5FW7A

Structure of human transthyretin mutant a109v
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
116
structure length
116
Chain Sequence
b'CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAVLLSPYSYSTTAVVTNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSTHYRETIN
molecule tags Transport protein
source organism Homo sapiens
publication title Structure of New Non-Amyloidogenic Mutant of Ttr A108V
rcsb
total genus 31
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 5fw7A00
2FBRA 4TQ8A 3DO4A 1BZ8A 4TQPA 3U2JA 4IK6A 4PWEA 4Y9CA 1ZD6A 3QVAA 2F7IA 3W3BA 3IMWA 4Y9EA 1TTRA 4ABVA 4D7BA 3HJ0A 5IHHA 5CM1A 1TLMA 4PM1A 3KGSA 5AKSA 3P3SA 4ANKA 3CXFA 3DK0A 4ABQA 2QELA 3DK2A 5EZPA 2H4EA 1FH2A 3CFMA 1E4HA 2ROXA 3ESNA 3P3TA 2PABA 4YDMA 4ACTA 4WO0A 4Y9BA 5CLYA 1SN2A 3I9IA 3CFQA 5FW7A 5K1JA 1TSHA 5E23A 1F41A 1IE4A 1THCA 4TM9A 1DVUA 5TTRA 2GPZA 3NEOA 3IMRA 3NESA 2G2PA 1TZ8A 5JIDA 5AKVA 1SN5A 5AYTA 1U21A 5L4FA 1TTBA 1DVYA 4TLKA 1Z7JA 2QGCA 5HJGA 4ABWA 5CNHA 5AL8A 1DVQA 2G4EA 4PMEA 1ETB1 1BZEA 3NEEA 3KGUA 4HISA 4TNFA 1OO2A 2FLMA 4TQIA 2B15A 3CN3A 3IPBA 5AL0A 3CFTA 1DVSA 4PWHA 1BMZA 4HJUA 4TNEA 2G9KA 4HJSA 2G5UA 2TRYA 3DJZA 4Q14A 4TKWA 2QGEA 4I89A 3U2IA 3DJTA 4MRCA 1E3FA 1Y1DA 3IMTA 1QABA 2G4GA 3GS0A 2B77A 5E4AA 5EN3A 1IIIA 4TLUA 5L4IA 3CFNA 5K1NA 1GKEA 3A4DA 4WNSA 1ICTA 4L1SA 4FI7A 4AC2A 4IK7A 3DJSA 4HJTA 4N87A 4QRFA 4MRBA 4TLSA 2G3ZA 1SOQA 3BT0A 1BM7A 4Y9GA 4I87A 3D7PA 5FW8A 5FW6A 3IWVA 4DERA 5CN3A 4PWKA 4IKKA 4TNGA 5JIQA 4Y9FA 3GS7A 3FC8A 2G2NA 3TCTA 3ESPA 2TRHA 3P3UA 4DETA 5A6IA 3P3RA 4IIZA 5DWPA 1G1OA 4KY2A 1IIKA 1X7SA 2B14A 3D2TA 3Q1EA 2H0FA 4PWFA 4AC4A 5CR1A 5L4JA 3GS4A 3IMVA 3CBRA 3FCBA 3NEXA 5CLXA 2NOYA 3IPEA 4PMFA 2IGLA 2QGBA 3BSZA 3IMUA 3IWUA 4PVMA 2B16A 4IKJA 4MASA 2B9AA 2H0JA 1KGIA 4TL4A 4TLTA 5E4OA 2H0EA 2ROYA 4DESA 3GRBA 5BOJA 4PWIA 2QPFA 3CN1A 4FI8A 3B56A 3I9AA 1TTCA 3M1OA 1IJNA 1GKOA 3CN2A 1X7TA 4PWGA 3DGDA 5L4MA 3GRGA 2F8IA 4IKLA 4YDNA 4QXVA 4N85A 4IKIA 2H6UA 3OZKA 4QYAA 4WNJA 4ABUA 1TYRA 1FHNA 4I85A 1DVTA 1F86A 3DJRA 5CLZA 4DEWA 1RLBA 3CN4A 2GABA 1BZDA 2G3XA 1DVZA 1TFPA 1TTAA 3CN0A 3ESOA 3IMSA 3A4EA 4PVLA 3OZLA 2H1XA 4PVNA 3NG5A 1QWHA 1THAA 3KGTA 3TFBA 3DIDA 1SOKA 1ZCRA 2WQAA 4TL5A 1ETA1 1KGJA 1TT6A 4FI6A 4DEUA 4PWJA 4TQHA 5DEJA 4HIQA 5AKTA 5FO2A 4N86A 3A4FA 1DVXA 3GLZA 5JIMA 3GPSA 3SSGA 4L1TA 1SN0A 2QGDA 1E5AA 3I9PA
chains in the Genus database with same CATH superfamily
1CCZA 3GHPA 2HUHA 3F12B 4C83B 4MZIA 2W9DL 1AGEA 4M8UA 1JNLL 4L3AA 2K3TA 4U0RB 4RGOH 5C08E 2PYEE 4EDXB 3LNFA 3QJHA 1QYGL 4G6AC 4WW2F 3SDCC 3T0EB 1UB5A 4F57H 2QBWA 2UXFA 4JX0A 1Q0EA 3QNXA 3ZDZB 5JR1H 2EO1A 1MFNA 3L95B 4L4TD 4PV9A 3HNTL 5E23A 4AVJA 2QR0A 4JZJC 4TM9A 1WA0X 3C60D 4PPTA 3ZE0E 4LASH 4QNPF 4Y5VC 3Q2NA 3KVDD 3VQMA 1OARH 2WTRB 4HUMB 2HLAB 4ZRGA 3W39A 1BEXA 1HS6A 5HI5C 4L0ZA 3ESVF 2NYZA 5I8KH 2E9BA 1F3JB 4HLZH 4HPYL 4ONHB 2XDHA 4K7PH 3VJ6A 1IC7H 1J8RA 1AZCA 2A0LD 3OBAA 4XI5D 4D9RE 4G7SB 1ZVHA 1F1AA 2WXOA 4RAUA 1H0DA 1U91B 4K3JL 3EOBB 2VZ1A 1DDHA 4L1SA 1NCCH 3GJFH 2VIRA 4JAMA 4N9OB 2OMWA 1I75A 3BSGA 2ARJB 5FM5M 3C8KA 5TF1L 3RWCA 3WYRA 1ZA3B 5DEZA 1RJCA 1RUMH 4YC2C 4PIBA 4Y4KD 1DLHB 2YC1B 2WXJA 1C1EH 3QQ3A 2APXA 4M6ML 1KB5A 2R1XA 3JWNC 4AYBA 4POYA 3TCTA 1S9XB 4WUKL 1IKOP 4BUGA 4PWFA 4LNRA 3DLQR 2KERA 1GGIL 4HFWA 3H8NA 2E7CA 4Y19B 3U4BH 2YUXA 1KULA 4C56E 5CKAA 5HVWA 5T1KD 2YD3A 4M7JH 3DNKA 4UDUB 3QISA 1VGKB 4KK5D 2LQRA 2XA3A 4NKMA 4Z0XB 4KZDL 5EIIA 3PL6C 3HVNA 3PWNB 2W59A 5LGYA 1A6TA 2F5BL 4OFKA 4PJ8C 1ACYH 4HG4K 1R3JA 2V17L 4LGRB 3K6OA 1M71A 1KEMH 3JV5A 2PTUA 4L9LC 4N24A 5FECA 4GLRH 4Z3JA 3QQ9D 4EN3C 4GBXD 1ZWIA 4MYWB 2VAAB 5FAAA 4YXHL 3MJ8B 1ETZB 5AWNL 1BJ1H 1EXHA 1NLDH 5D2NC 3NJLA 2ITDB 2Z93A 4JZOA 3U83A 2W94A 4TS6A 3QUXA 3TH2T 4K9JA 2ZAGA 3LJ3A 3BEVB 1ZMYA 2HVBA 3HE6D 3MNWB 4JHAL 4NC1E 4WDIA 5DHEA 4V33A 4HOMA 3EH3B 4UTCA 4GG6A 1MCDA 3L4CA 2EIJB 4GSQA 1B0IA 3HKZA 4FXLA 4JHVA 1Y7VA 1XGQB 3QDGE 2JELH 4NCDA 4YR6B 1FNEB 3LDBC 4OCSL 1QSED 4UI2A 1MJUL 1MCKA 1N3NA 3V5DB 5DDHB 1OGTB 1ZKAA 6CGTA 4MZ2A 1P4BH 1DEEA 2WTOA 1JD9A 4PJDB 3KNBB 1EEZB 1WBYA 3O8XC 1NMCC 1UA6L 2LAGB 2BNQD 5IW1A 4C58B 1CU4H 1D7BA 1K4DB 4JRYA 2LV4A 4LRIA 5LGKA 1A6VL 2IH9A 4MX7A 4XCNB 4HW6A 5A6IA 5I2IB 4OIAA 4CGTA 4NBXB 4L9LB 4PD4J 5FLUA 3TVMA 3DJZA 1KFGA 5CINL 5F3FA 1V54B 1OCWL 3F62A 3VW3L 3MBXH 3QXVA 5AB9A 4I88A 2PP7A 4MVBD 4YXKH 4ELMF 1A1MB 4RGMC 5FYLE 5LLIC 1V3JA 5DQDL 4FABH 4M93C 1FNGB 5GRJH 1MKFA 1OY3B 3QDJE 1NDGB 4OZGF 3PDGA 1UADC 1B4TA 5JLZA 4PV1C 2R2CA 3S3SA 4FP8L 4X6EA 4I5BB 2MMXA 3GMPA 1AH1A 3Q8CA 5H37H 4TNWF 5BW7A 2OLDA 3P4LA 4POZD 2UZYB 4QF1A 2ATPA 4ONFH 3B2VH 3RDTD 5IEHB 4WU5B 2NLJA 4FLSA 1NC2A 4TSAL 5HGDB 2YK1L 3B2MA 1YC7A 3BP5A 5JPMA 3U36B 4ALAH 3MUGA 3PDOA 1PZBA 5K9JH 3WIHA 4I1RA 3NPSC 3HRZA 3L5JA 3EO0B 1JF6A 4XN5A 2DZEA 5CBAA 5GXBB 4PJ9C 1KYOJ 5F7MC 5F6HJ 2CDGB 5CZVL 2WBWB 1TZIB 1NGXB 3SYPA 4XE5B 5C0DB 1ETA1 2NXYD 4M1DH 1G84A 1XGZA 3ULUH 1RIUL 4S2SB 2NSXA 3DRTB 4BE6A 1KBKA 5FA3B 1S6NA 4NQXB 1R5IA 1P1VA 3CE1A 2X6VA 2CE6A 3CSPA 4K07A 4F27A 4KTEL 3MRLA 3DVIA 