2ADFH

Crystal structure and paratope determination of 82d6a3, an antithrombotic antibody directed against the von willebrand factor a3-domain
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
218
structure length
218
Chain Sequence
QIQLVQSGPELKKPGETVKISCKASGYTFINYGMNWVKQAPGKGLKWMGWKNTNTGETTYGEEFRGRFAFSLETSVSTAYLQINNLKNEDTATYFCARDNPYYALDYWGQGTTVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Von Willebrand factor
publication title Paratope determination of the antithrombotic antibody 82D6A3 based on the crystal structure of its complex with the von Willebrand factor A3-domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting/immune system
total genus 46
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2005-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2adfH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2adfH02
3GK8H 4JKWA 5JW3L 4HS8L 2E7CA 3EZ8A 1SY6L 5C0FA 3NGBC 1CFVH 4KRMB 3RZWA 3FO9B 1A7RL 2FBOJ 2EDKA 2FCBA 2VAAA 5DHVH 3UBXA 4ZSOB 4HMEA 2VISB 4YFLF 1A9BA 3CSBA 5DQDL 3SKOB 3MC0A 4J4PC 4U1JB 2OS7A 5DC0A 2FLRT 1HHJA 4KRLB 4XWGL 2UY7A 5SV3A 2OMBA 2VXVL 1YECH 3WEXB 3TWCH 3BZ4B 5T5NF 2HN7A 1Q9KA 3HMXH 3U6RB 1S7UA 4MQXC 1IC4L 2BC4B 5HI3D 3EYQD 3V6OE 3EO1B 5CINH 5E99H 2D0FA 5E8EA 3SGJA 1TETL 2VZ1A 4C54A 4UIKL 4GRLD 1HH9A 2R2EA 4JO1H 1L4IA 2BDNH 1RMFH 1G9NL 2FEEI 2ED9A 4JKKA 4LF3A 4Y1AD 2XQBL 2IG2L 3HE6A 5D6DC 4KC3B 1K8DA 3RPIB 2XA8H 1P4BL 4QWWD 1MCOL 2VQ1A 3RHWF 2FX9H 1S7RA 2X7LA 2DMCA 4WFGE 4XPGH 2GYSA 1J05A 2J6EH 3OKOA 5GGSB 2WQRA 1IGYB 3HR5B 3EYFB 1P6FA 5INCA 3WFEH 6FABL 4RBPH 1ODAA 2EDEA 4X99A 1FSKC 1J0ZA 1OTUD 1KULA 4TPRL 3W39A 5GISL 1F3DH 4PG9A 3QUZB 3RWDA 1DBML 5K9JH 3V0WH 1WBYB 3GM8A 5F8RC 3X11A 4ODSL 2HKHH 4Q9BA 4TN9A 2Z35A 4A6YA 3EZJB 4JPIB 4HDIB 3NZHL 3CFBA 5C08E 3ZKXB 2AQ3A 5EC1A 5I30L 4H0IA 4UOW1 4C4KO 4XNYH 1D5ZB 1DBAL 1FIEA 1F6AA 3C8KB 2CPCA 3T0XA 5C2BL 2DDQH 1LO5A 4HS6B 2IC2A 2A74B 2W9EH 3QCVH 1WF5A 4JLRA 3L95A 4QGYA 4APQA 2NTSP 1SJEA 2XT1B 3F6LA 2YHGA 4K3JL 5I1AB 3UMTA 3SDAA 3RNQA 5TDOA 4WW2A 4P99A 1XF2A 1XH3B 4TRPL 4QHKJ 3TNMA 4AIZA 1G9MH 4HQQH 5LQBH 3WIIL 1BVKA 5JXED 2H6PB 5ID0B 5I2IA 4ELME 5HI3C 4QNPE 5DDHB 1OB1A 3WHE1 4CN4A 5I8OL 1JRHI 1NDGB 5IB4B 4TQEH 1MFNA 2GSIB 4W6YB 3MGAA 4KY1H 1S9XB 4LAQH 1BD2D 3KJ4C 3VH8A 4OI8A 2ADGB 1MY5A 1Q72H 4XNUL 4QOKE 5FUOH 1C7TA 1HHGB 3WCYA 1RZIB 3T0BA 1QVOB 2W9LA 3MLXH 1FFPA 5TDPA 4F37F 1GOGA 4XMKL 1A9EB 3M1BB 3VD4A 4QWWC 1J1OH 4QXTB 1FFOB 4IMLA 3FO9A 1S78D 3BEWB 4YDLB 4ZSOA 2K7PA 3BT2L 3IDYB 1PZUB 3SKOA 3MV9B 2CXKA 4PJ8B 3N1GC 4EQ2A 4K7PY 3WEXA 5F9WB 4XNQB 3BZ4A 1BFVL 3U6RA 1N6UA 1Q9WA 1NAMB 2ZJSL 3DX6A 5HYFA 4FHBD 1KPUB 1ES0B 2NR6C 2P5WB 3DVGB 3D87B 5AWNL 2EH8L 2D2OA 3RI5F 1UACH 4HIXH 4MXQC 2AI0H 5T1MA 3OSKA 4RA3A 4WHYH 1HCFX 4ELMF 3MCKB 4QNPF 4LSRH 3ESUF 1DZBA 3S88L 4EI6A 1BF2A 4HT1H 5GGTH 3MJ8B 3AM8A 3MNVB 4JDTH 4N0UA 3RPIA 5L2KD 3CMOH 2YKLH 3PL6B 4JZNB 1OAQH 2EXYD 4RRPG 3SKMB 5H2BB 1YN6A 4U2ZA 5IMOB 4OFDA 5EIIA 1WWBX 3RWIB 1HZHL 1QZ1A 4LGRB 1IGYA 2D3VA 1AXIB 2YZ8A 2OI9C 3HR5A 5T1DL 5ADOL 1I8LA 2QBWA 3CVIH 2V17L 5GGVY 3AFLA 1KTLA 5IROA 1TNNA 4OCXH 4X7SH 3L6FA 1EEYB 4BZ2H 2IAMB 4F33B 4PJDB 5IBUB 3HG1A 1IGJB 1S7WB 3ARGA 3L5XH 1A5FH 4EOWL 4UB0H 4HKZB 4JPIA 4PREB 4ZNEE 3JWNC 3QI9C 2QQNL 4EDXA 2X40A 4KAQH 5DD3L 4YDIL 3L3GB 3ZDYF 1IARB 4NYLB 3HNVL 2PETA 3C08L 1D6VL 4HV8B 4M7JL 3REVB 3TBWB 5JOFB 3MBXL 3S3SA 4YEEA 1D5ZA 1OAUH 3C8KA 1C5CH 5EU5A 5DK2B 2EDLA 1DLFL 4NO5B 3KPPB 3SCMC 5L6YH 3DSFL 4HS6A 3BIBX 2A74A 3WIHH 4UTAH 1NCDH 5IVXE 1PBYA 1A7NH 1B4JH 1AKJB 1C12A 5EZJB 4Y89A 4H88H 2V2TB 2E5EA 4QHLB 1BECA 1EVUA 3TN0C 1XH3A 1FAKT 5IR1B 1T3FB 4NC1E 3MJ9A 4FXGB 3WNOA 5F7DA 1E6OL 4M93B 4KI5E 2FYYB 2H6PA 5FYJU 5ID0A 1UCTA 3SO3B 4HUUB 4UT9H 5DDHA 3SGEI 5C8JB 5D8JH 1INQA 4XP1L 4TULH 5KVMC 1MHHB 1QNZH 1M7DB 2FHCA 2GSIA 4G8IB 1S9XA 3J7HA 5F1SA 2P45B 8FABB 5F44A 4MD4A 1RZJL 1IBGH 1TJIH 3D39E 2QADC 1HHGA 4P2OC 3CPLB 4XPFL 1NFDB 1S7XB 2Z31D 2EXYC 1A9EA 3M1BA 4PG2A 2FGWH 2X4UB 4K3EL 4P3CL 1WK0A 3BEWA 3UTTB 4OBSA 1T83A 4FP8L 4HCRL 2VLRA 5F6HI 4KPHL 3E2HB 5BO1L 5IVXF 4GAJH 1YQVL 5E94B 5LWYH 1E28B 3VMOA 2BFVH 1AO7A 2HH0L 4NQUA 3KXFE 4JPVL 4OBRA 4LCWE 1I85C 1TTGA 4MZ2A 3BQUB 3WSQH 1A7OH 3GSNA 1SVZA 3MUHL 5TDNA 1IE5A 5EB9A 3LHPH 1KPUA 1ES0A 2P5WA 5ISZD 3ZE2F 4TUKL 3ZKMD 1I9EA 4KI5F 4LCIL 4YHKL 4UAOB 3MCKA 4NHCH 5DVKA 4TTGA 5CIPB 4P4KA 5JXAL 1J0KA 3SHSA 1JTOA 4X83A 2G75A 3QCUL 4PRHE 1I1AD 2CRZA 2IANB 4TOYL 3SKMA 5KSAB 2AEWA 1N26A 4MMXC 5H2BA 2BNUB 5IMOA 2WMPA 5J3HD 5TQ0L 3DX9B 3RWIA 3BX7C 3B3IB 3G5XA 2BRRL 3DUSB 2AW2A 4QTIL 4TSBL 1INEL 2YC1B 3DBXB 2Y06L 5FF6A 5FO8B 1EEYA 3V6ZB 4I77L 3M45A 1A64A 1KEML 4PJDA 4N0YL 4QRUA 1IGJA 1S7WA 5DJ0B 2OXGA 4M43L 2AK4E 1IFHH 4HKZA 3EYSL 4PREA 1WISA 5FV2A 1FZJB 1GGIH 5E9DD 3L3GA 2PW1B 4LRNH 4HV8A 3TBWA 5JOFA 3GSUB 4FQXA 4MA3B 4XP5H 3N9GH 4X5XB 4RISL 4KKNA 4L4TD 2AJUL 3CVHB 2R2HB 4JVUA 3BUTA 2XKSA 5DK2A 3R0NA 2XOTA 4NO5A 3TIEB 3KPPA 3JWDL 3O6FD 1KPVB 3SJVB 1ZVHA 4NUJB 1UG9A 1T1ZA 3SE4A 4KGJA 5HHQB 1TDQA 5EZJA 5KOMC 1R3IL 5JR1H 5CBAA 1WFUA 4PLKC 1I1YA 3QFJE 4JQXA 1GSMA 3EFFA 