2ADFH

Crystal structure and paratope determination of 82d6a3, an antithrombotic antibody directed against the von willebrand factor a3-domain
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
218
structure length
218
Chain Sequence
QIQLVQSGPELKKPGETVKISCKASGYTFINYGMNWVKQAPGKGLKWMGWKNTNTGETTYGEEFRGRFAFSLETSVSTAYLQINNLKNEDTATYFCARDNPYYALDYWGQGTTVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Paratope determination of the antithrombotic antibody 82D6A3 based on the crystal structure of its complex with the von Willebrand factor A3-domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting/immune system
molecule keywords Von Willebrand factor
total genus 46
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2005-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2adfH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2adfH02
4PYHA 1XGTB 3NZHH 4JFDA 4OUUA 1OSZB 1BVLA 3O2VH 2H1PL 3AS2A 3TBWA 4P4RB 4YGAB 3SDXF 1KOAA 2AI0H 1K5NA 3G08B 2PXYC 4Y2OA 3NFNA 4ZYKB 5DMKA 4JPWL 4UUJA 4AL8H 1IRAY 4DWHA 1XGUA 3LH2L 4U1LB 5GRVL 5EU3B 5ISZB 2HJFA 4ZS6D 3FFCE 1YZZA 3HA0A 5JW3L 2FHFA 3N1PC 1GGYA 2ZUUA 2I25N 3CDGB 3GUTB 1X7QA 5JO5A 2PTTA 2LVCA 4OCXH 3OR6A 3GZKA 4TVPL 4X0KB 1A7RL 3HZYA 1TVHB 3TVMB 1DUYA 4EXKA 3HCVA 3AVEA 2IAMB 3OKNB 3K3QA 1WC7A 4U05A 3H9SE 1S7RA 4KI5D 1ZMYA 3TV3L 4KMTH 3O3AA 3WFBH 4KKLC 5FB8B 4TOYL 3GSVB 3S4SB 3B4NA 3L3IB 1GZQA 2ADFL 4X7SH 5DLML 3RP1A 5EIIB 4Q9RH 2H3NA 5DDHA 4HH8A 3VXQB 5C0AE 1QR4A 4QRRB 4XNXL 1WIPA 3PQYA 2EEAA 4Y4FB 2CXKA 3BDYL 3TH3T 3UJIH 5SWQA 1NAKL 4UQ3B 2NX5B 3MRIA 4AY0A 3R06B 3F8UB 4HMDA 4OD1L 4F9PA 1TNNA 4PJAF 3MBEA 3QIBD 4JZOB 3PHQA 3T0XA 1HQRB 3QG7H 1FC2D 3ZT5A 5EU6E 4OQTL 4PJEA 1XF5A 2VDQL 2CGRL 2ZSVB 5CJXA 4HIHB 4YBQC 3WFDH 2Y9RT 3C6SA 4X6CB 5IBLD 3NVQA 1FAKT 1AGCA 1Z5LA 1J8HB 1YN6A 3RU8H 2FEDD 3DPBA 4ZO9A 5D96B 3TO2B 1RMFL 5EBLB 3MLWL 2GIYA 1AC6A 1T20A 1QRND 1LO5B 4NNPH 1V7NL 3MV7E 1GHFH 1CD1B 4XXCC 4E5XA 3KYOA 3NZ8B 3UTZB 3TBSB 5EU5A 4MA1C 1R3KA 1EX0A 1WUNT 5I0DA 1ZT4A 3OKKA 2YPLD 1BIIA 1A14H 1I8KA 3AROA 3EOTH 4KHXH 4KI1A 1FRGH 2YR3A 5A2FA 4PV9A 5KVEH 5KZCB 1WCBB 3EYOB 3VE0B 1KTKE 4LCUA 4MD5A 5D7IA 3RWDA 1MF2L 3PWPA 2DM4A 2NNAA 2QL1A 4KTYA 4LLVB 3C2SA 2VDRH 1LNUA 1DQML 3GIZH 4WUUA 4BFGA 1MCHA 2P24B 1I7ZB 3WKML 5HHVL 1AXSB 1C5CH 4C83A 5FXCH 1U8PA 1RZGA 3STLB 1Z3GH 4KJWD 4WO4C 1RZ7L 4NUGL 4S1SL 3O6ML 1TTGA 5F3BA 3IS0X 3MV01 2AQ2A 3B9DA 2NY5C 1A02N 3V5KA 1RUAH 3PDOA 4NQXA 5TH2A 3BPCA 5I1LA 3G5VA 3QUXB 5SX5H 3K4ZA 3GMLB 5E8NB 3SEPA 1RIUH 4NO5A 5DJ8B 5GRUL 4U1MB 5IMMA 3NZHL 1XF1A 1ZSDA 4HWNA 4YZFE 3FRPG 4W6XB 3HC4L 1OAYL 4YPGA 1UXSA 2B1HH 4HK0A 4RGOL 5I73C 1HXYB 4NQEA 4KRPC 4N0UA 4EI5C 5KS9B 1W2KT 2HRLA 4QT5B 1O5DT 3ZKMD 1O7SA 5T3XE 3O11B 1FORL 4M7KH 2X6MA 1IAII 4WI9A 4XPTH 5JXED 3QXDB 4K94C 2HJLB 3RWIA 4M7ZC 3H9SD 2FX9H 4M43L 1QHOA 3UZVB 5T5FL 3WCYA 5LGHH 1F4WH 1EHAA 4PJIB 3MLXL 3QH3A 5DUBB 4LNRB 1FH5H 1MFCL 4XC3L 5CZVL 5GGVH 3CFDA 5D2NC 4OCRL 4XBGA 2XACC 2E6PA 4GRWH 4ZFGH 4EN3A 3JVGA 5IQ7L 1I1YA 3L3GA 5EO0A 2YRZA 5F89B 5BVPH 1WAAA 1PEZA 4DGYH 1KXQE 1MCPH 5F7KC 4KMQA 2N1KA 5IVNA 2Q7NA 1HHJA 5HHNA 4OTXL 5JNYB 4PTUA 4J3SA 2JK5A 4MMZC 1C8PA 4U33A 4KRPB 4PJCB 4HD9A 5TQ0L 3KXFA 4ZTPL 4XPHL 3ULVD 3N85H 1QFPA 4XPFL 2B5IB 1CD9B 5I15L 4OZHB 5FOBA 5E6IC 2AGJL 4QKXB 1HYSC 5T1LB 3ZMRA 5IB5A 1Q0XH 1ZLVH 1NGQH 5CEYA 3VXRB 4EDXA 3MCKB 1H3XA 5BZWA 5C0JA 4KVNL 5J1TC 4OSUH 1MI5E 4JZJC 3GKWH 3JV6A 4OCYH 3K1DA 4Q6YA 3MRCB 3UJTL 3O45B 2XWTB 4QTIH 5TE7L 1CGSL 4W81A 4YHKL 5GSRB 1ORQB 4C57C 3O6FD 3DLQR 2UV3A 2Z31A 4YQXL 3C60C 1MCWW 5IVXE 4KRPD 3BFOA 4JDTL 3OX8B 2BRRH 2HT4D 4YHPA 4N0CD 4OD2B 4LHUG 1U8OB 4L3CA 3I6KA 5IB1A 4JE4B 3ESVF 4DQOL 3O4LB 2VDLH 2I9LA 3C8HA 5DRXA 1A7OH 4EN3D 1HWHB 4TPRH 5CP7B 3NTCH 3RWCB 5ADPH 5JXEC 1HHHB 1RK1A 2IF7A 5LQBL 5CUSH 4WGWB 5IFJB 3TJHC 3QULB 1VEPA 3GRWH 1LEIA 4BUHA 2GK0B 4BFBD 1N2RB 4OM0H 1NCUA 1XZ0B 4NUGH 3WV0A 1XF2A 1TJIL 1L4IA 3MJ9H 4WY7L 1NAML 4L8DB 5D5MB 4U0QB 3F58H 3IXTA 3LKOA 3KPRB 2DJUA 1A4KA 4HWEL 3QQ9D 5HGAA 1L7TL 3AU1A 3BKCH 1V3JA 1OAKH 5A1AA 1I7UA 3ESUF 4MJ2A 3EO0A 4ODTL 2YPVH 3VGHA 4R0LB 3V95A 4ODBD 1E27A 4JKPH 4O2EA 2LFGA 4IMKA 4NCC2 5AYQA 1I7TA 2NY5L 2RFXA 1LO0L 3FO2A 1IILE 3T8XA 4CL7A 2EE6A 4BH8B 3AS3A 3MA7A 1AXIB 3IJYB 4MXVF 4Z6AT 2I07B 4NO3B 1G7QB 3H3PH 3K2UL 4TTDD 3W39B 4F2MA 5MEOA 4DKEH 2K3TA 1I8MB 4IBLT 4X6BB 3OAYK 5FM5O 5EU4A 5CJQH 2R23B 5I8CB 1OQOA 1KJMA 2E3VA 2G75B 4N8VA 3MOBL 3MJ8A 2LTQB 1OWRM 5I1KH 2UVFA 4ZFFB 2MFNA 1A6WH 1G1CA 3CSPA 3G6JA 4J7RA 3RJDA 5K9JH 5CZVH 3QIWB 5DRNB 1OB1A 4KAQL 5B38G 4MAYB 3BPNC 1JIBA 1WT5A 4R6UA 4X6FB 2XFXA 4NQCD 5AUMB 1RJCA 5DI8A 4I1NB 4RAHA 2ED8A 3L3JB 2G9HA 4R26H 3LHPH 5FYJU 1KJ3H 1W0VB 2ICEA 5IP4A 4I2XA 3QDJD 5MEND 3ZL4H 4ODVH 2R1YA 2Z4QB 4OF7A 4LKXB 4K3EH 1OTSD 2ITDB 1CXHA 3F65A 5L2KD 1NGWB 1FJ1A 1F3JA 2ZKHH 4FZ8L 3KJ4C 5HGHA 5DGRA 5C6PB 1EEQA 2NW3A 5DK0B 1W0WA 5C6WH 1E4XL 1OVZA 3IDYC 3TJHD 4L9LC 3IU3A 4HJJH 2R1XB 5JXAL 1MQKH 4Z7WA 1MJ7H 3BZDA 2FJGB 3JSSA 4PRHD 5KSVA 3MRKA 3L5IA 5FYKH 4LSPH 4TVPD 1T83C 1D5MB 4XCFL 4ODUB 4MLIA 1P5VA 3G04B 1Q9LB 3RY6A 4UNUA 