2AVFA

Crystal structure of c-terminal desundecapeptide nitrite reductase from achromobacter cycloclastes
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
314
structure length
314
Chain Sequence
b'LPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
molecule tags Oxidoreductase
source organism Achromobacter cycloclastes
publication title Crystal structure of C-terminal desundecapeptide nitrite reductase from Achromobacter cycloclastes
pubmed doi rcsb
total genus 80
structure length 314
sequence length 314
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2005-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2avfA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2avfA02
3UACA 2BZ7A 1V55B 3ZDWA 4Q8BA 2I85A 2XV2A 1IBYA 4UANA 4YVNA 2IDUA 1R1CA 2HRHA 4DP8X 1A8ZA 3S3DB 1L9TA 4AX3A 3QJRB 2VW4A 3FU7A 4L0PB 1KCWA 3T6ZA 3L45A 2FT8A 2I7OA 5I6KA 4JHUA 1SNRA 1SF3A 3UAEA 1TEFA 2VM4A 3NJJA 1ET5A 1RZPA 3T9WA 4BXSV 2N0MA 2FQDA 4A2EA 1JXFA 3FQ2A 1WA1X 1AS6A 2XU9A 2HLEB 1GS7A 4BXVA 1NIEA 1NWPA 4GP8B 1GS6X 4YSTA 3RYMA 1B3IA 3UABA 2IWKA 3NJLA 1W6WA 3TBBA 3ZBMA 4E9XA 1AAJA 1W8EA 3QJVB 1ET7A 1NDTA 3CDZB 2EIJB 3ZX1A 2J56A 1TEGA 1E5ZA 3FSAA 3OMAB 1J5DA 3EH4B 3NSCA 3QJSB 1PY0A 4FA7B 3KW8A 1FFTB 4E9YA 4E9VA 4DP7X 1TU2A 1JZJA 1XMEB 1KBWA 2PP8A 1BYPA 2IH9A 3X1EA 3FU9A 1GY1A 2IDTA 2Q5BA 4BK5C 1E5YA 3MBWB 3SBQA 3OQRA 6PCYA 4KO6A 2TSAA 4HALA 3FT0A 1XB3A 2XYBA 4HCFA 4AKOA 8PAZA 2MRYA 3WKQA 1IUZA 1AZUA 1M56B 1KDIA 3FPYA 5B7EA 3HEIB 3T6WA 2UXVA 4PCYA 2JFCA 2AFNA 2XXFA 3V9CA 4YSUA 4DP2X 3FYIB 2DWTA 3D12B 2YAFA 3T6XA 5I6PA 2RACA 1YLBB 3SBRA 2XV0A 4A66A 3H4HA 5ANHA 2I7SA 2FQFA 4JKNA 1OE1A 1OCCB 2AVFA 5B1JC 4ZK8A 2CCWA 2PCYA 2BWIA 3NSFA 3CDZA 1DYZA 2VN3A 4NB7A 1SHXA 2XUWA 1E30A 4YSSA 3QJUB 1RKRA 1KBVA 1OCOB 1GSKA 3EHBB 1PLAA 2UXGA 2IDSA 2UX7A 3DTUB 1ZDSA 4BWUA 4G72B 3OM3B 4A2GA 1J9QA 2FT7A 1OCRB 1NPNA 2ZONA 4KOCA 4KO9A 3WG7B 2FQEA 1HAWA 1NPJA 5LDUA 1GY2A 2UX6A 1BQ5A 1NZRA 4W9ZA 4PAZA 4P5RA 1SFDA 1SDDA 2EILB 2QDVA 9PCYA 1A4AA 3IN2A 1AZRA 1ILUA 3FU7B 1MDAA 2J5WA 1PAZA 3UAAA 5AZUA 3TASA 1FWXA 3U25A 3IN0A 1IC0A 1JZEA 1AIZA 1L9RA 3AZUA 3S8GB 3QQXA 4AKQA 2XWZA 2WSDA 1BXVA 2IDQA 3ABMB 2BZCA 3NP4A 2HX8A 1CYXA 2GSMB 2IH8A 2BP8B 3KW7A 3AG1B 2YAOA 2J55A 5I26A 4HIPA 5I6NA 3NT0A 4HHWA 4DPCX 2B3IA 1ASQA 1JOIA 1JERA 1RZQA 3FSZA 3CVCA 3EF4A 1SHWA 1ET8A 1PNCA 2IWEA 2PPCA 4KNTA 3ZIYA 3PXLA 4E9QA 1MG2C 5F7BA 1GYCA 1ASPA 4KNSA 4QKTA 4MFHA 2GHZA 5I5MA 2AANA 5B1BB 2FTAA 1JZHA 3UADA 1RCYA 2FNWA 4BWTA 1NICA 4DP5X 2BW5A 2TSBA 1ILSA 1HAUA 2CJ3A 2GI0A 2EIKB 1L9QA 3QJQB 4DPBX 1ASOA 5B1KA 4QLWA 7PAZA 1BQRA 3ABKB 2FWLB 3S8FB 6PAZA 4YSAA 2UXFA 2NRDA 5EHFA 2DY2A 4GY4A 2YAPA 1NINA 4YSPA 3CG8A 1OOWA 1KDJA 2W88A 2OJ1A 1AACA 2CUAA 5I6MA 2PPAA 1V54B 7PCYA 3PAUA 2ZOOA 5TK2A 1OF0A 2EIMB 1NIDA 2GC4C 2X87A 4GXFA 4G7SB 1X9UA 2VMJA 3HB3B 2A3TA 3FQ1A 2DYRB 1IBZA 1J5CA 1URIA 3T6VA 5I5IA 1A4BA 2VW7A 2PCFA 2H47C 3H56A 1L9SA 1AOZA 5AKRA 2YARA 4DP1X 4F7KA 4E9TA 3AY2A 3H4FA 3G5WA 2HXAA 3DKHA 3WKPA 3AG4B 3NJHA 4HCGA 3SQRA 3ERXA 2Q9OA 4AI7A 2R7EA 4GP5B 2DV6A 2OV0A 3C75A 3PAVA 1WA2X 1GW0A 2JXMA 1XB8A 3N55A 1F56A 1ZV2A 3FU8A 1EZLA 3AG2B 3GDCA 4A2DA 3ABLB 1M57B 1JZIA 4P5SA 1ADWA 1AS7A 2BP0B 1FA4A 5B7FA 5TK4A 4KO7A 3OMNB 2R7EB 2UXTA 1ZIAA 2DYSB 2GBAA 1L9PA 3NJNA 2BP8A 1L9OA 1GS8A 1BQKA 1ZIBA 4CSZA 1PMYA 1A3ZA 1ID2A 1AQ8A 4BDVB 2H5UA 3NSDA 4F2EA 2BP0A 1NIBA 2FQGA 1PZCA 2XX0A 2YXVA 2PPFA 4X4KA 1XB6A 2OCCB 5B3SB 4G7QB 3OD3A 1JVLA 2IDFA 1JXDA 2QPEB 1AZNA 1M9WA 1AS8A 3S3BB 1ETJA 5F7AA 3IE9A 5B1JA 3NSYA 5I28A 3CVBA 4M4RB 4DP4X 2CAKA 3TA4D 3BQVA 2PPEA 4TXVB 4YVUA 3JT2A 3QJTB 4KO5A 1NWOA 2X88A 3WIAA 2YAHA 4YL4A 1SDDB 2IAAC 1A4CA 4YSQA 1NTDA 1I53A 4ENZA 4E9WA 1QNIA 1AZCA 2EINB 1QHQA 4JHVA 1OV8A 5D4HA 4DP9X 2P80A 2E86A 4E9SA 5AFAA 3PCYA 1PNDA 4W1TA 3GXUB 2HZHA 4G7RB 2AZUA 4G71B 1CUOA 3ABGA 2VSMB 2W8CA 2P80D 1T5KA 3BVDB 4N8UA 4AKPA 2HX7A 2WO2B 1JVOA 3PLYA 1GR7A 1KCBA 2Y69B 2QT6A 3TU6A 2PP7A 2VW6A 2XVBA 2ZXWB 3NJGA 4KNUA 2IWFA 3OMIB 2GC7C 1V10A 2FJSA 2PP9A 4YSOA 3EH3B 4GYBA 2DWSA 1NIAA 3ASNB 4G70B 1AR1B 4YSEA 4EF3A 2CALA 1J9TA 1J9RA 2GIMA 5D4IA 3TBCA 1UATA 2ZWNA 1AZBA 3UGEA 1CURA 1BAWA 3NJIA 1NIFA 3T71A 1JZGA 1HFUA 1AANA 2Y1AA 1OE3A 3NP3A 5D4JA 1KGYE 3X1BA 3AW5A 3WI9A 3IEAA 3DIVA 2QPDB 1TKWA 1VLXA 1KYAA 1N68A 3X1FA 3N2JA 4NERA 3FSVA 4N4YB 1X9RA 1SJMA 2BO0A 3ASOB 3PAZA 1CYWA 1N70A 1PLBA 1SFHA 3X1GA 2HRGA 1CC3A 2J57A 2HX9A 4RH4A 1AG0A 4DPAX 2AZAA 5FC9A 1MG3C 1JXGA 1WA0X 1SF5A 1W6LA 1PZBA 2H3XC 1E67A 3NJMA 2JKWA 2WO3B 4A67A 5PAZA 4GP4B 4YSDA 5I6LA 2BW4A 3NJKA 4K9JA 1MZZA 4WTQA 3JTBA 4HZ1A 1BEXA 2BHFA 3NJFA 2LLNA 3CVDA 1QLEB 3IBOA 4WKXA 4DP6X 4HHGA 4YSRA 3FQYA 3FS9A 4A68A 1J9SA 4HAKA 2XLLA 2YXWA 1IKOP 1PLCA 1WS8A 1EHKB 1ZDQA 4UAHA 3SBPA 3WNIA 4A2HA 2PLTA 4NAJA 4A2FA 1PZAA 4UF7C 1PCSA 1ZPUA 2BWDA 5IY5B 3V9EA 1WS7A 1WAEA 4FAAB 3X2QB 5I6OA 2YAMA 3FPXA 2XV3A 2GB2A 1PF3A 2XXGA 4CSPA 2MTAA 3MX0B 1BXUA 2B08A 1A65A 4Q89A 3GYRA 5E9NA 4BWWA 2YAQA 3FSWA 3PPSA 1OCZB 2FT6A 4YSCA 3EH5B 5B1AB 4KOBA 3CZUB 1BYOA 2YQBA 1JZFA 2PPDA 3FYEB 3X1NA 3S3CB 1E65A 4BDVA 5B7MA 2YAEA 3QPKA 2CBPA 3AG3B 4DP0X 1KV7A 3NYKA 2QDWA 2VSKB 2VM3A 5A7EA 1AG6A 5PCYA 4E9RA 3WNJA 1OE2A 2XX1A 1MZYA 4M3HA 1DZ0A 5I5JA 4HCIA 4F2FA 1BXAA 4AZUA
