSWB 5ACZB 4KI5E 3SY0A 3QP3A 5IB1B 1TJIH 2K7PA 1P9MA 5TFSL 1J7VR 1ADQH 3MCLH 4CN6A 1U9KA 4KI5D 3VGEA 4WV1A 5FECA 5ENWB 3TVMC 3B2UD 5TDNA 4LVOC 1JNHA 1G9NL 4U6HA 1CD8A 3HPLB 4L4TA 1BQLH 4KVCH 2A0LD 4PGDB 1BGXL 5HGHA 5FXCH 5J1TC 1MLCA 15C8H 3PHQA 5E95B 2APWA 1ZMYA 1JMZA 1MJ8H 2Z8WC 4HXAH 4UAOB 2CIKA 3D87B 1FAKT 5HI4D 2FJFA 1AGDB 4RGMC 3CMOL 4S1QH 3DTXA 3KPOB 3PHOB 1OSPH 2UZXB 3QIUB 4HBCL 3T2OA 1CFSA 1WZLA 3QCVH 5GJTL 1BJ8A 3X12B 4GW4B 2AW2A 4JO1L 3HNSH 1ZTXL 2AV7B 4ODXB 5DQ9A 1K4CA 5DHVA 4ALAL 4EI5D 1B4RA 1DBKL 3HG1B 2AJYH 5IM7A 3UX9B 1Q1JL 5EC1A 2HFEA 4GXVL 5EH1A 4XXDB 3D39A 4G8EA 1JGDA 4X0KA 5TDOA 4OGXH 1IC7H 3JV4B 2UWEA 1ITCA 4XNUL 3Q48A 2PETA 2V9RA 1MELA 3F62A 5HGGS 5FUOL 3KLDA 1T66C 1UM5L 1IQDA 4MYWB 3VWKA 1F58L 4I77H 3L3IB 3D25A 3EGSA 2ARJB 3NIGF 1U92B 4PY8I 4JREC 1GZPB 3PIQB 3LKNA 3MRLA 8CGTA 2IH1B 4YR6B 2HFFA 3O6FD 5IB4A 3ECBA 4M6ML 1RZ8A 5IFAH 2EDBA 1RMFL 3IKCA 4HEME 1CLOH 1DVFB 3ARGD 2X09A 1BFVH 4M1DH 2J88H 1OVZA 4ZO6A 1F02I 4D2NA 4YGVA 5SWSB 4XPAH 1MY7A 2BNRB 3CXHK 4JQVC 1RV6X 2DJUA 3DECA 4M61B 4WW2B 3G9AB 4XP9L 4HWEH 3KYNB 3QDGA 4FZEL 7FABH 3LN9A 4P2QA 1CCZA 3NABH 3ZE1E 4HG4J 3RKDD 1HSAA 2DQTL 1UFUA 3FB8A 4HWBH 3DX6B 4Z7WA 3OJ2C 1AKJB 1ZLSL 5KTEL 2XG5A 4OJFH 3QBTB 4GKZA 1KEGH 4ELMF 3MRBA 1JPGB 4Y4KA 3SE3A 1AY1L 4KKLD 5ITBL 2P45B 3HC4L 1G1CA 3RIAK 5AEAA 1KLGB 4G8IB 5CSBA 4R3SA 1YEDA 1TQCB 3SGDH 4NKMA 1NSNH 4Y89A 5FYKU 1IAIL 1NCDL 4UT6H 2VQ1A 4P9MH 4FQCH 1XF5B 5ID0B 2D7NA 1P84K 4U1KA 1GCFA 1U91B 2E7LC 1WVZA 3RGVD 1KXVC 5EN2A 3ARUA 1CICD 5IK3B 2P8LB 4KI5C 4UTAH 1RU9H 1P7KB 4OZFG 3BP4A 2PO6A 1WUNT 4MNQA 3B2UC 3ZYZA 2X1QA 2Y6SC 3N0PB 4OUOA 3IVKA 3MREB 4PJXA 3KNBA 4HS6A 3QDHA 4HJJH 3SDXE 1GC1H 2PCPB 5ICYA 4BH8B 2VDQL 3VXOA 4EBQL 1MWAH 2D2OA 3QUZB 1XF4A 1CXLA 1LO0L 5HYQA 4R0LA 1XCQA 2F53B 1SY6A 2V5TA 4ZDHA 5HI4C 2PYED 4E41D 2XPGB 1S9XB 4OM1H 1IC4L 1YN6A 5I1GL 3D3VE 2BNUB 4JDVA 4LHQB 1NLBH 4LPWA 5EPMB 4R6UA 3V8CA 4XAWL 3WXVL 1RUMH 4DK6A 2VNCA 3D3VD 2EDLA 4Y88A 4TULL 1F6FB 2IADA 3RU8H 3BH9A 4EI5C 1VPOL 2AVGA 3BN9D 4XNZC 2BP3A 2OXHA 2IPKA 4N0FA 1QO3B 4AL8L 3TF7C 1XIWD 4HPYH 1FQ9C 1UVQA 1WTGT 2XNAB 1N2RB 4Y5YC 5TE4H 3RWJA 4U1LB 5JXED 1F3DJ 1YYLH 2M2DA 4MXQD 5IFHH 1RZGA 4NSKA 3FO2B 4UIKH 2DDQL 5EOCH 1FIGH 3EOTH 1S9VB 5FOBA 1I8MB 5FGRA 4ONHB 1YY8B 2P5EA 4OFPA 4Y5VA 3BGAA 1A7NL 1FFOB 2XV6B 3P4MA 5GGVH 3UJIL 2NY0B 2D9QB 4BYHA 4WU5A 4XBPA 4WCYL 3DO7A 5GSRA 5BO1H 3ES6B 3O6FC 2EXWD 2OQJA 1NGQL 3LSOA 4YBLB 3ARGC 3QFJD 1TJHL 2RCSH 2I60L 4YHKH 4LKXB 2D0GA 2W59A 4P5KA 4X5LA 1CGYA 3ILQD 1A0QL 4PTUB 3L3KA 5E2TH 1NCUA 4N9GA 4WENB 5DQJA 1CVRA 5I74C 5GZOD 3OB0H 5D9SB 2DIBA 1N5YH 5I1KH 1QBLL 4KI5F 4LLUA 3RKDC 1H3XA 4LIQE 4PJBB 1FNGB 5J3HD 1DBBH 4JDTH 2H8PA 4R8WH 3IDNB 2JF1A 4NO5B 3WUWB 1FV1A 1GGCH 3BUYB 2N1KA 3V6ZA 4KKLC 3PGCA 3QNXA 5SWZB 5D71L 3NGBB 2DIAA 3KHOA 3TBSA 4LSPL 4XP4L 3CDCA 3WD5L 3EUUA 5JLZA 2NY5L 3MYZA 4WHTB 2NX5E 4WY7L 1VKXB 1R5WB 5JXAH 4JFQB 1YJDC 3N1FC 4JFEE 5HHME 1JZ3A 1RIUH 2KPNA 4JE4B 5KVDL 1EX0A 1JIBA 2DQCH 4PYGA 5INCA 4MJ6B 3ARDB 4JFED 3UJJL 5CGTA 3BQUA 3EO9H 3WIIH 3RGVC 2BNQA 3GMNB 1BZ9A 1CICC 3BKYH 4YHZH 4NFBA 5FK9B 5I66B 3UCRA 4I0PB 2AJ3A 2G2RB 4L4JA 3S5LA 3C9NA 2IBZX 1M6OB 1ND0A 5KW9L 4M6OL 4NWUL 4OZHA 5E2VL 3U9UA 2CLZA 3NCEB 2C4FU 4LMQI 1FO0H 4BA8A 1NC2A 1K3IA 4KHXH 1T89C 2EDTA 4IRJA 4HF5L 2I24N 1MLBB 5GGRB 3FTGA 1I1YA 2VXUL 2J12B 4LRIC 2VDNL 3V6FB 1P4BH 4JFZL 4KZEH 5IW6A 2OR7A 3VFRA 3ARWA 5GGSB 2PYFA 4MB5A 3PL6B 4XPGL 4HH9A 4X99B 1IGFH 2B8OT 4FTVA 2C3WA 3HCVA 5JPMA 4NNXA 3O6KL 3BN9C 1EAPA 2OL3L 4QYOA 5J9PA 1JK8B 1C12A 4Z7UB 1YDPB 1XIWC 1KEMH 4R97B 3TH3T 4AZ8A 2VDMH 3V0WL 4YXHH 1IRAY 5JXEC 2KUTA 5KOMC 3BGFB 3MOBH 4U1GB 5ALBL 3CC5B 3Q2CA 4MXQC 3H2WA 3SKOA 5CCKL 3GSQB 9CGTA 2WUCL 2QJDA 1DBJH 2EKJA 2OR8A 43C9B 4O00A 3VRIA 5DQDL 5EUOB 1QNZH 2UVFA 4L8BA 4S2SB 2VLJE 2YK1L 1GAFL 3ZE1F 1F4WH 5J4MA 5FYJE 4RDQG 3I2CL 1IEAA 4X4YB 1SVCP 1IMHC 1IVLA 1EJOH 2EXWC 1U36A 2AK4A 2V7HB 1JN6B 1EVTC 1G9NC 5E6ID 2PUQT 5C09A 5CEZH 3N9GL 3P4NA 4PGEB 1XFPA 1TPXB 3QA3B 3DXAB 5HJ3B 4LQFH 3BDYL 2H3NA 3M17B 3ILQC 4ZPVA 4XC1H 3AY4C 2EO1A 1DQQA 3GHBL 5C0EB 4Y19E 4ZUWB 5EU5B 4RMQA 5GZOC 4HUMB 1WWBX 1UZ6E 3MCKA 1X5LA 2EDJA 5C9KA 5D7IE 3SDAB 3WNKA 4EVNB 2XFXB 5BXFA 4Y19D 4U1IA 3GHEH 3C60A 4A2MA 3SJVA 1IKNC 4W6WB 3RTQD 3BPOC 4LGSB 3TO2B 1NC4B 2IAMD 2V5SA 2Y36H 4C83A 2B1HL 5DMYA 3RWEB 3OJVC 1QPXA 3SDXF 3JSSA 1CLYL 1FYTE 5DFWH 4LEOA 4L8SA 1IC1A 2FL5B 4PV9B 1TVDA 4MAUL 1V3LA 1MHPL 4NZUL 4QRTA 1A47A 5IGXL 4OV5A 4AEIH 1S7QA 1HQRB 5ADPH 4JHWH 5A16A 1I1AD 3OAZH 2E8YA 4P57A 5I71B 1S5IL 3F6LA 3WL9A 3OHXB 3FB5B 3I6LD 1BWMA 1KN4L 2YA0A 5C08E 3VXMA 3A6BH 2W65B 