3O3DB 3C60D 4M7ZB 2XICA 4O51A 2PCPB 4ZNCD 5E2TL 2FR4B 5AZ2H 2JCCF 4IRJD 1RUAL 1A3RL 4R90H 5IMOA 4CVUA 4QRSA 5E00A 3RDTD 3CFBB 1NFDB 1KNOB 3QPQD 4XVTH 1UYWH 2YKLH 2YZ8A 4FS0A 3TBVB 3G9VA 3KLHC 5GIRA 1XGPB 4PJ9A 1WBXB 1R5WA 2W60B 3BHBA 5DC9B 5F1OB 3RGVB 3V7AG 1J88A 3CDCA 4QY8B 1H9VA 2FO4A 2NLJA 1MIML 2E9BA 1VA9A 1I7RB 2FX7L 4N0FB 3EZ8A 4YEEA 5BS0B 2QJDA 3IF1B 5GGUA 4NZUL 4M61A 4MNQB 1GGBH 2H8PB 2YUZA 4PJDA 4XNQB 2APXA 4KVCL 4MAYD 2F58H 1OTTC 3BZ4A 1WEJL 2R4SL 2A77L 3U7YL 2JB5L 3MLUL 3TM6A 3GRWL 2CQVA 4PRNB 5LBSL 5ACZB 1JWUA 3D1MC 1U58A 2N56A 4WRLA 4XB8A 4PRID 3DXAD 3F7QA 3DROB 1GH7A 3T77A 3BIKA 5LGHL 4Y0GA 3QIBB 3S35L 2XIDA 3C6LB 3VMPA 3DYPA 1QFWI 4PJ5B 1VFOA 5I1DB 1UWXH 2BNUA 4JM2B 3VWJD 3U30B 5C2BL 2DAVA 3S36H 1UKTA 4I48A 4HHAB 4JY6B 4Y5YC 4UOW1 5BVPL 3H7BB 4HH9B 1RUPL 3PV6B 2FJHA 4O00A 3IRPX 3NCCB 4B0MM 1LO0H 4KJYB 4J8RB 4KK5C 5ABDE 1XF3A 5DEGA 4FNLH 5C08B 5H37H 1ORSA 1K8DB 3SE9L 4P5TC 1DSFH 43CAA 15C8H 1QLRB 1NBYB 1CL7L 2P43B 4HS6A 1AI1L 4XWGL 4A6YA 5F7YC 1OSPL 4Q9QL 3RGVD 4GXVL 4MCYB 1P4LA 2FL5A 2V2TA 1P4BH 3NAAH 5J0BA 3VG0L 2OM5A 2OSLA 3P9LA 1WISA 4OCLC 1E4JA 3ES6A 4K71C 1IQWH 5D6CA 3HAEG 5FYKE 1VESA 5T1MB 2XXMB 2R0LL 1A1MA 1M7DA 4JZJA 2LQRA 5CD3A 3KPPB 3K7UA 4FQXD 1UACL 4Y4FA 2NY3D 4GT7A 5E8EB 3BPOB 1BQHA 5IQ9A 1LO3L 5IBLC 2CXGA 4W4OA 2EKSB 4U6HB 3A6CL 5D1XA 2SEBA 5E8PA 5J56B 2OXHA 1NFKA 2I5YL 2OL3B 2VZUA 4GAYB 1SEBB 1F4AA 2GTZA 4K3EL 3Q0HA 5DZOA 3NCBB 3MV8E 2EDRA 1YEHL 2VMFA 1YEDB 4X4ME 1GXEA 1J11A 5EH1A 1U6AH 1BF8A 1A7OL 2Z93A 3K1KC 3DMMB 4QCIA 4ZFZB 1YEJH 1R24B 2AV7B 5I1HH 5JXEA 1KN4H 4MA7L 4LCWA 3EYQC 3QFDB 3IDUA 2PYFB 5BV7B 2CUMA 2Y5TB 4GG6E 5L2JB 1N7ML 4JRXD 4EDWL 1YEFL 2DJSA 3G5YB 1EV2E 3H9ZA 4KKCC 1GCFA 5EZOH 1OF2A 1NUGA 2YPLE 2GJ6A 9CGTA 1NGPL 2X7LA 2XI9A 4Y2DC 1S9WB 4XP5L 5IWLA 1UA6L 2P8PB 2NY7H 3BZEA 2C3VA 5KTEH 5HVWA 4U1IB 1S9VB 4RDQF 1YY8A 3QDMA 2Q20A 1LP9E 4FFVC 3BGFB 2FX7H 1DVFA 1ND0A 4LARL 4KKAC 2ZZUT 3ARTA 3TNNA 4XP9H 3ROOB 1U3HC 4LMQE 1JPSH 3RL1B 1PQZA 1IGJB 5IG7A 3AAZA 4F8TA 3UBXA 5I8EA 1PKOA 4NM8H 3SDDB 5F6IB 2BCKB 5EZIH 1BFOA 4G8GA 1MCIA 2HN7A 4TNVK 4MQSB 3DI3B 4LLQB 3Q6FA 4M62L 4LLMB 3F6LA 4G7YL 1Z6JT 1S7XA 1U8NB 4HK3N 2DWEA 1U8HA 4MNGE 2R29L 5IVXB 5KZCD 3SO3B 4AH2A 3OAZH 4H8WL 1CICD 3X12B 2FNBA 1ZVSA 2UWEA 3I02B 4C58B 1JMZA 3MFFB 4HKXA 3EDDA 1EERB 4K94H 1A6PA 4DGVH 4GOSA 4JQVA 4P59L 4AT6B 4OLUL 2P7TB 1DFBL 1JYNA 3D3VB 3B5GA 1TITA 2X4QB 4LEXH 3U2SA 1JN6A 3T3PE 2P5EE 1B0GB 4JEGB 3QJFA 3MRJB 4RFOL 1X3DA 4GRMB 1I4FB 2M2DA 3EW3B 4JHBA 1CK0H 2O93L 3B3IB 2EH8H 1F02I 3P0GB 1YEGL 1F45A 1R3IL 3LKQA 1Z9MA 3DX6B 3U36A 3O2DA 1DANT 3TT3H 3SDYL 2DLFH 3QQNA 4U3HA 4JREC 5JIIA 4LQFL 3GIVB 1F6AA 4PTTA 5E6YA 2DQCL 2OTWB 3T0EE 5ELIA 2NY6D 4UMGA 3ZYZA 2F53A 4LRNL 5C0BB 1ZVYA 4LNRA 2CK0L 1NFDF 3VI4E 3ROLB 2GSIB 3EDEA 2Z8SA 3RY6C 5B4MC 5E2TH 1EVTC 5BJTA 5LKNA 1IQWL 4EN3B 4GG6F 3FQTA 5GGTA 3GKZA 5T33H 4EVNB 4MA8L 5JW4R 1A6UL 1JYVA 4XWOC 2HVKB 4N68A 2P5WB 3WHE0 3C5SA 4MXQD 1ZHNA 3J8F7 4LLUB 3SDDD 3UP1A 1FL3B 1HYSD 1RZJC 3D0VA 3TBTA 1JF1A 1QQDB 1KELH 1SJXA 1Y0LA 5C07D 3WLBA 5HPMB 3QUZD 3V5HB 5KSBE 3WSQH 2CD0A 3MUHL 3TH4T 4NNXB 3JUYA 3FONB 2VQUA 3TA3C 3BP7B 4NNYA 4ONHA 3PWJA 4CADA 5JOPE 1YMMB 3TZVB 1FVCB 2ZG2A 5HY9A 1FNSL 1KN4L 3FT3A 1NGXA 2B8OT 4WO4A 4I18A 1KLGA 1KGCE 3K81A 4L4VA 2NY2D 4CJ0A 2KL6A 1A8JH 2FHCA 3RIAF 1ZHLA 4D9LL 5HXMA 1AKJB 4WNQB 5DUMH 3W0WE 2OS7A 3L7FB 1NGPH 2DMBA 1BFVL 3L3HB 2FX8L 3Q2CA 2DI9A 3MROA 1UA6H 5D72H 1AIFB 5BV7H 3SOBH 4R4ND 5C07B 5DSCB 1UB5B 5C9JA 3QXUA 3ARFD 3TWCL 2R2HB 3ARBC 4PJAE 3VRJB 1UJ3C 2X9YA 4JO1H 5AAWA 4YHZL 3QQ9C 35C8L 3HRZB 1TQCC 4XP9L 3RNQB 3L5WB 3D9AH 4RQQB 1JPSL 3NFNB 1IQDA 1NAMA 4P2QE 3P77B 2YD1A 5DQJB 1S7SB 1TETH 3J7HA 3VDCA 3KR3L 5D1ZA 3TIEA 1P4IL 4ORGB 4HEME 1T1ZB 4YFDB 2PW2A 5E2VH 1JZ7A 3B9KA 1KB5L 1NEZA 1ONQB 2GHWB 1RVFL 4YBLC 3ZT6A 5H94B 4KPHL 5F3HB 2NTFA 5E99H 5JQ6L 1LE5B 1CZ8H 4M5YL 4UOW0 1KC5H 4Y88A 4L3AA 1P84J 4NKOB 1K85A 3Q5YA 1JWSB 4JO3H 4RNRA 4WENB 2XZCL 1MFDL 5EIQA 3O8XB 1CGTA 1JPFA 5IB4B 1TJHH 1MCKA 4DN3L 1X5ZA 1S7RB 1N5YH 1F90L 1YDPB 3HC3L 3MRBB 3GBLA 4R9HA 1AHWC 2APFA 4UV7H 4YHMH 4Y1AA 1DFBH 1OOAA 5KSBB 1QG3A 3FO2B 3MNWA 2VDPH 3VGFA 5J6GA 3A6CH 3WIIL 4HDIA 3RKDC 4RFOH 4Q9CA 5BVJA 1S9XB 25C8L 2I07A 4OFVA 5SWZB 3WN5A 4BSJA 1FDLL 1LEKB 1AP2A 1FIGL 3O0RL 3RDTB 1G7PB 3EOAA 2R23A 3BP6A 3F7VA 4N8CH 2DM2A 1S8DB 3HPJA 1KTLB 2Y6SD 3O41B 2DLFL 5D9SA 2EDQA 1YEEH 1X5XA 4M1CC 5I1JL 1R3JB 2VLLB 3ECBB 1HH6B 1HINL 1UM4L 1SYSB 4OLYL 3QB7C 1J8HA 4KHTH 5F6IC 4LRIA 3QPXH 3SDDC 5FECB 1V5JA 4J1UA 1TTUA 1C08B 3VD5A 1UVQA 5ICZB 2WANA 1HCVA 3IJHA 5T33L 2EDEA 3QRGH 5IBTH 5J3HD 3L5XH 3BOVA 3SQBA 5B39G 4WWID 3D85B 1U3ZA 4HUWB 3BX7C 3SKNB 5C70A 2GITB 4G6ML 3ZDXF 5C0BE 1OQXA 1I8KB 2ARWA 4DGIH 1P7QA 4ZD3H 4U0RB 1IGFL 4PGEB 4XPGH 1WAAF 2AK1L 4OFKA 2W0FB 3DRTA 1QP1A 3GSOB 3KVQA 3WIFB 2HP4A 3EOBB 3NACH 3FB7A 5D71L 4R2GD 2YEZB 2CIIA 2X4NB 5LWYL 1K4CB 4LFHG 4HFWB 1FO0B 4ZFOB 3HMXL 1UWXK 5CWSA 5F7MC 2EDLA 1JI1A 1I7ZA 1A22B 1C5DB 5F1NA 4FQIL 2PCPA 4NPYB 5TDOA 3EO9H 5T1KB 3WFHB 1TPXC 1K4DA 2Y06H 4GKOA 5E2UH 3ZHDA 4OLWH 3QO0A 4IRSD 1QOKA 