2AVFA

Crystal structure of c-terminal desundecapeptide nitrite reductase from achromobacter cycloclastes
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
314
structure length
314
Chain Sequence
LPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Copper-containing nitrite reductase
publication title Crystal structure of C-terminal desundecapeptide nitrite reductase from Achromobacter cycloclastes
pubmed doi rcsb
source organism Achromobacter cycloclastes
total genus 80
structure length 314
sequence length 314
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2005-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2avfA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2avfA02
2YAOA 1N68A 3X1EA 2UXTA 3NJNA 5I6NA 4HHWA 4W1TA 1V54B 2XWZA 1PZAA 3NJFA 1NWPA 2PP8A 3QPKA 2YXVA 1GS8A 1AS6A 5IY5B 1JZIA 3WKPA 5B1BB 3DKHA 4JHVA 4YSOA 1XB6A 2GI0A 2YAHA 3ABGA 4KNSA 2QDVA 3BQVA 3FU8A 2JKWA 1V10A 3WNIA 2WO3B 4JHUA 1RZQA 4YSCA 2W88A 5AFAA 1AANA 4EF3A 1PMYA 1TEGA 2XV0A 2UXGA 5AZUA 3X2QB 2FWLB 3JT2A 4E9SA 1AZUA 1GW0A 2PLTA 1IUZA 1OCZB 1W8EA 1KGYE 1QNIA 4DP4X 1F56A 1NDTA 3CVBA 4BDVA 1CYWA 1E67A 1W6WA 1AAJA 1OE1A 2GBAA 2HLEB 1J9TA 1PY0A 2UXVA 4N8UA 3S3DB 2VM4A 1KBWA 2FT7A 3BVDB 1NZRA 1URIA 2IH8A 2Q9OA 1KYAA 1VLXA 3AY2A 1JERA 1TKWA 1WA1X 4HAKA 2DV6A 4GP4B 3SBQA 1NICA 1AQ8A 3CDZB 1AG0A 3FYEB 1J9RA 3T9WA 4DP7X 1R1CA 1M56B 2CBPA 2UXFA 1J9QA 1PLCA 2JXMA 2YAPA 3TA4D 3ASNB 4A66A 2IAAC 2BP8B 4GYBA 1L9PA 1PF3A 2PP9A 3QJTB 2XX1A 1L9OA 2YQBA 4DPCX 1UATA 3FPXA 1ADWA 1BYOA 2FQGA 1IBYA 4QKTA 2J57A 3IEAA 2QPEB 1A4BA 4E9WA 1SHXA 1RKRA 2W8CA 2WSDA 4DP5X 5B7MA 1L9TA 3EH5B 1SJMA 2GSMB 2BO0A 2XU9A 1PNCA 2EIKB 4F7KA 1AOZA 1I53A 4E9QA 3H4FA 1SHWA 2HXAA 4HCGA 4UF7C 2J55A 3D12B 1V55B 4G7RB 3T6ZA 2QPDB 3OD3A 2HX7A 2B08A 2AVFA 2HZHA 3IE9A 3PAVA 4KOBA 1PLAA 1NIDA 2HRGA 3IN0A 3FPYA 3NJKA 3QQXA 4HCIA 4UAHA 2EINB 5I6LA 3NJHA 1AACA 1KCWA 3NP3A 1HAWA 3PPSA 1GS6X 6PCYA 1JXGA 2BWIA 2XVBA 4A2DA 4E9VA 6PAZA 4GY4A 2CUAA 4CSZA 1IBZA 4CSPA 3EHBB 4G71B 3C75A 2MTAA 2DWSA 3UADA 4HZ1A 1RZPA 4NAJA 2PP7A 3IBOA 4YL4A 1AZNA 2Q5BA 1SDDB 1ET5A 3OM3B 2GC4C 3N55A 5I26A 4K9JA 2BW5A 5I6OA 2OJ1A 1X9RA 1KDJA 1RCYA 3WNJA 1FFTB 3UABA 3TASA 2PPCA 1X9UA 5B7FA 1XMEB 2VW4A 3SQRA 1PZBA 1B3IA 4A67A 2Y1AA 3ZDWA 2J5WA 4A2EA 1OCCB 4E9YA 4PAZA 2VSKB 5D4HA 1A3ZA 1AZRA 3KW7A 2P80A 2AANA 1CUOA 3OMNB 1ILSA 4N4YB 4NB7A 4ENZA 1MZYA 1SNRA 1OF0A 2FJSA 2IDFA 1GSKA 2ZOOA 3CG8A 3NSFA 3OMIB 4G70B 5B1JA 3ZBMA 5I6KA 3X1NA 1J5DA 3NJGA 3IN2A 4X4KA 5I6PA 1DZ0A 4E9RA 5F7AA 1HFUA 5AKRA 7PCYA 2XXGA 1IKOP 3NSDA 3FU7A 4NERA 3TBCA 2XXFA 3EH4B 4KOCA 3AW5A 4DP8X 4FA7B 1JZFA 3NYKA 4BXSV 2BP0B 2P80D 4YSEA 5B7EA 1NIFA 1OOWA 5I28A 2LLNA 1BXUA 2HX9A 5B1JC 3CVDA 3KW8A 1T5KA 2IH9A 1L9SA 3DTUB 3FS9A 1TEFA 2H47C 3JTBA 3QJSB 1BEXA 1KV7A 4TXVB 4W9ZA 1XB8A 2VMJA 5E9NA 4P5SA 2YAMA 3QJVB 1JVLA 3T6XA 4F2EA 1SFHA 2I7SA 1AS8A 4AKPA 4BK5C 1OE2A 2Y69B 1NIAA 1NINA 2PCYA 4DPAX 4BWTA 5I5IA 3AG3B 3EF4A 3PLYA 3FQ2A 1JVOA 2PCFA 4YSTA 1ZV2A 2YAQA 3ZIYA 3PXLA 2R7EB 3U25A 3QJQB 4WKXA 2XUWA 1ASQA 2BWDA 3S3BB 3ASOB 1AR1B 1YLBB 4G7SB 3WI9A 3OMAB 3FQYA 2OCCB 4A68A 2PPFA 2DYRB 5ANHA 5EHFA 3FQ1A 1A65A 2EIJB 1SF5A 2FT6A 3PAUA 4KO5A 3ABMB 3UGEA 3T71A 3NJJA 4GXFA 2IWKA 3UAEA 1GY1A 3NP4A 4MFHA 5TK2A 2VSMB 2YAEA 2GB2A 4GP5B 1NPJA 1ZDSA 1PNDA 4YSUA 1BYPA 4G72B 4AKOA 4AI7A 2VM3A 1ASOA 1QHQA 4Q8BA 3CVCA 5PCYA 1SFDA 3GDCA 1HAUA 1ETJA 2GC7C 1NTDA 2AFNA 1ET7A 2RACA 1ILUA 3ZX1A 5B1AB 1GYCA 3ERXA 1M9WA 2BW4A 1NWOA 3N2JA 2XX0A 4KO9A 2IWEA 5D4JA 4BDVB 5LDUA 3FSVA 2PPAA 1JXDA 3CDZA 1OCOB 1L9QA 2BZCA 1MZZA 3FSWA 1KBVA 1EHKB 2GIMA 3WKQA 2H5UA 2BP8A 1AG6A 4JKNA 3SBPA 3HEIB 1OCRB 3TU6A 3UAAA 4DP9X 1JOIA 1PLBA 4M3HA 2E86A 3ABLB 3NJLA 1J9SA 3L45A 2XV3A 5I5JA 1EZLA 1E30A 2NRDA 3GXUB 5I5MA 3FSAA 3H4HA 1PAZA 4ZK8A 1QLEB 1BQKA 4DP0X 2TSAA 1MDAA 4G7QB 2EILB 3NT0A 4AZUA 3MBWB 2HX8A 2UX7A 1OV8A 1ZIAA 1AZBA 2ZWNA 2FTAA 3NJIA 3X1FA 2JFCA 1A8ZA 2X87A 1CC3A 2PPDA 4F2FA 3SBRA 4A2FA 3S8FB 4UANA 2XLLA 2CJ3A 4GP8B 5D4IA 2FQFA 4KNUA 3AZUA 4DP6X 1M57B 3FU9A 2TSBA 5B3SB 5FC9A 1ID2A 2FNWA 3WG7B 4E9XA 1WS7A 1GY2A 3X1BA 8PAZA 2IWFA 3G5WA 4HCFA 4YSRA 4YSAA 1GS7A 2FQEA 3H56A 2CALA 2A3TA 2VW7A 1BQ5A 1IC0A 2OV0A 3QJUB 1WS8A 1TU2A 1BQRA 2I85A 1KDIA 4RH4A 1JZJA 3CZUB 2MRYA 4AKQA 4YVUA 1MG3C 1SDDA 4YSQA 1ET8A 1ASPA 2EIMB 5B1KA 4HIPA 4WTQA 4A2HA 1E65A 4FAAB 1JZEA 4E9TA 2CCWA 2YAFA 3DIVA 1BXVA 3V9EA 1A4AA 1NPNA 3NSCA 3X1GA 2AZUA 2YXWA 1OE3A 2DYSB 2ZXWB 2H3XC 3TBBA 4BXVA 3T6WA 4P5RA 1PZCA 3PCYA 2J56A 4KO7A 1JZHA 2X88A 2VN3A 2IDUA 3FSZA 2BHFA 2PPEA 3NSYA 4KO6A 7PAZA 2IDTA 2UX6A 4M4RB 3GYRA 1BAWA 1FWXA 1NIEA 2DY2A 2VW6A 2QT6A 1PCSA 2QDWA 2DWTA 3AG4B 2I7OA 4BWUA 4PCYA 1MG2C 1NIBA 2AZAA 1JXFA 1ZDQA 1WA2X 1E5ZA 2XYBA 1GR7A 3S8GB 3FT0A 2HRHA 3AG2B 2BP0A 1E5YA 4YVNA 4YSPA 1DYZA 4DP2X 4AX3A 9PCYA 1AZCA 5I6MA 1AS7A 1KCBA 2FQDA 1ZIBA 1SF3A 3T6VA 1AIZA 1BXAA 3FU7B 5TK4A 1WAEA 3S3CB 1W6LA 4QLWA 2IDQA 5F7BA 2N0MA 2GHZA 3V9CA 2BZ7A 4HHGA 3ABKB 3RYMA 1N70A 3PAZA 1CYXA 3NJMA 3WIAA 3QJRB 4YSDA 2XV2A 1A4CA 1XB3A 2B3IA 4L0PB 5PAZA 1JZGA 4HALA 1L9RA 3AG1B 4BWWA 4DP1X 2ZONA 3HB3B 2IDSA 5A7EA 1ZPUA 2R7EA 2YARA 4A2GA 1FA4A 4DPBX 1WA0X 3UACA 4YSSA 1J5CA 3FYIB 4KNTA 3OQRA 2FT8A 1CURA 4Q89A 2WO2B 3MX0B 2CAKA 3EH3B