1AGCB 2V17L 1JZ8A 1JZ4A 4OFYA 1AR1D 2XA8H 1A3LH 1D5IL 1FO0A 3BMWA 1S5HA 1I3RA 1RK0B 1MVUB 3PXJA 5GGTA 1E27B 2Z4QB 1U93A 2ZPKL 4N5UA 2ATKB 3CVHH 2BERA 3LN5B 4NGHL 5DMIL 5DJXA 5D72L 5HGDB 2YRLA 1ODAA 5EORL 1S7TB 1B3JA 2FLRT 4ELMA 3T77A 2VLRA 4LU5H 4M02A 4F15B 4UOW0 1MAKA 5I0DA 3H7LA 4K7PY 5T1LA 5LQBH 4CADB 4FQXB 1F11B 5DD0L 4I18C 1ZGLP 2DICA 5EZJB 5T5FH 3PWVB 5IJKC 4PJDE 3MJ7A 2JK5A 4Q0XL 3S88H 2IMNA 5I1HH 2Z92A 1CXIA 4C58B 4ODUA 4ODSH 1EUTA 1F3RB 1T5XB 1YQVL 5I2IA 3REWB 4PRAB 2J1KA 3EAKA 4XBGA 4NN7C 3BPLB 5I1DA 3D18B 5INDB 1U95A 4MQSB 3BWAB 3HZKB 4PRIA 3GK8L 2BCKB 3RL2A 2GY7B 2G9HB 5I1IL 4YDIH 1FVCB 4GAFB 4R9HA 2G5BB 3C87A 4M5YL 5EG6C 3MLRH 4PJ5A 1OSZB 5FGSA 4W68A 2BMKA 3FJTA 4LF3B 4G8FB 5E5RB 1OB1A 3PV6B 4RSVA 4YC2C 4BSVB 5DVOA 1CFTA 3ARBD 1YEHH 4APQA 4LLQB 5B39B 5EU4B 2EDRA 4AEHH 5HHOB 3KLHD 1MIEL 3TM6A 1T83A 3OXSA 4POZD 2B5IB 3LOWA 1IT9H 3D69B 4YNYA 4UV7H 3U0TB 3LH2H 4Q9BA 3RWIA 3OKDA 1HYRC 3PV7A 4HK3J 1KCVH 3NFSL 2BHUA 5CHNA 2DQJL 3MSPA 3MO1B 3RWDA 1FNSL 5B4MD 4V1DA 2EDKA 3RTQC 5IFJA 1H15A 3DURA 1A2YB 1DSFL 1MFBL 3A67H 4ZFFA 3ZTNH 5E9DA 2IAMC 1OGAA 4PIRF 5C0BE 3SGKC 1D6EA 2PXYB 3INUH 4XZUB 1DDHB 1JZ6A 1H3VA 4TVSa 1H8OA 1JGVL 4U6XB 1OAZL 3RAJH 4OZFH 5C0BD 3UTTB 2RQ8A 4X5XA 3HUJB 4W70A 1ZHNA 3CFDB 3AXLB 4QRSA 3IDYB 2OLDA 3DVGA 5K9QG 1A4KB 1RULL 1OGTA 5C0IA 2ICWI 4WW1A 5F44A 3DO3A 2X7LB 2X44D 4TQEL 4F7EB 1QFUL 1O5DT 4DZBA 5D6CA 2HKFH 1VEOA 3MLWH 1BJ1H 3Q1SH 3VRJA 1FCCA 2RAMA 3PP3H 3O3AA 2ZNXA 3SPVB 3CVIH 3CXDL 4QT5A 1A9BA 2D7PA 4CMMA 1AR1C 1REIA 1MFAL 2OJEA 2VJXA 4FXLA 3CFJA 1MCWM 3BRFA 4M4RA 4XMLH 3CPLA 4YDVB 1MFEH 4KDTC 2D3VA 4JPWH 3WIHA 3P9MA 3LKRA 1NBYB 1NJ9A 4XPFH 3F7YB 5EOTB 4QGYA 4R4BA 5ETUB 1R5IA 2V5RA 4F2MA 1ITBB 3DHMA 3DARA 2XZZA 4A6YL 3OMZA 4D9LL 1D6VH 2FJGB 3W2DH 4KKCD 2FX9L 1IM3B 1S9YB 4LSSH 2Y06H 5C0CB 3K1DA 3P3YA 1IFHL 1B4JL 3AREB 3WN5B 3QDAA 3K2MC 3EKCA 2KL6A 2OK0H 4MDJB 1DQJB 1MFDL 1JTOA 2JJUA 1T04B 4NZRL 4EI5A 4LHUB 4BQ9A 4HUVA 2NY5C 3WHE0 1VGEL 3BKMH 1P2CB 4Z6AT 4HC1L 2VL5B 5IKCA 4G5ZH 3VW3H 3AMKA 4P2OB 3ZDZE 3HZVB 2DMKA 5LWYH 4Y5YA 1IAMA 1UZ6F 2LU7A 4LSRL 2Y7QB 4BH7A 3JTSB 4QOKD 2ADJA 3ZKND 4L9LB 2R0ZH 3RUGF 1LEGB 3A0OA 5HHNA 3IKKA 4NQCB 2EDDA 3QQ4B 3ARBC 3T2QA 4HFWB 1MPAL 3QPXL 5EO9B 4LVHB 3V5HA 5TFSH 2P8PA 2HAZA 3KLHC 3SKNA 4XCNB 1HQ4A 3BOVA 5M7QA 4POZC 1LK3L 1X9QA 4JJ5A 1XGRA 1JZ7A 3WFHB 1RUQL 4M9PA 1NMBL 1ZT1B 4I5BB 4M00A 4Z0BL 1G9NH 3O6FA 1T6WA 4MXVE 3CSBA 2Y1VA 2GK0B 3MRRB 1BGXH 2XTJE 3G9VA 4O51A 4F33B 1Y6MR 5IR1A 5DJZB 5B4MC 5C7XL 3VCLB 3OKLB 2R56L 2XTJD 4WEMB 2AABL 3CMOH 4IOIB 4UQ3B 1G9ML 3WKML 4PLOB 1G7MA 5DJCA 4HBCH 1Z0MA 4JGUA 5GJTH 3Q6FA 4I8DA 3ZDXE 2FGWL 4HIJB 4JO1H 5I76A 3CSYA 1ZTXH 1R5VA 2GHWB 1W0YT 3OAZK 5FDWB 2NLJA 1DTUA 4JB9L 4ALAH 1DBKH 1KNOA 5A2LH 1Q1JH 4ODVL 4GXVH 3MV8B 1PG7X 2VYRE 1EIBA 4G80A 3S5LG 2VLLB 5KAQG 4U1HA 4GOSA 3O4LD 3IDIB 3IJHA 3LS5L 1JF1B 1ZA6B 4XNUH 1WFTA 1S9WB 2VIRB 3E0GA 1KJVB 2BVUA 4XH2A 3OPZL 5TGBA 5HYFA 5A1AA 5FUOH 3RNKA 4D9RE 1OWRM 3ZKXC 3OKMA 1UM5H 2ZCKL 5E70A 2D31A 3MFFA 1F58H 3RIFF 5E94B 4PJDF 3KXFD 1WBYB 2ESVE 1LK2A 2MQ0A 3RGVA 1WF5A 4KI1A 4QRUB 1CICA 2X4QB 1XF3B 3GSWB 5IWLC 3FFCB 4KRPB 1S7VB 3LRSB 4H1LH 2QR0A 5E8EB 4M6MH 5JORA 2AK1L 1RMFH 2Z31D 4JEGB 1IAOB 5EO1A 4U31A 1VFMA 2EXYD 4H5SB 1ZS8A 4J3XA 4OUUB 3SDXA 2QKIB 3CH8A 4FQQB 2R1WA 4XP9H 1X7QB 2YD6A 3IGAB 3RZCD 5CP3A 1YUHA 3ARVA 3MRQB 3KPQA 4FZEH 1KACB 3LV3A 2ZUTA 1B0RB 1QQDB 1QEWA 4U49A 2WANA 2EDFA 4K71B 5EB9A 2DQTH 1FVDA 1OHQA 3D3VA 5CUSL 3IDJA 3IDMB 3V52L 5E5MA 3BIAX 1FC1A 4HW6A 4X6DB 3EDJA 1ES0B 1R3KB 4HLJA 1ZLSH 5KTEH 1EH9A 2DQUL 3I6GA 5BS0E 1AY1H 2IQAB 2R29L 5ITBH 3QXDB 3CX5J 3REVB 5L88L 3HC4H 3KPLB 3DVIA 3NCCB 3D85D 4G7VL 2NXYD 1YNKL 3IDXL 4BQCA 3VGFA 1DBAL 3ZKNC 3S37X 3I02A 5BZDB 3H9HA 4GO6B 5DR5L 4DJMA 5DTFB 1GJIA 4GH7B 4YBQD 1IAIH 3FQTB 1NCDH 3VFNB 1LEIA 3E1F1 3UTSD 4QHUB 5JIHA 4LHJB 4XCCL 3VFTB 1N8ZA 2FBJL 1NUNB 3AM8C 1JUFB 3HE6B 4O5LL 1L7IL 2ZP0T 3BP7B 3E6HB 3S96B 4IIQB 2DB8A 4AIZA 4U1MB 1W8NA 3L5HA 4ZQKB 5DXWA 1QSFD 4M43L 3MNZA 3SCMB 1ZHLA 5ICXB 3UPRA 4OCYL 2VDQH 1IAKA 4EBQH 1LO0H 3K2UL 5F9JB 1N5AB 5HYJE 2XTJC 4WHYH 1T2XA 2ICEB 4DGIL 3K80A 4Q2ZB 1A64A 3D0VB 2UYLA 1EXUB 4U3CA 3T0XA 1IC4H 5I1GH 2GTZB 4E42A 4YHIB 3DGGA 4B7IA 5HYJD 2NTFB 3FONB 3H0TB 1HH9A 2JLLA 4XAWH 3WXVH 4HUKB 4M7LL 5IB2A 1HXYA 4TULH 5ERWA 1E4KC 2H32A 1VPOH 2HN7A 4ZFOB 4OAWB 3U4BL 3GBNL 5BJTB 4AL8H 1AXSB 4WFGD 3MR9A 3BE1L 3PP3K 4KTYA 3NIDE 4J4PD 3GM8A 1FFPA 5IEKA 2DDQH 1YMMB 4Q9RL 4XCEB 1ZVYA 2GFBA 2BDNL 3TV3L 4KXZH 1HHJA 2NX5A 3SDYL 4WJ5B 5FO7B 1A7NH 32C2B 4JFEA 3MRKB 4H8WL 1F5WA 1HEZB 3UJIH 1IKFL 2X1XR 3H9YA 3C09C 1Y0LA 4EJ1C 