2AVFA

Crystal structure of c-terminal desundecapeptide nitrite reductase from achromobacter cycloclastes
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
314
structure length
314
Chain Sequence
LPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of C-terminal desundecapeptide nitrite reductase from Achromobacter cycloclastes
pubmed doi rcsb
source organism Achromobacter cycloclastes
molecule tags Oxidoreductase
molecule keywords Copper-containing nitrite reductase
total genus 80
structure length 314
sequence length 314
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2005-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2avfA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2avfA02
2BWIA 3NJMA 3AW5A 3QQXA 2YARA 1NWPA 4A2HA 4X4KA 3QPKA 4BWUA 4QLWA 1R1CA 1RKRA 2GBAA 3X1NA 3EH5B 3FU7B 1A65A 1GS7A 3C75A 4E9WA 4L0PB 2AZUA 5B7EA 3SBPA 2XYBA 1BQRA 3UAEA 4AKOA 1JXFA 1ET7A 1ET5A 4MFHA 1KGYE 4DPCX 2BZ7A 2W88A 5B7FA 1NDTA 1TU2A 2FTAA 1NIDA 2OCCB 3X1FA 1XMEB 3OM3B 2PPDA 2WO3B 3ASNB 3ABMB 2FQDA 3ABGA 1JXGA 4HAKA 3DTUB 1BYPA 1GY1A 2IWEA 4DP0X 4E9QA 1AG6A 3WIAA 3X1EA 2IH8A 1GYCA 2DY2A 4A2FA 1DYZA 1E67A 2E86A 4N4YB 4TXVB 3T6XA 3JT2A 3NSCA 1M57B 5D4IA 1OCZB 1WA0X 2XWZA 1IUZA 1HAWA 2OJ1A 1J9QA 2EIMB 3UAAA 2BP0A 4E9TA 1NINA 3ZBMA 4KO6A 3GDCA 1NIEA 3FU9A 1AIZA 3D12B 3AG1B 5B1BB 1E65A 1SDDB 1CYXA 1NIBA 2ZXWB 3QJUB 1ASOA 3WKPA 2FNWA 5E9NA 4GY4A 1A4BA 3HB3B 3BQVA 3ABLB 2VMJA 3PXLA 4BDVB 1GSKA 1W6LA 4KNSA 2AVFA 2AZAA 2Q9OA 4E9SA 4HZ1A 3NT0A 1TEGA 4N8UA 3ZIYA 1SJMA 1XB8A 3RYMA 2VM4A 1RCYA 3T9WA 1A4AA 2JXMA 3L45A 5FC9A 1ZIBA 1MDAA 2B3IA 1ZV2A 1VLXA 1SHWA 2YAEA 1L9TA 4DP4X 5LDUA 1KV7A 1BQKA 1AS6A 3H56A 1F56A 4NERA 2GIMA 3PCYA 3FU8A 1E5YA 3IBOA 1HFUA 3TA4D 3N55A 3CVDA 1JVOA 2R7EB 4DP7X 4E9XA 1OV8A 5I26A 1OCCB 3FPYA 2XV0A 4E9VA 1J5DA 1NIFA 1WS8A 4AKPA 1L9OA 4CSZA 3NSDA 1FFTB 1GS8A 1MZYA 2UXFA 4YSQA 3IE9A 1CYWA 5PAZA 4DP6X 3FQYA 1YLBB 2UXTA 3FQ2A 2CJ3A 1AZNA 2XXGA 2CCWA 1WAEA 1JZHA 2J57A 8PAZA 1SFDA 4GXFA 2YAMA 3S8FB 2GB2A 3IN2A 4UF7C 4WKXA 4KNUA 4DP1X 1WA1X 2P80D 4F7KA 5I6KA 3FSZA 1IBZA 3AG3B 3UADA 2QPEB 4HALA 4CSPA 3N2JA 4HHGA 2PPCA 2YAOA 3WG7B 3NJLA 1CC3A 3PAZA 3FT0A 3TBBA 3IN0A 4UAHA 4E9YA 3TBCA 4G7RB 1URIA 1AZCA 4G7QB 5F7AA 3WKQA 4F2FA 4YSEA 1TEFA 1IKOP 4KO9A 3S3CB 5B1JC 2GC7C 1AS8A 4DP2X 5I5JA 2FWLB 3NJIA 1NPNA 4P5SA 3HEIB 1A8ZA 1WA2X 3CVCA 2X88A 2H47C 4PAZA 2IWFA 3NJHA 4BXVA 1UATA 2PP9A 1AAJA 2MRYA 3FYEB 3JTBA 3NP3A 2VSMB 4G71B 3PAUA 1ILSA 3FYIB 1KYAA 4GYBA 3UGEA 2R7EA 3SBRA 5AFAA 5A7EA 4BWTA 1DZ0A 4YSUA 4YSDA 3NJKA 2JFCA 3X1BA 1EZLA 1X9RA 3QJVB 2A3TA 1KBWA 2XXFA 2EINB 2YAHA 2BP0B 2QPDB 1M9WA 1A4CA 1PLAA 5AKRA 2ZONA 1V55B 9PCYA 1BXVA 2B08A 2ZWNA 3PPSA 1JZFA 2IDSA 2AANA 1AANA 2HX8A 1B3IA 2HX7A 1ZDQA 2HZHA 1IBYA 2H5UA 4YSOA 4KOCA 2DWTA 2OV0A 1RZQA 4JKNA 1JZGA 1NIAA 1W8EA 3MBWB 2IH9A 2DV6A 1AZBA 2PP8A 1KCBA 4GP4B 2XUWA 1BEXA 3CG8A 3WNJA 1L9RA 2W8CA 2FT7A 1SNRA 5F7BA 2UXGA 4KO7A 3TU6A 1SF5A 3FQ1A 2FT8A 2BP8A 2YXVA 2J5WA 1OCOB 2PPAA 5I6LA 1OCRB 2HX9A 2QDWA 3S8GB 1FA4A 1XB3A 4A2GA 4JHVA 1OE3A 1J9SA 3V9CA 1PLBA 5I6OA 5I6NA 4DP8X 1SHXA 5I5IA 1JZJA 2XX1A 1SFHA 4FA7B 5B1JA 4BDVA 3T6ZA 1CUOA 2UX7A 4G7SB 5B3SB 3QJSB 4YSAA 2BP8B 2BW5A 2CUAA 3EHBB 1ID2A 1ILUA 3AG4B 1MG2C 3EF4A 4A2EA 3QJQB 2PCYA 2IAAC 3BVDB 1WS7A 2VSKB 2X87A 1IC0A 2VW7A 5AZUA 3EH3B 4JHUA 5B1KA 4M3HA 3AZUA 4YSSA 3T6WA 5EHFA 3S3DB 2CALA 3QJTB 2FT6A 3H4FA 2N0MA 1CURA 4A67A 2XVBA 4AX3A 4BK5C 1N70A 4NAJA 1AR1B 1V54B 3V9EA 1PNDA 2EIJB 2JKWA 5B7MA 1BQ5A 1RZPA 1HAUA 5D4HA 1AOZA 1JXDA 2BW4A 3PAVA 1JOIA 2WO2B 2XV3A 2EIKB 2HXAA 3ABKB 1OE1A 2YAPA 4F2EA 1ET8A 3CDZA 2QDVA 5I5MA 2HLEB 4DPAX 3CDZB 2PP7A 2ZOOA 1KDJA 4BWWA 1I53A 2WSDA 4DPBX 2DYRB 2PLTA 2YAQA 1NICA 4KO5A 4AI7A 3CZUB 2I85A 2J55A 4YSTA 1ZPUA 3NJFA 1QLEB 2BO0A 3AY2A 2GC4C 4HIPA 3S3BB 4YSPA 2DYSB 1AZUA 1MG3C 3IEAA 2FQFA 2EILB 2YXWA 1ASPA 5I6MA 2BWDA 2VW4A 3OMIB 2CAKA 5PCYA 3UACA 4YVUA 2XU9A 4ZK8A 3G5WA 2XX0A 2DWSA 6PAZA 1NPJA 1AS7A 3NJJA 4P5RA 2Q5BA 2XLLA 3X2QB 1BAWA 1EHKB 1KCWA 1NWOA 2BZCA 2P80A 2Y69B 5IY5B 1J9TA 3NJGA 4W9ZA 4RH4A 1GY2A 1PNCA 4M4RB 1AACA 1AQ8A 2AFNA 4G70B 1ETJA 3NJNA 3NSYA 3T6VA 3PLYA 4AZUA 3DIVA 1J9RA 1PLCA 4A2DA 1GR7A 3AG2B 1A3ZA 3ZDWA 3CVBA 3H4HA 4QKTA 1BYOA 4YL4A 2TSBA 1NZRA 2GI0A 4YSCA 5TK2A 1ASQA 1E30A 2H3XC 3SBQA 1XB6A 2HRHA 2UX6A 4NB7A 1M56B 1FWXA 2IWKA 1JVLA 1NTDA 4HCFA 2XV2A 3X1GA 3FSWA 2MTAA 4GP8B 3KW8A 4A66A 1BXAA 2TSAA 1PCSA 3ZX1A 3WI9A 1JZEA 3TASA 1QHQA 4FAAB 1JERA 4Q8BA 1KBVA 3WNIA 4AKQA 1L9PA 1T5KA 4G72B 3OD3A 1OF0A 1ADWA 1SDDA 2Y1AA 1PMYA 1PZAA 1PZCA 3KW7A 4GP5B 1PY0A 4DP9X 5I28A 1BXUA 3NP4A 3UABA 2FQEA 3NYKA 4PCYA 1L9SA 2RACA 1L9QA 2BHFA 1W6WA 2CBPA 1PAZA 2I7OA 3FSVA 3SQRA 1GS6X 1X9UA 3ASOB 3FS9A 1MZZA 4BXSV 2J56A 1KDIA 2QT6A 2NRDA 4DP5X 2VN3A 2PCFA 2VM3A 3OMAB 4UANA 2PPFA 7PCYA 2I7SA 4EF3A 3ERXA 5D4JA 5I6PA 3FSAA 4W1TA 1J5CA 4HHWA 5TK4A 2FJSA 4HCIA 2YAFA 1N68A 1TKWA 3QJRB 2IDTA 4KOBA 3OMNB 4HCGA 4Q89A 4YSRA 2GSMB 4KNTA 3EH4B 3GYRA 4E9RA 2UXVA 4ENZA 1E5ZA 5ANHA 1ZDSA 4A68A 3T71A 4K9JA 3MX0B 7PAZA 1JZIA 1SF3A 5B1AB 3DKHA 3FPXA 3GXUB 1PZBA 4YVNA 2HRGA 1GW0A 2FQGA 4WTQA 1PF3A 1ZIAA 2IDUA 3U25A 6PCYA 3FU7A 3NSFA 2GHZA 1AZRA 1V10A 2VW6A 1OE2A 1OOWA 2PPEA 2IDQA 2IDFA 2LLNA 1AG0A 3OQRA 1QNIA 2YQBA
