5FW7A

Structure of human transthyretin mutant a109v
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
116
structure length
116
Chain Sequence
CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAVLLSPYSYSTTAVVTNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords TRANSTHYRETIN
publication title Structure of New Non-Amyloidogenic Mutant of Ttr A108V
rcsb
source organism Homo sapiens
total genus 31
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 5fw7A00
3B56A 5L4JA 3CFMA 4L1TA 4N87A 1ICTA 2NOYA 4PWJA 5AL0A 1BZEA 2G3XA 1ETB1 3DO4A 4KY2A 2F8IA 1BMZA 4L1SA 4TLUA 3CN2A 2H0FA 3NEOA 5CLXA 5JIDA 2H6UA 5E23A 1IE4A 4PWIA 2WQAA 4TL4A 4IKIA 3FCBA 3ESOA 3DJRA 3CN0A 1E5AA 4TQPA 5IHHA 5L4MA 1GKOA 4HJTA 1ETA1 1X7TA 5L4IA 4I89A 2G5UA 3IMSA 3NESA 1TTAA 2G4EA 5TTRA 4DETA 5JIMA 5CN3A 2GABA 1TYRA 4MASA 2FLMA 5FO2A 3DGDA 3GRBA 4MRCA 1SOQA 2QPFA 4PMEA 5CLZA 3CFQA 5K1JA 2G3ZA 4N86A 4DEWA 4IIZA 2B77A 4I85A 3IWUA 4Q14A 1BM7A 3DJSA 4IKJA 1Y1DA 3GRGA 3IPEA 1SN0A 4IK6A 4TLTA 3P3TA 4TNFA 2IGLA 4ABVA 5K1NA 3IWVA 1TFPA 1FHNA 1THCA 3IMVA 4Y9EA 2B16A 2H0JA 1TTBA 3GPSA 3GS0A 3I9AA 5HJGA 4IKLA 3CN1A 4PWFA 5AL8A 3P3UA 3CFNA 3DIDA 5L4FA 3CN4A 3DK2A 4WNJA 2ROXA 3BT0A 3IMTA 3I9PA 3KGUA 5AKVA 3A4DA 3BSZA 4HJUA 4I87A 1KGIA 2H0EA 5CM1A 3CXFA 1DVTA 3TCTA 4HIQA 5DEJA 4AC2A 3I9IA 1OO2A 3P3RA 3GS4A 1TTRA 1Z7JA 3NEXA 4PWGA 4QRFA 4TQHA 3DK0A 4YDMA 1G1OA 2ROYA 4TKWA 4DERA 4WO0A 1TT6A 4TNEA 4TLSA 5EN3A 5CR1A 2B9AA 2GPZA 1U21A 3HJ0A 3FC8A 4Y9GA 4ABWA 1TTCA 3DJTA 3ESNA 2H4EA 1IIIA 1SN5A 1DVQA 3CN3A 3IPBA 3Q1EA 3QVAA 4ABUA 4PVLA 4DESA 5A6IA 4IK7A 2TRHA 4PVMA 2QGBA 4ACTA 3OZKA 1TLMA 1THAA 2QELA 3D2TA 5AYTA 4DEUA 1KGJA 1E3FA 5AKSA 4TQ8A 1DVUA 3KGSA 1DVSA 5E4AA 4TLKA 1ZCRA 5JIQA 3SSGA 1E4HA 3NEEA 2TRYA 2QGEA 1F86A 3A4EA 3DJZA 3U2JA 3CFTA 5FW8A 5CNHA 2QGDA 4ABQA 1ZD6A 3ESPA 1TSHA 4TQIA 1DVXA 3CBRA 4TL5A 5FW6A 3TFBA 4PM1A 3W3BA 1SN2A 4HISA 3M1OA 2G9KA 4TNGA 2PABA 3U2IA 4IKKA 2F7IA 1SOKA 3OZLA 3D7PA 4N85A 2G2PA 4D7BA 5AKTA 5BOJA 4TM9A 3GLZA 1BZDA 1DVYA 4PWEA 3IMWA 1DVZA 1BZ8A 5CLYA 2B14A 2H1XA 1RLBA 4FI6A 5DWPA 4AC4A 3KGTA 3NG5A 4PWHA 2G2NA 4FI8A 4QYAA 3IMRA 4FI7A 1GKEA 4PWKA 1IIKA 4Y9FA 1FH2A 1QABA 4PVNA 4PMFA 4QXVA 4Y9CA 4MRBA 3A4FA 4HJSA 1TZ8A 2G4GA 4Y9BA 1X7SA 2B15A 5E4OA 5EZPA 4ANKA 3IMUA 5FW7A 1QWHA 4YDNA 1F41A 2QGCA 3GS7A 3P3SA 1IJNA 2FBRA 4WNSA
chains in the Genus database with same CATH superfamily
4DP1X 5L4JA 1VFOA 1XR8B 4L1TA 4XPTL 5CN3A 1S7UA 2XI9A 3KLSA 4MXWL 4POUB 5C0BA 5CLXA 2BSRA 4Z7UF 3HRPA 4Z7WF 1XGRA 2PWHA 5GGRY 1NGWA 1EUTA 2GTQA 5D2NB 3APFA 5MEQB 3QWNA 4S0SD 5IG7B 2Z92B 3R8BB 3ZE2E 2B1OA 3P54A 4RMQA 1EHNA 3CHOA 4L4VD 4X5LA 4C4BA 2ZJSH 4Z5RA 2VZTA 4A2MA 3DNKA 1AYOA 2J25A 3KM1A 4IEFB 5F9OH 1FFPA 5KAQF 3FT1A 3BFQG 5D2LE 5KZCB 3VQ1C 3UOAB 1T03L 3FRPG 1S7TB 4HBCH 4OBRA 5TK2A 4DP8X 1HOEA 3T8XA 2EDYA 4A7GF 4UQCA 3HE7C 3BD4A 4NKQB 1BDYA 2PCYA 1VB9A 4FXKB 3QQ3B 4QHLB 5G5DB 4DHLA 4JANB 4KJWC 4BSWA 3C5ZC 4IOSD 1KBBA 4LCUA 3SPCA 3SDDB 1NPJA 3MKGA 4LPTA 1XCQA 2YK1H 4F7CA 5HYIA 3RVWC 2D4FA 3VI3B 1IFGA 1NDGA 3WTWA 3LQAH 5C7ZA 3BSGA 5IQLA 1S7QA 5CR1A 1TZGL 4P2OD 4EN3C 4KJPD 1FLTX 2DICA 1QSFB 4TMPA 1LK3L 3HNTH 1PNDA 4M43H 1YN7A 3CFDA 2D7OA 3VWKA 3WTTA 1W72L 4JFFB 3BUTA 5E5UB 4OD3L 1MHEA 4G7YH 3KGSA 1QX1A 5LQBL 3ZKND 2BH0A 1KACB 2MCG1 2XBTA 5AWNL 4ZUUA 3CUPA 4EI6B 2EC8A 1TCRB 4L1HA 1LMIA 5DD0H 5T1KB 5F89A 4H8PA 5C0CA 1A7BA 3EO0B 5JO5A 1Z32X 4FLSA 3FQRB 1OCWL 2FQFA 5AW7B 4CL7A 4I7ZC 1A4BA 1UD5A 1IB5A 3A4AA 3WIHL 4MA8H 1D3CA 3O8XA 5E0QA 4KI1A 4TVPE 1JPGB 4F2MB 2Z64C 2NZ9C 4DP2X 1ECYA 2OL3A 3QUYC 2A74A 4E9LA 4UIKL 1RUQL 1T03H 5AENA 5I30H 2DI8A 1GGTA 1M2OA 3W81A 5FECB 2ESVB 4LLAA 3RI5K 1RZJC 5EIIB 5C8JA 4OZ4B 3BAIA 2FBRA 1WWWX 3VXOA 5H4YA 3X11B 5L9DH 1MH5B 2RCSH 3LKSA 4NKMB 4JPKL 5AZ2L 2VRKA 1JRHL 2Q8BL 1CWVA 1ETB1 3M07A 3PL6D 5EBGA 1M7UA 3U46A 3LXUX 1FL3B 3U6RA 1L9RA 1H3XA 1TZGH 2DQDL 3O0RL 2BIIA 5DEFA 1OALA 2FJHB 3Q0HA 3JWNE 5DEGB 3HVDA 3O6KH 4I0KA 5E5MB 3TXAA 3WN5A 2VM9A 1T3FB 3GXNA 1BBJA 3KXFB 4MNHA 1AD9B 4OCWH 2WP3T 2WN2A 1W72H 1BV8A 1J5OL 4ZODA 1WBZB 3PQYB 4I3RH 2VQ1B 1OAUH 4X6EA 5LQBH 4JN1L 1HI6B 2N3JA 5D7IF 3EOBB 4NHUB 3WBDA 1FHNA 4RDBA 2CIKB 3JV6A 4KXZI 4YIQB 2FE0A 2O5XH 5DS2A 2ORBH 1BG9A 5GRJL 2UZIL 3FU7A 4XNUL 4FNLL 3X1EA 1OANA 2CO6A 3WIHH 1JV2B 3NH7L 2HH0L 1QFUL 2ZIDA 4Q7DA 4IOIA 1W0WB 3RKDD 1DLHB 3OAUH 2YA1A 5I82A 4UIKH 1G87A 5HHOA 4K5OA 1SLUA 5EU4B 1TU2A 2W60A 3M1CA 4ZPTB 1U3ZA 3WS6C 1V3MA 4CMHB 3QE5A 3SGEH 1FJ1A 3X13B 1RZ8A 1CIDA 4JPKH 5ENWB 2V4LA 1JRHH 5EPMB 5AZ2H 2Q8BH 4OUOA 4ZAKC 1YDPB 4TTDD 4Z18A 1IQWL 3KWXA 3D18A 3WKPA 1M4KA 1E5YA 1PKQE 5FM5O 2PTVA 4DGUA 2YEZB 2CUIA 1EZSA 2FHCA 3LOWA 4FMKA 4KRNA 4X6DA 4XI5D 2QADB 5E8EA 3ULVL 3DXAD 2Z7UA 4Y2DD 4AGLA 5C86A 3GZQA 3Q2WA 4M62H 3CLFH 4NC2B 2R0ZL 2EEFA 3FTGA 2XV2A 3C6SA 4H2CA 3DSFH 4P59L 1WHPA 4HIHA 1VESA 2JKXA 3HLAB 4PJCB 4OVUA 4X50A 3TA4D 3UP6A 2V9TA 2W65A 2ZX9A 4PRDA 2PTTA 3IMRA 4YAQB 3QPQC 5ALCH 4KKCC 3FFCA 3EYFB 3V0WL 1OF2B 2BLFA 1UXWA 2UZIH 4XNUH 1I8MB 3RWEA 2NUTA 4HUNB 3QJQB 4Y5XA 2EIDA 4F91B 3STBA 