4HK3N 4LCYB 1XT5A 3RVWC 4FXGA 1X5HA 3FKUS 1FNHA 2AXJA 2FYYA 1U8PB 1RZ8A 3OV6A 3O9WD 5D9SB 3D9AH 2H1PH 1MHHA 3FT2A 1NGPH 3E8UH 4G8IA 3ZKMC 4L8BB 2HT3D 3GMNB 4PJBE 1FNEB 4NQED 5GSVB 3CK0L 3MBEB 5CSGA 5D5ME 2IBZY 2QSQA 3CPLA 4PRPE 3V0VB 4UDUB 3HNTH 5GJTL 1NFDA 3ZDZE 3WO4C 3VW3H 5T3XD 2X4UA 2DQJL 4XAKE 4HULB 1MF2H 5T5FH 2G9HA 3RIAF 3WJJA 4ZAKD 2XZCH 1CF8L 1IT9H 3ETBF 4WI8A 1FO0A 1KNOA 2VAJA 4K2UH 4QEGA 5EPMB 4ZFGH 1E28A 1CDHA 1F4XH 2WSKA 1CXHA 5AYQA 3UC0L 2DQHL 3HI5H 4JRYD 5MI0C 4BFGA 1TQCC 2UVEA 4OD3H 4U1HB 3TT1H 3BQUA 4LARH 4DFHA 4A2LA 3N85L 5BJTA 1E4XL 1JV5B 1NC2D 1MCJA 1FL6A 4OLVL 1UKQA 4N0FB 3TV3L 2CXGA 3D2UB 4R4NC 5CIPA 3K4DA 1MJUL 3MROB 1A47A 4YHYC 1CVSC 2NY7H 2CLVA 3WS6A 4F7PB 2AXFB 1A6WH 3KGRA 3VCLB 4PJBF 4AENB 5KSAA 2CDEB 4XVJH 2BNUA 2IFGA 5D5MF 3DX9A 1NEZG 2DM2A 3PWPD 3ZDZF 3DUSA 4ZS6D 3O2DH 15C8H 1MLCA 4ONOA 2MHAB 3DBXA 2RFXB 1FP5A 2EYTA 1XGPB 2F5BL 3MOBL 4MJ2A 5M94B 4JQVA 1T1YA 1I9RH 3V6ZA 4ODXA 1RK1B 4YDKH 4YHOL 1DJSA 4NFDA 2E6PA 4R7NB 4HWBA 1OAXH 5DJ0A 2PO6C 5D7JD 4N8CH 3FRUA 4HEME 4DUVA 4WI3A 1Z9LA 3QQNA 1KJ2A 3QZWG 1FZJA 5GRYA 5IEHB 3FFCB 1GGCH 3HS0B 1G0DA 4DEPB 4DVRL 3GSUA 3QXUA 1JP5A 4OLYL 3CVHA 2R2HA 5IBLD 4JREC 1S9VB 3BIKA 3TIEA 2L0DA 4OF0A 3R1GH 5SWZB 4LCUB 4G8EA 1KPVA 3QNXB 4PRBB 3SJVA 5J13C 2O61B 3LIZL 4NUJA 5TGBA 4TYUA 4G7VH 2VXQL 1Q9OA 4CNIA 3P77B 4O58L 2H2PC 4U6HA 3MJ7B 1DCLA 3L7FB 4G9DB 3MXWH 4OM1H 4NC2B 3NA9H 4B41A 1R0AL 4J3WA 4LASL 1KLFA 5GZNC 2HMID 3TJHC 3B2UD 3QH3A 1V7NH 5IJKC 3EDFA 3S97C 4OF3A 5GGUB 1HEZB 3THML 3G6DL 4OGAC 2O5XL 2DD8H 1MLBB 5ICYB 5D9SA 2ZPKL 3KHQA 1M4KA 1BJ8A 5HXMA 3U79A 1V05A 2XKNB 1NCNA 4GKNB 4GW1B 4L8BA 4S1SL 4KDVA 3LKOA 3Q5TA 5GSVA 4BQ8A 3GKZA 2OP4L 3HPLA 4UDUA 1E4XI 3H8NA 1B6UA 3QIWB 1UGNA 3EOTL 1K3IA 2NY4C 2YD4A 1AGDA 1UM4L 5DUML 3BHBB 3KYOA 4I3SH 2Y5TB 3QHZL 1CXLA 4XCNA 5C9JA 4WWKC 4ZS6C 5IVZB 5D7LB 3BP4A 4Y4HB 4F2MB 4RIRB 3OJ2C 4OLXL 5HGGS 5EPMA 3TLRA 4ODWB 2VDRL 5BZDB 4U1HA 2VXSH 3X3FH 1UWGH 1JYXA 3VGBA 2R9HC 1S9KC 4R9HA 5F7YC 2APVA 4NDMB 3L5WA 4JPWH 2Q20A 2MWCA 2MQ0A 1JV5A 3MRMB 3MLSH 4ZG1A 4N0FA 2ICEB 4AH2B 3D2UA 2VDNL 2D7QA 5DT1L 1RUKL 5E8NB 3VGAC 3MROA 2GSGB 1PLGH 3FQNB 2VLLA 4Q9CA 1PZ5A 4P2QE 4GLRI 2HT4C 5CCKL 4AENA 3OR6B 4X9FA 2BX5A 4BSWA 3QJHA 5T3XL 2C1OA 2BERA 1BQLL 4HFWA 5L88L 1ITBB 4RCAA 1KC5H 5DR5H 5I0ZA 3BUYA 4OT1H 2MHAA 1KCRL 3K1DA 2RFXA 4AQOA 3EO0B 5AYUH 3QXTA 3B8SA 3T0AA 5ABDE 4NN5B 4XBEH 3ARFB 2XI9A 4WFHE 5HYJB 3JWOC 2EYSA 1MI5A 2X4OA 4U7KA 4ZTOH 3RIFK 4R7NA 5FO9B 5CWSB 4XPAL 5EORL 3KWWB 1CIDA 4HAFA 2W0LA 1JPTL 4S1QH 4W68A 3QUKB 3ZZ1A 2E27L 5FYLH 2WW8A 1WFTA 2O5ZH 5IEHA 1QFWL 3HS0A 5I75C 2R1WB 1AC0A 3MLTA 4KGLA 1QLFB 3BXNB 1GZQB 3K2UL 2B39A 3VXTB 3ZKQD 4LCUA 2O61A 4JG0H 3TFKD 4BQBA 4I18B 4KJWD 4OGXL 1UCBL 4G5ZL 1HIML 4N0RA 4HG4J 4NO0A 5KANI 5HHME 3QRGH 5T1KD 2F58H 1QEWB 3O8XB 5D1QD 1YMMA 3G08B 3L7FA 4G9DA 4H8WL 1U8NB 3GUTB 5MEPB 4K7PH 4XAWL 1AI1L 4X7FC 3CLFL 4DTGH 3G9AB 1E27B 5GS0D 3H3BC 1OARL 5EH1A 3QPQD 1HQRB 3WN5B 2ZUSA 4Z7QE 2D03H 1MLBA 3GFUA 5E2UL 1VKXB 1K4DB 4QRRD 3O0RH 2XKNA 4GW1A 2JJUA 1LP9E 4Z7VA 3JWOH 2F54A 2XICA 4MAUL 2MQCA 3CFKB 3ZTNH 4HUWB 5JIIA 43CAB 1VHPA 4R2GC 1J88A 4FN0A 4HPOL 2VDKL 1QSEB 3B9DA 1S7VB 4AIXA 4C55A 2V9RA 1NGQH 1TPXB 5DWUL 1VSCA 1MRCH 2VLJB 3BHBA 1HHIB 4HH8A 2V6HA 1U6AL 2Y5TA 5IFAL 2A77H 1WBZA 2P43B 1B3JA 3QDHA 5GGVH 4YHML 3F7PC 5EIQA 3AXLB 4K23L 2LE9A 3T1FB 2W60A 1GGUA 1MCBA 1MHPL 4WO4B 4P2RD 3AS3A 4FQIL 1U8LB 1U8MA 1K85A 3UJJL 4M8QB 4NDMA 3GSWA 1JWSA 5DVLA 2I9LB 3JUZA 4O51B 1PG7W 1KYOJ 1Y6MR 2ICEA 3O6MH 4AH2A 4QRPB 4Z7QF 3UAJC 4DW2H 1KENL 3P11L 3LSOA 1A1NB 1QA9B 4D0DB 1T03L 1EXUB 5DC9B 4JG1L 5SWSE 3DSNA 4HF5H 3V79C 2G5BA 1MSPA 1IGFL 3OR6A 4RA0C 1E4WH 4JM2B 1N6QL 3Q2CA 1KCLA 2ILLA 2CIIB 4KMLB 2VQTA 3IVKB 1IZJA 3GJFB 4K9EC 1UM5H 3VFPB 2R29H 4KK5C 3C6SB 4LPCA 3GSRB 3EO0A 5D1QC 1B0RB 4NZTL 1YY8B 1B2WL 2L4OA 3QIUC 1T22B 3ARFA 3Q3GB 1FBIL 5J6HB 2J12B 1B6DA 4K3DL 4JRXD 3IGAA 5FO9A 1MHCB 1MRDL 5CWSA 1NFIB 4IOFD 3KWWA 1U3HB 4NJ9H 4Q6YA 4LIQL 2C9AA 2YPKB 5ECJE 3TO4D 1NCWH 3U4EB 4NM8H 5DRXB 1A3RL 4RGND 5DVOA 3VD5A 1H8SA 5CILL 2EIDA 1WUNT 3HB3D 3KAAA 5GIRB 2R1WA 1RIHH 1A0QL 2A6IB 4NBZB 5ALCL 1OWWA 1QLFA 4EUPB 1C16B 3BXNA 2ESVB 3HZVB 5E2WL 5CD3A 2BVTA 2IQAB 3IT8D 4WY7H 4QHUB 3FONB 2B4CC 4GBXB 2DQFB 1IQDB 1WEJL 2HVKA 1KN2H 4UUJB 4OKDA 3KPRE 2DQEL 3O8XA 4XRCB 5E00B 3GUTA 4HXAH 2ZSVB 3TBVB 5MEPA 3LEYL 1OSZB 5HHXL 5IP4A 1E27A 2NYYD 1CXIA 3WN5A 4JAMB 5CJXC 2RAMA 1NUNB 4HKXB 3WFBL 1DBBH 1VKXA 3BN3B 2YR3A 3VFSB 4BFIB 3C5SB 3HAEB 4KQ3L 4MJ5A 1FFNB 3CFKA 3C9NB 5GS0H 2J7LA 3TH4T 3U4AA 3MXVL 43CAA 4RAHA 4ZUTB 1W2KT 4YO0B 1BIHA 3BPLC 3Q1SL 5B8CA 2Y07L 4MJ4A 4NKOB 4MA7H 2VLJA 2F5AH 2ZCKL 4WCYH 2A1WL 3GBNL 4PTTB 2E7BA 3HE6D 5D7KE 4PYHA 5CJOH 3H9SB 5E5UB 5FM8A 5DRWA 2XXCB 4Y16A 4H26B 4DK3A 1T4KB 3ARUA 4X4MA 4ZTPH 2J1KA 3T1FA 1RIVL 1CYGA 3G6JA 1U3YA 5EOTB 3E6HA 5IB2B 1RV6X 1G7MB 2AJSH 1U8LA 1EDQA 1RAMA 4MJIE 5E1AA 3DLQR 4Q6IC 2ITDB 1FVCB 5KVFH 4PJHB 4S2SB 4W70A 1FYTE 4O51A 4PD4J 3QIBB 5ALBH 3FB7B 4QRPA 3KJ6L 1QYGH 4KTDH 4EDWH 3QO0A 4XHJD 1PY4A 2D9CA 3OHXB 3W0WB 2APFA 2VLKB 1QA9A 2I60H 