1FFOA 2VXUL 4G6FB 3ZKQD 1LL1A 5GJTL 3VI3E 3VH8A 4PM1A 2JB6B 2Q86A 3A6BL 2NNAB 3EFDH 3QUYD 4JJHA 1KZYA 3WKQA 3SDCB 1CDBA 3LPFA 2K1MA 4CVWA 3LXUX 4Y16D 5LQBL 3CFMA 4IBTA 4OT1L 3RY6C 1NGPL 3D85B 2CJUH 2BHUA 4DUXA 2EXWD 3JXAA 1VACA 2VL4A 3UTSA 1LJMA 2R59A 2EVGA 3I6GA 5ALBL 3MGOA 5IBLC 3HZYA 2P24A 2VLLA 3O9WD 2I7SA 5C0CE 2DIBA 4Z76A 4P3DB 3BP4A 5KYNA 3ZDYE 3V9CA 2EDWA 3TPUA 3LKRB 1JRHL 2VLKA 3BRDA 5FO7B 4N2KA 5I28A 3V5KA 2A83B 3K4AA 3KPMB 3RTQA 4B9IA 2R29H 1JXDA 1KCVH 3ARUA 1T1YB 4YFEA 3L4YA 4NIKB 2CKNA 5GZOC 3A6CH 3ARED 3GK8L 5IEKB 4UTBH 1NKGA 2DM4A 3DJTA 3NYKA 4LQ1A 4GP4B 1ZANH 4GRWH 1J05B 3FKUS 2ICWA 4MLSA 3LKQB 4N2CA 4YSTA 3UZQB 3O4LE 5B8CA 4Y4KA 1S3KL 3ATBA 3ZGHA 4F7MB 1ACZA 1RURL 2X4RA 3UROR 3L3GB 2OSWA 4NO2A 4ICWA 2YS4A 2RJMA 4IOFC 5F3BA 4JPSA 4PI2A 4F2FA 3LRGA 4MXQD 2K8MA 3IU4H 5KJ7E 5CCJA 2C1PB 1YEKH 1FH5H 1RMFH 4L4VD 3TBYB 4L1BA 3I02A 1QVOB 4PRPB 4YLQT 2ZCZA 2PLTA 2VDQH 5ANMA 1JF1B 3WKNA 4Q9RH 1F2XK 4XGZA 2WHVA 4KK8C 2IADA 4G9FE 3H4HA 4PVMA 3UTTB 3DXAE 1SYSA 2N59A 2W60B 3EJJX 2QZQA 4JKPL 3IK2A 4OFIA 1KTDB 2BOBA 3QNFA 3MNZA 3NAAL 3KW8A 5L2JB 3KWVA 2J5WA 4NPYB 5E7BA 4AQAB 2H0PA 1IKFH 5DLMH 5E2TH 4FQLL 2H6UA 4N9GA 4GG6F 2YKLL 1F86A 1HCZA 3UO1H 1HYSD 3QO1A 1QX1A 3HA0A 2XTJB 4IRSD 3SBWC 2XTSA 4LLWA 2FAUA 1KLGB 3DVGB 4OAWB 3QXAB 5BO1L 1X5LA 5BMFH 3IXTA 2QSQA 1E4XI 2D7OA 1R3LB 4E41E 2ZF8A 3ZXAC 3VRJA 2MFNA 1DVXA 4JM4L 2GQHA 4P07A 4JG0L 1OAXH 4KO7A 4U1LA 3L5WA 1WIOA 1I1AD 2DYPB 3I3EA 5DJAA 3SJVE 5HPOA 1RZPA 1PS3A 4Y2DD 4BZ2L 1IC5L 5ESAB 3KPOB 4GS7B 3T6XA 5CEZE 2E7BA 4MGXA 2WUCH 1I8LA 1IAOA 2IBZY 3H85A 5EN2B 5TDOB 3DK2A 3T4YB 5CWSA 5IFJB 2BNRB 2CBQA 4OF5A 1BQLL 4J7RA 2VLMD 4G8IB 3HHSA 4FABL 1IM3B 3EOTH 4RMUA 4XMPL 3WGUB 3V4UL 1QEWA 3ULVD 5CP3A 4EI0A 4OD1H 5DSCA 1JRHH 3BX7C 1EDYA 4NNXB 1Z32X 3NRQA 4XBEL 3W11C 4LLUB 2R4RL 4YZFE 1KCVL 1JXKA 2GT9A 1MFEH 2Q6WA 5B3JF 2ENYA 3WE6B 4GKSB 3OQRA 1D6EA 5K5YA 5AL0A 2Z92B 3B9AA 1A6UH 4AGOA 4JY4B 2NY2B 1S5HB 4JO1H 4U0RC 3MZTA 5DMGD 4EIZC 2YD9A 1QSEE 3CLEL 5E08L 3FFCD 3QULA 3RL1A 4MFHA 4TLUA 5KN5A 3FRUB 4NKOA 4MMZC 1B6UA 3MV9A 2YUVA 4GT0A 3NP4A 3B5GA 1WTGT 4NRYB 4HOZA 1GTNA 3WIHH 1TUPA 3O6LH 3PWUA 1SOQA 2B2XL 2AXGB 1NH6A 1RZJH 3BT0A 1YZZA 3T77B 1U8CA 1S7SA 2VQ1A 4J3WA 2GJZA 4YHLH 4IIQC 1FFRA 4FZEH 3D0LA 3FCUB 2VN4A 4Y1TA 1URZA 4HFUL 1JSYA 2YLHA 1X5IA 5KYYB 4F2EA 2OYKA 4UBDC 4PI0A 4UV4H 3QUYA 2XPGA 5E4EC 1IFHL 1LO2H 2XSKA 5JHDA 5FGCE 3DV6A 3OGOE 4M61B 2AV1A 2VAJA 2APSA 3DPBB 3I50L 2AJ3A 3E3QC 1UXSB 5ISZD 4HUUA 4D9LL 2W5PA 4DWHA 1CN4A 3VB9A 4JQXC 1VKXA 5DD3L 2FO8A 3KEDA 3GGWB 4PJCF 3FU0A 4OT1H 3VD7A 3PJNA 1LEIB 4OZHA 5MEOA 5AZEH 3WG7B 3EJZD 1W9XA 1ORSA 3P1VA 1K5NB 1W0VB 1UH4A 2KQNA 2VITA 4RMTA 2Y5TB 3MBWA 1KGJA 2EABA 3BE1L 3Q6FB 4B41A 2CLVB 2DQ6A 1L6XA 4XPAL 1SEBB 5FGBA 3QR2A 2R0KH 1A0QL 4RSYA 1GJUA 1KXVC 2HTKD 1P0SE 3MZGB 5FDYA 3FK3A 1N18A 1NCJA 4JFZL 3RY5A 4HWNA 2XIBA 2X9XA 4X4ZA 3RIAK 3D0VA 3GO1L 1KBVA 4M4RA 3BESR 4GJTB 4HS8L 1E2WA 3MOBL 4LHJB 3WFCL 4PJIE 3AQZA 4QOKA 4AEEA 4KOCA 2F1AA 1TZGL 4S10A 4D9RD 4EDWH 4GQ9L 5IQ7L 4PJEB 1X7QB 5K9QI 3GBMH 2R4RH 5C0IB 3IDIA 1TIUA 5TD4A 3RKDD 5C0NC 2XIDA 2ZWYA 2GPZA 1JYNA 3KZ8A 1DSFH 4DN4H 2PWHA 2HJLB 5EO9B 5DTFA 1S7RA 1T0PB 4AE0A 1YEKL 1SHXA 3SE6A 3Q9QA 5IR1B 4G9FA 3SKNB 1D5XA 3HMXL 5BZXA 1MG3C 1H19A 3UBGA 5ACZB 3CLEH 4YBHA 3WOVA 1F6AB 1LD9A 5F89A 2VDPB 5DMKB 5ABZA 1FUNA 4NHCL 4Z7OB 1MWAA 2DH2A 1IGIH 4NQQA 1LNUA 4RAHA 5K93A 2Z0BA 1MY5A 4XPBL 4TLSA 1IV8A 4HIPA 1BZQK 1RFDH 1XR8B 4JFEE 2WP3T 4OF8A 2E47A 3C5ZA 3KD4A 4MNHB 4BWTA 5E99L 5F44A 5IHLB 3N0AA 4XH2B 4KKBD 1C8QA 4LAJH 4FNPA 5I8CA 1LO2L 2PWFA 2F5AL 1CFVH 3VNZA 2CPUA 4E5XB 4ALAC 3QYCA 1BECA 1TF4A 4GSRA 4ODTL 4RGND 2X2YA 4XXDB 5ESQA 2CDEA 4JFPA 3TZVA 1NGWA 5J9PB 2YRBA 3HPLA 1G5GA 3DPDA 3FW6A 2XA8H 3I9AA 1NC4A 4JRWA 5EPMA 4LF3A 2F54A 2QQNL 1A9BA 3FAWA 3V52H 2MOQA 1FVEA 4YDNA 4PW9A 2WC7A 2YD0A 4J3BA 4WU7B 5D7JD 4HOXA 4B9KC 2BVPB 1YY9C 2FJFA 2V2WA 3D87B 5GSVA 2ADFL 2OXHB 4RMWA 4J3SA 3US9A 3QZMA 1XHHA 4GW4A 4M7LL 4PW3A 3HLAB 1I1CA 1L5GA 4D0BA 4HAFA 2ZD0A 4CAGA 2AGJH 2EDXA 32C2B 5DJ0B 4XVSH 5EF1A 3MGAA 2WM0A 4DOHB 3RFZA 4FCHA 2A4EA 3EG9A 3NK3A 1XH2A 3FSZA 2VXQL 4QTHA 3FAXA 2UVFA 2WLIA 1CGXA 1FIGL 4B7LA 3QQXA 4X5XA 4PJHE 2Z31B 2RCSH 3G6DL 3AQXA 3Q5TA 2IJ0C 4DP6X 1ID5I 3GLAA 2X4PA 4PBVC 1JGVL 4I3SH 5CM1A 4X0KB 3BQUC 1U8MB 4ZMQA 3B9KA 2COVD 5D4JA 3GJFK 1QSVA 3UG3A 2ROXA 5FF6B 4N0RA 4YDIL 2DIAA 4N0YL 4P46C 1ZXQA 4KKNA 2J8HA 4X7DC 5FUOL 4Y1AB 3FSOA 2Z8VC 5EOTB 1KELH 3FUHA 3P40A 1YYLL 2E7LA 3HUJE 5D72L 4FQXC 2WVTA 1Q0XL 4PJAA 1ITCA 4AYFB 2OZNA 4OFQA 5E8PA 2E8ZA 3C2AL 4FRWA 3LN4A 1AFVH 2IGFL 3VSTA 1KB9K 2J88L 2YXWA 1DJYA 4F7CB 5IJKC 3B2PA 4AQEA 4CJ1A 1S5IL 4OI8A 4UV4L 2G9HA 3U6XA 3ULVE 1EJFA 5KVMC 1KV7A 3EUUA 4OZIF 2ZP8A 2TRYA 4B60A 4KO9A 5SWZA 4KO5A 3RP1A 5J0BA 1YSOA 1U8NA 3K0WA 1XF4B 4JVUA 4X5LA 3FU5A 3F64A 3GSNB 4NO3A 5J13C 2W07B 3VFRA 2IAMB 4G9DB 4ZO6A 4NUMA 4ZXBA 2R83A 3JYBA 3BD4A 2DWTA 3X1FA 3FF7A 3HAEA 4NLAA 4YO0B 4JJOA 5LB1A 1AGBB 1JPGA 4Q89A 1BWWA 4F7TA 3NRFA 4GKNA 3MLSL 3RWGA 4ODVH 3ATAA 2RHEA 2WXRA 4K7PY 4KY2A 