3U2SA 2G5BB 3SODB 1IQDB 1BD2E 2QBWA 3QHFL 3TWYA 1S8DB 3ZK0A 1LMKA 3KPLB 1ZA3B 1IAII 2EP6A 4R4NC 2XWTA 5HYSB 1HNYA 3AAZA 5CZXC 2GSIA 3PDGA 3MRFB 1Q9LB 2CM6A 2AV7A 2CCVA 1A6WL 3GMNB 5B7FA 4MMZA 2VR5A 2NY0D 3QIUA 3ZQ9A 3LRLA 4E36A 1F3JB 4GBXD 4JM4L 4X9FA 5IESH 1A3QA 3QQ4B 3GFUA 2ZXBA 3B7YA 3VXMD 1COBA 1U3HA 3K6DA 2CLZB 1TENA 3FQNA 1FYTB 2EYRB 3Q1SL 3WD5L 2HRLA 5L7XL 5DJAB 5DMKA 3US0A 3FB8B 2H0JA 3ULVH 1KPUB 1OAZH 3VM5A 1TEYA 2EDJA 2IFFH 4KH9A 4PGBA 2R0LL 1GHFL 4LPVA 3IDMA 3OXRB 3RA7H 1UZ6E 1MW3A 3QP3A 4GKNB 3STZB 3BT2L 2R0ZH 5GQBA 2D2CC 3DK2A 5CF3A 5AVVB 5JDJA 4E9YA 1F90L 4XBMA 1AIFB 5EUKA 3FU0A 3RWFB 3ZU8A 5A2KH 1AS6A 4G1EA 3TO4B 2FECI 5F7BA 1QRND 4YDMA 3E8VA 2OYLA 3PNWB 3WJMA 5GRUL 1OKEA 2WIIB 3BGFB 3BPNB 3BUYB 5EC2A 2EKSA 3TZVC 5KJ7E 4XCFL 2X44D 3HZMA 4L8CB 3PIQB 2GPZA 1MJJB 3VRLF 1MRDL 1KEGL 3Q8AA 4X6BA 1H5BB 4UTAH 3BO8A 2AZAA 2LU5A 2GIYA 3QHFH 4K15A 3SDAC 3KJ4C 5I19L 1ZHKB 3IXTA 4N0UB 5DZVA 5GGVY 4TTGA 1J5HA 1NSNH 5KANG 1BW8A 4D8PA 4P2QD 4N0CD 1IM9D 4JFYB 3MJ7B 2EIBA 1GL4B 1IM3D 5DZLA 2JXMB 4LL9A 3HE7A 4LCWB 1A6WH 5CUSH 1B6DA 2EYTA 2W5PA 4ZRGA 1XO8A 1P7BA 4E9VA 3DBXB 2Q20A 2XIDA 3GO1L 4R96A 4XC1H 5ECJE 4JM4H 5E6ZA 5T1DL 3RB7A 3HG0A 1PZSA 3C5ZA 5KS9B 4FN0A 5EZIH 4D9QD 3CFBB 4ONOA 4JKMA 4N9OB 5DGQA 4ZXBB 2F53E 3GLDA 3LMJL 4LLQB 3WD5H 2OR8A 2AERT 4P5RA 4AV4A 5FYLD 4BFIB 4H13C 1QPKA 2YKLL 3A23A 4JPVL 4XHQA 4FL4C 4L4TB 3RKPA 4B0MB 5L7XH 4NQTA 1XVSA 5AZUA 5DQJB 3ARFC 1Y0LA 3NIDB 2PWDA 4EN3A 1JGLH 4M00A 4LLWB 5CIPA 1AXSB 4JDTL 4JM2B 2BVYA 1IUZA 4MAYB 2Q7YA 1QUPA 2YHGA 2ZPKH 2YQBA 1HSAB 2UZXA 1BEYH 4WKZB 4I0PD 1I3RA 5GRUH 3GHBH 5F3BB 5F3HB 2V6HA 1EMTL 4AH2B 4LVNC 5GISL 2Z31C 1AQHA 5I8EB 3GK8L 2QKIB 3ILPA 5HGDB 3RWIA 3QDAA 5DHXB 1XF4B 1BXAA 2XN9E 4PGDB 1FZKA 4S1DC 1HWWA 3SGJC 3KPPB 4Q6KA 1CBJA 3PAZA 4GAYA 3RDTD 5I19H 3S36L 4GW5A 1PTZA 2OS7A 3QUYA 4NZJA 4WUUA 1W6LA 3FO2A 1P1ZA 1ZTXE 5DURB 3WUWG 4ABVA 4I9XA 5J7CC 3V9FA 1NJ9A 2WLJA 2Z4QA 1SYVB 2WKOF 1B0IA 2PPFA 5DUMH 2YPLE 3BPOB 3ZE1F 2VLJE 2APBA 3GQFA 1QYGL 1X4ZA 3VG9B 1MWAB 5A43C 1KFAH 1KG0B 1NFDE 3B5TA 4QXTB 2BC4A 3DVIA 3KGUA 3GSOB 4F7EB 3VSVA 5HGBA 3LMJH 1SMAA 5EHFA 3WIIL 5KOVC 1WUNT 2OQJA 2X9ZA 3MRLB 3ETSA 4IRZL 4OLZL 4QLWA 3FN0L 7TAAA 3HPJB 3U7YH 1KUMA 4DNLA 1XSKA 3QQNA 1NAMB 3JWOL 4JJHA 5E03A 3TT1H 4AQEA 4R84A 4JRYD 1O75A 4JLRB 2VMDA 4OGXH 1PX4A 4JDTH 3NSXA 1JZ6A 4Y8DC 4XCNA 1HXYA 3UYRL 1P0SE 1ODUA 4L4VB 1FLRL 2ALAA 1NC2A 2NY1C 5HDQL 2XZAH 3H1ZA 5DD1H 3SE9H 2ZD0A 5KANI 5TF1L 4NQED 4LHUA 4CC4C 1S9WB 2YAOA 3ET9F 3ZSTA 2J43A 1TPXB 3IETB 3G08B 3H0TA 2WYIA 1FIGL 4XNQB 2H8PB 4WO4C 3QDMD 3GSNA 2DYSB 3FK3A 3V7AG 1BZDA 1D7CA 1UWEH 1Q9OA 5IW6B 4OFPA 1PQZB 2A77H 4X6CB 4EI5D 3UYOD 3RPBA 3WS6A 1I7TA 5MERA 1KLUB 1YEIL 2IGFL 4A2EA 1Q0EA 4M8VA 4W6YB 3V4VL 2XWBB 5E8NB 3DIVA 2EXSA 2COQA 3ZE2F 4ZAKA 3WIIH 3QFJE 1IGFH 4OLZH 4XX5A 3FN0H 1AJ7H 3GKWL 4KHXL 3R18A 8FABB 4L3AA 3JWOH 3L48A 4GUOA 2ZXWB 1YEDA 2TSAA 3MV8A 4PWIA 3VH8G 3VMNA 3B3IA 4O02A 4PYGA 3Q8BA 4G1MA 1WFUA 3MRHA 3KPNA 4HJTA 2CJTA 3E1F1 3MVSA 1CQYA 3F65A 1F4AA 2VQUA 3OXSA 5HPOA 1AR1B 1XGQB 3A6OA 3C75A 3UYRH 1UB6B 1CS6A 5T3ZL 1A1NA 1TTUA 3UTSD 5L2JB 1MFDH 1KMGA 2XYBA 4FFWC 4DEWA 1IBZA 1Y6MR 2B2XL 1GAFL 5B1JC 2OSYA 4MB4A 3P3TA 1V7ML 2X1PA 3KYOA 3VW3H 4QOKD 1MQ8A 1HK6A 2RAMA 4JB9L 1NCAH 4E9QA 5C2UB 3ALWA 3CX5J 4ZQKA 1PG7L 3SGKC 4FQXC 3MREB 4FP8L 4L1DA 4DZ8A 1M1XA 3CCHB 1IAIM 1T5XA 2BPBA 3QUMA 3V2AR 1NEZB 5EOCJ 2OJEA 3IF1A 5DMGD 3N50A 1BPVA 1IGMH 4U7KA 4JRXB 3HAEG 4PRNB 4LVEA 3OC8A 2AAVA 3ILEA 1OM3L 4MA7L 32C2A 3BMWA 4BDVA 1J7VR 3V4VH 5AAWC 1SDDA 2UZYA 5BVJB 4XT1C 2A6DA 1MIML 3NSJA 4KFZC 4DJMA 3WSQH 3W0WE 3WNOA 2EIZA 4NQDB 1HOCA 2FIKA 3L4UA 1YAIA 1QKZL 3LEVL 2YAEA 3GMRA 4KHXH 1DQDH 4V1DD 4P3CL 3MHZA 2G0KA 3BQVA 1U6AH 5EDXA 3AXLB 3V8OA 3HMXL 2GFBA 4L8DB 4B7IA 1U2CA 3A3YB 2DWEB 2R7EB 4YBLB 2ED9A 1P5UC 1H15A 1SOXA 1K8DB 4FFYA 3NDYE 2V8LA 3OKNA 2DBJA 2WLIB 2BY3A 3QUZB 4UNUA 3FTXA 4Y89A 2O6FA 4ENEC 5I6PA 3BGMA 3L17A 4ZFOA 3ATFA 3L2LA 3ETBF 1USZA 1KNOB 2X42A 2BHUA 3NG5A 3TZVA 3UX9B 3F85A 1A14L 5JHDB 5DRWB 1HSBA 2VXQA 3FO0L 1HJCA 3V0IA 3DUUB 4J3OF 4I8DA 1KCWA 3W37A 3BWUF 5D55A 1D5BA 1PEZA 1FFQA 2IPTH 3LQMA 3SDAA 5A7BA 2DWDB 1PG7H 3GBDA 4PV9B 3VE0A 1RD6A 3LKOA 2KLRA 3WY4A 4E68A 4UT6A 4BFFA 3WO4C 2EEDA 4WJ5B 5DHYA 1BREA 2OP4H 3EADA 3S5ZA 5M94B 2RH0A 3W9EA 1KXHA 5DJXA 2QVIA 4RGOH 4U1MB 2DI7A 5F72S 2H9GA 1OM3H 1E9QA 5LWYL 4Y2DB 3VXTA 5D9SA 1RZGB 2K7PA 4ODTL 1ZAGA 3RWGB 3L3HA 2H5UA 4IJ3B 4BH8B 2UY7B 4JMNA 4N2NA 4RGND 1IT9H 5TK4A 1ZA6B 2YPKA 3RG1C 3BUIA 4MD5B 3Q06A 1LNUA 4Z7NE 3MR9B 4GAFB 4N2KA 1QKZH 3WDJA 4MQTB 1DVFD 1S9VA 3HMWL 3UFIA 3ARFA 5KSBA 3QZOA 1JZEA 1R3HB 3NN8A 1ZANH 3VJ6A 1NLBH 5D7JC 1LO0H 1EJ6A 5DI8B 2YAQA 1MW0A 4Z3TA 3EFDH 3UJJL 4E42B 4ZSOB 5T5NG 1RJYA 1GOFA 1R3IL 4LLVA 1C8QA 4R97C 1WFJA 1NCCL 1QSEE 2EDEA 1JCKA 1WV7T 3H7BA 3O4LD 2WMPA 4KK9D 5AVQB 1NCNA 4YPGB 1A14H 3PWPD 3W1ZA 3LXCA 4MJ6B 2Y7OA 2Z31A 4Z3GA 4BXSV 1H8LA 4BINA 4WTZG 2ZAGA 3PFUA 5AD0A 1UTDA 1BFSA 4N1CA 1BF8A 3SGJA 4QXWA 2AQ3A 1BZ7B 2AJSH 4JFDD 3VXMB 2I60L 2VKWA 3V95A 3RVXD 5A2IH 