2ADFH

Crystal structure and paratope determination of 82d6a3, an antithrombotic antibody directed against the von willebrand factor a3-domain
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
218
structure length
218
Chain Sequence
b'QIQLVQSGPELKKPGETVKISCKASGYTFINYGMNWVKQAPGKGLKWMGWKNTNTGETTYGEEFRGRFAFSLETSVSTAYLQINNLKNEDTATYFCARDNPYYALDYWGQGTTVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Von Willebrand factor
publication title Paratope determination of the antithrombotic antibody 82D6A3 based on the crystal structure of its complex with the von Willebrand factor A3-domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting/immune system
total genus 46
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2005-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2adfH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2adfH02
3ARGC 4MNGB 1YEHL 5GGRB 3BMWA 1T5WB 3QO0A 3FN0H 5CFHA 4Q0XH 2R1WA 2ZUXA 3VGFA 4KDVA 2GK0B 2DQIH 3IS0X 4XAWH 2GFBB 1WBZB 2VIRB 4LPCA 2FJFB 4JY4B 2B4CC 4NFCA 2Q86B 4MD0A 4YXKL 3UDWC 3CDGB 1J87A 1YC8A 1PZ5B 4AMKH 1WFUA 1T2QL 4G7YL 2EO1A 1VFOA 2ZWLT 4OBSA 2CK0H 4NJAL 4M6AA 1P84K 4Y5YC 5TE6H 3LY6A 1OLZA 3H9ZA 3V4PH 4JFQA 3TESA 1CD1B 2GCYA 5HY9B 4GW5A 2CUIA 5I1JL 5GS0H 1OQXA 4XCCL 2VABA 4TNWK 1HCVA 5IVXF 3MACL 4U05A 2H26B 5GJTH 3OR6A 3BO8B 5TJWK 3QDGE 4NHCH 4BKLB 3T0DA 4HUVA 3BP4A 3VFSB 5E8PA 1AC6A 1BF8A 4OLZL 1F90L 4WO4B 5B3JE 5F1IA 2VAAB 4H25A 4D9LL 3VXUB 2H2PD 3HC4L 4X9IA 4GBXB 4RGOL 1AXIB 2OZ4A 1E27B 4HW6A 3BDXA 5KZCD 1AKJD 1EEYB 4UAOC 3VXMA 4NZTL 1YEEL 3BPOB 4OD1H 1AGEA 3MBXH 3O6KL 5BOPA 4JRWA 2D0FA 3PDGA 4G5ZL 4TPRL 2FGZA 1U3YA 2UV3A 1DUZB 3V2AR 1HEZA 2D7OA 3OF6A 4X5XB 1BBJA 1XCQA 1D6EB 1XAUA 3UBXI 1CG9B 4P2OA 1LO3L 4HBCH 4P46A 2IAMA 2OP4L 3V5DA 1AO7A 4P2QD 2DLHA 4HV8A 1C8PA 3OR7A 2IFFL 3D48R 1X5XA 2QBWA 1CICB 2M26A 4LEXL 5ALCL 4C57C 35C8H 2IPKA 4MJIE 4KY1H 5IB5A 4JZOB 4WEUD 