chains in the Genus database with same CATH superfamily
1KXTB 4UIMA 2BWIA 5K93A 2EDMA 2P8PB 3L3DA 3IETB 1YUKB 4GRMA 3MV8D 2XETA 4N6RA 5IMLB 1DQMH 1B0WA 3S37H 3U1PA 4PS7A 2G60L 4A2LA 1NGQH 4G6KH 4HBCL 2NLJA 4EN3B 2GITA 2WNXA 3N9GH 3SKOB 5D7KD 3K72B 5FECA 4I4WA 5ALBL 4MA3B 3NIFF 1F1DA 3UAEA 5DK3A 4UDTA 3QCVH 5ITFA 2Q20A 5T1LB 4NO0A 2W88A 5I8KL 4HWUA 5FWQA 4EI5D 3BE1H 3HPLB 1IAMA 1VESA 5I1KL 4KFMA 5AWNL 2J1ZA 4ZS6C 5BMFL 2WM0A 2DJ4A 2VCOA 3OR7B 2NDFA 3TCLA 5DQJB 2FQDA 3ABGA 2Y1VA 1A47A 2BSSA 1CCZA 4Y5YB 2MOGA 2YD4A 3AXHA 3L3OB 2DMBA 2ZUSA 5MEQA 1G7HB 1TO4A 1DHKA 2X6UA 1EAQA 3D4YA 3UAJA 4PGDA 1DANU 4PB0H 1MFEH 3OXRA 3C5ZC 1H0DA 1TVDA 5EU3B 4F8NA 2OMUB 3PL6B 4HUVA 4S0TD 3L3JB 5D7SH 3EGSB 2WLZA 3FU9A 4M8RA 3CWGA 8CGTA 5B1BB 3KNBA 4GXVH 2QV2A 3QORA 3DHMA 4XP1L 2CO7A 4YLQT 3QUMA 3T77A 4FFYA 3HR5A 1AR1D 5A2BA 4KKAD 3BAJA 4W9KC 4X80H 3DOSA 2OJEB 3B9KC 4AGQA 4X4XB 4XMZA 4IKJA 2BY3A 2VMJA 4Y5YA 4A2MA 4KNSA 3LEVH 1WJ3A 4CA4A 1FNGA 3HE7B 1CU4H 2IH1B 2VDNH 1F6LL 2VMDA 3ARBD 5BS0B 1BD2E 2OMWA 2X3AA 5MEOB 2HLAA 4KUZL 2I25N 3MSPA 2Y2TA 2DICA 5I6XB 1RXLA 4PGDB 3F85A 5DO2D 5I74B 3MCYA 3GWJA 5HJDA 4Z3JA 1UACH 3VXSE 3EHBD 2EDYA 2ZOKB 4IIQC 4U1KA 5EFIB 1BZ9A 2BIPA 3K2MC 2LU5A 5T33H 4XRCB 3KL5A 3ENEA 4P5KA 2YPVA 2ZAGA 2V5YA 5I9QC 1AGDA 2ZWZA 2ODHA 5I26A 2ICES 4WWKC 1EAPA 1A25A 4WTWA 1WCBA 4HISA 2VTFA 3ROOA 5JHDD 1D5IH 5HYIA 4DQAA 2R2BA 4HVBA 2DQHH 4AKPA 1L9OA 5CILH 1B88A 2VJXA 2W9EL 2APVA 1IT9H 1E8WA 3KPLB 2IOOA 3PDOA 4N0UA 2XWDA 2HJLB 3LRGA 3DYOA 1YJDL 4X6DA 1FGNH 1W8OA 2VDQB 3LB6D 1EHNA 3JWOL 4HX1A 3VXSB 3BAYA 2GYSA 2YAMA 4J7RA 1FNLA 4KXDA 3ZQWA 3ZKMD 1QP1A 4BHUI 4RMQA 2DI7A 5C08A 3CN2A 5DMGD 3IETA 4MTMA 1G7IA 2FX9L 1E9QA 4JRXD 2HH0L 3L3OC 3L6FB 4IKLA 4KXZH 5F96H 2IFFL 3FQXA 5KOMC 3CX2A 1MCPH 3NJLA 5ESQB 3MACH 1UC6A 3AGWA 3D1MC 3PAZA 2RGSA 3DARA 3DK2A 2CR0A 4X8XA 1NBZB 4RZKA 1KGCE 2VDRH 1N18A 2W59A 4PUBL 2NDGA 4K2UL 2V2XA 3SIKA 2CKNA 2N4IA 5FCSH 1OAXH 4HH9B 4LEEA 1IKOP 5GRUL 3HIZA 2F7PA 4KO9A 2WMPA 4P9MH 5FKPB 4GRWE 4J27A 4X9BA 1UD5A 2WANA 3T0XA 4GW1A 1A6UH 3ILQC 2W65B 1KY6A 4PJ5A 3N41F 2XDHA 3AQZA 4N0FA 1NGXB 4KKZA 4XC3H 4N2HA 3EOBA 1GGCH 2AQ1A 4OFKA 5IFAL 4BXVA 1PG7X 1HK6A 3OAUL 4JPKH 2QSQA 4AYEC 5C0NC 4MNGB 1IJNA 4XN1A 5JOFB 1ZVSA 4KK8D 3GO1H 5A2KH 4KKBC 1S7RB 3BW9B 1L3NA 1M6UA 1RHHA 3EGSA 1KBWA 1N9PA 3BZ5A 3QDMA 2K7PA 3KLQA 2BXYA 5C1MB 1S7TB 3MV9A 4HPYH 1WCQA 3DHUA 1GOGA 3FDWA 3GMQB 4U49A 1DDHB 2DEWX 1NBYA 4HCRH 4NQVB 2GY5A 4B7LA 4UILH 4W9FC 2DQIL 3KPQB 1T03L 4O4YL 4FXLA 1E50A 1J8HD 1GRWA 3CNKA 3KYKL 1IBYA 1OK8A 2TRHA 3POHA 2DM4A 2XZCH 3NZHL 1W8EA 3GJFK 4LIQH 4OI8A 3OQ3B 1BX2B 1RZKL 5FYKU 4NO3B 4OJYA 3TC9A 3RUGF 5J8OA 1LK2A 4XVSH 4MXWH 4F7TB 4P4KB 5HHQB 1G7MB 2V9QA 3AUVA 4FFZA 4UCFA 1E9PA 1IC4L 2J5LB 3D0LB 1CB4A 4HKBB 5E2JA 3SGDH 4HD5A 1UT1A 2IVFC 3K74B 4KO7A 1KFGA 5GGQH 4KKLD 4UM8B 4AZ8B 1G9MC 2H2PC 3FCBA 5FAAA 1YY8B 4PU2A 5EEXA 4MAYD 5KWYC 1E0OB 3G7TA 3S5LB 1J9SA 3HR6A 1FAKT 1ZOXA 1H8NA 3GIZL 5GZOA 43C9B 3IJ7A 4KJQD 3UEQA 2HT3D 2A6DA 1HH6A 2EC8A 4MZ2A 1XCTB 1R34A 1YEIL 1ZHBB 1D5XB 5FOJA 3NCXA 3VYOA 3CZFA 3O3EA 1MNNA 1S3KL 4OZIB 4HEME 1XSIA 3K3QA 3QCVL 5DRNA 3KWTA 3T8VA 2O5YL 3O8XC 2QLVB 1W72L 1XAKA 2PCYA 1ROWA 2BFVL 5ICYA 2IAAC 1LP9F 1U8OB 4TQPA 3Q6FB 3CZKA 1KC5H 5DZAA 1D2PA 4UWQB 4N8PA 5TJWK 1EEQA 4QHPA 5IVZA 3CXHJ 2WC7A 1EMTL 4M1DH 4OU3A 3SDAA 2XPYA 3F7YB 3PQYA 1Z9NA 2ATPA 4AIXA 5C2UB 1G6VK 2ZF8A 3U9PL 4G8GB 5E9DD 1XGPA 3CFMA 2NY0C 4LKCA 2X9YA 3D07A 4L3FA 2J1WA 3DVNA 1MI5B 5BUGA 1WAAE 5ESQA 5KBNC 1AR1B 4K23H 5F97E 3I6GA 2CO2A 4MNQE 2QFRA 4QGTA 4JM2D 1UZGA 1MFEL 3MAWA 1MSPA 2A83B 2FWSA 3KPSD 2LTQC 5E1AA 3D48R 2OKMA 4JDTH 1RJZA 5DJZB 1PX3A 3ZUCA 4M7ZB 3GSXB 3GMRA 3QCTH 4QRUA 2HA1A 3KPPB 3D2UD 1JRHL 2YGQA 5DJCA 2YN3A 5I5MA 4FTVB 4KZCA 3I3BA 4IGBA 4PVBA 5D8JH 1PTZA 1KJ2B 3WN5B 4LPTA 5H2BB 5LDSA 1OALA 4OTXH 2DTSA 1F02I 2UZYB 4Y1TA 4CJ0A 5AWNH 4BSVB 4ATWA 1ODUA 4NGHH 5ANMA 3EJPA 3TWCH 3LY6A 4F37F 2R0ZL 3TA3B 1HSBA 1R5VB 3CC5A 4HIXH 3HG2A 1ZA3A 1RJLB 4YVUA 2WQXA 4F58L 2YZ8A 4O9HL 4ODHL 4UOJA 2DMKA 4JO8A 4L4JA 3JWNG 4K7FB 4B9CA 1JRHI 4MD4B 1AS7A 5E5UB 5E2TH 4QRTB 5HI4D 4FQIH 5D1XB 3S37X 4OSUL 3RX9A 2DEXX 4NZRH 5BOZG 1N6VA 2BZCA 4LCCC 5K1VA 3EUUA 2CLVA 5IG7A 4XP1H 3LS5H 4M4RB 1MUJA 3P4MB 4RGNC 4JQIH 4DGUA 4J4PD 4TS6A 3RP1A 5KSBF 3BAXA 4PV1C 1SUHA 1J5OL 4ZMXA 3E8VA 2ENQA 1HINL 1H3VA 3B2PA 4WDIB 1ZHNA 1BGXH 3D0LA 1IAII 2ESVE 1U8CB 5SV3A 1M6OA 4FQJH 2V2TB 1XAUA 4AZ8A 2FE0A 4MVBD 5D7IF 2X9ZA 1ZLUK 1HHIB 1FWXA 3AB0C 4XOBA 5F7EH 4KUZH 3VXNB 4PJBB 1QZ1A 3VXUA 4ADJA 4XC1H 4XX1E 3R8QA 4RLDA 2RR3A 5HHXL 1FIGH 2A6IB 2NUTB 4JGUA 3HLAB 5KYUB 2TRYA 3SGJA 3QUXC 4OF3A 5KSAD 4PD4J 1GZPB 5MHSE 3RDTA 4WHDA 3LZLA 1ZRUA 2ZNXA 2WAHA 1BVLA 2ZOLB 3NJXA 5AKTA 5FDWA 1S7VB 2ERJB 4FLRA 5F88B 5G55A 4PBDA 2DH3A 5JDSA 1JMZA 5CJQH 4R4BB 3RU8L 2AEOA 4XGZB 1X9UA 3FB6A 4B5EA 2A74C 3EW3B 3JTTB 4JB9H 3VFPB 4BXSV 2HFGH 5FYJH 