3AW5A 5MEPA 3BVNB 5IOPB 3JV4B 1CTOA 4X9YA 5CGTA 2W0FB 5GJTL 2BS8A 5IB1A 3HN5A 1OTTC 3QSKB 5CZKA 3RP1A 2WLHA 3RQ3A 3RVVD 5KYUB 5DC9B 3LNDA 3BP5A 5GGSA 5GIRB 2F08A 5TFSL 3UG5A 3LNFA 1I7UA 4BQBA 3FRPA 3OZLA 1ZJBA 3DARA 4FKKA 1OHQA 4R7LA 3V6OC 3TCLB 3L8QA 2Z35A 4P9MH 4NI6A 4PJAE 1QRNB 2AXGA 4PJXE 5B7EA 1H0DB 3HMWH 4AWJC 3LIZA 3MJGX 4FTVE 4HPYL 3EH1A 4GIOA 1KLFA 2DZEA 4PFEA 3MMEA 1SHMA 3WG7B 2BCKB 2N0MA 3D34A 5DD3L 3FB6B 4F7KA 1I1FA 5DVOA 4QT5A 3TJEL 4MJIB 4ETYA 2CHWA 3E0GA 3MUJA 5CJXC 4WNQA 1S7RB 1PG7W 2ZWSA 4DOHE 1NCCH 5F8RC 5EU6A 1UOKA 3CQQA 1ES0A 1M57B 4FFTA 1UWYA 4YXKH 4P2QB 2WHVA 1IM9B 3PAYA 4CC4A 1N59B 1IM3B 2DS4A 4NUGH 4F3FA 5DJYB 1JTOA 2P5ED 4C57C 5E94A 1OLZA 2DIBA 4WO4A 1KCUH 3MBXL 1FL5A 3LHPL 1G1YA 4FLQA 1BWWA 3CH1B 4QRPE 2F1AA 2HTKD 3VACA 1UZ6F 1G4RA 1HH6B 4MGXA 1ZHNA 4YZWA 4MJ5B 1JNNH 1TEFA 2PWEA 2ZONA 2O6EA 4S2SB 1FAIL 3HCVA 3UAJC 1XMWA 4N0YL 4IKJA 4N25A 3HS0B 3IPEA 2F5AL 2I07A 2YMOA 5GJTH 1QLRB 4K07A 4NBXB 2DH3A 3IAQA 4WCYH 1J0HA 1W72B 1CGSH 2VDKH 3B1UA 2WCPA 3FO1B 4L48A 1BVOA 1MCPH 4N2FA 4MMYA 1EAJA 2P80D 3CN4A 2VERA 3DV6A 3FRUB 4BH7A 3OF6A 1G4MA 1I82A 2HLFD 1LEKB 3F7YA 2WPGA 3P3RA 2DQIL 4LAQH 4HPYH 5F6IC 2ZYSA 2BOCB 4A2FA 4XN2A 4RH4A 5C0JA 4WO0A 1NCBL 3D87B 3TEUA 4Y2NA 3B2VL 4KGJA 3T6ZA 4APXB 3D4YA 4MQ7B 3BH9A 3DOIA 3N1PC 4DAGH 3B2XA 5J5EA 1G0YR 2A0LD 2I7OA 1BIIB 2MPVA 3M86A 3NAAH 4L3FA 2OMWB 3Q01A 3CGTA 1RFDL 4ZO7A 4OJAA 1P5VB 3ZYOA 2A9BA 1J9SA 4Z0BL 4B60A 2WZ0A 3N41B 3DSNA 4WAFA 2HCZX 1HN1A 2DYPD 2UV3A 2Y24A 3QUKB 2CBOA 3H9SD 5FEBA 4DVRL 3G04B 4JFHE 5FAAA 4MS6A 1XF2A 3WFBL 4UOZA 4WRLA 1TJGL 5D96C 1N6UA 3OSVA 5CCHE 1A5FH 4XNAA 5E9DB 4FQXA 3LHPH 4XOEA 4KO6A 4ZFZA 1NCWL 3SGKA 3MLTB 1NIFA 2UY6B 1AO7D 3FQWA 3FFOA 4MFHA 3ESMA 1Z5LB 3LZPA 2ICWJ 2DKUA 2Z93B 2OSLA 2VLME 4XN8A 5LAXA 4N5UA 1OZUA 4J3BA 4JKPL 3D39E 4MDRA 4O51A 4Y4KC 1MFAH 5HI3D 2ZCZA 4HG4K 2NPLX 3PUUA 2YD2A 3HUJE 5DFVC 1VJSA 5C0FB 5IQMA 5HVHC 4AE0A 4F15C 3MRIA 3QUXD 4QTFA 2P45B 2HG0A 4MD4B 5AAWA 1JN6A 3EOTL 4E9RA 2O5YL 3K2KA 2WVTA 4BK4A 4QRRA 2VB5A 2Z9TA 1VHPA 3GI8H 2EEBA 4LEOB 2KZBA 4F7TB 3FFDA 4HJJH 5ANMB 2BY1A 1FFOB 3G6JE 4JZOB 3QIWC 3VI4A 3MV9A 3V6ZA 5DZPA 4PRIE 3VXQA 1P5UA 3B2VH 2KYIA 2PPAA 3SKJL 2BSED 2QZ5A 4YPJA 3TPUA 1M1SA 1NL0L 4OFIA 3QDMB 2IAMD 2JCCB 4QCIA 3AUWB 4HUWB 2I5YH 1DE4B 1NM9A 1NFDF 2QPFA 4JG0L 1QW9A 2W0PA 1MZYA 5GZOD 4ELMB 2P47B 1RZIA 4PRBB 3KM2A 4DW2H 3WFBH 4H26B 2EDOA 5E8PB 5L6YL 3THMH 1QD0A 1NC4A 5DJCB 1X6NA 3EYUL 4JCMA 4NNYA 3P9LA 2VMEA 2UVFA 3BP7A 4JKPH 4LSVL 1MVYA 5FK9A 4M61A 4P9HC 3UMNA 1KIQA 5BS0E 2OMXB 1JZ4A 3FQ2A 4JREC 1XTMA 3WNMA 1GS6X 5HYSG 4N0FB 1YRKA 3MRGA 3O3EA 4QF1B 3Q1EA 3ZYJA 4OZGB 4PB0L 1WA1X 3UBXG 4CU6A 1YN6A 4ZOEA 1OAJA 1GGCL 3DPBB 4I3SH 4X42A 1PLGL 3EBGA 4GEJA 1SJVA 5D7JA 1ILUA 3L4YA 4I2XB 2XV0A 4IRJB 4TVSa 2AXFB 3ESPA 4N2HA 1JGDB 1GGUA 1OGSA 3VWJC 1PSKL 4XAKD 4HIXH 3RZCD 2VO5A 3SKJH 5C0BE 2XRAH 3IFOA 1NL0H 3PWVB 4AT6A 2NY5L 2CA4A 4Y1SA 1NBVL 1KT2B 2NTFB 3B2UC 4PEEA 4LVOC 4WW1B 1N5YL 1ADWA 1K2DB 1IBDA 3FQTA 3MV7B 5IK3B 3MNWB 2GIXA 5AZEH 5HDLA 3SY6A 3W5MA 2P8MA 3BUDA 1IC1A 1FSKC 1EEZA 4W4OC 1DZBA 5L6YH 4UU9A 4B9KC 1OVZA 4MRBA 3TN0C 1JGVL 3V5HA 3I3DA 2BNQD 2O26U 3IJ9A 2PWGA 3AZUA 2CLVB 5TPWL 3EYUH 5DRXA 3GJEB 4UQ3B 3IS1X 5HYEA 3H4FA 3NOIA 1A6TA 4NC1E 1IFHH 5CEZE 5DRNB 4LQ1A 5C07D 2XV6B 2P4AB 4JG5A 3U36A 4CVZB 2O30A 1H8OA 1VIWA 4NIKB 1OT1A 3NIGB 4UQDA 3GMQB 4HZ1A 3GJFA 3MC0A 1CE6B 3DX2A 3V6OA 2FJFA 3HFMH 2X2YA 2YD4A 3FDWA 1GGCH 4ZFFA 1PLGH 3CC5A 1MPAH 2OTUA 5AVTB 1IILE 1NLDH 4PJ8D 1T6VN 5E2WL 2QVKA 4HUCA 1TQBB 2ENQA 1T21B 1PSKH 3GM8A 1CU4H 2H3XC 3FSWA 1G9ML 5CJXA 2Y07H 4WSKA 1IKNC 3RX8A 2YKKA 4AYBA 2DEYX 2A9ML 3PUCA 4FQHB 2MEJB 3S3DB 2CKBL 3VFOB 2ZYRA 5I18L 4ADGA 3ALPA 1A9BB 1I8IA 3VD0A 3MRBB 2CLRB 5JUEH 5E6UB 3ROLA 4F8PA 1K8IB 2V2XB 4FCAA 3X12B 4QRFA 1X5JA 1XD1A 3KBHE 2VISB 4WSGA 4NFBA 1G7MA 4RIRA 3KYNB 1NGQL 3DMMD 4TV3A 4Z76B 1CD1B 5TE7H 5TPWH 5EU3A 3WKML 4FQLL 2NT0A 5GGSY 1YMMA 1ACYL 3UAJA 1FZJA 4IBZA 5D71L 3L4XA 3FQXA 1KGJA 4WQOA 1DYZA 5AALA 3UBXI 4QEGA 4M5TA 5FC9A 4K7FA 3Q44A 2QGDA 5F9JB 1XF5A 1UJTA 1WCBB 3CBRA 3UERA 4RAUB 1J05B 1HT6A 5D2NC 5ECGA 3VXRA 3WS3B 2BSSA 4AGPA 4AVKA 2WYZA 5LBSL 3WUWA 1GJIA 4G7VL 4Y1AA 5SWSB 2X89D 5HD8C 1VLXA 5CP3H 4CMMA 4IJTA 1BFVL 5TDPA 43CAB 2XYCA 4OZIB 5BQDA 1OSZB 1T0NB 1MVFA 7PCYA 2WUBL 2X1WL 1BJ1H 3PWPB 4ZTEA 3VFMB 5J89A 1GOGA 1XZ0A 3N91A 2K45A 2YBRB 1A7RL 1BQ5A 1JHLL 1G9MH 1IIKA 1Z9SA 2WOBA 2H2PC 2WXOA 4KRMB 4NO0B 1YCSA 2BW4A 4HJSA 2ZSVA 2EDFA 4FXKC 4RRPG 4KZDL 4K4KA 2CKBH 4JZNA 4UOJA 2QTEA 5J3HC 3SD2A 3SDDC 3P4OA 1OPGL 3QCVH 1P4IL 4ZTPH 2P7TA 4PJ5A 2QQNL 4XVTH 3UTPD 4FHBD 4X4YB 4N87A 4GP8B 3DOSA 4LU5H 1IEBA 2F8IA 3IN2A 3LNGA 2DMKA 1HXMA 1HHJA 1TJXA 2XTJE 4LNRB 2NCMA 1UD2A 5E99H 1F1GA 1CF8L 2ENPA 1RUKH 5EG6C 1N5AA 3IYLW 4LSRL 5HHOE 2OZNA 3WKMH 3I6KA 3F12B 3GXDA 1AE6L 4HJEA 3KLDA 3RWDA 2MNWA 5EZOL 1JXJA 1Z2KA 2IO5A 2ED6A 1S5HB 4Y4KA 1QR1B 4PJHA 2ZSWB 5KBLA 4A66A 2PLTA 4XRCB 5T8IA 4ZMOA 3L1EA 2NNCA 2BERA 3DBSA 3S3BB 2IAAC 1QVOB 2F74B 4EEEA 4JY5L 1CI5A 1CMOA 5KOMC 3CSTA 3OJ2C 4NKIH 