chains in the Genus database with same CATH superfamily
2LVCA 2X40A 5F72S 1U0QA 3ATDA 3ZRFC 3QHTC 2PWGA 1XVSA 1A7RL 4Q8BA 3FN0H 4M1DL 1MFEL 2OZ4A 5JORB 2R1YB 4ELMA 3IRZA 4HWBH 1E27B 4FJZA 4GI8A 4QRRD 4XMZA 3NCWA 1SF3A 1F90H 1MWAA 1QVOA 2VZUA 1MQKH 1R24B 3FB5B 4OCLC 5DEFB 3O2DA 4Z6AT 2N0MA 4XVUC 1P1ZB 4I77L 2GVYA 3MRLB 4P06A 2Q6WB 2NXYB 3JYCA 4NDMA 5DJZB 5CJBA 4FABH 4U6YA 5DD1L 5HGAA 3TWYA 2DI7A 5EBMA 4H8HA 5C08D 4AIZA 4ES9A 2Y24A 1XXFC 1NIEA 4J4PD 1UG9A 1QFWL 3CFMA 4L1DA 1T83C 3BUDA 5H37A 1J5IA 1HEZA 1W6WA 1TJGL 3OKEB 1H15A 3ZBMA 1AAJA 1HHJA 1S3KL 4FQIL 1MXGA 4FQCL 4G6JH 3T3MB 3CWGA 4HZLA 4ZX6A 1DEEA 5KVFH 4OCSL 2B0SL 3OMAB 1FYHB 3IE4A 3QIUB 3S3SA 3IXAB 1C9SA 2OA9A 3CHOA 3ZT7A 4CDHA 3QJSB 3K2UH 4WIQA 5DJDA 5GHWH 5JQHC 2UVEA 5E99L 2DWDB 2X1QA 3QZOA 1NCUA 3FQTA 5K9KA 2VRAA 1SLXA 4LAQL 2JKSA 1GY1A 2YRZA 5GIRB 4QXVA 5AKTA 4PHXA 4MBRA 1SDAB 4ZMZA 5KVDE 2A74A 2FYYA 5CGYC 3EFFA 4UIMB 4R3SB 2X9YA 4F33B 2ZAHA 1BZQK 1NLDH 1M56B 4F1SA 2WQRA 4PWJA 4MNQA 1DBBH 4BIKA 4ZNEA 3N85L 4PD4J 4QRRA 1DCLA 1QBMH 1W72B 1C1EH 1R6VA 2I5YL 4G7YL 2BNRA 3GXMA 1BZOA 3QXAA 4NENA 2AMUA 3BPOC 1W15A 4L5FE 4LHUA 5D1XC 2MIZA 5C0ND 4DZ8A 3CFUA 2J8HA 4IBUA 1IIKA 5KBMA 2BOCB 2IPKB 4ADJA 2F7QA 4U1JB 5E0QA 5F9AC 2HTKD 1JGUL 5DQJA 5IFJA 5FHBL 4KJWD 2EE0A 3BQUC 3VXME 2L7EA 1LE9B 3KVQA 4P5MB 4O2EA 2PYEB 3QJUB 4NHCL 4W9DC 4ENEC 3AB0C 2C7UA 4AIEA 5AAWA 5BUAA 3HHRB 2IDSA 3EDDA 4PJ7A 4LPCA 4QXGL 4TSBH 2E4FA 1NFDA 4BSVB 1HXYA 3BP5A 3DTUB 4BWUA 2XTJE 1LK2B 2QKIA 4ZX5A 4EI5D 4FKKA 1T20B 3QYCA 4UDUA 1KJ2B 1TFHA 4MA3B 4NKOA 1XGRA 4NRXA 4ZRGA 1RZ8A 2P8PB 3LSOA 4LPTA 1HAWA 3VGAB 2FIKB 4Z3JA 3DV4A 4AG4L 3RZCC 5HHME 1N5AA 1UJ3B 3VXRB 4B9KC 3LX9A 4PAZA 5E6UB 3MNVB 5CJXA 4XPAL 4DGUA 2O6EA 4NQUA 1OW0A 3W57A 4NO3B 3RNKA 2UWEA 3UL4A 1UZ6F 2NMSA 3NFPA 1HQRA 2Z0UA 4XB8A 2YPLD 3V52H 1AIZA 1GIGL 4YIQA 1G6RA 1KGUA 4Y0GA 3BH8A 2BH0A 2XOTA 5E2WH 3DIDA 1NFIB 1JWUB 3B7TA 5FO7B 3VFTA 3OKYA 5B39G 3O2DH 5T33L 4JFEA 5HHNB 4J3OC 3ZTNH 2DLFH 4Z7NB 3MHZA 4YHYB 4M5ZH 2F7RA 3ZTJG 2ATKB 2HUEA 4G43B 2UY6A 2WO4A 1I82A 5I26A 4LXFA 5I74B 3BN9C 4Z7UE 1UM5H 3Q8AA 3OKOB 1M71A 2NR6C 4K3JH 3CX2A 4HHWA 2QR0A 3W5NA 1ASQA 4FQJL 3CMOL 4R5VA 1RZQA 5DD5L 3TA3C 2JELL 4XR8C 3FSZA 4LFHD 2DM2A 4S1QH 4L8DA 9CGTA 1QZ1A 2IWEA 2PPCA 4IMLB 2CDEB 1KTJA 2EZ0D 5AD0A 4E9QA 1GYCA 1MLBA 3FKUS 1AGEB 3DMMA 4XBPB 5L2KA 4RWYL 1RZ8B 5FYKU 4XAWL 3T1FA 1JXJA 4S1RH 4GUPB 3CDYA 3HG1E 5GGSY 4GG6F 5MERB 3TN0B 2V9UA 1FG2A 1E43A 5E2TH 1CTMA 5MENB 5IESL 3G6JA 3RBSA 3QRGL 8FABB 1BQRA 4U0RC 1YC7A 4M4PA 4HWEL 1OSZB 2TRYA 4MD4A 5D96C 1WBYB 3A4AA 5C09E 4K8RD 3K5SA 3TPKA 2EUWA 2R2HA 3RA7H 2CIIA 1ND0A 2D8KA 3AS1A 3MRBB 5HHMD 5T5NG 3S9DB 3ULUD 1UM4L 2ZOOA 4PJ8B 4MAYB 3WCYA 3MCKB 5EUOF 3TIDA 4D9RD 4Y8DC 4FNUA 3LXAA 2XKNB 2XBTA 4R90L 3UYPB 3ZGIA 4Z3FA 3K6SB 2D03L 2FH8A 4P04A 5C0FB 4P2RE 5DVNA 1UQSA 2GAZA 5EO9B 4EMZA 1MLBB 1CICB 4AI7A 1DLHB 5D93B 1RUAH 5IZ7A 1R3JB 1BCIA 1R5WA 2P47B 5IBLC 1G7HB 1CDIA 4KZDL 2WVVA 4GSQA 3WMQA 5JA9A 1NBZB 3UTTD 2YBRB 2ATAA 4XTRD 4FXKC 1TQVA 5B7FA 1FA4A 1X7QB 1RURH 3RTQD 2WWMC 4YZWA 5C07D 4CGTA 2N7AA 1TUPA 2A9MH 3W11D 3KNBA 2VXQA 2B20A 4IRZL 3SDDA 3IU3B 4MCYA 4X5XA 1FL5A 2X1OA 3MUHL 4YE0A 2BSBA 1VFAB 3SDCD 1PX3A 5INDA 5DQJB 3U2JA 4U0QB 3D2UA 1G4RA 4JPIB 4OZGE 3W3BA 3MJ9A 4HYTB 3KYKL 1VSCA 3OR6A 3MLSL 3V4VA 3D9AH 4L5FH 2JJUA 1CJYA 2HFGL 3KPSB 1U93B 1KFAH 4UAOB 3ES6A 2LAGB 1AMXA 2AK4B 5GGVY 3P0VH 1EVTC 3JV0A 4YHPA 4U6XA 4M6AA 5DYOB 2WLKA 5IV2A 3CH8A 4P59H 4G2AA 4NKOB 3Q01A 4NRXB 4Q6IA 2PPEA 3WDHA 2VDKL 5CHNB 1JYNA 1J5OL 3R06B 3TZVD 7FABH 2XZZA 4ODTH 5D9SB 4AW7A 3H7BB 2H6OA 2K7PA 3AC0A 5DZPA 4HS8H 4DF9A 3C8KB 4PWKA 3IMWA 1DJGA 1F02I 3MX0A 1EXGA 4H1LA 4JRWA 4UQBA 4Q56A 4QHKI 2WWKO 4M93B 1CE1H 4Y7MA 3TBVB 4BSJA 1HNFA 1RJCA 3Q6FA 1T3FB 5EZJB 3D0AA 3ECBB 3AWFA 4LRNH 1H6FA 3C6LC 1A7PH 5EDSA 4JRFA 4KXDA 4G7RB 3NAAL 4HAFA 1OAYL 4WSKA 1GW6A 3I9IA 3MDJA 3NBNA 5HYSA 4N9GA 4QXUL 1MPAH 4FADA 3T3MF 5I24A 3IJSB 4NQTA 1F4AA 1ZSDB 2Y06H 4WEMB 3TT1H 3MGAA 1OPGH 4YDJB 3P3UA 1XQ4A 2Q20A 5CZVL 3TBTB 3NQKA 1B2YA 5DF0A 1G9ML 2JCCE 3K6OA 2QKIC 1UYWL 1IM3B 5D7LD 1IE5A 2Q86B 1MJ7H 2OCFD 1RK0A 2FJHB 4X6DB 4K2UL 5AAWC 1WFMA 5CD3B 4NO5B 3BVNB 4CN6A 3KS0J 1CURA 2DDQL 2XVLA 2JWYA 4XTRC 4JDTH 5D9SA 5MEND 35C8L 4HK3J 3HS0A 1SOQA 2VOTA 3MJ8A 3UERA 4MCZA 2X4QA 4IKNA 2NW2B 5IR1A 5EC1A 3AMLA 4UQ2A 4OGAD 4TPRL 3VFWB 4N4YB 5EFIA 1LEKB 3PIQB 3KJ6H 2K4AA 3QO1A 2MCPH 1JBJA 3JWNG 4OV5A 4G6FB 1GJIA 3BDYH 4OZGB 4RDQF 4EI6B 1MVFA 4L4TE 4YO0B 4Z78B 4DPAX 2VDQL 4ZX3A 4RRPA 5AVQB 3VXNA 1BGXL 1WZAA 2YKLL 4HJ0C 1UA6L 1FFNA 1UCBL 2FSEA 2Y36H 3OHXB 3RP1A 4EN3D 2RQ8A 5IHZA 5IVXA 2D3VA 4LCUA 2GEQA 1FO0L 1AIFB 5E6RB 1S6NA 1M7UA 1KIQB 1I8KB 3AROA 4HS6B 4PJCF 4U1IB 2VZ1A 4WTQA 5I6LA 1TZGL 4HZ1A 1EHLL 1BEXA 3HMXA 3N44B 4KHXL 2CGRH 3A21A 3CFNA 2ZOKA 4IRZA 2EICA 3UBHA 1Y1DA 3MODL 4D8OA 5EBLA 1UGNA 4AV5A 4R96A 3BVTA 2O4EA 1PLCA 3KL3A 3C60B 4B97A 