2AVFA

Crystal structure of c-terminal desundecapeptide nitrite reductase from achromobacter cycloclastes
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
314
structure length
314
Chain Sequence
LPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of C-terminal desundecapeptide nitrite reductase from Achromobacter cycloclastes
pubmed doi rcsb
source organism Achromobacter cycloclastes
molecule tags Oxidoreductase
molecule keywords Copper-containing nitrite reductase
total genus 80
structure length 314
sequence length 314
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2005-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2avfA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2avfA02
2LLNA 4G7SB 2OJ1A 3WG7B 4KNUA 3BQVA 2CUAA 1IKOP 1N68A 3KW8A 2PLTA 4Q89A 5ANHA 1ILSA 1ZDQA 4CSZA 1TEGA 2XUWA 2X87A 1TKWA 3FPYA 1PNCA 2YQBA 1OE2A 1L9RA 4AI7A 1ASQA 1ZDSA 2BZ7A 4G7RB 3QJUB 1JZJA 4JKNA 5PAZA 3UAEA 1OCOB 2WSDA 1WA1X 3TU6A 2FTAA 3SBRA 1TU2A 3UADA 3QJRB 3AG4B 4A2FA 4GP8B 1PLAA 1GS8A 3SQRA 1RCYA 4AKQA 2DY2A 2XXFA 5D4HA 4YSCA 3OD3A 3WNJA 1L9TA 1RKRA 2W88A 1AR1B 4E9WA 1J9RA 3X1BA 1A4BA 1OE3A 3FU8A 2QPEB 2YAQA 5AFAA 2AANA 2PCYA 4HZ1A 4E9SA 2PP7A 3QJQB 1AS7A 5AZUA 3FSZA 1CURA 3OMNB 3NJLA 1IUZA 1SHWA 1M56B 4N4YB 3S3CB 2MRYA 1ZIAA 2UX7A 7PCYA 2UXGA 4E9XA 4A2GA 3FQYA 2FJSA 4E9YA 2WO3B 1PLCA 3NSYA 3NSFA 1NIFA 3PPSA 4BWTA 4YSDA 1JOIA 1J5CA 1BEXA 1NDTA 4QLWA 3NP3A 1CYWA 1PY0A 3S8GB 3UAAA 1PAZA 3D12B 2VM4A 5B1KA 4ZK8A 3NSDA 2B08A 4GP5B 1M57B 2XV3A 2CAKA 4YSRA 3X1GA 4DPAX 4E9VA 1ID2A 1UATA 2HRHA 4HIPA 4DP7X 1J9SA 5TK2A 2X88A 3UGEA 2IDUA 3BVDB 3JT2A 4PCYA 5B7FA 1AZUA 3FU9A 4WKXA 2DYSB 4YSPA 1FA4A 3AG2B 1W8EA 2XYBA 3DKHA 1GW0A 3NP4A 4DPCX 2BP0B 3T6VA 2GIMA 2AZUA 1X9RA 4DP8X 2P80A 3H4HA 2DYRB 3AZUA 1L9OA 4YSUA 2TSBA 1GR7A 3CDZA 3OMIB 1CYXA 3U25A 1KCBA 2JFCA 3N55A 1A65A 4DP9X 1TEFA 2XX0A 2XV0A 2OV0A 3CDZB 2FQFA 1SDDB 1HAWA 3PAZA 2N0MA 2IAAC 2YARA 1QLEB 2VW7A 2BHFA 3ABGA 4G7QB 3V9EA 2PPEA 3NYKA 4CSPA 1XB6A 1EHKB 3CVBA 1JERA 3FQ2A 4KNTA 2H5UA 4M3HA 1NICA 3ZBMA 4BK5C 4DP1X 3AG1B 4GY4A 3MBWB 1A8ZA 2J5WA 2VM3A 3FS9A 1BAWA 1BXAA 1OF0A 2QDVA 1XMEB 1PZBA 2YXVA 1AS8A 2JXMA 8PAZA 3CZUB 4P5SA 4AKPA 1AAJA 3NSCA 3TA4D 2TSAA 2BO0A 1KGYE 2H3XC 1V55B 1NIBA 4DP0X 3TASA 1ZIBA 3NJJA 1NWOA 3SBQA 2YAHA 4UAHA 1KYAA 2J55A 5IY5B 4DP5X 1YLBB 4AX3A 3T71A 3FQ1A 3QJVB 2VN3A 2OCCB 3OMAB 2ZOOA 5E9NA 2PCFA 2QPDB 3ZIYA 1ADWA 4YSTA 1IBYA 4P5RA 1NPNA 1VLXA 1W6WA 2UXTA 3FYEB 3FU7A 1J5DA 3FSAA 4A68A 3X1NA 5I6KA 2VW6A 3ZX1A 2I7OA 3MX0B 1AACA 2HX7A 2PPFA 1J9TA 5LDUA 5AKRA 3X1FA 4UF7C 1BQ5A 2E86A 2FQDA 3QPKA 1J9QA 2I85A 4HHWA 1I53A 3ABLB 3EF4A 3OQRA 1E65A 2NRDA 1WA2X 2IWFA 3WIAA 3EH4B 1ETJA 1SHXA 2YAMA 4YVUA 3V9CA 2IDSA 1SFDA 4KOCA 2UX6A 1NPJA 3ERXA 3RYMA 1ET8A 2FNWA 1N70A 3ABKB 3AY2A 2EIKB 3NJHA 5F7BA 1DZ0A 4YVNA 1AOZA 5I6NA 4BDVA 1JZFA 1GY1A 1ZPUA 2BWIA 3EH5B 1L9PA 1A4CA 3NJNA 1NIDA 1L9QA 4KO6A 1BXVA 1EZLA 2QT6A 1PCSA 1MZYA 3GYRA 1SF3A 1OCRB 1PMYA 2AFNA 3S8FB 1OCZB 1M9WA 2YAOA 3ASNB 5B1AB 5I5MA 1OE1A 1GYCA 2IWEA 4F2FA 5EHFA 4HCGA 3NT0A 1ET7A 1HAUA 1ZV2A 1KBVA 2EINB 2GSMB 1WA0X 3EHBB 2FWLB 3IE9A 5FC9A 1E30A 1JZEA 2BW5A 4Q8BA 4YSOA 3S3DB 4EF3A 4DP6X 4HCIA 5A7EA 3CVDA 3DIVA 1KDIA 2BZCA 3QQXA 5I5JA 4A2EA 3GXUB 3T6ZA 2Q5BA 1JXGA 3FSVA 1L9SA 4JHVA 2AZAA 2HX8A 3IN0A 2HZHA 4A2DA 2BP8A 2DWSA 5B7EA 4DP2X 2XU9A 2YXWA 1GS7A 2B3IA 2FQGA 2YAEA 1A4AA 1NIAA 1NWPA 4JHUA 1ASOA 2ZONA 4TXVB 4F7KA 7PAZA 4BWWA 1CC3A 3TBBA 1NTDA 2I7SA 1JZIA 2GC7C 2YAPA 1PNDA 4G71B 2PPAA 1GSKA 1V54B 5F7AA 2FT7A 4FAAB 3PXLA 4MFHA 4YL4A 1BQRA 3NJGA 4BWUA 3JTBA 4KOBA 1PZAA 3WKPA 2PP8A 3IEAA 3PAUA 2WO2B 1GY2A 2GBAA 1PZCA 4YSEA 3HB3B 4KNSA 1WS8A 1AZNA 1GS6X 4HALA 1IC0A 2PPCA 1T5KA 1AZBA 2QDWA 2Q9OA 1OOWA 3FSWA 2IH8A 1SF5A 2A3TA 1MZZA 1QHQA 5D4JA 3T6WA 3AG3B 4FA7B 3FPXA 1AG0A 3X2QB 4KO7A 4W1TA 2IDQA 1ASPA 1RZQA 1FWXA 1KV7A 1JXFA 2FQEA 2GI0A 5I6PA 3NJIA 3PAVA 5B1JC 2CCWA 1R1CA 1SNRA 1BYPA 1AS6A 2EILB 3NJKA 1QNIA 2XX1A 4QKTA 1XB8A 1SJMA 2R7EB 4PAZA 2HX9A 3C75A 1AZRA 4KO9A 1OCCB 2VMJA 2HRGA 4A67A 4NB7A 3N2JA 2IDTA 1PF3A 2AVFA 2P80D 4HHGA 1JZHA 1BQKA 5B1JA 2VW4A 1RZPA 3DTUB 4A2HA 3HEIB 1KBWA 2XXGA 3IN2A 1SFHA 4W9ZA 1E67A 1DYZA 1W6LA 1NINA 1ILUA 1SDDA 1WAEA 2PP9A 4YSSA 5I6MA 2FT8A 3NJFA 1NZRA 4BDVB 4M4RB 2HXAA 2YAFA 3L45A 5PCYA 2R7EA 4NERA 2UXFA 1BXUA 2J56A 1F56A 4G72B 2W8CA 1AQ8A 3PLYA 1ET5A 3QJSB 1JVOA 5B7MA 1CUOA 2BWDA 1E5ZA 1B3IA 2BP0A 3FT0A 4KO5A 2EIJB 4BXSV 3SBPA 3UABA 4GXFA 5TK4A 4RH4A 3KW7A 4UANA 3WKQA 1A3ZA 1E5YA 1AG6A 2H47C 4AKOA 3QJTB 2ZWNA 2ZXWB 1MG3C 1BYOA 4HAKA 3AW5A 4X4KA 5B1BB 4AZUA 1V10A 1AZCA 2VSKB 1FFTB 3H4FA 5B3SB 4DP4X 4G70B 2XV2A 4L0PB 2PPDA 2Y69B 2XWZA 3X1EA 1MG2C 3FU7B 4HCFA 5I6LA 2EIMB 2IWKA 4BXVA 1MDAA 1NIEA 3TBCA 1XB3A 4E9QA 2CALA 5I6OA 3OM3B 2J57A 4DPBX 4E9RA 2IDFA 2CJ3A 1URIA 3FYIB 1PLBA 6PCYA 4N8UA 3EH3B 4GP4B 1WS7A 2RACA 9PCYA 4ENZA 1KCWA 2UXVA 3UACA 2VSMB 1JVLA 1AANA 2XLLA 3ASOB 2MTAA 4A66A 2HLEB 3WNIA 1KDJA 5D4IA 2IH9A 3G5WA 3ZDWA 3GDCA 2GC4C 1HFUA 2JKWA 3T6XA 4YSAA 2GHZA 3NJMA 2BW4A 2BP8B 5I26A 4K9JA 2CBPA 1AIZA 2Y1AA 4YSQA 2FT6A 2GB2A 4F2EA 2XVBA 2DV6A 3PCYA 1JZGA 3CG8A 4NAJA 3ABMB 3S3BB 4E9TA 1X9UA 4GYBA 1JXDA 2DWTA 4WTQA 3T9WA 6PAZA 1IBZA 1OV8A 5I28A 3H56A 3IBOA 5I5IA 3CVCA 3WI9A