4WCYH 3CFEA 4PJ9B 4OF7A 3IU3A 2J5LC 2G60L 5DURB 1NGQH 5FM5M 1RFDL 2Z31C 4ZG1A 3HE7D 3C8DA 1TNMA 1X5AA 2YXMA 3H6JA 1TJHH 3EOBB 3ZDZF 2I60H 1Q72L 1PZUB 3N1PC 4U1NA 5F7KC 1A7RL 3VMPA 1A0QH 3L3DA 1YPZB 3RX8A 2EDYA 3MRDB 4CVXB 3DX9A 2VSDA 4UV4L 3QEGL 4HAGA 1V3JA 1ZLUH 1QBLH 5A2JH 3QHZL 1X44A 3QJHA 1A22B 1SBSL 5D7KE 2EEDA 1A6WL 3AS1A 4MJIE 2DQIL 1MHHB 4NZDA 5CGMA 1I9EA 3RKPA 1T2JA 4MJID 3G5VA 5DFVD 4MXVF 5D71H 2NXYC 5B3NA 5D7JC 1T5WB 4LSPH 1HH6B 4XP4H 4P23B 3R8BB 3WD5H 2NY5H 1OPGL 4QHMA 1T21B 5JZ7C 4WY7H 1QRNE 3I9GL 1AGEB 1U6AL 2RB8A 1KB5L 1T22A 3BD5A 4DKAA 4YBQC 4PJIF 3WSQL 2W60A 2B39A 5KVDH 2VXVL 2OR9L 3IFPB 2X6MA 4TUOA 2ICWA 1ZA3B 3UJJH 1NGYA 3ZDXF 2EIZB 1RJLB 5EA0L 5C9JB 2VLJA 5MHSE 5T1DL 3DUHA 5KW9H 2YWZA 4M6OH 2B4CL 4NWUH 4PV8B 1FL5A 3KPSD 2NY3D 3HR5B 5E2VH 4JANB 4O2CA 1NBZA 1JL8A 5F9WB 1Z9OA 3AU1A 3OL2A 4PJAB 3MLTA 4HF5H 2F54E 1D5XB 4TSBL 4LSTL 1KIPB 2VXUH 2VDNH 4OF8A 2C3VB 4BQ8A 4JFZH 2WSKA 5A2FA 3VA2C 1RIVL 3HI1A 5F72S 4TN9A 1HHIA 2Q20A 4M7JL 5C07D 3L7FA 3QDJE 5TF1L 4KZDL 3MUJA 3P77B 3MYJB 4X9BA 2HRPL 4ZAKD 1BQSA 5DJ2A 1LE5B 3QDJD 5LVEA 5BV7B 4Y19A 4RISL 5B8CB 3O6KH 1A6AA 2V7NB 3S36X 5D7IA 1CVSC 3BJ91 3FO0L 3RX7A 2OL3H 4GBXD 2IAMA 3SGKA 1J8HB 1WFUA 1U58A 3V0WH 4PRHB 3UTPD 2EC9T 4NQXB 4QO1A 5ALBH 4J4PC 3S37L 5CCKH 1AP2A 2FZ3B 1JHTA 4J1UA 5E7FA 2WUCH 3VXSD 4OCXL 2WZPD 1FYTA 3C6LB 3X17A 5DQDH 2XA3A 1RAMA 1CD0A 2EIDA 4L1HA 4R7NA 1MCHA 2ICCA 2R2BA 3DMMA 3TN0B 2YK1H 2VH5L 1GAFH 5JMOC 1MRCL 5J7CC 3ZMRA 3QULA 3I2CH 5HVHB 2XACC 4UNUA 3QQ3A 1XCTB 1NFDB 3HE7C 4RQQA 5FA4A 4BK4A 2WINA 3DBXB 3WS3A 3N9GH 4PGBA 5C08A 3U7AA 3BDYH 3L3OA 2EH8L 4KDTA 5IVNA 4Y4HD 3OKOA 3OKKA 1FNLA 4KJYA 1ZLWH 1DUYA 4JY6A 4AY0A 3BYTA 2LV4A 4ETYA 3GHBH 5DEFA 1IZJA 2QQQA 3MV9E 1FGNL 1DJSA 1G9MC 1HDMB 4MA1C 1T0MA 1JHLL 1RZ7L 5F7FA 4HT1L 5B38B 2CUHA 1ZLVH 3SGEH 2IQ9L 3L9RB 5IUSA 1C5DB 4DZ8B 3VFVB 3FT3A 1BIIA 3GUTB 1XH3A 2B1HH 2FATL 5FB8A 1BQHA 5DFVC 1WC7B 5GS1C 1CLYH 2A6JB 3SGJC 4PJDA 1D7FA 4PJ7B 4LDOB 4UQ2A 2D4DA 5TE6L 1F3DH 4MAUH 4NZUH 1MHPH 3GSVA 5IGXH 1TVHB 1CYGA 3CU7A 2C7UA 5CZXD 4KAQL 1XGQA 5EOQL 5L2JB 2FB4L 2B1AL 1S5IH 4MZ3A 5IG7B 3QIWB 2YXFA 4JPVL 5DZLA 5DUPL 3UYRL 1KN4H 3SO3B 2PW1B 4GLRH 3RPIB 4M1CC 5IMKB 4LBEB 2V17H 2NY3C 3MNWB 4JFOA 2DQGL 4YHOL 1XZ0B 4MVBC 1D5IH 1JPSL 3NIDF 2PTTB 2AXGB 1A4JB 3CFKA 1ETZA 3LHPL 4NO3B 1A5FL 2NY6D 1RUAL 2X89D 3R1GL 1H3WM 3FCTA 2ZPKH 1VSCA 3FHQA 4NGHH 3QUYA 3PQYB 5DMIH 5D72H 3UBXB 5EORH 3NN8A 3VFOA 1CWVA 1K8DA 4ZAKC 4PR5B 4W6XB 2EDQA 5FCSH 2GUOB 1BF2A 1EFXB 2VR5A 5DD0H 5ANME 4HAFA 5M94B 5CD3A 5JDSA 4WHCA 4Q0XH 3U0PB 4AYFA 3QI9A 2Z35A 2GJ6B 4FZ8L 3RVTD 4MAYB 3B6SB 4GRLB 3U46A 5C0BA 2BXYA 1YQVH 2WM0A 4N0CD 4DN4L 1PBYA 1SJXA 2CKBL 2DBJA 4OBSA 1YEEL 4NFCA 5K9KA 3QXTA 2J8UE 1AHWC 3GI9L 3GK8H 5BZWA 4MA7L 3NPSC 5EBGA 1E4XL 4MD0B 1E28B 2YA2A 5I1IH 1N0XL 4G7YL 4M5YH 1QR1B 4NQEE 2XN9B 2OXGA 4HDIA 5BVJA 3OKNA 1BQUA 3QISA 3VFSA 1H3PL 2X4PB 5TH2A 4NQED 3K1KC 3MRMB 2NXZD 2YUWA 3QAZB 1ZLUK 1FN4A 1MIEH 2EYTA 2AQ3A 3VFWA 1H8SA 2ADGB 4FNLL 3KLAA 5EULV 2DYPD 5I73B 1YZZA 3T0WA 4Y4HC 4C59B 3G5XB 3ARTA 5DYOA 4OCSL 2XWBB 3B3IA 3VDCA 3DI2B 3NFSH 4ZPTB 3RIFK 1FH5L 2DQJH 5J1SC 3CZFB 1KPUB 1FNSH 1I3UA 3S36L 3C5JA 3QRFM 3MUGA 1TCRB 4X8JA 2XWTA 4MS8D 1DSFH 3ARFB 5IW3A 3D2UA 1MFBH 2HVJA 4J2XA 4AIOA 4LKCB 5J0BA 1JGVH 4P5MB 1OAZH 4XHQA 3QWQB 2IH3A 3OR6B 1J86A 3RVWD 2ZG1A 3QIUD 2GAZA 4D8PA 3WO3B 1RULH 1HOCA 5CZXC 3L95B 4HXBL 1I4FA 3ROLB 4TQEH 1QFUH 3HG1D 3CDGB 2JJTA 4NKDB 3WXWL 4P0DA 4HIHB 4Y1AE 2H2SD 5DSCB 1CGVA 1ZV5A 4TVPL 1FZKA 5MI0B 3BPCB 1H5BC 2VMFA 4Q9QL 1A6TB 2JJSC 3CXDH 4JO2L 3BW9A 1MFAH 3BZFB 4HHAA 2YRPA 3P4OB 3TLRA 5D1ZB 2D0FA 1AGBA 2NY6C 5MEOA 1WBXB 4HG4K 4HQQL 3FO1B 3ZE0E 5IMOB 1ED3A 4JLRA 3L5XL 4UDTA 1I8IB 3TNNB 3I3BA 5A3ID 3DHJA 4FFWD 4A6YH 3QNYA 2CMRL 4LAQL 4RX4A 2JB6A 4D9LH 4Y4FB 2FX9H 2E7HA 2DQEL 4D3CL 2P24A 2FH6A 1DVFD 1A6UL 1IFHH 5J6HA 4X80L 1B4JH 4MD5A 4QHLA 5SWQA 1P1ZA 3FT4A 5SWSD 3RVTC 3OB8A 2BNRD 2C1PA 1MFDH 4N0CC 5EU7C 4NZRH 4NQDE 1E4KA 1MCIA 4HKXB 2WQRA 1KG0A 1VGEH 2CIIB 1T0NB 4HC1H 5IVXB 1MUJA 3FB7B 4QHNB 3O3UN 3BIKB 2A83B 2N4IA 2CR6A 4LSRH 1A6ZB 2PN5A 4H26B 4JZOA 4R96A 1BZ7B 1AKJD 5DD5L 1KCLA 5E8NB 3TBWA 1X6NA 1CK0L 25C8L 5K93A 3ULVL 5KSAB 5FF6B 5MEQB 2GI7A 3PE9A 4DOHB 2NXZC 1MPAH 2B4CC 3QNZB 3QPXH 1YEIL 1U8IA 1EVUA 3DUUB 4PD4J 4HJGB 5CEYA 2KKQA 1LK3H 1WCBA 1RUQH 2FBOJ 2ESVA 4QF1A 1NMBH 1QVOA 3RWHA 3VFMA 4Z0BH 8FABB 1AD9B 1PEWA 4X5WA 2BFVL 1F4AA 1H0DA 3HR6A 3V7MA 2Z31A 1HHKA 3VFGL 5L7XL 3GGWB 1P7QB 3VA6A 1N6UA 4KKNA 1LEKA 4PLJD 3HAEG 5C7XH 1KIRA 1Q94B 4K94L 2R56H 2AABH 1KCSL 4GKNB 1XR9B 3W0WB 4MS8C 3RVUD 5C0DB 2JTDA 2V2TB 