3HA0A 3MA9H 2Z92A 1KB5B 4J7RA 5A2KH 3BIAX 2WLZA 2A9ML 2CIIA 2X70A 2XY2A 1CR9H 3LKQB 2IMNA 3GJFA 3VWKB 6CGTA 1YDPB 4NKMB 5C0AD 4LFHG 4UNVA 3FQUA 2WV3A 2DN7A 2ENYA 3GSRA 1KN4L 3TH2T 4MHHG 2FSEB 4KVCH 1YY8A 3KLSA 5H94B 1T22A 4OLZH 3V0AC 2X1OA 3DURA 2APBA 5J6HA 4APQD 3ZYJA 5JW4M 5FHAL 2NYYC 2NQCA 4JHWH 1MHCA 3BP5B 5CEXB 4BM7A 3SDAD 4NRZA 5FO7A 5KTEL 3S34H 1U3HA 5IQ7L 1DUZA 5HGBA 2YPKA 2J5LB 1A7QH 3IDUA 3EDDA 2AV1B 5DURB 4BZ1L 2J8OA 4HK0A 5GIRA 2VDMH 4XNXL 2HTKC 2YD8A 1DEDA 1C16A 3WNKA 2ESVA 1ZVYA 3MJGX 5LBSL 4LOUD 2IQAA 4QHUA 1TCRB 3HRPA 4OD1L 4HXBL 4HWEL 2PR4H 1DBJH 5JHDE 5EZOL 3BDBA 4GBXA 2DQFA 4JFHE 5TJWK 4PGBB 3P30H 1AGCA 2YEZB 3GJEB 3LS4L 3IFOB 4KK8D 4G43B 4XRCA 5E00A 1FLRH 2ZSVA 4MA8H 4FQLL 4X5LA 3IS0X 1NPUA 4KQ4L 3ISWA 3MRRB 1A3LL 5IB5B 5C0ND 1NL0H 2V5RA 4JE4B 4HJ0D 2UUDH 5DRZB 4HKXA 3RU8L 5BW7A 2C4XA 5I74B 2P8PB 1KOAA 2GTZA 1KBGH 4U1KB 4ZXBD 3VFSA 1TVBB 1LEIB 1JGLH 3HAEA 2XFXA 5FB8B 1YEGH 3TPUB 4MWFB 4HW6A 4L1HA 5L2KE 2X4SB 2XYCA 3T0ED 1I9JH 3C9NA 5EUKB 3MPCA 1VGKA 1ETZA 4CN6A 2H3NB 4PJ9B 4DKAA 3HMXL 3WHXA 4YO0A 3FAWA 2Q8AH 1JGUL 5CINL 1CGSH 5C3LD 1J5OH 1ZHBB 3QNYA 4M5ZH 5KSBB 4NKOA 3KPOA 3FB5B 4G6AD 3PQYE 4ONHB 4RFNB 3H9SA 1CLZH 2FWOB 3BDYL 1EX0A 5CD5D 4H26A 5IFJB 3KR3L 1CT8B 1F4WH 1HOCB 3VJ6B 3RX7A 1WLHA 3VXUB 5EOTA 1KXTB 4ERSL 1PG7H 4MB5A 5FHBH 1G7MA 4YDVB 3IF1A 1ZLVK 1QRKA 3QCTL 2ITDA 4IRSB 4S2SA 4W81A 4F8QA 1BX2B 4WW2C 3AREB 3F12B 1EEUA 4Y4KC 4HIHA 3V9FA 3QIBA 2MFNA 3L9RB 3HPJA 3MLVL 1JUFB 4JB9L 3HG1D 5KG9B 3PWJB 1FYHB 4LVHB 3W0WA 3ARGD 3MRJB 2WWKT 4OZGE 1JPSL 2VL4A 4ZUWB 3FN0L 3V4PH 1KB5A 4OTXL 1K4CA 4FTVD 4IDLA 4KTEH 4LOUC 1VACB 3I6KB 4LLWB 1J87A 4J6RL 5KW9L 1C5BL 2ZUVA 5CZXC 4Y19E 3LKQA 3VI4E 1E4KC 1MFAL 1JGDB 2EDFA 1UA6L 4D9RE 1YDPA 4NKMA 4UOW0 4Y8AA 1PJ9A 3Q6GH 4ZS7H 4LSVL 3MV7D 4A6YH 2FSEA 2YMXL 3QEUB 1J86A 3RWGB 3ULUC 2YN5A 1EGJL 2YD7A 5CEXA 3C87A 1RUML 2J4WH 1X5YA 5C0NC 3T0WA 2XRAH 3NIDE 5IFHH 1HNFA 2W9EL 5JTWA 1MFCH 3DX8B 3BKMH 1CZ8L 4PJGB 3UJTH 5IMMA 4GRMB 4KJYB 3DMMB 4U1MB 1KCKA 2R69L 1W0VB 4IOIB 5C0IB 2ICWI 2CGRH 2NW2A 5C0CB 4RMWA 1ZLUK 3GMQB 3WHE0 1RJZA 3H3KA 3TA3A 1FC2D 3MLUH 3KPNB 4DKFL 5KAQF 3CFJA 3CFEA 1TCRA 2EXWD 2DKUA 2NXYB 2PN5A 1DN2A 5IT2H 3QYCA 3SKUD 1BAFL 4OZGF 2NY1D 2PW2B 4F7TB 4KRPD 4OAWA 4PGBA 2YEZA 3WD5H 3MV8B 1I3GH 1Y0LA 3IFOA 4IMKC 2Z0BA 3HI6L 3AM8C 2ZG3A 3U0TB 2OJZL 3VI4F 1CLYL 3HUJA 1CGVA 5BV7B 4IM8A 5BQ7B 4UTBH 3QDGA 4YUEL 4ZFZB 3HC4H 4DGVL 2VLRD 2CRMA 5FYKU 1CQYA 5L7XH 2P8LB 3BD4A 4AG4L 4YXKL 4Z5RB 5CBEA 5FUCC 3FN9A 2P8PA 5IROC 4ZO8A 1AO7D 1TVBA 5FB8A 1MIEL 3QUZC 4NQVA 3NIDF 4OGYL 3RUGB 3TPUA 4MWFA 3UBXI 2VH5L 3ULUH 1HXYA 5F9AC 4Z7OE 4L5FH 2X4SA 2OQJB 2IEPA 3I3BA 4KUCD 1CICA 5EUKA 3IJHA 2P5WD 1Q1JL 2VDOL 1GHFH 1A6ZA 5D2LE 1QBML 3L3IB 5GGQH 2E8YA 2GJ6B 3ZKXC 1GPOL 1ACYH 5CP7B 5KSBA 2ED8A 4P4KD 3U7YH 3FB5A 3O2VH 4GJTB 3CUPA 4ONHA 2MPAH 4U3CA 1W72L 4PJ5B 1QFWM 4ONGL 4Y5YA 3H3PH 5C07B 4PJFB 2D7PA 1CL7L 1HOCA 3VJ6A 1PY9A 3VXUA 1CD1B 2AV7B 4XCFL 3O4OC 4YDVA 5I15H 4GMTH 1JZ6A 1YPZB 4IRSA 2DLEA 3WIFA 5E9DE 3ES6B 1BX2A 1GGBL 4YR6B 4R8WL 5HHOA 1F45A 4TSCH 5IOPB 1HSBB 3A6BL 3RVTD 3HI1A 1T2QL 3GRWA 4JDVA 1KTDA 2NX5E 5KG9A 5IHBA 1EO7A 3MRJA 1H3PL 4YXHL 3U7AA 4AYFA 4LLVA 4ZUWA 2W92A 5JZ7D 4Z7OF 2CR6A 4LLWA 3S4SB 4FQXD 1JWMA 1JGDA 4TTDD 2Q8BH 5D2LF 1SM3L 5F3BB 1BHGA 4XVUC 2ZKHL 1OGAB 2NY3B 4CRPA 4JFDA 4OF8A 1ZHKB 3RWGA 4JFFB 4PRDA 3GMRB 4Z7UE 4PG2C 3UDWA 5C0BE 4JVWA 3ILQD 4NJAL 4YDLC 4KTYA 4AL8H 1JNHB 1CFSA 4U4BA 3IDYC 3CC5B 2IALA 2UZYB 4L3EE 3DX8A 4PJ8C 1XR9A 2XN9A 4RNRB 2RCSL 4PJGA 3LKSB 4GRMA 3RGVC 4FQCL 4H88L 5SV4A 3UEZA 4XCEB 3DMMA 4U1MA 2EECA 1W0VA 1BGXH 4IEFB 1FL5B 2HJKB 1FN4B 4IIQB 2OK0H 3GM0A 5C0CA 5T33H 3GMQA 3HC3H 3TIDA 4Z7NE 4OCYH 2EC9U 5FDWB 2XQYK 3QUXB 3NFPA 4DN4H 1YEFL 4WGWB 1TLKA 1U2CA 4YBQD 1LD9A 4EI5C 3MJ9H 1V7MH 4F7TA 4PRNA 3KPSE 3MV8A 4OZIB 3MGOA 5ICXA 5DVMA 2QKIA 3U0TA 3PL6C 4JRYE 3CFCH 3R06B 2R23B 5EN2B 1TJIL 3RVUD 2J8UB 1IQWH 3RZCB 1IEBB 3A6CH 5TPWH 5CGYC 5D1ZB 3QEQE 2Y72A 2R2CA 2XKUA 4GKZB 2P8LA 3OAYK 1KT2A 4KH2A 4KXZH 3OMZA 1EMTH 4Z7UF 1N7ML 4FABH 5IB1B 3RUGA 2IAMC 3BQUD 4HIEB 1KB9J 2B1AL 2Z4QB 2OQJA 3C8HA 1Q94A 4UNUA 5IG7B 2DMKA 1OSPH 3SQOH 5CEYB 3FOMB 4HIJA 2BFVL 2LFGA 3QDJE 5D6CB 4WJ5A 4G9FE 5T3ZD 2AK1H 3L3IA 4WW1B 2GJ6A 3BD5A 1TVHB 5CP7A 5JMOC 4DN3H 5FYLE 3AUVA 2RIKA 4Z7NF 4YDJB 2AGJH 4PJ5A 2OR9L 3MFFA 4TTDC 3K4ZA 4HAGA 3JBG7 4ODUA 1ZANL 5C07A 1FIGL 1A2YB 3GSNH 3AY4A 5F6IB 3OTTA 3B5GA 4ZFOA 1CD1A 5HYSB 5GXBB 4UU9B 1YNTB 3B4NA 5ERWB 2N56A 2AEPH 1C5DB 1AR1D 4LVOB 1Z0NA 2WIIB 4YR6A 4U6XB 3LH2L 4JQXC 3VXNB 4H1LG 2YA0A 1NC4B 1ZVSB 3TBTA 1HSBA 2KUTA 3BO8B 5MHSD 1KYOK 3VRLE 4M93C 3SO3C 4HIIA 4EVNA 4F9LC 4ODVL 2PYEA 3KG5A 3NZ8B 1NCCH 1XGQA 4L9LA 5K9OB 3G5YB 3ARBD 5HGAB 4KROB 5GRUH 1LGVA 4OSUH 2BY1A 2QSVA 3MLYL 2DQGL 3CXDH 2AJZB 5F3BA 4W4NA 3VGEA 4U1IB 4LRNL 3ARDB 1WICA 2FL5B 2JELL 1MREL 1W8OA 5DD5L 2R0ZL 4PB0L 1ZHKA 1KSRA 2CLZA 4X6DF 2D31A 1J12A 1V3MA 4OCMC 4YX2L 4WVRA 2LQRA 1CBVL 2GITA 2EDBA 3PV6B 3WUWB 5I17A 2DJ4A 1QBLH 1F42A 4JM4H 3CC5A 4HWNA 5BCAA 4XMPL 3E2HC 1VFAB 3CSGA 3SKJH 4RNRA 1T66D 3FOLB 3LKSA 5A2JH 