chains in the Genus database with same CATH superfamily
1HEZB 2R2BA 2ITDA 2KZ1B 2ZJSL 4XTRC 3FCUB 4PJDB 1TU2B 3LPFA 3OC8A 5LBSL 3V0IA 2KQNA 3FK3A 1JGLL 4JO4H 4U0RC 5CFAA 1FNLA 4OLVL 4D3CL 3ARFA 1P5VB 4P3WA 3BP6A 2G2NA 2AQNA 2X2YA 2G9HB 4Y2OB 3Q2LA 4TQEL 5C0ND 1LK3L 1QBLL 1MJJA 2V0AA 3STZA 2Y5TB 3DV6A 5FKPA 5F88A 3ZW3A 1G9NC 1VESA 4HIJB 2R51A 1FAKT 4OF5A 3ZDXB 1DP0A 3QUYC 3A47A 3BHBB 4AUJA 5LG6A 1LO0H 1Q94A 3D4ZA 3ZDZB 1DFBH 2FUQA 1RFDH 3Q13A 5D70L 3DMMC 4DGUA 1SJVA 4OV5A 3KLHC 1MCQA 2DRUA 3QNZB 5DEGB 3CDCA 1BFVH 1MJUH 4F9PA 1P1ZB 1QLFA 3IFLL 2L0DA 1UUSA 4K3HA 4QRRE 5FHBL 5FO7A 4DO4A 3D8MA 4KVPA 2FK9A 4YFLF 5F1IA 3VFNB 4F7EB 4PHZA 4L8CB 2YSSA 2DICA 5DQDH 3WY4A 1S4IA 1Z9OA 3D9AL 5B22A 1OE3A 3ZE0E 1FZOA 3CSGA 3ULUL 2DTML 2VXQH 4OJEH 2VDMB 2Q8BL 1QRNA 5DRNB 1A7QL 5T1LB 4H0IA 2AAVA 2QMJA 5CR8A 2XQYG 4H13C 4UTAA 2C9SA 4Q9BA 2JJTA 1I7RB 1TLMA 3KLLA 2AK1L 5FUZL 1VFBA 3EXJA 3DSNA 1MWAB 3L48A 1YAZA 3QIUA 4NQDA 3KPPA 4P2RD 3ARGC 4NZRL 4JG9A 3W9EA 3UGUA 1ZHNB 2WXJA 2B1OA 2XG4B 1NGWA 2FEJA 5IHZB 5L9DL 4DZ8A 2IJ0C 5DMJB 3CZFB 3ZDZE 4XCNA 2HTLC 3DBXA 2Z92A 3I75B 4IBTA 1WTGT 4JGMA 1UCBH 1FYTE 4MS8C 3SPVB 3K74B 4DN3H 1OT1A 5J12C 5CJOH 2FJHA 4C8XA 1KB5B 3S8GB 5HHNB 3RX8A 3DHJA 2XBDA 4W68A 1OM9A 4JDTH 2XA3A 4JCMA 4UQ2B 4V1DE 1BYNA 5K9JL 2YEZB 2JJSA 5T3ZH 1A47A 5J57B 4ZD3L 2WLLB 4PJCB 5D7JB 4PJCA 1MJ7L 1Q90A 2C9AA 4U6VL 1U9KA 4NCC2 1T1ZA 4D9RE 3RY5A 2GTWB 3D85D 4NIKB 1P4LB 3T4AA 5I17A 2WINB 3UBFA 2JI1A 3DMMD 3NP4A 4PV8B 4CL7A 4DQAA 4M29A 1DVZA 4XN7A 4PTUA 2CJTA 3QXDB 5DHEA 3CN4A 3IF1B 3DOSA 3MRBB 3KL5A 4X98B 5DQJB 5D4QA 4XO3A 2Y1YA 1NCBL 4JFEA 4E2OA 3KZ8A 6FABL 3P0YH 2GKIA 3IAQA 3MCYA 1WDAA 4EI5B 1L7IL 3A6OA 3HS0B 2CLRA 3EGDA 2PXYD 3MRRA 5DQJA 1M6OA 5KBKA 2N0MA 2YARA 1NGWB 1NGZA 3VFGH 5LG1A 3LH2L 3ALXA 4UV7L 1U21A 3IVKA 3ZTJH 4TTDD 2VDPB 1Z1WA 5BOJA 1TZHB 4F8TA 2VQUA 3SDXB 1ZGLA 3U9PL 1YEHH 2OKMA 3BPLC 4PWKA 2QSTA 1CE1L 1HQRB 2IAMD 1YO4A 4X5RA 4D8OA 2D3JA 5C97A 4RAVA 3AABA 1RJCA 4LHUG 5DJCA 5KAQG 3HPLB 4X5PA 5HJBA 4BHUA 5AAWC 2WNKA 1MAMH 1I7ZA 4WTWA 2JKNA 2Z3FA 1H8NA 3KM2A 4BA8A 1AHWB 1G7JB 4OUUB 5CLWA 3QUXD 4NGHL 5DGRA 3C6LB 5I1IH 1HINH 3QH3B 5JO5A 3FQ1A 3LEYL 5HYIA 3VJ6A 2O61B 1KEMH 3RTQC 2F58H 1A9BB 3GSNA 1UWFA 1KULA 2QVIA 3TZVD 2ZOOA 5FXCH 5I71C 2OXHA 3QIUB 4NQDB 1GRWA 1QW8A 2ZWYA 2GSIB 3UDWA 5D2LE 4FNTA 4MNQD 4UILH 4GIOA 2XVLA 2MCG1 3HE7D 1HCVA 1TZGH 1LTXA 1ZWIB 2NXYC 5KBPA 3FQWA 1A7RL 1OD9A 3NQIA 2V8LA 2MCPL 4KROB 3MACH 1S7WA 8CGTA 4ZX4A 5CGYC 3A21A 3CXHJ 2IH1A 5CBAA 3FB7A 4LDOB 2HRPH 3RYMA 3SBWA 1A9VA 3BHBA 3B34A 3WSQL 1HEJC 2KLSA 2G3XA 5CP3A 3MZGB 5F88B 5DZNA 2UY6B 3DX8A 1ZT4B 4UOQA 1H6FA 4WCYH 5EU6B 5IG7A 2X2HA 1GY1A 3BVVA 4AJWA 4ONOA 1T04A 1TQCC 4I85A 5BZZA 3ULUH 5DVPA 4KO6A 2YZ1A 1HHHA 1NBYB 2GPZA 2AITA 2ZPKH 3UTSD 4ZNCD 3ARDD 2Z0BA 3IU3A 4R7VA 4ZTOL 2AQ1A 4K2UH 4RIRB 2VLRE 4OM0H 3X3FH 3AS2A 3CC5A 4YE4L 2IIJA 1G1CA 2ENQA 3STBA 3IE9A 4BYHA 1VERA 1A6UL 2XKNB 3DV4A 5CHNA 4YSOA 5A3ID 3S3DB 4WFGD 1S9YB 3KPSB 4JVPA 3DETD 5F96L 3ZYIA 3I3DA 4A2EA 4G5AA 1O7DE 4FTVE 1M2OA 5LHDA 4N0UE 3OGCB 1DQQB 3ZT5A 3ULVL 3MODL 1ZT1B 2QPFA 3MRKA 4WUUA 1CXFA 3RVVC 5C09E 4P0DA 1P5UC 7PAZA 3RTQA 1G1KA 4LARL 2E8ZA 4DUWA 4J4PA 1OP3K 1JZIA 4KAQH 1CLYL 2IVFC 5GRXG 3WDJA 3L5JA 3QPQD 5DVKA 5EOTB 2J8UF 4JY6A 4MA1C 4P57B 1DEDA 4DO6A 1IKNC 3MDJA 5J3HD 3G5VB 1AD9B 3GPSA 2WB1A 4I0PA 4GRLC 3MLZH 1QPPA 4IOSD 4CJ0A 1J1PL 1IX2A 3OXSA 1N8ZA 2QQKH 2BFGA 2D4DA 3UPRB 3MXVL 2Y07L 4FE9A 4NC1C 4LSQH 3PWUB 2ZG1A 1TXKA 1OEZW 4NRXA 1PZCA 3U82B 3TURA 1WFNA 2OFQA 3MGTB 3DJ9A 3N04A 5GGUA 3D50A 4LPTA 4JHWL 5C0CA 1SYSA 3F5WA 4P4KC 1R17A 5C6WH 1AXSB 1T5KA 2Q9OA 2X0UA 4B9YA 1XH0A 3AXLB 1SF5A 2C9XA 4PJAA 2YKLL 3MO1B 2WAHA 4NLHA 5E94A 1NDMA 3B4NA 3BQUD 5SX4H 3CMOL 3HMWL 3SHSA 3CDGB 4X4XA 3WIIL 1SYVB 2VZ3A 3DVFA 1NBVL 5H37A 4NM8H 2KLRA 3VA2C 5IZ7A 3CHPA 4WK0B 2BDNH 3IDMA 1DQJA 3ZE0F 4GSUA 4HWBH 3ZHFA 2FIRT 1ECZA 1PZ2A 4MBRA 3UEZA 3WE6B 4AITA 3DLQR 4DVRL 4APQA 5ITFA 1AS6A 4XWOC 2IAMB 4GQ9L 5E03A 1BWWA 3APFA 2H9GB 1RPKA 1KPVB 1HHIA 3P3TA 1JV2A 2QHLA 2F54D 1T7WA 3JTTA 2BVYA 2DQGH 3UYRL 1XCWA 3N2JA 4JM2D 5MHSD 2VR4A 2ADYA 1CVSC 2COVD 3MLTB 1YMME 3LOWA 2NY3B 3LKQA 5GJTH 3VFUB 1DDHB 4AQAA 1BLNB 4U0RB 1LVEA 5FO8A 3I6SA 3CN2A 1VGKB 4ZODA 2KYIA 1NUDA 5EN3A 2J21A 1U3HD 1P7KB 3FFCE 5DYOB 5HHMD 1AZVA 2CIKB 3UH8A 4X7EC 1WAEA 4WW1A 3CFKB 5GS3A 1K8IA 4RWYH 2L3BA 4GKSA 5AD0A 1THCA 2BHZA 4I1RA 4QJ3B 3QIUD 4NQDD 4G72B 5I1AA 3SDCD 5DRWA 1FL6A 2WLNA 5DUBA 5GS0D 1CB4A 2NZ9C 2AQPA 4GEJA 1AFVL 4BZYA 1TCMA 3H2QA 3LN9A 3OAYH 3OX8A 1IKNA 1USZA 4K8RD 3TOPA 1IBDA 2EIJB 3VFMB 4R8WH 2ZKYA 1DBBL 5TK4A 5IW1B 3F62A 1WZMA 1O6VA 3CUPB 1A3ZA 5ETUA 1WWBX 4GLRH 2H47C 2Z9TA 2EYRA 2A9AA 4WO0A 1MG3C 2UWEF 1FNEA 3CQPA 1NCIA 2GI7A 3MFFB 1KGCE 1ACXA 2K8QA 1HSAB 3S5LA 5B3SB 3Q5TA 3V4UL 2JB5L 2XV2A 3GJEA 4M6OH 3HI1B 3W38A 4Y2DB 2ZX8A 1EPFA 1FGNH 3B2VL 3PJNA 5G5DB 2WLKA 2B4CC 4ACPA 