1LD9A 1G9MH 3EO0A 4PRDA 3WKMH 5LGJA 4DCQB 5IV2B 5F1NB 3EO1A 1K4DA 4JAMA 4BSWB 3ORJA 2JCCB 4L3CB 3F7VA 3MZTA 3QUZD 2FGWH 1F3JB 1MHEB 2Q8AL 4UAOC 4WUUE 2H6PB 1ZT7A 2F53D 4JB9H 3RVWC 4AK1A 1QBBA 4MDIA 5D6DA 4ODVH 3ME0A 3QIUC 5I1JL 2VO5A 2IBZY 3T3PE 5DJYB 3U0WL 3AAZB 1XF2B 3LS5H 4MJ5B 5D7JA 5ELIA 2DQFB 5BS0A 5KSVA 5ESAB 1C16A 2JE8A 4C57C 2WWMD 1IGTB 3OPZH 5IMLA 1GZQA 2ITDA 4K7FB 4LLWB 1ZSDB 4F7MA 2H2SC 2ZCKH 2YD2A 3VU2A 1SJHA 1RVFL 4OZFB 5KJRL 5FO8A 2VUOA 1X4ZA 1F2QA 4WIQA 4YDJA 4KY1L 3LY6A 3VMOA 2X4UA 1ZGLB 3KGRA 2J8UF 4OD3H 1CDUA 5I17A 2AK1H 1IGYA 4XHJD 1FORL 3NIFE 4KROB 5A3IC 2NY0D 3JWNC 5I6XC 4FFWC 4C56E 4B5EA 1FBIL 4UBDD 5TE7L 2MCG1 4F9PA 4A6YA 4OQ1A 3VXRE 3OJDB 1DVFC 3ZSTA 2OSLB 2RIKA 5HYJA 1V7NL 5J6GB 1I7UB 1SMAA 3IFOB 4KK9D 1C1EL 1FAIL 3N1MC 5CUSH 3V52H 4F58L 2P8MB 1T4KA 4WW2C 4X4XB 4YDLC 4OFVA 2I07A 2G5RA 3T4AA 1QSEB 4PJBE 2W0FA 5GHWL 5GIRB 4WWKB 2W1NA 2MQCA 2X4OA 1XGTB 1YMHA 3RQ3A 2DQUH 5DS8A 5DDHA 1VEMA 2R29H 4F7PB 4UIMA 5L88H 2F9BT 1YN7B 4G7VH 1YNKH 4MCZB 3IDXH 3TO4A 3BP6A 1DBAH 2ZUUA 2R8SL 1W2KT 5D96B 4DQOL 3CDYA 2MKLC 1MAJA 5DR5H 3WDJA 3BX7C 1Z9LA 3EW3B 1U8MA 3AC0A 2NNAA 5DJ0B 3B9KB 3CDFA 3QDMB 1I8KB 5SWZD 3P73A 3DV6A 3P9LA 4TVPD 3K81A 4KKBD 4XCCH 2FBJH 5D2NB 4O5LH 5IB5B 3WFEL 1L7IH 1TQCC 4LRNL 3Q3GA 4XPBL 2OTUB 4NYLB 5CILL 4LNRA 4WGVB 3VE0B 1PYWA 2W38A 4KGLA 2FR4B 4EDXB 3ARDD 4JFHE 4BZYA 4M43H 4U7SA 3HE7A 3TPUB 3X3FL 1Z0NA 4OCYH 1JHKL 4ODBD 1L7TL 5MENB 2PTVA 3K2UH 4PLJC 3M1BA 4CNIA 4I0PD 4UOJA 1T7VA 3W39B 1R24B 2P7TA 4DGIH 3MLVL 4YPGA 3RVUC 2ICES 3WJJA 4RBPH 1EZVY 1KUMA 1SYVA 2WIIB 3BEVA 3KPMA 5JO5B 5DK0A 5DD6B 1I7ZA 3QUZC 2W9DL 1S7RA 4M7LH 3HLAA 3U4EA 3G08A 1NGPL 4NNYB 5MP6L 4N90D 3STZA 1VFBB 3D5OF 3QEHA 4HKBB 4Z7VB 3U4BH 4PGJA 1HKFA 1VA9A 3O2DA 3GBNH 5K9OA 1SYSA 3PL6D 4PRBB 5HYSA 5KANI 3K8KA 3BE1H 5L0QB 4MJIA 5J06A 1MHCA 3ZE0F 5JW3L 1U8HA 5GS1A 1UWXH 4G43B 2OTWA 4Z7UE 4D0BA 3EOAA 3HZMA 3VI3F 4RMSA 3SGJA 1EEYA 4KMQA 1U41A 4JFXB 4OCWL 4Q9RH 2WWMC 4ZFGL 1LP9B 1KIQB 3HRPA 1EO7A 2BDNH 2IFFL 3TV3H 3ULVD 2I9LA 1CFQB 3SDYH 5DA4A 4IS6A 4WW2F 2FSEA 4H8WH 2Q6WA 4LLMA 3X11A 5D5MB 1X5IA 1IKFH 2BC4A 5EUOE 1N64L 5ISZE 1WAAE 2A6DB 1JWMA 2G60H 3MRCB 1FL6B 1RFDH 4XAKD 4XHJC 3PWLA 5ISZD 2O93L 3U6RB 4Z76A 3GSOB 3SDCB 4OZ4A 1WEJL 1Q72H 2VN7A 1MI5B 1AR2A 3ZDYE 3MA7B 1A7RH 3NCYS 1FFNB 5T1KA 4P4RA 4RCAA 4UBDC 1CDIA 2WAHA 2Q3ZA 2F54A 4YBLC 5CP7B 2A2QT 4UV4H 3HC0A 3QEGH 4EIGB 3C5ZA 5F1SA 1EFQA 4KK8D 4FQLL 5FHBL 4LPTA 5DC9B 1NCTA 1P6FA 3DXAD 1NDMA 3QHZH 3NCBB 4KK9C 4RGOL 1SBSH 2AJZA 3QUXB 3QDJA 1A6WH 1I7TB 3OKYA 3FT2A 3FQNA 3IJSB 2DQIH 4TNVF 1OM3L 4M7LT 1VGKB 3SDAD 1OTTD 3IETB 2MQ3A 3MUHL 1DUZA 3KYMB 3P0GB 3IXTB 1KELL 2R2EA 1OPGH 5E99L 4G8GB 1FRGL 3I9GH 1NC4D 1U6AH 1KB5H 1AHWA 3UTQB 1Q9LB 3WSQH 4I3RL 1L6XA 2VXVH 2OR9H 3NGBC 4NQVB 3BKJL 2AP2A 4JM2B 1LNUA 4KKBC 1FG9C 4BFIB 2Z93B 1WK0A 1ZHKB 3PWPB 2IGFL 3L6FA 4ZODA 5EA0H 1HKLL 4JVUA 2VAAB 4K3DL 2EYRA 4QTHB 5T1DH 1Z5LA 3VXUB 2A6KA 2B4CH 3BAEL 2EC8A 3FQWA 4M7ZC 3ARDC 3BPNC 4GW1A 2GSIA 3ZHKA 3T3PF 3DNKA 5BQ7A 1AO7B 4JHAL 1N3NB 4OF5A 4I0PC 4TSBH 4LSTH 5EO0A 1CTNA 4XRCB 1RIVH 2OTPA 4M7JH 4KZDH 5TF1H 5IVZA 2BSRB 1YC7A 4UDUA 3WNMA 2R23B 4TTGA 3CCHB 2HRPH 4MNGB 3JTTA 2X4NA 5I8KL 1HSBB 4NUGL 6CGTA 1NAMA 1QG3A 4RISH 4AT6A 3MV9A 3FO0H 3QXAA 4CJ0A 3PL6C 3EOYG 4PTTB 3LKOA 1LDPL 3DIFA 1UXWA 4WI5A 3UJTL 1NH6A 3S37H 4XXCC 1TLKA 4WV1B 4GW5B 4FQXD 1CFVL 1JNHB 4U6HB 5L2KE 4OCXH 5J56B 1RHHA 5EU6E 3TIEA 3DWTA 4R97C 1I7RA 5E0QA 2EC9U 1L4IA 3ULVC 1MLCB 5D2LB 3BGFC 4U1GC 3M8OL 5EU6D 5SX4I 3EFFB 2VH5H 1X5ZA 2CIKB 3VD5A 1MRCH 4TUKL 2FJFB 4H25A 5MERB 3DTXB 4CU8A 1CFSB 3BUTA 4MLIA 5B21A 4XGZA 4PJBF 1S7XA 1H5BA 1S7UB 3IFNL 4PS4L 2W0LA 1JBJA 1K4CB 3BRGC 5DHVB 1YECL 4L8CA 4MWFA 5IM7B 2EH8H 4URTB 2FJHA 4EUPA 3ARYA 4ODTL 3DOSA 3D39B 4Q6IB 4DFHA 4X0KB 3L5WA 1FGNH 2QL1A 5HHOD 3AFLA 4U1JA 1TPXC 5E8PA 3ZO0A 4JHBA 3VMNA 1JHLH 1RZ7H 1UZ8A 4HT1H 2DWEB 2BVPA 1FZMA 4IMLA 2IQ9H 4KK6D 2RJMA 2ED8A 2IFGA 1MCKA 2AJUL 4HZAA 5DRNA 1IQDB 3VWKB 1X5KA 4A2LA 3HRZB 4J3OC 4RGNE 2FATH 3EGSB 1IL1B 1K2DB 1F4YL 5CGYD 4Z77A 5EBMA 2ZUQB 3KS0H 3SDAC 4F9LC 5ANMA 3I6KA 2CRMA 3MRLB 4BFEA 5F9DC 4MNHB 3HZYA 2HFFB 5TE6H 4U2YA 3ECBB 2R0WL 1RZ8B 5IB4B 2PXYD 3HS0A 4Z9KB 1CLZL 3GEWB 4NQSB 1KB5A 2YD9A 2YD8A 4KAQH 2J8UA 1MVFA 1V7ML 5EOQH 3UTTD 5F3BA 2FB4H 4YO0B 2ZCHL 2B1AH 2LABA 2DJSA 4WFEE 4JPVH 3QDGB 5DUPH 1JPFA 3UYRH 4ZO8A 4P2QB 1I9RL 3JV5A 4NQEA 2IANE 3O11B 5DMKB 4P2YA 1HSAB 4N5ED 5I71C 3FB8B 2DQGH 2R0LL 4YHOH 1CN4A 1JPSH 1LWRA 4WI6A 4LP5A 2EEAA 1CGSL 4ZTOL 4Z7UF 1Z6JT 1INEL 1DEEA 4QWWD 2EIEA 2R9HD 3LHPH 4Y4KB 1A5FH 4YK4B 1RUAH 3R1GH 1UQSA 1CIUA 1ZEAL 1NFIA 