4K71B 4X9FA 1HHKA 3DIFA 4X7TA 1JGUL 1F58L 4NQCA 2CKBL 1JNHB 2NLJB 2G2RB 2J88L 2XG4A 3IDXL 4BZYA 3O3BB 1X5LA 4LHJB 4IRZL 5A3ID 5FGCB 4UT9H 5HHOA 4E41E 2I24N 5DGQA 2YOCA 1YEKL 4P49A 4X6DA 2AEIT 2A6KB 3VRIA 4UT7H 5E4EB 2EH8L 3BUYA 1F6FB 1A1NB 1G0XA 4LVHC 3IFPA 3W5NA 3VWKB 1MUJB 3VFNA 3ULVC 1TETL 4KZDL 4MCZB 4UILH 1IZKA 2Q1EA 5EO1B 1PKQE 1J18A 3SDYH 3ARVA 1WFTA 5ICXB 4HUKB 2DQCH 2VERN 4WV1B 1ETZB 3B8SA 2X5PA 5E7BA 2B1AH 3PHSA 1OHQA 7FABL 3NA9L 3FQNB 4PLJC 3V8CA 3OKNA 1P7KB 3C5ZA 2G60H 5M7QA 3WXVL 1FYTB 4X4XB 1DQQA 3QEHA 3WIHH 1X5HA 3UDWA 3HC0B 4H88L 1KTDA 5L6YH 1DN0A 3QQ4A 4K8RL 1KCVL 4P2OB 2C5DC 2NR6D 1CDGA 2BERA 3FO0L 1VFAB 1OAUL 4RISH 4QWWD 1TCRA 4FQ1H 2RR3A 5ACMA 3M1BB 3P4OA 5SWQB 4U1JA 3VFTB 3HZYB 4EOWH 4IJ3B 4PRAB 4KV5E 1HN1A 1O0VA 1MLBA 1QSEE 1UG9A 2EO9A 4GSDL 4Z7QF 5EZJB 4YHYB 4CVZA 4R2GC 4QGTA 1B6UA 3T65A 2QQNH 3T09A 3O0RH 5D5MF 1DUZA 3RBGA 4C4KT 4JRYB 3R4DA 4JPIA 1U3HB 5DUPL 1HSBA 4ETQB 3MRRB 2KUTA 3QFJB 1QBBA 4MQXC 4JM2D 1AC0A 1MAML 5CKGA 5JMRA 5KSAD 4DKDC 1YN6B 2FL5B 1OARL 1T83A 4M93C 3AGVA 3SGEH 3VXME 1FYTD 1FVDA 3E8UL 3MO1A 3FQXA 3SDXA 4H1LG 2QQLL 4MB3A 3HAEB 3RUGE 2PO6A 2MPAH 5C7XH 2EXYC 4ZAKB 1FE8H 1A1MB 4XCEB 4NQVB 5K93A 4NQED 2ADJA 5DUML 4CRPA 4ODSL 3PWVB 5A3IC 3BIBX 1NKOA 5E8OA 2FWOA 3WFCH 4P23B 1AGCB 1Z5LB 4ZO6A 3DTXA 4XRCB 3V0WH 1SVZA 2GT9A 4G6JH 2SEBB 2R39A 3D6GA 4XVSL 4G6MH 4GJTB 4PJEE 1YUHB 2C3WA 4TULH 3L3OA 1MJJA 4HUXA 3RZCA 5J12B 3PWPB 1JPTH 3PHOA 4YFLF 1E0OB 3UCRA 1M05A 2BVUA 3IKCA 4K3JL 3SGJA 2KDGA 3ULVL 4WUKL 3M17B 1PKQB 1KIUA 2V2XA 5IB1B 3H6JA 4J4PD 4ODXA 1CVSC 1RZIA 4NP4H 3KR3H 4XP1L 1RZGB 3ZKNC 2I9LB 4KJQC 5DRXB 4D2NA 4U49A 3PWPE 5D7SH 1EJ6A 3VH8A 3DVGA 3S36X 5K9QI 4HPYH 3DNKA 3ZSTA 2ZG1A 4XX1G 4GRLA 3QUMB 4UT6H 5KVGL 4E41B 4PY8I 3LS5L 4CVXA 3SPVA 3RX7A 5CP3A 3BPCB 2X89D 4WW2F 5DD3L 4NFCA 1KUMA 2VZOA 2IJ0C 4MJ5B 2YSSA 3JV5A 1KG0B 1UENA 3HZKB 1J87A 4Y16A 3NIGE 4ELKB 4MXVE 3W82A 1BD2A 5HGAB 1F90H 3HC3H 3DWTA 4TUJA 2CMRL 2P8LB 3VGAC 4GO6B 1WIUA 4U6XB 5CJOL 2ICWA 4TSCH 4TSAH 3LKSA 5I71B 5I76A 1NEUA 5T3ZD 3E2HB 3HPLA 1GYAA 2DQUH 2JF1A 2UUDH 3IU4H 2DTML 1FCCA 3MRQA 4BSWA 1WLHA 4HJ0C 1FIGH 1TZGL 5M94B 4YK4C 4P2RB 2VISB 3RWIB 5I74B 3U0TA 5CS7A 4UILL 5EU6A 1K8IB 2P5WD 5D7LB 1IGYA 1CGYA 3U9UA 3HI5L 4G8FB 4OIIH 5J06A 4LAQH 3QUKA 2KQNA 4PJXA 5F97E 1BBDH 5FHAH 4X4MA 2OJZL 1LK2B 2JB6B 1HXYA 1L6ZA 4D8PA 1EXUA 2UYLA 3SE8H 1CFQB 5J11C 1YMHB 1EA9C 3BIAX 2VH5H 3MV11 1MIEL 4OCWL 5E08L 4JY5L 4Y4HB 4PPTA 3CXDH 3L9RB 2LABA 4K8RH 1FFQA 2EZ0C 4KJPC 1QBLH 3H9SA 4K3DL 2W9EH 4J3VA 4RMTA 2F5AL 1QUNA 4HMCA 5E6ZA 1AFVL 4CJ1A 1LQSR 1BZQK 4C59B 3TIDA 3H9HB 5T5NG 4JO4H 2X09A 4FQJL 1AKJD 1IGFH 3K8LA 4I2XB 2QHLA 1NLDH 1N6QL 3FFCA 1HSAB 2CO6B 5FOBB 3HR5B 3KS0J 2GY5A 1JI2A 1F6AB 1UZ6F 3DUUB 3IB4A 5C0BD 4ZUUA 3KPMB 3BUTA 5K9KB 3VXRA 1SBSH 1ACZA 3DX7B 2IGFL 4BFIA 4BZ2H 1VB9A 3MLRH 3P40A 1CG9B 2ZUVA 4NYLB 4R3SB 1C1EH 4JJHA 5FM5M 1IAOA 4NOBA 3RTQD 1T21B 2D03H 4OGXH 3QEQB 1T5WB 4JQVC 5CSZA 2V2WA 1FAIL 2CLRA 4JKLA 5D7KE 2X1OA 2VL5B 4JVWA 4UINL 3VFSA 4ACPA 1MFBH 5FF6B 3OSKA 5IB5B 1HILA 3LQZB 1M71A 5DXWA 1VDGA 5CEYB 5D1QC 3EFFA 1NCCH 3ZLQC 4R4FL 2XN9E 3CXHK 4RGMC 1W0YT 1R3LB 1ZGLP 1KBGL 1E4KA 4RRPA 4FQQB 3ULUL 1FGVL 5KVDH 3VXPA 4NBZB 2PN5A 4FQPA 3BW9A 1NGZB 1LMKA 4KK6D 4K3GA 5IEKB 3MQIA 1IAIL 1CDBA 3TNMA 1DE4B 3X17A 3QA3A 1B4JH 3PGDB 4WO4B 1R5IB 3ETBF 4D0DA 4M7LT 4G6FD 4WHDA 5CJXC 5C3LD 1FL6B 1MFEH 4DZBA 5JMOC 4DVBA 2PTTB 1JWMB 3HNVH 3WXVH 3BIKB 4WU5A 2Z8RA 1AGBB 3ZE1E 4BSVB 3UTPD 4XXCA 1PSKH 3UTOA 5I30L 3MOQA 3ARFB 1HHIB 5J13B 1XCTA 4UTAL 1L9NA 2RCSL 3HE6C 1N2RA 5E9DE 2OQJA 4Z95L 4KROB 3STZA 4OZ4A 2IEPA 3CX5K 2FEEI 3L5WA 2NY2B 3W39A 2FEDC 1B0WA 1D5BB 1I3GH 1G0DA 4KRNA 2Z0BA 2C3XA 3MCLL 4XH2A 3IDNA 4Q58C 1I9IH 5IK3B 5CILL 1ZLSL 5F9AC 1NCAL 4KTEH 1ONQA 4I18C 5DC4B 2DD8H 6CGTA 3VRLE 4BH7B 3LDBB 6FABH 4KTDL 5F7UA 1N5AB 3EYQD 4HMEA 3VG9C 4HLZH 1BZ9B 4GAJL 1SJVA 1ZS8A 4NQDB 1KFAH 4F7TA 1J5OL 2OSLB 5C0EA 1A2YA 2J2ZA 4AK1A 2WBWB 3EYFA 3NCEB 3PHQB 3W5MA 4CU7A 4OLXH 2R69H 1BQHG 2YPKB 1P5UA 3SO3C 1WZLA 2YXFA 1FFRA 1F2XK 3DV4B 5CD3B 3V0WL 3NCFB 4LSVL 4Y8DC 4PJHB 2ADGA 1MFNA 1U2HA 5JW4Q 2A9ML 1S9XA 2ED9A 3OPZH 4NN7C 3WN5B 3T4AB 5IROA 5C0DB 1B6DA 1BGXL 1JPTL 4XVUC 3EOAB 3MRMA 3B6SB 4G42A 5D4QA 5EORL 4K3JH 4ZUSB 5D2NE 1XGYH 5E4EC 1P69B 1H8SA 1YYLL 1EAPB 1Q9WA 1RZKL 1HH9B 4DK6A 5C0RH 4XP1H 3PWUA 5D7SL 1HH6A 3C9NB 3REVB 2HKFH 3FO1A 3MLRL 5EZLA 4J3TA 3F5WB 2NXZD 1AXSA 4C83B 4V1DD 3QIWD 2DMCA 3WUWG 2CDGB 1E6JH 5D1QD 5GGRY 3V2AR 4GRLC 2ITDA 4FQLH 3C2AH 4JGMA 4EQ2A 5ITFA 3THML 5JHDB 5ICZA 3QDGB 2C9AA 5DZLA 3GMPA 1JGLH 4LNVA 5IVOA 4PGBB 3V0VA 1UCBL 1MQ8A 4K8RD 5J7CC 5JR1H 2D3VA 4BJLA 3PDOB 4NO0D 3DYOA 3MGTA 1T2QH 4MGXA 1QBML 4LKCA 5D7LE 3GMMA 1NBZA 3ARQA 3TBWB 4JJ5A 4GW5B 1KLFA 1PFCA 4GW4A 2J8UF 1VADB 1FGVH 2G5RA 4R2GB 3PWLA 3VFVA 2Z92B 4OJFH 5DK3A 1FBIH 1QSFB 1LHZA 4PREA 1MCOL 4TVSa 1WGOA 1BM3H 5KS9A 5F7DB 4NQXB 1VEOA 4APQD 4Z5RA 5SWSB 2RBLA 5DEFB 4B50A 4F7PB 4YHIB 5L2KE 2A83B 3H42L 4P46C 4OIIL 3BP4A 3WHXB 3HMWL 3OG4B 1U9KA 4PRPE 5EU7E 3SDDA 3OV6A 3X3GH 1DLFL 3A0OA 3QO0B 4GRWF 4QRPE 5CGYD 4BA8A 