1TJMA 1FI8C 4JRXB 1JGIA 5DUPL 3D18B 4DPBX 3R0MA 4KUZH 3KGTA 1UKTA 2OTUA 4O5LL 2X6AA 4N8UA 3CFKA 3CIQA 5KWYC 1SBSH 2F2HA 2IOOA 3I85A 1Z3RA 5E4AA 4AQ1A 2UXVA 4XPFL 2NNAB 1H5BC 3DYPA 2QGCA 4GIPD 5F71A 2R83A 4OFYA 5L8JB 2WXQA 2CLZB 5AW8B 1EIBA 4GO6B 2CXKA 3LIZL 1HH9A 1QI4A 3RGVD 2K70A 5FB8B 5DMYA 1NDGA 3HE6B 3K5SA 2JKTM 2W0KA 3FN0H 5JIKA 3T6XA 1KPVA 2CO6B 3GM0A 4JANB 2YD4A 1KXVA 2GBVA 3U6XS 2EDNA 3BP5B 2HFEB 5IQMA 5JNYA 1EXHA 3L3IA 3QORA 1Q9OB 5CMAA 3QJFB 5DWUH 2VDLL 3MR9B 3PG2A 5AOZA 3S3JA 1D7CA 1IM9D 4PY8I 3WTUA 5KYYA 3G9AB 3BH9A 2ZCLH 3QR1A 1DANT 5HPMA 3EYFB 4JDVB 3H42L 3PP3H 1RLBA 2JMRA 5C2BH 4YZFF 3I6KA 2YBRA 3MO1A 4FI8A 4G7SB 3OKEA 1Z6JT 4PJAB 1YQVL 4DJMA 1TQTA 1ES0A 1RK0B 4ZXBD 2ZP8A 5AVRB 5IHUL 5EDSA 1N68A 3G7TA 1AE6H 2JB6A 4KXAA 3FC8A 5C0GA 3DMMA 2VQ4A 1BVOA 4XMXA 1OSYA 4ZS7H 2WIIA 1OAXH 4DVBB 3DTDA 5PAZA 2VDRH 3SCMC 2KLTA 3QWRA 3OB0H 4HS8L 5EFIA 4AE0A 3U4BH 4PJ5A 3ZDZF 3N44F 2F5AL 2CBQA 3WO4B 3MRNB 3H0TA 4H8WC 2FHCA 1GS8A 4ODWB 4KJQC 3ZTNH 4B9ZA 3T0DA 4UB0H 2DY2A 1G4RA 1UM5H 2WQRA 5IEHA 4HOWA 1H8SA 4YLQT 1GC1C 4RFNC 3ATEA 1JWMB 1RUAH 3RTQB 1WHOA 3LYRA 3O2DA 1MCSA 5SV3A 4HIHA 2LW3A 1IFHL 1IAOA 3L81A 3PWJA 4PIBA 4PI2A 4AV5A 3ULUF 3ZUNC 4YNYB 5E2UL 4L8BB 2BSSA 1AHWC 1URLA 3JV5A 3JQOB 3BH8B 1AZZC 1UM6H 2VUOA 2FAUA 4UILL 1SHWA 4AC4A 3CIAA 3DROB 3R7QA 3JV6A 2YGNA 3U46B 2VSDA 5CHNB 5AZEH 4ELMB 3VSQA 4CRPA 4PJAF 2ZXCA 2C26A 2GCYB 1A5FH 1JPTH 3Q05A 5FECA 5BZDA 4K73A 4ZFOA 1PLCA 5C08D 1YA5A 3NCMA 5D8JH 2AXJA 5EZLA 3HFFA 3MCG1 4HV8B 1IQWH 1CI5A 1I4FA 4LPCA 3UAAA 3V4PL 2V9RA 3HE6D 3MRQB 5CCHE 5KZCD 4I88A 4FZ8L 5J3HC 1NMAH 1S6NA 2E74C 5DURB 2UY6A 1X9LA 1KIUB 1M57B 2O6FA 3QNYB 4RGMC 1VCBC 3MBXH 3TBVA 2VRKA 2X88A 4C56B 2DKMA 4LU5H 3IWUA 5HI4D 1BQUA 3UZQB 5TDPB 1DJXA 1M7DB 1V5JA 4QEGA 1FE8H 5JPMA 1S5IL 2XTSA 3SGDH 5EOQL 3DHPA 4QDGA 2KHAA 1GZPA 2R39A 4JG1L 4PJEA 4OM1L 1IVTA 4N0FA 2ERJB 1G6RB 4MJ6B 3P4OB 4BUGA 4EVNB 5H4ZA 2ZICA 1N19A 2NSQA 4Q2ZA 1OLZA 5I1KH 4J6RL 1L9OA 3CDZA 2W59A 5DXWA 1KJMA 2D7NA 2NY6D 4JFDB 4MJIA 2OV0A 1SN2A 1R33A 3V5HB 1LEIB 5JUEH 4XP9L 3B9EA 4JFOA 1KPUB 3KBFA 1ZGLP 4X7SH 4ANUA 1OB1B 3C5ZB 5D5MA 3TZVB 2VW7A 2BHFA 3LIZA 2NDFA 1HXMB 3UP1A 3ECWA 3TCLB 5C3TA 3RWEA 3AT8A 4JFZL 3BP4B 5D2LF 4HUWB 2O61A 2C9PA 5I5RA 1A3LH 2KL6A 3AREB 3KPMB 1Z9SB 2W94A 3DHUA 1LMKA 5E1IA 1AHWA 1G7JA 4OUUA 3U7AA 5DUJA 2QVTA 2DLIA 4NRZB 5L8LB 2HFFB 4JY5L 3DXAB 4PH8A 3AU1A 3EBGA 1L5GB 2YO3A 5KVFE 2R0KH 1YNTB 3D51A 4NN5B 4WAFA 2V17L 2AEPH 3HPLA 4U6HB 2QGDA 1B3JA 1FFOB 3IKCA 4M7LT 2K8MA 2ZXGA 1RJYB 4KRPC 4AX3A 3QXUA 4KI5F 5LCVA 5LUMA 4JPKL 4W6YB 5T5FH 1NC4B 2W0FA 3IS1X 4YK4B 3CFTA 2X4RB 1PBYA 3LB6C 4GFTB 3J27A 2FNBA 4GSRA 4W6WB 4WV1B 1MHCA 4JQVA 3ZIYA 1IBYA 4ZFQA 3U9WA 4F92B 5IVXF 3N1PC 2ICES 5HHVL 3HLAB 4ZMZA 1DE4A 3P77B 1AD0B 3WBDA 4A68A 3VDAA 5BRZE 1A9EA 1INDH 2VW6A 1QSEB 4OLUL 3MJGX 3RGVA 3GLZA 3K6SA 2ZOKB 4U1GB 4OD2B 3CC1A 3OKLB 1FNGB 1UJTA 3PFUA 3CCHB 2X6MA 1A4JB 3BZFA 4MQXC 1CT8A 3FQUA 3I3EA 3DXAE 4GI9A 4RDBA 1RLWA 4HOMA 3F7PC 5JPMC 1VPOH 1WGVA 3T8XA 3QFJE 2DIBA 2KS0A 4I3SH 4J7RA 5D7EA 1E65A 5IVZB 1GGBH 4XC1L 4AJYV 2UWEE 2X1WL 1O7DC 4Q6IC 2RD0A 2XFGB 3UTQB 4Q14A 4A6YA 4ZSOB 4TV3A 1P53A 5JW4N 5E6RB 4XNXH 1RURL 3ILQC 3J2PA 4Y9EA 2WLLA 1NPJA 3FQRB 5DA0B 1ET8A 1BFOA 2W80C 2KZKA 4ZBJA 4KK9C 3ZMRA 1H6TA 2XOTA 2JF1A 3K6SB 3I6GB 4XVSL 5DMGC 5F0MB 5KBDA 1DSFH 4W81A 2H32B 1KB5A 2YLKA 3ESNA 3QO0A 5A40E 3LKRB 3IETB 1U3ZA 1HKFA 3K2UL 2CO3A 3KVPA 1UM6L 1NMBL 5DS2A 4OGAD 4ZFOL 3EOBB 4I2XE 3QCUL 2NQ3A 5EU3A 3HE7B 5IHZA 1MFDH 2FLBT 4YHZH 2JKIS 5DD0H 4ODVL 3B2DC 1JAEA 5EN2A 4QF1A 4XP5H 4X7FC 3MRLA 5DK0B 1JZEA 3VI3A 3DSNB 4NKIH 2FGWH 4DKTA 4ZO9A 5ADPL 4DP6X 1T2XA 4RGMB 1D9KA 3D25B 5HDQH 4AXWA 5GS2H 2WWOA 1JNHA 4HJ0D 1RZKC 1ZLUH 3DXAA 2NNCA 1SXZA 2L8AA 3HZVA 3SJVB 3T3ME 4P2OB 4PSPA 2XWTA 1IC7L 3DX1A 3GEWB 4LSTH 4ES9A 1N6QH 2R2CA 1U41A 4MD0A 5E2UH 3L8QA 1J5OH 4LCYB 4OZIA 1Z3GH 1KTCA 4W9GC 2E7DA 2ZCHL 2WANA 4MLIA 4Z0XB 1XXFC 5F1IB 3VFNA 3ULVH 2XC8A 3N1MC 2J4WH 5IVOA 3WFBH 2HMIC 2HT4D 1YEFL 3LXAA 4A7QA 2EXYC 1QFWM 1IM3A 2VC2L 1G87A 4LKCA 1MCPL 4OLZL 1UB5B 1X5GA 4BH8B 5J56B 4MMYA 5GRZA 3MYJB 2JE8A 3B9DA 1JZ8A 4XC3H 1YEGL 1QASA 1BM3L 3C9NB 4GBXD 5ALCH 2VJXA 2ZG3A 5KW9L 5GGVY 3ZE1B 1KCKA 4P2CG 5CU9A 1K72A 3V0DA 1XTLA 3D2UD 5HPOA 4PV1C 3SYOA 1PW3A 4F7CB 1P5VA 3VFOA 3VE0A 3O11A 1OGAA 4I2XA 2PXYC 3P73B 1D5IL 2QVMA 2I9TA 2IH8A 4NUJA 1T03H 4RFOL 3SJVE 3MLWL 3HZKA 3LMJH 2GQHA 1PZDA 2CK0L 2EIZB 4ZUWB 1E4XI 3KWVA 4QXGL 4O2FA 3WHE0 4Y2DC 1OCWH 5IJKC 5C2BL 3QNYA 4JZJC 4WI2A 2FR4A 1YMMA 2IANB 4R84A 3IFPA 4H5SA 1AKJA 4ZAKC 3CMOH 4JAMB 5G4MA 4N68A 3RJQB 4HUKB 3ZLQC 3V0GA 1AKPA 5AVTB 5DJ8B 3NJKA 4QKTA 2ZCKH 1IGJB 3FB8A 1HNYA 4MDJB 1ZLUK 3TJEH 1CU4H 4OD3H 1DCLA 4M48L 3O9WC 4FI6A 1MCOH 5EOCH 1INDL 1TUPA 4DGVL 4N5UA 5DUMH 1OL0A 1BVZA 4YL9A 1ZOXA 4K23L 1NGYA 3V5KA 1KWKA 2E5EA 4M8QA 4X7SL 3U2JA 1UZ8A 2F5AH 1KBPA 1BLIA 1ONQB 2H1PL 4GT7A 5DK2A 4D9LH 3QHZL 3V2AR 2DEYX 4FFTA 4ZNEA 1W6LA 3TTYA 1S7QB 4MWFB 4YXKH 5BZXA 2QADB 2VN4A 2J1XA 5BVPL 1R3HA 1YDPB 4AGLA 4IDJL 1I8MB 3LKOB 2A6KB 2A2QT 2BSSB 4NT6A 2P5EA 