chains in the Genus database with same CATH superfamily
3B2VL 3IAGC 4LCWD 4HS3A 2VR5A 5BZXA 1PZUB 2OFQA 4N9GB 2IPTL 4QMEA 5EU7E 3CN0A 3CHSA 4Q74A 3W11D 1FC1A 3RVWD 4ONOA 3ARFA 2A6KA 4KKNA 5FM8A 4KGLA 4L5FE 3OKOB 1PQZA 4OCYH 1IT9L 3QPKA 1P7QA 3WTVA 5FLVA 1D5MA 2YXVA 3VXSD 4DZ8A 3WKPA 5HJDA 5HDOA 2L7JA 2A74A 2QQLL 3DRQB 5EZLA 1WBXB 4JFQB 3JV6B 2E27H 4OFYA 4ONFL 3WENA 1M4KA 2FUQA 1IC1A 1SBSL 5J56B 3CVIL 3TN0B 1L6ZA 5E6SB 4NN7C 4JFZH 4U1HA 3GXTA 4XBEH 4FABH 3SQBB 3QHFH 4LSUL 3K80A 4UT6A 1TJIH 4Z7OF 1JRHL 1IV8A 2WKOF 5DD6B 2GCYB 4JREC 4K9EL 4PJ8B 2D7TH 2JTYA 3JBG7 5H4ZA 1MFCL 1GW0A 2BLFA 4Y16D 3O8XB 4X5LA 1WRFA 2HT2D 4F15B 1I4FA 3E0GA 2CHZA 1UA7A 4BZ2L 4PVBA 2XWRA 1CYWA 2D7QA 3BFOA 2C3HA 2EC9T 3FCTA 4N0UA 5JW4R 1HQ4A 3B7YA 1QG3A 3M7FB 3WL9A 5A16B 4ODSH 2K7PA 3JTTB 4X5XB 4CBPA 5I1KH 4YDIL 2BSDA 1JK9A 1D5IH 4OI9A 1T83A 4U05A 1V3MA 4B97A 2BMKA 1DFXA 1L0YA 2FWOB 3L9BA 5IGXH 4KMQA 3OKNA 3TCLB 1G9NH 4GP4B 1UOKA 2XC8A 3THML 1J9RA 1CTNA 2BHZA 2VABB 3D06A 5C09D 3B2DC 3EJYC 2JXMA 5I0YA 3KHOA 4YEFA 1UOVA 3QUGA 5I15H 3TEZA 4HIXH 1L9OA 2YBGA 3TF4A 4BA8A 3KZ8A 4UM9D 5IBLC 5HJBA 2GBTA 1L7TH 4CMMB 2WVUA 4PRIE 1HZLA 1IBYA 4YIQA 4Y19B 2O1AA 3DOSB 4CW1A 1YYLH 5B7MA 3BZFB 5FECA 4OGYL 2K45A 3Q9QA 1G7QB 4BINA 3U48A 4OIIH 1WBYB 2FZ3B 3DHPA 3P0GB 4RBPH 2VC2L 4DZBA 1MXDA 1TQTA 3CU1A 3HJEA 1FI8C 3L4XA 3FRUB 4GEJA 4X98A 3F7PC 5T1MB 2J55A 5TFSL 3KPRE 3VRJA 2GSIB 5BVPL 5FGSA 5IVOA 1H19A 3IDYC 3MN8A 4WGWB 4D0DA 3HRPA 4HC1H 3LSOB 2BFGA 2ENYA 2Q7YA 4XO4A 1MW1A 1TFHA 2ZPKH 3KBEA 4TQEH 5AW7B 1CGWA 2YC1A 3GMMB 3IFNH 1P4LA 4AEIH 2WBWB 3BVTA 4PJXF 3B34A 3L13A 3WUWA 3T0DA 2W95A 4E9VA 3GSRB 5EIQA 2NT1A 1OOAA 2CGRL 4MJ5A 2AXWA 2HT3C 3BUYA 4NN5B 5KVMC 3C75A 4EQ2A 4BH7A 5DFAA 4YL4A 1U3HA 3HVDA 2WLIB 3DVNB 1WPCA 5CO1A 3WFZA 4EUPH 4I3SL 5C07E 1OAZL 1CS6A 1OTUC 4XVTH 3WNJA 4UOW0 1EAPB 2GI7A 4N2EA 1OAUL 2F8OA 4O2EA 1IIIA 4FXKB 4M7KL 4PG9A 4TULL 3FFCD 1OLZA 3QO0B 3MNWA 3A4FA 5I71C 3QEQA 1XF2A 3C87A 1S7RB 3CVHB 3PRZA 3RI5K 5JTWA 1OSPH 4JZJC 4H2CA 4WWKC 2C1PA 1HINL 5AWNH 2H0FA 3TO4D 1ILSA 1TTBA 2VAJA 4NB7A 1YJDC 5DF0A 4A7QA 1T0MB 1NCBL 5FR3A 4K3DL 4GAAA 2EDKA 1UB5B 2YRLA 4E9LA 3MVSA 3PJSA 2FYVA 3WNPA 3NIFE 1UM5H 1LEIA 4ZW3A 1AKJB 1IGIL 4OF5A 2X4NB 1PD1A 1UKSA 2WXHA 2XFGB 3DBXB 4FKKA 4FJYA 3O3DB 1P9MC 2LE9A 1DJZA 4G1MB 3DHMA 3H2PA 1YY9D 2P45B 2YRPA 3D9AH 1N0XH 1OB1B 1DEEB 1X5IA 2F5BL 4ZDHA 2NZ9D 1EEYA 5DS8B 5DGQA 1NIFA 5FYLL 3R8BB 4OJDH 2IADA 3DI2B 4ISVB 5A2JH 1MF2L 4OFDA 4GUPA 4TQIA 3QQNA 3FU3A 4Z0XB 1CIDA 1FL5A 4ACPA 1OT2A 5EEXA 3GRWH 3DTUB 4N0FB 3LN4A 3FTGA 1A22B 2AABL 3OAZK 4KVCH 1BFSA 1KJVB 4TXVB 4DKTA 3RWFA 4NC0B 4EZKA 1BZEA 1P0SE 2MQ3A 4BKLA 3HFFA 1R24B 1AS8A 4NS0A 3ZPDA 2PCYA 1T5XB 2XACC 5ADOL 4Y0GA 4HKJB 1GPOL 4XNQB 3D2TA 5IBTH 1UWEL 5K1VA 5CEZL 2YAQA 4FG0A 3PXLA 2EEBA 2XQBL 3U7YL 2AITA 4J3TA 5KSAC 5INCB 5E99H 4PJBA 3ASOB 3BAXA 5DS2A 3W9EB 1AR1B 2Z9TA 2VN5A 1TPXC 1CFNA 3WS6A 1XF1A 3W39A 1BFOA 4NJAL 2YGOA 2Z7UA 4RIRB 2GJRA 2VRQA 5ANHA 4FFZA 5J1AA 2Z31B 5B39A 1C5DA 3S98A 3VFOA 1DSWA 4MNQD 5DEGB 2ZYRA 3O6LL 3SDAB 3QNYB 2UY6A 4IBUA 2NW2B 3C2SA 4QXUL 4UZSA 4A38A 2R1XB 3SDYL 5AAWA 3QIUB 5FB8B 3SE8L 4J3XA 3CTTA 1SGKA 2ENPA 4YPJA 3MFFB 4EKJA 4OCRH 4ORZC 3VXUD 1KBBA 4PGBA 4WK2B 5IMMA 3IGUA 3WJLA 2X4PB 2BNQB 2DKSA 3DO3A 4C4KT 3GBEA 4K8RL 4LLYB 3EOAB 3UYPB 5T1DH 4DQOL 1C9SA 5GGUA 4R8WL 1J1XH 4OZFH 1KACB 1OWRM 1ILUA 2JI3A 1RUAL 5KW9H 3O8XD 3GINA 4PWGA 4AM0Q 4DKFL 2Z1PA 3N2JA 3NGBB 1N5YL 4NUPA 7FABH 3HC3H 1OARL 4QHNA 4Y4FA 15C8L 3AXLA 4I77H 5HI5C 3ULUE 1ZHKB 4P06A 1MAKA 1A1OA 1G5GA 4YZFF 1BEYL 1ES0A 3RWJA 2QV4A 3V5DB 2GK2A 2R29H 1T7XA 2YPVA 3FRPG 3PU7A 2EXTA 5J89A 1AQKH 3LTVA 1B4TA 1E9PA 1A1NA 3H85A 4ZPVA 5LVEA 4ETQB 1NA8A 2IVFC 4DGVL 3O3UN 4KJWC 2F15A 3DXAE 4H1LB 3U0WL 4KDTC 5SX4I 3NFPB 1XGQA 2GJZB 3VU1A 3WY2A 2GSGB 3QXAA 5FW6A 3LKSA 1BQKA 2BNRD 2WTRA 2OYMA 3ILQC 5ABAA 3O2DL 4C58B 3HG2A 1F18A 2AQSA 2P24B 3ZRSA 4MAYC 4Y4HD 5D7JC 2LTQC 2X53A 4L4JA 3BSGA 4TTDC 1HESA 1VEMA 1FL6B 4GBXC 1SYVB 3W3BA 3BWZA 4HG4J 1MLBA 1H6TA 3HNSH 3I9IA 5E6RB 3IJYB 3ZHDA 1CDCA 2OMYA 4XRCA 1MJJB 3O0RL 5AB0A 2ZSWA 3IB4A 4ZFGL 4XNMA 5FEBA 1FIEA 4GKNB 4BE6A 5ITFB 1KIQA 2F53D 4FNRA 4JCMA 4R0LB 1HCVA 5TJWK 4AQ1B 5GS0C 4YSAA 3GI8H 4H4NA 4MD5B 3CHPA 1M7XA 4JM2F 3KDMA 1B9ZA 1DSFL 3IDIB 5DEFA 5I2IB 3MACL 5K9KB 1I8AA 1E0OB 2GHWB 2FJGA 3GSVB 4Y16C 4XP4L 4F80A 2UZYA 4K7PL 4MMXB 1BQRA 2QHRL 1G0XA 4OJFL 4OLVL 4RRPM 3SKMA 1HOCA 3SDDD 4Y5XC 1CFMA 3KS0J 4B96A 2AEPH 3QZBA 1LMKA 4JHAH 1BMZA 5D8JL 3RKDC 4NHCH 3RY6A 1OM3H 2OR8A 3HS0A 4TKWA 3NSCA 5I1DA 2AZUA 1FRGH 5BUGA 1OE3A 4U49A 1U92A 1UJTA 2D2CC 5TF1H 2WXGA 3P11H 4AE1A 4OIAA 2A6JB 3HNTH 2I26N 2LAAA 2W60A 5I82A 3MRRB 3ZL4H 1KN2H 4GKSA 3VI3B 3HZKA 3GYRA 1FWXA 4HHAA 1DJXA 3FFDA 4U6HA 4G80A 4TNWF 1FUNA 2B39A 5FYKE 2XKNA 2JCCB 3LKQB 3RGHA 1H15A 3AS0A 4KRPD 4NC1C 3LZLA 1E50A 3ES6B 4U1NB 4XMTA 4N5ED 1JXFA 1WA2X 4UQDA 4JJ5B 3BO8A 