2K9FB 2J6EH 4KZEH 4PV9B 3ZMNA 4JPVL 5DVLA 1YEWA 3L9BA 2KH2B 3EW3B 1NBCA 2WP3T 3BZ4A 4Z0BL 4PJ5A 4EDWL 3NIFB 3UG3A 4PGEB 4R5XA 4IHOA 3LKPA 4NCC1 8CGTA 5KYWB 1UTDA 3US9A 1WAEA 1NSNL 1ZVHA 2EP6A 1M3IA 2AVGA 4XNZB 1JV5A 1KXHA 3JYBA 2XXGA 3T4YB 2GEEA 2WZ5A 4N6RB 5LG1A 1PZ5A 4BKLB 1KCKA 1KLGB 3B3BA 4UQEA 3RTQC 2ZUVA 4Q89A 4WHYG 5IT2H 1A3RL 1VF5C 5BMFH 1UM6H 1JFQL 2ORBH 1RV6X 2X6CA 4NKDA 4E0RB 2CJUH 2VLLB 4ZZKA 5CGTA 4GRMB 4Q4EA 5D72H 3ULVH 1TQTA 3SOTA 3U4EA 1H9VA 3ML8A 2OSXA 5E2JA 3X1NA 3DA0A 1E65A 2DWEB 2I27N 2ZXBA 3M1BA 4LCUB 4WJ5B 5DUJA 3JV6B 4AH2B 4OB5H 4LSRH 1N5YL 2FL5B 4RFEA 1DJWA 3NPSC 1FVEA 5PCYA 3TYGH 1OE2A 2NY3C 1HILB 1A14H 4PV8A 3MV8B 3V0WL 1I85C 4NZTL 4G1MB 2VXVH 2MOQA 4WEBL 5H4ZA 2Z92A 5TDOA 4ESKA 3O2WH 1R5WB 1GGBL 1EUTA 1DANU 2R56H 4E42A 1WGOA 1QACA 4PJHE 4QRBA 4ZOAA 3BQUD 4NN5B 1X4XA 4AX3A 2VW4A 3KWTA 2DQHH 1O9VA 5DJYB 3Q6FB 4ENED 1EGJA 1FSKC 3FU3A 5E5UB 2WTRB 1N7MH 3T4YA 2ADFH 3HB3C 4LLDB 1KYOJ 4WUUE 2EEXA 3BFOA 1MF2H 4CVZA 4RIRA 3N50A 5D7EA 5AW6B 1XSIA 1A2YA 3MYJB 3L2LA 4UYQA 3W5MA 4NQEE 4TQHA 3D52A 5DJ0B 1C12A 5SWSA 4YHOH 3UC2A 1FL3A 2DN7A 3TBBA 4JKWA 1OW0C 1HSAB 5IM7A 1FNFA 3ZKND 5F7DB 5CKGA 2XJLA 1XL4A 1GOFA 2NY2D 1TEGA 3HI5L 1U91B 4JS7A 5IFHH 1MCPL 1MHHA 4JKLA 5CGMA 5EZLB 3F2LA 3B6SB 3FHAA 3FTWA 3RWCB 5IB4B 3QPXL 2V9QA 5J1AA 4NRZB 2PNDA 1LJMA 4YR6B 2QSCH 4XODA 2EUZA 1AR2A 5F1OB 1MFBH 1KG0A 1U6AH 4H1LB 5AVWB 4JN2A 3ARSA 3IJYA 4HUXB 5GS0C 2IH9A 2G3XA 4Y5YA 4UINH 3GDBA 1RVFL 2R4SH 4ACPA 2WMPA 2ZXGA 2IG2L 1LEKA 1MKFA 4IBSA 3LD8C 4KO6A 4HCFA 2V9TA 1A4JB 3W82A 3PWPA 4AQZA 3BJLA 1ZOXA 5H35A 1AP2A 2CR0A 3QUKB 3C5JA 4YGVB 1ZLVH 1L6PA 1MRCH 4HUNB 3Q2CA 3VXQA 4RIRB 5F9DC 5ENWA 4Y7OC 1MCPH 4PRHE 3GBMH 3UZQB 2JIXD 3LEVL 2WXLA 2XXFA 3ULUH 4HJGA 2JKRM 4G8AC 2YAFA 3QULA 2FB4H 1DSWA 4ZFZB 2GQHA 5I18L 1F4WH 4YQXL 1KY6A 3BEWA 1QSFD 4G42A 5GISL 1OE1A 2QMJA 4K5PA 1ZVSB 4BFJA 4WFFE 1D5RA 2DQTL 5IBUB 1TVHA 2ZUTA 2AXFA 3CC5A 5HHVL 5F3BA 2I9LB 3VD7A 2F2HA 4K3DL 4E41B 3EO9H 2VLRB 5CEZE 1UJTA 1XHHA 5D7IA 5KBPA 2J2ZA 2WXQA 1LNUB 5CBEB 2H4EA 5KTEH 3T0DA 2VQ1A 1QLEL 3PFQA 4WV1C 3BLBA 3PL6A 4AYFB 2YD6A 1A1MA 4XXWA 1GY2A 3B9KD 1ZT1B 2NZ1A 4FL4C 1XR8A 3G08B 5KN5A 4FFWD 4QHPA 3GZQA 2APXA 1QR4A 5IIEA 1XGRB 1QBAA 1FWXA 1NEZA 4ZT1A 4BFKA 2ZWZA 1JZEA 3FT2B 3FFCA 4HC1H 3BLPX 1IC1A 3LAFA 1CLYL 1T5WA 3G5VA 1IFGA 1S7VB 4TVUA 2XWCA 1RHHB 4HIEA 5TJWK 3MV8D 3L17A 4FGMA 4OIBA 4PJ7F 4QD2E 4N2FA 4Z7QB 4OLXH 1E4XI 2WLLA 4JFFE 2Y25A 5HSFA 2YK1H 5DJ8B 3R4DA 4PV9A 1IVLA 2JTDA 5EOTB 1NFIA 4IJ3C 3VFTB 5HI3C 1UURA 1S9WA 4MQXC 3CN0A 1FV1A 2VO8A 2Z34A 1S9VB 2JKNA 2YPKB 3FO1A 4OFIA 1CDCA 5AVXB 5BV7C 1CFQA 1D6VH 3EF4A 2UZIH 4YDZA 4XWOD 2CMRL 3K2IA 4WWID 1YYCA 4DTGH 4QNPF 4XX1G 4MWFA 3H6AA 3TN0D 3H42L 4EDWH 3WFBL 2EVFA 4BHUA 4OCXH 5DQ9A 5D71L 4M43H 3HKFA 3L3IB 4NKDB 1P6FA 4PCKA 3I6KA 1XZ0A 2BNUB 3L3JB 2BW5A 3BI9X 1XR8B 4X0KA 1Y18B 3W39B 1F0LA 1NFAA 4ZUUA 1QSFE 4KHXH 3VSTA 2DMKA 1FO0B 3WEXA 4A7VA 5JPMA 4WENB 5HP5A 3BEVB 4HDIB 2HT3C 1GGIH 1YY8A 4K55A 4B7LA 2IV9A 4KC3B 2BSCA 2G5RA 4LVEA 4KKNA 2FYVA 4GSDH 2HLFC 4OZIF 3GBML 1J48A 4OM1L 4I18C 1BGXH 5CO1A 4MXWH 1CGYA 3FJTA 1OARH 2GK0A 3HRZB 2MMXA 2IAMD 1Z9PA 3HB3B 4PH8A 1LILA 3APDA 3FQ1A 3I84A 1J5CA 4YS4A 1IL1B 2AGJH 2AW2A 1HH9B 2GY7B 4N8VA 3U9UB 4B9PA 3MBXH 4Y2DC 5AW4B 1JNNH 4PJIA 3LS5L 1U58B 3BWUF 1GGCH 3GSWB 3BSHA 1Y6NR 4KKBD 3Q3GA 1XX9C 2WBJC 3EG9B 4JFDB 1WEJH 4ZW3A 4JDTL 1J0IA 2BLFA 2MQ3A 3D39D 1MHCA 4NXSA 5B8CC 4ONHA 4Q0XH 1IX2A 3UO1L 2DQFB 2J1YA 3DVGB 4GAFB 1EQWA 5BOJA 3IAGC 4QRPB 1MH5B 3PGDB 3UTZA 5BRZD 1HIML 4MB4A 3TN0A 1ADWA 1IEBB 5L4IA 3CLWA 4XMLH 1D2OA 2WXJA 2Y6SD 5C0RL 5DUML 2NY1B 5JPMB 1IKFH 1ZIAA 2DYSB 4KXZI 4LBAA 1AFVL 1MCEA 3CN2A 3T08A 4ECNA 4QHLB 2Y07H 5I30L 1GC1C 4ZUTA 3ZT5A 4AEIH 1YPZE 5JR1L 3FQWA 4BHUI 2ZUQC 3S37X 2YGNA 5KVGE 3TNMA 3GIVA 1AE6H 2VDOH 2X0VA 3L3DB 3MROA 2DYPB 2FATH 5FYLL 5B22A 4HISA 1J18A 1W9XA 1R3KA 5GXBB 1UT1A 2CU9A 3IAPA 1YEEH 4LVHB 1AO7D 4PG9B 4OZHF 3VMOA 4DVBB 4R4BA 4AQ1A 2HRPH 3IU3A 3OD3A 4MCYB 4CILA 4JREB 2AV7A 2ZCLL 3BE1H 4OD1L 5F89A 4OT1H 1T0PB 4XNAA 1AS8A 4ZSOA 2VLKB 4LESA 2G3NA 3FCTB 3W9EB 1I7ZA 5I1KH 1JN6B 2OQJB 3V2AR 1VFBA 3IFPB 3MJ7B 4NBZB 1JYXA 4YVUA 3O2WL 4TXVB 5AVVB 4PTTA 1P53A 5KSBA 2VXVL 3P3YA 1NUGA 1RQ5A 2P7TA 3TLRA 4Q74A 5F44A 2W91A 3MNWB 3WTUA 2CKBL 4Z7QE 4X6BB 3FFCB 5E4AA 5DMIH 5HDOA 5AZ2L 3HG1A 2M1KA 1KFAL 2F9BT 4JMNA 3SPVB 4FXKB 2PR4H 5IOPA 4JJ5B 1AQMA 3JWDL 1SEBB 4WNQA 5C2BL 4GKZB 2CHWA 2IXQA 1FORL 3UDWA 4N8UA 3CE1A 4AKPA 4KZCA 3MRRB 2IDCA 4NUJB 5FIEA 3BUIA 5KG9A 4DVRL 4EIUA 2QT6A 3GQFA 3BLKA 2PP7A 2OR9L 1K9TA 1SM3H 2EC9T 3GIZL 3ECQA 1S9WB 2YMXL 1GOGA 3N3EA 3QS3A 4JLRB 4KNUA 1Z5YD 4GFXA 5FUOH 2X1PA 4X80H 5F3FA 3CNKA 3L5XH 2P5WA 2DWSA 1MNUH 4M7JL 2VDNL 1IC4H 3O2VL 1JF5A 1Z9LA 4XBEL 1MW3A 1HT6A 3GI8L 3RDTA 4KZDH 2C3VB 5E8OB 2YD5A 2GSGB 3T71A 3FU0A 3ILDA 3EYQC 3ECWA 3P11L 5K1NA 5I19L 1UA7A 4HF5H 2C9RA 3V0JA 3AM8C 3E6HA 1P4LB 1OB1A 3NP3A 2EDYA 2M2DA 4KKAD 5FUCC 1AI1L 2ARJQ 1FH2A 4XVOA 1AGFB 1N68A 1OANA 5GJTH 3MREB 3BWAA 4AVKA 4BD4A 4FFYH 5AVSB 1UB5B 1LEIA 4G80A 1RUQL 5LBSH 4X5WB 4RGMB 