2VLJB 2CMRL 5EG6C 3ABZA 3NSYA 2K3HA 1EANA 3ZRCC 1AGCA 1KMGA 2DQHL 1YPZA 2WZAA 2KDGA 1J0IA 4MQ7A 1Q94B 3FQRA 1Z5LB 2MPVA 2HVJB 1MRDH 3CVHH 4BWWA 3OKOB 5CD5D 1PLCA 1F11B 5TE7H 4XCEB 2LAAA 2JCWA 2YZ8A 1PZ5B 2Y1YA 3GXFA 4JGJA 1OPOA 3VFGH 4MLIA 4XRCA 5GJSL 3QXDB 1EFXD 2AV7A 3CV5A 2JK5B 4DEPB 2X2IA 2RA1A 2A99A 2GK0B 1HL8A 1GL4B 5IJKA 2FT6A 5ESVA 1WAAE 1FJ1A 4UZSA 3VFWA 4XMWA 4A66A 4KJYA 3KGTA 4QHUB 4HS3A 4X50A 2OJEB 4KXZH 4AIEA 4MJID 4GAFB 3MLUH 1SN0A 4YDMA 1MFUA 4HWUA 1LK3L 4LZKA 4DP5X 3V6OE 1J1PH 2FD6L 1WLHA 1S8DA 2OJEA 3FFDB 3VG0L 2YAEA 1T5KA 4KJYB 4QHUA 5IBTH 1D6VH 3UAFA 5HDOA 4QYOA 4LLVA 3CH1B 2EIEA 1FORH 2VDOH 3GSUA 5B22A 5B3JE 1HINH 4WHYH 4ORGA 1WK0A 5JNYA 5KSAA 1VERA 4X4YB 5B7MA 3JT0A 5KTEH 2OW6A 2O6FA 4ZK8A 3ZE2B 2WGNB 1UM5H 4PJAF 4CU6A 1EO5A 2AITA 1UCBH 1XH3B 4I0PB 1HI6A 3OKOA 2CIKB 3ETBJ 4QUOA 4ABWA 1E6JL 2GJ6D 3BIBX 1PKQE 2HX9A 1N0LA 4B9ZA 1AD0A 4R2GC 4XR8C 1UWFA 1ZVSB 2FLMA 1ZLDA 3B9VA 4JN2B 7PAZA 3KXFD 4BXSV 4ZUUA 1TU2B 3GSOA 4IW4C 1X5ZA 2DJSA 5AB2A 5E1AB 2C8NA 1IU1A 2YRLA 4N0FB 3LPGA 3K2UL 4KXBA 4EJ1C 4GKNB 2XWXA 3SODB 4JFXB 1REIA 4Y4HA 2XVLA 4QRUB 4ISVB 5I15L 2M1KA 2YXVA 3V8CA 2EUZA 3QZWB 5IKCA 2COQA 1J12A 1XO8A 2IAMA 2VZVA 3BZ4B 4W9GC 2O5NA 2DQFB 5EC1A 3KYNA 1GR7A 1UWXH 4KZCA 4W81A 2BIPA 2E27L 3S2CA 4HT1H 1P9MA 4MSWA 2XXMB 3OKEA 4OZFH 4XNMA 3JWNH 1F90L 1HVXA 5AW4B 1OWWA 1SDDB 3D48R 3QUZB 4PJFE 1XQ4A 3HE7B 4ICXA 2X4UB 5J6SA 2G9HB 5A1AA 1WF5A 1FN4A 2G5BB 3I9GL 3FULA 4LVOB 3WNPA 4ZNEA 1E42A 4JFFA 4PJCE 4R4FH 4KMTH 4GNKB 1L9RA 4OGQC 5GS0H 1FF5A 4QAWA 4YSOA 1BJMA 3ZQXA 3ASOB 1ZGLA 3AC0A 4WO4B 4LAQL 3ILQC 1SM3L 4PJAB 1ZHKB 2Q87A 1DJGA 2DF3A 3VE0A 2QQKH 1L0QA 5EOTA 2OULB 4LSSH 4H1LA 4H25B 3LIZH 4AL8C 3V4VH 2HT2D 4XOBA 3GB7A 3P77A 4ZAKA 5FF6A 4N1EA 1TPXB 1YEIL 1TJHL 3SKMA 1HEJC 2I07A 4BFIA 3BGFB 3MJ9A 5F9OH 4N8CL 1M6OA 2GW5A 5FV2A 2X4PB 3ZVVA 3IJHB 4KFMA 5CJBA 5B1JA 1IGTB 5HHXH 4HEPA 4PFEA 2B1AL 1UATA 3RVUC 3GBDA 3I9IA 1U4EA 3ZE2E 1O7DE 3HRZC 2UVEA 2EH7L 5ID0B 5KG9A 3AT0A 2YUWA 2HT3C 3EG9B 1OP5K 1UWYA 1FO0H 3CFBA 1S3RA 3X12A 1LWHA 4E2OA 5DRZA 1F13A 3AXLA 3HLAA 3HBGA 3LH2L 3P3TA 1RL1A 1SXCA 3ZW3A 2FTAA 4QEGA 4UT6A 2KQMA 2OXHA 2ENJA 1ZLEA 1CDUA 1UXWB 4XAKD 3LZLA 1SXAA 2BFVL 5EOCH 3QHZL 2I27N 4C59B 4PUBL 3REVA 1SN5A 2DQCH 3ZL4H 4HEMA 1QASA 2PCPB 4TLKA 1ZE3H 3U1QA 3GMOB 2WQRA 2ZKHL 3HPLB 4BINA 5ESQB 5J9PA 1PG7X 1RPKA 2NY5L 1DLFH 1U30A 3KJ6H 4GIOA 3S8FB 2CG9X 4WW2B 4JCLA 1KY6A 5T1LD 35C8L 1A7NL 2CBMA 3AADB 1CLYH 5JW3H 5I15H 1VB9A 1IGCL 2GY7B 5D55A 2DAVA 1W8NA 4PJBE 4WWID 4L8CA 3VI3B 5BV7B 5C8JA 1A6WH 1XR8A 1KTLA 2XN2A 1E4KA 3V7MA 1C9SA 3GEFA 3N42F 3N44F 5J89A 4DERA 4NQDE 3BXNB 5C3TA 3IDGB 5DMYA 1R5WB 4JR9H 3SYOA 5HHPA 3RPIB 4RDQG 4Z78B 1CYXA 4ZOEA 3STZA 1MWAB 5KSBE 4DETA 1OW0C 3GFUA 4QAMB 5C0CB 1QATA 5DMKA 5GRVL 5DMIH 1V5JA 5BUAA 4AMWA 2VR5A 3U4EB 5K59E 4NN5B 2ETWA 5ACZA 1FGNH 3V4PA 3LEYL 4D3CL 3ZHNA 5IQ9B 4X4XA 4CADB 4G9FB 3SKNA 3UTTE 4LARL 1R3IL 4KUCD 5IR1A 4V11A 3VD1A 1YAZA 3CFEB 5SV3A 3QNZB 2HJLA 3QDMA 1BFTA 1EFXA 1OSZB 1TITA 1W15A 2C5DC 3O0RL 4PY8J 2VR3A 5C0IA 5L6YL 1BM3L 5DRWA 1LO5B 3N5AA 1N59A 3AS3A 1J86A 4PLKC 3WJJC 3FB6A 3G6JF 3VA6A 3FRPG 1WUNT 2W0FB 2PCYA 2QV2A 5AOZA 2W91A 4HZLA 4XHJC 1HILA 4LLMA 2P5EA 4JFYA 3A4FA 2BSSB 1Y1UA 4HH9A 4H8VA 5IZ7A 1XAUA 5C0AD 3MOAH 4PV8B 3US1A 1FO0L 1G0XA 4DKFL 4Y7OC 3W5MA 3MPCA 3IGAB 4YNYA 3BKCH 1LK2A 3RWFB 4MXWH 1HE7A 2VITB 4MAYD 4F7KA 4P2CG 3O3EA 1Q9WA 4OVVA 1RJZA 5L8KB 5MEOB 3ZDYF 4KKCD 1T89A 4LSTL 4JDVB 4YSCA 1GS7A 3WUWA 3MRMB 3JWNG 9PCYA 2E6QA 4BRJA 5JMOC 4HUUB 5JPNA 1LP9E 3Q8FA 2AJ3B 2AVFA 5F2FA 5IK3A 1BX2A 5D7HA 4HT1L 2X42A 3DPBA 4JHWH 2X87A 4HH8A 5HD8D 4ZMOA 3EFFA 35C8H 4LVHB 4OZGA 5JPNB 3IFLL 3MV8E 1OCZB 3POCA 4KROD 4LB8A 4FNQA 3ULVL 3ZN6A 4KMTL 1MWOA 4RX4A 4KVCL 4HUVA 3NIGF 3QIUD 1CGVA 3LNHA 4R8WH 3VXRD 1GZPA 4TOYH 5ISZB 3M17A 3QT2A 4XNUL 3RJQB 1VF5C 3AM8C 4WTWA 1U8CB 2IOOA 1RJZB 2FX8L 1ACYL 1Q9WB 1NWOA 3O3EB 1XBRA 2AXGA 4QXUL 3K7UA 4M7KH 2XZAL 4LEBA 2MCAA 2BNRE 2EZ0D 4JS7A 1LK2B 1AGFA 3RWFA 2WBJC 3L1EA 2MCPH 3VI4E 1BFVH 3IGAA 3FRUA 4FULA 2MEJB 3UACA 5AVQB 4U1HA 1O5PA 5E24E 5D7LE 2P5EB 4JFYB 4HZLB 2QVKA 1JZ7A 2LGNA 3CTTA 1D6EB 1F00I 1SHWA 3P54A 4Q6IB 4BFRA 4G71B 3ARDD 3L6FA 3ATEA 1MI5D 2N0MA 1B9ZA 1AIFB 1FZJA 2EDKA 2GSMB 4OGXH 5D71H 5ICXB 1HXMA 4JO3H 4RSVA 1BYOA 2WQWA 4FZ8H 4I8DA 4TUJB 4KTDH 1GGCL 1DBKL 1SLXA 4OKDA 4LXFA 4FQ1H 1IM3A 4JUTA 4CSZA 1RZKL 1PX4A 1IUZA 4OFVA 1BZ7A 1AZRA 1OSZA 2WYZA 3QFJB 5AZ2L 2BNRA 4YVNA 4JRFA 5T3XL 3QNZA 2H3XC 4K71B 2A6DA 4M48L 5EN2A 1MW1A 4MQTB 3HNSH 3D4YA 4X4XB 5DT1L 4JDTL 3LZQA 3KPOA 3FSAA 5ESAA 4CU7A 3J8F7 1NL0H 4ADGA 1S4IA 3IRZA 4MHHG 4R4NC 4DKFH 2CLRB 1ZLVK 1ZXKA 1IGML 2ICEC 3OXRA 5D4IA 4KX7A 4ZZKA 2H2PC 4UINH 2AJYL 1U0QA 1TQBB 2L7UA 2BM3A 2CKBB 3CFCH 3IKCB 3KJ6L 4YDVA 2JJSC 3PLYA 5HHPB 1CK0L 3IXTB 2DS4A 1ET8A 2E7MA 3IDGA 3WIFA 3RGHA 4XNXL 3IMBA 4GXUN 4XO5A 3IM1A 2UXGA 4TVPD 1PF3A 2BSDA 2KLSA 2QLYA 4PCYA 3S36L 3NIFE 5C8JB 1JPST 1QA9A 1TJXA 3PWPB 4JBSA 1NCIA 3GMQB 2QKIC 3J2PA 4M6OL 1OTSD 2IXQB 4WI8A 5CLWA 1S7VB 1S7XA 4XNYL 1RZIB 1NCGA 2HG5A 