4KJWD 4R3SB 1YEDB 4YZFE 3G04A 4P2RE 5DZOA 4PB0L 1VDGA 1UWXK 3DGCR 5E5UB 4JFFE 5ENWA 5EUOF 2Q7YA 2YPKA 4JKKA 3HPLA 1NGXA 2C3XA 1WAAF 1E4JA 1BD2B 3V9FA 5I1LA 5SX5K 2HH0L 4FZ8H 4F15C 5L9DL 2PO6B 4MNQB 2Q87A 2ENSA 5D7LE 4FQXC 4DN4H 2CKBH 3TIDA 1YEEH 3ZDYF 1AGDA 4C4KT 1Q9WA 4PJXB 5C0CD 3GI9H 4HS6B 3PHOA 3S6CA 4MA7H 3QIUA 1E4XH 5ICYB 3ARED 5JIPA 3Q6GL 1N0XH 2CDEB 1XF4B 4FP8L 4GW4A 1DR9A 1PAMA 4ZFOL 4G7YH 2AV7A 4R0LB 1CF8L 1XCQB 4LHUD 3GKZA 1U3HB 2EDXA 3O6LL 1H3PH 3VI4E 4P2OD 3DRQB 5CIPB 4UNTA 2YC1B 2IADB 3VDAA 4NQCE 1QA9A 3FO9A 4K8RL 2XRAL 4BFGA 4I9WE 2APTA 5KG9A 4FNLH 2IPKB 4QHKI 2AKRB 4N0FB 5DD1L 5EBLB 1JGUL 3T1FB 3T0AA 4PY7B 1PVHA 4NQCD 2EZ0D 1UVQB 4I9WD 5EIIB 3RWJB 3LAFA 4OCSH 1G7HB 2ARJA 2ITCA 5LG1A 3VH8A 1RZGB 4DVRL 4F7TA 1FH5H 1U92A 2B5IC 1OLZA 1RZIB 3S36H 3DX8A 2W91A 4K7PX 4WWID 2EDNA 4YR6A 3MV01 1GGBL 3FQUB 2P5EB 1WT5A 4LLYA 5LBSL 2Q86B 5CGYC 5KS9B 3SEPA 4WU5B 1VFAA 4ZUUA 3DO7B 5GSRB 2XZQL 2V9TA 5DJ6A 5HD8D 1CE6A 4M61A 4WW2A 3LSOB 4OB5L 1J8KA 4E0RA 4NQDA 4NDMA 4P5KB 4TUJB 4HXBH 5DT1L 2P44B 4LFHG 4N9GB 3NA9L 5DQJB 4KC3B 3WXWH 5DI8B 3MPCA 3MV8D 3OX8A 1JPGA 1BLNB 5T3ZL 2I26N 4TVPH 4O4YL 3MACL 4LLUB 4N5EC 4Q9QH 2O5ZL 4JO2H 1KJ2A 2CD0A 1KLGA 4JZJB 1U8PA 4LVNB 2H8PB 2P42B 4QWWC 1FV1B 2R9HC 5DVKA 2MSPA 3FN9A 4HQQH 4P49A 4HLZG 3QNXB 5ID0A 4PJFE 1CT8B 2DLFL 3FFCE 3K7UA 1A6PA 3L5XH 5IBTL 4KJWC 4KHTL 3WFZA 5CD5D 5JLZB 5IK3A 2P8LA 3NVQA 2CMRH 2OCFD 4LAQH 3FFCD 2AJSL 4KRPD 4X7TB 4XCYB 3IB4A 3CX5K 3ULSA 4U7KA 2DQEH 4D3CH 3FN0L 5INCB 4Q7DA 1A6UH 2PCPA 1CGUA 3BIBX 1PGRB 4X80H 3QIBA 2BNQB 3MZGB 4BH8A 2CO6B 4Y5XB 3MV7B 3RL1A 4HGKC 1KXQE 4LSDA 2NY4B 5T5NF 3RWFA 3KYOA 3S5LB 3C9NB 1IEHA 4OZHB 3VXTB 1JYWA 4OGYL 3SE4C 1MJ7L 1CL7L 3WN5C 3T4YB 5BV7L 5IBLD 4N1HB 1Y6KR 5EPMA 5EFIB 4W6YB 1M7DA 3BSZL 1QTYT 4XB8A 3FTGB 1GC1L 1I1YB 1T1XA 5DD5H 4WI7A 4DWHA 4XP6L 3M07A 5IW6B 4YFDB 1CQKA 25C8H 1CK0H 3UROR 3ULVH 3VFRB 1J1PL 2PYFB 4P2OC 4MGXA 3GIVA 1GGTA 2XNAA 2C3GA 3NFNB 3VDBA 1YEIH 2OBGA 4FTVB 2ERJC 4MMZC 4NNXB 2CRZA 2X4SA 1EAPB 4C4KO 1FE8L 2FO4A 1CTOA 1C12B 2R4SL 3WDHA 4D94A 2Q1EA 2EZ0C 1OARL 2FGZA 2BFVH 4N0UB 4ONHA 1YY8A 4LVHC 3UYOD 3VFGH 5L7XH 3AVEA 3LCYA 3DPBA 3HE6D 3V5KA 1U3ZA 5HHVL 1OF2A 1QZ1A 4K94H 5F70A 1DN0B 1KCSH 3ES6A 1URLA 2FO1A 4C56A 4Y16B 2VLMD 3PP4L 4JFPA 4L8BB 1LDSA 4Q6YA 3SCMD 3I75A 5J57B 1ZT4A 1CG9A 1B6DA 4EEEA 2Q8AH 3VXRA 1BMGA 4KRLB 3K46A 4PTUA 5HD8C 1QACA 3ARPA 5HVFB 1CDCA 2AK4B 4QXTB 5I1JH 5FM5O 5ADOL 5I1CL 4ETQB 2E5EA 1CFBA 3P4NB 5D9SA 3U0WH 1A3QA 3OAUL 4PJBA 1FNGA 1I8LA 5E2UL 4ZPVB 2Z91A 4YZFF 2O5XL 4NC0B 3IDNA 1DQQB 1M05A 3WUWA 4RA0C 4AG4L 4K9EC 3BUYA 4TNVK 1RVFH 2RGSA 5KJRH 5BXFB 3VFUB 4LCUA 4U1IB 2H41A 1R6VA 4NOFA 3C60B 4B41A 1NCWL 4RIRA 4GKSB 1YMMD 3SJVB 4KY1H 5D1QB 4G42B 2WBJA 1VKXA 1ORQA 4K8RD 5C0GA 1W72A 2YWYA 1RUKL 3B8YA 2KZ1B 3MGTA 3SHSA 1J05A 3ARDA 3MRIA 1FORH 3SBWC 5CD5C 1CDBA 4L8SB 2K3TA 2FNBA 1F6AA 1T1YA 4PJ9D 4AM0A 1EAJA 4K7PL 2G2RA 2X10A 4KRPC 1FBIH 1U8QB 2QSQA 3CFCL 5TE7H 5DURD 1S7QB 5A16B 1YPZE 3VI4F 1ORSB 1V7NH 3WL9B 1OW0C 3GKWL 1C1EH 1FAIH 2QADB 4S0SD 4Z0XA 5H94B 3MRNA 2CDFA 4F58H 4G6KL 2DN7A 3KWWA 2E7BA 2FX7L 5GHWH 4WI9A 4ZMAT 4OKDA 5GGSA 5LGKA 3PL6A 5IBLC 4PRPB 4K71C 3WS6C 3NACL 3QZWA 1OP5H 1S5HB 1I3RB 1BFTA 4XXCA 2R8SH 1K5NB 5F7EL 3PGFL 3MRHA 3RVXD 4DQOH 1A8JH 2R0KL 1PJ9A 3WE6A 1UKTA 4Z7UA 4OD2B 1YDPA 1T7YA 5AYQA 4ELMB 4EUPG 1KCUL 2VLRB 3H9SE 1J12A 5T3ZD 4ONFL 4P23D 4P59L 2X05A 5T1LB 5IROA 3WFEH 1RJYB 4LRNH 4XPBH 3W11D 43C9A 5CILH 4FABL 3ELAT 2GJZA 3MJ7B 2JK5B 5GJSL 5EUOA 5IHBA 1VADA 1OAUL 4S2SA 5ISZA 1KLUA 1FIEA 1QKZL 1JHKH 1WAAA 5I2IB 3HE6C 1L7TH 4WO4B 5GGRY 4XBGB 3AMLA 3LEVL 4PRIB 4IIQC 1GIGL 4PJAE 3MLVH 4W81A 1J0IA 4HWUA 2V7HA 1JN6A 2PKDA 1D9KB 4L3EE 4PGEA 1RJZA 1G7QA 5LCVL 2W9DH 2BMKB 3QA3A 3U82B 1NGPH 1BJ1J 5MP6H 2XICA 2L0DA 3ISWA 1EHXA 1KENL 4APQB 1MCNA 4I2XB 1CD9B 5KVEL 5FGBC 4ONOA 4PJFF 5JW3H 3SDAA 2XFXA 5IVOA 3OXSB 3I84A 4KV5E 4AMKL 2QLVB 1UJ3B 4OCWH 3RWIB 4ZFGH 3GM0A 3TO2A 1NC4A 1J8HD 2IFFH 3RWEA 4PRHD 4RAUA 5CHNB 4QRQB 4V1DB 4NM8L 4V2CB 1KOAA 1HN1A 1M7IA 1KYOK 1NLDL 1O7VA 2MOVA 4CAGA 2VB5A 2CDGB 1N64H 3ZKQD 2L4OA 5IFJB 3C6LD 5E9DB 1HNGA 4XP5L 1HQRA 3MLUL 4HULB 1FHGA 2IG2L 3TN0D 4QXUL 1BVLB 4X6DF 1WIOA 1WEJH 3SQOL 1KB9J 1ZHNB 4PJ9C 5JW4R 3GSNA 4XNQA 1NANI 2E8ZA 5FEBA 1G6RB 2LU3A 2DMCA 5DEZA 1OGTB 4JQXA 4WW1B 1JYNA 3KYAA 4JRYE 4FQLH 1BX2B 3CD4A 3LEXB 5FHBH 5EZOL 5E6ZA 3C8KB 4DZBB 5D6CB 4N9OB 4S1SL 3KDMB 4RGOH 3VRJB 4NHCL 1MVUA 3OSKA 2Z4QA 3O3AB 1OM3H 3KPTA 1WFOA 1B90A 2PNDA 4QT5B 1A9BB 3CFBA 4R2GC 4CMMB 1TZGL 2OJEB 3G5YB 4GG6E 3CPLB 5EZIL 3D1MC 1KELH 3P9MB 2AAVA 1KPVB 4PJCB 2BOCB 3RVXC 1NJ9B 4FQXA 