3CSGA 2BVQA 1BD2E 5T3XD 4CDHA 4F80A 1INEL 1S7XB 2FGWL 5ISZA 5C8JB 2R0ZH 4N0UB 4X98A 1F11A 2Q86B 3RWJB 1PG7L 3MLZL 3VA6A 2A6DA 4XAKE 1FZJA 4LHUA 4JKMA 2QLVB 4Z95H 2QSVA 3PUCA 3OF6A 1JGEA 2XOTA 2ESVE 2Z31C 2YHGA 4ZS7H 3RBSA 3GJFK 3SJVE 4K2UL 3L5JA 4PB0L 2EEBA 3WLWD 2BNUB 4XHJC 3MV8A 1TJGL 3BEVA 3O3AB 7CGTA 5JNYA 1RZ8B 4JZNA 5JHDD 2DF3A 5J6HA 4RIRA 4P5KB 3JWOL 2VDKL 5DJCB 3SDAD 4P57B 1ZT7B 4M6NH 4JFQB 3S88L 2Q3AA 1I3RA 3UAJD 2BJMH 4WUUD 2DKSA 4LFHD 4X8JA 1LK3H 5BW7A 3C09B 2EYSA 3KXFE 3O6KL 4MJIE 2C1OB 3RVWD 3MYJA 3BPNB 2ZUWA 3P0YL 3ULUF 4AIZB 3QIUA 1G7IB 5D6CB 3NZ8A 4DAGL 4PRHE 1ROWA 3UTZA 1AXTH 2WIMA 1N0XL 2AKRB 2D03L 4BQ6A 4M9PA 2ADIB 2IALB 1JNLH 1OTSC 2PF6A 3ARWA 4OLXL 2DKUA 5JA8B 3LIZL 1YY9D 5ESVA 3TO2A 5HHME 2ZOKB 2BNRB 2HTLC 1N64H 4X6CF 1RK0B 4FFZL 2NX5E 2A9MH 2FHBA 4EZMA 3QIUD 3S35X 1QA9A 1T22A 5BZDA 1EHXA 4ESKA 1AR1D 2VZVA 3RVUD 1KJ2B 2Q3ZA 4RSVA 2MKLC 1YYLH 2D31A 2GAZA 3ARGD 4NT6A 2VSCA 4MZ2A 5LAXA 3LH2H 5CLWA 3K80A 5E1AA 3HHRB 4DUWA 1X4ZA 3C5JA 2HKFL 4V2BA 5I8KL 5IW6A 3MUY1 5DJYA 2R9HD 5F7NC 1S9KC 2F9BT 3MSPA 3IDIB 4NQEE 4YO0A 5CBAA 5C9KA 2VYRE 1R5VB 3LEXA 4XMLL 4R96A 4XMPL 1JGLL 3G9AB 3WL9A 3P11L 5T1DH 5C0IA 1XFPA 3KJ6H 3KYKL 1FO0H 2YPLB 3NFSH 3S3JA 5DMYA 3ZSSA 1W72H 2BY0A 2XZQL 1PSKL 3IXTB 4J6RH 3CLFH 3O4LA 4KUCF 1S9VA 1RUQL 1WZMA 5I2IB 4ZTOH 3OJVC 3RWCA 5HVGB 2AJ3B 4FG6D 1UXSB 1QO3B 1AIFA 5HD8C 3HE6A 4H20H 3ZTNH 1UH4A 2P4AB 1C7SA 4G8GD 4U1KA 5TFSL 5EBWA 4KQ4H 2GK0A 3HTLX 2AERT 5C9JB 1OD9A 4RGNC 1BIHA 1U8JB 2VR4A 4F9LC 4YFEA 4ZXBD 1UT9A 2WQRA 1I1FB 3SDAC 3VI3F 1BOGA 4PRPB 3LQAC 3ZT7A 2P8PA 2FDBP 2W92A 3QUML 5ESQB 2D4FA 3R0MA 3LKOB 3WXWH 3IAPA 1G7QA 5MEOB 1IQDB 2Y6SC 3HG1D 3PNWB 5SWSE 3Q6FB 4HPOH 5FYKD 1IEAA 2VZSA 5I8CA 3AY4C 3Q5TA 4I0PC 3D69B 1NDGB 2UZXB 3U4EB 2VOTA 5K59F 2PTUA 1KPVB 2YSSB 4OKVB 5AYUL 1A0QL 3SKMA 5F93C 2BVPB 4G9DA 4DUVA 1YY9C 3LD8C 2VTFA 3IETB 2ICCA 4JGJA 1T03H 1UQSA 1GL4B 3NGBC 1JZ8A 4Y19E 4JHAH 2P8LA 1PG7H 3MLZH 4URTB 5GZNC 4N5EC 1U8QA 1MJUH 4G8GB 4EBQH 1A9BA 3GM8A 4C56D 3DURA 1X9QA 4PJ9C 1ADQA 4GRMA 5HGBA 2AJZB 4ZPVA 1I1AC 3MRDA 1W0VA 4OM1L 3BH8B 1JHTB 2LU4A 4X99B 2F5BH 5DVLA 3PL6A 1T4KA 3QIWC 4C56E 3UPRA 3MLVH 2VDNH 2R1YB 2Z4QA 4QXUL 4JPWH 1JK8B 2JELL 3V4VH 5K9OA 4OZFH 4IRJC 3O6FB 4DZ8B 1HI6B 3ZYJA 3Q1SL 2X4QA 5C0BA 5F8QC 5L8LB 1CFQA 1O7VA 4DCQA 1J0IA 1XAUA 5ERWB 3TJEH 3W2DL 5HYJD 1Z3GL 3NIDF 3HUJE 2CDEA 4RMQA 4OI8A 1NBVL 2ARJB 3MREA 3HRPA 4FQLL 5T3ZE 4QOKE 2X9XA 3PGFH 1ED3A 1U91A 3D25B 4KY1H 3LKQB 4Q9BA 2X41A 1ZLVK 3B9EA 2LE9A 2YD8A 5DLMH 4PP1C 4Q9RL 4TVPE 5AWNH 3OX8A 4PJ9B 1N3NB 4XTRC 1RIHH 5DJXA 1GGTA 2GSIA 3OMZA 5CSGA 3KPTA 2IBZY 4P46D 5IB3A 1D5ZB 3NBNA 3F7YB 3OGCB 1HZHH 3GB7A 1PGRB 2J6EH 2EEDA 1FBIL 1D6VL 2H26A 1EVUA 4QHNB 3DUUA 3RA7L 1NMBH 3FHQA 2WBJD 5AD0B 4MNQE 3EUUA 3OB0K 4F58H 1PX4A 5DHXB 3O6FC 4PJ8A 1K4CA 3ZO0A 1XF2B 4FTVE 3PDDA 2CIKB 4P46A 1BZ7B 4LSRH 4HUNB 4JRXE 3MMEB 1RMFH 4AENA 1U8IA 3QUXC 2OL3H 3KHQA 3O2WH 3DROA 2V2WB 4GKSA 1CXLA 5ID0A 4IEFB 5BS0A 4Z7UF 4GXUM 2Y23A 1G9EA 1AQDB 4FQCL 1W72L 2GQHA 5IR1A 1FVCA 1WC7B 1T7WA 3BKJH 5TE4H 2PW1A 3BP5A 1PY9A 1G0YR 5INDA 1FC1A 5GHWH 2B4CC 2J8HA 1Q72H 3QNXB 1I8LC 4DKFL 1DBBH 1HDMA 4D0CA 3CK0H 4Y4KD 3QUYA 3QXAB 4LMQI 1WTGT 3R8BB 3PF2A 2MQCA 1KJ2L 5C71A 5FO8B 1A4KB 5HGDB 1N8ZB 4UQ3A 1KLUB 3TVMA 2F54B 1F42A 2DS4A 2FD6L 4ZTPH 1TZIB 3NIGF 3CFJA 1Z2KA 2YRLA 4B53A 4D0BB 4LGRB 2ZUQC 4P9HH 4JB9H 3GSVA 3OZ9H 5FKAA 4FXLA 2VXSH 5EO1A 4KXZH 1E6OH 1CFTA 1NDMB 1SHMA 2ZCKH 3UO1H 5C0GB 3RZWA 4WCYH 3U4AA 1FFOA 2BHYA 3O6MH 3ULUE 4BSVA 3MJ6A 4OSUL 3RTQA 2WUBL 3U7WL 2VLRD 3P77A 3GKWL 1HEZA 4UV4L 1XGQA 3W0WA 3R1GH 1OGAA 3LN4B 4E5XB 3D48R 4RMUA 3STBA 2EDYA 4LCCA 1V8HA 2UWEF 2FH8A 2FIKA 2OR8A 3IVKB 5AEAA 3UTSE 3K0WA 5ANMA 4OFPA 3CVHB 1A5FH 3NA4A 5IHBA 5JQHC 4X83A 2IH1A 4OM1H 1OAYH 4JFED 2EKSA 2X4TB 4QOKB 1OB1B 1CXFA 2EE2A 3OAUL 3P9LB 3IU3B 4F3FB 5IT2H 3V4VL 4B41A 3L3JA 5DJ6A 3EJYD 4GW1A 5LQBH 4JZJB 4F7MA 4M43H 4M6MH 3LV3A 4FFYH 1VPOL 3W2DH 1CDHA 2QSTA 4OM0L 3NH7L 3WO3B 1Z0NA 3WEXB 1J1PH 3FAXA 4U6HA 5D1XB 5IMOB 2Y5TA 5HHXL 2DWDA 1MFCH 3OXSA 1UH3A 3VWKD 4HWEH 1DDHA 4B7LA 2AABH 3T0EB 2R1XA 3BKCL 1G6RA 1KCRL 3BI9X 2NNAB 1XGTA 3UBXG 5D5ME 5J4MA 3SKNA 1S5IH 2WNGA 3WE6B 2HAZA 2F54E 1KB9K 3JZ7A 5DJ8A 2DLEA 2GY7B 3DTXB 4GKNA 1CIUA 3E6HB 5CCKL 1RSFA 2ZCHL 2H6PB 1SEQL 1B9ZA 1FG2A 5CP3H 2P5EB 3RZCB 1XGUB 3TNNB 3QUMH 2EDOA 2DKMA 5F1KC 4CN1A 4HUWA 4KUCD 4O5LH 4POYA 5HBBA 1LVEA 3SQOH 5KSAC 1KCSH 3S9DB 3PWNB 1E4XI 1TVHA 1ZWIA 2K7QA 2ZP0T 4UBDC 1S7QB 2DIBA 4XNQA 1KIQB 3QH3B 2MJWA 3QFJD 4U1LA 1GZQB 3CH8A 3BKJL 2GTWA 3UJTH 5TE4L 5DJZB 4MB4A 3BYYA 1UWGH 4GW4B 4JPVL 1MVFA 1Q72L 3OR6B 4HXBL 4DKFH 5CGYC 5I19H 3QDJE 5MENE 4BK4A 3EKCA 4Z8FH 2V6HA 3U9PH 3IDJA 4OZHE 43CAB 1B0GA 2A73B 5F7DA 2OBGA 4RBPK 5D7IE 5HI4D 1N6UA 2ICWJ 3MRQB 4BSWB 5LG1A 3S34L 3CDYA 4PTUB 2MOVA 2ZKHL 2A83A 2DQEH 2HH0H 4JM2F 1T1YA 3TN0D 4R4BA 3CD4A 5TJWK 3VXQA 1EBAA 3CFDB 1CT8B 2APTA 1MCJA 4G43A 2NY4D 4JB9L 4CDGC 1KB5B 4JFXA 2PR4L 1TVDA 1I1YB 4LSPL 4G8FA 4KDTC 3VJ6A 2AK4D 3QDME 4WU7A 3BD3A 1M4KA 2XXCB 1PD6A 5HPOA 4RAVB 5DEGB 1CQKA 5GGSB 1H15A 3PP4H 1MWAL 