4CW1A 5INDB 3K1DA 4HD9A 3U48A 3TBWA 2G3NA 4BCZA 1JZ3A 4A04A 4FNRA 5C2BL 2FDBP 3QIWA 2TSBA 3V4LA 3QDJE 3VXUA 1KY6A 5EUOA 1ET8A 1ZEAL 3IJEA 5DC2A 3L4ZA 3HG5A 3T4AB 4RMVA 1C12A 3TBTA 2ROYA 2FQDA 5I71B 1T22A 1A7RH 4F9LC 1UCBL 4KKQA 2EE0A 2CMRL 3T2LA 5JW5A 2GK2A 4BSJA 1IIIA 5E6ID 2VLKE 3HE6D 5HDRA 3VH8A 4KXCA 2GITA 4OUUA 2B1AH 3C8KB 1P4IH 3F84A 1THAA 1FIEA 1Z9MA 1ZCRA 4XPAH 1U0QA 4M6NL 1G7PA 3V4VB 4HOZA 2Z8SA 3SYOA 2Y1AA 2ATPA 1CF8H 4LSRH 4CU8A 5E7BA 3F6JA 1AE6H 1WFMA 4JFEB 1EJOL 5EZOH 1IAOB 3GSUA 4ELKA 3FSAA 2LVEA 2WJ5A 2W0KA 2N7BA 3F7PC 2Z3FA 4P2RB 5KSVA 4Z8FL 1QBAA 5KSAB 4TNVK 1HH9B 1QTYT 2X4SA 3DHPA 1L9QA 2XQ0A 3GI9L 4TS6A 1E27A 3TBCA 2XNAA 1JF5A 5GZNC 3CHRA 5AFAA 4JY5H 5IJVB 4GRLB 1ONQB 4TUJA 3ZTDC 5EN2B 3B2DC 3HAEA 1I7ZB 4KAQL 4DEPB 4DP7X 1MFCL 3T0AA 4L2LA 1BXVA 4DP5X 4XPHL 1DUZB 4KQ3L 4AITA 3MRKA 3N42F 2Y2WA 3MOAH 4X5XA 2ZX5A 1IVLA 3S3JA 1IBFA 4OD1H 3ULUC 2IH1A 1E9OB 2YWYA 4HH9B 2ZOKB 3ZSSA 2C8NA 4H20H 3BDBA 3FUDA 4JAMB 3TBSA 3VWJA 3ZDZB 4H8QA 2E0PA 1QLFA 5A2AA 1LE9A 1FFNA 3D50A 4CMHC 2D7PA 3FBKA 4HKXB 4NO3B 5CJOL 3QRGL 5E08L 2WVVA 3B2PA 4YFDB 1MCRA 1LK2A 3PV6B 4XWOC 5HYQA 1KTCA 3UDWC 5GHWH 1AO7B 2BY0A 1NOFA 4TRPL 4DN3L 3FB7B 3ARDB 3QEQA 3IEAA 4P5MA 4HGMA 2G60H 3S8GB 4M6NH 1UYWL 4W4OA 5D1XC 4DCQA 1DCEA 4EMZA 1T0PB 1U8HB 5JTWA 2QADC 1TNMA 1DQLH 3GZKA 2B16A 3TN0A 3WNJA 1JK9A 3PJNA 1XAUA 2IPUK 1DFBL 2GBAA 3EIFA 2YD8A 4KHTL 4AQ1B 1OTSC 1EJOH 3D85B 4YSUA 4NZDA 1KIPB 3DX8B 5AAMC 1T0OA 5JNYA 2HFTA 3QC6X 5T3XL 3BDXA 4F33B 5T1LD 5KBNC 1ZVHA 2BIQA 4KQ4H 3TYGH 4Z8FH 5L8LB 1KYDA 4PLOB 3EG9A 2Q9OA 5F7NC 4OQTH 1NMAL 1KXTB 2NX5A 3DYOA 5LG6A 2X6BA 1H3UA 5J06A 3HC0B 1SEQL 4KAQH 2H1LM 4HUMB 2OX5B 2OW7A 2E7MA 5TDNA 4XPHH 3MA7A 4KQ3H 2XVLA 3APMA 2BNUB 1KJMA 2WIMA 3IDUA 3D2UD 4N9GA 1IKNA 3CU1A 5T1MB 4HG4J 1RUMH 3QRGH 4XBPB 1J87A 1L9PA 5CJOH 1DO6A 1WZMA 3HUJF 2BZCA 3ARBC 5I26A 2YZ8A 3JYCA 2WLYA 4GLRH 5DZJA 3SZKC 3RWCA 4QYOB 2UVEA 2WNXA 3P0YL 3D7PA 4DN3H 1U4FA 5KSUA 3IMWA 1A22B 3CFJA 4KMQA 4PWHA 5TGBB 4AEIH 4C54A 4F58L 1C5BL 4PJFB 2IWEA 4X83A 3T77B 3G6JF 1INQA 2XFXA 4I13B 3AU1A 1XCXA 4Z7QB 3EJCA 1KB5A 4LMQI 4PRHD 2D7TL 4UUJA 3RAJL 4KHTH 2E8ZA 4ZMTA 4HXBL 4ODWB 4O2EB 1LO3L 5CWSB 1BQHG 4IIQC 3WN6A 2VDOL 1XR8A 2R1WB 4WTZA 4G6AD 3CZEA 2A99A 3MRDB 3ULSB 2OMZB 3U9WA 5C08E 3GS7A 1D6VL 2H1PL 3K2UL 3LEXB 3WDHA 2HRHA 3N43B 1UVQB 3BPNC 1XL6A 2R51A 4FG4A 4TSBL 2AK4E 4AG4L 4WV1C 1FVDA 5D2NA 5MEQA 5D1QC 2Z91B 5IG7A 3S96A 1H5BC 5LXGH 1UH3A 1A7OL 3KS0J 1N2RB 1KSRA 2DIAA 3EOYG 3ZN6A 3B37A 4IEFA 4GKLA 5IF0B 5F7FA 3QCUL 5FXCH 4CJ1A 4R7DA 1QPPA 1RH8A 3EF4A 3KCPB 1Y6NR 4XVJL 2HVBA 5JIKA 1XTLA 2HPTA 4F57H 1DDTA 2B59B 3QNZB 1PJWA 3B9DA 3HBQA 4CJ0A 1M7DB 1YYML 3D9AL 3DVFA 4R26H 1IZKA 4UQ2B 4FXKA 5CBAB 4QHLA 5G5DA 3LH2L 4HWUA 2C3WA 2IG2L 2BNQB 2HSIA 2WAHA 3D0VA 4FE9A 5LO7A 3WGVB 1EEQA 4NSKA 3SDDA 5AVYB 4YSDA 4ZXBC 1O6SB 4UNTA 4UT7H 1F11A 2D7QA 4YSAA 3VI3A 1JGUH 3CXFA 3MLXL 5FO8B 1YY9D 1L4IA 2J8OA 2VDKB 2P5WD 3HG1D 3VXSB 4WEBH 3W2DL 3L13A 2DWSA 3IGLA 1QSFA 4JFUA 4TKWA 2JKWA 2MTAA 4N8VB 3U1PA 2D7TH 3JTBA 4BELD 2VLRB 3HJ0A 3SQBB 5B3JF 2JB6B 1LO3H 2VC2L 3BRFA 1AKJD 2C9SA 4MMXB 1AZUA 3BW9B 2N7SA 2R1XB 4UAHA 4KTEL 5F7AA 2BS9A 2CA3A 5HJBA 4MQXD 4N20A 1JV5B 2H1PH 5CCKL 3MNZB 4PYHA 1J0JA 4EI6A 3M8OL 3AMLA 2DW5A 3WCYA 1TCRA 4A7UA 4TSBH 4NZ8A 2R2BB 3MLVL 1V55B 2QKIC 2A38A 3DX6B 3EO0A 3EJZD 4B0MM 4IOFD 1MLCB 1WIUA 4YJZL 2WLMA 4JG1H 2G9HA 2PABA 4R4FL 1JPGA 4F2MA 5E56A 1W8NA 7FABL 3MOQA 4MAUL 1E5UI 4YHZH 5TQ0L 2Q6WB 5IBLD 4XVJH 4JL1A 2BHZA 1P4UA 1QFHA 3SOBL 4NN6B 3NCWA 5FECA 4F9LA 2ESVA 5JOPE 3BPOC 3D9AH 1NANH 4OZ4A 1QOKA 3DMMB 3VG9C 4PVNA 4X4ME 1ZGLM 4GG6A 1ASPA 1JYXA 2D0GA 4ANVA 3QEGH 3X11A 2BIHA 4BSVB 1MH5A 3JQOB 4NKMA 1MRFL 1UWXK 5ILTH 4TNWF 1ZT7B 4L29B 4XBEL 4OSUH 3HZKB 4YDIL 3E6HA 1FL3A 3NJNA 1F0LA 4MYWB 4OIIL 4YDKL 4ZYKB 2FJHA 2Q86B 5C0RL 1ZK9A 4NKDA 4W9DC 3PDDA 3QARA 5E5MA 4AGQA 1T3FA 1UT9A 4OFVA 3PP3K 1R6VA 1EK3A 2ADGB 3KXFA 1AD9A 4GQPH 1QSVA 2GUOB 1IGCL 2IXQA 3GMOB 4Z3HA 3T6QC 1CDGA 5K9JL 1RI8A 1WBZA 3PQYA 4FABH 4NX0A 1L9MA 4EQ2A 2NY3D 4FNSA 4KKAC 1HI6A 2JKTM 5CCKH 1EJ8A 3EOBA 1SRDA 4YHKL 4YGVB 2CIKA 2F8XC 1SOQA 2VRQA 5GJSL 1P7HL 4YIQA 4AEHH 1DBAL 2DQ6A 2HFGL 5JMRA 4M5YL 1MFBL 5GZNA 4Z3FA 1SDAB 4H4NA 4ZPVA 4FQPA 1TPXC 1JV2A 3L2NA 1FA4A 4M5ZL 3IU4L 3KGRA 4RRPM 2QT6A 3HEIB 4CDGC 2FBJH 2LLLA 3L45A 4J6IA 4HV8B 1DLHA 2AEPL 3EJSA 3BUQA 3TVMB 5TQ0H 1DBMH 4CVXB 1TTGA 3V4PL 4NDMB 4M9OA 4K94C 5B1BB 3OLEA 4L37B 3PGDB 4UZUA 4ZO9A 2OMUA 4WW2F 3ABZA 4RGMB 4KUZL 4ZJ9A 3GXFA 4FF9A 3UDWA 4GXVL 3IK2A 1L7TH 4D9RE 3X13A 1CIUA 1D5XB 1OAXL 4AZ8B 4HS3B 4B50A 5ENWA 3HPLB 1YDPA 3UTZB 3L3OB 2VAAA 3RYMA 5K59E 3EJJX 3BAYA 2JCWA 5D1XA 2YEZA 4YDKH 1Q9WB 5JA9A 2KQMA 1A1MA 3OJMB 5DA4A 3RFZB 1WUZA 3AUVA 3BJLA 1G5AA 1TQSA 5IGXH 3AACA 4I3GA 4OAWB 1AR1C 2C1PB 4PJGE 4TULH 3BAEH 4TVUA 5K9JH 1DQML 1ZSDB 1CB4A 2VT0A 3HLAA 1WSST 5AAMA 1HAUA 5JOFB 1A6AB 4YR6B 3VD3A 1F4XL 5JLZB 4UQ9A 1LWJA 4KQ0A 3NTCH 5GJSH 1LYQA 3KZ8A 2QV4A 1HXKA 1CLYL 1NDMB 3BISA 2VITB 1MFBH 1DLFL 1OF2A 3NJLA 1I8MA 4FFVD 1CVRA 4FJ6A 1PFOA 1NFKA 