3WNJA 3WD5L 1NCAL 4U3SA 1BQSA 1G5AA 1DVYA 1KTDA 5LAPA 1VGEL 1KTCA 3IFLH 3UGUA 2K70A 3SQRA 3WFHB 2W60A 4XCFH 3ARZA 3UTPD 1QRKA 2G9KA 1JF1A 4S1RL 2Y2WA 2NY3D 2WBJB 3TBYA 1J0JA 3GIZH 2V5TA 3GBNH 4BK4A 2FSEA 3C5SA 4WO4C 1AACA 3CFNA 1KJ2B 4H8WC 4UT7L 3HRPA 5C70A 1GJWA 1HN1A 5F3BB 5I6LA 4HK3J 4HHWA 4TQEL 4Q0XL 5D2NA 4AJYV 1M2VA 3WXWH 5DRZB 3IU4L 2X4RB 5DS1A 3C75A 1M9WA 3CFBB 4XP4L 2GSIB 2PPAA 2VDRL 3UJTL 1KCLA 3LKQA 1CLOL 2ICWB 4Z7UB 1MQ8A 2I60L 1YJDL 3L9BA 3D2TA 5IEKA 4H7VA 2E4FA 2H0FA 3QDME 1FFNA 4M5SA 2PXYD 1RP9A 3PJSB 3QUGA 2XV0A 1JGIA 1O6TA 1ZT4B 5CBEB 5M94B 4TYUA 1DO6A 4R0LB 4Z7WF 3WLWD 1M6OB 1OAYL 5FO7A 5JIPA 2DM7A 2I07B 2VZ3A 3WNKA 4D9QD 3BSZH 4NXKA 5EF2A 3LKRA 3TPUB 2H6PA 3MREB 3BP4B 3VRIA 4Z76B 2YFOA 2QKIA 4ZAKB 1J8HE 3P77B 1XB3A 3D09A 2P24B 2VLLB 3KYMA 3QJXA 3EFOB 3SJVD 2AQPA 4NZFA 5T1MA 1DP0A 3UTSB 1ADQA 3DYMA 3U0TB 3RZCA 2XKUA 2VDRB 1NPUA 3VE0B 4G7VL 2IANE 3MJ9H 3MU3A 5HJ3B 4LRIC 1ZGLB 2CGRL 4X7FC 3D85D 3OJVC 5F1KC 3SDCA 2D4DA 4JFFB 8FABB 4FNLL 1FN4B 2G5BA 4PG9A 4F2ME 3LS4L 1EAQA 2ZUUA 3HE7A 1H3UA 5DK3A 1IJ9A 4RX4D 2O93L 3O2WL 1UKTA 2XN0A 1TVHB 3F05A 3Q06A 4R7VA 2XKNA 4FG4A 3ZTDC 1FAIH 4S2SA 4NCC2 1EGJL 5HHQB 3A47A 2DQFA 2PYEB 3IYLW 5A2FA 1CDGA 1TZIA 2ZUQC 1MZYA 2J8UB 4H2CA 4D0CB 3QZWA 3MX0A 5F7YC 1GGUA 3PCYA 5DFTA 4QRUA 4GAYB 4JFXA 3DWTA 4ZS7L 4O4YL 3HRZB 2YAOA 5SX4I 5DFVD 3PDOB 3UBXA 4PCTA 5C08B 3BC9A 1QSFE 4JN1L 5JPMB 1T04B 2OTWA 1IAIH 2V2TA 5HGBA 3RX5A 4ZUUB 3ARDA 5K33A 1AS6A 1Q72H 1RMFL 2UZYA 4QF1B 5CNHA 1DBML 1AD0B 2WUCL 3EHBD 4RA3A 2ZXBA 1QKZL 4WHTB 4X7SL 5E9DD 3SDDC 4DEPC 4JKWA 5EA0H 4F80A 5G4OA 1XH3A 5TK4A 3HN5A 1BFOB 3BUYB 1WWBX 1LO4H 3SE4C 1T7WA 4LT7A 3QEQA 3BCFA 3WIHL 4ZW8A 2MOGA 3EOTL 4ORGB 1IIIA 2KYIA 2NSMA 3C08H 1TEFA 5FX3A 4MJIB 2DEXX 1NDGA 1WFUA 3O6KH 3CH1A 5I75B 4LLVB 2DLFL 1EDQA 3NSDA 1BM7A 2O5YH 2C3XA 4WFGD 5C07E 1OZTG 2GBAA 4YBQD 1J8HB 4OR1A 2YFNA 1VFBA 4WTZA 2AKRB 1IFHH 1RUQL 2BHZA 2PUQT 4YPGA 2J8UF 4OZFB 3IS0X 2I9LB 4L9LA 3PWPD 2IPTH 2BY3A 1NIAA 1GTFA 1ID2A 4F92B 1K2DB 2EECA 1W72B 4JFFE 5EEZA 5DMJB 3MV7B 5IMMA 4P4KC 1WBYB 4PJDA 4P5TA 3CU1A 1T2QL 3EDKA 5CP3H 1PZCA 2JMRA 5A6MA 4MZ3A 4U7KA 3FTXA 2ITFA 4ODWA 2NR6A 1EDHA 1NFAA 5GISH 4WNJA 1YNKL 3ZO0A 1KFAL 1N3NB 3S88H 1XWVA 1KGYE 1MHPH 4A2GA 5LXVA 4LPYA 4XCEA 1R3HA 1HYSC 3II1A 3RI5K 1OGAD 3KLDA 4F5CA 4FQ2H 3ZKND 2HX8A 3QUMB 2HVJA 1XGQA 2P45B 1BDYA 3PF2A 1XGUA 3FQRB 2DKUA 1B9KA 1MHCA 1GRWA 4OH2A 2J43A 4H1LG 4OCLC 3A0OA 1T0MA 4WDIB 2JKJA 1CTMA 3MNWA 3IPBA 5MERB 2JQZA 4Z3FA 1F4AA 3BEVA 4XCFL 1DANU 1T03H 1G9NH 2LE9A 4F7TB 4L3EB 2Z93B 1AGBA 3GXDA 2GIMA 3ZYIA 4J4PD 5EUOA 4F8OA 1KPRA 5KANG 2VAAA 1NINA 1QFWH 1WTLA 2BSBA 4ZXBB 2J7LA 3KDMA 4UV7H 5F7BA 3VFRB 1JTTA 5FECB 3AT8A 5D5MB 4EF3A 1PIGA 1CIUA 2KLTA 3OAUL 2Y7MA 1SGKA 2F18A 2NW2B 1DHKA 2OX5A 1EHKB 5TGBB 5GRUH 3QUZC 5T1LB 1LTXA 4U1MA 3ULUD 2NY0D 1TYJA 4FQCL 4AYFA 4G3YH 2H8PB 3WCYA 4F9LA 4P06A 2NR6C 3AUWB 4CC0A 4Z95H 1RZ7H 1S9XA 4LSRL 4Y1AA 5I1JL 3KR3H 1PX8A 3RGBA 1U33A 1T66D 3NZHH 5HPMB 1DLHA 2YC1A 2N01B 4AQ8C 3UDWA 1ZA3A 3QDJB 3B9KB 1U8MA 4U2ZA 2VIRB 4X0KA 1E9OA 2DTMH 2AFNA 2AQQA 2Z3FA 2PYFB 5DUPL 1U91A 2EEFA 3DUUB 1HKLH 5DC2A 4Z7IA 5C0RL 1EO8L 1TVDA 3MCLL 3ESPA 4RAUB 4BYHA 3MR9A 1RUPH 4X5XB 4YOKA 4HKZB 5AG9A 4DK6A 3RIKA 4JL1A 3BYYA 2X3AA 1J5DA 1JZIA 1RERA 1XCWA 2VR4A 4F57L 3WEAA 4GLRI 4EZMA 2C7UA 2XA8L 1AD9B 3RFZB 4TLTA 1CE6B 2D7TH 1YPZE 4D0BB 4FYSA 2P8MA 1H5BA 1TJMA 5DA4A 4PWGA 3TWCL 3U6RB 3H7BA 5I1AB 3WO3B 2Y7SA 2IG2L 3GO1H 4G1MB 2QR0B 1LILA 3SDYH 1QNZH 1QSFD 4QLWA 1FP5A 4WKXA 4M02A 1A9BB 1TR7A 2F54B 1CJYA 3QUHA 5EPMB 2BVOA 1MUJB 1V55B 3ARBB 3GXNA 3K5SA 4MA8L 1NANI 1NGWB 1O9VA 2VXQH 4JFPB 2HT4C 4MA7H 4K3JH 4JNXA 1T1WB 1TCMA 4YXLL 5GS2H 4C83A 3QWQB 4HZAA 2B9BA 3CVHA 3FCSA 5I8CB 1MCLA 3KLHC 1AQDA 2XRAL 2O5ZH 3CXDH 5KANI 4FF9A 1MXGA 4M6MH 2FT8A 3PUUA 5DHXB 4GSXA 4YL4A 4D8OA 4ZPTB 4H40A 3D39E 2O26U 5FYJH 3LNEA 1AZNA 2A6KB 4J27A 1DFXA 1Y0LB 3KVPA 3SDAC 3BVWA 3BDXA 2AQ1A 3DMMB 2Z1PA 3ZT7A 3MBXL 1HIMH 1XR9A 3CIQA 5FCUH 4G59C 3RE0A 3ARVA 4L37A 4AH2B 1KG0B 1I4FA 3DVFA 5F89B 3KPLB 4AK1A 1A7PH 3FU9A 3FB5A 1I8UA 3QGVA 1D5XB 1XMWA 3SPVA 1ILSA 1ETB1 4L3FA 3S34L 5AG8A 1MAJA 1A7RH 4QRPD 4RETB 2YD5A 5IHWA 3H2WA 1S7RB 3FRPB 4YN3A 3ELQA 4XPTL 1F3DH 4C4UA 4K5PA 1NAKL 1CF8L 2FQGA 3ARPA 4FFVD 1JF5A 1OGAA 2WMPB 4LCYB 2R2EB 2GI7A 2FNWA 5DEGA 3LQMA 4JLRB 4ORZC 3NTCH 3HMWL 4X99B 5FKPB 2H9GB 4IBLT 3H6AA 2E0PA 4ZMTA 5D1XC 1MHPL 3V6ZB 3L3OA 1SYVA 1B4LA 2V7HA 4ANXA 5A2CA 3AWGA 1B0GA 4OLVH 3BEWB 5I6NA 2L3BA 4KVNH 5CGBA 2VWEC 5IQNA 3OKDB 5KYUB 2GC4C 4ZTPH 2CLVA 3LVEA 3Q01A 4FQPA 3RWEB 3BAYA 3BSZA 5DC9B 2Y5TA 5D1QC 2NY1B 3EO9H 2C4FU 3MCG1 4H20L 2OCCB 4LOVA 5G2NA 3SPIA 3BN9D 2BP8A 4DVBA 2ITCA 5F72S 2ZCKL 2VW4A 4L1HA 2QKSA 5EU7C 3BAWA 4DP9X 4Z7WE 3MNDA 5GZND 3GGWA 4A37A 4QRRD 1Q9LB 3Q6GH 4NGHL 4KUZL 1UZ6E 5LGJB 1UKSA 4YDIH 2VZTA 2PCFA 1T20A 4LU5H 4K0OA 4XNQB 2FK9A 2RALA 1UXSA 5DZOA 1OOWA 3OAUH 2RMNA 2ZKWA 4I0PC 2ESVE 4M61A 3TONA 4N6RA 4C4KO 4DEUA 5DZAA 2X12A 3M8OH 4HUCA 4K73A 4P3CL 4ZQKA 4F37K 3C2AH 5KSBB 5BXFA 5I9QB 4RLDA 4PB9L 5GGQH 4PGEA 