2VQUA 2HRHA 5I1EL 5G4MA 3QG6A 4L4VD 4DK3A 2V9TA 1Q9WA 2NR6A 4PB9H 1HWWA 4X8JA 2W07B 5CZXC 3FN9A 3FSOA 4YMPA 3LKPA 4JFEE 4NNYB 1MAMH 4OR1A 4KPHH 5H2BB 2RFXB 2HP4A 4S1RH 4YXKH 4IYKA 3T6VA 1SXBA 1TETH 3K6FA 3CHOA 2EADA 4J3VA 4YHKL 2B77A 2BK8A 4PN6A 5DYOA 3L54A 3NBNA 2NCMA 1QSEB 3TEWA 3ABKB 2VC2B 1BX2B 5CSZB 4YDZA 3IAPA 3WIAA 4PLKC 3QUZB 1Q0XL 5I18H 3B9KB 2H26A 2YXFA 3QQ9C 2NY5L 5F7HA 2XHNA 5E8PB 2E7DA 1I8MB 2C9QA 3Q6FB 1J8HB 4LLDA 1EFQA 1MRFL 3RAJH 2CKBH 2IDSA 1U58A 2Z8SA 1LDPL 4J1UA 3VD3A 3L3KA 4FXTA 2E47A 1OM9A 3TBWA 4G43A 1RULL 4F7CB 1XTMA 2L4OA 3MLTA 5LB1A 2E7LA 4RFOH 1ROWA 3MMEA 3N0PB 1FVCA 2HFEB 4G59C 1J0ZA 1KG0B 3EH1A 1KC5L 2X4OA 3QCUH 2MTPA 1QP1A 4XH2A 4UIMA 2X4SA 4B7LA 4ZX6A 1JPTH 5IG7B 3PP4L 1KB5L 2DH3A 3CH1B 3BSHA 1T2QH 4LOFA 4N90E 4G8IA 2CJUL 1RURH 3DKHA 3W5MA 4XXCA 3MLXL 4YSOA 4B9ZA 1TFPA 5HYQA 1RAMA 1FZOB 3TO4C 2FHFA 1I9RL 3O45B 3IF1B 3T1FB 2ATAA 1UKTA 2UZIL 5I17A 2J8UF 1I75A 1CN4A 1GVIA 2A9NH 1NOLA 2PWGA 1RU9L 2J6EL 4G6JH 3SGJA 1WQVT 2BOCA 1QACA 1UA6L 3LXCA 3JV4A 3U2SB 1MFBL 2WKOA 4NNPL 3PXJA 4DEPC 2DIJA 5ACZB 4JNXA 4AK2A 3D07A 5IESH 1OCZB 3MO1A 3RY5A 2WHVA 5IQ9A 1KGYE 5A1AA 1S5HA 4CNIA 4WVRA 1NDTA 1YY9C 3LKRA 5EMYA 4D9QD 1ZVHA 3EO0A 4FULA 4BDVA 4FI7A 2IMMA 1JNHB 3UP6A 1AHWC 1E67A 4GXVH 1M2VA 3RTQC 3CBJB 4HWEL 4X2UA 1OCWH 5DR5L 1RLWA 5HHXH 3JSSA 3MRDB 4X6CF 4MXWL 5GSRB 2ZUXA 6FABL 5IWLC 4HP5A 1PJWA 1TVHB 4GRLB 1NZRA 2NQDA 3LQAL 5D2LE 2P43B 5HYJB 3PDGA 2VR6A 4I0PC 4JDVA 5KVFH 3WJJA 1PD6A 1WA1X 4GH7B 3ZLQC 2IIJA 3BW9B 4Z0BL 1NICA 2VMEA 1Z66A 1Q1JL 1KTKE 2PCXA 3KXFD 4I18B 4OFKA 3VMNA 1J9QA 2VLMD 4PRHE 4XX5A 5E2TL 3K5RA 2BP8B 2NY1C 2XTJC 2QGDA 1F90L 1TMQA 4C55A 1MFVA 1BVNP 3PGFH 1YECH 2XZZA 4K71B 5DI8A 4AUJA 4EXPX 4QKTA 3HB3D 2R0WL 3GJFB 4P2QD 1NAKL 4KH9A 2WSDA 3CZFA 3WU1A 2EECA 4D9RE 1I9EA 4EI5B 5J8OA 3C6EA 3GIVA 1Q9LB 4IIQB 2O6CA 1QFOA 4ODWB 4YNYB 1W2KT 5JXAH 4ODXA 1FPTL 4IJ3B 4OIFA 5C97A 2UZXB 3GHBH 2D2OA 4OKDA 2D31B 1EFXD 2CM6A 2B14A 2LU4A 4NM8L 1VJSA 2HVJB 3QI9B 5DURD 4ZS6D 3FTWA 1EGJL 3UBGA 3UJJH 4JANB 4KI5E 2CHXA 2ADYA 1AE6L 3PABA 4DGYH 3TJEL 4MKMA 3G9AB 4HDIA 3SQOH 4C57C 1J5IA 1PG7W 1B6UA 1CCZA 3CSYA 3O3AA 2W1NA 1XR9B 5AZ2L 1BF2A 3IMTA 3HCVA 4J5VA 3TN0C 3PPSA 4E41E 2PMZA 4PJCB 3LNGA 4D3CL 2O6PA 1TCRA 4EIUA 3N06B 4S1DD 3CWGA 5CGYD 5IMOB 1QLRB 3APMA 4JO8A 5GZOC 3VQ1C 3QQDB 4PJ8C 1X7QA 2ROYA 3BHBA 1G9HA 3HZMB 4WGKA 3CFKA 3WJMA 5KJRH 4E0RA 2VDPH 3O8XC 3V5KA 4X0NA 4HS8H 4F15C 3EJUA 3REWA 1KFGA 4OBRA 1EVTC 4ATWA 5CU9A 5L4IA 3TZVA 2ILLA 2GEEA 5T8IA 2JSFA 3TASA 2NQCA 5IB3B 1CQKA 1MIEL 3MKKA 2VLLB 4LLUA 3HE7B 4IBWA 1MCSA 5DJ8A 4OCSL 5C0JB 2OZ4H 1B2WH 4FCAA 3RNKB 1ZY9A 2Q0ZX 4X7TB 4XBPB 4QHLB 1SOQA 1AD9A 4XP5L 3BZEA 1S7TA 3KPNB 4KDVA 4LDLB 5I76B 4PJDF 2V33A 1NPUA 1AGBB 4P46B 3RI5F 4S1QL 1L0PA 3VSVA 3KM2A 2NZIA 2WUBH 3PYCA 3GD1C 3FUIA 1NCWL 1T6WA 1ZVNA 1I3VA 2D0HA 4XT1C 1TVBB 1NBVL 3IDJB 4YBHA 2P8PA 3LN9A 5D7IE 3HS8A 2VR9A 2E6JA 2W9LA 4ZMXA 1U3JA 4PUBH 2O26U 4JPSA 2BP0B 4ABQA 3RILA 4DUVA 1KCRH 1OOWA 2J8HA 4ZTOH 5I28A 2VLJA 1BXUA 4F2MB 4U1KA 1AQDB 1EXUB 1ORQB 3KW8A 3MSPA 3IYLW 5D7LA 5BUAA 2WN3A 4PJIF 5D4QA 5EU5A 5SWQB 5JIDA 1K2DB 2B7DT 4AJVA 3A3YB 2EC9U 3L5HA 2QPUA 3SZKC 1JVKA 2ZX5A 3EFFA 4OGAC 2VXQL 4TNFA 1M1SA 4M8VA 2VMJA 5IR1B 2WNGA 3MXWH 4U1MA 2J1ZA 4LBEA 4PJFA 4QAMB 5KN5A 1LILA 2AXFB 1AD0A 4F2EA 2FBRA 1XIWD 1RVFL 2G9HB 5FYJH 5C08D 4Y7OC 5FUOH 3HRZA 5I5IA 2WSKA 2X3CA 1DBJL 5JZ7D 5H35B 1MFUA 3ULVE 2P8MA 2FBJH 4FYRA 2H3NB 2KUTA 3ZZ1A 5LLIC 4WKXA 5JOPD 1NM9A 4EZMA 2J88H 1SVZA 2VDKL 3FUMA 3NA9H 5GGRB 4HU8A 1W80A 4H2AA 2VSDA 4NN5C 3I3EA 4Y2OB 1YLBB 4G7SB 4MBOA 4A7TA 4ODHH 3E1F1 3CXHJ 2APBA 4XMLL 1M7UA 1O6TA 5A2LH 3UC0L 4AUUA 5IW6A 2PCPB 2FO1A 2J8OA 1A7NL 3CDFA 1P1ZA 1A65A 3WD5L 2EIJB 4B9IA 1ZPLA 5JDSB 1QRNE 2OMXA 4JPWL 3FMGH 4KKPA 1MWAH 3DV6A 4XXWC 4Y5VA 1YEIH 4HK3N 4W93A 4ZAKA 4N0CD 1B3JA 3KAAA 4FXKC 4HMCA 4M7ZB 3LV3B 3VVVA 1EDQA 2IAMA 4OLWL 3QS3A 2WM0A 5F7EL 4ZSOA 4LLWA 5HYSG 1AGCB 1IBGH 5E23A 1BOYA 4FQJL 3MRJB 3UO1L 2VM3A 4BK4A 1P7HL 2F74B 2WCPA 5PCYA 4ELKA 3QYCA 2A1WL 4PREB 2DLGA 3JWOL 5EDSA 2DQGL 4MJIB 1AJ7H 5BXFA 2HWZH 4ZXBA 3Q8FA 3D0VB 1RZIA 5L7XL 4X5PA 3W2DL 3MHZA 1TU2B 3NDYE 3PXHA 5JHDB 4AZ8A 1RLBA 2WQRA 4NXSA 1M9WA 3STZB 2NPLX 3D3VE 2ZXQA 3DRTA 4X7SH 2OTUB 3HAEA 1U3NA 4H8WL 2WXOA 3DX6B 1FO0L 4PJ9D 1DEDA 4ECNA 5C0DB 3FSWA 1E5CA 1RP9A 5TPWL 3UTSA 3EJSA 2AXJA 1HNYA 3WFHB 5E8OB 1HEZB 3P3SA 2YXMA 4AJYV 1UJ3C 4QRRD 4BQ9A 3U0PB 5AOMA 3CDYA 3DO7A 5DUMH 1E7UA 4BV1A 3L45A 4Z7WF 5C8JA 4EI0A 3UPRA 3QBTB 5J1SC 3KGTA 5CCHE 4W9LC 3ZE0B 5K9JL 1DL7L 2A7BA 4JCLA 1GH7A 2HT4D 4Z76A 4QRPA 4IBSA 1JHLL 5HGBB 4GQPH 3VACA 5LNEA 1DBKL 2EZ0C 4TUUA 3SDCB 1MIMH 5DMJB 1IKFH 4X80L 4D0CA 3OGCB 1DN0B 3MZTA 1HNGA 2XN9D 1ZWIB 2BXYA 4M61A 1M05B 5F1NB 2OR7A 2ZP9A 5IB1A 5AL8A 3ZDYF 2TRHA 3DSFH 1I85A 2E59A 3ZHFA 1AR1C 3LRMA 2D3NA 2O5XH 3FBKA 4XXDB 4MNHA 4F7EB 2IQ9L 4KHTL 4YPGB 4Z3TA 1M71A 1ITBB 3WO4B 5DHVB 3HNVH 5E9DA 3HMXL 2G30A 2Z31C 1Y7VA 2YPLB 3R4DA 1KB5B 2I5YH 3QJUB 3SDAC 1NH6A 2JJTA 4JLRB 2EKSB 4JQVC 2GUOB 1SJEB 5DLMH 2EDEA 2Z35A 3QIUC 3MUJA 2NY2B 5CILH 4YSQA 