2BOCB 1AFVL 4HC1L 1R3JA 2BP3A 3PABB 4K7PX 3AC0A 2RJMA 5JIPA 4FRWA 4ZD3H 1J8HA 2HJKA 1FN4A 3BQUC 5FGSA 5I1EL 5DD6B 2WINB 2DTMH 2V9QA 2XZAH 5KVDL 4TUJB 3PWNA 5FDWA 3VRLF 3QUXA 1OL0A 5DFTA 5FA3A 2XACC 4PUBH 1FG2B 5EU6E 1OTTD 3QG6A 2AJ3B 4U1GB 2NZ9C 2JB5H 3D9AL 5JIHA 3G5ZB 2GIYA 4CDGC 1R3LB 4Z78A 4OZIA 1Z3GL 5DVNA 4L3AA 1SEBB 2EE3A 1HINH 4NQXB 2QSCL 3R06A 3EFDH 2R23A 3GO1H 1I9IH 4QRSB 5KSAC 1SY6A 1ZS8B 2ZUYA 3FQWB 4S10A 2IGFH 3RZCA 1IEBA 3QWOB 2CIKB 2JCCE 3BGFB 4KXZI 4M7ZB 5D1ZA 1MCPL 4DVBB 4GKZA 1RULH 1WVZA 3RWFB 5KAQG 4C56A 2QQLH 5DUPH 1MJ7L 3PGCA 4YHLL 3B2VH 4R4BB 3D3VA 2AJYL 2BNRA 5A2FA 1XZ0A 2XZCL 4JVPA 3HHRB 5IG7A 2Z4QA 4ZPTA 4G7YL 2N4IA 5CEYA 1A6TA 4JJHA 3FO2A 1D5BB 4YAQB 4LARL 3ZSSA 5CUSH 1FO0H 3D2UD 3K46A 5HI4C 2JB6B 3BVNB 3TBSB 3U82B 3WLBB 1J1XH 4X7TB 2C5DC 1IKFL 1MCHA 2NY0B 3I02B 3H42H 4BSJA 2H26B 1ZEAH 5EOCL 2LVEA 4JFQB 1REIA 3H9YA 1JHKL 1A2YA 4M62L 1JZ5A 4G42A 3KLHC 2P1YA 5M7QA 1JZ3A 5MP6H 4HH9B 1DE4A 3ULVC 3F7QA 4WNQB 3HE7A 4YPGB 5CMAB 5T3ZH 1D5IL 1EO5A 2VITB 4KZDH 1RK0B 1YNTA 5ERWA 5CIPH 1C5DA 4J1UA 2RR3A 2WIIA 2BMKB 4GG6E 1J10A 3TVMA 3O6KH 1V5JA 1MI5D 1TIUA 3MLZH 4PD4K 1P7KA 2NW3B 2XTLA 4JGMA 5LXGH 4P5TD 4NFCA 2CUMA 3HLAB 4GRLB 5I8KH 2R0LL 3VXMA 4KDWA 4Z8FH 1A6UL 4S0TD 2FIKA 2XTJD 1EK3A 4E42A 1LEKB 4ZOAA 4K07A 4L4JA 1OTTC 4HFUH 5C0RH 2COQA 4Y1AB 5C70A 5INDA 3MBEC 4KHTL 2AEQH 4I2XE 4U1IA 5FYJH 4AEIL 5C7XL 4D9QE 1A7PH 3ARDA 5B4MC 4HWBH 2FL5A 4I0PB 1UB5A 3DUHA 3U9PH 5DEZA 4NZUH 2FBJH 4KKAD 3VDBA 2R15A 1KJ2H 3B9AA 4K8RC 3VGDA 3VXSD 2LTQB 4NO0D 3NVQA 3PV6A 4UBDC 2IPUG 3BZDA 3MRQA 4KJQC 2SEBB 2JF1A 4QRRE 2EEDA 3BISA 1YMMD 1F6LL 3CVHH 1TZGL 1RURH 4L8SA 3MUJA 4LBEA 4NM4L 1GGTA 3RVXD 1ZA3A 4GG6F 4P57B 3D25A 1OW0A 5KVGH 5DD6A 2WINA 1QRND 4L29A 5IHUL 1V7NL 2VN4A 4FQ1L 1WZKA 3EDEA 1FG2A 2DD8L 1CE1H 3LRSB 1FNSL 2AJ3A 2DKMA 2IPTL 2F54D 4JFOA 4MNHB 4M6AA 1YJDC 3G5ZA 3OF6D 4CKVX 1R3LA 2G60L 2BZDA 4U1LB 1FGVH 2QQKH 2XXMB 3WLWD 3S37H 5BVPH 3UYRH 4QRSA 1OAZL 3OZ9H 3VE0B 3FQWA 2ADFL 5D70L 4ZUUA 3QWOA 2CIKA 4O00A 2ADIB 2BNQE 1JFQH 3FRPA 2R56L 4DVBA 1T2XA 4RRPA 2PXYC 3RWFA 5JDJA 2DOCA 1NBQA 1ZGLB 12E8L 4GW4B 5EWIL 1FPTH 5F21B 5IVOA 1I7TB 4R4BA 2HRPH 2MOVA 4DWHA 4DZ8A 4PJIB 1CS6A 1ZHLB 5J1AA 1MWAL 4I8DA 4UT7H 32C2B 4LPUA 1D5BA 4IJ3B 4YAQA 1UWGL 1BD2B 1LE5B 3S5LB 1AXSB 2JB6A 3UROR 4DEPC 3NFSH 1QLRB 1AXTH 2GJJA 3DVFA 1FVEB 1MCFA 1NMAL 3NCFB 3TO2B 2H26A 4G3YL 2FH8A 3EHBD 2NY6D 1BQUA 4PJAE 4ZFFB 3U46B 4M7LT 4HH9A 4PJCB 1PLGL 1N0LA 4EEEA 5IIEA 3GI9H 2AABH 1F4YL 4YEFA 4YPGA 2CK0L 2MJWA 1D7FA 4IS6A 2VXUL 3ZL4L 1RK0A 4X4ZA 1UJ3A 4NQDE 4AMKL 1H5BB 1NBYB 3LEVL 1WQVT 5C9KA 5GRXG 4X4XB 1YJDH 1DSFH 1Q9LB 4PJ7E 5EZIL 2ZOLB 5E2VH 1S7TB 2YRZA 4X5WA 3IFLH 4XC1H 1X5FA 5GJSH 3FCTA 1DL7L 4O5LL 3DYPA 5AYUL 4OIIH 1XGTB 2R4SL 1HHHB 2ATKB 1KLUB 3K2MC 3MRKA 4GRLA 1TZIB 3B9KB 3AU1B 2CKNA 1H3GA 3QPXH 2DLFL 4G6JH 3REWA 1G7JB 1LEKA 2E9IA 3MV11 2FGZA 2L7JA 3S3PA 1MQ8A 3ZO0A 3SE3C 2B2XH 4LHUD 4P59L 3U9UA 3WYRA 4U7MA 2GI7A 4QY8A 1SJXA 2IBZX 4UINL 3HMWH 3QIWC 4I0PA 1OP3H 3NFNA 3WMSA 2OSLB 1UQSB 3DVNB 4F58L 1JGEA 4NGHH 1Z5LB 1LO4H 3HZYA 4FNLL 5F1NB 4PJAF 1XIWD 1ED3A 1OHQA 5H8DA 4IBLT 1DVFC 3DHJA 4Y4HC 2X10A 1MQKL 2C26A 2EYRB 1QD0A 3V5KB 2FHFA 5ILTL 4M1CC 1RUPL 2X1WL 4P57A 4S1DC 4NN7B 4PJ7F 2VZSA 2XY1A 2Y36L 3C2AH 2XIDA 3BP6B 1AJ7L 5E4EC 2HAZA 3LRSA 2UWEA 4BFEA 5DJCB 4HD9A 3SDDA 3OG4B 4MNHA 3G9VA 5HYEA 1YA5A 1C1EL 2W65B 1FL3B 1M71B 1B0WA 4ZO7A 3NCJH 4PJEE 5F7KC 5H35B 3JWOL 4XNMA 4K94H 3MYJB 4UV7L 2VC2H 1IM3B 1FZMB 2VLJD 1U41A 4XXCA 4HCRA 1GYAA 2DQUL 3MUZ1 4LPVA 3MODH 4Y16D 5E8PB 3EGSB 3T2NL 3BWAB 1IM9B 1ZGLA 4OM0L 1S5HB 5EC2B 5I66B 2HWZH 1I7TA 3LN5B 4NN5C 3ARFC 1NQBA 2X89A 3H6JA 1EEQA 1QSZA 2FX8H 5FIEA 3BGMB 2Y6SD 3DXAB 3BJ91 1HKLL 3I3DA 4OZ4A 3BW9B 4POZC 3N50A 1K5NB 32C2A 4GT7A 2I27N 1P4LB 5TFSH 4XHQA 4QRPD 1AXSA 1FH5H 1LO2H 3ZT5A 5HY9A 3ZE0E 1HH6A 2VO5A 2F9BT 1KJ3L 1QLRA 1ND0A 4JJ5B 3RVVD 2UYLA 5IW1B 3U46A 4DW2L 4ZFFA 1OD9A 2Z31B 1XAUA 4YFDB 3K7UA 2EC9T 4PRIE 3MLWL 4I18C 5DFVD 4PJEF 4M48H 3JXAA 1VADB 4N90D 2IJ0C 3O8XC 4WGVB 1SJVA 4Y5XB 3UTOA 1QACA 4LQFL 1OTSD 1TJHL 4L4VE 4AT6A 2YSSA 1CD8A 1XGTA 3AS2A 3WN5C 4QHKI 1HHHA 2ATKA 1DR9A 3V6OA 4HGKC 1J8KA 5EULV 1TZIA 3B9KA 5DEFA 5ISZB 1EFXB 3RA7L 4AQ1B 3FFDB 4LDEB 5KSUA 1IC7H 2YRLA 1FZKB 1VFBB 4LKXB 4MNQE 5JQ6H 1G7JA 1P84J 4I5BA 3L3HA 4I4WA 4Y2DB 3VFTB 1JNJA 4LRIA 2C3VB 1WAAA 4P4RB 3CAFA 3PP4L 4Z95L 4NM8L 2ESVD 3ULUE 1I1AB 1D6EB 1MCQA 5J12B 2CMRL 1OP5K 4ZSOE 1F58L 3A67H 5F7NC 3VDCA 4MNGB 2PF6A 2OSLA 1TPXC 4OUOA 3DVNA 1YC8A 1NUDA 1X7QB 3KPLB 4GBXD 1CE6B 1Z5LA 2WWKO 4E5XB 3KYKL 5DJYB 1S5IL 4AK1A 5H37H 5JNYB 4FZ8H 4ORZC 5EUOB 4TSAH 4I3RH 4WW2F 5LGKA 4JY4B 4WTXA 3V5KA 2EE6A 4WO4C 2YXFA 5BVJB 1HYRC 4UDTB 2IBGA 1IGIL 5JOPD 4UV4L 1CWVA 3U36A 2VN7A 5DGQA 5I1LB 3BN9C 5EU4B 4UQ2B 3SE8L 1CGXA 1SEQH 2CRYA 4K9EL 5C08A 1H9VA 1RU9H 2E7HA 4Q9RL 4UT6H 1S9WA 4L4TB 2H8PB 3WL9B 2W65A 1E0OB 3OXRA 2HJLB 4GXUM 1M71A 4IRJA 4HUXA 4JO4H 4OCRL 3LY6A 4JKMA 1JPGB 5CFHA 4WFEE 1FRGL 3O6FB 3KYAA 3R0MA 4N5EC 4JM2C 1IM3A 3BZEB 5FUCE 3ULUF 2ITCB 1O5DT 1BEYL 1IGCL 4DAGH 3H9SD 3I9GH 2OLDA 5AUMB 