5ITBL 2BVEA 3BUYB 4LU5H 3FQRA 2XZZA 3ROLA 2VLME 3RKDD 1ULVA 3I85A 4PJEB 3V6BR 3BEWB 5GZOC 3VXMB 2DL9A 2VO5A 3MRGA 3CZFB 3P2TA 2UZIH 1FN4A 1FNAA 4LEOB 2VXUH 1KF9B 3MRCA 1IL1B 3KAAA 5TDPB 4M9OA 3OKLA 4F33B 2VXTH 3U36B 3RVVC 2ZWLT 3MRNB 1J0YA 2H1PH 4N8VG 1LGVA 4H26A 2W65B 4M1CD 4HGWA 3MRLB 4FQHB 4JPIB 2IQ9L 2PO6D 3SKJH 1OTUD 1YJDC 4PB9L 3QUXD 4OD2A 3RA7H 4LPXA 3CVIH 4G8GE 4HBQA 1F2QA 3BRGC 2A1WL 2AP2A 2A74A 4CMHB 4LVEA 1SYVA 43C9B 4Y19B 2R4SH 5DMIL 4LDLB 4HFUH 3PWJB 1ZA6A 4MDIA 5D1ZC 1UWEH 4EVNA 4I4WA 3V6FA 3TO4A 5INCA 2FEEL 4M8QB 2ZUTA 1T0MB 1T3FA 4I18B 4Q6IA 3RGVC 2HFGL 4D9QD 3KWWB 2OL3L 3O2WL 4ONOA 4BELD 3D0VB 3TBTB 5KVFH 2DMKA 3KNBA 2OR9L 5F9OH 1QFHA 3O9WA 4PLKD 1AE6H 4XNZB 1JRHH 2AABL 3SY0B 4KAQH 4EQ3A 2NY3B 2DN7A 4MD4B 2PXYB 1QHPA 2DLIA 4NNXA 3U1SH 4HUUA 4Y4FD 1ZTXH 1FZMB 4LVOC 4PRDA 4ZPTB 5H35A 1G6RH 5EFIB 4KUZH 5IM7A 5C09D 4PGDB 4QYOB 5GRJH 3ARGB 1KJ2A 1KLGB 4FMFA 1F97A 2XV6B 3P30H 1UC6A 4ODVL 1JV5A 2V2XB 1CICB 1YPZA 3G6DH 4WHCA 4HIJA 1LDPH 3IDGB 4NN7B 3WN5C 1DSFL 15C8L 1A7NH 3MA7B 2QV2A 2BOCA 4GS7C 3BZEB 1T1XA 4JAMA 2CGRH 4OCNC 1A64A 4F2MB 1I8MA 4JFDE 3AU1B 4QRTB 1JE6A 1MQKL 2DYPA 4XWGH 5D1ZB 4LCWD 2MNUA 3HG1A 4GG6B 4L8BB 3EYSH 4XCYA 3QEUA 4WHTA 2Q6WA 4AQOA 4ZOAA 3EO0B 1M05B 3MJ8B 3KLAB 1UXWB 4Y5YB 2Z35A 2YRPA 3MLSL 4Y16B 1JGVL 4WFGE 1JZ3A 2H9GA 2AEWA 4P23D 3PGCA 4XNZC 3RTQC 4YC2B 2YMXH 1MHCA 2IQAA 3JWNC 4MJ6B 4XVTL 5BCAA 3QR2A 5HDQL 5DHVH 5T1LD 3OAZK 2NY6B 5HYJB 1A3QA 3EJZD 1J1OL 3FTGA 1MIMH 4OZGE 3BWUC 4RX4A 1MRCH 3QNZA 1NEZB 1XR8B 4XAKD 5FUCE 5JHDE 3HFML 4P2RA 1MF2H 2P42B 4ELKA 2Q7YB 3SBWA 5SWZA 4FMKA 3CPLB 4NZTL 3DUSB 5IKCA 4KK6C 3FB8A 5B39A 4EI6A 4X4YA 1MVUB 3QHTC 5KN5A 3MLUH 3HZMA 2LAAA 4PJGE 1KPRA 5D9SB 4XGZB 3SKMB 4YDKL 3QJFB 1SY6H 3MRKB 3S37L 4O9HH 3UROR 1CE6A 4S1SH 4TVPH 1BJ8A 2X4PB 3A6OA 3S35H 1ADQL 3AMLA 1DQJB 2ZSWA 1NFIA 4FTVD 5FKPA 2GK2A 4NC1E 1C08A 2YC1B 4OZHA 5GSRA 2IC2A 3WFBL 2A6IA 3P9MA 1Y18A 3GIVA 4PTTB 3VDBA 4FXGB 3ULSA 3RY4A 2VXTL 1W0WB 5KTEL 2NY6C 3HE6D 4XNXH 1JF1B 2E9IA 3HC4H 4QY8A 5HHOD 4QRRE 1PVHA 3GSRB 3EDKA 4QHLB 4F9LA 1QR1A 5BJTB 1BVLB 2ERJC 1DCLA 3PG2A 3O45A 3O3DA 2XWTA 4S1QH 3L3DB 2IG2H 4Y16D 4PGEA 3H9SB 2A1WH 3X11B 4HUVB 4NN5C 2CDFB 4LASL 1EHNA 4Z78A 3T0BA 4JO2H 5FIEA 1IGML 4G80B 3SKOB 2V7HB 3WFDL 3W81A 4QXGH 1GIGL 4LAJH 1AGFB 4PRNA 4ZQKB 5TF0A 2HFGH 1AKJA 1VEMA 3MODH 4NRZB 5MEQB 3WFEL 2R29H 2CLRB 1FH5L 4XC3H 3VDAA 4IIQC 1JRHL 2XKNA 4CADB 3TT1H 3VXTA 3G5ZB 2R0LH 4LIQE 3BXNB 1FGNL 3BGFC 1UB5A 5HDBE 1C16A 4IS6A 1MHPH 3F6IA 2G2RA 4L1DA 2R2CA 1WBZB 2WM0A 4RA0C 1LO3H 1DEEB 1CGUA 4LEXL 4AMKL 2F8XC 4AEFA 1B4RA 4MNHB 3ZDYF 3T2OA 4ZOEA 1VKXA 3DVFA 5B3JE 4GKZA 4KJYA 3FZUC 4M1GL 2PYEA 2CH8A 4M3JA 2EIBA 2HLAB 2DIJA 5E5UB 5FF6A 2DQEL 4P3DA 3QAZB 5LGJB 4JM2A 2HMID 1AH1A 2R4RH 2NPLX 4HZAA 3HUJF 3L3KB 4YAQB 5JORB 1MCDA 1R3LA 4GMTH 3SKUD 1RURH 4JFEB 2BSSB 5ALCH 1IGIL 3RWFA 4DVRH 4WU5B 3IJYA 3BD5A 4KVNH 4HCRA 4S1DC 3RUGF 5HHOB 4X7DC 1AQDA 4XBEH 3RAJH 3NFPA 4P5TB 4ISVA 2VABA 2A6KA 3VRIB 1JYWA 4HXAH 5F6HJ 4X6EB 2VWEE 1CLOH 3DSFL 5E5RB 3ZKMC 5D2LB 2VNCA 1YNKH 2D7NA 4HQQH 4AEHH 1TVBB 4N1HB 5FO8A 2IFGA 1YQ2A 3NABL 1BQHB 4JFZL 2GKIA 1DQDL 4MCYA 2DLTA 2JJVA 1K9TA 3VXNA 5IJKC 3DO3A 1IGCL 3BP6B 4K9EC 2BHZA 5MEPB 3RZCC 4UTBL 2CKBA 1XF4B 4OZFG 3KYNB 3MJ7A 1SEBA 4PB9H 4OT1H 3LPFA 4DFIA 1CD1A 4CMMA 1EO8H 3Q6GL 4GRWB 3QEGH 5DJCA 5CLTA 1CWVA 3T2PA 4Z0XB 5TQ2L 4OZ4B 4ZSOB 5EZIL 1NANH 4P2CG 2VLRB 3GMQA 4BUGA 1MCRA 1UM6H 4NC1C 4HWUA 3ZHLA 3B5TA 2PYFA 3L95A 1D5BA 3FQXB 4GG8B 2E5EA 1G7PA 4P9MH 1TZHB 4I3RL 4D9QE 1KENH 1NFDA 3BPLC 1QYGH 4OZFB 5E9DB 1MWAA 3LY6A 3T1FA 2A9NL 1CFSB 3RWDB 1BFVH 3O9WC 1DUZB 4GFTB 4ZFGL 5IQ7H 1HSBB 4I0PD 5ANMB 4XNMA 3PIQB 2YPVL 3BN9C 3G04A 2VQ1B 4WJ5A 4BZ1L 3OL2A 4DN4L 5F9WB 3S5LG 5C0DA 2VZ3A 1OT2A 4G7VL 4M61B 2R56L 1YY8B 3QDMB 4Z7UB 2CLVA 3SDXB 4F3FA 4YXHL 1A4JB 4OZIA 4YHZH 2OTUA 4XI5D 3IJHB 1DVFB 5MP6L 4BYHA 4YR6B 1AGDA 4OFYD 4HFWA 4IOIB 5TQ0H 3V5KB 3D85A 4L3EB 5EU6D 4WGVB 4P23C 5CJQL 1IFHL 1CDJA 2GITA 3TT3L 1OT1A 1GGUA 5E2VL 3L6FA 1EGJH 4JFHD 2X7LB 1ZEAL 4LRNH 1BFOB 3T0ED 3GMPB 3MODL 4ONFL 4P2QA 4XMKH 1KC5L 2ICWI 5EO9A 4JHZA 2DBLL 2W0KA 3C5ZD 5EBGA 4AQ1B 1RFDL 3D3VE 3QHZL 3QXTA 5IVXA 5EU3A 4TUKL 1UB6B 2DM7A 3OXRB 1CLZL 3WDIA 3MPCA 3ROOA 3MFFA 1U8MA 4HKXB 3OHXA 1MRDL 4UV7L 1CDCA 4HBCL 3QWRD 2YBRB 5JO5B 5T1KA 3WFHA 2GCYB 3RVXC 3U4BL 5FDWA 5I8EB 4IHOA 4U6XA 2X05A 5HYSB 1OP5H 4O2FA 3C60A 1QO3A 3U82B 4PJ5A 4JDTH 1QBAA 3D39B 3HKFA 4K23L 3RIFF 4B5EA 1AO7A 2IADB 2W59A 5IESH 1MUJA 3VFNB 4YBLB 4PJIA 4QGYA 4K7PL 5HHPA 3MGTB 3FO9A 2DWEB 3RI5F 4N8CL 2VDLL 5EIIA 5CEZD 1S78C 3M8OL 5E2WL 3GSXA 1FNSH 4FQXA 3DETC 2VKXA 5IV2B 4OLYH 1FYTA 4PJXB 4JZOA 3U4EA 1EK3A 4D9LH 1LDSA 4WWKD 5AZ2L 5FUOH 4TQEL 3MFGB 3KDMA 4YK4B 5IHUH 4F7PA 3O9WD 2BOBB 1WV7T 4KQ3H 3KPLB 2JJSA 4OZHF 5IMLA 2ADFH 2FX8H 4A6YB 1IAKA 4IDJL 4I5BB 1KEGH 2C7UA 1P4LB 3LAFA 2V7NA 5T3ZL 2Y36L 5BV7L 2NY2C 5EIVA 3SDXE 5L0QB 5JOFA 3U83A 4LCYA 4RGNE 3GK8L 4O4YH 3VXUB 1NAKH 4ZAKD 3TWCH 1NL0H 1DQDH 3GMNB 3ULUC 1BF2A 3GJEA 4XPGL 3CX5J 1KEMH 5E1HB 4S1QL 3KPPA 5ISZD 2A6DB 3V5HA 1A47A 1I3RB 1YC8A 4OT1L 