2DQEH 4PWEA 1EHLL 4OZIE 5IJKC 2PR4H 3GRBA 4E2OA 2B9BA 2JKNA 4E9TA 4LSRL 5HHVH 3TO2A 1G7IA 3R1GH 2F8XC 1W8OA 1MCJA 3LD8B 3CFNA 4KU1A 3OR6B 3ZU8A 2DYSB 2KYIA 1XBRA 4O58H 4BFKA 4MA8L 3T6WA 4P5RA 2IPKB 4N2HA 4H25A 5D1XB 3EOBB 1AI1L 4BHUI 3RVUC 3BMWA 3FB6B 4U6XA 1F11B 1OHZA 2IBZX 3P4NB 4MYWB 4PQXA 3NGBC 3V6BR 5A2KH 4TQ8A 2YGNA 5DUBB 1HHKB 3JVGC 2X09A 4AENA 4FADA 3I6KA 4XOEA 3CK0H 2QZQA 3L8QA 1QFWM 5D93B 4KFMA 3FC8A 4U3SB 2FLBT 2MQGA 3CFBB 4IBQA 1Z9OA 5IHZB 3ARUA 3MOBH 1XGUA 1TZIA 1NCJA 1JWSB 3BXNB 3SKJH 3VI4E 4LP5A 1OF2A 5MERA 2B59B 4AX3A 4R5TA 2VE6A 3QUYD 4P46D 3IJ8A 3SCMB 1AS7A 3R19A 2C8NA 3IFOB 4AGMA 3O4LA 4MB3A 1SF3A 5MENE 5ISZB 3L3HA 2OSXA 1DBAL 4B27A 1DUZA 3NUKA 3ESOA 1KY7A 1Z9SB 2NX5A 1TSHA 4NYLA 4WU7B 3GXNA 2D3VA 2IDQA 3C2AL 4Z7VF 3SGDH 3QDGA 2BOBB 2B1AL 5CP3A 3D69B 5F7MC 3UX9B 5FHAH 4OV5B 3MUHL 2IGLA 5DRNA 3TFBA 5FGCB 2OJZH 2DM3A 2ZNWA 3MLVH 1D6VL 1XB3A 4WTXA 1ZANH 3QH3A 4KK6D 5JIPA 4R0LC 4AQ1C 1FHNA 3KPMB 1KN4L 5JXED 2K1MA 5EF0A 1T1ZB 5IW1A 3C8KB 3G5YA 4DPBX 3DMMA 4P2RA 1HDMB 1CDHA 1IGCH 3LB6C 4MMXC 4MXQD 1S9WA 4WO4C 3OR7A 4RAUA 1U8MA 3HLAB 3MNZA 4H44C 4JDZB 5FDWA 4FD0A 2IGTA 4QHUA 2VH5H 5K9OA 1GGIH 4JRXE 4QY8A 4WEBH 25C8L 3RGVD 5C3LD 1S9VA 2E75C 1FDLL 2AERT 5CM1A 2CNYA 1CXHA 1ZV5A 3CDGB 4UT7H 1QBLL 3NCCB 5C0CE 3TC9A 1T0NA 4LCVA 3PFQA 4L4TE 3RWIA 5M94B 2XWJA 5I1IH 4L5FL 1IGTA 2CD0A 1CE6A 4M1CC 5LXVA 5A2CA 4MHHG 3W81A 5LDSA 2EUWA 1T1WA 3B56A 2JKWA 4AQAA 4HOZA 1IX2A 2VQ1A 3K4AA 2J8UA 2X4TB 3QJHA 4XMKL 1A9BA 1HX0A 1UUSA 3GTNA 5L2KB 5CJXA 4GG8A 2UXGA 5DMKA 3PV6B 2ADFL 3AWGA 2R0LH 3ZKND 1I8IB 3CN1A 4O2CB 4HJEA 4F7PA 3MJ8B 4G42B 3EYUH 3QZWA 4XTRC 5E0QA 4O2FB 3H9SA 4XX1G 4XVSH 4H7VA 4MMZA 5IMKB 5K5YA 3VXQA 5I1JL 4QOKE 4X6CA 2FT7A 2L7QA 4H8PA 5CMAA 3G9VA 3GM8A 5CJBA 2EEDA 5I0XA 5AOZA 2YHGA 4Z3EA 1KYAA 4AGPA 2WWOA 2MPAH 1C12A 3IAQA 5DJDA 3GTTA 5IJKA 5JHDD 1ETA1 3HI6H 1WFIA 3QORA 4NP4L 3VGFA 5KG9A 3SBQA 1EHNA 2BSSB 3W56A 1M42A 1A6UH 3CDZB 1ZLSL 3ZZSA 5I0ZA 2EVGA 4JO1H 1DJHA 3EH2A 3F6LA 3KEDA 5EEUA 1IFHL 1S8DB 2PO6D 2NZ1A 3QUZC 3B9KC 3CPLA 1N3NB 3MBWA 2R15A 4F57L 1PVHA 4DPRA 1WAAE 4Z7QF 5EU4A 2AK1H 4ALAL 5LWYH 3WFCH 1V7MH 2JIXD 3X3GL 2R27A 2G2RA 3BH8B 3N5AA 4NN6B 4XZ4A 2L04A 4XBGB 3UTQB 5BS0E 5L6YL 4RGNE 4IMKC 2AEQL 1FLRL 3BP5B 3FCSB 3MC0A 4H26A 1OGAB 1LDSA 4UOJA 3TT1L 3V0VB 4F58L 3RFZB 4FCHA 3KE0A 4UF7C 4LASH 4X6BB 3RBGA 5I8OL 3UZEA 3QUXA 2ZCHL 4G11A 5F9JB 5EBMA 3TVMA 2VDKB 2YWZA 4WUUA 3DSNA 5F97E 2GTWB 3SDCD 1YRKA 2R4RH 1U4FA 5CUSH 3HBGA 1KFAL 32C2B 4NNXA 2CK0L 4HCIA 3MBXL 3UEQA 3CN2A 4WTWA 5HDQH 2W59A 3MUGA 4PBVC 5IT2H 4O5LL 2QVIA 4AH2B 4WI7A 1THAA 3NP3A 3NK4A 3GUFA 3QEGH 4TYUA 2BSEA 3C8DA 2BDNH 1E90A 4G8GD 4AWJC 3C6SA 2WWMC 4MQXD 1XSIA 1ZS8B 3ARQA 3EYVA 1SYSB 3QFJA 3ZYZA 5E2WL 4NHUA 3L6FB 1BZ7B 1WGVA 4CSPA 1HJBC 2V8LA 1PJ9A 3SJVB 4B9KC 5I26A 2XI9A 4ZNCD 4GT7A 2D03L 3OJDB 1YEGL 1ZT7A 5HVGB 3WXVH 4KJYB 2NY2D 3MGTB 4M4RA 4PGCB 2OJ1A 2R69H 4X6DF 1CGSH 2EIZA 4GSRA 3VE0B 3KMDA 5AYUH 4IRZA 5BJTB 4XNYH 4YXLH 5AW0B 4G7YH 2GFBA 4JR9H 3N44B 3ULSA 5B7FA 2I9LB 4LLVA 3S37X 3BPCA 1Z0MA 1A7RL 4GRLC 2C9SA 1KB9J 3MNVA 4A2EA 3H42L 3QEUB 3S5ZA 4XN4A 1TZAA 4OM0L 4KH2A 3SO3B 1FO0B 5C0EB 2IDFA 3UTPD 1ED3A 8FABB 3V0FA 5KYWA 5EORH 4GINA 3WLWC 1EMTL 2VB5A 1J5DA 3OKKB 1MCOH 4I18C 2XBZA 5FV2A 4IEFB 3NJGA 1DVQA 1N10A 1QFUH 4WI8A 1MJ7L 4Y88A 5JW5B 5ANMB 1OGSA 3IKCB 2NY0B 4IHOB 4S2SA 1IKOP 4K71C 3FRPA 3T3ME 1GZQB 3GKWH 4H1LG 1J5HA 5KSUA 4BFGA 3DBSA 2VISB 1VGKA 2XXFA 4KOCA 2HJKB 2X7LA 3AW5A 4EI5C 3VGAB 5C0BE 4IIQC 4UTAL 2YSSB 2BS71 2LLNA 3T3PF 4NKMA 4IJ3C 3G3LA 2MOQA 1BREA 2Y06L 1T5KA 1X5JA 2EDQA 3CCHA 3NK3A 3P30L 2DQHH 4RISH 4UNTA 1MQKL 4U7KA 3GMLA 3LRHA 1TEFA 3QI9C 4TLKA 2JB6B 5F7DB 2EVHA 1JFHA 2GTZA 2XZCH 1ID5I 1T5WB 2ZXGA 1S78C 5I16A 2DIEA 2NXZD 3FQNB 2ZAIA 5GIRB 5I74B 1XGRB 3VD4A 3VGEA 4PWJA 3QWOA 2R8SH 4IKKA 1ITCA 4XPTL 4DPAX 1KJ3L 4FLQA 1W72L 4L9LA 3WO3B 2E9BA 1I9IL 3QQ4B 2PCFA 4JFDA 1KLFA 1NC2A 3GSNA 3Q8AA 3GM0A 1SXNA 3QJQB 5J9PA 4HUWA 1KPVB 5DD1L 1CICD 4S0TD 1NJ9A 5B3JE 4G9DA 1I7UA 1XXDC 1BVLB 2N3JA 3LIZH 5FO9B 3WI9A 5ICUA 4XP6H 2X0UA 3MUUA 1TQCB 5HDBB 4JUSA 4UILH 4IRSB 1X5YA 3DETD 4QRTA 5DTFB 1U8IA 2WMPB 1BQHB 3CV5A 2Q76A 2EYSA 1IAIM 4K8RC 1A4KB 3SEPA 43C9A 5EU6A 4HBCL 3OXSA 3HE7C 4R4NC 4B0MB 1K9TA 2DW5A 2Q3AA 2C7UA 3HUJB 4DETA 4WHYG 4FI8A 4NO5A 1N6QH 5TE6L 2XBTA 3W37A 3BRFA 1EO5A 2ZOTA 4G2AA 1WV7T 3MV7E 4JPQA 5FKPB 4HXBH 3V0EA 1PY4A 4LSPL 4LP4A 3DVGB 4P59H 1QOKA 4C56B 2R1WA 2H6PA 2I60L 5JORB 1U8QB 3SZ6A 5LGJA 4X7CC 4M5SA 2J73A 4XCYA 1D9KB 2AJZB 2BFVL 2F58H 2VQTA 3DV4A 4F7TA 2MHAA 3HPJB 3NESA 4LOVA 4OCXL 2CDEB 2JJSA 1KZYA 5HHNB 2ZG1A 4OF0A 4YLQT 1OP3H 2ICWI 1ZA6B 5EO0B 3Q48A 3QQ3A 3ARED 4HOXA 3NFSH 2Y6SC 3BPOB 3LEVH 4KK9D 3NIGE 1HWGB 4KFZC 2MQ0A 3GBDA 1H3UA 3D1MC 2WIIB 5D2NA 4O9HL 3ULUL 4F3FB 5FCUL 4UM8B 3GO1H 1JOIA 3D18B 3LCYA 4ZW7A 4PMFA 1ZGLA 3TL5A 1VESA 3BMVA 1P9MA 4OZHB 4Z7WA 1DVZA 2XV3A 4XN8A 4EDWH 1G5AA 3V0HA 1QKZL 1FNSH 1J86A 1BSIA 4Q9BA 5EFIB 1TO4A 5E2UH 2VR4A 4FYSA 5E00B 5CCKH 3UP1A 3KJ4B 4H0GA 5L2JB 1MCWM 4CN1A 1NGPL 3D0LA 2G4GA 1VZGA 1AZBA 3D52A 3TEXA 