4X6FA 3NGBB 2V2TA 4N0YH 5C07A 1CC3A 4NQCB 1TFPA 3T0BA 1R5IA 3L8QA 4WVRA 2WWNA 1AHWB 4N90D 3RWDB 3KPNB 1FFPB 3F7RA 5ELIA 2AJ3A 3ARBD 1T6VN 4J1UA 2OLDA 2H3XC 4M5YH 3U2SB 2BIMA 4CJ1A 2QQLH 2VH5L 1RXLA 4KQ3H 3ZUNC 4Z7OB 4PW4A 1AO7A 1VFUA 2ZP0T 3R0MA 2YIHA 4QY8B 2EIEA 2WXKA 5J0BA 3S2CA 3H2QA 3GIZH 4OZFH 2YXWA 3E38A 4W9JC 5DZNA 2HVKA 3ZYIA 3DHUA 4ETQB 2BSSA 1XD0A 2HP4A 1FPTL 3T3ME 4DQOH 4F8PA 1E3FA 2FJFB 4R0LC 4XMLL 3VYNA 4KKZA 1HKFA 3N5AA 1XH0A 5L2KD 4EVNB 4RDBA 4PJ8C 5IW3A 5IBLD 2FAUA 3MN8A 2A6IA 4Q97A 1JI2A 3ME0A 2P42B 3CK0H 2N4IA 2HTLD 5DGRA 2D4DA 4JO3L 4JO4H 5ITBL 4C8XA 4AL8C 2XPGB 1TYRA 2DWXA 1DJZA 5CN2A 4JFQA 1SMDA 4RMRA 3FSWA 1KEGH 4Y2DB 4P2CG 2QPSA 2XKUA 1BIIA 3DUSA 3QUMH 3CBJB 5AW5B 3VWJA 3P2TA 3Q13A 1OAYH 2XXCB 3GXIA 3U0PB 4GRLB 2A9CA 4GXVH 3FRUA 3GHBH 3KAAA 1T2QL 2CUHA 3FO2A 1JZ6A 1VESA 4BQ6A 3KPSD 4QCIA 1QFWI 4FQXA 4OBRA 1SZNA 4W6XB 1INDL 2OFQA 5DR5H 1SN0A 1G84A 2ODHA 1BPVA 4P5TD 3CFCH 1E5BA 1VHPA 3KYNB 4CW1A 4Z3TA 3HRPA 3DX1A 2ED7A 4WW2B 1F5WA 1OARL 4S0TD 2EABA 5JZ7D 4Q7DA 4F9LC 4XP9L 4E9RA 5TQ0H 1VFBB 4F7PA 4V2CB 2C9UA 3F3HA 2APFA 4FG4A 1RUQH 4V33A 1A25A 5D70L 1J86A 4H8WC 3PP3H 3R0NA 4JW3A 4RAVA 5AW7B 1JNLL 1ROWA 4WU7A 3QDJD 2XY2A 1ZRUA 2KPNA 4KI5C 4PVLA 1BFTA 4FMKA 1HILA 4XC3L 1NGZA 1A8ZA 1RU9L 1IKNC 3FBQA 1L9TA 3P11H 2VITA 1FG2B 1ZD6A 4TRPL 4XNYH 3L1OH 3L5IA 2R23A 1DBKL 1FVDA 1H3WM 2I7OA 3MGOA 2JJSA 1N64H 3SO3B 3NJJA 1PFCA 4M43L 1M2VB 1YEGH 5IROA 1OO2A 2XIBA 1G1CA 3TCXA 4MD4B 2OTWB 5DU7A 4M3JA 2VQ4A 5GS1A 1H9DA 4JFZL 2NQ3A 3NFSH 1OP3H 2R29L 3RTQB 2PYFA 3WIFB 4FKHA 1NEZG 3MRHB 2CKNA 2O5ZL 4L4JA 3GMLB 3GSUA 3UDWC 3W0WD 2PWEA 4HU2A 3KPRA 3PABB 4N1CA 4DWHA 4CVZB 4FFWC 5IKCB 3GUTA 3RVTC 1CQYA 1NC2A 3SY6A 2YK1L 2B4CC 2G3MA 4DFHA 2AK4E 3D50A 3LQAC 5JXEA 5GRJH 3TIDB 1YNTF 2G9HA 3UPRB 2GW5A 3NPSB 3OHMB 4UM9A 4APQA 3H0TB 3FH8A 4JDVA 1F42A 4K07A 3SY0A 3BSZH 3T0EB 3DMMD 3GC3A 4OI8A 5KVEE 3WHE0 1OT1A 3CSBA 1XGPA 4UU9A 4P2RD 5FKPB 3X3GL 2QHRH 3ZZLA 1AD9B 2M8XA 2W0KA 1TNNA 1U8PB 4GSDL 5DJXB 3DHPA 1K3ZA 1IGYB 3IGAA 3KS0H 3LRLA 4NIYE 1XBDA 4Z7VA 1NCNA 3MUUA 2KC0A 5IG7A 2WZ6A 4MZIA 3CHSA 3TF7C 5E5LA 3FT0A 2P45B 1L0XA 2NYKA 2VWEC 4JGJA 4OZFA 2UY7A 1M53A 1HEHC 1IUZA 1CD1A 5TDPB 2ZXAA 3QORD 2QGCA 4RNRA 4HCRA 3ULUE 4B9JA 2D7OA 2NQDA 4XCNA 3N41B 4DAGH 3NIGB 4BFFA 2GITA 3WJJA 2PXYA 2UXVA 2G5BB 3C5SB 2LR4A 4QEGA 2RQEA 1ZLUK 2BVQA 3GSUB 4NKIL 5JXAH 2W80C 2EE6A 3BAXA 2X41A 3IDGA 2Q3XA 2LU3A 4G9FB 2YS4A 1REIA 1SY6H 3KBPA 3DYMA 4PJFA 4EN3C 1T1XB 1BEYL 4IGBD 1PKQE 2JMRA 1NGQL 1BF8A 3BESR 4W9EC 5CD5D 3DI2B 4HIHB 2IBZY 5DURD 3QNZB 1IFHL 5EZOL 2AEOA 4FN0A 3RKDD 5CZXC 5DJCA 4K9EC 5C09B 5INCA 2WXFA 3A6CH 2Y2WA 2Y0SA 5C0BD 3ZGHA 5JOEA 3V10A 1IM3A 2QKSA 5D93C 5DRWB 1WE5A 4N5ED 4WWKD 2WN3A 2VZSA 3LEVH 3R8BB 2F1AA 2O5YH 3E3QC 4NKQB 4N2DA 3U1SH 1PKOA 4JG1H 4YHKH 4C54A 4G9DA 3ARUA 2I9LA 5I17B 3BP7B 3SYQA 3G5ZB 3ZU8A 4RZCB 4HWZA 4J3XA 3OB0H 5CEYB 5LAPA 4AVHA 1N12A 3Q8CA 2X1XR 5HI5D 2ZAGA 2DRUA 4I9WE 2O26U 3OR7B 1WAPA 5IHBA 2X6MA 2XV6B 4M6NL 4YLBA 4PJDE 4FQXB 1FNSL 5T1LD 3QC6X 1D7DA 2A1WL 4H13C 1TJMA 4WWPA 5I1CH 3NG5A 2QGEA 4OIIH 5KBLA 1MW2A 2W07B 1BAFH 4LRIA 2ED9A 3LN4B 1J1PL 1WUZA 1G6VK 1X5HA 3O0RH 4QHNB 5DUBA 4GG6B 3P69A 5HDWA 3LZFL 1U8CA 3ZUCA 2QSQA 5I1EL 2A83A 1K8IB 5CSGA 1U3HD 4FQHA 4HH9B 3FT3A 4KXAA 3GGWB 4HIPA 4PRIA 3ZRCC 1YYMH 2B3IA 1EXUB 2ATPA 2LFEA 3OJMB 4IS6A 2R0KL 1NUFA 3HPJB 5DJ8A 2NZ9D 2JK5B 3E9UA 5IHLB 4TVPE 4R7DB 1FVDB 3N40F 1OCWH 3QIUA 2A77H 2EXTA 5F7BA 1ASPA 1X44A 3BIKB 4X7TA 3C6LB 3MRQB 1LMIA 1MFVA 4MGXA 4NJAH 4P3CL 4YXKH 5FHBH 4BWTA 3IBEA 2W65B 5I1LB 5ADOH 1T1WB 5EUOE 1GHFL 3FRUB 3LZFH 4AEHH 4Z0XA 4DOHB 3QDGA 4NBXB 5HHMB 2Q8AH 3LRHA 1HZLA 4CW1B 4HS3B 2UXFA 3SDDD 4HULB 4QHUB 4JFOB 1L0QA 4OF8A 5HDRA 4WU5A 1A6PA 1OAXL 1YAIA 5FCSH 3S36L 4RFOH 4EBQL 2H1PL 1ULVA 1QSFA 4KTDL 1ZLUH 3I50H 2QSCL 4HK3N 1YEJH 4ETYA 4WWKC 6CGTA 1JPGA 3WDJA 5EU3A 5F93C 5F97E 1KGIA 5EBLB 1WIUA 3L54A 3TVMB 1CICD 1X9UA 2WSKA 3KGUA 4QF1A 2H2SD 1KTLA 3GFUA 3ARDA 1B0GB 3P4MA 2XN0A 4XP4H 2IPKA 4FQQB 4U4IA 3U6XS 3ENEA 1FAIL 2JJSC 1EAOA 3D0VA 5GGQH 3LB6C 3WKPA 1K6QL 4HFUL 3BIKA 3VFRB 1MY7A 2BC4B 5HHOD 5D1ZD 1I3UA 4LCYA 5KSUA 1A6AB 4WWNA 3RY6A 3K74B 3MBWA 3D4ZA 1DSYA 1MCWW 3IJ8A 4RDQG 3SPHA 2BVOA 1ZV2A 1DVFB 3FU8A 3GDCA 2F5BH 1M57B 5EWIH 2PWHA 1AQDA 2ADFL 4TNGA 3KPRB 5TQ2L 3WFCL 4E0RA 1KLUA 2DQ6A 3OL2A 5HHVH 1CE6A 3TFKC 1BFVL 2UXTA 3EOYG 1Z3GH 3ILEA 5MENE 2NX5B 2J6EL 4HKXA 4KZEL 2OAAA 2UYLA 4LSDA 5ID0B 1ZIBA 2CXGA 3BD4A 2MSPA 2KS0A 3GMMB 3TC9A 4PB9H 3AT0A 1YYML 1A64A 3UAJA 3VTMA 5BO0D 4ZW6A 5C92A 3VXMA 4O02L 3MLVH 3NJVA 4MMZB 1OY3B 1PZCA 3QQDB 2YXVA 1LK3H 4WGKA 1HCYA 3T0VA 4NN6C 2Y7QA 1F90L 2FJHA 1FFQA 3O8XA 5FM4A 1J1PH 1YPZA 4H8WH 4HJJH 2IAMA 5FGBA 1U95B 2YMTA 4TMPA 3S3BB 3SE4C 3U7WH 4M7ZC 3RL2A 2OMWB 2TAAA 3QQ3B 3O4OB 1L7TH 5B1JA 5M95B 3A22A 1W0WA 3FT9A 4YXLH 4IBZA 2VYRE 1KG0B 5F89B 4I8DA 5JIKA 3W9EA 3I6SA 4YSQA 5D6DC 1UVQA 4BUHA 4DGYH 1TZOA 3FQUA 4HLZG 5CJOL 1UXSB 1PD0A 1QFHA 1H3VA 4DGVH 4D8PA 5K9OA 4OUUB 1SOSA 5K9JL 1DQTA 3O6FC 1YEDB 4UIKL 5ADPH 4OF0A 5C08E 2V7NB 2BOBB 2F5AL 4TTDD 4P2YA 