4KZCA 3UPRB 1HE7A 2G5BA 1IQDA 3IU4H 2WQWA 1S8DA 2AMUA 5KSBE 4HW6A 1CFMA 3MYJB 3RVTD 5DJDB 2AEPH 2PNDA 1ZA3A 3KPLA 2MSPA 3KPMA 2W91A 5FW7A 4KKZA 4PJ7B 4ZS7H 5HYSA 5ISZB 4L5FE 3V4PH 1UFGA 3MRFA 3EH5B 2GUYA 5DS1A 1Q9LA 4N22A 3L5HA 1E7VA 4PS4L 2X2JA 5AUMB 4ZD3H 4DGYL 3SDCD 3UBXA 5I1AB 2VNCA 3EYQD 4LLUB 4LOFA 4JZJB 2FX8L 2NY6C 2DAVA 3SO5A 3QQ4A 1C5CH 3LPGA 3ARBA 2AKRB 4EN2A 3IBOA 2F9BT 3HA0A 1JFQL 3MJ8B 1N67A 5FF6B 3NCYP 4P4RB 3FPXA 5BVPL 3QJZA 2CLZA 1AR2A 3W38A 2EYRA 4KPHL 3DXAE 4CKQA 4HJ0C 3SGEI 1YYCA 5DJAA 3FB8A 4OCSL 4LCCB 2PP7A 3NJGA 1JRHI 5C0AB 4OZHB 1SXNA 4GKNA 4NCC2 4YBLC 3STZA 5IKCB 1SLWA 3Q8EA 2OK0H 5GS1B 1SYSB 4XHJC 2FX9H 4IIQA 1TVHA 5IEHB 1DQMH 3VB9A 3CN1A 4HFWB 3RWFA 3P3UA 3QUZC 2BWQA 5BNXD 4PBVC 4CDHA 2GK0B 1F4XH 2VDRH 2XPYA 2NR6D 3MUHL 3PNWA 4RMWA 4Z7OE 4K7PL 2WIIA 1QQDA 4YDVB 1ZPUA 3BUYA 4ZQTA 4I87A 4L8CA 5DEJA 3PIQA 4WV1A 1MJJA 1NBCA 5CEYA 5JZ7C 5D1QA 1F6AB 1NUDA 3ESUF 2Y6SD 4NWTL 1EZLA 3MRMB 1H5BA 2IQ9L 4XO5A 5EN3A 2DQEH 2ZOWA 1U21A 4L8SB 1ZHKA 4N0UA 5KVFH 5GSRB 3BKJL 4GKOA 1NBZB 1H3TA 1TDQA 5GS0C 4JFYA 3MJ7A 5JHLA 2LGNA 2V2WB 1AZCA 1EAPB 1HL4A 2JXMA 1BQLL 1I31A 5FO9B 1E40A 1MCNA 2EE6A 4PS4H 2A73B 3DBXA 3II1A 5IW3A 3U6XS 5IR1A 4Q8BA 5F7LB 2XA3A 3UACA 1JFQH 4KK8D 4HHAB 5BO1L 3ZZ1A 5KS9A 1IC4L 4PJCF 4A6YH 4IJ3C 2HUHA 2VSDA 1MCFA 4ZXBA 4LLQA 2V0AA 4KPHH 2BVEA 1BVNP 4LGPB 4OCSH 4TVPL 4LHQB 1HCYA 5AOJA 2WJ7A 3BN3B 3NVQA 3UGEA 1XF3B 1D5MA 3FCTB 4PRAB 1Y7VA 1E4XH 2P9RA 2YSSA 3ARED 3DWTA 1AXSA 2CCWA 2CO4A 2HFEB 3GMPA 1EDHA 1LDSA 1E2ZA 3BDYH 4L1LA 4PBWD 4UYPA 4CAGA 4K9EC 3HTLX 4XX1G 5ETUB 2DWTA 4WKZA 3A4FA 1EA9C 3KE0A 1KENL 3AWGA 3BFWA 5DYOB 1A2YB 4K7PH 5F3HA 1ZGLA 3B83A 3L7EB 4P46B 5I8EA 2QKIA 1A7NL 5HGDA 1WBXB 2NZ1A 2ZOOA 3LYRA 1XF4A 2HT4C 1J0IA 3D2UB 2CKBB 4FCHA 4LDEB 3B1TA 4PGDA 1ZLUK 3KPPA 1FNHA 4IKIA 3NFSL 3ZUNC 4FNQA 3TP4A 4PJBE 2NMSA 4FS0A 1IC5L 3ECQA 4C56B 3LQAC 3RVUD 5DVMA 4F8LA 1JAEA 1SYVA 1XFPA 2IQAA 2X1OA 4I85A 1YPZA 4WLCA 3CZKA 4MKTA 3UGUA 2DDQH 4D9QE 5AB2A 3GF8A 4QMEA 2GJ6B 4H8WH 5DT1H 1KTDB 1EEYB 1KG0A 2X4OA 4PRHB 1JF1B 5DA0B 5FYLE 3TV8A 4PLKC 3ZDXB 4AW4A 1JDDA 2V37A 3GSOA 4YC2B 1SMDA 1RQ5A 4UTBA 3GDBA 4X7SL 3MRLA 3E80A 2LE9A 2HFFA 3HPJA 2NRDA 1UA3A 4KMTL 4XNBA 2EO7A 3CZNA 5AKVA 1NAMA 4TVPH 2QPEB 1MI5B 3GEWB 2V9RA 4RRPA 4XGZB 4JLRA 4DPCX 2J6EA 1SFDA 1DQKA 2AQPA 2BNRD 2WWNA 3KDPB 4GT7A 5DO8A 5AVRB 4ATWA 2PW1B 4KK5D 1RZPA 1AG6A 3ISWA 1SZNA 4LEBA 3WUZA 5E00A 4IU3B 1KENH 4U1KA 4HAGA 2Z1KA 4LLDB 4PVLA 4DGVL 4NM4H 4NENB 1NUGA 3OZKA 3TNNB 3GD1C 3JVGC 3H3PL 4WUKL 1R5IB 1VZIA 1S9WA 4J3OH 2IH3B 3MRPB 2QGEA 4EZMA 1IBBA 2DBLL 3N1GC 1UZGA 4RVBA 3GLEA 2Y69B 2H8PA 3JWNH 3ZL1A 4CGTA 2WBWB 5D5ME 5HSFA 3UEQA 3NFSH 3EGXB 4K8RL 3L3GA 1DEEB 4LP8A 5E2UL 4TNGA 5IW6A 2ETWA 5D70H 4Y2OB 3MNMA 4X6CA 5AKTA 5CKGA 3NIDF 2IBBA 4U7SA 3HS0C 4YUEH 3QS2A 3APCA 1A3RL 1RV6X 1KLUA 3QXWA 4JM2F 2VGLM 4GO8A 4LOUD 2QSVA 1CGXA 1JNHA 4PJDE 5E8NA 4FMVA 1G9EA 3CVCA 1J1PL 2CR0A 5EBLB 2HKHH 4Z7UB 3JWDL 4JRYE 3L3DA 4Z7WB 1PZ3A 4KMTH 5HJ3B 2SODB 4GIAA 3S6CA 3TPKA 4XB7A 3NFNB 3VX0A 5IHUL 5DLLA 3TBYB 3HKFA 1RHFA 4MCMA 1VZHA 5JW3H 3UL4A 4LVHC 4N2BA 2VWEC 4JFQB 1XGQA 4W6XB 3BAXA 1KGCD 1GGBL 4HC1L 3HW7A 2Y4SA 5L2JA 2HG5B 3BOVA 4NQEE 2ZUVA 5DR5L 5L4IA 5IROD 4F1ZA 4DGVH 4LSSH 1EO5A 2V9UA 1JYVA 4POZD 2J1KA 3S98A 4WUKH 1GMEA 2JKIS 3LVEA 3TS8A 3KYAA 4WFGD 2DBLH 5LBGA 5K1NA 1FO0H 3MDJA 4XP9L 3QAZB 4E9TA 5IMLA 1I9JH 5KVEL 3CBKB 3BXNB 3CVHA 3MREA 1IX2A 5E2UH 1ND0B 2XY2A 1WFNA 2CRZA 3BYYA 8PAZA 1YC8A 3GMMB 1V5JA 1S3KH 2DM7A 3SOTA 3US1A 3NZ8B 2O6PA 4JRXA 1TIUA 3GBLA 3TV3L 1GY1A 1RUAL 4PUBH 4KKNA 2QHRL 5BVJA 1J1PH 3KEDA 1Z9OA 5JXED 3RILA 3NA9L 1PD1A 2E9GA 4I88A 1N19A 4NQDA 2H4EA 1VFAB 3Q5TA 4ABUA 4UQEA 3CSGA 3DYMA 5LAPA 2KPWA 3NCJL 3MJWA 1OP3K 3AXLA 4L8DA 1A8JH 2DWEA 5KVMC 3UTSE 1D6EB 4LP5A 2JNZA 4N8CH 4O2CB 5BZWB 1K8DA 5ABZA 3UTTD 1TG8A 3NCXA 2H2SC 5DTFB 3T08A 2WLIA 3QUZA 1GGBH 2VMCA 1TZIB 3MKKA 4G8GA 1DANT 4QOKE 3U9PH 3IFPB 1DQIA 4HCRL 1UA6H 5JHDA 4XMKL 6FABH 4NUQA 2X0UA 5LBVA 2FX7L 1QEWB 5D93B 1NAKH 3DUUA 2X3BA 5AAPA 1ID2A 2YPVL 2ZCHH 3AU0A 3IRZA 5AW4B 4EPSA 3KS0H 3IN0A 1BF2A 4GUCA 4PV9A 3D33A 3LV3A 4HWEL 3MRCB 5ESAB 5B1AB 3T0WA 2AJ3B 1DL7L 3LRMA 3O45B 3VDAA 5I1KL 2VR4A 4ZMWA 1OK0A 3E2HB 3FUIA 3QXTA 1ET5A 1URIA 3TESA 3ULVC 4WJ5A 5EU5B 3IDGA 3LKQB 4X7DC 4P3DA 4U1MA 4XOCA 2AQQA 4NJAL 1J10A 2DV6A 5DU7A 1OOWA 4BH8A 4AYMC 4V1DE 2UY7A 1NPUA 3H9HB 1S7VB 3NA9H 2CE6A 3EYVB 1OB1B 1ZA6A 4X7CC 5DD6B 5ITBL 2WOYA 3I3BA 1MOEA 3MR9A 4G9FA 5IP4A 1H6FA 4LSQH 5HPMA 1R3HA 4YBHA 1KN4L 3VD9A 1INEL 1WS7A 3OVUB 1ZTXL 4IRJC 4APQB 3QZWB 2EDWA 3CHSA 4LPYA 1UXLA 3V0DA 2YLHA 2X1QA 1NIBA 2AJYL 2BMKA 4R9HA 2IAND 2XVBA 4ERSL 1D5IH 2MCPL 4JS7A 4WHYG 1YNLH 1ASQA 5C0IB 5H35B 1EV2E 3ZIMA 4KKBC 3OKMA 4Q6YA 5CLWA 2OMYB 4AI7A 2V5RA 4N26A 3VXRE 2F8VA 4YPGA 4XMKH 4BJLA 3JTSA 3BFOA 2E4TA 1KTLB 1BQHA 4Y1AE 4E9WA 3I02B 1F1AA 4OGAC 1WAAE 2K6WA 3N6YA 1XCTB 2YPVH 2XXMB 5K59F 3CDYA 4MZ3A 4NEHB 5KUMA 1X3DA 5L88L 1BZ7A 3P77B 2VR8A 1V7NL 2VJXA 4GAGL 1DL7H 5JHMA 5I1KH 1G94A 2DJUA 3MGOB 4UDUB 4XMXA 3BVNA 4PJGF 1JZJA 