4P9ML 2R7EA 1FSKB 5IFJB 4EIBA 1I85C 1DEEA 3L1EA 4MCNA 4HGWA 4KAQL 4G6KL 4U3SB 4XGZA 3DK2A 2NY7L 3TFKC 4LRIC 4HSQA 4ZDHA 4ZW6A 5CIPH 1XWVA 1MLBB 2W65B 1NKRA 3H3PH 4G7VH 5B7MA 1R0AH 1YMHA 2GJJA 2VLLB 1JK9B 2CGZA 3ME0A 1T66D 3MTRA 2MIZA 3WFDL 2MMXA 2CQVA 3UABA 5AAWA 5HBBA 1AOHA 1GGTA 4L0ZA 2V2XB 5IJBC 3H54A 4FQJH 1AG6A 4Y8AA 1GGIL 1T21A 2OW6A 4RGOL 3MACL 5F21B 5I1CH 4WZ9A 1KFGA 4XRCB 3HAEG 3QIBD 4L3FA 4O02A 5K39A 3V6OC 4AZUA 2B8OT 4QRPA 1LK3H 1QBLH 4UZUA 4K94L 4X99A 4WFFD 3QUYB 2WIIB 1AP2B 4MZ3A 1EANA 4N8PA 3UG3A 3ZSTA 5LDSA 4IU2A 4KX8A 5E2VL 2JELL 3VXTA 4BXVA 3HE7C 4HKJB 4NFBA 2AEWA 2LU4A 3OM3B 4PWHA 4WFEE 3FT3A 3NCYS 3DI2B 2L04A 3VB8A 1ULVA 4YZFE 1PEZA 3I2CH 1EEZB 4PD4J 3ZTDC 4N1HB 3KPQB 1J8KA 1LMIA 2A74B 2K7PA 4OR1A 3I6KB 4RMTA 4NQXA 2VXUH 5CUSH 1KYUA 4HMEA 5FAAA 2E9JA 4MNGB 5BV7L 1VKXA 3ZMNA 1E4WH 3BZEA 2OMXA 4OFDA 1H0DA 4U1JA 4KQ3H 5IF0B 5KJ7E 2HLEB 3ECQA 3L7EA 4N5EC 1J0HA 4PU2A 4QI3A 2VLKB 2X38A 4R2GB 2LTQC 4KPHH 3ILEA 4PG9B 4QXTA 3QT2A 1BD2A 2JKLA 5ICZB 2R9HD 4OLZH 4MJJA 3M1CA 2VAAA 4K9JA 3TA3C 4PJIA 3GI9L 1UXSA 2CCVA 4KFMA 1J1OH 3I9PA 1GJIA 1C16A 3IRCA 3BRFA 4PY7B 1QKZH 1T5XA 4AYDC 3FO2A 4TPRL 4XCCL 1KGIA 4JKWA 4Q58C 5E2TH 3QDMD 1M2VA 4PYHA 3DUUB 4JDTL 3WCYA 1CXEA 4FG6D 4B3EA 3GHBH 3CVHB 3E6FA 5A16A 4D7PA 3OKKB 4U6XB 7CGTA 2B9BA 5C3IA 3CLWA 4PJ5E 4R4NC 5SWQB 2QVKA 4MAYA 4GAFB 4RDQG 4X0KA 3WHXA 2NY3C 3AU0A 4H1LG 2JTDA 4UT6L 2NW2A 1J0JA 5IROA 4AGMA 4BIKA 3SGEI 2R27A 3MMEA 3FQNA 2UZXA 2D3VA 4AMXA 5J8OA 1T0MA 1WZ1H 3GJEB 3O3DA 4HAGA 5CSBA 4IRSC 4X0KB 1CFSB 5D7LA 1FVCB 3Q48A 3E2HB 1NLBL 4BQ8A 4KK6C 4L18A 3HZYB 3MA7B 3GWJA 4P9HC 4WFHE 1CFNB 2HRLA 4IRSD 1CU4L 3HR6A 3MLPA 1JGDA 1PLAA 5JZ7C 2P44B 4TOYH 3CSTA 2DEWX 4LNVA 1NCHA 1NJ9A 4LPXA 5F8RC 3AC0A 1WFJA 3N9GL 4NZJA 4P05A 3KPLB 2D8KA 5HHME 2DBJA 3VRJB 1E3FA 4RA0C 2K6WA 1MFEH 1Q9LA 4CC4A 2PABA 3M1BA 3VI4F 2VDKB 4D0DB 1KV3A 2DWEA 5FHBH 2WBKA 3ZZQA 4BH7A 2QPEB 4DSYA 5KSAB 3B9KD 4OGXH 1QSFA 3QJQB 2EDWA 1AS7A 3LD8B 4DQOH 3LV3A 5CILL 3OGOE 4HOXA 1HHKB 1IGFH 3VYPA 4KX9A 5JQHC 2EDQA 1W0YT 1E0OB 1J0YA 4FJ6A 3S3CB 3PNWA 3WEXA 1GGIH 2VIRA 2YKKA 4Y19E 3EJTA 3NN8A 4ZQKB 2VO8A 3UBGA 3WENA 1EDYA 4Q9CA 4IOIB 3QZMA 2D2OA 1FFPA 2DL9A 5AWNH 5DDHA 1MW1A 3GSUA 3K8MA 2K7QA 3PDOB 3IJ9A 5JMOC 1FIEA 2V37A 4OCMC 3SYQA 3S5YA 3GSWA 4PWIA 1JPEA 1DFXA 1LD9B 5JHLL 3QUYA 3QE5A 3I2CL 1KJ2B 5HGAB 5DZAA 4JLRB 4YSRA 4DPAX 3K2IA 4OVVA 4X8CA 1ID2A 2VL5A 3GTNA 3O41B 1SYVA 2NYYD 5F93C 3OHXB 4GINA 1DL7L 1ND0A 5CCGE 3P4NB 2WK2A 4HK3N 3IFOA 4R0LA 5E8NB 5EWIH 3K4AA 1KUMA 2FLRT 3LQMA 1V3LA 4MNHB 4XVJL 4ZUSB 1JK9A 4UYQA 4Z3TA 4QTHB 4U6TA 4RGOH 4DP8X 1G7PA 4P46D 3UBXA 4ADJA 3FRPG 3U0WL 1BVNP 1MREL 2D4FA 3GJFB 4BFKA 1FUNA 4N9OB 4O4YL 5AOJA 3NIGE 4OGYL 4YDMA 3U0PB 3D0LB 4URTB 1JK8B 3R4RA 3MBEC 4JPVL 4NWUH 4KI5E 4P2YA 5C09D 4WHDA 3FFDA 3SDAD 3ARBA 1E4HA 4IDLA 1N8ZB 1YUHB 2BX5A 3B2VH 4X9HA 1D7BA 3GQFA 2WB7A 4G6KH 1FCGA 4AJVA 4HZAA 4FQ2H 2CDFB 3BUIA 4P2OC 3UP6A 1ZSDB 3L3JA 5J5EA 1CF8L 1KT2A 4IRJC 1C08A 4NZ8A 3QUGA 3IDXL 4NNPH 4M1DH 5EIIB 3CVBA 2FB4L 3OLEA 4U6YA 5E6ZA 4ZFFB 2HN7B 4OV6F 3UC0L 3AG1B 3MJ9L 3MRHA 2HKHL 2VLRD 1BXAA 2QDVA 3KR3L 2L7EA 5FGBA 4YBQD 4BFOA 5JIQA 2P8MA 3QQ9C 2OZ4L 1O75A 1YN7B 3MXWL 4XC3L 3ZTCC 1JI1A 5ICYB 2BO0A 5ECJE 1KGYE 1TVHA 4PRIB 4XMPH 2BMKA 2DD8H 3UX9B 3N0AA 3KPRD 3DUSB 4X8XA 1KYAA 5F2FA 2OAAA 1JGUH 4NJAH 2J55A 3L2MA 2F53E 2YUZA 3Q8BA 1BJ1J 5JIPA 4RIRA 3QJVB 3LZFH 4C55A 5AVSB 3MI6A 2FJGB 4QRRA 2WLJA 5E8DL 3RG1C 4NUJB 3GO1H 2XETA 1B0RA 3JUYA 2D73A 3BW9A 4R7NB 3VFVB 3VE0B 5DD5H 1GW6A 3RWGA 1RPQA 3ZQXA 5IW6B 1K5NB 5F44A 4JPSA 4J39A 2D7OA 2ZUTA 4HFWB 1I82A 3QUZB 4NQSA 5I75B 4PHXA 4FLHA 1MJ7H 1VAHA 3MYJA 3TH2T 5IQ7L 2G3NA 2OW7A 1K85A 1HCYA 3QPKA 4B0MB 1A3RL 5DI8B 3WNLA 2VDKH 2VLJB 1GH7A 5ERWA 2GSGB 3BGMA 3OQRA 5T1KD 1O9ZA 1RSYA 2A6DA 1PZUB 1JCKA 3MRMA 4CN6A 4G8GE 2XYCA 2C9UA 4NDMA 4N25A 1I9IL 2I60H 2R1XB 4KK5C 2CKBB 3LZRA 3S8WA 3RL2A 4LCYA 4OZIB 4IRJD 3PXHA 4FXGC 4MD0B 5C6TH 3N1FC 4LPWA 1RUQH 4WV1C 5C7ZA 5C8JB 1E7UA 3SQBA 3HZVB 3SJVA 4KKPA 4OCWH 4F8LA 2AJ3B 4HJJH 1RZ8A 3NJHA 3BAEL 4ENED 1CGSL 1DZ0A 4LEOB 3E6HA 4PV9B 1D9KB 3D25A 3FL7A 1JZFA 4G1EB 1YPZF 4FLQA 1O9VA 3K72A 1U92A 1A4CA 1PLGL 2E6PA 2J3SA 1T1XA 4FQCH 5FDWB 4PJBF 3BWUC 5DF0A 1BPVA 1SF3A 2RAMA 1IGFL 1KCRH 1OCRB 4HUXB 3Q5OA 2G3ZA 4YHIA 3L4YA 3ECVA 5EU3B 1E6OL 2C3GA 1V3KA 1FLTX 3MV7D 3QDGB 5JO5B 1XZ0A 3RB5A 1CD9B 4ZAKD 1ETB1 2FO4B 5IMKA 3MCLL 3ZBMA 4N0CD 3OJMB 5J9PA 3VGEA 1YEEL 4XMWA 4OJAA 3BSZA 5DHYA 4YPGA 3ZHNA 1S5HB 3QQXA 5IKCB 2YD7A 5E6YA 4NGHH 4MBOA 4GXVH 4ZNEE 5C0NC 4DP2X 3RZCD 1CK0H 1Q1JL 1HSBA 1JGEA 4HDIA 2V2WA 2VH5H 4KXBA 2VXQA 5DO2C 5HI5D 4ANWA 3FO0L 4XVSH 3VRIA 2BNRE 3BQUB 4YJZL 3TBWB 2E6QA 4ZOCA 2UUDK 4QR7A 1E42A 4OZGA 5FCSH 1P9MC 2G2RA 1V54B 3DX7A 4ICWA 4GAYB 4F8OA 2EC8A 2YWYA 2EDEA 2ERJC 4WO4A 4M93B 4LSRH 2VXVH 3MRIA 1A4JA 1BQRA 3BZFB 2VXSH 4QT5B 1KB9K 1GZQB 2YRLA 4PR5A 3PAUA 3V4PA 1VPOL 2WO2B 3OB8A 1SJEA 5GHWH 4G11A 5D1ZC 5DEZA 3B9KC 3MOAL 5FO9A 4S1QL 3ZE0B 5DJ2B 1L9MA 4KJPC 4O00A 4WSGA 1JZDC 3PL6B 3HUJA 1D7DA 1LWJA 2Q6WA 3OR6A 2GTWA 2A38A 3WSQH 4U2YA 2FATH 