3G6JE 4Q6YA 4F5CA 2VSDA 2DW5A 2V5RA 2VB5A 4G71B 1CUOA 4LPWA 1DL7L 3GMMA 1A3LL 1YMHA 3QDHA 1T5KA 3QJFB 1CFTA 1OCWL 3BVDB 2E27H 4WV1B 2ZUXA 4M62H 2A83B 4N5UA 5JHLA 3HC3L 1WD8A 1V3LA 3FFDA 3L1OL 5HYJA 4PRHD 5IOPB 2KZBA 3ZDXE 3CFJB 3TX4A 1OGTA 4R96B 4XT1C 1DVUA 3THMH 3MJWA 3VGFA 3VVVA 1Z5LB 5CXPA 5I6XB 2YXMA 3O6MH 4WDIB 3K91A 2YRLA 1BMZA 1A1OB 4R97C 4XWOC 3RPIA 3UFIA 1AQHA 3FTVA 3ALPA 4MQ7A 2A2QT 3WFHB 2MPAH 5HYJE 1AZBA 3UGUA 4CAGA 5JQ6H 1NIFA 3AWEA 4Z7AA 2ICWI 4DAGL 1YDPB 5JOPE 4DZBA 5E6IA 5KANG 3AREC 3DARA 2Y1AA 5GSVA 3TTSA 5D4JA 4GSXA 3T2NL 3SEPA 3MRCB 2IH1B 2PW1A 5T1LA 3IWVA 1F97A 1G7JB 2CLZB 5GZOC 4OVVA 1FGVH 3LZNA 4NERA 4X7DC 2WIMA 1Z7JA 3K80A 2RBLA 2ZKWA 1B0WA 3ESUF 4WFGD 4ALAL 3GSVB 1S7QB 4WJKB 3UZQA 4NZTH 2VXQL 5HVFB 4U6VH 1UCTA 1H5BC 1MIEH 3EJRA 1C5CH 1I7TA 1NEZB 4OLYL 1ZVSA 5BZZA 3P0VL 4AYEC 3U1SL 4JKMA 2DKMA 2D7MA 2HPTA 3VMNA 4HIXH 1XGTA 2C3GA 5BQDA 4JKPL 1A7QL 3F7VA 5LGJA 4JO3H 3D9AL 4L5FL 2Q76A 1MFCL 2O6CA 1XF4B 4G8EA 1IO4C 1U8OB 2OYKA 3MBED 3KPNA 3EGDB 5E94A 4P2QE 4YN3A 2BY2A 3VVWA 5I8CB 3DI3B 4IU2B 4YSRA 2V5YA 3S7GA 1OPGL 3WLBB 4F7CA 5EN2A 1X5AA 4P46D 2A9ML 1E8ZA 2EO1A 2C3WA 1SHMA 3CSFA 1LYQA 5HYIA 1AO7E 2OMTA 5I6XC 4LDCA 4APQC 1C5DA 3DBXB 3K4AA 3FMGL 2Z7UA 4JZJB 1CTNA 1KTBA 1J87A 2G2NA 2LLLA 3LVTA 4HEMA 3V9EA 2A5UA 2ITCA 3HRZC 3VH8G 1EHXA 2WYIA 3V5HA 1ERNA 1UKQA 2IANA 2NX5D 2GB2A 2QTEA 2BSSB 3RZCD 2X6AA 3KYOB 4A39A 5DMIL 3QUXB 1T5XB 1F3JA 3HG1D 5SV4A 2KERA 4AENA 4XP5L 1KSRA 4NPKA 4HSCX 4LSPH 2GJ6B 3BHBA 3PPSA 3CPLB 4QGTA 1NKRA 2XI9A 2OMXA 3WL9A 3NFPB 6FABH 3G5VB 1I9RH 3OG6B 2ZSWB 2DQCH 3IMUA 5HDBF 3R7QA 4E68A 1AHWA 2VDKH 3RWDA 3TBVA 5C0BE 2QADB 5C3IA 2WXPA 4ZAKC 4PJ9C 1OAJA 4L37A 4XOBA 1D5ZB 4NZUH 4UQAA 2QDWA 3VI4B 3GS7A 5I1IL 2A73A 2PCXA 3RGVB 2X4OA 2Y3AA 3CQPA 3HZKB 4KPHH 1IFRA 3MCG1 2MCPL 1CFQB 1A21A 3MTRA 4HF5L 3QUHA 5IB1A 2K3TA 3SD5A 2R0LH 1NOLA 3N43B 1LE9A 1ZA6B 3UJTH 1GZPA 4TPRH 1YEEL 1U8QA 4KDVA 4GJTB 2P5WE 2VDNH 1CD0A 1LD9A 2XA8H 3O4LB 4IMLA 3EJUA 1AE6L 2VDOL 1AJ7H 3AY4C 1YEIH 2VERN 2FJFA 1MVUB 4H1LH 1M42A 4MX7A 4ZD3H 1KCWA 3LQMA 4X8CA 1FGNH 2YZ1A 1H3PL 2BY3A 3PFUA 4XAWH 3EJYD 5L9DL 1MWAB 1QVOB 2HYMA 3TS8A 1RJZB 1H3PH 2MQGA 8FABA 2HLEB 5CCHE 3DX6A 1YY8B 1ZHBB 3BT0A 1S7TA 4N86A 2CKBH 5LGKA 4U05A 3TT1L 1WEJL 1M6UA 3NJLA 4HIXL 2I9TB 4QCIB 4N3UA 2CA3A 2JI1A 2LT9A 3VI4A 4Y19B 4R90H 4XO9A 4OLYH 2F53E 1NQBA 3LS5H 1EVUA 3SJVB 3NAAH 4POZD 3QYMA 5BV7B 4WUKH 1D5XA 1MEXL 3FSAA 3QXTA 4TNEA 1QLFA 4M5YL 1WLHA 3VXOA 1RJYB 4ALAH 1ZANL 4NFBA 1B90A 3KW8A 4JY5H 3QA3B 4N25A 3TT3L 4Z7WE 1VERA 3IVKB 2CR3A 3GSWA 1NGYB 4IKLA 3K6SA 2G0KA 4NO0D 5KZCD 1A1MB 4JPKH 1KPUA 5J3HD 2R2BA 3TT3H 3X1EA 4AW4A 4PGJA 3WIHH 4H44C 2NCMA 4U1NA 3D08A 4GW5B 4X9FA 3BD5A 3QRGH 1PY4A 1T03H 4LSVL 1K4CA 1MJUL 3P73B 3S97C 3O6FA 3MZTA 4I5BA 3BWUC 1RHHA 4HIEB 4Y4FA 3O3AA 3REVA 4TSBL 4W4OC 2E4TA 4DK5A 5DUMH 2DYPA 4WI8A 3O9WB 5CMAA 4EZMA 1MFNA 4OCXL 2WLLB 3N04A 3S0PA 2ZD0A 3F5WA 4JJ5A 1FL5B 2R2EA 2L0DA 1Z5LA 1FLTX 3WNNA 4D7PA 1DEDA 4TNFA 3KL0A 3NSXA 2X2YA 4UIKH 3DHJA 4RAUA 3DX3A 5DC4B 3N9GH 4EZKA 1AJ7L 1YEIL 3H9HA 4JLRA 4PJBE 3APFA 5LN4A 3H9SB 1KPVA 4HJ0D 3KMDA 1VPOL 3FB6A 1BJ8A 1FORH 3KPSE 1SJHB 4TOYH 3UJTL 5J11C 1KV3A 3RE0A 3MBXL 4HWUA 1GSKA 4B9CA 5I23A 4Q58C 4JAMA 1CFSB 1CGUA 3TTYA 1J9QA 1ZLWK 4WQOA 3QJZA 4X6BA 3MO1B 4L2YA 4EDXB 3QARA 3ARQA 4N8CL 5C0CB 1GTNA 2R1WA 4PJAE 3IJEB 3GZOA 4LMQE 4PB0L 4UILL 3PXJA 4AG4H 2IH3B 3TYFB 1LE5B 3QP3A 4L1LA 3OF6A 4BQ8A 1VAHA 2BRRH 5ISZB 4BZ1L 4ZS6D 2JJTA 2VE6B 4X5QA 2CO1A 3FCGA 5B4MD 3T5WA 2VLJD 3SQBB 4R8WH 2DQGH 5A6MA 3BFWA 3A23A 4QXGH 3IJSA 4OD1H 4XHQA 2BDNH 3F58H 1F45A 4J1UB 2BP8B 3K6NA 2C1PA 4WFHE 5F7MC 2ZXDA 1YN7B 4LGRB 4ZOEA 2N59A 2C7UB 2LAAA 4OD3L 5J57B 2EDXA 3NDYE 3SODB 3L16A 4BGDA 3X13A 4LOFA 1HXYB 5IQ9A 1I1FA 1VZGA 2AK4A 4G6MH 4JKKA 3HMWL 2EDJA 3CMGA 1HKLL 2AEWA 1SHWA 5JNYA 4KNTA 4KVNL 1UH2A 1FH5H 3DSNA 5IMKA 5EMYA 3AADB 4TVPD 1NH6A 4M8UA 2B1OA 1SRDA 5EOCJ 3UH8A 2R83A 4NQEA 3S8WA 3WO4C 2HVJB 2YPVH 3MXWH 1MI5A 1EEYB 4YHNA 3AXHA 5D1XD 1J1OH 4GO6B 2VR6A 3FUEA 1HAUA 2B5IC 3N42B 3KXFD 2BVYA 1B6DA 2E6JA 4PJXB 4QTIL 2BNQA 5DS1A 1JPSH 5DLML 4HXBH 5F8RC 3LQZA 1FE8L 2A6DA 5FUZL 3O3EA 4LLYB 1JGVH 3HN3A 1IJ9A 1A7RH 1SJXA 3U30B 5I1JH 1E5CA 5FW8A 1J1XL 3VSQA 2XFGB 1CD8A 1FGVL 1QA9A 4FP8L 4AE1A 3TJPA 4ZMOA 4L05A 3JWOL 3UZVA 3BZFA 1KOAA 4JDZA 5I1DB 5I1KL 1JGDA 5D6CB 4HS3A 1S46A 2D3LA 3GSXB 1Q9WA 4PQXA 5TK2A 3LXBA 2D0HA 3X11B 4XVTH 1WVZA 5LB1A 1RMFL 3KPOB 4JX0A 3TV3L 3QH3B 1EUUA 2WBXA 4LVNC 5DYFA 3CVHB 4YDIL 1YPZF 1FYTB 3WEBA 3G5WA 3DECA 1WC7A 3BP4A 4UMSA 3VX0A 3EO9L 3QIUD 4BQCA 4M9OA 5EUKB 2J8UA 3E8VA 4PJ5B 3PP3K 2NNAB 4PP1D 3CH1A 5D1QC 4WI2A 2NXYC 1UH3A 5ICZB 3VXTB 5CJ8A 4Y4FB 3REVB 2VKXA 5F8QC 1IT9H 1LNUA 5CBEA 3TO4A 5BVPH 5I18H 5D1XE 1JZIA 4AUUA 1WQVT 3HE7A 4ZI8A 3FT4B 2RCSL 5FA3B 1NDGA 2XTJB 1JRHI 4UV4H 1JG9A 4QRQB 3Q8FA 3D7PA 5KG9B 2DKSA 3HTLX 3WTWA 2HG5B 3ZYOA 3VA6A 2MHAB 4YLQT 5SWZB 1OGAD 2Y7OA 4O51A 4X7EC 3DJ9A 3AAZA 4YO0A 4Z78A 3ULSB 4F2EA 5EULV 2P5WB 5T1DH 1QPXA 5C0IA 4OIIL 1HQ4A 4DGVL 1YRKA 5C6WH 4UINL 4YUEL 4WWKB 2P52A 5H37H 2QPEB 