1BIIA 1UKSA 4C56E 3AGVA 5SWQB 2BC4A 2QR0B 1U41A 3RA7L 4YDLC 3JWOH 2VGLM 1AHWC 3CFJB 2BSCA 3ZY7A 3VXQB 4WK0B 2CDGA 2B1HL 4CJ1A 1U2HA 3K1KC 1TT6A 2XIBA 1W0YT 4D8PA 4KNQA 4AT6A 3RL1A 1EO7A 4LXFA 3SCMC 3ZRSA 3ES6A 1UD4A 2V4LA 3P77A 3AS2A 4F7EB 2C7UA 2Z92A 1TZGL 3MNVB 4OF6A 4WI4A 3MMEB 3HZYB 2YQ3A 4N3TA 3M7FB 3WTUA 1TFHA 2OQJA 2ATAA 3IGAA 1NSNH 3C2AL 3X3GL 3WMQA 5LNDA 4XNBA 3HUJF 3OLEA 2XFXB 2FQGA 3W9EB 2ZP8A 4JFOA 5C8JB 1OE2A 1RZFH 3A24A 1EVTC 1WUZA 2WUCL 1YY9D 4LVHB 4UI2A 1G9EA 1YO4A 2XN2A 4JQVA 1G43A 4RGMC 3QDJE 1I8KA 4XC3L 1NWPA 3TA3A 3KYMB 3S34H 5IQ9A 2R59A 3ZOAA 2Y3NA 2KLSA 3JWNE 4L0PB 5B7EA 3NUKA 2NYYD 3OHXB 3JV6B 1JD9A 2FR4B 1JD7A 4WAFA 2VXQA 3IMSA 3L9BA 1KMGA 3KWVA 4HOZA 2EDRA 3RWGA 2DQTL 1TPXB 1VAHA 2SEBB 3KYOA 3EYSL 3G9VA 1WHOA 1A2YB 4NQXA 3HMXL 4ZNEE 5A6IA 4RSVA 2BVPA 1UCBL 4MZIA 1H3TA 3GQFA 4LU5H 3LD8C 2X1PA 2BFGA 3EJZC 4YHML 3GSRB 3FFCD 1QLEH 2DI9A 5JHAA 2IH8A 3VWJB 1AXTH 4M93B 5TE4L 3QDAA 2PYEB 3SYAA 3W5NA 3EGDA 5E7BA 3T6XA 3QXDA 2WVVA 4NOBA 4IRSA 1KTLA 2PO6B 3L48A 4LLYA 2ADGA 4JL2A 2Y36L 1RZKH 2VWEE 3GUFA 1EBPA 4JFXB 4OB5L 2HCZX 2EIMB 3HE6C 5DHMC 3UAAA 2BP0A 4BGLA 3F7PC 1JVKA 2R2HB 4Y88A 2GJZB 2ZPKH 2F1EA 5SWSA 4AL8H 4ZUVB 1NDMA 1PX4A 4AQEB 4LOUC 4YR6A 2J8UA 3NFSL 2IH3A 5D1ZD 5SWSD 2OYKA 2FD6L 2IEPA 2XZAL 3QJUB 4LSUL 2CDFA 4NZUL 2JV6A 2Z0UA 5F9WC 5JIKA 2NZ9C 4GG6F 2KZKA 2XZZA 1FSKC 3G5ZA 1OPGH 4X42A 2FZ3B 1Z3GH 1O7DE 2P5PA 1UYWL 2Y22A 2EKSA 4DZBA 4HUXB 1MVFA 3HC3L 3QS3A 1Q4NX 2ZSWA 3QVAA 2O61A 1S3KH 5C0DA 4PJFA 3C6SB 3WEAA 4QMEA 1BHGA 3CLFL 1QSFD 2BNRA 4MJHA 4B6ZA 1I1RA 2DWDA 3SHSA 3MV7B 4JGNA 4L37A 1MLBB 1L7TH 2AJ3B 3C60B 1E5YA 1QYGH 4ZFFB 1ZT4A 4C4KO 5CCGE 5IQNA 1FO0H 3W9DA 3PGFL 1AGEB 2QADD 4HIXL 1VFOA 1ZTXL 5AL0A 3UPCA 3T0EB 1OV8A 2GEQA 2XV0A 5K9QI 1H3UA 1PEZA 2F7QA 1NAMB 4NWTL 1GGIL 4M9PA 2ED9A 5E8OB 2X38A 1E2ZA 1TF4A 1OSEA 2YRZA 1BVKB 3IE9A 5E2TL 3SCMB 5ISZB 4BV1A 2H26A 1YMHA 4FQIL 1AZNA 4NM8L 4ACPA 2XWEA 2CHZA 4FJYA 2O61B 3NFPB 4YHPB 1S7RA 3DECA 5DD3L 4EN3A 1UGKA 1PLGH 1QR1B 5T1LA 1NMAL 3U1QA 3U7WL 4LSPH 4RBPH 4IRZA 3U0WH 3MLWH 1EK3A 3BPOC 1UB5A 4DFHA 2BNQA 3HC0A 3P2BA 5E56A 5I2IB 1MH5B 4JRFA 2XG4A 3O0LA 4HHGA 2Z8WC 3KMDA 1F11B 3ZSTA 4FLSA 1X7SA 3CCHB 1EDYA 3ZK0A 2ENJA 1AGEA 2HFEA 3V8CA 3MRGA 2ZX5A 3TBBA 3ILPB 1KIQA 4M4PA 3FZUD 5TD4A 3WFBH 1MCOL 1HCFX 3CMGA 4HJUA 5EU4B 2LE9A 3UZVB 1DANT 1AZCA 1T1YB 2ED6A 4R3SB 1CFVH 5I30L 4UOZA 1KN2L 5IQLA 1R47A 1MHHB 1T0OA 3TEUA 3GRWH 1TXKA 1OP4A 2AJYL 2UVEA 3N44F 1OAQH 5HGAB 5EU4A 5JW4R 2IWFA 1HEHC 2F19L 2FCBA 3RBSA 1SLVA 3JTBA 1M7XA 4XXWA 3R4DA 3ORJA 1H3GA 1A5FH 1ZHKB 3OPZL 3DX2A 1EZVX 5FUCC 3NQKA 3H1ZA 4Z7VF 3VQLA 2E74C 1YCSA 2VO5A 3AU1B 4GUCA 1V3KA 5C2BH 2YBRB 1EZUA 3C6LA 3HMWH 2JFCA 4NNPH 1X9RA 1NCHA 1OIOA 3QIUD 5BUAA 4RA3A 1TLMA 3RA7H 2HWZH 4YH6A 2BP0B 2QVIA 3EYOB 4FJZA 1OF2A 1W72B 4EVNA 3B7TA 4H20L 4P5TC 5DYFA 4HWBL 4WVRA 1QR4A 4IDLA 1UGNA 3S48A 1QFPA 3VFOA 3CSTA 5HHOB 1NGPL 3I75B 1IM3D 1WBYA 2A73A 1MCHA 3FCSA 4M9OA 3TCXA 2ZJSL 3LKQB 4WW2B 1FIGL 1BZ9B 2GUOA 4L4VE 1AY1L 1QSZA 5AVTB 1O9ZA 2DM3A 4S1QH 5E4OA 3WIHA 1MWOA 4HIJA 2IFGA 1KBGH 4LSVH 3TN0B 2CKBH 2DQCL 2IAMB 3FFCE 5D70H 5D71L 4F7CB 3JV4B 4MJ5A 2Z4QA 1RZFL 1GJWA 4HHAA 2WUCH 3M8OH 5CJQL 2JXMB 5CJXA 2ZUWA 2ITCB 1I3RA 1S78D 4L29B 5D2NE 1KEGH 3QNXB 1XB3A 3FONA 3TNNB 1L0XA 2DIEA 1TZIB 4RISL 3BSZL 4A2GA 5ABZA 4JY6B 3TA3D 2WP3T 4ZW3A 1N4XL 3B2VH 4NN7B 3RZCD 1GYVA 4FXGB 4MA8L 1RD6A 4QUOA 4YWGL 4ZQTA 5JW3L 4LAQL 2WZPD 3TBWB 2Z8SA 5C7XH 1EAJA 3SDCD 1U3NA 3BISA 2WXPA 3LQMA 4OZ4B 5KSBA 1NCWH 2H1LM 2G3ZA 3CFBB 1IC0A 3FW6A 3NFPA 4YHPA 2EZ0D 4TRPL 3PABB 5AZUA 3ZHLA 4Z6AT 3EO0B 3SE9H 1I4FA 4Z0BL 3HA0A 3IDYB 4ZO7A 1OTUC 4L1HA 3BW9A 3NN8B 1UA3A 4YHMH 3N42B 1ECYA 4QT5A 1SM3L 2EO7A 5TE4H 4JREB 3UC0H 3ULAB 3BEVB 4LL4A 3ZHFA 2NR6D 3DVGB 1PNDA 1KENH 2VYRE 3NAAL 4K7PX 4R7DA 3NOIA 1C16A 3NABH 4JKLA 4IOFC 1XGTB 2CPCA 5KTEL 2XV3A 4HEPA 3THMH 2BIHA 3O2WH 4YDVB 4KGLA 5KVDH 1CICB 3MCLL 2BCMA 1FBIH 3HRZC 3JWNC 4R4ND 4GFXA 2DL2A 3BVVA 4BFKA 5DMYA 2VMEA 2NY4C 2WXNA 3WNKA 3BKYL 1MJ7L 3TNMA 3VE0A 3WKYA 1KDJA 2GBTA 3HG1D 2F6AA 1BLNB 4TOYL 1WAAF 1J1OL 1SLUA 4Y4FD 2A9AA 1G6RL 3ECBB 1JBJA 3IDGA 4IRZH 3P3UA 4WU7A 3S35X 1O0VA 3BHBB 5ERWB 2QTEA 4NRZB 5IHBA 4PWKA 3V6OC 5I1DB 5INDB 4KWUA 2EILB 1FNSH 3NACH 2NNXA 5FCUH 5CBEA 1UCBH 5D7KE 4NSKB 5PCYA 1AQHA 5F6IB 3FUMA 3MRCA 3VDCA 4ZMTA 4OLZH 3DJSA 1QI5A 5DLML 2EVHA 4FC3E 4IEFA 3ARGC 3F7QA 1CZ8L 1M1XB 1GH7A 5CFHA 2G2RB 1JGUL 4X6EB 1YMMB 4WI6A 4GG8B 4QGYA 5H94A 3MLRH 3VRLE 5JTWA 2Y4SA 1M2VB 3TIDA 4XMUA 4HC1L 2WLMA 3REVA 3N85H 2YQ2A 5AW6B 4IU2A 3TL5A 1EO5A 1EEZA 3MGTB 3FQXB 3CUPB 2QFPA 4ZW8A 1TVHA 3IDGB 4LASL 4ZSOB 3RTQA 1AI1L 3VFVA 4LNVA 5IQOA 1PW3A 2LW3A 3HI1B 2XXCB 4FADA 4P46D 4QKTA 4KI5C 3VFGL 5C9JB 1N59A 3W0WD 2MOVA 4WIQA 5GJSL 3H6AA 4GW4A 2VAAA 4NZTL 3UTZA 4GMSH 4MNQA 2EDFA 4HCFA 4OGYL 4HJTA 5CM1A 2MTAA 1FZJB 4Z95L 3BPLB 3VXME 3WI9A 3NESA 1EAPB 2IOMA 4PS4H 3GMPA 4WWID 2NYKA 2BERA 4JZNB 5CD5C 5CHNA 1ADWA 1DBKH 3LEXA 4GP5B 3HVDA 3K4ZA 4OZHB 4ZO9A 4ZYKB 5SX4H 3GSOA 3SDXB 4X7TA 2FH8A 7CGTA 3DX0A 4PJCB 4QRPB 4G6AD 1FZMA 2MCAA 