2PNDA 3W56A 5KYYA 4LCUA 1H6FA 3VFPA 4L9DA 1INEL 1NIEA 4AV4A 1D5IH 5GJSH 2WIIA 2YD1A 3T65A 3LDBB 5C71A 2HA1A 4H1LH 5JDJA 3V0AC 4PB0L 3T77A 3DK0A 1A21A 1MY7A 2EDLA 2WKOF 3PWUB 5JQ6L 3QIUB 2PW2B 3HN8A 3E8VA 3MYZA 1PLGH 1MFAL 3JWDL 5H37G 3S35H 4B53A 3NJJA 4M1GL 4EZJA 4LIQE 3VFSA 4C57C 2YMTA 3QULB 4J2QA 2ZWLT 3CXHJ 4DP2X 4Y5YA 1GMEA 3S35X 3EBIA 3GMRB 1B4JL 1SHMA 2V3DA 1QZ1A 1QFUL 2WSKA 4ODSH 4JY4A 4D8PA 1YEEL 3MRCA 5D1QA 2Z92A 2Z91A 3MLWH 2BWQA 3D05A 3I2CL 3LQAC 5K9JL 4K3GA 2ADYA 2WQXA 3OTTA 2Q6WB 4P2OC 2GT9B 1U8QB 2J3SA 4TSCL 1CFBA 1NA8A 2DQIH 3G3LA 5HHME 3K2UH 1P5VA 4QKTA 3W5NA 1J9CT 5DO8A 4Q14A 4WCYL 1NUFA 4AZ8A 1E67A 4JCWA 2D7PA 4U2YA 5D1ZI 1QEWB 1U36A 3WNMA 2BXYA 4UIMA 5H35A 2BSRB 4KK9D 3D3VE 4G8IA 4DK3A 2AK1H 2XBTA 2Q8AL 1UM4L 2FUQA 2YSTA 5KTEL 5KSBF 2WJ7A 4HK0A 2W81C 5CWSB 2BOLA 4I1NB 2AABH 4OZHE 1WEJL 2YA0A 4M5ZH 3GMNA 4JKLA 4F9LC 2HFGH 5I8KL 4ELME 2XTJD 5GS0C 1P7QA 3V55A 1MAMH 5KYWB 5DJAB 2DYPA 3L17A 1A1OB 1CGSL 3ARGB 3GLEA 1E28B 3D50A 1JOIA 1ZLVH 3VRJB 4NPJA 2VLME 2W95A 1BQHB 3CMOL 3IWUA 2EDHA 3C5JA 4P57A 1LK3H 3ZZ1A 3U0WH 3DVGA 2YGNA 1CE1L 3MA9H 4LLAA 4BGLA 1RUML 3WFDH 4GMSL 4WEMB 3Q6GL 3WNOA 3T6QC 2YN5A 5JZ7C 2ADIA 4WWPA 3UMNA 3IF1B 3WAKA 2W88A 5FGCB 3O3UN 3MNZB 2BOBB 5L2JA 3SQBA 4RZCB 1AHWB 1CYWA 3N85H 2VDPH 3N9GL 4H0LC 2NY3B 3DIDA 1OLZA 3T6VA 1XTLA 2WQAA 4Y5XC 1JZ4A 3FQXA 1FYTD 1SYSB 5I0WA 3D39D 2YPVA 5B1BB 4XXWA 1E5ZA 2FHCA 1FHGA 4JVWA 4WFEE 5F9AC 2FBRA 1F02I 5ERWB 3PAZA 2C1PA 2K7PA 1YJDC 2E5EA 5IBUB 3T0ED 3MGTB 4P23C 4P9ML 2ZUQB 4L8DA 4QOKD 5DHVH 4K15A 4APXA 1KGCE 1JWMA 3O4LD 4LL4A 2QELA 3QG6B 4L4TB 4NO2B 5AALA 3DSFH 3L3GA 4O51B 2NY6B 3A67L 3MRGB 1YMMD 4QRAA 5HYJD 2YR3A 4EI5B 4A39A 3UZQA 3B2XA 5B8CB 5E08H 1XCQA 2Y5QA 4NX0A 1J05A 4HEPG 2X0UA 4ODSL 3MLZL 3D3VB 4NWTL 4MMYA 2B1AH 4ZDHA 3BIAX 3K6NA 4E9YA 4NM4L 4WSGA 1KIUA 3EJYC 2IEPA 1T1YA 4Q4EA 2DLHA 2YGOA 1SFDA 2FE0A 1A6AB 1BQKA 4OJYA 4XVTH 2A83A 3KPMA 4YE4L 3LD8B 4FZEL 2VLKB 4POZC 1P4IL 1KLFA 4KKQA 4JW3A 3U7AA 3U7YL 3V4VA 1YEFL 3EO9L 1IX2A 5F7LB 1X5YA 2IWKA 5D1XB 3P0YL 3PWJB 1VACB 5LHDA 3LV3A 1Q9KA 3D85A 1QFWM 4N2MA 2CHNA 4DAGL 5C86A 5BRZE 3EGSA 3V0WL 3FB8B 1OAXL 4NYLB 1NEUA 2EXYD 4PWKA 2XIIA 5F88B 1IC5H 4YHIA 4WTXA 1SLWA 4A04A 3QFDB 4Z7UE 5I8OH 5IHZB 2B4CH 1MG2C 1FGNL 2XACC 2JIXB 1R5IB 5BJTB 3UOAB 2VTFA 5AZEL 1A02N 5KWYC 4MYPA 4NUGL 5KVDH 3QIWC 2X38A 4XBGA 5HHXL 1CE1H 2J5LB 3FTSA 2CLZB 3B9KC 2B9AA 3F7PC 4XMPH 5F1IA 2DJUA 5C0BA 3DX7A 5T33H 5I23A 5AW3B 4BE5A 3L3OC 4X5QA 1NMAH 2VXVL 4WFFD 5HYIA 1MCQA 1FE8H 4Q9BA 3P2DA 2VSDA 3EO0A 3TV8A 3IB4A 4R26H 3B2DC 5CSGA 3U36A 1G7IA 1A65A 4HOWA 5IG7A 1Q38A 3FU7A 3BP5B 3ZHKA 5HGDA 3ZK0A 1NC2B 2J6EH 1N2RA 1A4JA 5DMIL 4IRJA 3UJJL 5IEHA 4BFJA 2R23B 2UXTA 4FQIL 4J3XA 1WHPA 3N6YA 3QI9A 4DN3L 1VADB 1G7HA 1FCGA 4QHMA 2OK0H 2VDKH 3P2TA 4NZJA 3GSXB 2NYYD 2A7BA 3MLWL 4A7QA 4GFTB 3AREC 5FHBH 3IAPA 4MXWL 4X6EB 4JPKL 5D8JL 1EHAA 4PRAB 4ZXBD 1JE6A 2Y7NA 4MTMA 4UILH 5JPNC 2F74B 1HXKA 5I0VA 5JHLA 2ZX6A 3P3SA 3KPSB 3CXFA 4HPOH 2D0HA 3ZL2A 1FNGA 1CFQA 3VXOB 4RNRA 4PS4H 2AK1L 3D4GA 4HC1L 4LHUD 5BOZG 4BZ1L 5DR5H 3PGFL 1E5CA 4G6KL 3UTSE 1S7WA 3BH8B 1H3GA 3E1F1 4J28A 2VDNH 4IDJL 3IVKA 2AI0H 4YDLB 3Q2LA 4GI9A 4OGAD 4MNQB 2R0WL 3WEMA 2D7QA 4BK5A 5I2IA 2NNFA 2ZQKA 2N1TE 4ZODA 1GYWA 5CEZL 4YQXL 2WCGA 4V1DA 3KS0H 2F7OA 1EEZA 5I6PA 4DKTA 4GMTL 4KVCH 3S4SB 1IZKA 3L16A 3HUJB 1DEEB 2JWYA 4GRWB 2FZ3B 3M46A 1R24B 3RVXC 3TH3T 2OMUA 4DAGH 4OCRL 5PAZA 1NBZB 4MS8D 1CTOA 1PL3A 4M43L 4GXVL 2Q0ZX 3AXIA 2XXFA 1FSKB 1FNEA 4HWBL 2VR8A 1I85C 4WEBL 2ODIA 1EPFA 1W91A 4ELKA 3BAJA 1PFOA 1HHKA 2R29L 4AJWA 3PAVA 4JANA 1L9NA 4HAKA 4O2EA 4BSWA 5T3ZH 1E8ZA 1FZOB 1I9JH 4HBCH 1XGYL 1MCCA 4HS8H 4AC4A 1OAZH 2EKJA 4DT2A 2G75B 3KL0A 1BQRA 3O41B 1IM9B 4AGQA 4JZOB 1FZMA 3OGCA 3U0PB 25C8L 5IY5B 5F8QC 3UPRA 1ETZA 1ZWIB 1Y6NR 3NCWA 1FNHA 3RL2B 4LCCC 4YHKL 5IJCC 3LKNA 4LPXA 5AZ2H 3IJSB 3C6LC 3I74A 4NKDB 3KPPA 1WVZA 3OF6D 3ULVC 4NNYB 4M8QB 1BVOA 3QG7L 1IAII 5D9SA 4O2FB 2ZWSA 4LK4A 1I8KA 2AVGA 3ZUCA 1QACA 3PFUA 4TL5A 1FSKC 2PPCA 1UZ6F 4FJYA 5LAXA 5E2VL 2AJYH 5F1OB 3SN6N 4FA6A 3C5XA 4A68A 4JHWL 2FX9H 4PJDE 4X6FB 3UIYA 5ICZA 2VDMH 3UTZA 2AK4D 4CRPA 3BIKA 4WJKB 5E2UH 4Y8DC 4MHHI 5J12B 3GM0A 3R4DA 1QFOA 2HMID 1MCRA 1A7OH 5SWQA 3HZ3A 1MREL 4DQOL 2HAZA 4DZBA 3OD3A 5IUSA 5DZJA 3SCMC 2I9TB 2F5AH 2WNKA 1MRCL 2IOMA 4WO0A 1DDHB 3OAYK 3PQYD 3T04D 4PRDA 4DPBX 2EYTB 1YECL 4I48B 4Q7DA 1HTYA 4EVNB 2R2HB 4I2XE 1TLKA 3BN3B 4ONHA 3IFPB 4XP1H 4ZO7A 1FVCB 4RQQB 5I8OL 4UAHA 2BNRD 1CK0H 1YEJH 1ZJAA 3D2UD 2FWLB 4BFNA 3W39B 1UYWH 2FLBT 2WTRA 3W9DA 4OJFH 2IF7A 5IB5A 2X2HA 4U3CA 4C55A 1QSFA 3NJIA 5FCSH 5EU7E 1N7ML 4EUPA 2J1KA 1N6QH 3PRZA 5E4AA 3L95A 1CFTB 5BUGA 3K71B 4HUNB 4NRZB 5EF3A 2XWCA 1F4WH 4WUUB 2A2QT 3TEUA 3T0EA 3BRFA 5LCVA 5IOKA 2X5PA 3IGFA 4LPWA 3BFQG 3QJRB 4LCVA 3ILEA 4EDXA 4ZNCD 4HBCL 3Q2VA 2ZNXA 5GZOA 4M3JA 1AGEB 1JZJA 2WXLA 5J57B 2R69A 4TNVK 2OYLA 1IE5A 3F12A 2XWTA 3STBA 3T3MF 4J39A 1G4MA 3JWNE 2X9WA 1KWKA 1UXLA 2Q20A 4LHUB 2HN7B 1K85A 3BZFB 4IGBA 2X4SB 4S0SD 4UQ3A 5FEBA 2ZG1A 4C56A 1EXGA 4ZX6A 2IV8A 1J9RA 