4OJFH 5E8PA 4ELKB 1RZ7L 2ORBL 3BWAA 1IM9A 1DN0B 4HKJB 1S5HA 4YE4H 5EC2A 5I66A 3LN5A 1NEZA 5EO0B 4MXWH 1T21A 5F96H 1J7VR 2YS4A 3BGMA 1QG3A 3DXAA 3O9WB 1KB9K 4UQ3B 5GZOC 1U3HC 4XVTH 4OI7A 1K5NA 4NRYA 3QIBD 1P4LA 2B4CL 3OXSA 1BQHB 3C60A 4P5MB 3G6AB 2PTUA 4PLJD 1I8MB 4LVNC 4MS8C 4NQEB 3W0WD 3WFCH 2MCPL 1NAKL 2R1XB 3BRFA 1JWUB 4PP1D 4EN3B 4JJ5A 1JNNL 1IMHC 3QZWA 1AD9A 1F3JA 2P47B 3P9WB 3FQTB 5IW1A 1XGUA 2BVEA 1XR8B 5ITBH 4D3CL 1NLBH 4F37K 4X4YA 1DQMH 3RNKB 2C3HA 3VG0H 1YEJH 1NEUA 4B5EA 4GBXC 2ZG2A 2A9NL 4ZAKB 3MOAL 3NABH 5CZVL 4Y5XA 1J0HA 3SOBH 1A02N 2ZCHH 3P0VL 4GAGL 4YGAB 1BFSA 3KXFB 4CJ1A 1WZ1H 1WWCA 2QLVB 1P69B 3GJFH 4AIOA 5E8DH 3VU2A 3DYMA 4KV5F 4H5SA 3OGCB 4GAFB 2O26U 4XBGB 1EFXA 4HMCA 1MPAH 1WZMA 4RWYH 1NC2B 1FZKA 4LKXA 3RI5K 1YEHH 1MVFA 2P4AB 4Y2DA 1IEAA 2CDFB 4P4RA 4WFFD 1RFDL 5C0GB 1N5YL 4AEHL 1JHTA 4O9HH 4JFYB 3TA3D 1D6EA 3IJSB 3W2DL 3P4MA 4IRZH 4MNGA 4LLUB 3MV9E 4HJGB 3KPLA 4E5XA 1QLEL 1PGRB 4NKDA 1NMCC 1QBAA 5DJYA 1A6VH 3MOQA 4PBWD 5EUOA 3CDGA 3MLRL 3IRPX 4G6FB 5ITFB 3LQAC 3EJZC 3MO1A 5BVJA 2P5WE 3QDGD 1VERA 2BVPB 1RUAL 5FOJA 1FLRL 4X7DC 5L9DL 3CLEL 4BYHA 5I1LA 3IDIB 5D7JB 2DTSA 1LEGA 1NMBL 1VFUA 2HFEA 2JJSC 4NBXB 5EU4A 3TBYB 5JHLL 4ZNEA 1QKZH 1ZLVH 1U9KA 1EHLL 3QIBC 2BVOB 2OCFD 3NACH 3VFMA 4YZFE 4YH6A 4GG8B 3HCVB 4OD2B 2CSPA 2B5IC 2QHLA 5I0DA 1CICD 4L4TA 2H8PA 4WHCA 3RJQB 3WL9A 2HLFD 2HJLA 2JTDA 4QXGL 3MUY1 2G2RB 3MYZA 3GNML 1IAIH 4N9OB 1UADC 43C9A 4XCCH 1QR1B 4KKCC 1V8HA 3B8YA 3V4VH 3BZEA 3L5JA 1SVCP 1DQQB 2OR7A 3HAEH 3B9EA 4JFPB 3VWKC 1PSKL 2F53B 1UZ6E 1LK3L 1T89C 4ELKA 2DLTA 1MFDL 1DN0A 4HKJA 4PJDE 4BSVA 1U8OB 2A0LD 4GXVH 3T65B 3STZB 1ZKAA 1IKNC 1F4WL 3OKEB 4IRSD 3LZFL 5FV1L 1SYSB 4CVXB 1QP1A 2D7TL 3UTPD 4YGVB 4G6MH 2YPVL 5HHOD 3QQ9D 2J5LC 5K93A 1BQHA 4KI1A 1I8MA 4JFED 2W0FB 4NQEA 3U2SA 2R1XA 1KCUH 3I6LE 3L3DB 5I6XB 3DROB 1JWUA 4EN3A 1A14L 5TQ2H 4NRXB 4YZFF 4OFYD 5C0JA 5JMRA 3FQTA 5KN5A 2ED7A 3HFMH 5LGHL 2VLMD 4YHIB 3RNKA 3TGXA 5DMJB 4FFZH 4U31A 3FO0H 1KG0A 4GW5A 1G7HA 2AJVL 4ZAKA 3VRIB 3G5VA 4L3CA 4ONFL 2YXMA 4WWID 2HFFB 1BZ7B 4JFDD 4JPKH 1KB5H 4MQTB 3ZSTA 1UZ6F 3TEUA 1U93B 3KXFA 4HZAA 4ZO9A 4ZS7L 5F9OH 4U6VH 4O4YH 4PJDF 3RAJH 1WIPA 3OGCA 2EDRA 2X9YA 5I1CH 5F7EH 2YZ1A 2XN9D 3INUL 5I74C 1F2QA 2GHWB 2J4WL 5DMKB 1NH6A 3V7AE 1A1MB 2IQ9L 3NIGE 2FEDC 3GZKA 4QHNB 3F58L 1KFAL 1L0QA 5IGXL 2CDFA 4FQ2L 3RY5A 3HKFA 3MRNB 4O2EA 5C0GA 1NSNH 1P7HL 5CSZA 2HLFC 4PR5A 2NXYD 3IJSA 4NP4L 1BREA 4PJ9C 3UTTE 1HILB 4M6NL 1FAIH 4M5YH 3IJYB 2DI7A 3EUUA 4HJGA 1S8DA 4YHNB 1MFBH 1FDLL 5I1HL 1U58A 4RFNC 3LPWA 2PKDA 1UH4A 3WE6B 5IT2L 4R90L 4I9WD 5F7FA 2CUIA 5ITFA 3TZVA 3O3EB 2OZ4L 2BVPA 3OB0H 2HA1A 3OGOE 3I84A 3IDIA 2VKXA 5D7JA 3WV0A 2AK4A 3AREC 2BJML 4JZJA 3EBAA 4PGZA 4JGUA 4OZFG 3OJMB 2IANE 3M8OH 1KIRB 4KZEH 3KYNA 1EJOL 3EAKA 3HCVA 1BIIB 4OD2A 4NOFA 4LVHC 1MCCA 3MRDB 1T1WA 2QJDA 3WFDH 2HT2C 5HHNB 2G2RA 3NIGF 3ULUL 2YD9A 2GJ6D 1QR1A 1NFDF 3IKCB 4I0KA 2JJVA 4WHTB 2OX5A 4RFOH 1DQQA 4PJ5D 5BS0D 4JR9L 1KEGL 1B9ZA 3V52L 2Z91B 1GAFL 4NIKB 2F53A 5C07D 2BSSB 5T1KB 2E7LC 5JORA 3U0WH 3QO1B 3MJ6A 4XWOC 3O81A 3T77A 5AZ2L 1ZLSH 3DHMA 2M26A 3QFJA 1R5WB 5FYJE 5DZOA 3DPBA 1U8OA 4YXLL 2WBJA 3NCCB 3IDXH 2HG5B 4N1CA 3STZA 3BKYH 2V7NB 4J12A 4NBYB 4NZRL 1SYSA 4CVXA 2VABB 4OFPA 4RZCB 4KVNL 5F8QC 35C8L 4JKPL 2YK1L 5FCUH 4NNPH 3EO9H 1BBDL 3KYMB 5C0EB 4JANA 3O45B 2W0FA 3DMMC 2H45A 1I75A 3H9HB 1XGYH 2FJGB 3ULVE 1EHNA 2R4RH 3SJVE 1X5AA 2PYED 1YNKL 3BP7B 5D5MA 4PRPA 3KDMB 1KJVA 3LQZB 4OKVB 4P9ML 1MCDA 1JGVH 2X42A 5JDSB 2WP3T 5MEND 5I1IL 2AQ2A 4X6CB 1XCQB 4DZBB 1FJ1A 4OZHB 1F90H 1EVTC 3GRWH 3QDME 3VRIA 1INDH 1HCVA 1ORQB 3RIAK 2J88H 3P4NA 3PE9A 4LVEA 4LP5A 2HFFA 2NY3D 1BZ7A 2Q8BL 3UX9B 3C5ZA 4JCMA 5BV7C 4P2RB 4LSSH 3BYTA 1U93A 3GGWB 5DLMH 3MZGB 4M9OA 4ZOEA 4RGOL 3QXAA 5FYKD 1E6JL 1G7LA 3I3EA 3DTXA 5TF1L 2OXHA 1LMKA 1UWXK 3P0YH 4MVBD 5DMKA 5J06A 4ODHL 4R0LB 1N4XH 4CW1A 2FECI 4YNYA 1J8HD 1BFTA 5K59E 3MRHA 3S35H 1T6VN 4M6ML 3ZKND 2ZCLL 5I1GH 3QUXD 3CDCA 2JIXD 4Y88A 1BGXL 2YD2A 2Y9RT 2FJFB 3T3ME 1WV7T 3LS5H 1Q0XL 3ULVF 3HC3L 5CEZD 5EZLB 2FB4H 4F15B 2X6MA 4ZODA 4P9HC 3F7VB 1C08B 5FOBB 3OAZK 3CZFA 1MCWW 3AY4C 3RZCD 3S37X 1KIPA 4HLZH 3O3EA 5C0DA 4JRXB 1N59B 5D1ZD 2ICWB 1ZLWK 2CR3A 4C56D 3MACH 3D6GA 5EA0H 1I4FA 2CUHA 4X8XA 3TO4B 5D71H 2YWZA 5I1DA 3D3VD 5D7IE 4RGNB 2BNRD 3O11B 1KCVL 1X5JA 5BV7H 3DIFB 3F8UB 1CVRA 1AY1H 2NMSA 3ROOB 1OPGL 3CSYB 5JPMB 1GC1C 4I3GA 4Z0XA 1WTLA 1R5VB 5ADPL 2BSRB 3SQOL 3IKCA 3BZFA 5EBMB 5AD0B 5K59F 5KS9B 4LMQE 3QWRD 1FVDB 3VA6A 4BKLB 4XVSL 3UO1L 3S3JA 1HYSC 4OCWH 1I7ZB 5DJDB 3LKRB 1JHLH 2Z91A 4P48A 2BSSA 5T1KA 4XCYB 3OJDB 3T3MF 3QO1A 2ZUQB 2QHRL 5MEOB 1VPOL 1R5WA 1KV3A 3HE7D 4BK4A 5LCVH 2IFFL 2VAAB 4JO2H 3IETB 3UBXB 1NAML 2HG5A 4JHAL 4JQIH 5DA4A 3QFDA 1LE9B 1XF3B 3L1OH 3F5WB 3VXOA 3FFCE 2VABA 2YD5A 3W9DA 4RZCA 2ZZUT 3TVMD 3VXRE 5SX5K 5F7WC 1CG9B 3ULSA 3KYMA 2HN7B 2YA2A 4OI9A 4MVBC 1Q9KB 5C0EA 3O45A 3H9HA 4WV1A 5SWZE 1LP9B 2DQDL 2VDLH 4IIQC 1KCSL 1TQBB 1MRFH 2DMBA 3VXMD 2R2EB 4UILL 4U7SA 4Z18A 3QUXC 5IBTH 3TCXA 1RVFH 5JDSA 1GRWA 1CLOH 3BE1H 3CIQA 3H0TB 1F8TH 4R96B 4X6CA 1XCQA 3SGKC 3FMGL 