4Q14A 1DVYA 4XGZA 3VFTA 1KNOB 4MB1A 2CLRB 4CGUB 5JA9A 1FGVH 1UXLA 5F7WC 1A1MB 3ME0A 1BECA 2OMTB 1I1YA 2YEQA 4DP5X 4WFFD 1DR9A 1WO2A 3AT8A 1CFTB 1IAKA 4WEBL 3QDGB 3ET9F 1A6PA 4ZTPL 1F3DJ 2C7FA 4JM2A 2X4UA 2E7HA 1A3LL 3KBEA 3IMBA 2OSWA 4JFYB 4LLUA 1YEJL 4H5SA 2NY6C 1N68A 3NIGF 3ZN6A 1BBDH 4HOXA 1VF5C 1TQVA 4IRSD 1JK9A 3IXTA 3GYRA 3SGEI 9CGTA 2QHLA 4LP4A 5AENA 1Q72L 2ZWSA 5E2VL 3MLSH 1ZDSA 2O72A 3AJ7A 4NCC1 1F3JB 4PRIB 2H0FA 3VRIB 1U8IA 3ZKND 4LPWA 1B0GA 1A6VH 5AVXB 3MX0B 3H2PA 3WUWA 5GGSY 4HWBH 2E7LC 2D03H 3BP5B 4PPTA 3W0WA 2VUYA 5FGBC 5I8KH 1RY7B 4G5AA 4YL9A 3A4EA 3LQAH 1P7KA 5JPMC 2V7NB 3GRWL 4K3GA 3L13A 5GGTH 3RX5A 3WJMB 2WINA 3RWEA 3BHBA 5DJ0B 2VT0A 3L2LA 4GRLC 1AGFB 1J88A 1HNFA 4OLUH 1HH6B 2A74A 2D3LA 2Z31A 1NDGA 4H5SB 4P4KC 3GLDA 2YWZA 4BH8B 1ZE3C 3PHOA 2AZUA 1BZOA 1IM9B 1TPXC 5D2LE 4H1LB 2OCJA 1CDUA 1NEZG 2D7TH 2OX5B 3MOQA 4U33A 5F6HI 1U8IB 2FYVA 2LU7A 5IROA 3RAJL 1WFNA 1XGQA 3GSWA 2K8MA 4WFGD 4M5YL 3BSZH 4YPGA 2J8UF 1HH9A 5D1QC 2Z35B 4RDBA 1J7VR 2MHAB 1JGEA 5F0MB 1OGPA 3KPOA 4W9LC 4NJ9L 2AGJL 2VLJE 4OFPA 3ZR5A 5LHDA 4YWGH 3I9PA 1WIOA 4TQ8A 2UWEB 4AGNA 3ULSB 2EXSA 3S2AA 4YQXH 1KGWA 3HLAA 5C0AD 1ZTXE 3MBXL 3WS6A 3X1EA 5IBUB 5FO2A 3N1GC 2AV7B 3RUGA 3T6QC 4KKCC 1TLKA 2Z7YA 1OPOA 1RZ7H 2G5BA 3AFLA 3AREC 4HAGA 3PGCA 1CU4L 3QG6A 3IJYA 3BP7B 5D4IA 3CC1A 2JJUA 5KOVC 3RWCB 4LSVL 1A9VA 3ZBMA 2RJMA 3U30C 2FO8A 2YPVH 5F9AC 5I1LB 1P0SE 4R0LA 3GBDA 3ARSA 2NCMA 2J6EL 4HUUA 4U3CA 1P84J 1CR9H 3AM8A 5JW5A 2ZXWB 5E70A 4PJ6A 5EO0B 5E9NA 2EIZB 3EF7A 3NRFA 2XBTA 1JPEA 1FG9C 3NABL 3IS1X 1T4KB 1SYVB 3O3UN 4RISH 2X4SA 3BPNC 2PCFB 4XR8C 3MRRA 4HZ1A 5ICUA 3VW3L 3L8QA 3NT0A 1IAOA 1RZKC 3B2VL 5D96C 4FQCL 3BUPA 2AS5M 4BUGA 4XCFH 2CO1A 3T0WA 1MNUH 1DUYA 2HFFB 2Y9RT 1GIGH 4W9JC 5F8QC 4IRZL 4L8SB 1KV7A 1AS6A 4Q0XH 3DNKA 5B22A 4ODXA 2P28B 4FKKA 3OLDA 2KMWA 2BSED 1MCCA 4JZJB 1DO5A 2HH0H 5JW5B 5EEVA 1OAUH 2BM3A 2E6JA 4XNMA 1HOCB 3SYQA 2SEBA 4AVIA 4Y5XA 3VQMA 4RBPK 4X9FA 2GJPA 2G2NA 3QNFA 2J88H 4S1DC 4Y16D 2NY7H 5IESL 1P84K 3H3KA 4K2UH 1R4XA 1YG9A 2APTA 2NNAB 1KIUB 3O3AA 3MRKB 3QPXH 4MDRA 4DEUA 5EBGA 2HTLD 2P80D 1CLYL 4IBSA 3FQWA 3UTTB 4ODVH 3CXDL 4U1GC 2APXA 4Z7AA 4HALA 5I1GL 4Z7QB 3TYFB 1N0LA 1HL9A 1MFDL 1MJJA 3MGOB 4MJIB 4YBLC 3HI6H 1G6RH 2J43A 4P57A 5CIPA 1CC3A 2NY4D 5G2NA 3C60D 4NPJA 2YEZB 4YXLH 5CJBA 5DURB 5TQ0L 1NDMB 5GJSH 1BMGA 3IN0A 4FMVA 4UAHA 1BXXA 2EYTA 3GXIA 4G7QB 3GO1L 2ZCKH 3CU1A 4YSEA 5KBKA 5J6HB 2XQYG 4LCVA 1K8DA 2QVMA 5L2KE 2R8SL 3VFPA 1Q9WB 2YFOA 1XIWD 1FFQA 5AAMC 4BD4A 2D2OA 4L18A 1UB6B 4K7PH 4P0DA 1DFBL 1U8KA 3GHBL 4PY8J 4MX7B 5DUML 4BFFA 4L4TB 3ARVA 2P5WE 3O9WA 1IAIL 2EYTB 3RDJA 4E42A 4PH8A 4HCRL 1W15A 4XOEA 1N0XH 1UATA 5HHPB 4AJWA 4X9HA 4ELMF 2QKSA 7TAAA 5KVGL 3PAUA 1UA7A 5SWZA 3BEWA 7FABH 1R0AH 2ZXGA 4M1GH 3K6SB 2Q7YA 3DO7A 3BO8B 5T3XL 2Y7LA 2JJVA 2A5UA 4N87A 3C6SA 1MLBA 2RH0A 2B16A 3QORB 4N28A 3G08A 4NO0D 3NJKA 1EZLA 3CFQA 5IEHB 3SY0A 1PZ2A 2ZKYA 4PRID 4YDIH 3DOHA 3FSOA 2C9VA 4TTGA 1QFUL 2JB5H 3DX6B 1IC4H 1OQOA 4ORGA 4POZD 4M43H 5EIIA 1V55B 9PCYA 1PIFA 1AHKA 4ENED 2WXOA 2ZWNA 3VXOB 5I0VA 1ZJAA 5D7JD 3D4ZA 1ED3B 2WPGA 1NCJA 5EORH 4ZMYA 4ZFFA 2CG9X 3CV5A 2AQ3A 5HYQA 5DYOA 2Q8BH 4RAUA 1RZQA 4JM0A 1J48A 5FO8A 4LDCA 1JHLH 4XBPA 3PP3K 4U1SB 4ATTA 4HZLB 3WHE0 2CRZA 3L3GB 2BXZA 1AZBA 4D0DB 4QXVA 3JV4A 1XGRA 4X7CC 5L0QC 3QULA 5D5MB 1SNRA 3UZEC 1DJIA 2DLIA 4NUMA 2HFFA 4D7PA 4APQB 4U1JA 5C09A 4FLOA 2GHWB 3ROOB 4I4WB 2J4WH 3FUKA 4R90L 1KLFB 2Q3XA 1FA4A 1EMTH 3DVIA 4KK5C 3MRPA 3H85A 3FQUA 3ALPA 4PRIE 1PLBA 3LVEA 1IKNC 4ANUA 3D9AH 5CUSH 5J1AA 3O2DL 1Q38A 2DBLL 3CDGA 1KJ3L 5E94B 1OY3B 1EO8H 1MG2C 1U91A 2QV4A 4A2EA 3NPSC 3WFZA 1FG2A 3IDMA 4C56D 1X6LA 1BG1A 5DC0A 3DJZA 1YJDC 4PR5A 5DZPA 5BO0D 2JTYA 3KD4A 4F9PA 3KYMA 2AEPH 1RIVL 2VQ1B 4IOIA 3FN3A 5B4MC 2FH6A 2DKSA 4V33A 4YQXL 3H9HA 1LGVA 2YMTA 1WCBB 3MJWA 2VQUA 2JI3A 1AQKH 4LGRB 5CBAB 1CGVA 3TWCL 1E5UI 1V27A 4JVPA 4WLCA 5D4HA 3G5VB 4M7JH 2BZDA 2BW4A 3IPFA 1MCKA 4GPVA 1GMIA 3EADA 3VXRE 4PG9B 1AE6H 5BV7H 4ES8A 2B14A 4PJ7E 4Z7QF 3SD5A 2YPVL 1NAMH 2IXQB 4G8IA 4PCSA 4XNQB 2W94A 2KBGA 4GRWF 1CD8A 5IIEA 3E9TA 4JY5H 3U7AA 1GZHA 4DGVL 4U1LA 3RAJH 4HG4J 3KPLA 4NKDA 2X2YA 5SWZB 3FO9B 4UTBL 3COOA 5KBPA 4U6XA 1MCEA 1WGVA 3GSQA 1EWHA 4Z7UA 3I50L 1E4JA 2DYSB 4TUOB 4HW6A 3ARUA 4FFTA 4IJTA 1BSIA 3L95B 1WFTA 1SDYA 3OMIB 2CXGA 2RA1A 3BPCB 1MNUL 4XB7A 3GBLA 1U8OA 5CXPA 5D1ZI 5LNEA 4BZ2L 1DUZB 4ZZFA 1Q9KB 1YMME 1CVRA 5I1HL 3TS8A 2WXIA 2XLLA 1WH0A 2GSIA 2OMZB 1CIDA 5JPNC 1IGYA 4AMWA 3TEYA 1HQ4B 1U95B 2OXGA 5E4EB 1BVNP 4WO4D 1BX2A 2D4DA 4N0YH 2YD5A 5DEZA 3TVMA 5FO9A 5FYJE 2YN5A 3WXWL 2J6EH 4N2EA 3PJSB 4Q56A 3HZKB 5DYOB 3TYGH 4F24A 3NIDB 3PYCA 3H54A 5D2NC 1W16A 2ZG1A 4RGOH 5DFVC 2BNRB 3U1SL 4K3JH 3U6RA 4ZDHB 2OXGB 1WYJA 3IJ9A 1XGYH 2W0FB 3MNWB 3SE3A 2PTTB 3MV7A 4XAWH 1F90H 1Z9LA 2YKKA 4UNIA 1TDQA 5DJZA 1S46A 2XWXA 4NQTA 2YPLA 3CXDH 4XCFL 3KJ4B 3ZDZB 4JB9L 3W57A 4F7PA 1OB1B 2KHAA 2WZ6A 2DJSA 2ZX6A 3GBMH 4NPKA 5KUKA 3TFBA 3F7RA 1V3LA 2N59A 3BUBA 4ZPVB 3MFGB 4FP8L 3CN3A 3QO0B 2C9UA 5AOIA 1I8MB 3Q9QA 3LSOA 3OZKA 4ORZC 4QLRA 4XMLH 1UH2A 3DURA 3ETBJ 