3H1ZA 1CDCA 1JHTB 5B39B 4M8VA 1CXHA 4N2IA 4YFLI 2NXZD 2OXGA 3E6FA 4QT5B 4Y2DB 1CFSB 4XNXH 2O5XL 5FKAB 4L3CA 1INQB 4RGOL 4AEIL 4M3KB 3QRBA 5B38G 1RLBA 3G9AB 4HC1H 5BZWA 5HYSB 5F9WC 2XZQH 4UT6H 1F18A 2YMXL 4Z3HA 1O9WA 2IANA 3S7GA 1VFUA 4ZAKD 5GS1A 4QWWC 2YWZA 4DP4X 4IKNA 1HINL 4BA0A 1X6NA 1CIDA 3ROLB 4ZMLA 3RHWK 2GAZA 2YPKA 3QNYB 4HCRL 4WTQA 4WNSA 3PV6B 4R4ND 2WLLB 3X13A 3GMMB 2Q7NA 4XTRC 3C87A 3P0VH 4J3UA 2Z8RA 4PP2A 3WTWA 3MRRB 1I1YA 1BVZA 5TPWH 1M3IA 3FO2A 1CD9B 3CQPA 3SBWA 1DZ0A 3PGCA 3U2SB 2CK0L 1U95B 1PG7L 1BP3B 1XSJA 1DSYA 4JFQB 1EMTH 5INDB 3ECWA 3R8QA 3L1OH 3SKOB 1I53A 3OZ9L 4ODUB 5DJYB 2OZ4A 5A16B 3L3IA 3MROA 3U9UB 3PAUA 1LE5B 4ZS6C 3PL6B 2GJJA 2WWNA 1OTSC 1D7FA 3ZR6A 4XP1L 2R0KL 1TQCC 1I7RB 1NGQH 4Y5XB 3TF7C 3OM3B 1HHHA 5KW9L 1K4CB 1AP2B 1R34A 1XCTA 4XPFL 2PPEA 2Q5BA 3ZIYA 4G8GE 2BFGA 4RFOH 3CZFA 1MH5B 1I9JL 4OJFL 4RBPH 4U05A 4YGAB 3VFGL 1OARL 2LU5A 3N43F 1WFTA 2V7NA 1KPUA 3PPSA 3UBXG 2OSLB 2YIHA 5BRQA 4L8SA 4TKWA 2WVUA 1I8MA 3E8UH 2EO7A 3DRQB 4P4KB 4OZFG 3GBML 4WO4D 1PY9A 5ECGA 1VDGA 3BP6B 2R8SH 3AXHA 2NZ1A 2WCSA 3V0DA 2FEDC 3TO2B 4NKIH 4AXWB 2ENQA 3PWVA 1COBA 5BCAA 5CJQL 5FFLA 4LKCA 3RJOA 3P4NA 2OMXB 4XWGH 5IB3A 4LSSL 1UXMA 5C0AA 3JTSA 1PX3A 1X9UA 3DBSA 4MJJA 5D96B 1QUPA 1OCCB 4U1GB 3H55A 3VM7A 1JN6B 2A0LC 8PAZA 1U3HB 4MAYA 5E2VH 2BX5A 4OB5L 3R7QA 2EDBA 4WI0B 1YN7A 5JR1L 5B1AB 3QDMD 4H5SB 2Z35A 3NZ8B 1KBGH 5FGRA 2ZSVB 4KZEH 3HC3L 4OTXH 2GVYA 1ONQB 4IS6A 2XHNA 4JEGB 3ARYA 5AOMA 4A2MA 2NQDA 3EOAB 4X2UA 1BYPA 1EJOL 4S1SH 1FC1A 1T2JA 1A7OL 3ARGC 3WHXB 5JOEA 2YBRA 3F7VA 1ZV9A 4PSPA 4Z7WB 1P7HL 4P4RB 4AM0Q 5IM7B 1G7JA 4E0RB 5BZDA 3WLBA 1INDH 2Y7QB 4CC4A 4HPYH 4QRTA 1B90A 4YHYB 2XG4A 1I8LC 3HLKA 3MRPA 3TA3C 4U0QB 4IU3A 2WYTA 2Z6FA 2JTDA 4AT6B 4FKEA 5JUEL 4XP5H 1UD4A 5T5FA 5AWNH 5J13B 4NZTL 5GGSB 1JDAA 1Q72L 3MV8B 3ETBF 4MCZB 5ENWB 1WZAA 2VSMB 1KZQA 4LFHG 3LY6A 3NJNA 1R17A 3BO8B 3TT3L 2EVJA 3NOIA 1F6LL 2GTZB 3VI4A 1DL7H 2Y7LA 3FQTA 3QRGH 4K7FB 3HZVA 4AQ1B 1C5CL 1CB4A 4FQ2L 3IAQA 1IBDA 4YWGL 5DJ6B 4OY9A 5H2BA 4A7UA 3F01A 5DS2A 1O6SB 3AS0A 3IU3B 1A66A 2AJSL 2AQ3A 4XO3A 1KLUB 1QLRA 5BVJB 4QO1A 5HHOB 3AMKA 1HHIA 4YGVA 3IETB 4KXDA 1W0YT 1KC5L 4GRLB 1AQHA 1TCRB 1KN4L 2O1AA 3WO4C 1MJUH 3BRGC 3GIVA 3GKWH 5EZJA 3MJWA 4BQ8A 4YAQA 4O5LL 2R69H 4XMLH 4ZFOB 1QPKA 1DR9A 1NAMA 3RI5F 1RUQH 2ESVB 2QQKL 1CL7I 4D7PA 2L7EA 2IFFH 3GINA 3NQIA 4XN2A 5T8IA 5DWUH 4NQVA 4JHZA 2Y1VA 2E76C 4KKAD 3LKPA 5E6IC 3NJMA 1WSST 4YC2B 1Q90A 1AANA 1S78C 4OV5B 1CLZH 1HEZA 2EVFA 3MACL 3BPCA 5T3ZD 4ZFOA 2C4FT 5DI8B 3GTVA 2EYRB 3NGBB 5JIQA 5KVGL 3WMQA 2H41A 4GRLA 4YSSA 3IETA 4PG2A 4NS0A 5T5FL 2GFBB 4QO1B 5M7QA 1XD1A 6FABL 3IU3A 4NWUL 5DWPA 5DYOA 1CICC 4XC1L 2JJTC 1D5MB 2QVFB 1C5BL 3APNA 4PR5A 3CSFA 4AQ1A 3S37H 3FQTB 3WL9A 4UDTA 2GTZA 1EAJA 3H42H 3VM5A 5I1EH 1BVKB 3WMSA 4RFNB 4AE1A 2IG2H 3Q5YA 3FN3A 1JBJA 1ZEAL 3J27A 1OT2A 1WRFA 2DLGA 4Z7VF 5B38A 3UIZA 3WS3B 4WHCA 4DGVH 4IKLA 3L54A 4J3TA 3S3PA 3MNMA 4HJ0C 2P5WE 2B1OA 3BDYH 1R0AH 4ZSOE 4F91B 2CH8A 3IS1X 2GBUA 4R97B 3TNMB 3OZ9H 4OBSA 4LCWA 5HDQL 2Q10A 3H54A 5F1SA 1G9ML 4M3HA 2Z8WC 2Y7QA 1PYWB 2HB0A 1A4KA 1ND0B 2B3IA 3FF8A 5AYQA 4P4RA 5IM7A 4IJ3C 3RHWF 2VISA 2R9HC 3FYIB 3QARA 4WWKD 4NQCA 5I76A 4HX1A 4B50A 5BQ7A 4HJEA 1ZHBB 5DVLA 4BZ2A 1ONQA 4IS6B 1E40A 4Y4HD 4FG6D 2X53A 5EEYA 3NZ8A 4R3SA 1BW8A 2YN3A 1QR1A 3TGXA 4U1KA 4ENEC 2XWBB 3LEXA 4KKLD 4IGBC 2EH8L 4FKKA 4JCMA 1GW6A 4J4PC 3QA3B 4JFEB 4L4TE 5GGTA 2Z31C 2DKSA 4KK6D 1KN4H 1EGJA 1FZKB 2J4WL 1KTRL 4MQXD 4X8JA 3HS8A 4XPHL 1G7MB 2VUKA 1EXUB 3QYMA 2AJUL 1JPTH 3NJGA 4AVKA 4ZMVA 4AKPA 2EKSB 5A7EA 3S5LG 2Z8SA 3O11A 5I1DB 3CK0L 4WY7L 3SDAB 2OAAA 4AXWA 2QVMA 3INUH 5K9KB 4P4KA 4PMEA 3VG0H 4X98A 3NCJL 4GP8B 5K69A 4WIQA 3FO1A 1CF8H 5E56A 1I8MB 5DFWH 1BGXH 3VACA 3PAYA 2EXTA 1FL5A 3ILQD 4TTDD 1G7PB 3ABKB 3GDCA 5CUSH 1I31A 2D73A 1LQBC 1X5MA 4HV8A 4PYGA 2NY6D 3AWFA 5IVOA 3KW7A 4B6ZA 3CZFB 3LMJL 5DZNA 3SGEH 3G08A 4G11A 4LSQH 3RPKA 3AMLA 1A7PL 1AP2A 2YPLE 3NQKA 5AOKA 3UABA 4Y5XA 2WB7A 2EEXA 4AENB 4UYQA 1U3HC 1E8XA 1LE5A 1DBKH 5A16A 4JE4B 5IV2A 3SKOA 5CR1A 2BP0B 4LDCA 5INDA 1QBBA 4UUJA 3UTTD 1OT1A 3GZKA 2ZOLA 4LBEA 3FXIC 1U95A 4DUWA 1I9EA 3KPRD 4BH7B 1KGIA 2BDNH 4XMUA 1T5WA 1ZHLB 1J0HA 3I6KB 1AKJD 2HWZL 2O5ZL 3MRRA 4XZ4A 3RX7A 1J0ZA 1GH7A 4DGVL 3F2LA 1X7TA 3TJHD 5J6GB 1I3UA 1GS8A 2B8OT 2EIKB 3FQUA 3PV6A 2OQJA 4MA3A 4NGHH 3BUDA 4PJHB 4J8RB 5DCCA 2Q7AA 1KIQB 2X10A 1NCHA 4UAOB 1JXFA 2CALA 2CDFA 2ICWJ 2NUPB 3B6SB 4G7RB 2IANB 4AIOA 1Q8MA 5DJZB 5BRZB 2EDQA 5J1AA 5K39A 4JFVA 3MTXA 1GZHA 4HKXA 3FBKA 5BZWB 3RGVB 4NT6A 4OM0H 5EU5A 3WN5C 4ZNEE 3BZ5A 2P8LA 3RBGA 2WP3O 5BPPA 3F7RA 4PRIE 1EZUA 5GRVK 5L9DL 3IJEA 1UC6A 4MMZB 1DBJL 3OC5A 4N2FA 5B39A 5EZIH 2OV0A 1GAFH 5B8CC 3T1FA 3FTYA 2D3VA 3KBPA 3BGFC 4F37F 3ZMNA 1MVUA 4P9HH 3P9MA 4U7MA 4YEEA 5ALCL 4PJCA 3LIZL 1DZBA 4D7BA 5JQ6H 1OF0A 1HWGB 3NA9L 1JNNL 2HFFA 1A7QH 2HN7A 2F2HA 1ESOA 1FYTE 3PABB 5KS9F 3SDXA 4NP9A 1UH3A 3BAEH 2H32A 4F20A 1AHMA 4RGNE 2XWTB 3QXTA 4YZFF 3AZUA 3KJ4C 3GXMA 1J1XL 5AZUA 3HMXA 1RSFA 1H8LA 1BQLH 3EYFB 4WY7H 5L2KD 1T4KB 3VFOB 2FUTA 2CHZA 