3VMPA 4JG0H 4TUKH 1D5BB 4YHLH 3P2DA 2X87A 3RWHA 4P9HH 2EDRA 4ZODA 1RHHB 3G08B 4M48L 3P9MA 1PFOA 1M7DA 1YN6A 3D39E 4J3OC 1YN7A 3T2QA 5DGRA 2CBMA 4E42B 1BQLL 3L3IA 5JW3H 1ID2A 1U8LA 4TL5A 1L4IA 4U1JB 4XVJH 1GY2A 2YD7A 3QEHB 4JFFA 2R59A 4FTVE 2Q2EB 3L3DB 3OX8A 3NPZB 4MASA 1UM6L 4U2YA 1OGAD 4BFIB 3M8OH 2E6PA 3BKCH 1GGCL 4K7FA 1ONQA 5KVFE 1NAMH 5D1QD 1KLUA 4K94C 2CIKB 2R83A 1PEZA 5KSAA 1WS8A 1UASA 1QNZL 5I1GL 1KDIA 4M7ZC 4GW1B 5LGYA 1HCZA 2OPCA 4X6EB 4XNBA 4HWBH 2NUTA 1JV2A 4I1PA 4EJ1C 1OW0C 3PP3K 4YHIA 2GVYA 3CN4A 5C7XH 2CO7B 4NZUL 3KPSE 5C86A 4AW7A 2A6IB 1YQ2A 4HIHB 3V9EA 1BXVA 3VFGH 1A4AA 4Y1AA 3QW9A 2MEJB 4DFIA 4AG4H 3V0WL 1KSRA 3X14A 4EE2A 2BIIA 1AMXA 2WLHA 4TS6A 1FGNH 1Q94A 2R23B 5JQ6H 5AW6B 2UUDH 4ZS7H 3GUTB 1VGEL 2BHFA 2ZNXA 4OCLC 1DO6A 2R2CA 3DA0A 2CRYA 2UX6A 1VACB 2BSRB 3VXMA 1PG7H 1NIEA 2F9BT 3QZOA 1B0RA 1GZPA 3WHE1 1K8DB 1UVQB 2DQTL 2VRKA 4RVBA 5C0IB 4PB0L 1MI5A 4GI8A 3CXFA 1IMHC 3V7AE 5JHLA 5FYKL 4UAOB 5JIIA 1UZGA 4RQQB 4EDXA 4XN5A 1PYWB 3N9GL 1MPAH 5JIHA 1YEDB 3LNFA 4TF4A 1BM7A 1NCCL 1CF8H 1RJYB 1XXFC 2JJWA 5EF3A 3GF8A 3MRPB 2FHBA 4ZFOA 3G5ZA 4JO3L 5I6XB 1JDCA 2R9HD 1INEH 5SX5H 2A6DA 4JO4L 3TNNA 1CZ8H 5G55A 1AHMA 1KT2B 2NY5C 4WRLA 2QZ5A 5IVZB 3H9HA 5AAPA 4PI2A 3MRNA 5JQIB 3V6FB 3WAJA 3GMPA 4PRDB 4PY7A 5GPRA 1UWGH 4PRIB 1QHPA 3SDCC 4Z7VA 4CU7A 1I3RB 3UBHA 2DM7A 3GI9L 3QUKA 1VCAA 4LCWA 2H8PB 1U93A 4YSDA 3FTSA 5ICYA 1MVUA 3WHXB 3BSZH 3O0LA 4QO1A 2V17L 2V2TB 4UB0L 3WKMH 3V4LA 4MAYA 4BZYA 2GK0A 3WO4C 1DLHB 4JHWL 3AG1B 4F8PA 5D7JA 3RZWA 1B0WA 2YD9A 1CLZL 4JMNA 3P9LA 4GBXA 4MQXC 3VXSA 4NOBA 1KIRB 3KPRB 4WNJA 3U46B 2AJYL 2QQNH 4ANVA 2MIZA 3FUHA 4P3DA 5DQ9A 3GHEL 2L7UA 3Q2WA 3U0TB 1FZKA 3RX8A 2FLMA 3MX0B 3TH2T 5IQLA 4FQXD 1I7RB 1N5AB 2B1HL 2CNZA 4W1TA 1E8YA 4D8PA 5B38A 3POHA 4Y16A 4RFEB 1RZ8A 3LD8C 1SMAA 4OSUH 2V7HB 2F61A 5IF0B 1PEWA 1HH9A 1BVZA 3BRGC 1JFQL 2C3VA 4JHVA 1T20A 5EULV 4B60A 1LJMA 4AJWA 1G7HA 1XCQB 5D1XC 5FUZH 2VXUH 4X9HA 3DUUA 1V10A 3FF8A 3WNIA 5ECGA 2IPTH 5C07B 4YSCA 3NRPA 5ID1B 4Q9QL 4P5KA 5D96C 3IJEB 3PWLB 1IT9H 3E9TA 3U9WA 4M9OA 2OMUA 1RK0B 1O0VA 1O9VA 1P4IH 3LQAC 2PLTA 4NRYB 3MJ7A 5I8EB 4XNXL 5D93C 1A2YB 2QVTA 3O3EA 1FGVH 1U3ZA 1JXKA 3QUMA 4JRFA 2YRBA 3S97C 1MCQA 4ONFH 5EV7A 3C9NB 2R2HA 3HHRB 4ES8A 2XY2A 2FSEA 1SBSH 1KWGA 3SBWC 1GGUA 3FT3A 2VNCA 3AROA 4D94A 4UM9A 3MBED 3UGXA 1S7SA 5JYMA 2N4IA 4K9EH 1B90A 3SCMC 3E3QC 1PLGH 2ZQKA 2DAVA 3N43B 3NIFB 1WC7B 3DO4A 2ZXEB 4BZ2H 4LDEB 4M1GL 2APWA 5AOLA 4G8EA 1LWJA 5IUSA 1N2RB 1L0XA 3WNNA 4AEEA 3IJ9A 4GSXA 5DJCB 3FB5A 1UCTA 3HG1D 1PF3A 3KR3L 3JWDL 1J0YA 2YK1L 4HS6A 3QZLA 3AY4A 3M1OA 1WZKA 5LN4A 3DTXA 4XMXA 4XZUB 4FS0A 3QK0A 3VRLE 1IU1A 2JVUA 2W8CA 1KPRB 4KJQC 3ETBF 2DQFB 4ANUA 4NI6A 1QRKA 2AJVH 1NEPA 1ND0B 3QA3B 2WXFA 5CJ5A 3REVB 4WI2A 1EANA 4B6ZA 3BGFB 2IH1A 4WHTA 1MCCA 2ICEB 4HKXA 3S96A 2DQIH 2ICWJ 3CFDA 3MREB 2F7PA 1LNUB 3BD4A 1HL4A 5IHUL 2ERJB 1IEAB 2OSLB 4J3OG 5DJAA 3T77A 3NCEB 2PW1A 1PS3A 1FAIH 4B9FA 3S4SB 1AVAA 1ZGLM 4HG4K 2WLKA 5IFJA 1M7IA 3PNWA 4QYOA 2HRGA 3C6LD 4UAHA 5F9OH 3QQXA 2VC2H 3FQXA 5BRZE 2CPUA 3WMPA 4D9LL 3L4ZA 3GSOA 4WFED 5TFSH 5EO1B 1RI8A 5JUEL 3NABH 4HGWA 4FKHA 5B8CB 1LO5B 5BVPH 4M7LL 3FFCA 3VH8A 5I1LB 4V1DD 4PJHE 1DE4B 4XC1L 2W81C 3HA0A 2MTAA 4EBQH 1HIML 4ODUA 3TO4A 4GRMB 4ZFZB 1DANT 3VI3F 1HZHL 1RK7A 3BFQG 2QGBA 4JDEB 2C1OA 4W6WB 5CD5D 5HYSA 3APNA 1KBPA 2FNBA 3RVXD 2F1AA 2IH3A 4KKAD 1RZJL 2JCCF 5G5DA 1X44A 5LG6A 1B88A 2APFA 5ACLA 3DDFA 1CXFA 1IKNC 2XNAA 3J07A 4JDTL 4YGVA 2CGRH 1YYMH 1FYTD 2V4LA 4PAZA 3IFLL 1HHGB 3SKOB 1I8KA 3QJFA 2ZSVA 3VQ2C 1UXSB 1QVOB 1CUOA 3HS9A 5AVZB 4ENZA 2ZOOA 1LE5A 3RVTC 2CDGA 3TBSB 1UQSA 4HUUA 1LM8V 3FQWB 1RUKL 1UB6B 4HIJA 1A7PL 2HH0L 4U3XA 5J3HC 4A7GF 5IWLA 1M1XB 5IROD 3OG6B 3I2CH 4M7KH 5ID0B 1QW9A 4TULH 4L8SB 1AXSA 2EIBA 3TIEB 3UGUA 5EB9A 4WLCA 5EH1A 4NQTA 5INDB 1RL1A 3B43A 1HINH 5E2JA 4FA7B 5ECJE 3TJHD 4NN6C 3DXAB 4EIZC 1NCBH 4LGPB 4N2IA 4IRJD 4K3DH 3LNIA 4M9PA 4QRUA 1ACCA 3RFZC 4GXUM 5KEZA 3HN3A 4OU3A 4AYID 5GRVL 1IGIH 3VW3H 3BWAA 1AO7A 3QEQE 1IRAY 5DJXA 4DN3H 3TIDB 5JLZB 3R7RA 4WNQB 2JMRA 3P1VA 1IBFA 5E9NA 4KK5D 4HSQA 5JR1L 1GTNA 2VZSA 2F5BH 4JS7A 2OL3A 4MWFB 3QCVH 2EDLA 2IBBA 1HYSD 1MCBA 1DUYA 1E8WA 2WOYA 3OKMB 4AMKL 4Q56A 4BH8A 1MF2H 5DLLA 3MA7B 5IOPB 1AOHA 4K3JH 4N9GA 4M43L 2KC0A 1B4JH 2H1PL 5DK0A 4MNQA 2FHCA 1KZQA 3EFDH 4GS7B 3OKOA 4NQED 3ARTA 3GBML 2AABH 3CHXA 3ULVL 2LU7A 1PZ5A 3GJFH 1A9VA 3DRQA 5DK3A 1WBXA 4JFQA 4PY8I 4DJMA 2WZAA 3L4VA 3VXUA 1I7TB 4HWNA 3WN5B 1J48A 1FFNB 1UFUA 5F70A 4GLRH 4DVBB 2OSYA 1SLVA 3SQBA 4IMLB 3PGDB 3JWOC 1JDDA 1UWEH 5EA0H 4F24A 1R0AL 3L2NA 1A6WL 5DD6A 2XQBH 2GCYA 4PJ8A 3U7YH 5GZOA 2Q10A 1CBJA 4OY9A 4M3KB 4P05A 3OHMB 3O8XA 4GP5B 5KBPA 3LQMA 1UACL 3QG7L 1ZLWK 3C08L 1E6JH 2ATKB 2HJLB 4H8WC 1CI5A 3WTYA 3AQXA 4WCYL 4R4FH 3SO3C 4FZ8L 5C6TH 1VFAB 3U7WH 3ROLB 2Z6FA 4ZQKB 1SFDA 2HG5B 2A2QT 3CLEL 4KMLB 5A16A 4L8CB 1HSBA 4BSVA 2HUHA 4W9DC 3WELA 1R5IA 3JTTA 3C5ZB 3IPEA 2AFNA 3OKYA 2Q7NA 3VTTA 2NY0C 2OP4L 2ITFA 2BW4A 2FWOA 1T21B 3E8UL 2LLLA 3C5JA 1LTXA 2BNRA 4JPKH 3US9A 1ADQA 5HHOD 3VGAC 3BDYH 3Q5OA 4XVUC 3GMOB 2GBUA 