2D7QA 4QAWA 1QFWI 2VWEC 2WINB 2ZCKL 3KHQA 3R7RA 1IQDB 1LD9A 4MWFB 1M53A 2RHEA 4GQ9H 4RIRA 2LAAA 1PS3A 3E3QE 2X42A 2GEEA 4OCYH 3QIUB 2IMMA 5KVEH 1KXVA 1UWEH 5A2FA 3TFKD 4QRTA 1TCMA 4UNVA 4M8QB 5DT1H 2QT6A 3P9WB 5JOFA 3WDJA 4NUGH 5D9SB 4Y4FA 3T3MB 4UANA 5E5MB 3VB9A 2ZAHA 3T65B 1XCTA 3JVFC 5I6PA 1R0AL 1VFBA 2NTFB 2VZUA 3VDAA 2PWDA 3KAAA 4JR9H 3MRFB 3WIHH 4Z3FA 1ZVNA 4PRHD 5I75C 4I3RL 3GSNB 2JB6A 2OSXA 3QH3A 2E9BA 3B9VA 2WB1A 4QCIB 1BZ7A 4XOAA 4DERA 2I5YH 4XCNB 3D85A 5B1AB 4Y5VB 4ZUWA 5KVMC 3V7MA 2JI2A 4N2AA 4ZFZB 4B27A 1JP5A 4TUKH 5JORB 2XC8A 4F9PC 4RFOL 2PPEA 2DQMA 1JDDA 5E4IA 4I2XA 1E9OA 5D7LB 1URLA 5I82A 3RTQB 4QJ3B 1BM3L 2R2BB 3VACA 3W37A 4OAWB 4HIHA 1OLLA 4U6YB 3RIKA 1CDGA 3HS0C 3G5YB 5J9PB 3UG5A 1TJIH 3QUZD 4QLWA 4L4VB 1JCKA 4OLYL 1L9NA 1CXLA 3QJXA 4G6JL 1MLCB 4NUPA 4QRQA 2COVD 4FYQA 4OI7A 3C75A 1QLEL 3RGHA 4GQQA 2D8KA 4V2BA 1AXTL 4NN7C 2B1AL 4X6DB 1AIFB 4ZO6A 5E7FA 1JXFA 1HU8A 1P1VA 2H8PA 4QCIA 5GJTH 4P2AA 5L6YL 4X8GA 1R6VA 3SE4A 2VKWA 4DAGL 1AKJD 3K6OA 5J12B 4I3GA 3L54A 5CAYB 3VGAC 1IQWH 3L4ZA 1A21A 4M7KH 4ZUUB 1TQSA 3S5LA 1I9EA 3N1FC 4LCIL 3EUDA 3TJHC 3L7FB 4NWUH 4AT6B 1U3HB 3QZWA 4E9QA 2A6DB 4P3CL 5LBGA 2CKBB 4JG5A 3QXTA 1AG6A 4UIKH 2DY2A 2BIIA 2R2EB 2W9LA 3P9MA 3LKNA 2RIKA 3NGBC 4GW1B 4TXVB 5CF3A 4G6KL 3OAZH 4ECNA 1T3FA 4EAEA 4PVNA 4U3SB 4MDIB 4R2GC 5ICYB 2NQ3A 4G3YL 4K9EH 3QHZL 4QOKE 3KL0A 3ZE0E 1E4KC 1QBLL 3KDMB 3QJFA 2BVEA 3KCWA 3GXFA 1KY7A 1P5UA 4AYBA 1EJ8A 5FLUA 3TH2T 4X6BA 3UGUA 4A7UA 4F8OA 2MPVA 2HMIC 4QHUA 3B37A 1RUKL 4P04A 5DMJB 4WF7A 4JM2B 4AQ8C 3BDYL 2R56H 4GUPB 5IR1B 2YUXA 2OL3L 3GRGA 3W11C 1WG3A 4N2OA 2CLVB 5HDBE 4EE2A 4F57H 4QRRA 1HHIA 1F3RB 2R15A 3D9AL 4YDJB 1HZLA 4WZ9A 1IAIM 3TA3C 1RCYA 1VJSA 2NPLX 3SPVA 1YQVH 3ZGHA 4FHKA 1A0QL 3PHQB 3U4EA 3G6DL 3CX5K 2FJGB 5TDOA 2LLLA 4YXHL 4K55A 4OZHF 1VLXA 1IGTB 1KPRB 1SHWA 2X6VA 3QA3A 5C92A 4LSPL 3PAYA 3MLWL 4S0SD 4Y2DD 1NCBL 2CBTA 2F53D 4P2OA 5KSAA 1QQDA 2HPTA 3TO4A 1U8KB 3RJDA 3TT3H 3FAWA 1YSOA 3FAXA 5EBLA 5KSUB 1GC1H 4JE4B 3P54A 2DQJL 4BE6A 1F0LA 1MY5A 5JQHC 4AH2B 5EN3A 3LDBB 3VU1A 4OUOA 2JCCB 1J0YA 3VFUB 3WFBL 3IU3B 3BP6A 3DRTA 3ATFA 1I7TB 3OKEB 4ZO8A 5F9OH 2BIOA 2J57A 5BV7L 1HDMB 1QSEE 3BZ4A 4GXFA 1U3JA 3MFFA 1NAML 3HAEA 3AREB 4G1EB 2IPKB 2X3BA 4AYFA 2ZWKA 1FVDB 3QEHB 3US9A 4N2BA 2IPTH 3DX8B 4JN2A 5EZLB 2D73A 2NY2B 5HDWA 1LO0H 4H2AA 5DK2B 4JZOB 1JDAA 2PYFA 3KLHD 1DN0A 4M61B 2Y3AA 5C0CA 5I73C 4Y7OC 2EEDA 3DVFA 1X5FA 1CL7I 3VJ6A 1HOEA 1G7PA 2FL5B 3OPZH 4N0UE 3ZZ1A 1GOFA 1SHSA 5H37A 2OYLA 4DQOH 3QEHA 4ODTH 4OFVA 4PWEA 1RMFL 2R0LL 1CDHA 4BZYA 1DTUA 1T89C 5LGHL 2ICEB 2VL4A 1EZSA 1ORSB 1EXUB 2VLKA 4YIQA 4FFVD 1AS8A 4L1DA 3RX7A 2HWZL 1K2DA 4RFEA 4JFED 4L8DB 1PY4A 1YYLH 2GK0B 3QQ3A 4K73A 5B8CC 5IW1A 2H4EA 1XF3B 2ZICA 1A4KA 3LN4A 2BNRD 1ZT1A 1GHFH 5E6RB 1AAJA 1NGPH 1U33A 1YVLA 1XMWA 5DR5H 4H8WH 5F21B 4PTTB 3STZA 4QRBA 4ZX3A 2R7EA 4P99A 1UXWA 4KRNA 1RUPL 2IO5A 4OCYL 5CSZA 5E2UH 3UTOA 1OTSD 4YSDA 1MJUL 4KRPC 2YAHA 1RK0B 1EGJL 1WAPA 1CG9A 4K3JL 4U4IA 4NPYA 1OZTG 2HJFA 2QPDB 2DDQL 5DA0B 4YHNB 3JTTA 5CU9A 3HCVA 4PD4K 2PCPB 2O30A 1ZA6A 4Z5RB 5C0CE 2YS4A 2ZXAA 2L7QA 4NO2B 2ICWI 3DGDA 2JJSA 2FJFB 1ZANH 3O6MH 5F7LB 1SJXA 3RVXD 5D6CB 5DF0A 5KZCB 4NKQB 2CDEB 1TJGH 3GBML 5K1NA 4F5CA 1XL6A 1E27B 1JGLL 1GGBH 2C3XA 4KKLC 4OFYA 2GBVA 5AAPA 4I3RH 2H5UA 1PFCA 2QQQA 4MD0A 1OXYA 3K6FA 2Y23A 1PZ5B 2I5YL 5GZOC 3MBWB 4PRDB 3ESOA 3S36X 2PP8A 1NOLA 1OOAA 1VCAA 2N1TE 3SPVB 4BH7B 12E8L 4NAQA 4CMMA 1JV2B 5DJAB 2HLAB 2VKXA 4LHQB 4KDVA 4UOW1 4UM9A 5CN3A 4NQQA 2VQ4A 1AQDB 1BAGA 2EUWA 1HHHA 4LRIC 2BP8A 3NZ8B 2J5WA 5I6LA 2R1WA 2BMKB 3GI9H 4HUCA 4B0MB 4HIQA 5IBLC 1BF5A 4NZFA 1ZHNB 3KPOB 2GY7B 4MAUH 1MJ8L 4NLHA 3NFNB 4OD2B 4PRBA 5LLIC 4CC1A 1BEYL 3D87B 4FA7B 4PJXB 5DHVA 1RVFL 4YR6B 4PRPE 2DAVA 4K8RD 4Q6IA 2XQBL 1DVXA 5FPIA 2BP8B 1A7NL 1SLXA 2K4AA 2ZUQB 5D1XC 3T4AC 3WIHL 4CADB 5A40E 4G9FA 5KS9E 3HZMB 3JVGA 1USQA 4UQ3B 2OMYA 4L05A 4JE0A 3UCRA 5KTEH 5IMMA 2X1XR 3FTGB 3TN0C 3CK0L 3EH3B 2CXKA 2V6HA 4MXVE 4PP1C 5CN1A 1EZVY 3AY4C 3HN5A 1YEHL 3FRUA 2J2ZA 1R3HB 5DU7A 2IBZX 1PD1A 4YDKL 5I19L 4OKVB 3UOAB 3Q2WA 4KC3B 2PUQT 5F7KC 1FL3B 3EO1B 3R0MA 2UYLA 5I8OH 1BM3H 2P4AB 4UQ9A 3LNEA 3CN4A 3V52H 3V9EA 2BX5A 4PJDF 1YPZA 2J21A 1YEIH 5B38A 2DD8H 1R5WB 3FO1B 3NACL 5FCUL 3WHE1 4PSPA 2X4PB 3BFOA 5FFLA 4EZMA 4KDTC 5TH2B 2O5YH 3QRGL 4LLYB 4LPXA 1W72H 3QWNA 5HYFA 1ET8A 4JDEB 5ICXA 5IIEB 3RFZA 1BOGB 4DPAX 3BVWA 1CF8L 2NLJB 3MR9B 3VYPA 1G6RA 3LKRA 4NNYA 4BWWA 1B4JH 5GJTL 5L6YH 4KO5A 2J55A 4YSTA 1HE7A 3U46A 1X4XA 2NY3B 3FRPA 4X50A 3LCYA 3UZEA 4A7QA 4P2OD 3S3BB 4Y16C 1WDAA 5GGUA 2DQ6A 1KYUA 5GGSB 4E5XB 1LDPH 2HRPH 4HK3J 4JY6A 2CRIA 3BYTA 4XO3A 3WAJA 4Q9CA 4R84A 4JFOB 2Y06H 1ETB1 1OGAD 1TU2B 2IBZY 2R1YB 1KLFA 2XU9A 2VJ0A 3QYNA 2D7NA 3RJQB 3IU4H 1ZSDB 3OWRA 3J07A 1QO3B 1WZ1L 5B1CA 5EZIL 1NBCA 1NFAA 4P5RA 4A04A 3QCTL 4WSJA 1RUAH 2YKLH 4MJIE 3S5YA 3QIUA 5I1EH 1U6AL 2CA4A 3HG1A 5JOEA 3QWOA 1OGAB 2PXYD 2W81C 4JANB 1BF8A 1SMAA 4R9HA 4I1NB 5E94A 2VLJD 3MRRB 3GS0A 2ITFA 4HJJH 3FTYA 1AQ8A 1L6XA 2Q3ZA 4KDTA 5DO2C 4DOHB 1QSVA 4PV9A 3T6VA 3ULUD 3CDFA 1SLWA 