4Y5XB 3P4LA 4HWBA 3LN9A 5IQ9B 5JIKA 5LBSH 3RU8L 2HFEA 2HVKA 1RVFH 3MLWH 4G9FE 4KPHH 2ZUQB 3GBNH 3QUYD 3O81A 2D7QA 1KJVA 1OF2B 1WIOA 1Q1JL 4L4VB 4OLWL 2CDEB 2X40A 3WFEH 1F5WA 4R3SA 5D2LE 3N06B 2NY0D 3P0VL 4JFQA 1XCQB 5IVZB 1A9EB 4GBXB 4ZUWA 1EMTH 4IIQA 2O5ZH 3JTSB 5DD5L 5GSVA 3KPRA 4MS8C 4JFYB 3UTTA 3L3HA 3TN0B 4P2RE 4OI9A 1HHHA 1RK1B 3EOTL 5JIPA 4KHXL 2HTKD 4AIZA 4HAFA 4R0LA 4BQCA 1FYTE 3DGGB 4OZIF 1EH9A 2D31B 1RAMA 1FNGA 4ETYA 5IVXF 4U1NA 5EUOB 3AM8A 3GMRB 3VXSE 2C1PA 5I1CL 1EHLL 1AD9A 1T6WA 4FZ8H 4YDJB 3FT2B 1BBJB 4U1IA 3VFSB 2WP3O 1VGEL 3QA3B 4L9LA 1QRKA 1INDH 4LLWB 2B1AL 3VFPB 1HE7A 2EYRA 4XCFH 1U8NA 5C07A 4PJ5E 1IGIH 4NQEB 4XMKL 2ZG3A 3P73A 1L7IL 5GRYA 2RFXB 4M02A 4PJFB 2W0LA 5FA3A 4R90L 1HXMB 4CW1A 3I3BA 3HRZA 1RIUL 3BW9B 4RWHA 5ISZE 1OAUH 4RISL 1UEMA 4N1CA 2YK1H 4X5XA 1RHHA 1I85A 4AEHL 1R5IA 5C6TH 2YD4A 4E42A 1BX2B 3HE7A 2B1HL 1BQLL 1IAMA 4QRPA 4MJ5A 4DGIL 4K7PY 4PRPA 3BVNB 3QUYB 3QXAA 5FA4B 3W9EB 1WFNA 4UTBH 3N1QC 2MCG1 2AK1H 4X8XA 1LEKA 2VIRB 4M7KL 1V3LA 5D71H 4OB5L 1MAMH 4NHUB 4MAYA 2XZAH 5I9QB 2F58L 4MJIA 1ZLUK 3CUPA 2QKIA 1JPFB 5CEXB 1CLYL 3HE6B 4QRUB 1S8DA 3HPJB 3VFUA 5TQ2H 3HMXH 2FZ3A 3CLEH 2Z35B 3MRJA 2XY2A 2OXGA 4G9DB 3VRLF 5DRZA 2GEEA 4PJCA 3PGCB 3UBXI 5JDSB 2FR4A 4JHWL 5ACLA 4PG9B 1G9NC 2EDTA 5EBMA 4DEPC 5C2BH 4XP5H 2DQHL 5T1LA 4ZPVB 5FO7B 4OLZL 1FLTX 3WDJA 3H9HA 2V5RA 5BZWB 4Z7WB 4BH7A 3IVKA 4Y89A 2R56H 2FYYB 4JRWA 2ESVB 4QHMA 4HLZG 1RPQA 1YEKH 2NXZC 3EO1A 5B21A 5D7LD 3B6SA 4G42B 3BZFB 1NCTA 5IHLB 2P5WA 2LU7A 1IARB 4KZDH 3GSNA 3TO4C 2VZTA 5ID1A 3KYMB 3REWA 3MRDB 3RWGA 1CE6B 4YNYA 1XGPA 3GHBH 5GQBA 5CJBA 4F7MB 3WLBB 5HPMA 2Y72A 3S98A 4YLQT 1JGDA 1NCWL 5H2BB 5BXFB 4JPKL 2YC1A 3I50L 4RFNB 1HIML 3BP7A 4H8WH 1K5NB 2FBJH 4NNYB 4ONHB 5EOCJ 5GGQH 2Z8WC 3IF1A 3NCYP 2O5ZL 3ME0A 2XRAL 2X4OA 3PXJA 1RIVL 2WBJA 5BO1H 3ZDYE 4HBCH 4YQXH 4PLJD 5AZEL 4UIMB 3DARA 1VFBA 1FVEA 3T4YA 3ALXA 1QLEL 3S4SG 5DD1L 2I5YH 2XG5A 5HYJE 1CK0L 5FGCE 4XX1E 5L0QC 4DQOH 4X0KA 1I9JL 3L7FA 3T3ME 1MSPA 2HFTA 1EHLH 3QDGA 2JKXA 5DQ9B 3IJSB 2K9UA 2OMBA 2CR6A 1FL6A 1AGFA 2PUQT 5IBUG 2HLFC 3EYUL 2EDWA 2W9DH 1C5BL 3GMMB 4FQQA 4NM4L 4GKSB 2CK0H 2G5BA 2AXFB 3RIFK 3V4PL 4KRLB 1JYXA 1IKFL 3EDFA 3F58L 2IMMA 4NO3A 3VXTB 1FE8L 4UU9B 3R06A 1BECA 1U93B 2RJMA 3LZFH 4K9EH 4PG2C 4JGUA 4PY8J 1T04B 2FATL 1OAKL 4QRQB 2ORBL 3OJDA 5C8JA 5GS1B 1WBZA 4DZBB 1RJZB 4JCMA 4OCSL 4D0CB 5TPWH 4DW2L 1F4XL 2HJKB 3QZWG 3MYZA 3B9AA 4YZFF 4O4YL 1BQLH 4N90D 4TULL 2DJ4A 2F54A 4RNRB 2YN3A 3H7LA 1RUKH 1DVFC 3F7VB 1T20B 4KV5F 3H3PL 3K2UH 4DKEL 3NN8B 5KSBA 4JRYA 4LSUL 1U3HA 3GI9H 4OBSA 2VL4A 4JFDD 4NM8L 1NGYA 1SYSA 5JZ7D 4NC2B 1H0DB 3MRPB 3CLEL 1J9CT 5KG9A 2AV7A 3VD7A 5I1KL 5DHVA 3TPKA 3QHFL 1FVDB 3BKYL 1AP2B 3VJ6B 3MO1B 3RZCD 5C0EB 5CZKA 5F96H 3BKML 5C0AD 3HAEA 2EE3A 4YHLH 5KJRL 4POUB 1OTTD 2AKRA 2Q8BH 1CCZA 4LLVA 4DGVL 4ETQA 4R26L 4P57A 4OLZH 3SCMA 2CMRH 2DQDL 2IH1B 3WNLA 1IL1A 1QNZH 2BVOB 5IB2A 1PYWB 4G6KL 3A67H 5CIPB 1RULL 2DQTL 4YJZL 1DLHA 2W65A 2GW5A 2DTMH 4H26B 1A2YB 4HLJA 4IRJB 4HIEA 3RRQA 3CFBA 4HF5L 3VXRE 1S5HA 4GW1B 1QFWL 1OGAE 4U1HB 1R5WB 2W60A 3BHBB 1GGCL 4XCEA 4HEPG 3EFDL 4LCCB 4HJJL 2ADJB 1C5DA 2AQ3A 3C87A 5FYLL 3F5WA 5DFVD 1BOYA 1LD9B 3ZKSD 4TN9A 4XHQA 4LPWA 4HWBL 1YQVL 2VDMH 2P49B 5JQ6H 1XR9A 3SE8L 1IEHA 1B2WL 3I50H 1K3ZA 4HIXL 1NSNL 2EH7L 4OV5B 2E7HA 1JNHA 2R8SH 4XNMB 3TPUA 5DYOB 5CWSB 3EGSA 1D5IH 5E7FA 1A6UH 2XN9A 2ED7A 2H32H 3LRSB 4PJEF 1K2DA 4WFEE 1JPST 4M5ZH 3D39E 3QXDA 2VDPL 4FFWC 3VH8B 3PWLB 3KHOA 2AJ3A 1A4JA 4OGAD 1FFNA 1YEIL 1YN7B 4N0RA 4OIBA 5I76B 8FABA 2VRAA 1XIWA 2B0SL 4ZO7A 3ZDXE 1GGBL 1IC7L 5J89A 3PL6C 4JG0H 2DIAA 1I9IL 2WLZA 5JW4M 3L6FB 5ICXA 2VISA 4KDVA 3WS3A 3LKNA 1FPTH 2BMKB 2DDQH 5ICYB 1EO7A 3EYUH 1CLYH 2W9DL 1JTPA 2FH6A 1LILA 3O8XC 4W68A 1YPZE 3U9UB 1P7KA 3C5ZB 4N5ED 4TUJB 1D6EA 1IEAB 5KW9H 1YECL 1UEYA 3VFVB 1TQBB 1A7RH 2OTWA 2HG5B 5CEZE 3HLAB 1BLNB 3HR6A 2DLGA 4KC3B 3WKNA 4KROC 1YC7A 4XPAL 4K9EL 5J9PB 3SDAB 2P5WE 4KMTL 5DJZA 2J4WH 5GS2H 5DURB 3TLRA 2YBRA 2X4RB 2J5LC 3MGOB 3L5XL 1GOFA 5JW5B 2ORBH 5F21B 3BE1L 3SGDI 3U0TB 5GGTL 4JQXC 1R3HB 1S7WB 3N1MC 1H3PH 4OLVL 3B43A 3OBAA 1V7ML 4ZUVB 3N9GH 2BVQB 4WTWA 3AS0A 4N1EA 4X9IA 5J57B 4GQPH 5IOPA 3GGWA 5A2KH 1M7DB 2WUCL 1QQDA 1Y0LB 5IW1B 2DM3A 3CC5A 4OF3A 5EULV 2YD9A 1NC4B 5B3NA 4HT1H 5HSFA 5ESAB 1RUMH 3VMOA 1Y6MR 1VGKB 4FG6C 2CKNA 4GLRH 4PRAA 1UM5L 2A38A 2D7MA 5CHNA 1YMMA 1NQBA 2C1OA 4PJCE 3O6FA 5E8PB 4PJ8C 3ALWA 1MVUA 3GHBL 4CVZB 3DGCR 1EEZB 1IGTB 1TQBC 4LLUA 1T89A 1RZ8A 4JZNB 1V7NH 3VFWA 1D9KA 2OK0L 3WNKA 4ZSOE 4JPKH 3ZE2F 1AD0B 3BH8A 3VGBA 1JHTA 4N9GA 5IMLB 4S2SA 4PR5A 5D7IF 3UPRB 2HWZL 2JIXB 3I6GB 5IMKA 2J5LB 3F12B 4DN3H 4WTXA 1OP3H 5FYLE 1N5YL 4LVNB 1S7TB 2A6IB 4WU7B 4M7JL 1NCDL 1OGTA 5K9OB 3VXUA 2WBJC 4DZ8A 2BY3A 2VLKA 1AHWA 5DQDH 3A67L 3KPMA 1FRGL 2APWA 1FNHA 5DA0B 4L5FH 3VFGH 3TBYA 2X1WL 1PJ9A 2QEJA 3GSRA 4S0TD 1RJLB 3ILPB 1YEHH 2AEQL 1ZHLB 4G8IB 4Y19A 4BK5A 1T21A 3SDCC 2C3HA 2C3VB 4WNQA 2ZOKA 5T5NF 1JNJA 1OY3B 5INCB 1NCAH 4KTEL 1UKQA 4UBDD 4KTDH 2V7HA 4NSKB 2HVJA 3QI9B 1FZKB 4NM4H 1EUTA 4P3CH 4HSQA 1GRWA 5C08E 4WEBH 3WL9B 1YEFH 2CIKA 