3QEHB 5IOPA 1W0VB 4XMLL 5AYQA 3CXHJ 2LW3A 2L7UA 2YUWA 1OP4A 3JV4A 4W9LC 4XE0A 4R3SB 2W0FA 2OZ4H 3MXVL 4UV7H 4EXKA 5GGTL 5TJWK 4RGNE 2Y36L 2F7OA 2ICWB 1NFAA 1ZDQA 2J72A 4BUGA 1U8KA 2ZCLH 5K93A 2WGXA 5FLUA 3RGVD 4OTXL 2WZPD 1FPTH 1MJUH 5IVXE 2BM3A 3TCLA 1OTUC 3FU5A 4BFGA 3V79C 2ATAA 3P2TA 2ZP0T 1H0DA 1Q1JL 1QR4A 1QI3A 4UM8B 1S7WB 1EH9A 3SYQA 1INEH 3J7HA 5F9DC 1ZTXH 1JWMA 2BCKA 2BRRL 3QJRB 4IGBD 1TQBC 5J13B 2YS4A 3WAKA 4XVSL 4MJIA 2AJYH 2GIMA 3L9RB 3O4LE 2IDFA 2C9QA 1HHKB 1AHKA 4HP5A 4N8VG 5I9QB 4BE6A 1X44A 4Z0XB 3REWB 1YUKB 2W0LA 3A24A 1PY9A 4OZFH 5B38B 3JVGA 1Y6KR 4YEEA 1PIGA 4DKEL 1CLOH 1RZKL 4JPWH 3ATEA 1K6QH 4JFDE 2QMJA 2H7WA 2X70B 5F6HI 3RY6C 1A1OA 4BV1A 4X8XA 3UYPB 2G30A 2C9VA 2Y3AA 4FMFA 4YK4B 3SKUD 2HT3C 1HH6A 1T4WA 2Z0BA 3KHOA 3MOBH 4GAGH 4AYGA 2EILB 4FJZA 5CU5A 4S2SA 3ABLB 4B9YA 1SUJA 3HS0A 2HXAA 4ZW3A 1S9XB 1MNNA 5E2VH 1RCYA 3AMKA 4RFNB 5E0FA 5GGTH 1QLRA 5CLZA 4N90E 4HXAL 4Z7OF 1W72A 3EYOB 3FO1A 2J1ZA 3MODH 1IC7L 2WTRB 4NRZB 4R2GB 4LLMB 3F2LA 2X9YA 3FRUA 4OTXH 3TYFA 4WEUD 3TBVB 4ZX4A 1XH0A 1LEKA 2AVFA 5I8OL 2OMVA 2VDNL 2BP5M 1Q1JH 4OF7A 3T65A 4KK9C 3CMOL 2BOCA 3F6LA 3BWAB 2BIOA 4WTQA 2CDEB 1YEHH 3WIHA 4W9ZA 2F1BA 4QTHB 4APXA 2RQEA 5I1GH 4MQ7A 3EO1B 1E28B 3X1FA 1BIIA 1S9KC 4JJ5B 2Y6TE 4ZFGH 2OMWA 5L8JB 1PZCA 4FG2A 2P49B 4YHLH 5JORB 1P5VA 2R2CA 2XKNA 5AW0B 4MCZB 1DZ0A 2P5EE 1ZGLP 4E0RB 3QUKA 4KRPB 4DKEH 4PVMA 3G04A 3QWOB 3ZJAA 2XVGA 5C9JB 2QHLA 4IRSB 5IOKA 2R69L 2R2HB 4ODVL 1S9YB 1D2OA 1WCQA 5E9DA 2ICEC 1ZV5A 2XZCH 3B4NA 1ZD6A 3HN8A 1Z5LA 3GINA 1BFOB 3GRWL 4YXHL 3JWOC 3HZVB 5GSVB 5INCB 2DD8H 3RTQD 4Y5VC 4JHAH 1CZ8H 4XPBL 1A6PA 3S35L 4W9HC 5IFHH 1YNTF 5C0FA 4HXAH 2VUOA 4A68A 2LR4A 1S7XA 2BDNH 3LEYH 2WBJD 3VA6A 4MD4A 3KL5A 4CSPA 3TL5A 3MRNB 5F44A 1FNGB 1SEBA 4KC3B 4LEOA 3ENEA 2O5NA 4K0OA 1A4JB 4OGQC 3LS4L 2GSGB 2E9WA 5ANMA 5LGHH 2VDNH 1FFOA 2DLHA 4PJBF 4JZOA 1U2YA 5C0DB 3CMOH 1HWGB 1JZ7A 4WWKB 1LGVA 2B5IB 4S1QH 3T4AC 4P99A 2FTAA 5SX4H 1CFSA 1SM3L 4GSDL 1OD9A 4KDVA 4OF6A 3K2MC 1LE5B 4O9HH 2N7AA 4RSVA 2CUAA 4UCFA 1FZOA 3DTUB 3SGDH 4NERA 4WI3A 4G6FD 3Q9PA 3H9SE 2JCCA 4HUWA 3V4PB 1DE4A 2RBLA 3ZTJH 5B8CB 1UGKA 4ZMPA 2PW2A 3PAUA 3TWCH 2F7RA 2I32A 2V9QA 4FKHA 1TJIL 4ELMA 3ZE1B 4PRBA 4FNUA 2P46B 4HPOL 3V4UL 4BZ1L 3QZLA 2J1YA 4H26A 2MNJB 4ODVH 2Z7YA 3UCRA 1BA9A 3NJHA 3FZUC 3MLYL 5A2FA 5DJCA 4U1IB 2HP4A 2XBZA 2WO2B 4QPEA 2P24B 1AQMA 3RPIB 2N56A 3UZQB 2J12B 3GRWH 2YQ3A 1USQA 3KLLA 4XXWC 4P5TD 4NQXB 4JL2A 2GTZB 1JVLA 5FHBL 3V5KB 4U6YB 1MCWW 3C5JA 2F19H 3S35H 5KSAC 1FZMB 3LB6C 1CXFA 2OMXA 2QSTA 3I9GH 4A7VA 5I16B 2GC7C 6PCYA 4JK0D 1OGAD 1H6EA 1VENA 1X5ZA 4IU2B 4ATTA 2X6MA 5GGUB 1T80A 4EI0A 3UG3A 1W16A 4PHZA 4QF1A 2CO1A 4GRLC 1ED3B 2VDRB 4OZGA 4C4KT 2FWOB 2IWKA 1MW1A 3LS4H 1I3GL 4EVNB 4DEPC 2OTPA 1EO8L 4HIJB 5D5MF 2A1WL 5TQ2H 1N64L 2XQYG 5CBEB 1T20A 1UUSA 4BK8A 5IB4A 4IRJA 4I2XA 2F7PA 2AXFA 3EAKA 1JGDA 2YPLD 4DEUA 5A16A 1SY6L 5C09A 3POCA 3S34H 4MZIA 4NFDA 5JIQA 1WWBX 2XWJA 4IDJL 15C8L 3QR1A 1B0GB 3PWVA 1PZ5A 1KTKE 4FOMA 2NTFA 3BGAA 4WW1A 4NNPL 1K2DA 2D3VA 4WI8A 1K5WA 3MV7A 4PJDF 3OKLB 3ARDC 4XMPH 1KGYE 4UQIM 4X98B 1E42A 4HPOH 4KJYB 1ROWA 2J21A 2KL6A 4A6YB 4OIBA 5IBTL 3ZE2B 3CSBA 3MLYH 2CGZA 1NGXB 3O2VL 2UYLB 3ARGB 2CLVA 3SE8H 4AQ1C 3QJOA 5ITFA 4UQ3A 2OAAA 3ZGIA 2M2DA 4V2BA 1MEXL 4U3XA 3TCXA 1CUOA 3HBGA 2G4GA 4LDCA 4Q2ZA 5DRNA 3MBED 2CD0A 3IAPA 4OF3A 5I1JH 5D2LB 4BGLA 3JXAA 4PJEE 4KVCL 2WXMA 3T0ED 4Q97A 1UATA 3QORA 4CVZA 3QQDB 4AUUA 5C6TL 1V8HA 1F4WL 4ZOBA 2IJ0C 3HJEA 1C5DB 3TIEB 2EXWD 3OPUA 4FG6D 5FWRA 3WLBB 5JIDA 2EZ0D 1CE6A 2BSTB 4QI3A 1I3GH 3LKNB 4ONFL 2OV0A 2PPCA 1EO8H 1RL1A 2P3YA 3O6FB 3WTYA 3Q8CA 3ZOAA 3QB7C 4AYID 5FPIA 2YAMA 4XAKE 5LNGA 1KXQA 1KWKA 3ATBA 1MNUL 1RUPL 3CHQA 1SY6H 1J8RA 1UM6H 1T21A 3KYMB 3O4OB 2YMXH 15C8H 3L3IB 5CKAA 3D25B 12E8L 1PJ9A 2AXJA 5EH1A 2Y1ZA 3BI9X 4DUVA 3IMVA 4FQHA 1MHHB 1HKFA 4OFYD 4WY7L 1B0RB 3B7TA 4XZUA 3VFOA 1TTBA 5KJRL 1NGZB 3OGOE 1A9BA 1IGIH 4NO5B 5MEOB 3KDMA 4ODUB 2AITA 4I77L 2LFGA 1K8IA 2R1YB 2V2XA 1B88A 2B1HH 4Y4FC 3X12A 4ZW8A 1L9SA 1HKLL 5TE6L 2VISA 4S1SH 3RY6A 5IZ7A 3D05A 1L6XA 3IAGC 4M9PA 3KYNA 1FDLH 4PAZA 3RY5A 2FWSA 5D4QA 1CT8A 1CD1A 1CDHA 2NTSP 3VGAC 1KCRL 2ADJB 3C9NB 4CC1A 1DQJB 2Y5TB 5C07E 2J4WH 3LN4B 4GUPB 5J1AB 2AW2A 4EZKA 1EFXB 1G9HA 3DI2B 3H6AA 4PG9B 4HS6B 2ZOUA 1L9TA 2IDCA 3QA3B 4GMSH 4GG6E 2X9XA 3EGDA 4HETA 1OT2A 2ZUUA 4ORGB 4QY8B 5HI4C 5F9JA 4RMBA 1EZVY 1WCBA 4WK2B 4WI7A 3TONA 4RAUA 4AX3A 3WS3A 2EVJA 4HUXB 4W70A 4EOWL 4NUMA 2DM2A 3AC0A 1XSOA 4CADB 2CRMA 5J1SC 5SWSA 5AB0A 5FW6A 2K9UA 3DX7A 2YUXA 1KPVB 43CAA 4HGKC 5EBWA 5IB3B 4OZIA 1OSZA 1T0NA 1IKFH 1GGIL 4HEPG 4BIKA 4A67A 2W92A 4JFWA 3PWPA 1VDGA 2HLAB 3A5VA 2JTDA 1VEOA 4DO6A 4U6XA 4AIEA 4F7MA 1UM4L 3ML9A 3V8CA 2BWIA 3OB8A 3RL1B 3NZHL 4NO0A 3WE1A 3P9MB 1MRCL 4YQXL 1CL7L 5EBMB 5KBDA 3IGAB 4MX7B 5KJRH 3CSFA 2ZWKA 3C6LD 1NCJA 4ODHL 4QTIL 4BYHA 1U8OA 2OR7A 1WK0A 1L7IH 2RFXB 4PGZA 2HX9A 3RIFK 4F5CA 3CXDL 3DOHA 4LNRA 2AMGA 2ICEA 1DO5A 3UABA 5B3NA 1MWOA 4IRZA 2A9DA 4GW1B 1RULL 1DJZA 1G7HA 4TUKH 1AXTH 4MMXC 5F88B 1OAQL 4FQIL 1JNLL 4HSAC 