4P23D 3C2SA 4LDEB 3BP6A 2VXTL 1QNZL 1T6BX 3SDAB 5EO9A 5C0AE 1J1XH 3NSYA 1M6OB 1GL4B 4LSRL 1HSBB 5AUMA 1R9FA 3ARXA 4DP4X 5D2LB 4F1ZA 1G7PB 4KTDH 2DQMA 5AAMA 4N0UA 2WXIA 1I9EA 4NQCE 2P46B 4GS7C 2BMKB 1XF5A 3P4NB 5KSUB 5J13C 5FAAA 4JFDE 4Z7VB 2FEJA 4W4OA 3MXWL 5DFTA 4GINA 4JQIA 4AJYV 4MB3A 2BHUA 4KJPC 1AC0A 5E99H 5GZND 1LK3L 1NFKA 1NKOA 1Q0EA 4TKWA 3BWSA 5DXWA 1SMOA 3QZBA 4JANB 1EZSA 5JLZA 4B0MB 3QIWD 1PVHA 4BYHA 4P3WA 3ZKXB 2JIXB 1W0YT 4WHCA 1E42A 3HMWH 4QAWA 4CA4A 3FULA 5EWIL 1CDYA 2GBTA 1QRND 5JXAL 2E46A 4K3DH 4PI0A 4QOKB 1E7UA 3NK4A 3IS1X 4UOZA 4Z77B 4BV1A 1MF2L 2G9HB 3MLWH 3GUTB 4MVBC 2DQHL 1HSAA 1S2EA 2CQVA 2NXZC 4ZFOB 3X13B 3E6FB 3QWNA 2EUVA 1IJNA 1GZQA 1V10A 5AG8A 3ARGA 4HUVA 3P3RA 1GKEA 3L3HA 1OKEA 1G9MC 4ZAKA 1VRSA 4HLEA 4K7FB 4YSEA 2EJ1A 2VAJA 2R27A 4TVSa 4Y1TA 4BZ1H 4IRJA 4PB0H 5GGQL 3LRMA 32C2A 1P6AB 3JBG7 3NCCB 4L3AA 4QRRE 3RWFA 4K73A 5IMLB 4Y5YB 4M00A 1ZS2A 4H7VA 4HC1L 3TYFA 1FQ9C 4XI5C 4N8CH 1BLNA 2UY7B 1WT5C 3L9RB 4FYTA 4MASA 3VGDA 3LIZA 1A4JA 4QTIH 4XRCB 1NCIA 5CEYA 5ALCL 4YZFF 5CFHA 1CYWA 5KW9L 3ZE0F 2I26N 2NY1D 4MKTA 1M05B 1ETZB 2IH1A 5GGTA 5T1LB 3PY9A 1MG3C 1S9KC 2E7LC 4H2AA 4KVNH 3S98A 1JF6A 4HWNA 1CT8B 4YMPA 5GGSA 2Q8AL 1O75A 4GXUM 5IFHL 4QRUB 1PGRB 2J43A 4ODSH 5IHZB 4FNQA 1WBZB 4XN4A 2BW4A 1QRNA 3LZPA 2C9VA 4YPGB 3O41B 5BVPL 4WO4A 1IAKB 2E8YA 4JFFD 4M8RA 5DMGC 4GIPD 2KYIA 5DD3L 2RCSH 1MHPL 5H94B 4PRIB 3MV8E 4ONOA 4N2KA 4DCQB 1H3TA 5E2VH 1NGXB 2X4SA 2BDNL 3F58L 1T0MA 4GRWF 4L4VB 3QUZD 5IEKA 3KEDA 5ABDE 2JJVA 3SO5A 2VISB 3BPNB 4UB0H 1ACYL 4QUOA 2DQGL 1SY6L 4FFTA 1A7BA 1MJUH 4AGLA 2V8LA 2ZWSA 4R4NC 1UKTA 3AQXA 3IFPA 1TTUA 4Y1AE 2FECL 5AZEH 1G7JA 2NR6D 4C4KT 3GSOB 1JNLH 1C5DB 2MHAA 3DOHA 5SWZA 3VJ6B 5EF1A 5C07E 1M2OA 3S5LB 4AK2A 4MLSA 3ELAT 3V7AE 2P7TB 3WKYA 1XGYH 1T22A 2AEPL 2FSEB 1JTTA 4M5SA 3EH5B 1BIHA 2E7CA 3L4VA 3M1BB 3QWRD 3LS4L 1LQBC 1LP9E 7FABL 1U6AL 4Y1AA 1J7VR 4YAQB 3FT3B 2VUKA 1LXMA 4EKXA 4LKXB 4Z76B 3H0TA 5AWNH 2Z7ZA 1W72H 5LGJB 3PNWB 4Z3GA 1BQHB 1N2RA 4UQDA 5L8LB 4JEGB 4TULH 4X4ZA 1T04A 1OSEA 3BP4B 3JV4B 4LHUG 4EUPB 1VADA 3N6YA 1U4FA 4AZUA 5KYXA 1WITA 2OSWA 3ZW3A 2H9GA 4JGNA 4ZMAT 3S3PA 3MLSH 2PMZA 2YPVL 2VMDA 4EXPX 3PHOB 2J2ZB 1HKLH 3QJRB 4XVSL 1EPFA 4JZOB 3B83A 3FONB 1U2CA 5GRVK 4N6RA 5DSCB 1TJXA 5CLXA 5TDNA 4P4RA 2WD0A 4FCAA 4QKXB 3O3DB 1F1AA 1URZA 5MI0B 4OD3H 4LVOC 3RFZA 1RZJC 4ODVH 4OJFH 3C5ZA 4XCYA 3NDZE 3QFJE 2BVOB 3ULSA 4LSVH 4UTAA 2BSEA 2Y06L 4KQ3L 15C8L 2CLRA 3MNZA 4FEMA 3B1UA 1DQML 2TRHA 4XNBA 1CVSC 2JF1A 5EH1A 5GS0H 2B1HH 4P9ML 3WIHL 4QNPE 5JDSA 5F7WC 4U7SA 5KSVA 1QSEE 4MMYA 4B9IA 4N0FB 4JZNB 3U0TA 4LRNL 4N0YL 1FZOB 4FXTA 1SLWA 4GS7B 4YOKA 4KUCD 2H41A 2XETA 4JY5L 3CDZB 4YIQB 4D0DB 1I9RL 3EOBA 1ICTA 5GJTL 3N41F 2Y36L 2Y7QB 1Q72H 4LOEA 4N2CA 32C2B 3P4MB 1BVNP 3KPMA 4YPJA 3E1F1 1PY0A 1YPZB 1JWSB 2AABH 2QQKH 3FF7A 4UTBA 5T3XD 4KROD 4BK8A 3WUWG 1IE4A 4Y9GA 2AV1A 2VR3A 1BQUA 1UB6B 3H2WA 4GKNB 1MCCA 2OM5A 4I48A 4DP7X 4OZIE 3OZLA 4MXQC 5IW1A 1INDH 1XMEB 3CDCA 3QEGL 2HMID 3RA7L 2WBJD 1D3CA 1I1CA 3POHA 4UOW0 2IGTA 1IM3D 2YD2A 3KLSA 5D7LB 4CADB 4ONHB 1E9PB 2V2XB 2QHLA 4FCHA 3ROOB 2CM6A 3IF1B 1VPOH 2F8IA 4EAEA 3L5XL 3QVAA 4IMKA 4G9FD 1BWWA 1KLUB 4Y19E 4X0KB 4M29A 2NY7H 1E3ZA 2OZ4H 2YMXH 4G8IB 4H0GA 1KN2H 4GO8A 4PS4H 4R97B 5ID1A 1QTPA 3MLXH 3WY2A 1WZKA 5BW7A 3LKOA 3WNMA 5MI0C 4I0PC 3M1CA 3KH4A 4DP2X 5A2FA 4KI5E 2Z4QB 3LTVA 3DRQB 3DWTA 3WHXA 1C16B 3EJPA 2BCMA 5ICYA 3K72A 2AQRA 2ERJB 2ZUSA 1MHHB 1RUAL 2FQFA 2X4PB 3O3AB 5BS0E 3FXIC 1H3UA 3GLEA 1D9KA 1FAKT 2PR4L 4L4VD 4AITA 5EV7A 1FL6A 5I1IH 1RKRA 1KBVA 1OCOB 3B8YA 3CD4A 5IJCC 1GVIA 4WEEA 4PRBB 4ZTOH 5T1JA 2Y1YA 3WTVA 5JPNB 4MXVF 1BAGA 5EEVA 2WWKT 2BIOA 2K6ZA 2VQ1B 2EDWA 2EIBA 1OQXA 1BJ1J 1BQLL 3HLKA 1CE1L 2XICA 4KX9A 1L3NA 2O93L 2HJFA 5JW4R 2AEPH 5FGCE 2WNWA 4ZFOL 3MRFA 3I6GB 2WXMA 4HS8L 3GSRA 3TO2B 2C7FA 5K9OB 4MJIB 4NT6B 4P5RA 5D5MA 5K69A 4FFYL 5EEUA 1TDQA 4OZIB 1TCMA 4QDGA 1U4EA 1NJ9A 1QHOA 1OAUL 2FWSA 4I2XA 5DJZA 2G4GA 5J89A 1G7IB 4G6AD 5CMAB 4C4BA 4PWIA 2ZUYA 2AJZA 2FLMA 2A6KB 3BUYB 3DXAD 3BVXA 4NI6A 4F8NA 5ICYB 4PY8J 4LOVA 2VR8A 2IO5A 4CN1A 5C0RH 3KPTA 3AG1B 4NZFA 4ZW7A 4BKTC 1DL7H 3M07A 3ZDYB 4AXWA 5L9DH 5I1HL 1QEWA 1PZSA 1BBJA 3PPEA 5E94B 5CWSA 4DO5A 1WT5A 1ZT7B 1IGJA 1OLLA 1U30A 2OMZB 3GPEA 4N2NA 5FECA 1OXYA 4GKOA 4RBPK 3VXUE 4FQJH 5HHOA 2YN3A 2BK8A 4I18A 4MNGE 3CU1A 4P2OC 4MFHA 2QQLL 2WQWA 3RGVC 4U6VL 3WY3A 3UADA 3ZSTA 4GBXD 3M6DA 2Z93B 3HC0B 4RLDA 2MWCA 2TSBA 3ETSA 3DVIA 4HUKB 5GGUB 3FU5A 1N4XL 1XCTB 4GRWB 1OWWA 1P2CA 2P5EE 3VSUA 1ASOA 1QTYT 3RY5A 2P8LB 2N7BA 3GS0A 4QYOB 4JHAH 3MV11 3B9EA 3QCVL 1L7TL 2C4FT 1BQLH 2ZX7A 2DQCL 4KJPD 3O45A 1JMXA 2AJZB 3BUYA 4L23A 4GY4A 3SQBA 2XT1B 5MHSE 3DO7B 1AACA 2PW2B 1V54B 4XP5H 3GMPA 4KTEH 4JB9L 5I75C 2ZNWA 1KTKE 4P9MH 5HJ3A 4UB0L 5HYSB 2X87A 3KLDA 1ES0A 4XAKE 5JW5A 4NOBA 4JZOA 5C0AD 3ZKQD 2E8ZA 2EIDA 3C8DA 2VW7A 4FA6A 3QXDB 1W8OA 1XCWA 4PJBA 5I0ZA 3HC3H 5AKRA 4ABQA 3WLWC 2HMIC 5DQ9B 1U8QB 3KM2A 2YZ8A 3DKHA 1ZGLB 1EFQA 1D7FA 2WLHA 4NHCH 5CJQL 5TGBB 1OQOA 4HCGA 4XO4A 3ZDYE 1PZ2A 3EYFB 4PJGB 4A1RA 2DQFA 2ADJA 1DANT 3DMMC 