2H5UA 4NSKB 3U36A 4Y4HA 4WTZG 3CD4A 2M1KA 1SOSA 5JMOC 1ACXA 4JFEB 4KROB 4CMMA 4Z3GA 3QCTH 4KHXL 4OCYL 5ICXB 3X3FL 3D05A 1RUAH 3I6GA 4Y19A 3DOSA 4N28A 3WXWL 4YL9A 4DKFH 5EZIH 3BZFA 4A7VA 1N5YH 3F6JA 5I5MA 1OARH 3RY4A 4FXGB 1G7QA 1FCCA 2HFFB 15C8H 1WZLA 2F53A 1FG2B 5SWSD 5I74C 1Z3GL 5K59F 5CIPB 1BEYH 4XBEL 3VFPB 3QHFL 4AZUA 4GIOA 5LO7A 5T1MA 2ZWNA 5BV7L 3VTMA 2GSIA 2A9AA 4RCAA 3LVTA 3MLUL 4Z7IA 1J1PH 1CGXA 4A2FA 4DGVH 4H20H 2IAND 3SDDA 1RZGB 5C2BL 3GT6A 3V6OC 3BP7B 2X1WL 3E80A 3PY9A 4Y2DB 1EDYA 4J4PC 3BP6B 3BYTA 2X2YA 3GMMA 1TQCC 4NAQA 4PVNA 3VD5A 4IRSC 1E5UI 3QULA 2P49B 2CXGA 4PJCF 1H3TA 1QAWA 1JWUB 1IFRA 2CALA 1MCLA 3NCXA 3GSRA 2E46A 1BQ5A 5AOIA 5I1KL 5CGTA 2W38A 3K4DA 3FL7A 2I85A 2OM5A 4KNQA 1EHXA 4KZEH 3IFPB 1EERB 4HIEA 1Z3RA 1CFVL 4J6RH 5EC2B 2WLIA 1G9NL 3DVNA 1FV1A 4OFYD 5FO2A 4LVNB 4M62L 2FJFA 5TDOB 4FFYL 2MCG1 4XXWA 1EAPA 3MYJB 4OQTA 2OXGB 1D9KC 3N50A 1SY6L 3D5OF 3BVWA 3PUUA 4FXKA 4XP4H 5BPPA 3HMWH 2QHRH 3HJ0A 3QO0A 4HWUA 4OLVH 4NGHH 1S7RA 3CVHA 3RURA 4F27A 3DVFA 1BOGB 2B0SL 3AT8A 4KO6A 5DHYB 1Y6KR 3I9PA 3RWDB 2F7RA 2ETWA 1T0MA 4P5MB 2FYYA 2QDWA 3BPOC 5CD3B 1UB5A 4PCYA 3ZYIA 4PBWD 3DJTA 2X4NA 4QRAA 2B2XH 3L7EB 3ZDXE 3O3DA 5JA8B 1QR1A 2ENQA 4N25A 2NMSA 1OB1A 4TQEL 2Z4QA 1X9LA 3LOWA 5JHMA 1IJ9A 2WXIA 4ISVA 2VTFA 3IFNL 3T0BA 4RMBA 3BI9X 4PRHB 3U9PH 3KJ4C 1KCBA 3T4AB 3KL5A 5DVNA 5L4JA 1ZIBA 4N0FA 4TSBL 5EF2A 3EJRA 2ZAHA 1WAEA 3Q06A 1HTYA 3AC0A 2AAVA 1R5VB 2DJSA 2Y5TB 2GHZA 1SJHA 4N2KA 3V9CA 1T6BX 4MNGA 3T8XA 3VXRE 2AQRA 5DK2A 4YDLB 1S46A 1R24A 3QXTA 1MY7A 4XOAA 5E8NB 5T1JA 1T5XA 5PAZA 4XVTL 1UH4A 4HKJA 2N56A 4XNQA 2Y23A 3WDIA 3JUZA 1RY7B 4BZ1A 3QJZA 5EU7C 4Y1SA 5T3ZH 2V2WB 4DO5A 4U0QB 2P1YA 4J3OF 4KNTA 5INCA 4E36A 3K91A 3ZVVA 1OSPL 1KJMA 3IDNA 2OX5B 4ADIA 5I1CL 4GKOA 1Q0XH 4DTGL 4RIRA 2NY5H 4WHDA 4Y9GA 5IKCA 1YNLH 3NJNA 4HHWA 2Z31A 3FT2B 1MRFH 4TNVK 2ESVD 2X4UB 1LDPH 4N86A 5DEGA 4J7RA 3HLKA 1JZIA 3QNYA 5F44A 2QMKA 2NW2A 3AITA 4QUOA 5AG9A 1UD8A 1RULH 4JQVA 4EO5A 3X17A 3APCA 2EDBA 2NY3B 4UCFA 1SMOA 1U6AL 1XB6A 1ZT4B 2YAHA 4OLYL 5DVOA 1LXMA 3KPPB 1RQ5A 3D9AL 1U3HD 1N59B 4KVNH 3TV3H 2J20A 3CH8A 5K39B 4B50A 3QUHA 5I9QB 5CHNB 2X4PA 5DHVH 2BNQA 4PG2A 3B8YA 1TEGA 1TJGL 2MFNA 4LLYA 3EOAA 4NRXB 1RUPH 3ARZA 3GWJA 4PJ5D 3UYPA 3JT2A 4LFHG 2LAGB 2CJUH 2P5EE 2ZX6A 1SEBB 1GZHC 1SHSA 3QARA 4UAOC 4KVCL 4PSPA 5CEYA 5DO2C 2EDXA 3KYOB 3CMOL 1I9RH 1OTSD 3BIBX 1ROCA 1VFBB 3JVGA 2UZIH 2V0AA 2PYED 3FJTA 2ID5A 1PY0A 4FP8L 1ZHKA 5I6XC 1RU9H 4PY8J 4XPHH 1UA6H 3VFUB 3VFNB 5EOCL 3V5DA 1MFBH 1HNFA 2GPZA 3BUDA 3NN8A 5IBTL 2BNUA 2V37A 4P2QA 3VB9A 4HBQA 3VFTB 4ALAC 3TH4T 1NFIB 3C5ZD 5A2AA 3VA2C 2YUXA 2ZOWA 4PTTB 4KK5C 5D7IB 3ZE0F 4H1LA 3NFPA 4QF1B 3BX7C 2GJZA 3S35X 3V55A 3UZQB 2GSGA 1OZUA 4WNSA 1XL6A 4HWEH 5DR5H 5KJ4A 1EFXA 3UTZB 3D6GA 1P69B 2IAAC 4Y89A 6FABH 2NY6D 3BLKA 2XX1A 2P24A 1MRDH 3KH4A 4IOSD 5KBKA 1CGUA 3TEYA 5D9SB 3AB0B 2YFOA 4XMPH 3VWKD 3DX7B 1FL6A 3S6CA 4DN4L 4ZMWA 1SYVA 1A4BA 4E9WA 1NCUA 2YQ2A 5JPNA 4Z0BH 1MJJA 1CXLA 5F7YC 3NZ8A 2Z3FA 4M03A 1JI1A 4OCRL 4ZT1A 2V3FA 5AQ0A 5F89B 3W82A 4GKNA 1L7IL 3EYQD 2QHLA 4MDJB 4AQ1A 1F90H 4M93B 1W0VB 2X1XR 3Q2VA 4X5RA 3S3JA 4UV7H 1ZHNA 1XH2A 3IDIA 1D5XB 4MJJA 5T1DL 3DX9A 2HX7A 1LWHA 5CWSB 1J1XL 3AABA 3JWNH 4AT6B 4MMXA 2VO5A 3ZR6A 4KOBA 1NIDA 3S0PA 3FPYA 3NJKA 2B5IB 1FPTH 1O75A 2EINB 1HILB 5DQJB 2EE0A 4NP9A 5GS1B 5I6LA 1BQHG 3U9UB 2NSQA 3CFJA 4QCIA 5H8DA 1P5UB 4LHQB 5E4OA 5AW8B 2XVBA 1VEOA 3EJJX 3HC4L 3OXRB 2R29L 1QRNB 2OI9B 2BY1A 1EGJH 4PBDA 5MHSE 1IC4L 2MKLC 4MBRA 1AE6H 4A37A 3CN3A 4IU2B 4NEHB 2A6JA 4IK7A 1N26A 4HZ1A 1NBQA 4F9PC 2K6ZA 2ICWB 3T8VA 1TTFA 4RAVB 3VI3A 2BW5A 2L8AA 4I7ZC 1GIGH 5TGBB 4WI9A 3VU2A 5IFHL 1AP2B 1OPGL 1X9UA 5DDHA 4HKZA 5EIIB 1OSEA 4HCRA 4KXDA 3PQYE 1TTCA 1WZ1H 4H0LC 3LQZB 4JJ5A 4HJSA 2YS4A 4POYA 5CLYA 1GKEA 1XGPB 43CAB 4O51B 3D3VB 4PP1D 1KEGH 3LKOB 3O41A 2VKWA 5FIEA 4A7GA 3S8WA 4NNYA 5H2BA 3GI8L 2RFXA 3C5SB 5F72S 3WIHH 3GZOA 3BP4A 1DJSA 3IMBA 1BZ9A 4HWZB 4O02A 3QXDB 5D6CB 4XP5H 2Z92B 2W0KA 4XGZB 4M5ZL 5C08A 2EABA 3L4CA 4BK5A 1BX2A 2EVJA 5CSZA 3AM8C 5T5NG 5KUKA 2AEPL 3MUY1 1KBGH 2BVOB 3BGFC 3QUZA 3B9KA 2FEDC 5D5ME 3TWYA 2ICEC 3B1UA 4XODA 1I8MA 4JHAL 3K2MC 3Q6FA 1J8HA 4L29A 5BV7B 2AJ3B 4YBLB 1OM3L 5HPMB 1T66C 2X1QA 1NBVH 3I75B 2F5AH 2FH6A 1FRGL 3ARRA 2ERJC 5TF1L 2BRRL 3P11L 4JPVL 3HNTL 1SJVA 4CUCA 1C8PA 4OQ1A 3NTCL 3VXPA 4GIAA 4U2ZA 3DGGB 3ZL4L 4IMKA 2DLFH 1SFHA 1KN2L 3U6RB 1R4XA 2Y69B 2HFEA 1YEWA 1T89C 3JZYA 4WF7A 1KG0A 2WANA 3EF4A 3ORJA 4OVVA 1HC1A 4PD4J 2DM2A 3AJ7A 3TV8A 5B8CC 2OULB 5IG7A 2W9EL 1NGYB 2W65B 1NC4D 2BOLA 3CUPB 3GMRB 2FSDA 2JLPA 4JFOB 4JRLA 1MW2A 4I9WE 5DRZB 2KS0A 4LVEA 3UH8A 2VLJE 1RVFH 1FZOA 4KI5D 3MRFB 4DK5A 3QRGL 3IS0X 3O45A 3IF1A 4PB9L 3T1FA 1CE1L 3VWJB 1DBJH 1E3ZA 1MAML 3ML9A 4KPHL 2UWEE 2DQDL 3HG4A 4G9FE 4GXFA 4DNLA 3UC2A 5ACZA 4YOKA 4PJFE 1TETL 3NCYS 2VDKH 3LKNB 3RHWK 3DK0A 4XMLH 5HI4D 4PJ9A 3FTYA 1C08B 1K5NB 3WD5H 5TQ2H 3IMWA 4LRNH 5I18L 4FG2A 2XXCB 4JPWH 5F3BB 5GSRA 4M1DH 4QRRA 1CJYA 1PKQE 5CZVH 5LCVH 3ULUC 3EXLA 3OAUL 3RAJL 5H37H 1KNOB 4OGXH 1NM4A 5HYJA 4Q58C 3SGDI 4L8SC 5BVJB 