1UWEH 4DZBA 4LF3B 4Y4FD 1P4IL 4OZHA 2HTLC 4LGPB 4JGJA 3HE6B 4M1DH 4CBPA 1K8DB 3IDMB 1QQDA 1ORQA 2ERJB 4UIMB 3ARDD 4M7LH 4D9LL 5FGBA 4ZDHB 5EOCJ 2VQ1B 3MFGB 5DO2C 1S7RB 5F3HB 5GRJH 3GGWA 3RBSA 5D1ZC 4MD5A 5INCB 4XPTH 1S7QA 1JNLL 3WNLA 1YYMH 5E1HB 3WFHB 3W39B 4PG9B 1PAMA 1SYVA 2VB5A 4JY5H 4R0LA 1FQ9C 3GEWB 4HBCH 1RZKH 5A3ID 2DM3A 4NO3B 3D85A 4XP6L 4Y7MA 5ENWB 4RMRA 3QAZB 4NWTH 5MEQB 2Z35B 4A6YB 2VZVA 4RSVA 1NBZA 5FYKH 5I19H 5HI5C 5I1JL 1L9NA 2Z93B 2ZWLT 3CFBB 3MRLB 4OB5L 3KLAB 2FJFA 4LSUH 5CP3A 1B88A 1PKQB 3QXDB 1B90A 4P46A 5EZLA 5D7LE 5IBUG 1DBKH 4MQ7A 1JMZA 3B6SB 5JLZB 5KJRL 3S8WA 5C0AB 3F7VA 2ADJA 5FOBA 1XMWA 4N0CC 3CD4A 2AXHA 4NQCE 1ZT1A 4UI2A 5DHYA 5F6IC 1T5WB 3BKCH 4JLRB 1UB6A 4APQB 2VE6B 4XMLH 4HUVB 1N59A 3SDCA 3SDAB 4DOHB 5CEZH 3RNQB 5TDOB 1XF2B 4OLUH 4GO6B 1RY7B 3TO4A 4F57L 3TNMB 1S7SA 3ZMRA 3LD8B 3M17A 3O11A 1BVKB 5JW3H 4HS8H 4KK6C 3DIFA 3KS0J 2Z8WC 1A7RH 5FUZL 1OB1B 1X9QA 1QFPA 3BSZL 3CSYA 2X2YA 3HMXA 4NCC2 5DQDH 4C83A 1R5VA 1JRHH 4NQTA 3VH8B 4XGZA 4HZLB 4XWGH 5DMYA 1N3NB 4KROC 4M1GL 4PS4L 5KS9A 4BKLA 1GOFA 1FVDA 1H3WM 3L5IA 4DKDC 4XB8A 1I7ZA 3MNWA 5DJDA 3LKRA 1IEHA 1IC4H 1S3KL 4FFWC 4NZJA 4XCYA 1R3HB 1QHOA 1D9KD 1TETH 4PP2A 5HYJE 3RY4A 4UIKH 3ARDC 5MEOA 4EIGB 4IMLB 1G9NH 3IETA 3OKLB 1IC5L 1L7TL 1LE9A 1XF3A 3T8XB 3F5WA 3V7AG 1SMAA 2XQBH 2XA3A 2IG2H 3I75B 1T5XB 4XX1G 1CG9A 5DC4B 3LB6C 4R7DA 5FECA 4ZXBB 1LHZA 4NQSA 3V7MA 4QO1A 1P4BH 1T0NA 2EIZB 3AVEA 1MCOH 1MJ8L 1MVUA 5E5MA 3JUYA 1Q9WB 1SBBA 2PCPA 3T0EB 1LP9A 3NCMA 4LCCB 3DX6B 4QXUL 1OW0C 1ADQL 1FE8H 3V5DA 6FABH 2EZ0D 4R6UA 5BXFB 1BVZA 1LO0L 4L1DA 5T1MB 3S96B 4CU8A 1GIGL 1N5AB 4TPRH 3H0TA 5GISH 4R96A 3BRDA 4EI6B 4U1GC 1DBMH 4J4PA 3PGDB 1MCIA 1NBVL 2YBRB 3IDMA 4N0UB 4UIMA 4Q9QL 4ODSH 4OFKA 1G9MC 4I0PD 3TT3L 4ZDHA 5LKNA 2NY2D 3X14B 1N0XL 1YN6B 3J8F7 5F3HA 3DV6B 3GIZL 5EIIB 1EGJA 4GQ9L 3AS1A 2N1KA 3S98A 3BGFC 4M7ZC 5I30H 4JO3L 5DD1H 3IB4A 2BXZA 4MJIB 1DBAH 1LO3L 1KTLB 3RL1B 3K8MA 3L3KA 3WFHA 2FATL 5C2BH 3L6FB 2EDNA 4NWUL 1CDBA 3BMWA 3U7WL 3HG1B 4NO3A 4TVPL 3ARGB 4ZO6A 5ENWA 5K33A 5TE4L 1QSEE 1RURL 2B1HL 5MEQA 4K3JH 3VA2C 3BI9X 4X7CC 2VLJE 4RBPK 1H3VA 3ULVL 5K9QG 3W11C 4EDXB 5EG6C 2Z93A 3TYGL 1BZQK 4FTVB 5SWSA 4PLNC 2Q86A 3MRLA 3HRZB 4WUKL 3KLAA 4TRPH 4CJ0A 2DM7A 1PKQA 3QXDA 3SDDD 4L8CB 5KVGL 2OI9B 4EJ1C 3FTGB 3WIIH 2CKBL 2YPLD 1MCSA 1YYLH 3B6SA 1MUJA 1UENA 3VFNB 5JLZA 5EU5B 5C0AA 2NY0C 1IGML 4ODTL 4DFIA 4KJPD 5I8OH 1AC6A 3MV7B 4WEBL 3SDYL 3IAGC 1T5WA 2VE6A 1H3UA 4HUVA 1WT5C 2WANA 4RMSA 1C12B 1FNLA 3PGFL 1MIML 1MNUL 5J8OA 4YWGL 5LG1A 3NH7L 2AQ1A 2WUCL 4XNUH 4QRPE 1CK0H 5ID1B 4QXWA 4D0CB 5F7DB 1OT2A 1WCQA 2X89D 4XMKH 5B22A 2JK5B 3EYQC 1I1FB 1BF8A 4KDTC 5DTFA 1OCWH 4U6YA 4H1LB 1INQB 3BT2H 4GRLC 3SGEH 5F9JA 3C6LD 2IPKB 4PGDB 3MREB 4HZLA 1N3NA 4K7FB 4PB9L 4K8RL 3UPRA 4MD4B 3ARXA 1W72A 2NY1B 1BFVH 1A8JH 4KRPB 3MCLL 1R3HA 2ZJSH 1OOAA 4P2YA 5AWNH 2CRIA 3B43A 3GB7A 4XP9L 2EH8H 4XC3L 3OKLA 3LQMA 4YHZL 2VLRB 1YEKL 4AEEA 3S88H 3T8XA 2LTQC 4XT1C 1UM6L 4X80L 2NXZD 3Q6FA 2Y7QB 5K9QI 4YLQT 3I75A 2DF3A 1T5XA 1OTUC 1NCAL 4ZXBA 1AD0B 2HKFL 1AO7B 2E8ZA 2NLJA 2EIZA 2ESVE 2QADB 4OQ1A 3ZDYE 5F72S 4WHDA 3T0EA 3GSNB 5GHWL 4LCCA 5TDNB 4LPYA 1HZHH 3B9KD 2I5YL 5T1DH 5ADOH 2V17H 4C59B 2BSED 5BXFA 4ZPVB 4DGIL 3S96A 3ALWA 1N5AA 4JM2F 4P4KB 1I7RA 3UTSB 2ZUTA 1T0PB 4QF1A 1RZJC 3AAZB 3U4BL 2PUQT 2G75B 3PGDA 2YBRA 1DQTA 4EOWH 5DZNA 1AE6L 4DQOL 3X14A 2QQNH 3DV6A 2NTFA 5DD3H 4YDIH 3G5XB 3C08H 3HNVH 1D6VH 4M7JH 1EH9A 4WFGD 4HHAA 4MJIA 4GUPA 1X5ZA 3UCRA 3RL1A 3T3PF 3UJIL 4DUWA 3G04A 1DLFH 3K4AA 5DMIL 5FF6B 3LMJL 1FYTA 4HGWB 5J7CC 1T80A 2VSCA 4QRUB 5JXEC 4NHUB 4LPXA 3GMPB 2Z8RA 1P6AB 4FTVA 2I24N 4IJ3C 3HRZA 2EH7L 2N7BA 2P44B 3H9SE 4XPHL 5C08D 4RDQF 4FQXB 4L8CA 3FTGA 3CX5K 1E6OH 4Y19B 5E03A 3IYLW 3VFNA 3VWJD 2BSTA 2MQ3A 1YZZA 3GSVA 4IRJD 4KUZL 2FX7L 4XP1H 3MV7A 5B21A 1FV1A 2LU4A 3DRTA 1H15B 1T1ZB 2DWEB 2K3TA 4PJHE 1SBSL 4DJMA 1S78C 5FGCB 1RIUH 5CBAB 1H5BC 1ZTXL 3QI9A 3CXHK 1RZJH 1I1YB 3OL2A 1IM9D 3EFFB 5ID1A 4XPFH 4MCZA 4PRAB 4D0CA 2VLKE 1FNGB 3ZE2E 2JK5A 4K3EH 3VFRA 4P3CH 1I1FA 1DFBL 3DXAD 1RZ8B 4YQXL 4I48A 4FP8H 4H1LA 4HCRH 3SCMA 3NCBB 5CLWA 3FT2B 2OTWB 3B9KC 4JN2A 4KPHH 3IFPB 1U8QB 2IPKA 4PGDA 3C60D 3MREA 3ZYZA 4K7FA 3RTQD 2HH0H 3A0OA 4LLMB 3RX5A 2QV2A 3TN0A 5JHDA 2VWEC 1EBAA 2WNGA 1F11B 4QOKD 1FH5L 3VFUA 3O4LB 4ZMAT 4NZDA 1G84A 1CQKA 4W6XB 1I3VA 4TUKH 4C57C 1JPST 4LCIH 4YHKH 5AG8A 2CD0A 3BKJL 5C6PB 3L3OA 2G9HB 3MA7B 1QSFB 4EZMA 5JXAH 2Y7QA 2Q6WB 3VFOB 3QCUH 1FO0B 1KNOB 4LPWA 4PJHF 3FL7A 2V5MA 3VXQA 1AD0A 2LVCA 4TOYH 2X4RB 1OWRM 4P2OA 1Z6JT 5TQ0H 4GS7B 2E6JA 4NN7C 2B7DT 2AXGA 4M03A 2BRRH 5BJTB 4LU5L 1EFXD 2HRLA 4QTIH 4P23D 4TSBH 4ZPVA 1INEH 5JQHC 1FL6B 3UTSA 4Y2DD 5DYOA 3X13B 2CLVB 3AAZA 4I77H 4DCQA 4PBXA 2VDPL 1KEMH 4N0YH 1DANT 1X5XA 1KXQE 3GHEL 1BMGA 2X4NA 4M43H 3EYSH 3QG7L 5T5NG 2BXYA 2IF7A 1I85A 2YA1A 5E08L 2OTUA 1CFBA 5CGTA 2J8HA 4F7MA 2CLRB 4RISH 1MLCB 2AJUH 2EYTB 5DI8B 4HGWA 1T1YB 4HC1A 2D9QB 3V4UH 4ODXB 3ZHLA 3EJYD 3JWDH 5DGRA 1A4JA 2Y23A 4NHUA 3GMPA 4Z0BL 5KSBE 3FRUB 1KJ2B 5I8EA 4OZGA 1K6QL 1VGEL 3ARBB 3PWUB 5IWLA 5K9KB 5IF0A 5IK3A 