1S5HA 1IL1B 4Y5VA 1QFWH 3VYPA 5D8JH 1NBYB 4WI0A 1QR1A 3IU3B 4HS8H 3OGCB 3ZXAC 3R06B 3KH4A 4OLUH 4Q4IA 5E2TL 3D6GA 3PV7A 1R19A 1DBKL 1YJDL 5LCVH 2IH9A 3GUTB 4IGBB 2B4CH 2EECA 3U82B 3HG4A 4U6VL 1WBYA 4TNFA 1VFBB 2IGLA 3SKOA 1WAAF 4LT7A 1BSIA 4JR9L 5J56B 4XNMB 5D1XE 3O3UN 2X1XR 4NQVB 4XNXL 2F68X 3WDIA 4D0DA 4FA8A 1A0QL 1A6ZB 1QSZA 4YSCA 1UXSB 1A4KB 1PKQB 3T4AA 3BT0A 3IMTA 5A3IC 1FO0B 4XVUC 1UM4H 4HJUA 3KPRD 3RE0A 4IBLT 2FZ3A 4UIMB 1B4RA 43C9A 1XD0A 4LF3A 1MAJA 3LN5B 1MRCH 3UTPE 5IW1B 3L7FB 1CL7H 3QFGA 4XPFL 3NP4A 2XPGB 4JRWA 2QMKA 1Z0NA 5JQIB 3ML8A 1Z3RA 2MIZA 1N6VA 1OGPA 3MA9L 5KAQG 5IVXF 3DVGB 5CHNB 2JI3A 1R33A 1P6WA 5H37G 3V4VA 3CXDH 1A9EA 2EXTA 3P11H 2X5PA 1DVSA 2NLJB 2EC9U 3C2AL 4L9DA 2Q8AH 1BD2B 5FKPB 4JFEA 1RULH 3F7RA 4JDZB 2I9TB 1QSED 1OAQH 1KV7A 1XDTT 4K3DL 1JNLH 4GKSB 2GHZA 2WLKA 1HTYA 4P2RA 4BBWA 3M1OA 4FQCL 2JI1A 5KSAA 4OU3A 4XAWL 4CU7A 2EDNA 2YN3A 2IOOA 2YD1A 4PG2C 3GJFK 4C83B 1MKFA 1MCSA 4JJOA 3JT2A 1DP0A 3PNRB 2UX6A 2GAZB 1I9EA 4OLWL 5FGBC 2CUHA 4GRLA 1ONQA 2PCFB 1DHKA 3HI5H 5EN2A 4NXSA 5DUJA 4GSQA 1I7ZA 35C8H 4JQVC 1F2XK 4XNXH 1D7BA 1UD6A 4ZO6A 4BZ2H 3TA3D 4M4RB 2X2IA 4YO0B 1DUZA 1JCVA 4QHPA 3ZRFC 5HYFA 3TVMC 4ZMAT 1ANUA 3C09B 4PY8I 4HH9A 5I66B 2NNFA 4LQFL 2DM4A 2AXHA 2WAQA 1RPKA 1JGEB 4HKXA 1J1XL 3C60C 5FA4B 3N40P 1AGBB 1MDTA 2G0LA 4OCYL 3T8VA 2XTLA 4BA0A 3HNVH 4M6AA 2JELL 3F7QA 2LU4A 3FB7A 5D1QE 4EDWL 3ARDA 1T1XB 1GKOA 2N01B 3BVDB 3IMSA 3L3OC 4YMPA 2IEPA 2GABA 4J3UA 4HOMA 1U8HA 5K9QG 5FB8B 5T33L 3RFZC 1BM7A 4AQ1A 3GRGA 4ANWA 4ZTOL 4K3EL 1PIFA 2AGJL 4OB5H 3D85A 1OCRB 4K3DH 1MJ8L 1KIPA 2BVUA 2E27L 3HMXA 4F33A 4NNXB 5CD5C 4ETQB 4FQCH 1E8ZA 2EDKA 5DMYA 1ITBB 1RERA 4W9KC 3OLDA 2UXFA 1URZA 4OR1A 3T71A 3OKKA 2JQAA 4Z9KB 4EKXA 3KL0A 1C16B 1REIA 1UFUA 2I24N 2Y7NA 2JIXD 2EVHA 1F00I 1W91A 2FYYB 5DQDH 5BUGA 1KXTA 1U92B 3FU8A 4OLWH 5C7XH 3MZTA 4QRPD 3QDGA 5FO7B 3FW6A 3HC0A 2L7JA 1MCOL 4G6FB 4P23C 4PTTA 2OX5A 4W9JC 5ID1B 1HQRB 2F53B 1AANA 4P4KD 1XGZA 4AGMA 3HOGA 3BVVA 5DWUH 3ZDYE 2BNUA 4A55A 5IMOB 1ORQB 5D7HA 5CEZH 4LQFH 1RZ7H 3MZGB 2EUWA 5T1MA 3MRJB 4JZJC 4XBPA 2FGWL 3VFUB 1DQQB 3IVKB 2NXYB 2QPUA 1E43A 4OCYH 1KCSH 2DF3A 3VFNB 2QFRA 2A6IB 3KNBB 2QR0A 1IKOP 5HDBE 4Y4FA 4P5TB 1YEGL 1C7TA 3LKRB 4IKKA 5CINH 5TGBA 4PJFA 3GBNL 3S7GA 4UAOC 4LCCC 4UBDC 3MJ9L 1DVYA 1JE6A 1QBBA 5HHMD 4X9IA 1DVZA 5HHPB 2XN9B 4ZK8A 5K1VA 3P30L 4XMWA 4ODWA 4O2EA 4FI8A 1KIRB 3QR0A 4QHKI 3NACL 2IFGA 1MJ8H 1VGEL 1YPZE 3MRDA 2Y3NA 2Y72A 4JKKA 5K39B 2OMZA 2KS0A 3KD4A 1QNIA 2OFQA 2YQGA 5G4OA 4LL4A 3D4GA 5C1MB 5IMMB 3CDGB 4S11A 3ECBB 1FE8L 1D7FA 4M3JA 4FADA 1QWNA 3QZPA 2YPLB 2Z91A 3BKMH 4PP1D 3KMDA 3FXIC 4QRUB 2VLJB 2VMFA 2NY5C 2NSMA 3BVUA 3TJHD 4UF7C 1NFDB 5LGKA 1ZK5A 2DWYA 4L3CB 4YHML 1N2RA 2F5BL 3G5ZB 4NRXA 3SE4C 4GINA 5ALBH 3VDBA 4OZFB 5IB5B 5EEXA 1AD0B 2YD9A 2HMIC 4IMKC 2GW5A 2EDQA 2JMRA 3D39D 3UEZA 2AJXH 5GS2H 1M7IA 2Y06L 1CI3M 1JZFA 5SV3A 1JP5A 2CNYA 1V3JA 2PYEE 4PGCB 1EBAA 1G9NL 2B59A 3O2WL 3QNZA 4YHOL 4LARL 3WTVA 5I6XC 5I6MA 1M7DA 5CBAA 4UQ2A 1ZKAA 5M7QA 1TF4A 5K9QI 3HB3D 4M93B 1E6OH 2BNQA 4AQZA 5AOKA 5I74B 2QQLH 3EOAB 3IJYB 4RBPH 5HHNA 1O6SA 1KGWA 2X09A 2PXYB 3E6FB 4I4WB 4GLRI 5FO8A 1EDYA 2KI6A 1X5XA 3VXSA 4B5EA 3GBNH 3FTVA 3GBML 1AZNA 3LZRA 4HT1L 4N8VA 3PHQB 1L3NA 4XB8A 1EXUA 5B38G 1EHLL 3ZW3A 25C8L 2VLRA 3GS4A 4B9FA 1NINA 1CXHA 5BRZA 3GSXB 4MMXA 3BW9A 2R1XA 3CHPA 3IFLL 3K6FA 4DKFH 2O72A 2Q7NA 3QS3A 2BFGA 3MNZA 4KGLA 3BP6A 3ULUL 1TZOA 2GY5A 3M1BB 5BZDA 3LX9A 4KI5C 1FE8H 2R2BA 1G9MC 4P46C 4WDIA 4ACTA 1H3GA 5J9PB 1WICA 4OJDH 3U0WL 4LKCB 4G42A 1MLCA 1L0PA 1X5FA 2F5BH 3IXAB 5CNHA 2EIEA 2FT8A 2CDGB 2C34A 3QFJB 3A67H 1TVBA 2E5EA 1G7JA 1MHPH 3BCDA 4IBQA 4HIPA 3OX8B 5DZAA 1X5KA 2WM0A 4LFHD 2Y06H 3U7WH 4FNTA 3ESVF 4BRJA 3SQOL 2E6QA 1FVCB 1G9NH 4YHOH 3O2WH 1GC1L 2QTVA 3JVFC 4PJEF 4JFPB 5I6OA 1AQKL 4RFEB 1CFNB 2D0FA 3MU3A 2WXHA 4YC2C 1TVDA 1J1OH 3HG1E 2P5WE 4BSVA 1EHAA 1ZT7A 1N18A 2HT2D 4R5XA 2EO9A 2X4TB 4Y16B 1E0OB 1F45A 4UILH 5EO0B 1P2CB 2Q86A 5IHLB 1JDAA 3INUH 2QSCL 4HT1H 5EU7E 3VFSB 1BLNB 1WISA 1TUPA 5C0BD 4MVBD 3CFMA 5C0NC 4CBPA 2GUOA 4EIBA 3GMOA 2UUDK 5A2LH 3FU3A 2VDNB 5AOMA 2FUTA 3ISRA 3MRQB 3QPXL 1KTJA 1QAWA 4YGVA 1ZV9A 2CGRH 3QJHB 4BWUA 3ZHDA 3DTXB 4PG2A 3VMPA 2OI9B 1BXUA 2EUVA 2R56L 1KELL 5FO2A 3TEXA 5FGBA 2OR9L 3W9DB 3KR3L 5I76B 3JV0A 3GSWB 1S5IL 2B77A 5T3XD 5I75B 1KGUA 4JQVA 4AENA 4LCIL 5IQNA 4YSRA 1CFTB 3W0WB 3G6DH 4HV8A 5CEZD 5FDWB 1TSRA 3TVMA 2ZG1A 2DH2A 4CVXA 4N5EC 4Q74A 3CFNA 1BGXL 3ZDWA 3LQZA 4KRLB 3KLAB 1K3ZA 1MREH 4F7PB 3PGDA 4WFED 4G8GE 3CQPA 3C60A 4MD0B 4JO2L 1AQKH 4MNGE 5D1ZI 2BP0B 3R0MA 2EE3A 2LV4A 4MDIB 1AHWB 1D5XA 1ZDSA 3NA4A 4D94A 1S7SB 1NGYA 4HS3A 2DMCA 2V7HB 2IV8A 3HPLA 3NJKA 3GSQA 4KROD 1NANI 3UTZA 3UADA 4QXUL 4ZMQA 1T4KB 3L3OA 4HK3J 4N6QA 3V52L 1RVFL 5DJZB 3VWKD 1Y1UA 3RHWK 1DJHA 2DQCH 4J27A 2XV3A 4XZ4A 4X8JB 5DXWA 4LPUA 4DPBX 3RFZA 2E7LC 1YECH 2N1KA 4Z7VA 1R3LB 1HIML 1U8LA 2DJMA 3GEFA 5CXPA 3MUY1 3Q5OA 2C1PA 1ZSDA 5C0CD 3PWJB 4LSPL 1Z5YD 4IW4C 1DCLA 5JOFA 4YR6A 5CGYC 3FMGH 4MJJA 3MLRH 3O8XD 1NDMA 3MLUL 1W8EA 3SEPA 1BQUA 4LEEA 