1JK8A 3MV8E 1GYCA 3VXTB 3FHQA 3PWNB 4POZD 3QT2A 3RDJA 1J12A 2XX0A 3BW9A 1GGBH 4FQJH 2EJ1A 1YEFH 3ZT7A 2TRYA 2BZCA 3T0EE 4LPVA 1KB3A 3VI4B 4X9YA 2A1WH 3JWOH 2BP8A 2DQGH 2MSPA 3OB0H 4TRPL 3FUFA 4XHQA 1DANU 1Z32X 2NLJB 1U2HA 1N9PA 2ZUUA 4ABWA 4MZRA 4XVOA 4HEMA 4YN3A 4C4KO 1K8IB 1LEGA 4IDJL 5CCGE 1EPFA 5MENB 3EJZD 4H8WH 4A6YA 4EI5A 3EXJA 3M17B 4IIQA 4EUPB 4KTDL 4ODWA 4YNYA 3D25B 5DFTA 4OM1H 2YUZA 1A3QA 1TDQA 1G84A 1CWVA 5E1GA 3B7UX 2A9NL 5DZVA 3VXNA 1ZIAA 2WUCH 4Q6IB 4WFHD 5E4IA 1EZUA 4MA7H 1S7QB 3QI9A 3D2UD 3A5VA 4GS7C 1W9XA 2JKLA 4AY0A 3RVVD 3HBQA 5EZJB 1CT8B 5K9JH 1UKQA 1DL7H 4FQ1L 3T0WA 2HTKD 1S9YA 5B21A 4WUKL 2GIYA 4JFYA 3BLBA 1QSVA 4YZFE 3WN5C 5KAQG 1XR9A 3L5XH 3UJIH 1U33A 2IWFA 3MQIA 4LRIC 5HHXL 4JRXB 1JZ8A 5G4NA 1JHLH 2FQEA 4HJ1A 2MMXA 4PJCA 1DBKH 4YHZH 4X80H 5IMOA 1QLRA 4N2OA 3QYMA 3QQDA 1AYOA 3HZMA 5F6HJ 2EE6A 5C0CB 3BZ5A 3P73A 3RZCB 4I3RL 2WYZA 1JZJA 4L4TB 2AQTA 3TT3L 5H94B 4YVUA 2BHUA 3K7UA 1U21A 2IQ9H 4KHTH 2GITB 3CIQA 1WBZB 2FIRT 4QHMB 5J12B 4QRPE 3VRIB 4WU5B 3HMXH 1KCKA 2VLLA 3N44F 1NUDA 3QDJE 4TL4A 3PGFL 1YECL 1XWVA 1NKGA 2WINB 3RNKA 4NFCA 2H3XC 4HIQA 1J88A 2WNXA 2OZNA 1I3GH 3CFEA 3Q1SL 4XBPA 4K7PX 2J7LA 3FSZA 1XEDA 1HS6A 1CFSB 3ZKMC 5IHWA 1EHLH 4JG1L 3KPNA 5E6ID 4IGBB 5JXAL 4U1SA 1AGBA 2QT6A 4P46A 3GHBL 4LSRH 3B8SA 3CC5A 4FZEH 4PRPD 4QOKB 1NUNB 1TVBA 4GUQA 1UD6A 4QHPA 3IDJA 4KROC 2XWTA 1E5ZA 3OZ9L 1RIVH 4W6YB 3EO1B 2G5BB 1UWYA 3H3KA 3QIBB 4MB1A 2HLAA 2AV1B 1MWOA 2BP0A 3BEVA 4AIEA 4FNSA 4FXGC 4QRBA 4NLHA 3O2DA 5FM5O 1AQDA 1ORQA 2QFPA 1FNLA 2CLZB 4TMPA 3BE1L 2JQAA 5SWQA 3DYMA 1K2DA 5D7HA 4JY4B 5B4MD 4FQ2L 1B2YA 1S5IH 1LP9E 1JGDA 1MCHA 4KZDH 3X13B 1NGWB 2X28A 5KJRL 4KWUA 2VDPL 2P52A 4LBAA 1X5FA 3FQTB 4HS8L 2KLSA 4GOSA 4RX4D 3WN6A 3S88H 2B15A 1X4YA 3N1GC 4UIKL 2G9HA 4Y2DC 3RGVA 2E9WA 4KUZH 5BS0B 4RGNB 4G1EB 2PWHA 5DJ2A 4HALA 3UPCA 1NCOA 5H35A 3DX0A 1QUNB 5FGRA 1DBAH 1S7UA 2DWYA 2H3NA 3GSWA 1B2WL 4OZFB 3S4SG 5JHBA 3C2AH 3WKYA 5KSBE 2K8MA 4N8VB 1UXMA 5GGRA 3QS2A 1EJOL 4Y2OA 2H6OA 4YAQB 2XVKA 3K6NA 5HDBF 1HHJB 4LVNC 4QNPE 1EWHA 4ZJ9A 1E7VA 1NGZB 5JDSA 3F7VB 1KN4H 1T2JA 2E0PA 4NQDD 1O6SB 2CM5A 3CHQA 4QHKI 1VFMA 2FJHA 3NMEA 4GW4B 4P48A 5LBSA 2HRPL 3V4VL 3B9VA 5KBNC 3CHRA 3SYAA 3HUJF 4TNVF 2COVD 2GI0A 1K6QH 2WXRA 5FYJU 1BJ8A 1ZLVH 1NFAA 3KPLB 1LLAA 4HA1A 4LL1A 2YWYA 25C8H 3MRJA 4ZTOL 4LLMB 2VAAB 1UWFA 1FDLH 1XGYL 2F74A 5KS9E 2F2HA 4L18A 1JG9A 2ITEA 3VWJD 2IWGA 2HLFC 4BKTC 4MJIA 3PWJB 1JCVA 3D0VA 3FB8B 4P2RE 2FL5A 4L5FH 12E8H 3FTUA 3EJTA 5JHDA 2UY7B 3QPXL 4KUCD 4HX1B 3STZA 3MXWL 4FNLL 4J28A 2VXTL 1NKRA 2PO6A 1SMDA 3RDTD 2UXVA 2EEFA 3L95B 3DX6A 4OD2B 5C0DA 4XMKH 4ZOBA 4HLZG 2HPTA 1KXTB 5C70A 3JWDC 3T2NL 3WFHA 5E8OA 1GYVA 1RXLA 1HEZA 2ADFH 1T1YA 3T4AC 2V7NA 2BP3A 1WD8A 3U0PA 1FVDB 2JIXA 3MPCA 4K7PY 4OZHF 4URKA 1E2ZA 3ECUA 4IS6B 4M8RA 3T3MB 3NA9L 4I9XA 4TNGA 5FUCE 4Y9EA 3DPDA 4ZUTB 1YHPA 2J8UE 2QVMA 4KTEH 1UZ8B 3ESMA 3T9WA 4KZ0A 4LCCB 3WY1A 4YDLC 3ATEA 4DGWC 5C0BB 2QADB 3O6KL 1KGCD 4I87A 5T5NF 4F9LA 5CP7A 1JMXA 4HMDA 4XAWL 1TTUA 2GTQA 4UT6L 3S5LB 1GAFL 2HB0A 3FT4B 3L7FB 1MWAL 1E4XL 3D85B 1F6AB 2NW3B 5GZND 2OYPA 3SDCA 2HMID 2GJ6D 2C9RA 1BF5A 3PGCB 2DYPB 3WEOA 1DN0A 1ZT1B 1ZWIA 4GNKB 1M05A 2QV2A 1XGZA 1CL7L 4W81A 4KI5C 3ARBB 4J8RB 4XXDA 1XSJA 4X6CE 1IFHH 1IBGL 4LSQH 4XR8C 4F7EA 2EO7A 2D7MA 3EJQA 5T3XL 1A25A 3QP3A 2CZNA 4AV0A 3K6SB 4I3GA 2VDQH 2E3VA 4G7RB 1AJ7L 1KB5A 2HWZL 2QPDB 2X2UA 3I3BA 4HOWA 4FFWD 5T5FA 3QWQB 4JLRA 1DSYA 5FO8B 2GUOA 4IKJA 1YSOA 2NY3C 3ME0B 5AYQA 4F91B 5L6YH 4NM4H 4B5EA 3TM6A 1CDJA 3JV0A 4APXA 2J6EA 3NJHA 5GS3A 4UUJB 4OGZA 3MOQA 5HHMD 4MA3B 1GS6X 4UDUA 1KLGB 2EDYA 2GIXA 1RZJC 4LE8A 3QWRD 2ZCHH 5E6UB 5I9QC 1BD2D 4LF3B 1DHKA 4S1SH 3OR6A 5LN8A 1KJ2H 1BAFL 4HT1L 1K85A 4ZAKD 2IPKA 3EHBB 3LZFH 3AUWB 5D1XA 5SWZE 3EOBA 3RZCD 2GC4C 3FB6A 3LPPA 1F11A 3P4NA 4O5LH 5DUBA 1HHKA 3MV7B 4WEMB 2DTML 3W0WE 5GJTH 5L8KB 4YE4L 1EK3A 4NRZA 2BCKB 3T04D 5DU7A 3V5HB 2YMXL 4WUUE 2RR3A 1EJ8A 5E2WH 3F12A 1MIML 2BIMA 1IKFL 4RLDA 3GSUB 1NFDE 4MD0B 3CFBA 2AQ3A 4U3SA 4WI3A 4MQTB 4L3ED 4PTUB 5IHZA 2RALA 2WLLB 5DVLA 2AANA 2D03H 3W57A 1YEGH 1JWSA 3BXNA 3SBWA 5B1JA 2AQPA 3HIZA 2BVQB 4IGBD 2B59A 2BM3A 4MQ7B 4HD9A 4DGUA 3HC0A 1HVXA 2DI8A 4MJ4A 1L6XA 3NIGB 3HNVL 2X6VA 3QFJE 3IFOA 5HJ3A 5KOVC 3SDXE 5IJDC 1T7VA 2LW3A 2EDFA 2I5YL 2AXGB 3H42H 4PV9B 4WTZA 1Z9SA 3UJTL 3AB0C 1MUJB 3QDHA 2DMCA 2EH8H 2BOBA 2HTKC 1YA5A 2KZBA 3D69A 1RJLA 4OV5A 1MHPL 5DLML 4EPSA 4AITA 4AYSA 5CILL 5DHXB 3SPCA 2P80D 4ENED 3B2PA 5DZAA 1XD1A 2WQUA 4U4IA 1CFTB 2EYRB 4YHPB 3VUAA 1MJ7H 1AIFB 4QTFA 2BP5M 4NUJB 2L0DA 3V4UH 5LQBH 3KPMA 3R1GL 4M93C 4HPYH 3S7GA 4QGTA 3X11B 1QPKA 2H47C 3G6JE 1Z9MA 5DC0A 4BSJA 2BWQA 3ULVC 4W70A 3HZVB 4ZFQA 2X41A 1HDMA 3VVWA 2EYTB 2F1EA 3B7TA 2C9VA 3BUQA 1PZDA 3MLZH 3QJVB 3D39B 3OJVC 4JDZA 2MQCA 5DRWB 4Y4KB 2B5IC 4PP2B 2Q3ZA 2XN0A 5GS1C 2QPSA 2Y06H 5KAQF 3AG3B 4FTVB 2YEZB 1R47A 1P5UC 3CDGA 5JPMA 1MQKH 2JI1A 5E9DD 5E4AA 4JM2D 2OI9C 2ISDA 5F21B 2ZWZA 2K3HA 3MOBL 3M86A 4XHJD 1G1KA 2H32B 3FQYA 3SKJL 3PUCA 1W72H 2X4TA 5IVXA 1XL4A 3TA3B 1I9IH 2WP3T 4JREB 3KPSB 2RBLA 1KV3A 5L2KA 