3V4PH 3VXMD 1L0QA 4WWKA 2G60L 3QDJA 3OR7A 3HZKA 1LP9B 5MENA 4J3OC 3WFZA 1RI8A 4JFPB 4XB7A 4P2RD 3JTSA 3VFOA 2PNDA 3LSOB 2B2XL 4TRPL 3NCYS 4MA3B 5DVKA 5GS3A 1MCSA 3LVEA 4QNPF 5D96C 3RNQA 4U1GC 3GI8H 2NY7L 2V5YA 3G5ZA 1KT2A 2ATKA 4M8QA 3BXNA 2GSGA 4QHKJ 1YDPA 3MRBA 2NYYC 3MNZA 3BAEH 1T7YA 5F9DC 4G5ZH 5J8OA 1I3UA 3RHWK 4XBPB 4XZUA 1EGJA 3OPZL 1H8NA 4PV8A 5AG9A 4OI7A 4AH2B 4M7LH 4FTVB 1HDMB 3QCUL 1NKRA 4NQTA 5GS0L 5KSAB 1DN2A 4PP2B 4NJ9L 5HGDA 5DUPH 3WJJA 3PJSB 1IKNA 4QRTA 4H0GA 4XPTL 4TTDC 2BJML 4HIIB 5IR1B 5L7XL 3IDNB 3GI9L 2FX9L 1DJSA 2CUHA 5HI5D 3SHSA 1QVOA 2JE8A 1QRNB 2QR0A 4FFVD 4H8WC 4MQ7B 4OV6F 1JF5A 2OQJB 1ERNA 4WUUE 3ET9F 3MX0A 3QNXA 5KOMC 2Y06L 2PXYD 1I9EA 1MHCB 2IQAB 3D0LB 3BKMH 4XPAH 1W8OA 4R7DA 5CJ5A 3HNSL 1NC2A 1RZFL 2J4WL 3H0TB 2WINA 3NGBB 4YHYC 2QQQA 1ZGLM 3ISWA 2HKHL 5AAMA 2Q8BL 4MYWB 3OQ3B 4P48A 5HGHB 4G6JL 4DOHE 4RMSA 3MV7B 4JQIL 4G6KH 4OTXH 4HJ0D 3C08H 3JTTB 5J1AB 1QSEB 3SDCD 4H0HB 4AEEA 3T4AA 5DJDA 2VLKE 1CF8L 3CFCL 3E6FB 2AEPH 4YBQD 3C09C 2CKBB 4PJIF 4ZUUB 2MHAB 4WW1B 1MY5A 2IMNA 3C5SB 3DURB 5FAAA 2EECA 1UM5H 4PJ9D 5I8KH 1CG9A 4HX1B 4NYLA 4R8WL 4XNYL 1I1AD 1RZJH 5KVGH 4ZSOA 3S37X 5JDJA 5FCUH 2BK8A 4YE4H 5TDOB 4FFWD 4L8CB 4WTZA 4L4JA 1T7XA 2XQYG 4Z7NE 2EH7H 3P9MB 4X6DE 4DOHB 2RQ8A 4K8RC 1MOEA 2IANA 1YYML 1MWAB 2D0FA 2FCBA 2WBKA 1HQ4B 5HHOE 1OCWL 1I8IB 3FB7B 1P9MC 4FQ1L 4LKCB 4QHLA 4WFHD 1FFPA 2FYYA 1DTUA 4BQ9A 4ZFOA 3F7YA 1G7LB 5IEHB 2WWMC 2BRRL 2F15A 4NWUH 1A7PH 4X9HA 3CFKB 3QDHA 3ARRA 2KQMA 3BZFA 2NY1D 2B0SH 2R0WL 1NC2D 4WI7A 3QIBA 4Z7UA 5ITFB 1DE4A 1Y18B 4JR9L 3JXAA 2QTEA 4Q0XH 3JWOH 3RIAK 4A2LA 4TPRL 1EEYA 3ULSB 3SKOA 5ADPL 1HILB 3LQZA 2VE6B 4JKWA 5DSCA 1Q8MA 5I66B 4IMLA 2DDQL 1F4HA 4LK4A 1Y6NR 1OWWA 4YXLL 4EIZC 1QSZA 1A7BA 3E8UH 5D93C 4UDTB 4RMVA 4KDTA 5IIEB 2VH5L 1R6VA 4P0DA 3SN6N 3AREC 3FQNA 1ZLUH 3V4UH 5E24E 2B7DT 3HI1B 5T3XH 4PJHF 4JHAL 4Z7VA 1A6AB 1QSFA 4TSBH 3GI8L 3E1F1 4G8EB 3LKRB 3LOWA 3IFNH 5H94A 4P46B 2NXYD 3OHXB 1JFQH 1HNFA 4YHIA 5I74C 2BX5A 4YDIL 3QUZB 3ARBA 5ADOL 3M1BA 3EDJA 4U6YB 4JRXA 5F1SA 3QCUH 4G3YH 5D70L 3EHBC 1BEYL 5IK3A 4MS8D 1U2CA 3T65B 5D8JL 2A73A 1B0RB 1C16B 4I0PB 2YS4A 1P4IH 4NWTL 3FO9B 1NFDE 3VI4F 1OAXH 3T0VA 3S96B 3MA9H 1DN0B 3MOBH 3Q1SH 1RQ5A 2GUOB 5HJ3B 5C0NC 2BSSA 2IGFH 4BZ2L 5FGBC 2E27H 3MCG1 1WFOA 3RTQB 2GFBA 5E99L 1FCGA 3FRUB 3MR9A 1A6WL 4YX2H 3QEQD 2FJFB 1T66D 3PGFL 1DVFD 4W4NA 4KY1L 5EZJA 3CFJB 1IC5L 3AFLA 1MFDH 3P11H 3D18B 4PJ7A 1MI5A 3MUGB 5D2NA 3BT2H 4M48H 1R3JA 1LWRA 5DT1L 1I8LA 4PRHB 3DMMA 1KIPA 4WI6A 3NOIA 1KB5A 3GM0A 4HCRL 5EUKA 4Y4KA 4XT1C 1L9MA 1T0NA 4J1UB 2DQUL 4F7CA 4HULB 3VFGL 3HUJA 5TGBA 3ULUH 2NY1C 3BQUA 3U79A 1IM9B 5B38B 2J1KA 1G7IA 1HH9A 2VXQH 1S7VA 3I6LE 3DSNA 4LGSB 3SGEI 2D7OA 2GAZB 3C9NA 1TLKA 5D6DC 2GJ6B 1YEEL 4Y5XA 5HD8D 1ZLWH 5F70A 3CZFA 3H3KA 1F6LL 3JWDH 5GISH 2EDDA 4HPOL 4DTGL 2CRMA 3ARED 1EFXA 4GXUN 4HC1L 2OJZH 3MRNA 2AJVH 1NMCB 3WNMA 1WWBX 5FCUL 4ZUSA 4PGBA 5I73B 5DHYB 4CAGA 4M1DL 3QRGL 2LTQC 3EJYC 2AQ1A 3FN9A 5MI0B 4GAGH 4NBYB 3M17A 5IVZA 4ZS6C 1H3WM 3B9VA 1PYWA 3QWOB 5GHWL 1JZ2A 1BD2B 2W9EL 4ZOCA 2F5AH 5E1AB 3L95B 3UJJL 5EFIA 3OAYH 2B20A 5KSUA 5DJYB 1KJ2H 2F53E 5E9DA 4YR6A 5C0FA 4IRSB 3FKUS 3T0EA 4L29A 2N7AA 1WFUA 1ES0B 2XNAA 2VDNL 4R96B 1A1OB 2JELH 2YN5A 3I02A 3T2QA 1WEJH 4MDJA 2CLZB 2DQFA 5L7XH 3JV4A 4M03A 6FABL 2RIKA 2WK2A 4Z77A 4YXLH 2VXVH 3CGTA 32C2A 5F7WC 1TMCB 3PNWA 1NANI 3LN5A 1X5AA 5DJ2A 4WCYL 4J23A 3K46A 2P5EA 2XPGB 4NKIH 3BQUD 4PREB 4EUPB 1G7MA 3AXLB 2X70B 4L4TB 3V4UL 2N7BA 5E95B 1YMHA 1GOHA 5T3XL 4Z5RB 1FZJB 5I6XC 3IDGA 3DECA 5DS8A 3UC0L 1I1FA 1UQSB 2J88H 4JDVB 5DFWH 5FDWB 3IFNL 4R4FH 2P5ED 3QUKB 5GRVK 5E56A 1UZ8B 4E42B 5HHPB 3D69A 3DI2B 3BH9A 5GS0C 5DTFB 5D70H 3BDXA 4M4RA 3KLAA 3SE9H 2BVPA 4YC2C 1U8MB 2JIXD 2AEPL 3RPIB 3AUVA 1T7ZA 3MOAL 2OP4H 2Q7YA 5ENWA 4Y4HA 1RZKH 2GCYA 4FQXB 2VIRA 1EJOH 4HKJB 2BNQD 5CEZL 4IHOB 3UTTD 3BESR 1MLBB 4HC1A 2NW2A 1YNLL 1V3KA 3B83A 3LEVL 1A9BB 3QIUB 3RPKA 3VFUB 1RZJL 4E0RB 3DX7A 1GZPB 3GSUB 4XGZA 1HKLH 2MQ3A 5FUZL 3ARPA 5TE6H 5IFHL 1ZA3B 5DRZB 2ADIA 2IALA 1IAOB 5JR1L 4NQSB 1ED3B 1U91B 4PBVC 2HT2C 2IAMD 4PJ7E 1R3HA 4NHCH 4NZJA 1T5WA 5CSZB 5F1IB 1II4E 1PZ5A 5DJ0B 2B4CL 5I16B 3Q3GB 2BHUA 4HGWB 4FXGA 1DBML 5BZDB 1WWCA 4OZGA 1G9NL 2UUDK 5BMFH 3CMGA 1A7PL 4UNTA 2BP3A 1BJ1J 2BSRA 4NT6B 4LCWE 4APQB 3PWVA 4Z76A 1BREA 3MRGB 2X4PA 3FN0H 1FLRL 3D25A 5SV4A 1HWGB 5GGSY 2D9CA 5TDPA 5MHSD 5CILH 1ZLSH 3H42H 1JRHI 4OIAA 3JWDL 5GISL 5CIPH 4GRWE 4AZ8A 4Z78B 1CU4H 3P4NB 3SJVA 4PJ5D 3OKDA 5EDXA 4XAWL 3O9WB 4N9GB 3MMEA 3INUH 4AENB 2WUBH 4P2OD 2L4OA 3F12A 5F88B 3GB7B 2D7PA 2NY3C 2X42A 2H26B 3WFCL 4OFDA 4PLNC 4U6VL 3FZUD 3P9WB 4MVBC 2JJWA 2OZ4H 1NAMB 1GOGA 2XA8H 2PW1B 1T0MA 4HXBH 2I60H 2ZPKL 1SJEA 4R4NC 4JN2A 2XWJB 2AVGA 1FV1A 5ADOH 3B9KB 4CN6A 5EN2B 4K2UH 5BQ7A 5CGMA 5JPMB 3Q5OA 2VUYA 1AD9B 1U8IB 4GBXA 4L3EE 2ZJSL 3K4AA 4Z7OE 1ZGLA 1AGEB 1BEYH 2R15A 5EUOF 5CKAA 1PG7W 2CRIA 2EZ0D 5IT2L 4EI5D 3TN0A 3MJGX 4AL8L 4NP4L 3ZE0F 4GG6A 4FP8L 4XH2B 5SX4H 3LKSB 5C0RL 3O8XA 3T0WA 1MJ8H 2EYRB 3ARDB 5I1AA 1AJ7H 2VC2H 5DD6A 4M6ML 1LEGB 1PZUB 4ODWA 1FSKC 1NDMA 4C55A 4G7YH 