3ZSSA 2ENSA 3C8HA 1G7HB 2ESVD 3BUYB 3ENEA 1U8KA 3FPXA 4NPJA 5AW7B 4FA7B 4LOFA 4ATWA 3DURB 2XN0A 3QUYD 4B5EA 5T1KB 3T0EC 4JHAH 25C8H 3GLDA 4WNQA 1T6WA 2D3LA 3ARQA 3T1FA 2A4ZA 4Y5XB 4JFEE 2AABH 2DLFH 5E8DH 4G6JH 3BESR 3NIDF 5EO0B 1DQVA 4KZDH 1OP9A 3KXFA 4P2RE 3JWOL 1MI5B 5K9JH 4YO0A 2GBTA 4NRZA 1F3RB 1FJ1A 1SJMA 4HUUA 2EABA 1U8PB 2IFFH 5E56A 2ICEA 1Z9SA 4AGNA 1MCEA 1MI5D 5ACZB 3ISWA 5FYKE 1KG0A 5FYKH 1OAUL 3HTLX 1E2ZA 4Y4FC 1F3JB 4RZCA 4H2CA 3BVTA 1FV1B 4PJFE 1NCAH 1MVUB 3HMXH 5IBLD 2VQTA 2C9QA 5F96H 1J5HA 3VXSE 1E3ZA 1QSFD 3AUVA 1KTLA 4PJ6A 5IHWA 2ZAHA 2E9GA 3SGJC 4K71B 1QTPA 1PD6A 5D7KE 2YPVL 3ARSA 3QAZC 1HJBC 3FONB 4IKNA 4F58L 4Z7NF 3ARGA 1BXUA 4U4BA 2YMXL 1RUQL 1QLRB 3QFJA 3S37H 3SDXF 1ZHKB 4H26A 3K8KA 1MFBL 2VTFA 1RZ7H 4RNRB 5FYJE 2YRBA 4PJEB 5DJAA 2X05A 4P8QA 4QY8A 2OX5A 2I25N 3MLZL 4X6CA 4X6CB 5LBVA 2E0PA 4L9DA 4PCKA 1EUTA 3D33A 3ZTJG 4HCRH 3ZVVA 3HZ3A 1BQHA 3V4UH 4I5BB 2NY6C 4NKDB 3HPJA 4LLMA 3WOVA 1MAJA 2P5ED 4NZTH 4XMTA 2BXYA 5FYKL 1AZCA 1KIUA 4PGDB 4I0PC 4FNUA 2J2ZB 3MNZB 3IXTB 3L3OC 1MFCL 2CHNA 5T3XD 2XWZA 2BP3A 3OLGA 1UCBL 3T2OA 3UYPA 3DIDA 4HF5L 2AJYL 2A9DA 5K59E 3ZKNC 4RRPM 4NO0A 5FM5M 3QG6A 2Q0ZX 1K6QL 4KH2A 4P49A 4RWHA 5JOFA 4J8RB 3G6JE 4PJDA 4Z7QB 4PEEA 4OD3L 3E8VA 5HJ3A 5CINL 2NY1C 4XZUB 3GIZH 4G7VL 5FWRA 4IBSA 2YQGA 1VACB 4R7LA 4HHAB 2XLLA 3ALPA 5C86A 5FO2A 4F7PA 3WNIA 3SY0B 1QR1A 1YEKH 3ZRSA 4NQEA 5KVEH 1U8CA 3G5WA 1JDDA 2Y5QA 4LNRB 4NQCE 2GC4C 3OMZA 2NY2B 3FN9A 4HJGA 2HG5B 4LLQB 5F0LB 5HHOD 4L8BA 3GMQA 4KI5C 5F9WB 3MOAH 1WLHA 1SXCA 5I6MA 3EBIA 2Y06H 5FOJA 1SVBA 3VTAA 3G6AA 1C8QA 3KVDD 1QRKA 2X12A 3T0AA 4DKEH 4Z23A 2W91A 1ORSA 3UL4A 1XMWA 3LXBA 3MN8A 3AJ7A 3AS1A 5T33H 1WBXB 2DL2A 4GKOA 2VDQL 1IE4A 4QHLA 4U1SB 1B88A 4FQCL 2COQA 3TESA 5FO9B 2BHYA 1J05B 2HLFD 5JLZA 4AIZB 1CLCA 2ZCZA 3SDCC 3ZT7A 1KBKA 2YUXA 5ANHA 1ILSA 4J3OD 4ANVA 2CR3A 2AEIT 4KKAD 1F5WA 1UD5A 3C12A 4NWTL 1TKWA 1U91A 2CU9A 2ZYHA 4Q9RH 4WO4B 4HS8H 4MB3A 4HIIB 4YFDB 1AGCB 4FQLL 3LRSB 4LCWB 3VMPA 2NOYA 4TNWF 4YHYC 3BN9C 1LWHA 4UQBA 1IGCH 2MQGA 2I5YH 3VWKA 1KFAH 2MHAA 3HAEA 1BIIA 3LNDA 3QUMA 3C5SA 5ESAB 1IQDA 3NPSB 3SQRA 5IFHH 4HMCA 4AKQA 4P5TA 1JGEB 4A7SA 1T03L 4Z3GA 3LEYH 2DQJL 4U3XA 3QYCA 4HX1A 3IJYA 4RSYA 4K15A 4BFBD 5LWYH 1KXTA 3PPEA 4NRYA 1K2DB 4M61B 5EMYA 2A9BA 1QATA 1IGYB 2ZNXA 3BPLB 1SQMA 1AGFB 5E99H 2YMXH 4L4VE 3VWJC 5KVGH 4FQHA 3FU8A 2FH6A 5E9DE 2BVEA 4YDVB 2AANA 3BP5A 3VXSA 1ZLEA 5TPWH 4E9SA 5I9QB 4LVNC 4LSUL 4M4RA 3PYCA 3D08A 5AZUA 1XD0A 1FZJA 1PJ9A 1EAPA 2F7RA 2N1KA 1MIEL 2DQUH 5I8KH 4E9XA 2V3FA 3P2BA 5I1LA 5AVWB 2GHWB 2WLHA 4YPJA 4BFIA 4YDNA 3S34L 2I24N 2P8LA 1EXUA 1WITA 1Z5YD 4XVUD 2WWKO 1PZ5A 1D5ZA 4LCVA 5TFSL 3GBNH 1TVDA 4XVOA 3P3RA 4XXCA 5KUKA 3KH4A 4PGEB 3V4PH 4NJ9H 3NSFA 4IGBB 5E24E 4LO9A 1RZ8B 3HC4L 1NAMH 1P7QB 4LEEA 4LLDB 5T1LD 3CX5J 5BXFA 2P24A 3EGXA 1TSHA 3NP3A 1G6RL 1UJ3B 5DZJA 3IMRA 2V5TA 4ISVB 3IDYB 2XRAH 2R1XA 5ADOL 2DDQL 4NDMB 1TTAA 2CAKA 2CPUA 3IDJB 4DP7X 1FNEB 2GSGA 1FNFA 1EHNA 3GMOA 1TSRA 3HHMA 4L3EE 3BEVA 4QHNA 5DFTA 2B39A 4OKDA 3KE0A 4P23B 5DVMA 4I48B 3P30L 5LVEA 1BCIA 4LU5L 2HPOA 1UH4A 5AW1B 2X40A 5I0WA 2AZUA 2NPLX 1BX2A 5BOPA 2P80A 5FV2A 4G2AA 2HLAB 2DQTL 1VSCA 1EA9C 1WIPA 4ZMNA 3UAJA 3H9SE 1UA3A 5EBGA 5BVJA 5SWSB 2O6EA 4IIQA 4AK2A 3BQUC 2Y7MA 3PWVB 3ZTNL 3GSVA 3L6FB 3RWCA 1BP3B 3SE4C 3C5ZC 15C8H 3L3GB 3PAZA 4WO4D 8FABB 1QLEB 1BVLB 4ZMXA 1M1XA 5KYUB 2OS7A 2C7UB 1G7IB 2DJUA 4LLUA 1A14L 4YGAB 4JY5H 3B3IA 1GYVA 2BJML 4DP1X 4XVTH 4GY4A 4YFEA 3FUDA 3MBWB 1NEUA 4EIUA 2J5WA 1R9FA 4GG8B 5F7UA 5EEXA 2H9GA 3QZBA 4QPEA 2X4QB 1DN0B 1MELA 3M7OA 1HL4A 3CSBA 3FHAA 3O2VL 1WC7A 4AH2A 4Z7VA 2AQQA 3BXNB 4TULH 4GQPH 3HBQA 4DGVH 4HJUA 3DIFB 3EO1B 5DJDA 7FABL 1E9PB 4UAHA 4UQ3A 2W9LA 4S10A 1KLUA 4POZD 2NXZB 4L1BA 3T71A 2G5UA 1YN6A 5L2KE 4O9HH 3ZGHA 3QNXA 1XT5A 3HG5A 2X4SA 3MLRL 4YGVB 2OSWA 1GYAA 4XPHL 3B5GA 3J07A 1MUJB 2WYTA 4PJ9A 5CN1A 1CGWA 3KVQA 1R5VA 2XXMB 3EW3B 3QQ3B 3D0LA 3TF4A 3CFQA 2PR4L 4NUQA 4X6FA 4MDIB 1CFVL 1LQSR 1ZS8A 4MA7L 5KEZA 4LFHG 4G6FB 2HKFL 5FF6B 2FO1A 3EHBD 3HAEH 3SDXE 4O2CB 3S36L 4OQTL 2YUVA 1XF2A 2AV7A 2I07A 5LDUA 4LAQH 3ARTA 4P3DB 3QUML 1WK0A 2OPCA 3W3BA 2ENJA 2X4SB 3G04B 3JWOH 5M7QA 3ILPB 1OWRM 2IPUG 3MLUH 4XPFH 1DBML 1NC2A 2HG0A 4RGND 4BK5A 3C60C 4KFZC 1NMCC 4RRPG 2PCXA 1VGEH 2IADB 3A4FA 4JLRA 3SE8L 5IWLA 3VWJD 3EH4B 5AAMA 2R4RH 4MZIA 3BXNA 2A6IA 1E2VA 3US0A 3L1GA 2NR6C 3RDTD 1WCQA 4RFOH 5FYLH 1U8JA 1DQQA 2X4QA 5E8PA 4RFNB 1D6EB 5LGHL 5DJ0B 3GIVA 4QWWD 3PJLA 5I8CB 1TMCB 3OKOA 2FEEL 2W9DL 4YVNA 5JXEA 3US1A 2KPWA 5D55A 4B41A 1J86A 4FFZA 2Z6FA 3OPZH 4RSVA 3WFEH 4B9PA 1M1XB 3FTGB 4YIQB 3MRGA 1PMYA 3VACA 1AFVH 3L3GA 2KZWA 4PWFA 1XGRA 1BMZA 4K71C 3A4AA 3HG3A 2ZYSA 4OGAC 3VGGA 3OAUH 4TSAH 1M71A 1ZANL 1ZV2A 3GUFA 4IU3B 4P4KA 4QHLB 1WA0X 2N7BA 2ZF8A 1B90A 4U2ZA 3LSOB 3UJIH 3RA7H 3DJRA 3W56A 1A3QA 3SYCA 2X4PA 1P9MA 2HP4A 1ANUA 2ZSVB 1GYWA 3C60B 4ALAL 1CXHA 2YXWA 4GW1A 4RMVA 1A4AA 4TRPL 5EBWB 3PFQA 1WIOA 4P9MH 5ELIA 4I4WA 4NQEB 2HJLA 2YAPA 2CDGB 5SWZD 2ICWJ 2GT9B 4YXKL 1GSKA 1S7SB 5T3XE 3O3DB 2WBXA 4MQ7A 1NCWL 3D05A 4RAUA 5F7AA 3MRFB 