5E99H 1G7PB 1F11A 1FRGH 1DL7L 3B5TA 3QJFA 2ID5A 5HBBA 5T3XL 3PWVA 4I3RH 1R5IB 2AXJA 1UKSA 4PGCA 1PQZA 3BKJH 5L2KA 5E1HB 1F90L 4OQTA 5EU6A 5EC2A 3REWA 4PRAA 3ROOA 1N59B 3VH8G 2D7TL 2IGFH 5H37G 3W11C 1PZ5B 1HKLH 3D18A 2HFGL 4K3DH 3TPKA 3BAEH 1BFSA 4U33A 3MFGB 2OZ4A 4LPCA 5E03A 1FVCA 2F74A 4Y2OA 3T04D 2G5BA 2EKSA 3GIZL 4LQ1A 4GKOA 4JHAH 1OSZA 4EI5B 3QIWD 4U05A 4LF3A 4KRNA 4G8FA 4X98A 4P4KA 5IKCB 3PV6A 1Z3GL 5GS0L 2YPLE 4NT6A 4BSVA 2QHLA 1DQLL 5F9WC 4Y5YB 4LLQA 5B39A 4L29A 3H9ZA 5JOPE 2ADJB 2B20A 1WIUA 5KANG 2D7QA 4NUGH 1RUPL 5I8KH 3TYFA 5AUMA 3CSGA 4LSVL 1A14L 5JOPD 3EBAA 4I4WA 3THML 4P9HL 1A1MB 3PQYD 3GZKA 3QRGL 1INQA 3V5HB 5C3TA 1LDPH 3UJTH 1HQ4B 5BV7C 3MO1A 1SJEA 3X3GL 1EFXD 3DV4A 4JJ5B 4ZS7L 4ZUVA 1R3LA 1GC1C 1CFVH 2MHAB 4E9LA 4O51B 4XZUA 3WYRA 2GJ6D 1OAXL 1G7JA 5IR1B 1QYGL 3M8OH 1YPZF 4MAYD 3CJJA 4GRLD 4OT1L 3B2VL 1WCQA 1ZHBA 4TUKH 2WMPA 4GXUM 3HI6L 4XMKL 3AXLA 2VITB 3C6LC 4S0TD 3PABA 3LQAL 1A1NB 5DUML 1A4KA 3RHWF 1T0PB 2ADFL 3Q6FB 2XN9E 4JFYA 4NCC1 5DMJB 3CSYB 1C08B 4PS4H 3IFNH 1FG2A 3TN0C 3BD3A 4ELKA 1Y6NR 2X7LA 5HGAB 4YAQA 3KVQA 1CFNA 1YECH 2XN9D 3LZFL 3TA3A 3B9AA 3QEQE 3GSXA 5HVHC 1KNOB 2IANA 3SO5A 7CGTA 4YHML 4G80B 4ODTH 4QRRE 3P0VL 1GH7A 5K9JL 3SPVA 1MCLA 4NZJA 1KN2L 2VLKE 4F57L 2BRQA 1OP5K 1JVKA 1GXEA 5TGBB 3WV0A 2WV3A 4Z78B 3O3EA 3OKMB 1I9JL 1MCQA 2AJUH 3OWEA 3MFFB 4P2RA 5ETUA 1F4YH 1W0VA 4JFFA 2GW5A 1S9KC 1LK2B 3PWJA 4RFOL 1BVKB 5F21B 4Q74A 4CVZA 2FJGA 1IM3A 2ZUVA 3ARFD 1UENA 2R0WH 4HGWA 2VC2L 4PJAF 1QFPA 4BSJA 3SE4A 3H42L 2LU4A 1CLZH 5EO1B 2HT2D 2UUDH 5D7LA 5ID1A 3WN5A 1X5GA 3ZYIA 2ZUXA 4PLKD 1V7MH 2R1YA 3SDXB 4MDJA 4EN3B 2ZCHH 1KGCD 1JV5A 1T1WB 2R1WB 4TRPL 3ZYJA 3EZJB 1Y18B 3ZE2E 3KPQB 4NPYA 1P2CA 1I9RH 2J6EA 4LCWB 2AJXL 3QUMB 1QEWB 2HTLD 1PX3A 4TYUA 1QP1A 2R0LH 3UTZA 3C5SA 3IDJB 5E5MB 1JZ2A 4FXGA 4NC1C 2AXHA 1CGSH 3QIWC 4ZTOH 1INEH 4KV5F 3S35X 1A7OL 3SO3C 3D6GA 3SQBA 3C2SA 1ROWA 1EHLL 2J4WL 3I6GB 4NQCA 3NCYP 3H3PL 1ZEAH 1X5JA 3QQ4A 4NUJA 1FVEA 2WWKT 3I02B 3H9HB 4XCNA 5D1ZD 4JQIL 4PB0H 3TCXA 5I8CA 1XR8B 2BY1A 4I5BA 4S10A 1LEIB 3BN3B 4DKDC 3V4UL 1PKQE 2D7OA 1PD6A 3MRRA 2WUBL 1N8ZB 3I3DA 3V0VB 2HH0H 5DJZA 3U4AA 5C0FA 5L9DH 5DC0A 4Y4FD 4HK0A 4MQTB 2B7DT 3GMMA 1JP5A 1KJMA 5T3XE 4IOIA 4AIZB 4G9DB 1S8DB 4PD4K 3MNZB 1ZHLB 3VGHA 3MROA 3UPRB 3Q6GH 1IAKB 2A9NL 5T3XD 5F7NC 4FP8H 4HIJA 4GRLC 2FEEL 5FDWA 1CF8H 3DX7B 3VJ6A 4CL7A 2UYLB 4TSCL 1PW3A 5F8QC 4E42B 5CEXB 3DGGB 3O6LH 3WIFA 3G6AB 4XPTL 2M8XA 4HPOL 2F15A 1I85C 2FYYB 2C3HA 3IDIA 5EIQA 1HXYB 1HZHL 4EQ3A 5ERWB 2HG5B 4GG6F 1X6LA 5I18L 2H32B 2MJWA 2XRAH 4K8RH 1CGWA 1HHHB 5DD1H 5KSAD 4OI8A 1JGUH 1KCKA 3BPOB 3SKMB 3VWJB 2DI9A 3MR9B 1D5BA 3KPNA 1KIUA 5GS0D 3QAZC 4JJHA 1WBYA 1FFPB 2BSTA 4M1GL 4MXWL 5CJ8A 3SBWA 4N0YL 4DVRH 1C5CL 2CH8A 4FMFA 4RMVA 1GOFA 5CINL 3KHQA 2X4QA 3GSWA 4PJFA 3QZWG 3FFCA 2JIXA 3PDOA 1GGBH 1HHJB 3TT1L 1JI1A 2NX5B 5ECJE 1QUNA 1UH2A 5LBSH 3EHBD 3HMXA 4DFIA 3TH4T 2XXCB 1VEPA 1Z9SA 4F8QA 5HHMB 5GGQL 1P7QD 4PUBL 4H5SA 3T1WA 4O2EA 4FFVD 1Y0LB 1OW0A 2XZQH 2JCCE 2QKIA 4CJ1A 4FQQA 3W0WD 3IU3B 1X7QA 2ZOKA 3ARFC 3MJ9L 1QSZA 5DRWB 4OB5H 2L7JA 3U7YL 1BFOA 2HT2C 5ESVB 2O5YL 1B0RA 1QQDA 4UT7L 4X6BA 4NO0B 4PLKC 3KJ6L 4U1NB 5DT1H 3L3DB 3IDMA 2YD4A 5D93B 2HLAA 2DTML 1AGFA 4JG1L 3NA9H 3DX9B 3VRLE 4LCCB 3MXWL 5T3ZH 3QG6A 4LSUL 2YS4A 4O4YH 2HTLC 3MACH 4Q58C 3KPLA 5F6HI 2O5ZH 3QJHB 5IB3A 3SDDB 1G1YA 4PJEB 2FHFA 5AG9A 4LVEA 2NYYC 1AIFB 4PPTA 5DTFA 2W0PA 4GQ9L 3ZTJG 3UMTA 3FQRB 5MI0C 3WFCL 2DIJA 3G5VB 3MJ6A 3RWGA 3HAEB 4KQ4L 5AD0B 4MD4A 1L9NA 2DLFH 4LPUA 5C2UB 5FDYA 1I1CA 3JZ7A 5IBTH 1TQBB 4KHTH 5I9QC 3WCYA 3HE6A 4Z95L 2P46B 5J11B 3S96A 2AJSH 3WFBL 1I1FA 3GJEA 4Z5RB 2FECI 3FN0H 4U1MA 2AEPL 4TUOB 5JUEL 2ICWB 2VISB 2UZIL 4D9QE 4KROD 3IDUA 2NY1B 3K4DA 2GK2A 5F9JA 4Y4FC 4D9QD 2VLJB 2ICEA 2R39A 5DGRA 3D0VA 3RX5A 1FL5B 1E4WL 4LSQL 4OGYH 1R0AL 1ADQA 1CL7H 1MJ7H 1NGWB 2IC2A 4YHIA 4O2CB 2E3VA 3BD4A 5ITFA 3FONA 5BV7H 3H0TA 5CSGA 1RI8A 2WWKO 3MLTB 1A7PL 3BSZH 2AEQL 2VTFA 2A0LC 1D5MA 4MA3A 4E41E 2PYEE 1QSED 4XP6H 2IPUG 4WWKD 1HHIB 1J1PH 4RA3A 5LXGL 4MX7A 5DJ2B 3ZLQC 3FFDA 2A77L 2RBLA 2CKBB 5EDXA 3S35L 1A6AB 3QDME 5E4EB 4CMHB 3V8OA 5D7IB 1Q9KA 1FE8H 2O26U 2VXQL 4XCEA 5KSAC 2R4SH 3B9KD 2XWJB 3EIFA 3QDMD 5D2NE 1OARH 1Z9MA 3MLXL 5GS0C 2HJKA 1GL4B 1XAUA 2Q76B 3RY6C 2X70A 5HHVH 1HEZA 1AP2B 1JHTB 5MEPB 4PJ9A 4WI4A 1FYTB 4ZO9A 3ZE2F 3PP4H 2JKXA 3EHBC 4P9HC 2R2BB 3DMMB 1KULA 4Y2DA 1EHNA 2UUDK 5MEND 2N7AA 3TZVB 4FFVC 3QO0A 1YPZA 3BZ4A 4UMGA 4X9HA 5IP4A 5BW7C 3DJ9A 3MRDA 3QQ3B 3GRWL 4HS3B 4RQQB 4ESKA 5ADOH 2WINB 5I1CH 4IOSD 3QFJE 2X1WL 4IHOB 4PGBB 4Z7VE 1EO8L 5C08B 5BMFL 3WNPA 3OAUH 5DK2A 2QSTA 