4AM0A 2AKRA 4Y19A 5DJ8A 3MX0A 3VXUE 1BM3L 3WDIA 5C6TL 3BIKB 4AY0A 1RU9L 4G8EB 2NY5L 2Z31C 3T2QA 5TGBB 1H15A 5IESL 2DWEA 1Q9OB 4CNIB 3IU3A 4XPBL 1UXWB 3NN8B 1ONQA 4U6HB 5H37G 5C92A 3CK0H 3GBLA 1Q0YH 5J89A 3D5OF 5DS8B 3AS0A 5GJTH 4DAGL 4PRAA 4YFLI 4ENED 1FNGA 4PGCA 4Y5XC 3IDJB 3QH3B 1MEXH 2DQJH 4KI5D 1MWAB 4GOSA 3EYOB 5J13B 2OTWA 2RB8A 1CF8H 1LNUA 5HDQL 3IFPA 1U8QA 2HFGL 3V6BR 1X5GA 3LKOB 5KSBF 3UC0H 4Y2DC 4LLMA 2ID5A 5AEAA 4EN3D 3HPLB 1F11A 1I1AC 4PY8J 3KPSB 3O4LA 4GMSL 3N85H 1E4XH 1I3RA 5B3NA 3JV6B 1AGDB 4OLVH 4GRWB 3TV3H 5J3HC 3ROLA 3KYOB 3MA7A 1OM3H 1QSFA 5DMGD 1MJUH 5TE7L 4XCNB 5C9JB 4PJGE 3VGHA 1CCZA 2Q6WA 3VFOA 3BP4B 2ZUUA 1M6OA 4MCYA 3F7RA 3ILPA 3SQBA 4A2MA 1TCMA 2X4RA 3QJFB 1YEIL 1MJJB 1ZWIB 5C0CE 5D96B 2JKXA 3EJYC 3KXFD 4B7IA 7FABL 4LEOA 4BH8A 1ZK9A 1LILA 2DWDB 4LCWD 1J1PH 2X9WA 5IMLB 3L5WB 1DQDL 4FG6D 3U1SL 2DI8A 1WZ1L 4QRTA 1MCLA 1WCBA 3CNKA 2F5BH 3MV8E 2C1PA 5KVEL 3MOBH 4XP4L 3X13A 3ARSA 2R8SL 5ESVA 2XZQL 5ICZB 1N6VA 1L7IL 2YRPA 4M00A 4YHOH 2VLLB 2W1NA 1PZ5B 4TNVK 1YEHL 4PRHD 3F7YA 4GLRH 4BSWB 4CMMB 2R0KL 4LSTL 4OF7A 3O6FC 4TVSa 3QJHB 2C1OB 3IDNA 4DVRH 4HFWB 2CLRA 2V5SA 4Y8DC 3BUYB 4OLYH 2D7NA 3RUGE 4C58B 2FR4B 4G6FD 3LDBB 5DI8A 2WP3O 3TZVD 2EYSB 1MI5B 2EKSA 4V1DE 2X4OB 4PJGF 4KKLD 3LIZH 3C09B 2VXQH 3FHQA 4P5TB 1R6VA 2GJ6E 2NX5A 5HVHB 1DQLL 4GAYB 2A83B 3O9WC 2A6DA 4YBLB 2AK4D 2IPUK 4PGEA 4PJ5E 2RHEA 3ARBA 3PWUA 2XTJB 5K9KA 1EHAA 3WBDA 1QOKA 4I1NB 2HT3C 1R0AH 1FGNH 5C07E 4PJFE 3OAUL 4LASH 4K3GA 1RJCA 3MLTB 4DGYL 3BEVA 2V5TA 1QKZL 3THMH 3G6DH 4OLWL 4Y0GA 2VL5A 2O5XH 2D0HA 2ZPKH 3PDGA 4LSQL 3LKPB 4ALAL 1YPZE 1ZT4B 2DQCL 3GSOB 2PO6A 4Z7UA 1RQ5A 4S1SH 1UXWA 3NN8A 3VXSB 1L6XA 1T6WA 4NO0B 2F53D 5CJQL 5C0BA 3DARA 4EUPG 2VXTH 4ZAKC 1YMMB 1I7UB 2OP4H 3QFJD 4KHXL 5DS8A 4FA8A 3VFGL 2WBJD 3EOTH 3IDJA 1CGWA 1K9TA 4M3JA 1UM4H 3Q5OA 3RUGF 5DUMH 3LVEA 1MWAA 3EYUL 1K3ZA 1WGOA 2X5PA 2X1PA 3EYOA 3QHZH 1QRNB 3NPZB 3CH8A 3K3QA 4OV6F 4Q0XH 3D1MC 4OLXH 1D5XB 4MLSA 2BY0A 4Z7VB 5B3JE 1HSAA 2F54B 3QQ3B 2VDRH 1OGAE 5DQ9B 4X9BA 3D18B 4JFFE 4U33A 3KPSA 4PRPD 5E6YA 4PJFF 3CU7A 3LQAL 3LRGA 5IJKA 5E2JA 5FYKE 4IOSD 3JV6A 3BPOB 5TQ2L 3Q5YA 3AB0C 4XAKD 5DT1H 1RUKH 1IAMA 1WBZB 2WM0A 2LABA 3QEQA 1YPZF 2H2SD 4H8WC 2GAZA 3SE9H 2W60B 5CCKH 3C5ZD 1OAKL 3QJFA 1MJJA 1ZWIA 2NPLX 4L8DB 1CFQB 4HPYL 1U8MB 1HWGB 5T3XH 4R2GB 3FT3B 2DWDA 1RJYA 3NA4A 5IMLA 3GSQA 1G6RL 1BQLH 1T1XB 5L88H 3GSWB 1JWSB 1OY3B 5D7JC 5ETUA 2DQTL 4GFTB 3QDJA 1CFNA 5F9OL 4G9FA 3ARRA 3NAAL 3N1MC 1KELL 3LSOB 5I1CL 5ICZA 1V3LA 1G7IB 3EDKA 4XPAH 2J8UE 2G5BB 5EORH 5IBLC 2NY6B 3O6LL 3BJLA 1JPTH 5B3JF 1BBJA 4CMMA 2E27H 5JW4Q 1QFWH 4JN1L 1LDPL 3U30B 3R4DA 5I18L 3WXVL 3NCEB 3LV3B 2FR4A 4G8GE 1WFOA 3S36X 3K2UH 3GMOA 3S6CA 3ABZA 4JHBA 4HGMA 3CSPA 2HMIC 2UV3A 3B2UC 3IGAB 1UH2A 4BH7A 4P5TA 1T7ZA 4OGXH 1FORL 1UCBH 4H25B 3IRZA 4GAYA 1HIMH 2A83A 5EFIA 4KMTL 2EDHA 4H8WH 4ZOCA 4JFZL 5DEGB 4XAWH 1AI1H 4N1HB 1VEMA 3CLFH 4X6BA 2X41A 4ZUVB 4Q2ZB 1HDMA 1OARH 5FFLA 4HMDA 5I6XC 4LHUB 4CADB 5CD3B 1OP9A 4OZIF 3BRGC 3LKPA 5E2UH 4G6KL 3GHBL 4IDJL 5JW4N 3GBML 1ZT4A 1QHPA 1EBPA 3KPTA 3P9LA 2J8UF 4LEXL 4OQTL 3GSOA 2HVKB 3VXSA 4ZUSA 1M1SA 3JZ7A 1XIWB 3GMLB 2I9TB 5HJ3B 4MAUH 4RAUB 1I7UA 1RUQL 3FT4A 2LV4A 3V6FB 2H2SC 1YUHA 4PTUA 4HPOH 3GI8L 2VDKH 3ARYA 3U0WL 5DWUH 3HNSH 4LFHD 4H20L 2WUBL 4M8VA 1X6LA 4Z76A 1U6AH 5IFAH 4NCDA 1QRNA 1V3KA 1CXFA 4UNTA 4YHMH 1UJTA 2M2DA 4MJ5B 4F9PA 1D5XA 3JVGA 3ZE1E 4MB4A 5EU7C 1MHPH 3OPZL 2GK0B 5EU6A 1YEEL 3SN6N 4FQIH 3QQ3A 5DQ9A 3ZTJG 3OF6A 5D2NB 1UWXH 3D18A 3UJJH 4OCSL 1IGTA 2OL3B 3JTSA 1VB9A 5D7SL 5B8CB 4ETQB 1S9YB 5I9QC 3QUYB 3K8KA 3QA3B 2W9DL 3FZUD 2JCCA 4Y2OA 5DRWB 1KENH 3P11H 2D7OA 4Y16B 1JGVL 1T03H 4JG1H 2AJXL 1UYWL 3G6JB 1IGFH 9CGTA 1NCTA 4FFYL 3E6HB 3KPMB 1N6QH 1FG9C 4L8DA 1CFQA 3OKMA 1KJMB 5E1AB 3OAZH 4M61B 1KPRB 3FT3A 1AGFA 2OM5A 1T1XA 4NFBA 2B8OT 1YC7A 2VR4A 3VXPB 1JF5A 4NZTH 3QO0B 1B2WH 4LNRB 3D85D 4K3DH 1G7IA 1NLDL 1AQKL 3WKML 2Z92B 4PY7B 4P2QD 1IC1A 3ZE1F 2BCKB 1QFWI 1U36A 4LIQH 3K80A 2X70B 3T1WA 4OCNC 3TFKC 4P46D 1A3RH 5B39B 4HJJL 5CILH 4KJWC 3L3JA 3TH3T 4YHPA 1A0QH 3FQUB 5ALCH 2V5YA 4TUOA 3LV3A 5E2WH 2VIRB 4GG6A 3DI2B 5IW3A 5A2LH 3DURB 4B53A 3QSKB 5GS0C 1NGYA 4WFHD 3SDCD 1G0XA 3QPQC 4GSDL 2E3VA 4NRZB 5FO7B 4H25A 1DUZB 3C5JA 1WEJH 1F6FB 4F7CB 5HGBB 2DQEH 4WRLA 4XBPB 3DV4A 2EDDA 3VFWA 1U8JB 3MMEA 4HK0B 5DEGA 3LEYH 5HHXH 4ETYA 2IBBA 4FFVD 1JMXA 4ZUVA 5HGHB 4Q2ZA 4LHUA 1J0IA 4FOMA 4LDOB 4CADA 3DGGB 4KWUA 3QIUA 4P2CG 3SBWA 3WFBH 5J4MA 3I50L 4KQ3H 3JV5A 3RWCA 1AGCB 4R97C 2I9TA 1XIWA 3GMLA 4XI5D 1U95B 3FZUC 5HJ3A 4RAUA 2A73A 2FZ3B 4J3SA 3MXVH 2XG4A 2P7TA 2MCG1 3V6FA 5GS1C 2H9GA 4WI7A 4FQPA 1F13A 5KSVB 2CJUH 3Q1SH 5D93B 2Y07H 2ZCKH 2R2BB 3RWJB 2A1WH 1OAYL 3GBNH 3VRJB 1QFHA 2UZIL 4NPYB 1W0YT 2GTZB 5C2UB 4JQIL 4WI2A 3PUCA 4Y1AE 2XFXB 1RIVH 2DLGA 5CLTA 4U0RB 1CDIA 1G7QA 25C8L 4P9HL 1MAML 4J8RB 2GK0A 2CDGB 4P49A 5D2NA 1JL8A 1VGKB 1ETZB 2B0SL 3KPQB 3WHXB 1F2XK 3O3UN 1QFUL 4NN6B 2OL3A 3O2WL 4HBQA 2FD6L 3QNYB 3TJEL 4ETQA 3KPOB 1EO8L 1A22B 1S9YA 5CJXA 3QUYA 1MRFL 4J4PD 1NGZA 3KJ6H 2EE2A 4F15C 3QA3A 5EOQH 1MH5A 3NPSB 2BNQA 1QFOA 