3DVGA 4MJ5A 5HYEA 4TTGA 5EUOA 4P46A 4HUWB 1MHCB 4DVRH 1FO0A 1K6QH 1PTZA 4HFUH 4X4XB 4RFNB 5T1KD 4ELMF 1EZLA 3AG2B 4ZMXA 4YBQC 1ZTXH 4ZUSB 1AGBA 5DLLA 4PLKD 4I77H 1XIWB 4PS8A 4D7BA 2JI3A 3BWAB 2W60B 4OKVB 4N8PA 3W81A 2XTLA 1EEZA 5E7BA 2CK0L 3K1DA 1JCKA 2XZQH 1HOEA 5E5RB 1U8IB 1FJ1B 3MPCA 3N85H 5HGBA 4WCYL 4FG0A 4OGXH 2PW2A 3MRKA 3GRWL 5EA0L 1F00I 2XX0A 4L9DA 4AQ8C 4WDIA 1F1GA 1GZPB 4UT6H 4P4KC 3SGJC 2VLKA 1KELL 2NSXA 4R83A 4Y9BA 1T80A 4I85A 4LL1A 4LZKA 5IB5B 4XZ4A 4A7GF 5BVJA 1BWMA 4PR5B 3HUJE 4GAAA 4QHNA 5F7AA 5ETUA 1HZKA 1G1YA 3B43A 4AEHL 2EYTA 2OK0H 5E6YA 2HJFB 4DJMA 3DBSA 2WKOF 1MHEA 5LVEA 4MJID 3EFFB 4UIMA 1GGIL 4KU1A 5J5EA 4HV8B 1NCBH 2OP4H 2FATL 3C60A 4ENZA 4S2SA 1QHQA 4M5TA 1BX2B 2BS9A 1M2VA 1VJSA 1ZHNA 5E2TL 2HH0H 3BXNA 2P80A 1BOGA 5AFAA 1TJGH 1ACYH 1PNDA 1P7QA 2B16A 2GI7A 2X4RB 2MKLC 3JZYA 3N1FC 1S7WA 1P7QD 4KHTL 1L6XA 4OKDA 4W81A 2DQTH 5DD3H 3TOPA 4DUWA 4I5BB 3O6LL 5D55A 2RA1A 3HI6L 4P2QB 4HC1A 2YC1B 1HIMH 2VSMB 3TM6A 1T1YB 2KQNA 1A6VL 2HB0A 1WV7T 1BZDA 4PVNA 3MV9D 4PUBL 3VTAA 2DMHA 4D9RE 2IGLA 1A3LH 1GMIA 5FGRA 3NJGA 5C0GA 3VSVA 3MV7E 4W70A 1I7ZB 4WHTB 4K3JL 5EU5B 3WE6B 5HHPA 5EN2B 4Y5VC 1QBBA 4BE5A 4NJ9H 4YHLH 1WGVA 4M1DH 1BAFL 2OMTB 4TUOA 3STZA 1JNNL 2ZXCA 2MNWA 3HG0A 4GKLA 2HKFH 4PTUB 5D4IA 3I6GA 5EU3B 3ARGD 1UATA 1KZQA 4NQXA 1HN1A 4JFXA 3UGEA 5D5MB 5F9WC 2X4UA 4UDUB 5T1MB 5HY9A 1AANA 3IPEA 1UXWB 2LQRA 3QFJD 4GBXC 1FIEA 1KGYE 2FLBT 2X9ZA 4KK6D 4PRPD 2E3VA 4LVHC 5CEXA 4YXLL 3FQNB 4ZMQA 3ZKMC 1R3JA 4K5LA 4UM8B 1R3LB 2I07B 3ISYA 3ELQA 4FTVA 2F74B 4HXBL 1CD1B 5TDPA 3U7WL 4WNQB 3KLKA 2APWA 3QORC 3PAZA 3IFOB 2GITB 1N70A 4MS8C 4YXKL 5EBWB 4ZMLA 5LNDA 4WSGA 3X1GA 3DO7A 5GS1B 2EKSB 2WTOA 1HXKA 2IADB 4J3OG 3CFBB 4HEPG 1UACL 3NZHL 4L37B 3VWKB 5BXFB 5DHYB 4AXWB 1DVFA 3EHBC 4PRAB 1IIIA 1SF5A 1VENA 2OKMA 2UWEF 2VLMD 2UZYB 1PZBA 1P5UA 2ZPKL 3JSSA 1ES0B 5D71H 3VI3A 4TLTA 2J73A 3A47A 3ISWA 3B9KC 3GUFA 4M1GH 2BNRE 3MVSA 4GP4B 5ECJE 4ATWA 4L3EB 2HT2C 4YX2L 1RZFL 3JTBA 4XCFH 5F21B 1U92B 4CSTA 3OXSA 4R2GD 3DRTA 4KRLB 1CFSA 2X0UA 1EEQA 1XSJA 4MJIE 1YMMB 2JI2A 1TSRA 1HCVA 1UZ6E 2QZQA 3FRPG 3B3IA 1DQLH 2FUTA 4H25A 5ITFB 3VI3E 3NFNA 3EFDL 4MJ4A 5CHNA 1VACB 3KDMB 5IMMB 4XP4L 1TZIB 1S7RB 3WTXA 4GOSA 2ENSA 4QR7A 4ODUB 2BRRL 1I3RB 5KVGH 2I07A 3KWWB 1WSST 2VISA 4PLKC 4DSYA 3ATAA 4HUXA 3X3GH 4J6IA 3V8CA 3NSJA 3MX0B 1YEJL 3VWJB 2WAQA 4PJFF 5SX4I 1R17A 1MFEH 4UNUA 2NW3A 1NAKL 2P8MB 3MRKB 1QLRB 2P4AB 4KNQA 1YJDH 1CL7L 2Z8RA 4W68A 3WGUB 1C08A 3GXPA 1X9QA 3IMRA 4P48A 4PI2A 4RFOL 4X4YA 4QRSA 4X99B 4QRUA 2OXHB 4U49A 3GXDA 3VXMD 3SDAD 1GMEA 4PJHB 1A47A 3ARPA 4C83A 3A6CL 3HIZA 3MMEB 4Q6IC 3TBTA 1DZ0A 1TEYA 4A04A 4OCSH 4HCIA 3GGWA 2R29H 4ONGH 5JIHA 4P2OA 4X6CF 5KJ4A 1JHKH 3IMVA 3QC5X 5E4OA 3ZDZF 4KK6C 1MREL 4DUXA 1TVDA 1OEZW 4MHHI 3WFEL 1BEYH 4QAMB 1KMGA 4JHBA 2N01B 2GT9A 4NS0A 1A6VH 1NEPA 2BXYA 4NKIH 4NQDB 3QQ9D 5IMKB 3VXUD 2P28B 2A77L 3R7RA 5F7UA 3VG9C 3CQQA 3O6LH 4OZHE 4YQXH 5KUMA 3QZNA 1M1SA 3G04B 3UEZA 4A7GA 4UOJA 5F1NB 4K5MA 3F12B 3FRPA 4R4FH 3C6LD 2Z0BA 4GNKB 2ZUQB 1PG7H 1AS6A 3TL5A 2ZX9A 1TMCB 3I02B 1NCBL 1NCDH 1HL4A 2OP4L 3D3VA 1XCQB 5JHLH 4QRQA 2WM0A 2JJTC 3OGCB 3ULUL 4YSTA 4M7KH 1B3IA 4GW1A 3MLTB 1B88A 2OK0L 4XP9H 2EIZB 3JWOH 2F15A 4M6NH 4AQOA 4DEWA 4XMXA 1ET7A 3BSZL 4I89A 2VKWA 3RI5F 4ZBJA 3PXHA 4JM2C 3GHBL 2OSLA 5FYLD 1MVYA 5JDSB 3GXNA 1ZE3C 2Y5TB 1F4HA 1KELH 2EADA 3NSCA 1MUJB 3OPZL 5DDHA 3RIFF 3V4UH 5EEXA 1KTLB 1BD2B 1NL0L 1PBYA 2HKFL 2XPYA 3GLAA 1IARB 1QRNE 3VXPA 5CEZD 1EJ8A 4A63A 4GRLC 3NIFF 5EA0H 3JVFC 2H32A 1BX2A 1U8OA 5E4IA 4NJ9L 5D1ZI 4AYMC 3QAZB 4OIAA 2J1XA 4CKVX 3US1A 2APSA 4JG1L 1E5YA 3IPBA 4YHKL 1MJ7L 1J8HE 2D31A 2DL9A 3IFOA 1T21A 4KKLD 2GIYA 2MRYA 1G9MH 2PYFB 1I85A 4K9EH 4U4BA 1G87A 1UT2A 3M46A 2ZUUA 2VZ3A 1FBIL 1ZTXL 4NLAA 1LL1A 1S5HB 1T0NA 1LEGA 4GMSL 1PYWB 2ESVE 4E5XG 2Z8WC 3NCEB 2C1OB 4MDJA 5FB8A 1EWHA 5JMRA 5AB0A 2DWTA 4M48L 3NUKA 4HA1A 4BE6A 1DVZA 4G9FA 2F61A 4HX1B 1SJEB 1N0LA 3EZJB 1ZSDA 2XV0A 5CJQH 3PHSA 5LG6A 3L4XA 5C0EB 4ODXB 2OMBA 2APVA 1KLFA 2GFBB 4JKNA 3HI1B 3DRTB 1N7ML 1KXTA 2H0JA 2MNJB 4MBOA 3CDZA 1T7ZA 3V5KA 3KLHD 2QFRA 2PF6A 1T7VA 4ANWA 1M7DB 2VDLB 4QF1B 1XT5A 2OTPA 3RY6C 3K8MA 4N0UB 5F6HJ 1JI1A 1EFXD 1R3HA 3MXVL 2UXGA 3Q05A 1HDMA 1QRKA 2B15A 3QNYA 4FTVB 4NYLA 4UT6L 3L7EA 1RH8A 5KVEH 5BJTB 1WWWX 2MQCA 3P2BA 4R4ND 2VN7A 2A0LD 2X4QB 2AF2A 3AU0A 3HC2A 1NPNA 1HK6A 3QR1A 1KGCD 1T21B 2ENYA 5B38B 4PRBA 4PY7B 1NPJA 2QHRL 3ULVF 4I1NB 2ZKHL 3MA7A 1BQ5A 2HFGH 3U7AA 1IKNA 3CJJA 1J1OL 1YYLH 3EOAB 4RGOH 3WEOA 2DJ4A 3BCDA 3OR7A 2NNRA 4XBEH 3O6FD 2WBWB 2CO7B 1WAAF 2WWOA 5DJ2A 1DQJB 4GT7A 1XTMA 4HMEA 4TTDC 3U25A 5LKNA 3QG6B 4N28A 5SWSD 4BSWB 3F7KA 2X3BA 3PAYA 5ID0A 2PCPB 3GSXA 2NY6D 1GZQB 2IDQA 4PS3A 2BZCA 3DX0A 2BSRA 3SE3A 1WFUA 4ZFOA 1H0DB 5JOPD 3HS8A 4DKTA 4Y4KC 1GCFA 4Y19D 1ZHBA 2AEIT 2N0KA 5F7DA 4MA1B 1HX0A 3QUYD 2J55A 2XA8L 5DRWA 4GQ9H 3PG2A 4WO4D 3GSNB 5F6IC 2E9JA 1KJ3L 3V4LA 4DO6A 1NGPL 3TJHD 3DO4A 2DM7A 3HW7A 2VQUA 3F7YB 4OF6A 4JKPH 3CH1B 3VYOA 4KPHL 4KXBA 3APCA 4FHKA 4P4KD 3CUPA 4TRPH 3L9RA 2MFNA 1YQ2A 5L4JA 1T4KB 2KBGA 1LDSA 2KL6A 