3O2DA 4GSRA 2XRAH 1WSST 3FFOA 1PEWA 5LXGL 2TSBA 3EYVB 1KTKE 3QUYC 4FMFA 2GI0A 3UZQA 4BK5A 3RHWK 4EKXA 1QPPA 5DK0B 4HSQA 1DLHB 4KVNH 3VI4A 1IE5A 1FNEA 1CJYA 2XV2A 1L5GB 1X5LA 1ZLVH 3EDDA 4KKPA 3P2TA 2O6PA 2TSAA 3TH4T 1LO0L 1QSED 3DX9B 3U7YL 1FZKA 5ITBL 4Z77A 1FYTD 2G9KA 4NZRL 3BGMA 1SRDA 2OI9B 2IH1A 4WJ5B 1L9PA 2WLIA 3HUJB 1MHPH 1XEDA 2OMXA 4ONGH 3E6HB 2NQCA 1N12A 3QUMB 5CINH 3IJSA 1PMYA 3SDCA 2HKFH 3SJVE 3T77B 1JG9A 4I18C 4HWEL 2FIKB 4ODTL 4JQIL 1JNJA 3VFWB 5FGSA 4JFHE 5FV1L 2CRMA 3QJHB 5EO9B 1Q72H 5E2VH 3O6FA 2KI6A 1NBYB 1ES0A 1WIPA 2Y2WA 2IQ9H 1DQJB 2UZIH 2VLKD 1OM9A 3ULUF 4ABVA 3MRCB 1ACXA 1B0RB 3H9ZA 3JWOC 1IVLA 4LCWD 3QORC 1FORH 4ANXA 3GK8L 1MZZA 1IBFA 3PL6A 3RIAK 1TOXA 5F7EL 3CH1A 1Q9OB 3F5WB 3QFDB 4XC1L 2BVOA 1GXEA 4L9LA 3FSAA 3ZMRA 2VXTL 1MFVA 1RH8A 2EC9U 2YAFA 1ETZA 2VISB 4AQOA 3VFRB 2IPTL 2ZOTA 5F71A 3BVUA 4Z7UB 4E9RA 1KLUB 1QPKA 6TAAA 4U1IB 4ENZA 1C12A 1L0PA 1AFVL 3F12A 3ESUF 4Y8AA 3WDIA 1CXHA 5I0XA 1A7RH 5T3ZD 2OSLB 4ERSL 1X5MA 4NRYB 4BSJA 2L7UA 4NXKA 2VDKB 3ULVF 3I02B 2QADC 2IDUA 3O6ML 1JNHA 4WTQA 5SX4I 4HPHA 2X1QA 2VABB 4LLMB 2HFGL 3A6CL 1JGLH 1GGBL 2BCKA 1JSYA 1IU1A 4M7LT 5CLXA 5HI4C 2V2XB 3SB3A 2M2DA 4Q9BA 3FQRA 4U1NB 1Z5LB 4FQXC 4H88L 4ALAC 4JK0D 2DF3A 5HY9B 1Y0LB 4Q9RL 3P11L 5DWUH 2UZYA 1IC1A 3UCQA 3G5XA 4FXKC 5D7LD 4D2NA 3T1FB 1KCRH 5L7XL 5JA8B 1IC7L 5CLZA 2XQYK 4TQHA 2QBWA 1BQRA 1TZGH 1W9XA 4FQQB 1TCRA 3CFKA 2D0GA 1XDTT 3J7HA 4HH9A 4TULH 4YGVA 3D0AA 5T1KA 2YD0A 2GQHA 3BAKA 5HHNA 5IKCB 3X3GH 1SPDA 3MROA 2FTAA 4L3EA 4UOQA 4MHHI 5DGRA 5E6YA 5DHYB 4P9HC 3FQ4A 4R7NA 4H0LC 1A7OH 1S9VB 3P73B 2DDQH 4OD3H 3BYYA 3K8KA 5EH1A 2XG5B 5IQ7L 4O02L 4G7VL 4E41E 1MI5A 5KVFE 2OZ4L 3MJ8B 4P5TB 5CKAA 3L6FA 4U3XA 2XA8H 3S2CA 1F4AA 1BYPA 1Z5LA 3V0HA 2XKNB 1EJOH 1GOHA 5IG7B 2FGZA 4OBSA 4P2OB 4KI5F 4Y4FB 4KDWA 3UBHA 4N4YB 3BWAB 3WMPA 2Q7NA 1MXGA 1XGZA 3VW3H 4OGZA 5LQBH 2ORBL 4HLJA 4P59L 2C4FU 4BCXA 3IF1B 2A9NH 5SX5H 5EF0A 4E9TA 5FS5A 2Z93B 5JPNA 1S7SA 2BNQD 3B7UX 4KKQA 1C16B 4Z7UF 2EXTA 4FQ2L 4PN6A 5DJ6B 2ZKHH 2OAAA 4R7XA 3KE0A 2VQTA 3EYSH 2ZTBA 4AM0B 4OCNC 1ASOA 1J0ZA 5E1IA 1AO7D 3NCWA 1LP9A 3QJOA 3RWHA 1CT8B 3PXLA 3V4VA 5TF1H 4LU5L 1PD6A 5BOPA 3US1A 2X2IA 3HAEG 1FO0A 1BEYH 4UQDA 2VE6A 4JKMA 4GS7B 2VDLH 5F1OB 5FM5M 5F9JB 4DTGH 1XH3B 1AJ7H 2X0UA 5AYUL 4DGWC 3CTTA 1OEZW 2ZUTA 5JMRA 3QQ4B 1CFNB 4O00A 1MDAA 3UIZA 4NI6A 2B3IA 1UWFA 2A2QT 4NIYE 1BPLB 3BZEB 1EXGA 1L9TA 3P3RA 2HVJB 1Z0MA 3PE9A 3QUGA 4YFDB 2Z6FA 1ZHBA 5AW5B 2GJ6B 2AI0L 5DJYA 4D9QE 4I18B 5HVHC 4E0RB 4PJCF 3IBOA 2X6CA 4ODVL 3TVMB 1GMEA 4FXKB 2AW2A 2FD6H 2XZAH 5DCCA 1KJVB 2Z35A 5I1GH 4HKXB 5JHDE 5INDA 3VB8A 5DQDH 3OKMA 3N44B 3CQQA 2HKHH 5IJKC 3AWEA 3WFHB 4CW1B 3R1GH 5I8OL 1DQLH 4FZEH 4CSZA 5C0GB 1P7KB 2GW5A 3AADB 4PJEA 3OZ9L 4HJ1A 3TBYB 4IEFB 4PJIA 2CIIA 4Y9CA 1G9MH 1GZQB 4PJ7A 5IB2B 1SN2A 3P9LA 4J6IA 2IAMD 1V7ML 1CWVA 2G4EA 4FERA 3UBXG 5GRZA 4ICXA 5E6IA 3BP4A 2WBWB 3QZMA 1B4JL 4KZ0A 3R0NA 2IAMC 3RPKA 4U3HA 5BS0E 1RPQA 3QUYD 4GAFB 1E4KA 1IZKA 1N19A 1WWCA 5LXGH 4R7LA 4U6TA 4KK8C 3VI3B 2AK4E 3WL9A 2VZVA 3RQ3A 3VG0H 1U8MB 4OZGF 4UB0H 2EE0A 5EUOA 5GSRB 4DUVA 3HZ3A 5LBSL 4G83A 3WJLA 1CGUA 3RIAF 4F3FB 4YDLB 5F7AA 4WTZA 1I4FB 3LJ3A 4QJ4B 4DWHA 3AXLB 5GRJL 4U6VL 2DJMA 5KSAC 5HBBA 5B1JC 5BCAA 5ITBH 2VH5H 5DJCB 43CAB 4YDIL 1EIBA 4WUKH 1F13A 1QWUA 1S9YA 2XWTA 1T1WA 2C3VA 4AK2A 1T7VA 1DN2A 3OKLB 3K2KA 1RUAL 1RZIA 2YKLL 5CINL 2EDJA 1FNAA 2H47C 4KMQA 3Q8BA 4PWGA 5MP6H 3UTTE 2A38A 4ZMQA 3QQNA 4N0CD 4BSVA 2CJSA 3H7LA 4XPFH 1UFGA 1XCWA 2WOBA 4XNMB 5K9KA 3U9UB 1LE9B 1MI5D 1NCDH 5I17B 3FF8A 2QPSA 4W6WB 1CE1H 1QSFE 3KXFE 4MYPA 1XH2A 4XZUB 1ZV9A 4NC1C 2VL5A 1EV2E 3UJTL 5C6PB 1FHGA 3QJVB 4XNYL 4P2OC 1Z66A 2EINB 4NUJB 2YGOA 2K3TA 2C3HA 3RHWF 1I8UA 4L8BA 1JZ5A 3RBGA 4JFFD 2YOCA 1WAAA 4CNIB 1RJYB 5DRZB 4WHTB 4XNZB 5ID0A 3G6AA 4ZD3H 2KPWA 3CFDB 3PIQB 3DIFB 3MRIB 1U8JA 2AANA 2MMXA 1JYVA 3B34A 1XD0A 5K1JA 1IQDA 3TOPA 4HOMA 1B3IA 1QASA 3FN0H 3G04B 3BD3A 6FABH 1R3HA 3WMSA 5JIMA 3VH8B 1D6EB 2E7LA 1J8KA 4NP4H 1VGKB 1DE4A 2JMRA 4GKNB 3HAEB 3BPLC 4ERSH 4QF1B 1SOSA 5H94B 2OL3A 2WXQA 4DK3A 3MCG1 2P26A 1D5BB 15C8L 3TJEL 2C4FT 2NX5D 3OKDB 2WUBL 1EBAA 3JYBA 1WEJH 1H9VA 4HWZA 5DZJA 3FQNA 2UZIL 2NY3C 3MJ7A 3GSRA 3S96B 1G1CA 2VZSA 2LVCA 3IJYB 4LL1A 4Q9RH 5A2CA 5IEKB 2K0RA 1TQBB 1NC4D 3AT0A 2VERA 5K69A 2L8AA 1JWUB 1ORQA 5I5IA 2HT2D 1NL0L 4CVZA 1HCVA 3O9WD 5D1QB 4RMUA 3II3A 3T3PE 4P2YA 3QJSB 3O3DA 2V33A 4JN2B 4FZ8L 2VITA 5EZLA 5KBDA 1BIIB 3ML8A 1A6TA 2JKSA 3FB5A 2AQPA 5AVQB 4CU6A 4PMEA 2WXGA 4R4BA 2X87A 1E5CA 3GEWB 4K5MA 1UZ6E 2R1YA 4YE0A 1F2XK 5B1KA 2VUKA 5FKAB 3TESA 2X7LB 2FZ3A 2JKTM 3ZTDC 5DC9B 3CSYB 4JO2H 4YFLI 4PJAA 2CALA 5HHOE 4H8PA 3TP4A 4F7EA 2G9HA 3MXWL 5IT2H 2EC9T 2KPNA 4HPOH 2VAJA 2Y5QA 4N1EA 2QQNL 5C8JA 4Y1AA 1KGUA 2IOIA 1XEUA 3P11H 3LZRA 3QG7L 4OZGA 2YLHA 5EUOF 1JXDA 3E8UH 3K6NA 3D25B 3PWLA 2WO2B 1CMOA 2EIKB 2DI8A 2JKIS 3RPIA 3ZSSA 3W5MA 2YAPA 3GMOA 3BIAX 4R3SA 5IOKA 4PM1A 2V3DA 5BZWA 4ZS6D 4P2QD 2FBOJ 5E6ID 2H1PH 3JT0A 2ZOOA 2EIDA 1TQUA 3VRJB 5I1HH 1I9RH 3BO8A 4QXTB 3IKCB 2CK0H 3L4CA 4MJIA 1AO7E 1T5XA 4Z0BH 3VMOA 4RMVA 3KPMA 