2OJEA 4S1RL 4XMUA 1XO8A 2JCCB 3ORJA 3CVIL 4XBPA 5FCUH 3UBHA 2M2DA 4J8RA 2P5EE 3ULSB 1I7TA 2W60A 1NKOA 3D4YA 3D69A 5JOFB 5LCVH 4L3ED 4MQTB 1C5DB 1F42A 3LRLA 3RIAF 3IJEB 3VFSA 3VXPA 2VLKE 2NLJA 4GAGH 3MV8E 4ZO8A 1CE1H 1HI6B 3U1PA 5DEFB 4PJFF 3CVHA 4LP4A 4S1DC 2NY5C 1MJ8H 1IKFH 2AW2A 3WJMB 3S96A 3WXVH 1E9OA 1ZT7A 1A9BA 5C92A 2V5MA 2Y4SA 5C2UB 4JPWH 5TDOB 1KLGB 3T77B 5ID0B 3T6WA 4Q97A 3QH3A 4YWGH 4E42B 1HH6A 3BWAB 4QRPE 4UQEA 4HXBL 3WKML 4PW3A 3GHEL 1OGTB 3QHFL 5J11B 1Q9WB 2EDXA 2E9WA 1JWUB 2NY0D 4FNRA 5D2NC 4FI7A 5B1JC 3TBSA 4F1ZA 4FQIL 1HYSD 4N8CL 5IMLA 25C8L 2WN2A 2Q8AH 3F85A 3EJYD 5FYKD 3WUWG 3FONA 1CR9L 4CVZA 3CBRA 4U1JB 4ZFZB 2X3AA 4KO9A 1U58A 4PGCA 5GGVL 3MUHL 4DK3A 5KYXA 1JIBA 4MXVF 3SDXA 4X6DA 3KLQA 3LD8C 4EI5D 1IGCL 2HJKB 2SEBB 4OLWL 4XPBH 4IYKA 4OZIE 5DD1H 5D7IF 2FYVA 3NAAH 3FCSA 1KXQA 2BXZA 4JRWA 4ERSL 4Y1AD 1ZY9A 4LCWA 4FKEA 1AGCA 1W0WB 1XAKA 2NCMA 3C5JA 5JORA 3VXTB 1NINA 3A67L 1V7NL 4IEFB 2DM4A 4K55A 5CEXB 3EGDB 4BDVB 2RBLA 4PBWD 4YHKH 2HUEA 2YHGA 1CF1A 5CZRA 1OF2A 1AGEA 4QRPB 2ESVE 3G6JF 5F7KC 5DZVA 1HOCB 3CVHH 4DW2H 4ODHL 4XPAH 1N4XL 1F56A 3TIDA 4HISA 2EE6A 4Z7VE 4DPRA 2VZ1A 3DOSB 4X98A 1OAKH 4I3RH 4XBEH 1F2QA 1YEIL 1UOWA 3RWIB 3LDBC 4UNIA 4TM9A 1ACZA 4TQPA 4UM8A 5FGBC 4M9PA 3SBPA 3T4AB 1JHLH 2AGJH 3DBSA 4P2OD 4RISH 2VLLA 1RHHB 3KPNB 1USQA 2WNXA 1EAQA 4AKOA 2KT6A 2HT3D 1NLBH 4FXGB 4IBLT 1KJ2H 4IOFC 4LOUD 2BVPB 5EU7C 4KROD 1KGWA 3R0NA 1BXXA 1PU0A 5GGSA 5C0EA 3H4FA 4G70B 4YDJB 1T7VA 3EFFA 2JQZA 4QLRA 1NFDA 4MAZA 5AKVA 2KC0A 1OALA 2FJHB 1NIEA 4F7PB 1H3UA 1G84A 1B4JL 4ODTH 2VDNL 3KJ6L 1UZ8B 1U93A 4QT5A 1AJ7L 3MV9D 4XZUA 2DDQH 3LXCA 5T5FL 3EH3B 1U3HB 3TX4A 2BIPA 1ZLSL 4PJHF 4JG1H 4YHPB 3H2PA 4AWJC 1WZLA 1UXWA 3PL6D 2CCLA 4NQCD 3QUKA 4HK0A 5FCUL 1OSPH 3GSRB 3QEQA 4R2GC 5E1GA 3MJ8B 4TLKA 4N90E 4AT6B 4EMZA 3QDGD 5KJ4A 5T1DL 2J2ZA 1E90A 2XTJD 3W81A 2R0LL 4KJYB 2D7TH 2IXQB 3EO9L 4PB0H 4CW1A 1OP4A 5IB5A 2JWYA 3VTMA 1AIZA 4BZ1H 3W0WB 4FEIA 4L3EB 1KNOA 1QSEE 2CJUH 1UVQB 4G6ML 1MQ8A 2FJFA 2R8SL 4WTZA 3WL9B 4NCDA 2YZ8A 2F19H 2I9TB 3TEUA 2ZE0A 5CNHA 4LSSL 1T7YA 2M8XA 3LNIA 4HETA 4WHYH 3TT1H 1NFIB 3LTVA 3CVCA 3NGBC 4OTXH 3VI3E 2BSTB 2NQDA 3QFJB 4OCNC 1GYUA 1I1AB 3SE6A 5KTEL 3P9MA 4CSZA 4DVRH 1N10A 3FXIC 4WWOA 3S96B 5GRWA 4JM2C 1BFSA 3L4CA 4DOHE 4JFQB 2EADA 3ILDA 4G8GD 1S7RA 3HC2A 2GK0A 1JYVA 3T3MB 2H6UA 1VCAA 1I3GH 3NCBB 1FYHB 5DMKA 3REWA 4DO5A 3CDYA 4PGBA 2W60B 4AVJA 1F3JA 3I50H 3NFSH 3NPZB 1TU2A 3WLWC 1HZKA 3OKMB 4WW2B 3RL2B 5FLVA 1PD0A 1I3RA 5BUAA 3SGKC 5M95B 3KXFE 4R3SB 1QSFE 3I9AA 3VSTA 2V4LA 4JO3L 3NESA 2WQ8A 1JS4A 3O6FC 3Q2WA 4G9FE 3PQYE 4QCIA 1T0OA 3RWFA 3RURA 3KG5A 4AG4H 3VI3B 4WNQB 4U05A 2YAQA 4JKPL 3QDJD 5GISL 1GC1H 3WTYA 2ZSVA 1CFQA 4OCLC 2PWDA 2F53D 3QIBC 2HTKC 4MCYA 3N43F 1B9ZA 2NXYB 3HE7A 5I19H 1N0XH 1IJNA 2DBLL 3IDXH 4NNPL 5GS2D 1HZLA 2UXGA 2O5XL 1RMFH 2IALB 3EJSA 4QHMA 3B7YA 1EHLH 2VRQA 4FYRA 3WLBB 4ZX3A 5JQ6H 2FJGA 5J6GA 2H32A 3QO0B 4X7DC 1GGBL 1MCWM 4U0QB 2EYTB 3MCKB 4FLOA 1MFNA 3BUQA 1KC5H 1HHGB 5F7EH 1F1GA 1MPAH 1XF4B 3RRQA 5C0CD 3GBEA 1BDYA 4HQQL 3ULVD 4UNVA 1K8DB 3T4YA 4FQXA 2CDEA 4K7FA 2WPGA 5F3BA 4G82A 5F6HI 3GSQA 3G9VA 5SX5K 4J3XA 3BZ4A 3TYFA 2X4OA 4G9DA 3BEWB 3VQLA 3DETC 5G55A 4MA3A 3WY3A 4HKXB 5TK2A 1E40A 1B2WH 5E5RB 4RFEA 1SXAA 2ADJA 1AZUA 3FNKA 2ZX5A 1MWOA 3FQUB 3O6FB 4PJ7E 3X13B 3PV7A 3ZO9A 3FRPB 3I9GL 1PY4A 2DJ4A 2YPKB 1GW0A 4YUEL 4DPCX 4EBQL 3JTSA 1LO3L 1D5BB 5IFHL 1EK3A 2YD5A 2CDFA 4PTTB 2EE3A 4GRWH 1AD0A 1JPGA 3ASWA 2J1ZA 2Q7YB 2TSBA 4WW2C 3G6JA 4UTAH 1PPIA 3DVGA 3L5WB 4M6NL 4Q4EA 4Z8FH 4XR8C 5DC9B 2XY2A 2X4RA 1ZAGA 3P4MA 2WXFA 2W0FB 4Y2DD 3BVNB 2QQQA 3QQDA 4JQVC 2BOCA 4PP2A 3ZYOA 5AVZB 3UPCA 1TJIL 1RJYA 3JWNE 3PS6A 4HUXA 3BAKA 1F90H 5EZPA 4QRQA 2PPEA 3NYKA 3DO7A 2OULB 5DS8A 4CSPA 5B8CC 3W2DL 3KLDA 5DMIL 3NABL 3ZKQD 1LO5A 5MP6L 1NCCL 1T2QH 4B60A 4RWYL 4ZMLA 4FXTA 2RQEA 4OCWL 4MYWB 3P69A 1KF9B 4P99A 1ADQL 1CQKA 4DKAA 4BGDA 1IVLA 4XAKE 2L7QA 3AU1B 1IBHA 4QD2E 1IV8A 1LQBC 4R7DB 1JFHA 3GK8H 3ZE2F 2VDRL 2MJWA 1AAJA 2X3BA 4Z7VB 4AH2B 2OMZB 2H3XC 3BP4A 1IAIL 3OSVA 4DP0X 5IV2A 1UC6A 2YAHA 1X5XA 3AAZB 1UFUA 1HXMA 3PDOA 4FYQA 4X7TB 4XMKH 5ERWB 2QR0A 3B9KB 5F0JB 5I8EA 2W07B 3G5YB 4WI6A 3ARDA 4J3VA 3P0YL 1IRAY 4JX0A 4PJHA 4PVNA 5AB2A 1FLRL 2YRZA 3FZUD 4U1MA 4QJ4B 5KN5A 7FABH 3PGCA 2BP5M 5KVDH 4PS7A 2WQUA 3GTTA 4JFDA 2PTVA 1KJVA 4JM4L 1QW9A 5E9NA 4M93C 5C0IB 4P4KD 2CD0A 3O9WA 5A2FA 3DX6A 4JBSA 2UXTA 5C07D 1J5DA 3L6FA 3RWCB 4MJ6A 3TT3L 4IK7A 1AQDA 5DJZA 2E4FA 1GGYA 5B38A 4FG2A 2A74C 4XVTL 3FT2A 1NL0H 2PPFA 4LPUA 1GIGL 1QNZH 2M26A 3PXJA 4FNSA 4MVBD 4WKZB 2NSXA 3T65A 4BQ6A 4FA6A 2BSCA 2VT0A 4IOFD 4LOUC 5SWZB 1FN4B 3O3EB 1ITBB 5DR5L 5IB2A 1ZHLB 3ZMEA 4Y89A 3SSGA 1DJZA 3ABLB 3O2WH 1S7UA 1SHXA 2HA1A 4H1LB 35C8H 5CSGA 5IMMA 3GEFA 3C5XA 1I7UA 1L7IH 2BM3A 3U48A 2FNWA 2W0LA 2YK1H 4JFXB 5I8OH 4LSPL 1FP5A 4MCZB 4K5PA 2WBJA 1BGXH 1EJFA 1H9VA 1U6AL 4KRLB 1G43A 4ZUVB 5TDNA 3V4VB 4EZMA 2V3EA 3FF8A 3LVEA 4IRZA 4C59B 4AMWA 3L3KB 5I30H 4HP5A 4JZOA 1WFIA 3AM8C 1MW3A 1GAFL 3FQTB 4KRPB 4X8JB 4XP1L 3SDCA 3KPRE 4JKPH 4UT7H 3OKNA 1C08B 4X6BA 3FCGA 1AXTL 