4M3KB 3NZHL 5DFTA 4HX1B 5E2UH 4BM7A 1FL3A 3OKKB 5GRZA 2O5XH 1DUYB 4JY6B 1YY9D 4D0CB 1BF8A 1MHHA 1ZVSB 1A9EB 1K6QL 4AG4H 1T0MB 3LQAC 2V2WB 1LP9E 3UXFA 1BOGA 1MJJA 1TDQA 1XGYL 1NCWH 1T3FA 1T21A 3TFKD 1LQSR 2BSSB 2YD3A 3GMPB 3H9SA 1AGEA 2VDRL 1HILB 3FT3B 3O9WA 3CH1A 1RUKH 3ZKSD 1PKOA 5GISL 4HWBA 5C0JB 5A40E 1LO4L 1WZKA 1UWGL 3JUZA 4PJDB 3BZDA 4UQ2B 5IVXF 1RJLA 4MB4A 2BVOA 4K7PH 3GSUA 2DRUA 3CFCH 1ZANL 4Z7QF 4PV8A 3VGAC 4QEGA 2C7UB 4JFDB 4JANA 4KROC 1MAML 3SDCD 1WLHA 4PJAA 1MI5D 2NZIA 3GKWH 3L3HB 3VFPB 3GJFH 3AS3A 4G6KH 1JNJA 1C5BL 4L3EA 2FX7H 1JRHL 3E6FA 5H2BA 4JFOB 3V2AR 4BZ1L 1NKRA 4G3YL 3NACH 3QUXD 1FGVL 1OP9A 3CFKB 4GMTL 3PGFH 5F7EH 4HV8A 1ETZB 4X6EA 3GDBA 3FCTB 2R0KH 3P4LA 1RZJL 4WWKC 4EXKA 3QUYB 4F37F 3HFML 3TJEL 4WU7B 1MQ8A 1K8DB 1MWAA 4JN2A 5IOPA 1J8HA 4TNWF 1CDGA 1KCUH 4ONFH 5HHPA 4HS8L 4P59H 5D96C 3Q5OA 4G8GD 4XWOD 2JCCF 1DP0A 3C6LA 1XF1A 4LP4A 4FABH 5CD3B 1HYSD 5GJSH 3N06B 4TPRL 3KPRB 3QI9B 2Z35B 1SY6L 1OAUH 4JM2D 3P11L 3TN0A 4Z7NE 3FMGL 5LKNA 1QKZH 4J3SA 5D2NC 4YBHA 3PWPD 3FRUA 3LEVH 5K9KB 1AO7E 1GIGH 5BZWB 3ILPB 3VXUD 1DFBL 5C8JA 2I27N 3W5NA 3VRLF 5IESL 2AEIT 1XCTA 1OQXA 1A02N 2VXTL 4NKOA 1AO7D 3DBXA 3RHWK 2R1XB 5LCVH 3R06A 1F45A 4HDIB 3OKNB 3FOMB 4JRYA 3NZ8B 3VFSB 1U8LA 5TH2B 1KTDA 5FYLL 3ZKXB 4DGVL 3BEWA 1KENH 4JO4L 5KVEH 1FN4B 2EYTB 3VFWB 4EI6A 3KLAB 3G5ZA 4AMKH 4ZTPL 2OMBA 2ZSVA 2E6PA 4DZ8A 1YY9C 4GG6A 4DUWA 5DYOB 3GUTA 3B3IB 5L0QC 5DLML 5L6YL 4PBXA 3CU1A 3TP4A 3T3ME 3TYGL 1RZKL 2HJFB 4NM8H 4ZFZB 1T7XA 2A6JA 3MUGB 1NLDH 5D2LE 3IFLL 1Q9OA 4NO2B 5GGUA 3D2UB 4PY8J 3DUSA 5J3HC 4OBRA 1HHGA 2HVJB 1U42A 3RUGE 2DS4A 4XP5H 5ILTL 2CK2A 3MLUH 1U8NA 5E1AA 3D0LA 2IG2H 4QXUH 4LDEB 1DLHA 2IH3B 1JZ5A 3SQOH 1HI6A 2QQNL 3QIWA 4HZLA 1P53A 2DAVA 2AI0L 3IU4L 2GAZB 4D8PB 3RPIA 1HOCB 4NIKB 5FFLA 4M5ZL 3MNWA 1EZVX 1I4FB 3OG6B 4YX2L 3RJQB 3SDCC 5HYEA 4QRPB 4JPIB 4RMRA 5EZOH 3V4PL 5DJAA 2YPLA 4OM0L 4S1SH 3O8XD 2WP3T 3I6LE 2AXGA 4G9FB 4NHCH 1B0GA 3CGTA 3IAQA 2ZSWA 4NRZA 3QXWA 5JTWA 1QSVA 3J7HA 4X9IA 1FZKB 3D39D 3ULUL 2DL9A 3UBXA 1H3GA 5JA9A 1TZGH 5HY9A 2YA1A 3BW9B 3KAAA 4OGZA 1QLFA 2SEBB 4Z8FL 4KTDL 3QUXC 5EZIH 3RI5F 1EFXA 5DO2D 1J5OL 4CW1B 3BDBA 1AGBB 3U2SA 5MEOB 3VWKD 4R4ND 1DL7H 3K4AA 5T3XH 2OI9B 3GB7B 4UDTB 1J0JA 3TVMA 5IIEA 3L3GA 2C1OA 3QNYB 1F90H 1YYML 2R2HB 4HCRL 3B6SA 4K3HA 4IM8A 2HYMA 3MRJA 1NCNA 2D7TH 4XWOC 2CO7B 1JFQL 2HFGH 1ZWIA 2NW3A 1HYSC 5J6HB 1NDGA 4PJGE 2AXFB 4MD5B 1E28A 3DYMA 5SWQB 1P1ZB 4ZD3L 1I85A 3GIZH 2DMBA 2BJML 4OIIL 2L7UA 4Z7VF 4JG0L 1TZIA 4NQTA 5CJXC 1QHOA 2XN9A 3QDGD 1KG0B 2P1YA 2QV2A 4KUZL 3L5IA 4P2QD 1Z3GH 5GS0H 3F8UB 2YZ1A 3K8MA 3MRMA 4KMTL 1QRKA 2ARJQ 1CQYA 3QEQA 1DQLH 4U0RB 4R96B 4AIXA 3FOLA 1XEDA 5J12B 1LP9F 1RUPH 3BP5B 3TBWB 4QRRA 1EEQA 4LSVH 1A14H 2E9IA 3MX0A 2H9GA 4Y4KD 5GRYA 3THMH 4P9HH 3QHFL 5FOJA 3QRGH 2R2CA 1J10A 2VLKA 1JGLL 5DHYA 2NW2A 4WI2A 1FNHA 2XWBA 1U8IB 2QTEA 3SN6N 3H3BC 1UA6L 4MQXD 5CEYB 5KVFL 5HDBE 1HINL 1KPUA 3X3GH 5E6IC 1BD2E 3C09B 5F7WC 1JCKA 4ZS7H 1WCBB 3B5HA 2ESVB 1MCJA 4QF1B 1QVOB 3OB0K 3WO4C 3VFMB 2QSCL 5HSFA 4P46B 4X5WB 3ARFA 2MPAL 3FB6B 1BD2D 4KU1A 4O2FB 5CSZA 2O61A 4LKCA 1OAXH 2F58L 1QYGH 4WV1C 2PO6D 4MNQD 4OT1H 1KIRB 3B2VH 4X6CB 5TF0A 3VGGA 3FRPA 3HI6H 4XMKH 3EO0B 3GNML 3TBVA 3EO1B 4JAMB 3LQAH 5DUMH 5FGCE 4FQJL 2ADFH 3F7VB 4JQVA 1AFVL 1ZT7B 3ROLA 1CZ8L 1H8NA 2Z0BA 3LZFH 3PJSA 4MDIB 1U3HD 4NKDA 4XNMA 4EDWL 1U8KA 4HIHA 3KG5A 4YHMH 3P0VH 4OI7A 5K9JH 3VG0L 1KPRA 3C08L 3DVNA 1A6TA 4NJ9L 5D7JB 3RFZC 3QT2A 3BZFA 5BS0B 5KSVB 1C16B 5F96L 2P5WB 1KN2H 3O8XC 1IAII 1I1AC 1G0YR 2GEEA 4OZGB 5F88A 4F57H 1MCFA 5IMLB 1GZQB 2ITDB 2YBRA 4F7MB 2Y07L 1I9JH 1IGIL 1WBXA 1JMXA 4FQHA 1VACB 4Q6IC 3E8UL 4R4FL 5FYLD 4QTIL 2YOCA 4JO3L 1I8IA 4RFOH 4X9FA 4Z7NF 3VGDA 1PKQA 5DO2C 2X4UB 2VKWA 5CWSA 5LAXA 5KS9E 3A6CL 2DKSA 2E7LA 3VWKC 4R4NC 2P5ED 2VC2H 4JHZA 1IGYB 4GXUN 1IM9B 3H42H 2F19L 1R3JB 3OJMB 3CVHA 3TCLB 4TRPH 4HKXA 2IALA 1OLLA 2CIIA 5IVXA 2AJXH 2VZ3A 5JNYB 2LVEA 2A83A 4NN6B 4KRMB 4ORZC 5GGTL 3MMEA 3HNTL 4M9OA 4S1DD 4YHPB 1FDLL 5GRUL 4P99A 3RVVD 2I07B 3T4AB 2I9TA 4NZTL 2FIKA 1A7OH 2X4OB 1YMHB 5KSAA 1EHLH 2J4WH 5DS8B 5MEQA 2AV1B 3OTTA 2E9WA 2CUMA 3H3PH 4QY8B 3JWDL 3QNZA 4OLZL 4LLDA 4OKVA 4WNQA 3TO4B 3BP6B 4QOKE 3RY6A 3T3MF 1OAYL 4JQIH 5BVPL 4KXZI 3MBEB 1FZOB 2FLBT 2EH7L 1U8MB 5D2LF 2NNAB 5F1OB 3ULUE 3V4UH 3ULUD 1LO2L 2WUBH 4MQXC 1P7QA 3MV11 1BBJA 2H26A 2HT4D 3Q3GB 4NM4L 4O02L 1Q94A 4LNRB 1RJCA 4RNRA 1G9EA 1XR9A 3ARRA 4HUXB 5C0DA 3MV7E 3RNQA 4PG2C 3E3QE 5F1NA 2JCCA 2BNQD 2A9NH 1LE9A 3MV7D 1KC5L 1F3JA 2MWCA 2NY4D 2PO6C 1FFRA 2H6PA 4XCFL 2FEDD 5I19L 2KH2B 4NCDA 3ARGA 4TSCH 4YPGB 4OTXL 3BEVB 1H3UA 3KPMB 5DK0B 