2NPLX 4X80H 1PNCA 4RH4A 1JVLA 2BVTA 3BHBA 4OD1L 5C0GB 4WUUA 1RXLA 1XGTA 4NRZA 4FQLH 3RNQB 3HIZA 1CLOH 2NY2D 2YKLH 2NY7L 2Y36L 4HU2A 3D18B 3MV7E 2EDYA 3PUCA 5IB5B 2DQTH 3HE7D 3AS2A 1UM4H 3QEUB 2PWDA 5L88H 2BOCA 5DZ9A 1PW3A 4NPKA 4LKXA 4LCIL 1G0YR 2JSFA 3B43A 4M93B 1FVCA 1WEJH 2Z65C 4RQQA 2IQAA 2Q7YA 1L4IA 4Q8BA 4XAWH 4Y4FB 3OWRA 5FW8A 4EVNA 3VX1A 4FFWD 4I48A 2XVKA 1CICB 1ERNA 4YHYC 3CLFL 5E8EA 4HXBL 3UL4A 1L6ZA 1G9MH 1F58L 5FYLD 3V6OA 4JPWL 2ALAA 4JFFD 2EICA 5D4QA 3ARSA 3JSSA 3PQYE 1NEZG 2J2ZA 3TNNA 3NIDE 2WKLA 4JKMA 4BQ9A 2WBXA 3FB7B 4HDIB 2YGVA 5HHMD 3NK4A 2OJZL 3QCUL 3RPBA 3TNNB 3M1OA 1X4ZA 4TXVB 3UTZB 2AABL 5ICZB 5ES4B 2FX7L 3JWOC 4BHUI 4KV5F 5DVMA 3EO1A 1CICA 1EGJH 3BZDA 4I13B 3ASNB 4TSBH 2BMKB 3MOBH 1CGSH 1U3ZA 3Q0HA 4HP5A 3GHEL 2IQAB 2IOIA 3WN5B 5KZCD 5D9SB 1QNIA 5DHYA 5BNXD 3MAWA 4KY1L 3HE6B 3O2DH 3IJSA 1K9TA 4NKDA 3FUDA 4AVIA 4CVUA 5F6IB 3LKNB 3W82A 2VO8A 3EGDB 1L6PA 3ATFA 5BRPA 3RL2A 3H9SD 4XP4H 3U0PA 3QIUC 2JV6A 1XGTB 2ZKMX 5ITFA 3Q2CA 1LO0L 1OQOA 5C0GA 3TV3H 2V9TA 4PJ7F 1NUNB 3BHBB 3L4XA 3Q13A 1JHKH 1E4XH 3VU1A 2EZ0C 3LIZA 3VXSD 4BSWB 4YSEA 4CMHC 4CMMA 1PZUB 2HFEB 1HHKB 1RK0A 2IWGA 4YSAA 1A3ZA 2WXPA 3TBBA 1G87A 2L8AA 3X1GA 4AJ0A 1NAMH 3O6KL 2DLFH 2BO0A 1TEYA 1Z9SB 1HOEA 1U8LB 4P2QD 4CDHA 3TOPA 3P9MB 3GI8H 4UM8A 5A43C 1M56B 1XV8A 4YDKH 1OIOA 2ZWZA 4P2OD 4RISH 1R24A 2FZ3A 4PJAE 3DSFL 3HUJA 3U6XS 3BI9X 4WFHD 1CLCA 2W65A 5ADOH 3MA9L 4HWZA 3THMH 1JMXA 1R47A 1ZIBA 3BE1H 1QRNB 4HJIA 4QGTA 3RKDC 2W9EH 3RAJH 3BPNC 5D6CA 4JPIA 1KB5L 4HJTA 1JK9B 2CXGA 1OKEA 1WAPA 2VABA 3O2WH 4MNQA 5DJZA 5BRZA 1BVNP 4AYMC 5J1AB 3WTTA 2MPAL 1WD9A 2CDFB 3ZZQA 1F58H 3BH8A 1S7WB 3RB7A 3K6SA 1KIQA 5CJXA 1P53A 5TE4H 2HXAA 4NOBA 4EKXA 3DIFB 4PGBB 4PJHA 2VDPL 3N9GH 3HG1A 3OR7A 4AKOA 5JXEC 3DX6B 5J6GA 4M6AA 3KPSA 2HCZX 4AUJA 2AGJL 1JZHA 5AW7B 4A6YA 4K8RD 4RDBA 2H0EA 2XVGA 1ETJA 4LBEB 5IQ7H 1KIRB 4UUJB 4MMXA 3VAEA 1BF5A 4QXUH 3RFRA 1AZBA 4NIYE 1P5UC 3S2AA 2DV6A 1LE9B 5FR3A 2Z7WA 4QHMB 4X4MA 1J8SA 1PBYA 3VWJC 3MC0A 1G7HB 1N4XH 4X7SH 4X8XA 2JKXA 3CN4A 4M6NL 4JM2F 4IMKC 1QFWL 4MDJB 4NB7A 5EC2B 4X9BA 4PJHF 1G7IB 4LP4A 5IG7B 5FK9A 3VDAA 3C08L 1E9QB 4PS8A 5T33L 4HV8B 2APWA 2FEEL 1G7PA 3TFKC 4JZJB 4HPHA 2F54E 1BCIA 4WWOA 5AVUB 3MCYA 4LESA 3FO1B 2LTQB 3OB0K 1QPPA 4MCNA 4AQZA 5DUMH 1NCTA 4X98B 3MLVL 4WRLA 1YY9D 4FQ1L 5F1IB 3T0EC 2CLZA 5AVWB 3OG4B 5AKSA 2DQTL 4ZMWA 5LBSH 3UJJH 5BJTA 4MJ2A 4IBYA 3AVEA 4LCIH 4UZUA 1HNYA 1TQBC 2HTLD 2XBDA 4GS7C 4ODXB 2WANA 3NFSL 2GYSA 4AYSA 4EMZA 5CLYA 5MEQB 4RESB 4WK0B 1G7MA 2WV3A 2GCYB 3B83A 4YHIB 4X8JB 1FZKA 1QRNE 2VO5A 1E6OH 4A7GF 1J5OL 1II4E 5A2LH 4JFEA 2EDMA 2UZIH 4NYLA 1DQDH 2X2UA 3TTYA 1E2ZA 5E8DH 5DXWA 3EGSB 5FHBL 3MBED 1BWMA 3BFOA 3QPXL 2QQLL 1DTUA 4JPWH 1HZHH 4IRSA 4M7ZC 1GZHC 5KAQF 1R6VA 3QR1A 1QR1B 5D1XA 4HJUA 2MQ3A 3K74B 4P2YA 2IPUK 3OV6A 2NY4C 4XB8A 5BQ7B 1H3PH 4HX1B 2OJZH 2DY2A 1E3FA 3R06A 4GXVH 4NQCB 1MCWW 2VZUA 2DQHH 4CJ0A 2VISB 4JHUA 5HY9B 1QG3A 1D9KD 1A4KB 1ND0A 1OK0A 2F15A 4RBPK 1WYJA 3KBFA 4QOKE 4Q6IC 5DJ2B 4E9XA 1AXIB 1KIUB 5MI0C 3RRQA 2HRGA 5TE4L 2O30A 3RNKA 4TNGA 4Z7QF 2HLFC 3D3VA 5FYJU 1FGVH 3BGAA 3MODL 1X5JA 1BAGA 2MH4A 1KXQA 1KDJA 2CCVA 2DTSA 3MRGA 3WELA 3B1UA 5EO0A 4S1RH 2ZNWA 2KS0A 2AQRA 4UMGA 1EHLL 2GTWA 1BVKA 3GIZL 2DWYA 2XG5A 2APVA 5LXGL 5DK2A 3KLQA 1G94A 1PAMA 1DQMH 2EEAA 2VE6B 1WCQA 4M4PA 4EN3D 3ULSA 2H2SD 4NM8L 1EVUA 3P73B 3TZVD 4Q74A 5AB0A 1U92A 2F61A 4P2QB 1N4XL 1QMUA 4IHBA 4KRLB 1VSCA 1D5RA 1JMZA 1V8HA 4S1DC 1EX0A 4LVHC 1MJ7H 4FXKB 4ZUSA 3CZEA 2EYRA 1XF2B 3FMGL 4N2BA 5DI8A 1OAZL 4G42B 4N2GA 3QK0A 5D7LB 3HG2A 3Q48A 3OMAB 2AJZB 3KLSA 5JMRA 5FCUL 3W0WD 1SUHA 5C6TH 2ADIB 3GLZA 3LKPB 2WSPA 5A2JH 1KCWA 2F7PA 5HJDA 4Y5YC 1Z9LA 4TULL 2CQVA 2DLIA 3T0VA 1NGZB 1L9TA 1MREH 4P57B 2HKHH 4PJEE 3C5JB 5INCB 2ESVA 4ZXBC 4UNIA 4DGYH 4KI1A 3BKYH 1JK8B 4N2DA 3TX4A 3ZE0F 3X14A 1A1OA 2AQSA 2CMRH 4WHYG 5AAPA 5EZJB 5G55A 4BM7A 1TCRA 1E6OL 5IBTL 2WWKT 1J5OH 4YDLC 4NC1C 1YEGL 2H3KA 3UYRH 2NX5A 1QLRB 1MCHA 1F41A 4WGVB 1QSEA 5BVJA 1W16A 3E9UA 4OLZL 5DD5L 2XNAA 3QAZB 3ZQ9A 2XTJE 3KJ4B 1WCBB 4HK0B 3ROOA 4K7FA 3HI6L 5FFOA 3VI4B 3MV9E 3WEBA 1JXJA 3BO8A 4WSKA 4M9PA 1N6QL 1IVTA 2I69A 4FXKC 5JW5B 3QQ9C 4ZTPL 3L2MA 2ED6A 4NENA 4UB0H 3PWPE 3PFQA 1F1GA 4WFHE 5DK0B 3IDUA 3FO9A 5K1NA 1X3DA 2J1XA 1TJIL 2X3CA 1AXTL 5EU3B 5IIEA 2L7QA 2OMZB 3W2DL 1LEGB 4D8PB 1WZMA 1IBHA 3JYCA 4QRTB 3WLBB 1G7JB 2WXHA 1BIIA 3HC2A 4P2QE 3NH7H 4X6CF 2UZXA 3NIDF 3VFSB 2YBRB 3TVMC 4OD3H 2P5PA 3X3FL 1IMHC 4J6IA 4KHXH 5FYJL 4LU5L 1N68A 2FWUA 2CZNA 2ZP9A 4JO4H 2ZSVA 4NP4L 4H5SA 1YN7B 4GO9A 3SYQA 2WIIB 1ED3A 1DANT 1F97A 1JN6A 5E2UL 3T09A 4N90E 3C12A 4TMPA 3NMEA 4IHOA 4PY7A 1CU4L 3WS6A 5LBSL 5C0AB 4Y1SA 4WI4A 5IB3B 2OMXA 4PRNB 1A7RL 2DBLL 2XYBA 2IDFA 4HKJA 4G5AA 4OLEA 1QBLL 1ZT1A 5CINH 5IF0A 1T20B 2PCFB 1EEYB 3B4NA 3FFCE 1TENA 5C6TL 1S9VB 2OSXA 3FOMA 3DRQA 1NBQA 2MOVA 4IOIB 4S1QL 3M1BB 1GOHA 2ED9A 3DECA 1B4JH 1FNAA 4L8SB 3WTXA 2K0RA 3CUPB 4ZX5A 1YEHL 3FCGA 2Y25A 4MA1B 3EDEA 1JJUA 3HJ0A 4YHNB 3DXAA 3QCTL 1TQTA 3OSVA 1K4CA 1HHHB 2R4SL 4XNZB 1PIFA 2QPSA 4ZMAT 5KYUA 