2NTFA 4WI5A 5AUMB 2R2EA 3B1TA 3JVGA 5BV7H 2QPSA 4K3JL 2F5BL 4N9GB 5BV7B 3G5ZB 5I5MA 3W39B 4HC1A 3DUUA 1FNSH 2AJVH 2NYZA 1J10A 1Z9NA 2GSMB 2GJ6E 3FT4A 4YNYA 3RE0A 3A23A 4JN1L 2DD8L 1EAPB 1E9QB 1FO0H 5E6IC 3NSJA 3QIWB 3S2CA 4P5TC 1KDIA 2FH8A 2H1LM 2NYYC 4MMZA 2D3NA 5GGTH 2JXMB 5MEOB 4YDVA 3VXSB 1T1WB 1H6UA 1MCNA 3F84A 1XGUB 2B20A 3ES6A 1NIAA 1X5KA 2IH3A 1ZA3B 3KD4A 4HH9B 1AGFA 3AT9A 4WFED 3DX2A 3OHXA 3VNYA 5ILTH 1SJHB 3QUZC 3L3OB 2MNWA 1JRHL 1BZ7B 3DK0A 1RD6A 2PKDA 2MOQA 4I7ZC 1KJ2A 1NM4A 4JZJB 2FT7A 1VRSA 2ATPA 3GMMA 2E9IA 3QUMB 5I71B 1HX0A 3QQNA 1YEJL 3S7GA 2MHAB 3HAEB 2H3NB 5C0GB 3HB3D 3HKFA 1XR8B 1YEDA 4I9XA 3FSOA 4OZ4B 5BQDA 1PZAA 2PCPA 2EH8L 1U8LA 4K5LA 2R1WB 2DJSA 5DDHB 2AXFB 5INCB 2APVA 4QTFA 4HIIA 4AMKH 4B9CA 4OZIF 1T89C 3AY4C 1EUUA 3NK4A 4NAMA 4Z76A 5J7CC 2QV4A 1BBJB 2ZOUA 5IJDC 1DUZA 2PPCA 3L4UA 5HHXL 2W0PA 2ZNWA 4PRID 3FU5A 3N0PB 4CVXB 5F3HB 2A3TA 2Y6SD 1ACYL 1T0NA 2O93L 4D0CB 3DRTA 3BAEH 1XR9A 4C4BA 4BCXA 2OP4L 1FWXA 1A21A 2YKLH 4JHZA 4G7YH 4N6RB 2Z65C 2HVJA 4LGPB 5ENWB 5KSAA 1I1FB 3WS6A 2GI0A 5FYJL 5CR1A 4KDWA 3T8VA 1QRND 4PJXF 4EN3A 2F8XC 4K9EC 4F9LC 4GH7B 1QNIA 1RUKL 2MFNA 2F8IA 2X2IA 4UT6A 3WMPA 4L9LC 1XB8A 1NJ9B 3QQ9D 4G43B 2F68X 1MF2L 4WWPA 2V3DA 5C7XL 2O4EA 4K9EH 4OLUH 2WVVA 4YBLC 3V4LA 1QFWI 2IDTA 4YX2H 4OZFA 5IQNA 1PF3A 3DVNB 3JWDL 1YEEH 7TAAA 3Q9PA 4HHAA 5FHAL 2RH0A 1RVFH 2PO6A 3HEIB 1Y07A 3OKNB 2QKIA 1HL9A 4K3EH 4OGQC 2D0GA 1SDDA 1LO2H 1WPCA 3H9HB 5AZ2L 1SDAB 3CXDH 3RZCC 5D1ZA 3B43A 3HI1A 4Z7AA 2YIHA 3QG6B 4M6MH 1DVFC 3D09A 4M03A 5DVLA 3FB8B 1NBVH 4OZFG 3KGRA 5D96B 1X5MA 4EQ3A 3CSFA 3U2IA 3ARFD 1ZTXL 3BCDA 2VLRA 3D07A 5IVNA 3TO2A 1ESOA 5E9DB 3V0WL 4CKVX 4QTIH 1PKQE 2C34A 3A3YB 3LZQA 4PLJD 4BXSV 5KG9A 1YNLH 2J5LB 2EEDA 4TS6A 1S9XA 4EUPA 3HPJB 4LLMB 4LKXB 3RAJH 5EEZA 4HJ0C 3DPBA 1JE6A 3S4SA 4F8QA 1RU9H 2K3HA 3HZKB 3MRPA 3LEVL 5SWZA 4PJ5D 1EHLL 4XT1C 4FTVA 3ZY7A 4Z3JA 5I1AB 1IC4H 4LFHD 1LE9A 1T20B 4FFYH 4OLWH 5K9KA 4WKZA 4AENB 3O2DH 5JZ7D 4PG9A 4QXTB 2VGLM 4AV4A 4IS6A 3EHBC 4M7ZC 5FHAH 1YY8B 3X1EA 4KHTH 1ZHKA 1MG2C 4PN6A 2B5IC 4KZ0A 1OGSA 4W70A 9CGTA 4KTGA 3ARGB 5K93A 3T04D 3M46A 1H0DB 4X0NA 1OZUA 1KIPA 4B9GA 4ELDA 1AVAA 3KYMB 3FTZA 3WKMH 2FX7H 4PJHB 1TT6A 1YEKL 3ZTEA 5HHQA 2CXGA 3WE1A 5ANMB 4GS7B 1MCPH 2E4TA 4ZMPA 1MVUA 2WZ0A 3WELA 3Q2VA 2XTLA 5BZWB 1GOFA 1J8HB 1F3DJ 5AB9A 4G8IA 3MV7A 5CINH 4KKLC 1GHFL 1DVQA 3IT8D 2J4WL 1TNMA 1B9KA 4X4MA 4ORGA 1IZKA 3WFHB 3FTYA 2IC2A 3CFCH 1FFNB 1U8PA 2Y72A 1A6UH 4RLDA 3RX9A 4IM8A 5K39B 1SJXA 1IAKB 1MFMA 2EIBA 1MI5A 1N2RB 5C0DB 1MFAL 5ISZD 1KCUL 1JNHB 2GB2A 3CDGA 2QTEA 2NR6A 4LAJH 1UACH 1UUNA 3ABMB 4WEUD 1PDKA 2VZVA 1L4IA 2YXFA 3HFML 4L23A 4ZTPL 1OP5H 2WN3A 3DO7B 1F11B 1JXDA 4HUNB 4WTQA 4QRQB 2VDPL 5JXEC 3OBAA 3IBOA 2AXHA 1T1YA 3U9UA 3BUYA 4FFYA 3TM6A 1OPGL 4ZDHB 1JG9A 3MKGA 3MGTA 2XCMC 4M1DL 4R97B 5IFJA 1OW0A 4FRWA 1W16A 2VKXA 3HR5B 2JVUA 5D2LA 4PJCE 5ALBL 1S8DB 1R3HB 4N3UA 1F45A 5C0FB 4XXWC 3DPDA 3ZYJA 4M6OL 4GKNB 2HYMA 2PCFB 5E6UB 2OL3A 3GXIA 4S0TD 5IOPA 3D6GA 2A5UA 5I73C 1R5IA 4GW5A 4HPOH 5TF0A 4JFDD 4WIQA 4OCRH 1QFHA 4HKBA 2DLTA 4GXUN 1QBML 5CF3A 3VG0L 2C5DC 5SWSE 2PN5A 3QISA 4YHNA 3MV11 1PSKL 4MX7B 2AQSA 4HJIA 4MHHI 2XZQL 3KWXA 4YXHH 1MKFA 5CP3H 2CHZA 3T2QA 5DHVA 2A73B 3SKJH 1AKJB 4C83A 1AJ7H 1TNNA 4TQIA 3NG5A 1EO8L 4UYPA 1FNGA 3OPZL 3QEGH 3F7LA 4HZ1A 3RWJA 4L37B 4CVUA 4O2FB 4Z7NB 3ARXA 1U95A 3V10A 5HYJA 1OTTC 2EO1A 1D5XA 4FZEH 2QLVB 1NFKA 5EV7A 2EYTA 1E5AA 2WIMA 5E0QA 4W9HC 2DYPD 3BMVA 1XQ4A 4Z77A 3VGFA 5KANG 1UJ3C 3HKZA 4PRPB 4QAMB 4TULL 4H25A 4RMWA 4ZMQA 4V1DA 1P4IL 3DGCR 2AK1H 4Z7UA 4OFKA 1NBCA 4JCLA 2R56L 1M6UA 2Z91B 4FN0A 4ODSH 4Z5RB 5JHDD 3C9NA 4M43L 4OZHF 3HVNA 2QHRL 4R90L 4TQ8A 3NJVA 3C87A 5E8EA 3PGFH 4X4ZA 4QLWA 5A43C 3RTLA 1PY0A 4S1QH 3T5WA 1JF5A 1JHKH 2R29L 4GMSH 1JBJA 2ZXQA 4KV5F 5I1JL 3EJUA 4PV9A 3O9WD 2N01B 1BF5A 4HA1A 3PHOA 3SKJL 4CBPA 1C8PA 1N5AA 4LL1A 3X1GA 4MA7H 5AW5B 3SQBB 2V9UA 2EC9U 1NSNH 4S1SH 1ZTXE 1I3GL 5D1XE 4MAUH 1C12A 1C12B 3JT2A 3LZOA 4WW2A 1F6AB 4YLBA 3QEHA 3ARVA 3UIZA 1UWGH 3TCLA 5AVYB 3AG2B 4TN9A 2VDOB 5TE7L 5I19L 4G8GA 3REWB 5DMKB 4WI0A 3T6VA 3WJLC 4FDWA 3NMEA 1G1OA 1XAUA 3ZZ1A 2WKOA 4Q4IA 5CD5D 1VGEL 3NPSC 4ZMWA 1THAA 3QC5X 4QYAA 5DK0A 4DP9X 4YHOH 3NFPB 5DFVC 4MJIB 1KIQB 1NFAA 2CG9X 3RVUC 3FOMA 4HFWA 4NQSB 1EJOH 5L4IA 4X6CE 3MA9H 3OLIA 1HXKA 5CJQH 5IW6A 3VJ6B 5IB4B 4PWJA 3EOBA 3DOHA 3BKMH 4NX0A 4AQEB 2VB5A 3FH5A 4FQ1H 2DMCA 2DQCH 5CIPA 1WUNT 3IETA 5TDPA 3DWTA 1EHKB 1DQMH 1JERA 2AMUA 4IDJH 2H5UA 3QQ4B 1NICA 1XL4A 5D7IB 4PI0A 2AERT 1NEZB 1A8ZA 1B0WA 1NCUA 1U95B 4FULA 5KJRH 1U8HB 1UA6H 1XMEB 4CW1B 5MP6H 1BFOB 4MXQD 5FKAB 2NUTB 3WNOA 5DJXA 1TVHB 1KYOK 4PRIA 1I8LC 2A73A 1I9RH 3IU4L 1XVSA 2MCPH 1C9SA 4ZSOA 3F12B 1G9EA 3LY6A 4J3OF 2ED7A 3SKNA 3W1ZA 1MY7A 1UD6A 3QP3A 4K3DH 4OLXH 2GK2A 4IKLA 2Q7NA 4NZUL 1UXWB 3DSFL 1HKLL 1NGZB 3BLBA 4OM0L 3X3FL 5HDLA 2HN7A 2VN3A 1U3HA 3N6YA 4NKMA 5FECB 1E6JL 2H6PB 4L1SA 1O6SB 4NNYA 1M7IA 1FL3B 2C3WA 3OAZH 3SQOH 5A2IH 3RVVD 4JR9H 2FX7L 4QRFA 4OD2A 1IBGL 2K1MA 4GSQA 1FO0B 2H41A 3VG9C 3TC9A 3WFCL 2IQAA 1E4WL 4QXGH 3EBAA 4NQCB 