3P4MA 5ADOH 1VEPA 1X44A 3TGXA 2GC4C 4RMBA 2IADA 2A0LC 3IMUA 1NC4A 3T4YB 4ONOA 1JUFA 2O6EA 4J3UA 1MIEL 1ZJBA 2ZKMX 2CAKA 2YZ1A 1PZ3A 1CE6B 1TTFA 5HI3D 3WN6A 4QAMB 4ZPTA 4U1GB 1QLRB 2R1WB 5GGRB 2GKIA 3RY5A 3KS0H 2FR4A 2XX0A 4LLWB 3FFDA 2FHFA 3HMXA 5CS7A 3QCUL 1RFDH 4MCYB 1TYEB 4WCYH 4XCEB 1BAWA 2W95A 1MJ7H 4PJXA 2DEYX 4F8PA 3IDXL 2N3JA 4NT6A 5DK2A 3FULA 3CSPA 1YDPA 2VDNB 4FP8H 1BMWA 3WKMH 4NEHB 1TYJA 1RZJL 5FA3B 2BK8A 3NZ8A 3MRBA 5D7JA 4XMLL 5DHXB 4B9PA 5CEYA 5IHHA 4OZHE 1AOHA 4PI2A 3ZR6A 1T5WA 4OCMC 4X4YA 1G7JB 3SBQA 1HTYA 2DYPA 1MIML 4LVHC 5D2LF 1H3PL 3X1GA 4HSAC 1S9XB 4J23A 4PJXF 2X2JA 2CO3A 3MRMA 3T0EE 2PO6A 2QPFA 4CN4A 2DQFB 5KSUA 1OSZB 3MRDA 4P23C 1WUNT 2CDGB 4J3TA 4M00A 3B83A 4HC1H 1BVOA 1KYOK 5BPPA 4G72B 5FO8B 1XF2A 1VFAB 2A4ZA 3RFZC 5C3IA 3GJFB 1PZAA 1PZCA 1SY6L 4LASH 3T0VA 2G3NA 1D7FA 4WRLA 5C0EB 2ZCHH 5MHSD 2IG2L 2KH2B 4P46A 4QHLB 1W6WA 5F3BA 5F1SA 1FPTH 2P5WB 1T22B 1TR7A 5HPOA 4Y2DC 2QKIC 2PW1A 4YGAB 5JDJA 4HZLA 2DYPB 2EICA 3HG5A 4OGYH 4ZX5A 1G9ML 3ZPDA 1V7MH 4PS4L 4J3BA 1XGUB 1QEXA 1QTSA 5G4OA 4EJ1C 2KT6A 1URZA 3IAPA 3WIIH 1A66A 2K78A 4AGLA 4HA1A 5EF2A 1IFHL 5T5NG 2ZXQA 3LAFA 4HIEA 2NSXA 4N5ED 1R17A 4UT9H 5MI0C 4XNXL 3W11D 1MH5A 1OAJA 5HI5D 1VPOL 5J13B 5T3XE 5J6GA 3QW9A 5EF1A 4OCSH 2DQDL 3F04A 3SY0B 5BW7C 5HDQH 1YY9C 1U8PB 3GXUB 5FYJD 3I02A 3X12B 2PTTA 3LN5B 2HMID 1DP0A 3HG3A 1S6NA 1T22A 2D7MA 1NFDE 3ILPA 4UQAA 1IKNA 4BKLB 2H26B 3PPEA 1S9WA 5DJ2B 5ENWA 5J13C 2CSPA 3D3VD 4KXBA 3JBG7 1FL6B 1T1YA 5HXMA 2VH5L 4U7SA 3E1F1 2X4QA 3HZYA 1F4WH 2ADJA 2JLLA 2NNFA 4AQ1A 1NM4A 3MNZB 1E2VA 4F33B 4WEBH 2D3VA 4ZTPH 5BNXD 2G75A 1CE6A 1QI3A 2ZX8A 2WCPA 2O93L 4KTEL 4A2HA 4HK0A 2X89D 1GGUA 1RKRA 1VADA 5K59E 4MMXB 4UIKL 2A77L 4GJTB 1UZ6F 1I7RB 3ARBC 3W39A 3KS0J 3JV5A 5IP4A 1S7TA 5D1XD 5EFIA 4JGJA 1S8DA 3T8XA 35C8H 3ASWA 1KGYE 1IMHC 3BT2L 3B5HA 3S3SA 5HD8C 1KFAH 3S8WA 1REIA 3WE6A 4MMXC 1XMEB 2AJVL 4X83A 4XP9H 4C54A 4DPRA 1P4BL 1U3YA 3ASNB 4OZFB 4FNLL 4PRAB 4OF0A 3OL2A 3L7EA 1PZ5A 4FQPA 2IC2A 2JK5A 4PJFE 4Z7VE 3MA7A 1N8OE 5TGBB 4EIZC 1PCXA 4I48A 4RX4D 2GJ6A 2IWEA 4GH7B 3H6JA 3P0GB 2K6ZA 1CI5A 3E6HA 3HI5H 1HEZA 3K8MA 2R4SL 4AMXA 2RMNA 4WKZA 1E9PB 2OSYA 2F58H 4JFFA 4WW2C 3SO5A 3CBRA 1RUQL 3B43A 1WA0X 4JRYB 2B9AA 3UO8B 1HXMA 1ES0B 1OAYH 3Q48A 3PXJA 4Z7NB 1ZT7B 3GDCA 5GSVB 1UWXK 3D12B 4JJ5A 1INDL 5E4AA 4M5YH 4CDHA 5C0CD 1UADC 2EDHA 4FFWC 4RSYA 5IVXA 1LP9B 1JZ4A 1OAZL 2JKRM 3ALWA 2GCYB 5IGXL 1JHTB 3BQVA 2D4FA 4BA0A 3LKQA 5C0JA 1DVSA 5BRZD 2QZ5A 1E5AA 5SWSB 2A73B 1KXQE 1JPST 1XD1A 2Y1ZA 4LEBA 2PR4L 2VR8A 5BO1H 1R19A 2AJZA 2P5WA 5EO1A 1ZEAH 1MRCH 1IGIL 1TVBB 2EDLA 3P4OB 4GQZA 2XICA 4PWJA 3QEQB 4M6NL 1F42A 3ESVF 3IMRA 3TVMC 3QRBA 5IHLB 5ADOL 2JNZA 4PLJC 3GT6A 3Q13A 2ICWB 3LRSA 3TV3H 3ZTCC 2EE3A 2X4OB 2W07B 3ARRA 3K72A 2QEJA 1TVHB 3DURB 4RDQF 1HFUA 3GSUA 5HHOD 3D39A 3HBZA 3OR6B 3SE3C 2X44D 3QHFL 4FYSA 4RAUB 1NGXA 2R23A 2FSEB 3OGCA 5A2IH 5EBWA 4HP5A 3BMVA 3VTMA 3WBDA 4CL7A 1CGSH 4GLRI 4N2IA 1OW0A 1BFVH 4APQA 4WK2B 2VDKL 4P2QB 4XO4A 3B1TA 4OIIH 2WQAA 4YSQA 3ARED 3OJ2C 3O4LD 4V11A 1XT5A 2O4EA 5FK9B 2CCWA 2WXLA 4K3DH 4YPJA 3ARQA 4W9HC 4PVMA 4DUWA 1NJ9A 1GC1C 3OKOA 1WVZA 3KLHC 5KANG 5MEPB 2ZCLL 1UUNA 2GB2A 3SE8H 5LCVA 2WNKA 5TFSL 1TCRB 2OXHA 1HHJA 4I8DA 3OLGA 4P2QA 5ANMB 3ZZSA 3AG3B 4ZMZA 4YAQB 4F91B 2AERT 4HT1L 3QIBA 1I9RL 3GIVB 4XO5A 3WEBA 1T83C 3CE1A 2YAOA 5KN5B 4ZXBC 5CEZH 3L3IB 4APXA 3D39B 3O6FC 4PFEA 5K9JH 4XP6H 1NCAL 4LQFH 2F61A 1SN5A 5KAQF 4G82A 4XN4A 3WS6C 3ECBA 3H3BC 4OD1L 4WY7L 1QVOA 4LCYA 4FXGC 2NY0D 4R97B 2LT9A 2X6AA 3D6GA 1XBDA 2B1OA 2COQA 2FJGA 3C08L 5ETUB 4QTIL 5HHMD 2P5WD 2FWLB 4JY4B 4OT1L 3V8OA 1A7QL 2JKNA 1TKWB 1QNZL 1QVOB 5DZLA 2XZQH 3NCBB 3P69A 2VZOA 4WNJA 2R4RL 1LEKB 1YUHA 2KUTA 5TGBA 4RWYH 3GMMB 1OGTA 4L8CA 3WU1A 1E28A 2L0DA 5JYLA 5EUOE 4GYBA 4ODWB 1Q0XL 4S1SH 5KN5A 3HI6L 1FPTL 3SBRA 1ONQB 2AXGA 4XAKD 2YUWA 3X1BA 3GPSA 4G8IB 4P2QE 4XNQA 4XWOC 5DDHA 1CGYA 2XXFA 1NCIA 2CNZA 1W2KT 3Q1SH 3U82B 2YXFA 5C9KA 4LMQI 1DEEB 4Y2OB 5FW6A 1CFNA 2ZONA 2NY6D 4YXKL 1MI5E 5JYMA 3ZLQC 1WV7T 3UDWA 2YHGA 3QI9C 3RKDC 4G8GE 3QORD 4DUXA 3WY3A 1B4LA 1JZDC 1KCKA 3MUY1 3D09A 3PDDA 2XV6B 3I9IA 3RG1C 1IBHA 1E3ZA 1RZGA 4FXGA 1TTRA 4XNXH 1AMYA 5EZJB 3D33A 4BA8A 4OH2A 4WO4B 2GPZA 2AV1A 4WNQB 4KOCA 1PYWA 2OV0A 4HKXA 4N26A 2HN7A 2DQDH 4EDXB 4TL5A 3LTVA 4X9YA 2R0WH 1KCBA 2OTUA 4ZXBB 2X0WA 1MAML 4PJ8C 1A4JA 1ZVHA 4ISVA 3PXHA 1TTGA 3GSWB 3GMNB 2IG2H 5CKGA 4HWZB 3R18A 4RMSA 4K94L 1BQSA 1N6QL 2UWEF 3DRQA 2F68X 2FJHA 3CK0H 4FEIA 2YXVA 3DTXB 4TUUA 5DJ8B 4NQSA 3S6CA 4O58H 2WB7A 5DSCA 4FQ1H 3LZNA 1H15B 2NUPA 4H1LG 5EBWB 1TZOA 4AMKL 1R3JB 5GISH 3BKCH 3H53A 4PTTA 3A21A 4J3OF 3STZB 4PW9A 3V6ZA 3ZVVA 1MWAL 2W91A 2Q1EA 2AVGA 2VR5A 3NDYE 2JIXA 3FFCA 5DWPA 4ZW6A 2Y5TA 2X70B 1AXSB 2CUIA 2DD8L 1P7QB 1DQTA 1CG9B 5I75B 4LAJH 2W65A 4WW1A 2VSKB 2VW7A 3O0RH 5DMIH 4IKIA 4PSRA 1KB9J 3SGJC 3NCCB 1BDYA 3BGFB 2JE8A 3VRIA 4Z7VB 3NCEB 4LBEB 3S3DB 1DQQA 1MRDH 4Y19A 4XZUA 2FT6A 4WEUD 4L4VD 5F6HJ 2XVBA 4Z7WA 2R4SH 5CBEB 3L3IA 5H2BA 2E56A 3OJMB 4FTDA 2C1PA 2JQMA 1AOZA 2EH8L 2VDML 4MA7L 3STLB 1YHPA 4ZUTB 1P69B 