5LWYL 2DDQL 4I0KA 1F4WL 4HSQA 4Y88A 3F00A 3PL6A 2JELL 4I9XA 1AI1L 3VQ2C 3BEWA 3L3IB 3MROB 3U9UA 1FFTB 2YMOA 5JTWA 4BUQA 1QI3A 4UMSA 3HI6H 1N5AB 2H9GA 1DUZB 1TZ8A 3MLYL 4FTVB 4X99A 5FKPA 5GPRA 3P0VL 4UU9B 2E9GA 2BFVH 5EOCL 4A55A 1J8HD 5HVHB 2FL5A 1H3WM 3O9WA 3VA2C 2G4EA 5J11B 4YHMH 1I1YB 1BEYH 2B15A 2NTSP 1Z0NA 4PP2B 5JW4N 2WAHA 3ABMB 3WY4A 1YEDA 4L1LA 4DVRH 2YPKB 1D9KA 1DQML 3FRPA 5IMLA 1WGVA 3LEYH 4D3CH 1PEWA 4IRJD 4ETQA 3NABL 2FSDA 4XVJL 1G9MC 2NXYC 5JW3L 1OPGL 2DQUH 4OJDH 3RA7L 2CSPA 4QRPE 1TETL 3KPLA 2DIJA 1I4FB 4OD3L 4AH2A 3WTVA 4L37B 5I5RA 1CXFA 5AFAA 3T2PA 4L3CB 4U6VH 3IE4A 4X4ME 5EOQH 2WO3B 2OXGB 1A7BA 4PEEA 4Y2DA 1KNOB 4BKLB 3KG5A 1JHTA 2V9QA 5TH2A 3DARA 1C16A 3BWUF 3D4CA 1D2OA 2F1EA 4UQ3B 5LJYH 3BLPX 2BERA 2VXQA 2HFTA 2WYIA 1U58B 4IRSC 4LHUA 3TO4C 1JHLH 3LCYA 3PNWB 4RA0C 1CUOA 1T6BX 4N90D 3OZKA 1G1KA 2A1WH 1NDMA 2YK1H 2QZ5A 4KRPB 1NFIA 1PZ3A 4XP6L 1MUJA 3ARBA 1OP4A 2BVOB 3CCHA 4BRVA 5KAQG 4YHOH 1RSYA 5I24A 2XX0A 4OLZH 5I74B 2HH0H 2VZSA 4TVPH 2WAQA 3HNVH 2DI7A 3S96B 3JWDC 4G1MA 1YC8A 1TZOA 1R33A 1QSFB 2Z4QB 2QADD 1Q0YH 4LBAA 2EE2A 3KH4A 3H7BB 4LVNB 4PD4K 4U33A 5I1AA 5CZXC 1JERA 4FTVE 1H5BB 4U6YA 4G6FD 4XMKH 2P8MB 3VXPB 2D9CA 2D31A 5LBSA 4HWEH 4EOWH 3US0A 1UWGH 2NY0B 4OF3A 3IFPA 3DX0A 4NLHA 3BUIA 4HKZA 2EYTA 4GSUA 3GKWL 1BQHG 2JQMA 5DS8A 1SF5A 2F8OA 5MP6L 5JPMC 2PYFA 2QSCL 3T3PF 1UTDA 3KPTA 5E03A 4LSTH 2DD8L 1E9OB 1W8EA 4XVUD 5FHAH 3QDJA 4WF7A 5AYUL 5T1KA 3AG1B 1ZDSA 5FM5O 5KSAD 4G80B 4MS6A 4RRPG 5HPMA 1IKFL 1KBPA 5DLML 5AL8A 5E2TL 2BRQA 5IMOA 4JRYE 4Y2LA 2OZ4H 3LNDA 4K71C 5I0ZA 2ALWA 5DQ9A 3RVTD 4HJ1A 4XO9A 1G6RH 4ZMXA 4TF4A 5EBWB 1HK6A 5CGYC 2HRPH 3TBVA 4TTGA 4X6FA 4RMVA 5F96L 4QHPA 5EBLA 3S36X 5CCKL 2H8PA 4N2AA 4ZJ9A 5LAXB 4YX2H 4U1MB 5I0YA 3VI4F 5T1LA 4H44C 4RAVB 1H3TA 1TDQA 1TQUA 3OKLB 5TGBA 4AC2A 1EJOH 2OX5B 1MFCL 3UEQA 3BD5A 2FEDD 4EPSA 1BF8A 2P47B 5T5FH 3T8XB 4OFDA 1KJVB 2J72A 4P5KA 4GAGL 4A2LA 2TSBA 5G4MA 3VSUA 4MBRA 2YD8A 3S37L 2J6EL 1P6AB 3GD1C 1GOGA 4GAAA 4KQ4L 3QJZA 5FLVA 1KPRB 3CBRA 4P49A 5EUOB 1ZTXH 2HYMA 1UOKA 3LQAL 3QJUB 4HHAA 2VR7A 1CI5A 4Y19D 5MI0B 4ES8A 4XWOC 5JA8B 1FL6B 1QQDA 2OI9C 3TN0C 1IM9A 2QPFA 3FZUC 3HS0B 1A3RL 4ZFOL 4NI6A 3LS5H 2G75A 3TT3H 1M05B 3VRLF 3WTSA 1BSIA 4AKQA 2HRLA 4DPAX 1QAWA 3FQ4A 1TJGL 2WBJD 3FL7A 3GEWB 1QYGH 3QCTH 3L13A 3NSCA 4JANB 1MHCB 4JY6B 4OUOA 1XGUB 4F1SA 2G3XA 3QUMA 4FLHA 3VRLE 2HTKC 2OJ1A 4HPOL 3HI5H 1KC5H 4IBUA 1R3HB 2H1LM 2Q3ZA 3HNVL 2L04A 4AQ8A 1H3XA 2AQTA 5LDUA 4U6XB 1DBAH 1E3XA 2Y6SC 4M6OH 4XXCA 4X6CA 2WZ0A 4ODWB 4DHLA 1HWWA 5BO1H 1ZEAH 3S4SA 2ZCKH 2R0WH 1JP5A 3SBPA 2A9DA 4V1DB 3DO4A 4DQAA 1L9OA 1UWGL 1HSBA 3MV7A 4YHLL 5DWUL 4YSPA 4Y9EA 4X42A 4KH9A 5I6KA 3K8LA 3NZUA 5BQDA 1K2DA 3CFCL 3BW9A 2MNWA 4WUUE 3EH1A 3C5ZD 2Y22A 1UEYA 4R7NB 4UBDD 1Z5YD 4AIZB 4XOAA 3IDMA 4OCRH 5DD6B 4HUKB 3WU1A 1TQCB 1VFBB 3UX9B 3W57A 2X44D 4P3CH 1THCA 2XWJB 1J8HA 4HG4J 3VXOA 1V3MA 1CFQB 4WV1C 3UYOD 5IFAH 1CXKA 4JM0A 5EWIL 4NAQA 3SBRA 1O5DT 3PWLA 1VZHA 2F74A 3INOA 3WNIA 2VDRH 4FTVD 4PRAA 3L1GA 4ZMPA 4OCYL 5DEFA 4LPUA 4HS6B 5CFAA 4L4VB 1UZ8A 4C8XA 5C9JB 3ZKXC 5BV7H 3QQDB 4YX2L 1XGYH 3GC3A 1F4HA 1OP3H 3GSXA 5E6ZA 3AITA 3U2IA 2ZUWA 4UNUA 3LMJH 3ARBD 4K5OA 3MSPA 4UT9A 3HC4L 1VADA 4QXGL 4Y2OB 1N70A 1QBMH 3U30C 3P9LA 2CO4A 1JGDA 4MRBA 5HGBB 4IRJB 1JZGA 4ZI8A 5BO0D 1N2RB 1T04A 5HBBA 1K72A 5E6SB 3RGVC 4LOUD 4MD4B 5C08A 3UBXB 4N3UA 5FA4A 5D8JH 4CN6A 4B9YA 3L7FA 3NCJH 1EEQA 1PCSA 1WA2X 4YHOL 3BKJH 4GAYA 3V4PH 2CO7A 3MJ9L 1MCPH 1DQVA 3MX0B 4YHZH 3T2QA 5B7FA 3VQ1C 5C7XH 4UYPA 3DX7B 4LPTA 2PYEA 4ZW7A 1IC0A 5HHQA 2P49B 4GY4A 4XBGB 1SMDA 1GA2A 4IYKA 4FL4B 1W8OA 2XKNB 1TVHA 2JLLA 5EBGA 2BRRH 4BCZA 5DVNA 2Y3AA 1AVAA 4NJ9H 4PG9B 8CGTA 4K55A 1OP9A 4WVRA 2CHWA 4Z5RA 3EYVB 1DVFD 2JJSA 2WWKO 2CO3A 4V2BA 5FXCH 3PGDB 2Q76B 2Y24A 1Q9KB 3LV3B 12E8L 4M9OA 3RZCB 3U0TA 3PWJA 2DWDB 3GBNL 5E0FA 3EFOA 2P43B 3B7UX 3KYMB 2WY3B 1HSAA 3G6JB 3V4VB 4APQB 4ZMNA 2VC2B 2V9UA 2QKIB 4G83A 4QCIA 1UT1A 4GMSH 3MREA 2H6PB 1A8ZA 1KLFB 1DJIA 2J1YA 4PJ6A 2R7EB 3DSNA 1DBMH 1A6AA 3UJTH 3VWKD 5CBEA 1ZT4A 1G9EA 4M5YL 4MNGB 1E4JA 2EDDA 4D9QE 2YWYA 5J4MA 3O2VH 4YL9A 4IGBD 1FFNB 3EYQC 3DOHA 3QEHB 4PG2C 3E80A 1CXIA 2EXYC 1GHFH 1OALA 2LTQC 1FCCA 3NFPB 2DMGA 1XCQB 5DC4B 4LCCA 2YAMA 3UTPE 4N26A 1U3JA 4EI5A 4F3FB 1V7NH 5L7XH 4OCXH 4Z9KB 4G6AD 4O51A 4Q9QL 3D51A 3HG4A 1M2VB 4L4TA 4MB5A 3QG6A 5D2NB 3ZDYB 3EYUL 1FI8C 1JWMB 3HR6A 3BQUA 2ZT9C 2ZZUT 5BV7L 1OAUL 3Q44A 3VDBA 3NEEA 4P9MH 1RCYA 1KUMA 1ZJBA 4N8PA 3UBFA 4GEJA 2OM5A 2WBJA 3GXUB 3C60C 1NOAA 4G7VH 2AEQL 4BIKA 1LHZA 2X88A 1WZKA 4ELDA 1AZUA 3NPSB 3LPOA 2XX1A 5JHBA 3RVVD 1BXUA 1V05A 1YVLA 3UC0H 1E4WH 3FSWA 2YD2A 1I1FA 4N2LA 2ODHA 3HZKB 4N5EC 1BQUA 4NQCE 3WFHA 1QO3B 1Z3GL 4J3OD 4BXVA 4DZ8B 1RULH 1AHWA 1D7CA 3SE3C 4U3SB 1ZY9A 2V5MA 2VSKB 1UOLA 2YRPA 4LCWE 2C3HA 1RK7A 5FFGA 5E1HB 2HG5B 1RZIA 4MDRA 3IF1A 4HGWB 1QI5A 4EO5A 3VTAA 1MQKL 1JAEA 2IXQA 4W9ZA 4AUUA 5IJDC 4BQCA 2OR7A 3BJ91 3GMQA 1JZ2A 4S0HA 3APDA 5ID1B 4XPGH 5EUKB 5L4JA 4H8QA 4JM2A 1I3GL 4Z7QB 2X4OB 3P02A 5E4IA 2WQ8A 3LN9A 4PIRF 3WIFB 4JL2A 5CFHA 5LGHH