3I50H 5D6DC 3ARDB 3PV6A 4JZNB 4J27A 5DD1H 1E27B 1I8IA 2YIHA 3IS1X 1ZRUA 4YDVB 4MFHA 1GTFA 1SVBA 1WD9A 2CIIB 3MJ8A 1YEEH 4G42A 3VQMA 1MFAH 2YZ1A 3ZTNL 4O2FA 2DLIA 4N20A 1HJCA 5GGSB 4OW6A 3PS6A 3WY3A 1A9EA 3RHWF 4PJGA 1H0DB 2OJZL 4HSCX 1OD9A 5T3ZE 3T5WA 3O9WB 3MV01 5FKAB 1CFQB 3MDJA 2A83B 5F7UA 1IKNA 3N43F 1EBAA 3NIFF 3QIWB 2RACA 5A3ID 1DQJA 5EDXA 4JGNA 1H6FA 1IGCL 3Q8EA 5GRVK 3RA7H 3I02B 2ARJQ 2I24N 3F7KA 4B9GA 3CDZA 4LSPH 1Z9LA 2IPUK 5D70L 3PIQA 4LAQL 1J0JA 1MZZA 2VH5L 1MH5B 4G6KL 4WEBL 4ZO6A 1P7KB 3O11B 1A6PA 5EU6E 4FFZL 2BFVH 3L3GB 3WKQA 1N3NA 3JV5A 3DIDA 1ZSDB 3QISA 1HQRB 4OCXH 5AW2B 5BV7C 4YBLC 3HE6D 1PLBA 2VXQA 3O4LD 5L8JB 1H3VA 2Y2YA 2VDPB 1TVDA 1ZK9A 2NX5D 5I1IL 1T4KB 3BH8A 4R3SB 2HFTA 4XBGA 2E4TA 2IFFL 5HI3D 5BO1L 3UTQA 4OI7A 4R4BB 2IGFL 1RK1B 3V0VA 2I9TA 1OGAA 3KYNA 2CRZA 5C0FB 3UG5A 2QADD 3CZKA 4WW2B 5LGKA 2P46B 1EV2E 2FCBA 4X6BA 5FCUH 3KPQB 2YD5A 1IL1B 5F9JA 4MCYB 4HJGB 1YYCA 2R0LL 3D85D 3S8FB 2GTWA 1QKZH 1V7NH 1KGUA 1BJ1H 3AZUA 4LSTH 3DYOA 1G4RA 5E8EA 5ENWA 5DC2A 2VDLH 1G9NC 4QTHB 3BQUB 1AZVA 2JV6A 1EJ6A 2A9DA 5D2NE 5DHMC 4AH2A 1OZTG 1NGPH 3VWJC 4WWNA 4UYQA 4BK8A 5AW4B 3V4VB 2YPVL 2X2HA 2C9XA 1PKOA 1SYSA 2V3EA 4NT6A 4R83A 3L6FA 4ZUUB 1NLBH 1MKFA 4MJ2A 3S35H 4NKOB 2F8VA 2OMTB 3CZSA 4GAYB 4YH6A 1URZA 5EBLA 4ANXA 4APQC 1A6UL 3MGTA 3PNRB 4KJYA 1JPEA 4UT9H 2ZE0A 1UM6H 4KKRA 3VE0A 5FS5A 3Q9PA 3QDMD 1GGCH 3L08A 5I1GH 1QNZH 2ZOKB 4I5BB 2DM4A 2AK1L 5LWYL 3QEUA 3WUZA 3EGDA 1DJGA 2X6MA 3WFCL 1F45A 1LGVA 4XWOC 1P53A 5GRWA 4JQIA 1FO0A 4KMTH 2FIKB 4NZUH 3MRGB 3U2JA 3H55A 3OKKA 5A40E 2QSVA 2FEJA 4IEFA 2YO3A 1QABA 3ULUF 2A6KB 3IDUA 2VJXA 4UDTB 3VX0A 4C8XA 4W9HC 4LASL 3JWNE 1EEZB 5ANMA 1KXHA 1P7QB 5GRUL 5ITBL 4JB9H 3K74B 3B3BA 2BHYA 3RU8L 3IKCA 4DZ8B 5EOTA 4IHOA 5GSVB 1G87A 1GZQA 1ZGLP 2A74B 2ITDB 4FI6A 4N0YL 4QWWD 5FF6B 5K69A 4NCC2 4Q97A 2VISA 2HJKA 2R4RL 3O2WL 5CUSL 1DN2A 1G7LB 2OKMA 2DN7A 2JF1A 1IAOA 1W0YT 4YO0A 1MCKA 3ZKXB 5MEQB 2YSSA 2WQXA 3GPEA 5IT2L 2MCAA 5E95B 2DQTH 1P5VA 2Y9RT 3BGAA 4FX5A 2QLYA 4X4XA 3I9GH 2J3SA 1MNUL 5D1ZI 1MWAB 5JOFB 1IJNA 3P77B 1TEYA 3KH3A 4Q6IC 3BGMB 2JB6A 5F7DA 3MUZ1 4K2UL 1I4FB 2VL5B 3PWUA 1XH3A 2IO5A 2N0MA 4Q9RL 2N59A 4FQXA 5T33L 4JO3H 3FQNA 4JRYD 5GIRA 3FCTB 4JO4H 3UBXI 3WFEL 4WI0B 5CNHA 1MCFA 2R69L 3AAZA 2LOEA 4XNYL 4EQ3A 3P3YA 4YXLL 2XCMC 2Y72A 3QQ4A 4G7YL 3V0DA 4CMHB 4X7FC 1PFCA 1ZPUA 1GGTA 3P2BA 1BDYA 1QYGL 2EDMA 3QUXD 1JK9B 4PJEA 3BN9D 1KPVA 3TVMD 4R7DB 3RZCC 3T2LA 3MRIB 1BVLA 3GI9H 1VB9A 5FO9A 3EH3B 4AK1A 3L4TA 2CU9A 5AB9A 1ICTA 2V17H 3D39D 3E8VA 1OANA 1EO8H 1JI2A 4UB0H 5JO5A 1N68A 2F19H 1CPUA 1MCOL 1CLOH 3GJEA 3L1GA 5DTFA 5J12C 3X1EA 2WMPA 1BQHA 1DFBH 4DO6A 1V54B 2XWZA 3MLYH 1QFUL 1FFPB 3N1MC 3MRLB 4WENB 3HI5H 3IMVA 3WDHA 2BSED 2PP8A 3U82B 2AJYH 4OFQA 3JTSB 4RBPK 3FOMB 1IC5L 3K2IA 5F9AC 4CW1B 3GKWL 2X4RA 3HUJA 4LCWE 4PJHB 1I1CA 1CD8A 1MHCB 1YAZA 3FU8A 4LEOA 4DZBB 1H3GA 1K72A 4JFUA 4IGBC 2J71A 3DVGA 4C56A 1TYEB 3OHXB 5E5RB 4X98B 4U6YB 5EIIG 5BOZG 2AJZA 3B6SA 1NLDL 3VRJB 3TA3D 4Z3IA 1T0OA 3HPJA 2QBWA 4OCWH 2IQAA 1A14L 1QPPA 2W5PA 4D0DB 1JFQH 4ZTPH 5HHNA 4XMUA 3LPWA 1QNIA 1FJ1A 3L5WB 5E5MB 2XZCL 1F6FB 1ZA6A 1SDYA 3QIBC 3QZNA 4PSRA 5EO0A 1SLXA 2GBAA 1EEQA 3V6ZB 1SUHA 2R8SL 4Q9QH 3CSGA 2BCMA 2WIIA 3DUHA 2ATPB 5IB5B 3EUUA 4TPRL 4F3FA 4UM8A 4XNXH 4B5ZA 3IKKA 1PTZA 3D18A 5FO7B 4CVZB 4FNUA 4NUQA 1H8OA 2C34A 3D4GA 2IV9A 2VMCA 1UENA 2ALWA 3LIZL 5DD3L 3SGKC 5EFIA 4Y8DC 3OVUB 4I4WA 2VZ3A 4XP6L 4YBQD 4JN2B 3EJYD 5ALCL 5E51A 4F33B 1TNMA 3H2WA 2DJMA 3QFDB 5L2JA 3IVKA 4RGNC 2YQBA 1P6AB 3SOTA 4U6VL 5IBLD 4PG9B 1D5BA 2Y07H 2QJDA 3MGAA 5AVTB 4YFLI 3MNWB 2K4WA 2K9FB 1RHHA 3G08A 5C09E 3TCTA 3VJ6B 4L37A 2C9AA 3AS2A 1CBVL 3CPUA 5AB1A 1N6QL 3BN3B 3VDAA 4E42A 3PHQB 5I1AA 2G3XA 3ZQ9A 4YX2H 4U1JA 2X40A 4GLRI 4HXBL 2C5DC 3TXAA 3QEHA 3L3DA 4AGQA 4P59L 4AUYA 1OSZA 3EYFB 1S7XA 2YK1H 2WVSA 4Z77B 3D12B 3T08A 5EPMB 1FQ9C 2ZXCA 3VD9A 1LEIB 2C4XA 5IEKB 2E7CA 3O81A 4XNZB 1KBKA 4GKZB 3EJPA 2CIKA 4C54A 2A38A 5TDNB 4GW1A 4X6EA 1ZA3B 5F93C 3K3QA 1PLAA 4IU3A 2FATL 2J1XA 3CJJA 1BA9A 3GSXB 3PV7A 5GRJH 1I1YB 3INUL 3FULA 3NFSL 1JZ7A 5J1TC 1A6VL 5FFGA 1KCWA 2X89D 3RWCB 2A6IA 2DEXX 2PTUA 4HIHA 4G6FD 1COBA 1P1VA 1GJWA 3BRDA 3M1CA 3K0YA 3CQFA 3TWCL 4YR6A 2HT3D 2HVBA 3RIFK 4EDWL 2R23A 3GUTA 1FNSL 1RJZB 3CSPA 4BKLB 4KQ4H 2J25A 3F2LA 1VACA 1MCIA 1OTUD 4D9LH 2NQ3A 3ETBJ 3DUSB 2CBQA 5GGTA 3F7YB 5JUEH 2WPGA 3ARWA 4MX7A 1IM9B 1K8DA 2CH8A 3LRSB 4LSSL 1UVQA 4M7LH 3SKUD 5C0IA 1HL9A 3FH8A 5EUOE 2X9XA 4JG0L 1BLNA 1EH9A 4TUKL 4XB7A 1GZHA 4XO8A 4PGZA 3G5XA 1XZWA 2J5WA 2WVVB 4P9HL 1HIMH 4RQQA 4MRCA 1YEDA 5T1LB 2M2DA 1SN5A 1RJYA 2WWKT 1CFNB 4WWKD 3K71A 3ZE2E 4D0BB 3W39B 4GI6A 5JW3L 4XVJL 5J1AB 2VDOH 5FYJD 3WNOA 1MCPL 4LCCC 2EDNA 3FFCE 2QADC 1JPSL 1KT2A 5JIMA 3M8OL 5AKRA 4DQAA 2VT0A 1QFWL 3IU4L 2YMTA 3BKCL 5IVZA 1UH2A 1UWXH 3N3EA 4CAGA 3F04A 2QSCH 3IFLH 3V6FA 1BJMA 2ZYHA 4YZWA 4GMSL 4PRIA 1CXIA 4EUPG 2EDTA 4FRWA 4YHYB 4I0CC 1I3RA 4DP8X 3SD5A 4RFNB 3NYKA 2UYLB 1NKOA 4X6FB 4OAWB 2H8PA 1N19A 2PWEA 3ARBC 1TJMA 1EHAA 1YMME 3L16A 1RUKH 1U36A 3WHXA 1A7PH 1FNHA 2HH0H 4B41A 4MXVE