3U46A 4FABH 3P77A 5TGBB 1QOKA 3OKYA 2V7NB 1SGKA 4FLSA 5IVXE 3BH8A 3LN4A 3EFFB 1AACA 1B2WL 2B2XL 5AKRA 2HLFC 2CM5A 4IRSB 2F7IA 2I85A 4NP4H 1R75A 4B9IA 4LDLB 3APCA 5FK9B 1QG3A 3NVQA 4QXVA 3BAJA 4HLZG 2CBMA 5BRZD 4ZUSA 1RZKL 1UT2A 1ZVHA 2FDBP 1F11A 2MEJB 5AENA 4KZEL 4UQ2A 3CSPA 3TEWA 2YXMA 5E2TL 3IFOB 1ETJA 3RWIA 2FX9H 4UZSA 3V4VH 3S36X 3GBMH 2OMBA 3E3QC 3VSUA 4ZQTA 4GPVA 1PKQB 3WV0A 3P3UA 5C0DA 4X5WB 1Q1JH 2HFFA 2NQCA 3ABKB 1CD1A 1HEHC 1CLOL 2EIKB 4U49A 2Z92B 3I75A 4KJQD 4XO9A 2UYLB 4AQ1C 3TPKA 4Q7DA 2OTPA 4PY8J 2E56A 1JXJA 2V5RA 2AQ3A 1ZHNA 2NY0C 3II1A 1S7XA 2ED9A 2OYKA 4GQ9H 1OCZB 4N0UA 4F7TB 1VFBB 5B1AB 2JJWA 1OE1A 2PWHA 3HVDA 4H0HB 3NN8B 1BF8A 1LEIA 2R23B 3QHFH 5C0RH 3NCCB 4L4VA 4ZXBC 1UB6B 2C1OB 2CR6A 2VZSA 5C08A 1YPZA 3MRCA 2XFXA 1PKOA 4Z7WE 1G6RA 1DN2A 4UIMB 4TUOB 2V8MA 3ZXAC 1ZSHA 3NCFB 3GSXA 3P2TA 5A3IC 4XVUC 4WLCA 1RV6X 1X5ZA 2JCCF 3QORB 4WI4A 5FO7B 4D8PA 4N2IA 2YA0A 1JYWA 4FTVB 3BKCL 4MJ5B 3PDGA 4YR6A 5JW3H 4KDTA 4LKXA 3TBBA 3HW7A 3VRJA 1I3UA 1KLGA 3K0YA 2X1QA 4IGBC 3BKJH 1KPRA 1E9OB 1ZT7B 2B14A 2CRMA 2W9EL 3JWNH 5JQIB 5GRVL 5H35A 3H9SB 3I74A 3BIKA 2H8PA 3ESUF 4WK4B 5DRXB 2WLMA 5HHPB 3K71A 3VXUE 2XN2A 4KOBA 1T22A 2BIQA 4YHLH 3L5HA 5FLUA 3QARA 3D69B 4AW4A 3ZKSD 1GY2A 2GBAA 4TUJB 3FO9B 4WJ5B 5I1KL 5BZDB 3S5LG 3MFGB 3VXNA 2OJEB 4EIZC 3QS3A 5KW9H 2DZEA 2X4TB 3F04A 4CN4A 5AW6B 1OOWA 4ELMA 1U8MB 4MYPA 4YN3A 1QYGH 4NHCH 4OZFB 1LXMA 3D39D 1F0LA 1JV5B 1NANI 5JHDE 1E4KA 1IKFL 5EBWA 4I8DA 5F7WC 4W1TA 4GRMA 4GRLB 3MJ6A 2XHNA 4LCUB 1G6RH 2WWNA 4EXPX 4KTDL 4OFYD 3R06A 5JXAL 1JXFA 3FFCD 3OR7B 4IRJA 1ZEAL 1F4WL 1YHPA 3MJWA 4HMDA 4UQCA 4Y5YC 5DUBB 1R1CA 4HS3A 2FIKA 1M42A 5F1SA 1MIMH 1K9TA 1DL7H 4G6FD 3ELAT 4GUOA 4JG0L 4GKSB 3G5XB 4PJ5B 1S9VB 1BJMA 4QJ5B 3HNVH 2Y7SA 3L7EB 2BVTA 3TCTA 1T6BX 1OTUC 4PJBB 1TQBB 2PW1A 2WZ6A 3QCTL 3KCPA 3T1WA 3BZEB 1BLNA 4OZHE 1BA9A 2WTRB 4HSCX 4HWZA 3HZMA 5FYLE 3MOBL 4ALAH 4N87A 2WVSA 2H7WA 2OMWA 4GUPB 4AYFB 4F7MA 1HHIB 4JM4H 1U8LB 2E75C 4GRLD 1MH5A 2JKXA 2YAFA 3KPRB 4U4IA 4TVUA 5DJ0A 5I8CA 4QRTB 2AMGA 4JFFB 2AJUL 1AQ8A 2W8CA 4X80L 4AIEA 2OL3H 4PJ8B 1BREA 1ET5A 1QR4A 4IU2B 4AVHA 2EDYA 1A4KB 2E59A 2ZCLL 3NUKA 4ZD3H 3FKUS 4WU7B 1FYTB 4PRNB 4IJTA 2XBZA 5EU5B 5JHDA 4P2RA 5HVWA 3RP1A 2OSLA 3KW7A 5HDBE 3EYUL 2J6WA 3U9PH 4IHOB 5HHXH 1ZA3A 4JPIA 3LHAA 4FL4B 3AROA 4JE0A 4MZRA 3NZUA 5EEWA 4IRZH 1H3GA 4C4KT 4N20A 4WTXA 1FFTB 3CHRA 1MH5B 3BAWA 3KPRA 3NZHH 5CZVL 4MMZB 3DRQB 4L0PB 4U3CA 4W9FC 4AYFA 4F7MB 4ZFGH 4KXCA 4R90H 5GGUB 5I6LA 3EFOB 1AHKA 1VEMA 4MDIA 1JGUL 4NJAL 3FT4B 2DH3A 4W9LC 4FG4A 2EVHA 3VGAC 2VJ8A 1TLKA 1I8MA 3QWRD 2AJUH 5E4EC 1RHFA 1VJSA 2VR9A 3IPFA 4FTVD 2RACA 4NP4L 2OTUB 2ZKMX 4U1NB 3SDYH 9PCYA 1KEGH 1ONQA 2OR8A 4Y9BA 5IMOB 2R2EB 4BZ2H 3D18A 4LBEB 4TL5A 4F15B 4M56A 3FT1A 5F70A 3FW6A 3R18A 4JJ5B 1JTOA 3DIFA 5DJDB 4L8DA 3RIFF 3TNNA 1BECA 1X5LA 1F6LL 3ZDWA 2N3JA 4PREA 4YSAA 2IG2L 3CLEH 2VDLH 1GOGA 4YBQC 1CG9A 5AAPA 1YZZA 4AEHL 3N3EA 4XNMA 3IJSB 1VADA 2L7UA 3OGCA 1IGJA 4MDJA 1P6AB 3HRZB 1FO0L 1CL7I 2FSEB 2WGXA 1CLOH 3BFWA 1UH2A 2XPGB 3OL2A 2ADIB 4UI2A 3S3BB 1N9PA 4LLUB 1N0LB 3MLRH 4MASA 3K81A 3KYAA 4NLAA 3UG4A 3LPOA 1MAKA 4EEEA 8FABA 3MRDB 2IGFH 5TQ2H 3WI9A 1FN4A 4FTDA 5DRWB 4FKHA 3TWCL 4FCAA 4HJTA 5H2BA 1IGIH 1IKOP 4L5FH 5D6DA 4JUSA 3FT2B 4X9FA 5F7MC 4NKQB 5GSRA 1GXEA 5E23A 5HYSA 1H5BA 3EDDA 1L9RA 5DRXA 1HQ4A 2LLLA 1RIUL 4GLRI 5IG7B 5C0IA 3D48R 2DKSA 5BV7C 3IGAA 1JZJA 5GS0H 2B1HL 1ZVSA 4AMKL 4AEHH 2XIIA 3UTZB 5BCAA 3UADA 1G94A 1QAWA 3CHOA 3ZT6A 2KKQA 4MMZC 1MIML 4YEEA 1WYJA 3FB7B 1RULL 3JZ7A 4MXQC 3MCLH 2XQYA 1L0YA 4N1CA 3ZKXC 5C9JB 2AP2A 1IFHH 4XCCH 5F6IC 4YSCA 3D39B 4APQB 3WNJA 2W88A 3FT9A 3MRCB 4C4KO 3WTVA 5DMIH 1CBVL 2CO4A 1WISA 3ML8A 1EFQA 5G4OA 2XICA 3VI4E 2AC0A 1W72H 2VH5L 4JQIA 2XKUA 2O6PA 3ULAB 4X4XB 1Z9LA 4ONGL 5GGRY 3LHPL 3QFDA 3VFTA 2BPBA 4GB9A 4N4YB 2MRYA 5IK3B 4NQUA 4HLJA 4BGLA 4BFIB 3ZOAA 3FQYA 1F6FB 3HJEA 2E7LA 3GSNB 3W57A 1L3NA 2FJSA 3QPXH 5C0CB 2F8OA 3KL3A 1FZJB 2ICEC 3NSYA 3P0GB 1UURA 4POZC 3SCMA 4HPYL 2EH7L 2ICWI 5D9SB 1SEBB 4XP9H 3S35X 3P3YA 3ETSA 1YG9A 2JCCE 2LGNA 1KN4L 1GPOH 1PKQA 3FUEA 5B1KA 1QFWL 5HI3D 3H2WA 1DBKL 4GKZB 3SDDB 3G5VA 1BFTA 3JTSB 4F58H 5D7HA 4ELKB 2YPKA 4TKWA 3SO3B 2E9BA 2EDDA 3VH8G 4E9VA 4HX1B 1GKEA 1XF1A 2GTZB 4Q6YA 2HRHA 1T2QL 4H7VA 4U31A 1JZ6A 1S5IH 1EMTL 3FQRA 2Y1VA 2EDOA 1TEYA 2ZKHH 3GZKA 4G5ZL 3EGSA 4ZS6C 2GUOA 3F7YB 1ZGLB 4QTIL 2NZ1A 2QZ5A 4NNXA 1T0PB 2N4IA 2ARJB 2Z8VC 3O81A 3UTQA 3FU9A 3JT0A 1TYEB 3QR2A 4WKXA 4PGJA 3V6FB 1W8EA 1KGXA 3DKHA 3RKPA 3T8XB 5IB1B 1IFGA 4AEIH 2BSRB 2EEFA 2HT2D 2W1NA 4RMRA 5F7DB 3U2SA 5GJSH 3CH1A 3GSQB 1S9YA 2JCWA 2YS4A 3QJHB 5LXGH 3EDJA 3QO1B 1K8DA 4A04A 4EI5A 1CYXA 1J0KA 4K3GA 2XV0A 5EO9A 5LQBL 2X1XR 3NIGF 1QSEA 3GXTA 2OK0H 2CIIA 2UV3A 5JLZB 4K5NA 4NKMB 1P0SE 3HLAA 5J6GB 3MRBA 4M1GH 3U7WH 5IFAH 2YPLB 4G7QB 5EZIL 3L4TA 2IALA 2CNYA 3MA9L 5CJQL 2OCFD 2WLYA 1T04B 1PJWA 3BKYL 3TWYA 5FW6A 1XGQA 4RMSA 4X2UA 4DFIA 2OBGA 2VM3A 4NWTH 4NXSA 4HU8A 3S35H 3QEQD 1IIIA 1JP5A 3PJSA 1W15A 2N59A 4P4RB 2YXVA 2OZNA 1BZDA 4MD4A 4Z9KB 1N3NA 3CZUB 2YGOA 2X4UA 1P5UA 2ZAIA 4GAG