3TGXA 2XKSA 2YMXL 4HIXL 1NBVL 5C70A 4XPTH 5DJYA 1I7ZB 4PJIE 4MA1B 4HPOH 1QLRA 4M48L 1GOGA 1S7RB 4JKWA 3HLAB 1UB5B 2VXSL 3U4EB 4MJ5A 1HZHH 3BGMA 5I18H 3QEHB 1TZHB 1N7ML 1U3HC 1JNLL 1IGTA 4LLVB 1SYSB 4LLWA 3B9DA 1UXSA 4LK4A 2P49B 4OZFA 2EYSA 2VN4A 3O4LE 1NGZA 3MGOB 5CKGA 1RHFA 5HGBA 2OTWB 3G6DL 4FTVD 4M1GH 4MXWH 2GKIA 3ARSA 4N0YH 3WHXA 4PP2A 1C5CH 4N0UE 2BHYA 5CINH 4BJLA 4P5TB 1ZGLA 2CJUL 2VZVA 4UU9A 2I9LB 3TT1H 4P3DA 4WI3A 1QRNB 2GYSA 4LPYA 1LO5B 4PJGF 3KXFE 4O58L 5GGQH 2FSEB 4DEPB 4PUBH 4LGPB 4LLMB 2BC4B 3F6IA 4ONGL 1G6RL 5CZKA 3W81A 2R69L 3WLWD 3MJ9H 4TSAL 2CLVA 1OCWL 4Y16D 4HJ0D 3UDWC 3PWLB 2YD1A 1ZKAA 2OSLA 3LPGA 3BHBA 4MHHI 3U7YH 4Z76B 5I1EL 2O5YH 4UT7H 1NEZA 4OD3L 3KJ6H 2KBGA 4KJPD 4JZNB 4KH2A 4KTEL 4NBYB 5T1KB 4P4RB 2P8MA 3ALXA 2DTMH 4JG1H 1RZKC 1T89A 2AK4D 1QSEA 4JY4A 2F54B 4D0DB 1AE6L 5GIRA 3MXWH 3T0EB 3HC0B 1NMAL 3C5ZB 4YUEL 1XGTA 3LDBB 4LSUH 4KKCC 4LRIA 4E41A 2PYEA 3WIHL 2R15A 1JPTL 3V79C 4MCZA 1GGYA 2AJZB 5JOFA 4OLXL 4S1DC 2X4RA 4FQ2L 1L6ZA 5HDBF 1FNEA 3X13A 1AH1A 4KJQD 2V5MA 4OZIE 4GQ9H 3WFCH 1AJ7L 3QDMA 4KQ4H 2E6QA 3LMJL 4F37K 1DUZB 1NCCL 4NN5C 5C92A 3C60D 3LEYL 4JZJC 2DM4A 5FO9A 5KSUA 2R2EB 4GS7B 5TQ0L 4TNWK 2VQTA 4LVNC 3G6JE 5D2NA 3SJVD 1XIWA 5D1QD 4Z95H 3V6OE 1ULVA 1CE1L 4OFIA 5JXEA 3WFBH 1AHWB 1N4XL 2FR4A 4KGJA 4PG9B 4WRLA 5HHQA 3UTSE 1S7WB 2LVCA 2AEPH 3ZSSA 5JUEH 3QXUA 4DUVA 2UZIH 3ULUC 5F97E 2X4TA 1B88A 2HT4C 3L6FB 1K85A 4RZCA 4MLSA 1AC6A 4PBWD 4HIIA 1MCWW 2A6KB 1E4WH 3K0WA 4LSQH 4GW1B 1R0AH 1QSFE 2YRZA 3S4SA 5DD6A 5BQ7B 3SE9L 4Y5XC 4MCYA 3E3QC 1A7PH 2QADD 1S7SB 2AEQH 2NY4C 2FEDC 5EO0B 4HWZA 4PRPE 3QFJA 2VABA 4HKBA 4U3XA 4Z7VA 1YEJL 5T1MA 1MCCA 4YEFA 1BHGA 5IVZB 1IILE 4PRBA 4PRPD 4OFYD 3QEUB 5LXGH 3AY4A 3JTTB 2X4NB 2EEBA 2OX5A 4OLEA 1T20A 1SEBB 1CGXA 2A77H 1NAMB 4J3WA 4AT6B 3MV9B 2V6HA 5GSVA 3S35H 5A43C 3S3PA 2VAJA 1IQWL 3LQZA 2VXQH 3IXAA 3QXAB 1U3JA 2B2XL 5KS9F 1LP9A 1JWUA 3MGAA 2NY2B 4WFGE 3LKOB 1WWAX 3DIFB 3MLXH 2VLRD 1IKNA 3KS0J 3GMOB 1K9TA 3UBXG 5T1LD 4JKPL 1DZBA 2JJVA 4S11A 3TT3L 1I7RB 4H20L 3FN3A 3MRCA 4CGTA 3MXVL 5DHVH 3QSKB 1B2WL 1I3GL 1MCPL 3GSOA 4WO4D 3SDCA 4H25B 1EO5A 4GLRI 2IF7A 4CRPA 4PRID 3C6SA 2GSGA 3WLWC 4NKQB 4XGZB 4Y16C 4HJ0C 1S7XB 3GRWH 1KTKE 2DWDB 2F5AL 3EJYD 1H5BB 1D9KD 3UEZA 4K2UL 1GGIL 1EO8H 5BMFH 3U7WL 1YJDL 4L8CB 2H1PL 4IOFD 4MWFB 5DEGA 3NZHH 4H1LA 4I2XE 2EXYC 4EUPB 4X7EC 3V7AE 4APQD 3UPAA 3ULUF 1K6QH 1NAKL 2NCMA 4U1JB 5E8PB 6FABL 1F4XL 1KB9K 1VGKA 3RZCC 4DGYL 1FZMB 2XKNB 3IXTA 1XGYH 5DRNB 3RI5K 2VDKL 1UH4A 2BY0A 2ZCLL 2VDRH 1PG7W 4KJQC 2DLTA 3UTQA 4YIQA 5GISH 5JQHC 5EBMB 1GVIA 4DVBA 4I18A 4PJHE 1PG7L 4V1DD 1LO4H 5E8DL 3I6KB 5KAQF 1WJ3A 3BWUC 1UWGH 3QO1B 5IJKA 1ZHKA 5D1QC 3HZYB 4Z18A 3SE8L 3E2HB 5CJXA 3QUML 5E9DD 1VENA 4CBPA 2VAAA 3BO8A 3HS0B 1ZANH 5I15L 3V6OC 5FKAB 4XVJL 4XVTL 1T6VN 3LD8B 1DQTA 1MAMH 3TBTA 1AO7A 5F3BB 3DROB 4L8SC 1N3NA 4HUUA 3P40A 1IC5L 1SEQL 5D70L 3S3SA 1GPOL 3TJHD 1C5BH 1UM4L 1DE4A 3KPSE 1JRHH 2F8XC 3FRPG 4PJ8B 2BSRA 5DZNA 1MCEA 1MJUL 2R23A 4WTZA 4BZ1H 3CCHA 3HC3L 2QADC 4XMPL 4G3YH 1FGVH 1DEEB 3OV6A 5F9AC 5E6IA 3O81A 4GMTH 1UQSB 3BT2L 4RAVA 1RZJH 4ZOEA 5C07E 3TEUA 1YNLL 3HFMH 4L4VE 3TJEH 3HNVL 1MIML 4PJCE 4PTTA 1NFIB 3IF1A 4I13B 2DJ4A 3G04B 3UC0L 1MNUL 4HS8H 4L4VD 4GW5A 1G7IB 3IS1X 1WV7T 2Y6SD 2Q7YB 2YPKB 1RK1A 3UTOA 1NGXB 5C0AB 1MCBA 5I16B 5I1LB 5C1MB 2EECA 4TPRH 4YPJA 5D2LA 1RD6A 1SY6H 4LNVA 3RTQA 3K74B 3UTPE 3P11H 1CR9L 1LILA 1UWEL 3EFFA 3FMGH 1MCOL 3GMLA 3JWDC 3RUGA 2QBWA 1WWCA 3TIDB 1G7LA 1Q9WB 5MERA 3VXSE 1AD0B 2CLRA 3RDTB 5CIPH 1DFBH 2XIDA 1IE5A 3LKSA 5IESH 5J1AA 1DQDL 4UUJB 2VXTH 1S7UA 4WO4C 2NPLX 4LIQL 4XVUD 4YHLL 3O8XA 4K07A 1I1AA 2ATPB 4N8CL 5FYLH 3WNOA 4DGVH 2X9YA 4Q6IA 4OZIF 3EJYC 3STLA 1D9KC 1P6AB 4GSDL 4KKAD 2EDEA 4JO4H 4Y1AB 3GRWA 1QA9B 3FO9B 4IOFC 1B0WA 4HD9A 5KG9B 2DWEA 2V2XB 1KBGL 2LFGA 3G6JF 4ZTPH 1XGPB 4DUXA 5EBWB 2W92A 1HIML 4MZ2A 5IQ7L 4J23A 4APQC 3HRZA 4AEFA 4IRSB 2CGRL 2ITCB 1IL1A 1K2DA 5DLMH 5L6YH 2DI7A 3VH8B 5F6IB 4F7TB 4UNVA 1T83C 3NPZB 1KYOJ 5I6XB 3TYGH 1RZKH 4LL9A 3DX8B 4LMQE 1UJ3C 2FH8A 3W82A 2GY5A 4MNHA 5E7BA 3IFLH 1FC2D 4LLYB 4Y8AA 3JWOL 4NP4L 5ILTH 4N8VA 4NQSA 2A1WL 4OF0A 1VFAB 4ZUUB 3WUZA 1EERB 5DJ6B 1DEDA 3LIZL 4YO0A 1OTSD 4PJGA 1CE6B 2QQNH 1MCSA 4YDLB 3NCJL 4YDKL 3VXNA 2QHRL 2AI0H 3IU4H 3T8XA 1A7QH 4E0RB 3NFPB 4NQDB 3O11A 5DMKA 2YR3A 4NDMB 3PNWA 4M5ZH 4YX2H 1SMOA 1FZJB 3V4PH 3HKFA 3VXQA 3AS2A 4OM0H 2FHBA 1FLRL 4JCMA 3TJHC 3GMRB 3OX8B 2WK2A 4K3EL 5TJWK 3QWRD 1TENA 5KN5B 3ULUH 1KJ2B 1U8PB 2EDWA 2YEZA 4Z8FH 2X41A 4CVUA 4KTDH 2VZSA 3ARBA 4CDHA 1J5OH 1WTLA 5CBAA 2BZDA 1JWSB 4HUNB 5HVWA 1FFQA 1BP3B 1L0XA 2IEPA 3OGCA 2H2PD 4PG2A