4L8BB 3KXFE 4K0OA 1MIEL 1JV5B 3K3QA 1NGYA 2BCKA 4XNMB 3LKSB 4X6CA 5FECB 2WXGA 3GSRB 3OKKB 4Y5VA 3U6RA 3QCVH 4E9LA 3HR5B 4N68A 1NUNB 3MCLL 2FO4A 4LSUL 4OCNC 2FJGB 1XR9A 2AKRA 2EVIA 3CXFA 1JPST 2ZYHA 3VM5A 3ZE2F 4MXVE 4Q9CA 2BIHA 1IAOA 2YPLA 2XZCH 3H3KA 3M88A 2F53A 43CAB 3K5RA 4GXVL 2YAPA 3SSGA 3VXSB 4OCYL 5DR5L 3KJ6L 3VFPB 4KKCD 5I6MA 1FVEB 1BD2D 4UT7H 1BD2A 3MI6A 2VC2H 4ZMVA 3O6ML 1MCRA 3QJXA 3QUML 4QT5B 5KBKA 2GT9B 3F5WB 4J6RL 4IU3B 3IMBA 2JK5A 1IBZA 4QXTB 3N9GL 1A4KB 1CXHA 3GM8A 1E7VA 1P0SE 1OALA 4HUUB 3ZO9A 1L9SA 1Y07A 2BS8A 2EE3A 2YARA 4UNIA 4A2MA 4M4RA 5I1HH 1W8NA 1WTLA 3ZJAA 1AHMA 5C2BH 3WAJA 2ZP8A 1AXSB 3VFRA 3CMOH 4UNTA 3RJQB 1ZTXE 2RMNA 2LFGA 1V3MA 1XB8A 4P3DB 3N55A 2VCOA 5AW1B 4AYFA 3LPPA 5F1IA 3V0VA 3WN5A 4QXUH 2NY6C 4HKZA 1UWXK 4L4TD 4M5ZL 3K0WA 2NY0D 3KLQA 4JDEA 4IQHA 4LEOA 1OAUH 1S7QA 2KT6A 3ARYA 4Z77A 4K7PY 4ZUUB 1BQKA 2ADIB 5CN3A 2BY1A 3MRIA 5FFGA 3VFUA 3T3PE 3GHPA 3J8F7 4Y1AB 4PJHF 5IJVA 2DLIA 3CFIC 3UC0L 2BP0A 1NIBA 5CP3H 2FUQA 2YHGA 4PYHA 2IH3A 2Q2LA 3H54A 2N3JA 1LE5A 3WJMA 4F8OA 5E2WL 2YD7A 5ISZA 5JMOC 1WFOA 3AQYA 5HJGA 3B2MA 4NQDE 5C0NC 5JDJA 4MTMA 1JXDA 5I75B 1Q72L 1HDMB 5CR8A 4XPAH 1BLIA 3WELA 4ZTOL 3AREA 3IDNB 1PG7L 5I19H 2YA2A 4IGBB 4NNYA 3CN3A 3INOA 4M4RB 1AI1H 1BOYA 1P7KA 3TA4D 2VMFA 4LGPB 3DJSA 4AQEB 3D85A 4QY8A 3EUDA 3FB7A 2O6DA 3O3DA 1K8DB 1T3FA 5EZJA 2XVKA 4A7TA 3G5XA 2R69L 4W6WB 4Z7UB 3BW9A 4Q6KA 1MHPH 4P5KB 4WHYH 3ZMRA 3KPRE 1HXMA 4M7JH 1WIPA 3WO3B 5D4HA 3BGFB 1N8OE 4W1TA 1KGJA 4NQSA 4G6AC 1YEDA 4RSYA 3VFOB 3GMOB 4F24A 3WJLC 4RSVA 4B0MM 1WWAX 2P80D 3LKQA 1JWMB 5E8PB 2HJLA 1PPIA 3JWNE 1HCFX 1ORSB 1YEKL 1ZMYA 2KKQA 2BNRD 2XVBA 3HOGA 5FYKD 1D5ZA 1AKJD 5H94A 4TUJB 3RVVD 1QEXA 4S0HA 1A7QH 2LGNA 5HI3D 3T0WA 3QEGH 4EXKA 1WCQA 3MOBH 2EDOA 5ABZA 4XBMA 2XWRA 1Z0MA 2YN5A 4J3OD 4WI9A 4PW3A 4OW6A 4DVBA 3GEWB 4RVBA 3WFHA 2AABL 3UPCA 3F6JA 1HEJC 2AQNA 3TN0C 1T7YA 3I75A 2PKDA 3X12B 4L3EE 5B3JE 3FQTB 1OE3A 4B27A 5CD5C 2PO6C 3NIDF 1OF2A 3VJ6A 3Q06A 3AW5A 1XGYL 4G8IA 3DIVA 3GMQA 4N2AA 2B8OT 3BOVA 5DHXB 5FYJE 3N2JA 2AKRB 5CS7A 3HNTH 1EZUA 2H26B 2B1HL 2CBQA 5KTEL 4WV1A 1Z3GL 5I73B 1PLBA 1CXLA 1PCXA 3G6DL 4Y4KA 3VI4F 4N1EA 3FQNA 5HHXL 5FM8A 3T2OA 4K15A 5TQ2H 1DDHB 3V0GA 4G6JL 3WFCH 5JR1H 1JGEA 1H15B 1K3IA 4HPHA 3SPVA 2YA0A 5H2BA 2Z8SA 2EZ0C 1AFVH 2ICWJ 1BFOB 4LSSL 1OGAE 4GMSH 4PRHA 1INQA 1FL6B 4B5EA 2GTZB 1DE4B 2E75C 5LLIC 3CZJA 3O6KL 3O8XC 3LPWA 4K9EL 4K8RC 1OHQA 3LKNA 5DD1H 3HR6A 2XTSA 1I8MA 4JFDD 1FAIH 4GAJH 4UT9H 4L0YA 4Q0XL 4EO5A 3FS9A 4A68A 1ZV9A 5F9OH 2F54B 1EHKB 3ROLB 3SBPA 3KGSA 4LDOB 1KT2B 4P99A 4A2FA 4ORZC 2J4WL 4F2MA 5EN3A 3CU7A 2NYYD 1SOXA 4XE5B 4QYAA 1HHHA 2IG2H 1QSED 3BMWA 4M8VA 2D0FA 2DLFL 4U3SA 4RISL 2XZAL 3OF6D 1FNSH 4U1NB 4DGYL 3IDYB 2Y23A 1OAXH 3RNQB 3S36H 4J3TA 43CAA 4YUEH 4CSPA 4GRMA 1X3DA 2Y6SC 5F96L 1S78D 3DX7A 3LHAA 2ADIA 5CLYA 1AD0B 4U3XA 1XCTA 1L5GA 5B8CA 1I8IB 1ZA3B 4F2ME 2HSIA 3P3SA 3NCFB 2QLVB 4MDIA 5E8EB 1NMCB 3BC9A 4K3EL 1C8PA 3HI5H 4B9GA 3MV7D 4S1DD 5TE4H 3CDFA 1KN4H 2BIQA 4OM1H 1N8ZA 4MCNA 3MRDB 5FUCE 1F8TH 3I3BA 4D0DA 3KPQA 4DP0X 3CZKA 4YGAB 1H5BA 2Z92B 4XNZC 1H8SA 2W59A 3MLUL 1VFMA 3KPMB 2H1XA 2VM3A 5DS8B 3RWHB 5A6IA 2C1PB 5A43C 5F0PB 2E9IA 3AGWA 2PYEA 3FBKA 4F2FA 3PQYB 3RWJB 3UACA 3P9LA 1PIFA 3DJZA 1IBGH 2R0ZH 3ZDWA 2C9SA 4HWBA 3IJHB 4OAWA 1DFXA 4IRSD 2HRHA 5E7FA 2C9XA 3SDCC 5FHAH 2FB4L 3LH2L 4ODSL 4AC2A 4L8CB 1PW3A 4Y4HB 1KTDB 1ZT4A 1X4ZA 4U2YA 3L4TA 1OTSD 2KDGA 3W0WE 1IGMH 4MNHB 4YHZH 1UD2A 5K9JH 1JGUH 3LKOB 1T4WA 4ZDHA 1B9ZA 2D7TH 5T1KB 1NCGA 4CC4C 5IJVB 2JCCF 4UZUA 4JNXA 1Z2KA 5GGTL 3RL1A 1JIBA 1UD4A 4FLSA 1JK9A 2WCSA 4PJXE 2XPGA 4QO1B 3VI3F 1ODUA 2QV2A 4G6FD 3VQ2C 4JREC 1CLYH 3S4SA 1OGAB 3RVUD 2NY2B 4NHUB 4IOFD 5CIPB 3E2HB 1CGXA 4OB5L 3VD5A 1WZ1H 4C4UA 5CBAB 3PF2A 2H1PH 1LP9B 1U3NA 1NLDL 4JFHD 5EU7C 1ETZA 3J2PA 2ZKXA 4H8WL 1OTTD 4X9IA 4EBQH 4JFYA 5GGSB 5T5NF 1AGDA 4MJHA 1W16A 3QI9D 3ORJA 4WK4B 1KXQE 4OAWB 1SXBA 5CUSL 1U33A 2R2BB 5GZOA 3U9WA 1TU2A 3RI5K 4ZOCA 2AI0H 1KBWA 2P5ED 5ADOL 1S78C 1BYPA 2CBOA 4PB9L 4C55A 2XN9D 5J6GB 1Z3RA 5GSRB 4HMDA 5EIIG 3HG5A 5KSAA 4HGKC 4MJIA 1AR1D 3BPLB 1LO5B 3H9YA 4FFZA 4H26A 4ZW8A 4HALA 3DUHA 5E4EB 3AWGA 4HJGB 5D1QD 4B96A 5KYYB 4Z0BH 2GCYA 3ZIMA 1GCYA 2I69A 1ZXQA 4ZFZA 3B4NA 3P1VA 2J72A 4YX2H 1AZUA 1JWMA 2GUYA 4UT6A 4ZTPH 4NDMB 1E6JL 3F65A 4DN3H 2CUMA 1QI5A 1ORSA 3FCBA 3FK3A 1F4WL 1N64L 1P7QB 5AL0A 3FYIB 1ADQA 4EE2A 2ZX5A 3S4SB 1EHLH 3BRDA 4YDNA 3HNSL 1MCNA 3LMJL 4KTEL 4UUJB 2CGRL 3EKCA 3AU1B 4X8XA 3SCMD 3WIFA 1KBBA 2Y22A 43C9B 2R2EB 1GA2A 1ZY9A 4FNSA 4KH9A 2AVFA 3Q5YA 1PYWA 4LLQB 3IDXL 4B53A 1HQ4B 2AJUL 4IRSC 2VDQH 2BJML 4FC3E 4PWFA 1Q9WB 3ARBA 5HHPB 2SEBB 1H6TA 2ITEA 1TLKA 3CX5J 1MRCL 5ETUB 1N0XL 5D2NB 3EHBB 1QNZH 4GAGL 4BEIA 3FN0L 2DBJA 2JQAA 3ES6B 4XOAA 1S7SA 2YD1A 3C6EA 5IROC 4RMVA 2WAHA 3D33A 1CICC 4D0CA 4XH2A 5KSAB 2CDFA 4MRBA 2MOGA 35C8H 4PJEA 5AKVA 1XF2B 1E8YA 4X50A 2ZONA 4FQQA 2J8UB 5BMFL 3BISA 4F33A 4LOUC 3HZYB 3QFJB 1JGVL 1NZRA 5A2IH 4W9ZA 2DH3A 2XKSA 3HKZA 5LCVA 1GHFH 5J1SC 2QV4A 3OAYH 2DDQH 3NFSL 4PUBH 3O9WD 1LEGB 3NRFA 2X6VA 1IC0A 2P5PA 3DLQR