4DT2A 4FA7B 2R56H 2NY7H 2J88L 4G9FE 2XACC 1NIDA 4JY6B 2E74C 3T3PE 3FUJA 4X7FC 3QAZC 1CLCA 3DPDA 4P23A 3MYJA 3S3SA 4X4ZA 1F3DJ 3SPVA 5SX5K 4Z7NB 2CCLA 3EFFB 1KTBA 5ISZA 2VL4A 1HHGB 2E75C 3FN3A 1TZ8A 1F2QA 3MCLL 4L0YA 1JWUB 1FV1B 2DQTL 1PKOA 4RAVA 1J48A 1SVBA 3L16A 4LIQL 4PLJC 3K6NA 3CH8A 5I1AA 4LLUA 4JZJA 4JUTA 3LN9A 1KBKA 5IBUG 2J55A 1SF3A 1T5KA 2AKRA 2XQYA 3MJ8A 2NY2B 5FF6A 5CZVL 1IGTB 4QXGL 4MNQA 3AQXA 1FNEA 2FB4L 2Q7AA 1QSEB 3V0HA 1DJIA 2E56A 1TO5A 3WMQA 2YO3A 3V52H 1JPTL 3AQDA 3AS2A 4TPRL 4LCCA 2R8SH 4X4XB 5C0AA 3WKNA 4OZHA 4HMEA 3NPSB 4R90L 1I1CA 4ANXA 5FUCE 2R4RH 5IKCA 4X6FA 1HIMH 1CYWA 1UD8A 4FQ1L 1WRFA 1KB3A 3DUHA 5IEHA 1AQDA 1I4FB 4HFWA 1MSPA 4N8UA 4Q9RL 4LSPH 2FQEA 4GSUA 2VM3A 1RIUL 3QQXA 3H53A 4KX7A 3NCYS 3MLUH 4YVUA 5IM7B 1MCCA 3S37X 5D93C 2ADFH 2ROXA 3OLIA 4G43B 1MWAL 3DV4A 3MRMA 5BMFL 4Y1TA 1G7LA 5HHOD 2VIRB 2O5ZL 2XG5A 4UTBL 3E9TA 2MCMA 3RLSA 4LRIC 3SE4A 3DK0A 2Q87A 5GSRA 2YFNA 1NBZA 4FYQA 4W4NA 1HCFX 2RJMA 2EH7L 4IMKA 5JR1L 1NAML 2E7HA 3E2HC 4PJAB 4PJXB 1O7VA 2V2WA 1QZNA 1EAPA 3PGFH 2Y9RT 4FTVB 1SN5A 5FO9A 1RU9H 2AEQH 2ENJA 1ZLSL 4C47A 2A73A 3D8MA 4U1JB 5M95B 1ZLVH 2A6JA 4GY4A 2E7BA 2AQTA 1Z3GL 1U8IA 2D31A 3NABL 4HHAA 3QIBB 5AG9A 4GXFA 5MP6H 5BO0D 4U6HB 4J3VA 3B9KB 4QXGH 3F5WB 2P42B 1HHIB 3ZT6A 4DOHB 3IJSA 4PRPA 4QHMA 4OW6A 1G1CA 3GMLB 1ZLWH 1MG2C 3K1KC 3CG8A 4XNYH 3R1GH 2EDMA 4TPRH 2CO3A 1XF3A 3FCTA 4PRAA 1T2XA 4O5LL 4R90H 4F24A 4APQC 4AIOA 5EFIA 1MAKA 2D7NA 2HFEA 2YZ1A 3GUFA 3QG6A 4FFVC 5FWQA 2JJSC 4D0CA 4K3JH 4LPXA 5CP3A 2C26A 4FQ1H 3ULAB 1AMXA 4QRPB 2CR3A 2HKFL 5ETUA 4Q9RH 3FFCD 3N42B 4PJ7F 4Z77B 3VX1A 2B39A 3V6BR 1HCVA 1A2YA 2NYYD 1RIUH 4K94L 4ZUWB 4P4KB 3H6JA 2FSEB 1OIOA 1LP9E 5HY9A 3RWJB 3L7EA 4P46A 3U9UB 3QQ9D 1M71A 1K5NA 1NOLA 3BH4A 4YDNA 1BIHA 1SBBA 2CKBA 4LBEB 3H3BC 2XJLA 4FEIA 1UG9A 3FT2B 5CSBA 1S6NA 2DTML 4OFDA 1D5RA 2EH7H 3QIUD 4R6UA 4C56A 4H0IA 4Z7IA 3OSKA 1B2WL 1U3HD 1YSOA 3I2CL 1ZLSH 5F7HA 5I28A 4YE0A 4F37F 3MFFB 4J7RA 3VRIA 1AOHA 4AYFA 4J3OG 2GJ6A 4PMEA 4G71B 1KTDA 1EEYA 3NABH 3O11B 4HEPA 5FV1L 4YDJA 3OAYH 2NCEA 4G72B 2FVNA 5E4EB 1JZIA 3QULA 4X7TA 2ATKA 3CFKA 4PP2B 1FRGH 2XETA 3BZFB 1JWSB 2EXYD 2Q10A 4O02H 1FFTB 4ODXB 3LXBA 1MI5A 4P05A 4XGZA 2VZOA 1MQKL 4N2EA 3MX0B 4TQEH 5LBSA 5HHXL 1B4JH 4ORZC 3ZDYF 5J13C 3BLPX 1VCBC 3QUGA 2PW1A 4Z78B 3LH9A 1T7YA 4JO4L 4I48B 4N2AA 3VFPB 3DO7B 2X88A 1PBYA 2AAAA 2Z65C 1KPRB 4LLDA 3GLAA 3U1SL 2VCOA 3OAZK 5D1ZC 4NENA 3D39B 3K80A 1OCOB 2FRGP 4HFUH 3TNNA 1SHWA 3X17A 2Z8WC 4DN4L 1R5IA 5HDBF 2C9UA 3HUJB 3L6FB 2IH3A 3MRPA 5D6CB 3WJJC 2QGBA 4WI2A 2V8MA 2Q5BA 1AYRA 2CK0L 4NZUL 3QUMH 1NH6A 3DC0A 1DVUA 2DTMH 3J27A 4YK4C 3HE7D 1DEEA 4YFEA 3H2WA 1CGVA 1UZ8B 4XP6H 1ESOA 1B2WH 1U2HA 3ZLQC 4EDXB 3DRQB 3C5SB 3G6JB 4KJWD 4NJ9L 5AB1A 4ZZFA 3WNNA 3C5ZD 3I2CH 1QUNA 3VRJA 3G5WA 1F56A 4AQ8C 4XP4L 4PRIB 4AK2A 3RVWD 4N6RB 5KUKA 4X0NA 1QATA 1AY1L 4ILDA 3OR7B 5FUOL 3T4YB 3WTUA 1UGNA 4R2GC 4EN3D 4UINH 1N8OE 4Z7UA 3SY0B 4JFXB 4Z7WA 4U0RC 3P2DA 3VDCA 5HJ3A 1JIBA 2BNRE 5E8OA 3NFNA 4LSUL 2JQMA 4F8OA 4JFZL 2CU9A 1NFIB 2KUTA 3TBYA 3WNIA 3WTXA 2E7LA 1D9KB 1OXYA 4L5FL 4DVBA 2ODHA 1IGJB 4JFQA 2ITCB 2X4UB 4ZNEA 4HWBH 4ACPA 3BEWB 5GS0L 4ZX6A 1KEMH 3S5YA 2HG5A 1RJLB 2J20A 4HGWB 4RWYH 2HWZL 3T6VA 1CG9A 3U1SH 5L2KA 3RY4A 1T7VA 2VXQH 3BZ4B 2ICCA 4JQXC 4KRPC 2XQBL 1OD7A 5JHBA 3NESA 2NZ9D 4GJTB 5BS0B 1GS8A 2VABA 4IRSC 3KPSA 4WUUD 4NGHL 2NNAB 4NZUH 3BXNA 5CSGA 1CLZH 3OHXB 3D07A 2YUZA 3OB0H 3QFDB 3VGFA 1ND0A 2EH8L 4UT6H 5C09E 3P9WB 1OP5H 4PREA 1KYUA 3GPSA 1UXMA 4HLZG 3MROB 4XP4H 3FQYA 2CO7B 3EZ8A 1TOXA 5A2JH 4OI8A 5SWZA 4OV5A 1ZSHA 4Z3EA 2X6VA 1UKQA 1KGIA 5F9OL 3ZBMA 5FA3B 5C0BB 3QK0A 2ITDB 2R23A 4TOYH 4HBCL 1WE5A 4I18B 4K5LA 3CLWA 4TQHA 4ZW5A 3FUKA 3K6SB 1VFAA 1XGRB 1MAMH 5HGHB 3SKMB 1AGEB 3IDXH 2C4XA 1CXLA 4RCAA 5CMAA 2ARJQ 4OQTA 3WHE0 4WWKC 3RI5F 2A83A 1NC2D 4KBPA 2B5IC 4L5FH 4Z5RB 4FZEL 4LB8A 1DJGA 2NY4B 5BZWA 3VAEA 4I9WD 1LQBC 2YK1L 1BAWA 4ZUSA 5DTFA 1DANU 4AQAB 3LQAL 2GY7B 4LHUD 3AROA 2E6JA 5G55A 2XIBA 1TZIA 1ZLWK 3CVIL 3UZVB 2HWZH 5IJKC 3H42H 2ZUQB 2DEWX 1G6RL 5B8CC 3TO2B 3HNTL 3N1MC 4CSZA 4WFGE 1GS7A 3I74A 4YBQC 3NGBB 2XQBH 3L5JA 4LLYB 1KCKA 1KB9K 1I8KB 4BSWB 3VM7A 4G7YL 1ZPLA 4NGHH 4GNKB 2EO1A 2VM4A 4PJ9B 5GRVL 4H1LB 5F1OB 4LRIA 5IFJA 5ESAA 3CFCL 1SJEB 1M9SA 3MRCA 2QLVB 4GS7B 3UZEC 4B3VA 2KERA 2AJ3A 3WNLA 5JW4M 3O45A 3Q2NA 5DD0L 3EJYC 2EH8H 3ZKMC 4K3GA 3TNMA 1LEGB 2C9RA 5EU5A 3CFDB 3LKQA 4E9XA 1IGYB 4MA8L 3ZHLA 2D3LA 1SBSL 4ZAKD 2DWXA 3FU6A 4RZCB 5A2CA 4XTRC 3PWUB 4PI0A 1CE1H 1UH2A 3H9HA 1S7VA 1T5WA 5D7IA 1OB1A 3MV8D 5I30L 1KN2H 4IMLB 5F89B 2VAJA 3LIZH 2OCJA 3P0GB 1JZ8A 1FG9C 1RXLA 2WWMC 5FIEA 5KVDE 3BAKA 4AQOA 3UTTE 2NSQA 3O8XB 4APQA 1P7QB 1F1DA 5JOPD 4FZEH 5L9DL 2RCSL 3BHBA 1HL8A 1CC3A 2DN7A 3QPQD 1WG3A 1V3KA 5KBMA 4AKOA 5AKRA 4KKCD 1HZHH 3VSQA 2CXGA 5C0IA 3CVIH 4JY4B 5H35A 1B90A 4W9EC 3GIZH 5FYLL 4IBTA 1G6RH 3H9YA 3O6LL 3O6KL 3DX0A 3DETC 4MWFB 1R3KA 4MS8C 2DMGA 1YEWA 4WW2B 2HX7A 4OCWL 2YLKA 3PHOB 2VDML 4PIBA 5CCGE 1KTLA 1CURA 2VR3A 3O81A 3VXOB 3GTVA 1AZVA 4JGUA 3LXAA 3SO3C 4R4ND 1XCTA 3LKS