1ZWIA 1BW8A 5LBVA 5B8CB 1KULA 4PRHE 2EYRA 3MFFB 4G1EA 2VR4A 2WQSA 4NC1E 4ZMWA 5C0IA 3RIFK 4H13C 3F6LA 5EZIH 3PQYE 2BSEA 3ZKMC 1MCFA 1CDBA 1IEAB 1COBA 5ABAA 1SOQA 3IU3A 3TWYA 4RMWA 3O41B 4AI7A 1H3WM 1RIVH 1NGQL 5GRVK 1QLEB 3MJ9A 5FB8A 3V79C 2ZG3A 3WIFA 2C4XA 4N9GB 5EN2A 3KWWA 4N2NA 2IQAB 1J1PH 4G6ML 3P3YA 5JUEL 3WFDL 4X9GA 1ASPA 3C12A 4LCUA 3BLKA 1LWRA 3EDEA 3LPWA 4QOKB 2XTSA 4IBYA 3UTQB 4GKSA 1MRCL 5IJBC 3I85A 4CC4C 3BPOB 5TDNB 3HNSL 4JMNA 2C9AA 3Q2VA 1MFAL 3D2UA 1KJMA 2Y72A 2DYPD 3ARWA 4IU3A 3MLVH 4O02A 4X5QA 3VWKD 4AGOA 1DVFA 2WVSA 3EHBC 3T0DA 1SUJA 4R26H 2WN3A 2YEZA 4OZIF 5CP7B 1MJJB 3A4FA 3MGOA 5IY5B 2HTKC 1J9TA 5EWIL 4PCKA 5F89B 1CFMA 3O3EB 3RWEB 3RZWA 2FB4H 5FB8B 2PETA 1MHPL 3FU0A 3NJNA 3NSYA 5E99H 4DW2L 4AZUA 3DI2B 3RDTD 3JTSB 5FKAA 1AQDA 3I9AA 2NUTA 4KK9C 1EDHA 3AG2B 1GR7A 3GJEB 5CGYC 1Q94B 1A3ZA 5D7SL 4X99B 4KQ4H 3UERA 1KTDB 5JO5A 4LSTH 4QDGA 1SZNA 4ISVB 4XB3A 4FNPA 5TK2A 1KJ2L 1CDYA 1YEFL 2H3XC 5AD0B 2J44A 4WUUE 1NM9A 4NS0A 2ESVD 4NB7A 4PWIA 1M56B 2E9IA 5TFSH 4GG6B 4K3EH 2PR4H 4XMKH 5BO1L 1M05A 3GK8H 3PGDB 1IGIH 4OZGB 2CGRL 2VR9A 1OD9A 4XOCA 1EJ6A 1YYMH 4WO4C 1MWAB 4LFHG 2BDNH 4M8UA 2HRLA 3HS9A 4PJ7F 1S78C 5IVOA 4IRJA 5C0BB 5D7LE 2Q7YB 3UYOD 3W9DB 5ACZA 3SPCA 1YNLH 2WXKA 3EYUH 1SDDA 3N40P 2Y1AA 4CC4A 4PJBE 3NEEA 4E68A 1YQ2A 1VEMA 3TYGL 4ZUVA 3W82A 3NYKA 4KU1A 4ORGB 4PCYA 4F7MB 3FXIC 4OLXH 4CVWA 1XSJA 3GMPB 4QTIH 2CBPA 1FFPA 4WW1B 5T33L 1HS6A 4UZGA 4Y0GA 3T09A 2VXQH 4JG0H 4NQEB 1KDIA 3SKMA 5B3JF 1CXKA 1GKEA 4ZX4A 2P5EB 5D7EA 4B5ZA 4U1MA 2KYIA 4RWYL 7PCYA 4EF3A 4HS8H 4ZTOH 1KB5A 5CCHE 2ENPA 5JXAL 2Y7NA 4Y4HB 5TK4A 4M7ZC 1T5XB 1IT9L 1W0VB 2C8NA 5D1XE 4NRXB 5DD5L 3IYLW 3V4PH 1G5AA 1YJDH 5FA4A 1EFQA 3MUZ1 1R3LA 2PWEA 2ILLA 3T2PA 2GJZA 4WI9A 5C0IB 1CFTA 3U30B 1X6NA 3RTQD 5L7XH 1F4XL 2LOEA 4GQ9L 5DMKA 1K4DA 1IEAA 1D5BA 1JZIA 1V3JA 4LVEA 4XCEA 2VDOH 3C8HA 3DKHA 4LVOB 3GMLA 1MHHA 1X9LA 4G8EA 4U0RB 2IXQA 4HXAL 4LLWA 1VACA 1CDJA 1K6QL 1N64H 2GHZA 5HHME 1KF9B 1N7MH 4JCWA 1NC2A 1FYHB 3V4PA 3MV01 1T0MA 1JPGA 3L4VA 4I1PA 5EN2B 4NQDD 4W4OA 3Q6GH 3L4WA 4Y2DA 3RNQA 3UTTA 1DQDH 3QPKA 1A2YA 3VFNB 3ZT6A 1X3DA 4M6OH 1GJUA 5IMOB 1D7BA 4UYPA 4PRHA 2J6WA 4LEOB 4YNYA 4DCQA 1OSZA 3MRDB 4H40A 3IDMB 5C0BE 2YD6A 1QA9A 2D2CC 1NGWA 3MRMB 5TQ2H 1ULVA 4B7IA 1R3KA 3BVNB 4GLRH 4WWKA 3FB8B 2CE6A 4OUUA 1E42A 3QEQE 3HNVH 3REWA 3ABMB 1WHPA 3DMMB 2OMWB 3PQYD 3UP6A 3LXBA 4BJLA 2NY5C 4ALAL 4MS8C 1OM3L 3LNIA 2X4SB 5E8DL 3VM5A 2AK1H 3C5JB 3GXNA 3CU7A 3O9WB 3HC2A 4IK7A 5GHWH 4OZIE 1XF2B 4GMTL 2H3NA 4IIQB 5LGYA 1YRKA 4PREA 1QR1A 3RGBA 1UJ3A 1E67A 2A6KB 5C07E 3JT2A 2WNWA 3EKCA 1CN4A 1DQIA 4U1KB 4GRLD 5SWQA 3WKNA 1AJ7L 5AYUH 4WFHD 4WW2F 3HBPA 2DLFH 1QLFB 4XHJC 3TEWA 1YN7B 3E3QC 3ES6B 3P77B 2YPKB 1SDDB 2E75C 3VU2A 2Q6WB 3NZHH 3QJHA 1WBZB 3L1FA 2C9RA 3DGCR 1S7WB 3WFEH 5C0BA 1ED3A 2OA9A 3BDBA 1U2YA 4GBXC 2FGWH 1A4BA 4M7KL 1PDKA 4AG4H 4XI5D 3VDBA 2A1WH 4ZS7L 4IIZA 4NWUL 1ERNA 1W6LA 1G84A 4E9SA 1WFUA 3IGKA 1O6VA 4Z7IA 3JWDH 3WGVB 1T04A 4IRSC 2A4EA 1FL5A 4R83A 2UZPA 4PJFB 2EXWD 1MHEA 5TE7H 4APQC 5LVEA 4OZ4A 3G6JB 1BWWA 2P43B 1E8YA 1WP6A 5FC9A 4NENB 5T8IA 5L9DL 2NXZC 5EA0L 2I07A 2HG5A 1GCFA 4CVXB 3KPRA 4TVPL 4DP4X 4Z8FL 4AC4A 3QAZC 2YC1A 1I7RA 5D1ZC 3IJSB 3HZKA 3SDCB 4OW6A 3FU8A 4DEWA 1X5AA 4TSCH 5JUEH 3NH7H 4PGEA 4R2GD 3V2AR 5JW4N 4PB9H 1E4XI 5IK3B 3DXAE 1SXBA 1HHKA 1WBZA 4LRNL 3VWKC 4GRMB 4CUCA 1BREA 5BV7B 4JLRA 3U0PA 1DO6A 1FZKB 1RSFA 4FFYH 1YUHB 1LEKA 3HNSH 4L8SA 4AQ1B 4QYOA 5IWLC 5CR1A 1MFAH 1T66D 4ZFQA 4NQXB 5FR3A 1K8DB 2UXFA 5DRWA 3FQ2A 3WJJC 2O5ZL 2WGXA 4MJ2A 4GSQA 1TZHB 3RVVC 1XF4B 4XP4H 3PWVA 2WTRB 3P4LA 5KBMA 4PG9A 5D7IA 1BQHB 5HJ3B 3UTSA 2FB4L 3DXAA 2ZSVA 4AWJC 1N8ZA 3IVKA 3DUSA 1DBJL 3SQBB 1MFBH 2YJQA 3DBXA 3V5HA 4AEHL 3IMVA 4RFNB 1JI2A 4P46C 5TPWL 4B9KC 3TXAA 1YEFH 3IDYC 1TNMA 2Y7MA 4E9YA 4WWKB 4DGYL 3WTVA 1WT5C 1NLDH 1X5JA 2E27H 2ZZUT 5BXFA 5I1IH 2W9DH 2WWMC 4UT6A 1G0YR 2PW1B 2R29L 4YHKH 4HF5H 2ZWLT 4C56B 3NJIA 1PQZA 4P5SA 3UIYA 1UKTA 5CZKA 3B7SA 1RUMH 1TQCB 4EBQL 4YMPA 4TNFA 2FUTA 1KELH 2XBZA 1F1AA 2ZAIA 3MRHB 4G8GA 1UHVA 1UQSB 3B3IB 4O9HH 4F58H 5EIVA 4E0RA 3DUSB 4KMTH 4N8VB 3BQUD 1FFOA 4R8WH 3SQBA 2EVGA 4G71B 5AZEH 1LWHA 4Y4KC 5IZ7A 5B3NA 4B9IA 3V5HB 1X4ZA 5AB2A 3I75A 1ID5I 1PQZB 3MR9A 5KBLA 4XVOA 3TT1H 2W07A 4DW2H 5H4YA 1IBDA 5HYSA 1UUSA 5I5RA 1I75A 5BXFB 4M1CC 4FQXA 1M9WA 1X5HA 2X70A 2IPUK 4JFZH 1X5XA 3DO3A 3HE7C 5TE6H 1BXVA 2B08A 3TPKA 2Z64C 5BQ7B 4DKFH 2GJ6E 4C83B 4OZIA 1ZS8B 2WBJB 3GI8L 4HMEA 4LHUA 4LSRH 4NBXB 2AV1B 1JS4A 4WNQA 3HRZA 3QIBD 1BA9A 2EE2A 1TO5A 4XMTA 1WZLA 3TBSB 1EHXA 1GVIA 2YPLB 5IB3A 2E9WA 2YD1A 1MAKA 4HFWA 4WWNA 3SEPA 2B20A 3E2HC 2XUWA 1BEXA 5DJYB 43CAA 3AMKA 3DRQB 4UOW0 4ZDHA 5T1KD 3GZPA 4KX7A 3TBWA 1TUPA 2IBGA 4N2LA 3HRPA 5D1QD 4FF9A 4X2UA 2JI1A 3BC9A 4X6CA 5IHZA 2AJXH 2HFEB 4RRPG 1C08B 3WTSA 3EYQC 2F9BT 3QO0A 4TLTA 1VGEL 3A6BL 3MODH 1LE9A 2CR3A 4YHYB 4BDVA 3C9NA 5EC2B 4R7NB 1CBJA 4AVKA 3MNMA 4L5FE 4OCXL 4KV5E 2AQTA 3T3MF 4KQ0A 3KEDA 5JHBA 2R9HD 4X6BB 4NYLA 4GI6A 5ANME 5C6TH 3BVDB 4MB4A 3WENA 4M48L 4I88A 4G7YL 4Q6KA 1EUUA 2B1HH 4FTVE 1NUNB 1I7ZB 4JG1