3R8QA 4MQXD 2FEEL 3PHOA 3KPMA 1TJGL 1GH7A 2L7UA 3NTCL 3IF1B 1KJMA 3GKWH 5DD0H 4D8PA 4M61A 5I76A 1KPRA 3W5MA 1YNLH 4ORGA 1GC1L 3F6IA 2FRGP 4IOFC 4JFXB 2X9XA 5EO1A 2Q3AA 2ARJA 4HIHB 3TO4C 3HPJB 1KN4H 3VXPA 4RGNC 4XPTL 3HB3C 4LNRA 4AZ8A 1D5MA 1N2RA 5FHAH 3UTQB 1HK6A 2E9WA 2DICA 4OZFB 4PY7A 3P73B 1K4CB 5SWSD 5JOEA 5KTEH 5IQ7H 3I2CL 4OUUB 2BCKA 1NANI 2VJXA 2NZIA 1AR2A 4ZOBA 3UZVB 4ZYKB 4Q6IA 5B39A 2XPGA 5AZEL 4BZ1H 3QUML 4XNXH 2RGSA 3DRQB 2QSTA 2P5EB 2ZUQC 2KQMA 4PJIE 2VIRA 1CN4A 1BOGB 2A38A 4PJ7A 3S4SG 4OD1H 4HXBH 2VZ3A 3S36L 4X6EB 5CP3H 4HWEH 3RWHB 5EZOH 5BMFL 1BD2E 3QEGL 4F7CA 3LS4H 2V2WB 3WXWL 4X98B 4XBPA 2K9UA 1EEZA 5IMMB 1U8JA 5I71B 1G7PB 4FQLH 5J0BA 4HX1B 4O2FB 1NJ9A 2F74A 4FZEL 5HGHA 3SGJC 2NW2B 4PJCE 1A3LH 1RZGB 1RJZB 3DGGA 1MAJA 3TA3B 1TQBC 2XWJA 1FFRA 3CFJB 1NUFA 2F19L 3CFEB 3RU8H 3MNZA 3WS3A 3SPVB 3PWLA 5F7HA 4NKIL 2PNDA 5J1SC 3MUGA 4NKQB 4OAWB 1JRHL 3HE6C 1Y0LB 2W0KA 1U95A 1BJ1J 1N64L 4IHOA 2ERJC 2FZ3A 2X09A 5D72L 3HUJB 3KPRD 1NCBL 1JGUH 3PXHA 5KSVA 3QDGB 2VUOA 2R2BA 4JEGB 2Y5EA 3RWJA 1NUGA 3GK8L 4PJIF 3T0DA 3VRJA 5CBEB 1CFVL 4NPYA 1P7QA 4K71B 2GTWB 3BDYH 1H3XA 3X12B 3KR3H 1WAAE 2VWEE 4R4FH 1LQSR 4NQVB 3PP3K 1HXYB 4J8RA 4ERSH 4XHJC 1PX4A 1YECL 2CDGA 1CICB 3D48R 5EU3B 3DETD 3IJHB 3TWCL 4H0HB 3QCTH 3QAZC 4MHHI 5IJVB 3KPQA 1A6ZB 3FQXA 2UUDK 1SJHB 4XZUA 5E99L 4PJEA 2FNBA 4URTB 4PJCF 3CUPB 5HPMA 1FE8L 2CO7B 1B0GA 5E8OB 3MLVH 4JO1L 5CGMA 3NCYP 2BDNL 4JB9H 4Y5YB 1RMFL 2R0WH 1K2DA 3T4YB 5D7KD 3UPAA 2XNAA 1JPSH 5ANMB 3FN0H 4P5KA 1L6ZA 4OTXH 3PF2A 1U92A 4APQC 4J6RH 5KW9H 1C5BH 2NR6D 5IHLB 2XA8L 4JZOA 1MFAH 5IM7B 5EBWA 1UA6H 3WIFB 4MJID 3RQ3A 4MXQD 3SDAC 2FX9L 4JFXA 5DJXB 1IAIM 5HHOB 4NOBA 4XPGL 2EEBA 2J6EL 3WFZA 1FYTD 2JLLA 5LGJB 4KMQA 4LSVH 5DD1L 2DQIH 3HI1B 4JDVB 2YMXH 5DJ2B 5C3TA 3WFEL 1JF6A 3LD8C 5HBBA 5HYSG 4JFEB 1KTDB 3Q48A 4PGJA 3O3DB 4LHQB 1GVIA 1EGJH 3UTQA 1JK8A 1WAAF 1RUMH 4LLVB 3D69A 4OZFA 5K9JL 3P73A 3V0WL 4OUUA 3O4OB 3AMKA 2A6JB 2DL9A 1M05A 1CZ8H 1P5UA 2HKHL 3CZJA 1JWMB 4ZYKA 2PTTB 1Z2KA 1DDHA 2R69H 2K1MA 4PRIA 2V2XA 4FMFA 3DRQA 5FA4A 2P5EA 4Y4KA 5F97E 3RY6A 4KK8C 4W4OA 1CDCA 4JFDB 4XNYL 4DKFH 5E7FA 1BOGA 1YYLL 2BVUA 3DXAE 4PRDB 4X8JA 1V3JA 2OZ4A 3RL2B 4X6EA 2LAGB 3MGTB 2DDQL 3QI9D 4L4VA 1BAFH 2ZNWA 1CFSB 3RWHA 1OD7A 1RHHA 2EO9A 4NNYA 3QCVL 2IALB 3CDFA 3FB6B 4HJ0C 2C3WA 2V2WA 5F7MC 1XR9B 3HI6H 4X98A 2XN9B 4CU7A 1E4KA 2OJZH 4ZXBC 1CLYH 1G7PA 1N8ZA 4MNQA 4BJLA 5BRZB 1CK0L 1BFOB 4HX1A 4O2FA 2BY2A 4YUEH 3T0EC 3WUWG 4LCCC 1G9ML 3SCMD 1RZGA 3ALXA 3TIDB 4DGVH 1A6AA 4HQQL 5LQBL 3DETC 1JIBA 4AG4H 5L2JB 4YXKH 1XF5B 8CGTA 1KXVC 3NFPB 3DJ9A 4KK9D 5TE6H 3SPVA 1OCWL 1LD9B 2VISA 3X3GH 4G6AC 1MIEH 3QHTC 3V95A 4TQEL 1DLHB 4OGYH 1QBBA 4U1JA 3TN0D 5JHDD 4PRNB 2VH5H 4KY1L 4LAQL 3MGOB 4JFHD 5ICXB 4PJXB 2QKIB 5CD5C 1JE6A 3RGVB 1Q1JH 1Q72L 2VDOH 1WFNA 1QBMH 5FUOL 4Q97A 2BC4A 3VFVB 1JZ7A 3EO1A 1GPOH 2ZUWA 4FQHB 3MLXL 5ISZE 1AQDB 1KT2B 1W72H 1I8LC 4ONGH 1J1OL 4WUUB 1EA9C 2GTWA 4N9GB 3X12A 4EI5B 1CL7H 2EIBA 1JBJA 2F15A 5HGDB 2QADD 4P2OD 4XCFH 3MRBB 3FRPG 4IMKA 5D4QA 1Q94B 1JYVA 3ARGC 5EU3A 4HIJB 1IVLA 4MNGE 5IJVA 4WJ5B 4YPJA 5KOVC 2A6KB 4F80A 1SJHA 1GGBH 1I1CA 3FB8B 4R8WH 3UTSD 5GGSA 5T1LD 3A6BH 3KNBB 3P3YA 5EUOE 3EYFA 3MFFB 5E8OA 1T2QH 1UACL 5BS0B 3PQYD 4HIXL 2AI0L 4ODUB 3T4YA 4YXHH 1H3PH 4LSRL 1BPVA 5L8KB 3QUZA 1BOYA 5ANMA 4F3FB 4ZFOB 4HT1L 5GGTL 1WBYA 3IFNH 4JDTL 2D0GA 3CMOL 2YKLL 2AVGA 3WNNA 1OAQL 3S9DB 5IM7A 4HDIA 4J3UA 1SM3H 5DJXA 1ZMYA 2X4PB 4RMQA 3TBTB 5LGJA 2ZKHH 4L4TE 3CVIL 5DJ2A 4PV8B 4JFEA 2DJUA 3O3DA 4U0QB 4HIIB 4EVNB 4OCXL 4NJAH 4X7SL 3T09A 2PYEB 4BZ2L 5LJYH 1XGQB 3FQRB 4WHYG 4L9LB 4OFYA 3CDYA 5CKAA 2A6JA 2EXWC 3SEPA 3L5XL 1A5FL 5MENB 4KK9C 2RCSH 4UB0L 5I1AA 2LU3A 4FQCH 2PTTA 4MA1B 4Y19D 2W0PA 4LLDB 2NY1C 4KAQL 5E95B 4D9RD 4KRPC 5EUOF 1OAUL 3NCYS 2CLZB 5A16B 2D31B 3ET9F 1C5CL 3DVIA 3RL2A 1YEFH 2GITB 3MGTA 1T83C 1NDGA 5L6YL 5I17B 5IB4A 2DL2A 1A3QA 3WIHL 3FB6A 4UTAL 1NCDL 3GDBA 4NQEE 1A7NL 1B4JL 4X9HA 1RIUL 2ADGA 5F9WC 1R3JB 5BRZA 1BFOA 4NC0B 1UC6A 1RZIA 1J8HB 1A6PA 1QVOA 4N8VG 4UZGA 5T3XE 1MCKA 2Y25A 3PWNB 5L2JA 2Z8VC 4DKEH 1JZ4A 1XF5A 2JIXB 2O5YH 1Q38A 4QXTA 1FFOA 5FA3B 4UT9L 1N7MH 3PHQB 3QG6B 5D8JL 2WQ8A 4P4KC 4RMUA 4TULL 4PLKD 1QNZL 1DLHA 3MV9A 4ODBD 4Q7DA 4Z78B 4PJ8A 2G5RA 3RVWD 5F70A 2B1AH 1ZHNB 4PJXA 3O4LD 3RGVA 3IDGB 4XNQA 3HC0B 4H1LH 1IBGL 3VFVA 2YN3A 4MGXA 5A40E 1NAMA 4FQHA 4WEMB 1QSFD 3EOYG 3DVGA 1AQDA 2OR9H 4XNZB 2FGWL 4C56B 1CL7I 4WUUA 4N9GA 1ZANH 2F8OA 1FIGH 3PGCB 4EI5A 3D3VB 2BNRB 4LL9A 1XZ0B 4NUGH 5HGDA 1ZOXA 3RVTC 3MRBA 3MJ8A 4GAJL 3MNVA 4ZPTB 5LWYL 3PL6A 4JZNA 1A6TB 3FO2B 2GJZB 3PDOB 1Z0MA 2A6KA 3V8CA 3WSQL 2KL6A 3LH2H 3PWPE 1A7OL 3FB8A 5JZ7C 3T04D 5IWLC 5SX4H 3LHPL 4FQXC 3KNBA 2HJFB 1T7YA 5BS0A 5IV2B 4X6DE 4NHCL 4G42B 4CDHA 3B9VA 4ODVH 4P0DA 3WJLA 1DE4B 4F3FA 2IAMA 3HE7B 3S5LG 4F33A 3SDXB 3SE4C 3ILQC 4J1UB 4MJ6B 1KUMA 3MLYH 2DQGH 4X9GA 3K0WA 3BOVA 3TVMB 3ARWA 4R4ND 2X4PA 2EDQA 4NYLA 3REVA 2JELH 2YD6A 1MREH 5J57B 2GT9B 5DD5H 2R0ZH 4PB0H 3CFIC 1P7KB 3N0PB 4PV8A 2VSDA 3DWTA 3LPFA 2NX5D 4YX2H 1CBVH 5C09B 3V4UL 5M95B 2YUXA 3FQRA 3VXMB 2FIKB 2KZWA