3STZB 3VFOB 4HIJB 4JFEA 3THMH 5J6GB 2E7LA 4Y16C 1ZAGA 1T1XB 3I9GH 5D7LA 2Z91B 1NMCC 1MHHA 5DFVC 3CVHH 4K94L 3S3PA 3OKMA 5BV7C 3EYVA 1WK0A 2V9RA 3BT2L 4ALAH 4X7SL 3LN4A 5DT1H 2F8VA 5E4IA 3W11D 1OP9A 1F8TL 1SM3L 2FGZA 5SV3A 3ULUD 5FA4A 3CNKA 2DL2A 4NUJA 5C09E 5I17A 3HB3D 4OD1H 1KN2L 4PJBF 3KPOA 3MZTA 2L7JA 2DQJH 2B39A 1BM3L 5CEXA 1X5IA 3UYRH 2AV1B 4M4PA 1IC4L 5A16A 5DO2D 5D2LA 5HYEA 3DJ9A 3DV4A 5E6ID 1LE9A 3TH2T 4HC1H 1HKLL 1MIEH 1NC2B 5D7KD 2YA2A 3CXHJ 4WVRA 2EDJA 4YWGL 4RMWA 3SGKA 1MEXH 2D4DA 3U6RB 1FO0L 3NFSL 3HS0A 3MRMB 5HYQA 2EO1A 2XZQH 4NHCL 5JLZB 5FO7A 3C8KB 3VWJA 3DX9B 2A0LD 4EI5B 3RVTC 3D2UA 3GMOB 4CMHC 1QSEA 1ACYL 4Z0XA 5I19L 4NZRH 4YBHA 3EJZC 2YWZA 3P30L 3L3DA 3L7EB 5HVFB 1IM3A 3G6DL 3ZDZE 3CMOH 1NMAH 1EEUA 5AD0A 4PG9A 2H6PA 4JG1H 1MAJA 1FLRH 3T0EC 1TZHA 4Q74A 1YJDL 1DANU 3PABB 5D7JC 4OF6A 3X13B 3T1FB 4IOIA 3S88H 4NC0B 3WKMH 5HHVH 5GRWA 1CU4L 1C5CL 4P4KC 2WWMD 4PRBA 4MVBD 3PIQA 1CBVL 1J86A 1GC1C 3CSYA 2BDNH 3O6KH 5BW7C 4U3CA 4FQXC 4KKCD 1WICA 3P0YH 1B88A 5HI3C 5H37G 3QIUC 5JA9A 3UX9B 1OW0A 3GSNL 2Z92A 4LPVA 2O61B 2OTUB 1AR1C 4MXQC 3UTQB 3UC0H 4JY4A 5BRZD 2XA8L 4D9RD 1DEEA 1T0PB 3S5LA 2X1XR 3MC0A 2BSTA 3UPAA 4ELME 3WO4C 1VACA 3ZHKA 1N64L 1VKXB 3OF6D 5LCVL 2B5IC 1AO7E 4HKBA 1N8ZA 5FM8A 1HKFA 4CKVX 5EA0L 2IPKB 3TA3D 2Y25A 3I75A 5GPRA 5JUEL 5JPNA 1S7QA 3IDJB 4NQCE 3MJ9A 3BEVB 4V2CB 1JNNL 4POZC 3JV0A 1B4JL 5FKAB 3QAZC 2Y07L 1URLA 1IE5A 1MLCB 2EIZA 1ZT7A 1CGWA 1UB6A 3D2UD 4X98B 3VXRD 1CT8A 4J2XA 3H3BC 1NUFA 1A7QL 3G08A 3TJEL 3V0AC 3LEVH 5F72S 1F4YH 3FL7A 4UU9A 3ZKXB 4K7PX 4XI5C 1U93A 1U92A 2HLAA 3MYJB 3GDBA 4XMPH 5DQ9A 3I9GL 2W0PA 1D5XB 5I30H 4UNVA 4I2XE 4QWWC 1KULA 3HN3A 5EWIH 1RUQH 3RL2A 2B4CH 3V5DA 3QO1A 3GSXB 5EUOE 4U1GB 3RWHA 3QIBC 4FQ2L 1HEZB 1HZHL 3NFPB 3GMNA 1I3VA 3MCLH 1LDPL 4JM2C 2QQKL 3CH1B 3R0NA 1Z9LA 3BEWA 2DD8L 3D85D 4ORZC 5I15H 2OJEB 3CCHA 2FWOB 4YEFA 3IKKA 4ZG1A 1HINH 1TQCB 1UM4H 3AREA 1U8LA 2BNRA 3P4MB 1DDHB 2DQIL 1XF5B 3BO8A 2IBBA 4XWOD 1A3LH 1KPUA 1T03L 3VA2C 1DP0A 1MRFL 4Q2ZA 5TE7H 5DVOA 1CGSH 4YHKH 4PR5B 2WIIA 3SE4A 2P1YA 1MHPL 2VITB 4RDQG 2JJTA 4Y4KB 3FOMA 1H5BA 4NN6B 5ETUA 1LP9F 4EIGB 4U31A 2I60L 1QFUH 1DBBL 1BQUA 1CDUA 1FG2B 4OFIA 4PRDB 4WW2C 5T1KD 1I85C 3BQUB 3B2UD 1A6TB 3V7AE 4U7KA 2DWDB 3OXSB 1U42A 4Y1AE 5EBWB 1QRNE 3IFOA 3KWWA 5DJAA 1CXEA 1JV5B 4J4PC 4LSTH 1YJDH 1NBZB 1MFAL 5EUOA 3DVIA 4O58H 3TN0C 4U7SA 3FT2A 5FGBA 1MJ8L 3OZ9L 4MAYC 4RFNC 1OAQL 5FOJA 5F9JA 1FZMA 1DLHB 2BDNL 4KXZI 1MH5A 1JMXA 4DVRL 4XHJD 3U0WH 3LEYL 5E2UL 3QI9A 2FSEB 1OM3L 2ATPB 1NAMH 1WJ3A 1IBGH 3EGSB 4UZGA 1CICA 1YPZB 1G84A 1F58H 3QWOA 5FA3B 1K2DB 4MLSA 1HCFX 2VWEC 1U3JA 2W38A 4ALAL 1T5XA 3DMMC 5ESQA 4ODHL 4LLYA 4ODTH 1ZHBB 3QG6B 5HYSA 4M93B 1JTTA 3ARXA 2PYEE 2DYPB 1DQLH 3BQUC 4XC1L 1OAZH 1JF6A 2F74A 2AJYH 3MXVL 1RJYB 3FTGB 5HVHB 4F15C 1Q9OB 3FT4A 5KANG 1H3UA 4OKVA 1X4XA 1F11B 4K55A 3T1WA 4QHUA 1JZ4A 1UJ3A 5I1IH 1NMBL 4PJFA 2WZPD 2Y07H 4DFHA 1NH6A 2IANE 3MLPA 4MJIB 4KGJA 1HI6A 3C60B 1IC4H 3I84A 4HK0B 4L4VE 2ZNXA 5ECJE 2FZ3B 5HHMB 1CXIA 5B8CB 5L8KB 3G5XB 4WI4A 4PRIB 1QZ1A 2A6JB 5EPMB 1S3KH 2ARJA 3MREB 1N26A 4P3WA 2FGWH 3D0LA 4G43B 2HJLA 4NO0A 4GMSH 2WMPA 4O2CB 2HFFA 3FO0H 4YDVB 4C56A 4OUOA 3DX8A 5BRZE 4W4OC 4ZUVA 3VD3A 1WTLA 3LHPL 4WEMB 3HLAA 1I1RA 1BLNA 4ZS7L 3TO4D 3RUGA 4AMKH 3HI6H 4WFED 2XKUA 3QDAA 3CC5B 2NY0B 3EIFA 1GSMA 3VXMA 3CMOL 5IB3B 1XH3B 1NMAL 4M1GH 4OKDA 1DQJA 4Y5XC 1P1ZB 3ULVF 4P9HL 1KCSL 4HUVA 2VL5A 3QXWA 5I71C 3GJEB 5DRWB 1D9KB 2QQLH 3KG5A 3UO1L 3RNKA 2BC4A 2MPAL 4RBPH 3RWGB 5GZOD 3GO1H 4CGTA 1AXTL 1ZV5A 1RFDH 3QHZH 4XBEL 4YUEH 2YD6A 3VXPB 3R1GL 3ZKXC 4Y5VB 4HV8A 3C5JB 3ARDD 2YUVA 4AIOA 3QWRA 5IEKA 2VUOA 3LQAL 3GNMH 4YGVA 3U4BH 4S0SD 1CTNA 2BNQB 4D0DB 1FL5A 3GMRA 4P2OC 3T4YB 4ZQKA 5CFHA 1WZ1L 3ULVH 2HT4C 4NGHH 4MD4A 1BBJA 5H2BA 1RU9H 3WLWC 3OAUH 2NY4B 4GKZB 1C12B 3DVNB 3TYFB 3QDGE 4PY7B 5LJYH 1TZIA 1U3HD 3K74B 4PGDA 4QYOA 4HPYL 2VLKD 3MV7D 4OLEA 4IS6B 1IEBA 4KK8C 3LEYH 1S9YB 1UH2A 2XQYK 4RX4D 1J1PL 3RVUC 3PDGA 4Z0BL 4LOUC 4JFEE 1QYGL 3HG1E 1Q9KB 1U95B 2Q76A 1EO5A 4YIQB 3TV3H 1XMWA 3QNYB 2M1KA 2EXWD 1A21A 3VD4A 4TOYH 4IDJH 4L9LB 1S5IL 4A6YL 4NSKA 4P3DB 5E0QA 3KYAA 4RMRA 4XBPA 5I1EH 5FYJL 5DZNA 2R2EB 1CXKA 4RFEB 5GS1A 5I8OH 2HJFB 4H20L 1HYRC 1N5AA 1QKZH 1NLBL 4UQ2A 1D9KD 1X7QB 3WIHA 3IETA 5E8DH 3MUZ1 3DUSA 4YXHH 3SKJL 5IKCB 1ZHKB 3GFUA 3I2CL 3QG7L 4JM4H 1ODAA 2NY4C 1U8QB 2AXGA 1SJHA 2GJ6E 2X1PA 4AM0B 1KT2B 2ATKB 4X80H 3QBTB 5C1MB 2YA0A 4NJAH 3NN8A 1IFHH 1OGAB 3AY4A 5DMIH 3W11C 4KJWC 3K2MC 5C09A 2V9QA 4M3KB 4OF5A 2HT3D 1RJZA 1NGYB 1L6XA 4BH8A 3NAAL 1A0QH 2X44D 2ESVD 2ZSWB 2ADGB 3QP3A 1CR9L 3MV9D 4ONFH 5JDSA 3VG0H 4BKLB 1DBJH 3FRUA 1GHFL 4JY5H 3CX2A 5C08D 2LAGB 1G7HA 4FXKA 1XF4A 4GMSL 5KN5B 4W6YB 1RHFA 4EBQL 1MRDH 1QFOA 3VFRA 1MI5B 3MUGA 4F37K 1XGRB 4LBEA 3TP4A 3ALPA 3QISA 1AQKL 2ESVA 1QFUL 1VERA 1I75A 2FIRT 2FB4H 1NFIB 5FKPB 3QIWA 2I9TB 3RFZC 5KVEL 4PRPD 3IGAB 3OTTA 3TA3A 5ALBH 3HUJB 5TGBB 4JANA 4OF0A 4OAWB 2CLVB 3MNVA 2OR7A 4HKZB 1OPGL 2IH3B 4OZFA 5BOZG 1S7VB 2EC9U 3ARFC 4L8SC 2AJUH 5J13C 4YNYB 4LLDB 5EU5B 4D3CH 5DJXB 5I1HL 2APVA 3IDMB 2NZ9C 3T0DA