5EU7C 2B5IC 5FHAH 2BSRB 1KXTB 4NKOB 3VMNA 1CGUA 3RTQD 3MBEB 3RTQC 3GB7B 3AM8A 1F4WL 1XR9B 2G5BB 4WJ5A 3K0WA 3B3IB 3VFUA 3TF7C 2DQFB 5J11C 4WDIA 4KQ4H 5I1GL 4LVHC 3BWAA 4XNUH 5D1XA 4ZAKC 4NZRH 4O2CB 3LAFA 3P0VH 2G5RA 4U1HA 3JTTA 1B0GA 1S7XB 2DQEL 3DSFH 4HC1L 1FNFA 4JAMB 3L3GA 1ZGLB 4QGTA 3HI5H 2R1YA 1IAOA 4Z7VF 4R8WL 3IDUA 4QHMA 1UM5L 1QR4A 4PJ8B 4M62H 3WE6A 4K7PX 1RJCA 5FV2A 2RFXA 5HI3C 1BLNB 2VYRE 1JJUA 4NO0D 3IYLW 3VRIA 1NAKH 4V2BA 1Z9OA 4ELME 3P77A 1BVZA 4ZFZA 5AEAA 1S5HA 3MNWA 3OKNA 2FH6A 3QXAA 5FM8A 3IT8D 2AV1A 4NQDB 2VZSA 2BJMH 3P0GB 3RUGB 4HS3B 1FZKB 4RMVA 1FCGA 1FQ9C 5HJ3A 3IVKB 1U92B 1EUTA 5FA4B 2DQHL 1KPUA 1KOAA 4ZOEA 3HZKA 3SGJC 5DC9B 3QH3B 5F96H 5GGVY 2ESVB 4PBVC 3BSZL 4LSVH 5IMKA 1T3FB 3FN9A 3Q6GH 2A9MH 1BQLH 5I1IL 1BEYH 3FO0L 3ZTNH 3LD8C 3ZE0F 1CQYA 2NY0D 5JW5A 1N0XH 5JQHC 1QQDA 2NY0C 2EH8L 1D5XB 5EB9A 2FGWL 4TVPE 3T08A 4E42A 1NLBL 3U48A 4XMKL 2NTFA 4WHYG 4LLQB 1FZJA 1MJ7L 3T2QA 4G3YH 1OAUH 1OB1B 1F3JA 5D7LB 1KLUA 4S11A 3W11C 4AG4H 1QG3A 2JK5B 5C3LD 5EUOE 4OZFH 1NC4A 3SDDA 5HYSA 1U2CA 3S35H 4NNXA 4LSRL 1OP3H 3CFKA 2O5XL 5ALBH 2ZOLB 2GJZB 1AY1H 2PETA 4UDUA 1EO8H 1WZMA 2NXYC 2ZOKA 3C5JB 4HKJA 1INDL 4QHLB 4ORZC 2DMBA 3AMLA 3NVQA 4N9GA 5SWSE 4PJCB 1XF2B 4W4OC 3OG4B 4L1HA 5SWZD 2WQ8A 2YD1A 25C8L 4UV4L 3LKQB 4XVTH 4S1RH 3DROB 3BN3B 4IMLA 1RVFL 4HFUL 4LASH 2PXYA 5CJ5A 2YXMA 4Y5XA 1YQVH 1QSFD 1NDMB 1MPAL 4K94C 3ULUE 1P69B 3PWPD 1LVEA 5IFAL 3TNNA 4C54A 4JDTH 1BFTA 3L5HA 5FYKH 2QSQA 3PWNA 5AG9A 3FO2B 1C08A 4JQIH 3D39B 3VRLE 4RISL 3VMPA 4JFEA 5KOMC 3MLRL 3OG6B 4X5LA 1ZT7A 3SQOH 3TYFB 4F7TB 1HH6A 4DGIL 2ENSA 5DSCB 3PE9A 3OKEB 5K9JH 1MELA 3LQMA 1KJVA 1WAAE 1WCBB 1I9RH 1T21B 3OKLA 2DYPA 3TVMB 3IJHB 3RP1A 1CE1H 4GSDL 5IMOB 5L2KA 3PWUA 2PUQT 4U0RB 5CCKH 4FQIL 3OX8A 4ZOCA 3X14A 3RWGB 2MNUA 5EORH 5EBLA 5D7KD 2WWMD 5T3XE 3RBSA 3MXVL 4CMHB 4PG9B 1XGTB 1QA9B 1KIQB 2YHGA 2AJZA 4M7LT 1EHXA 1LDPH 5L88H 1A7RH 3D18A 1AQDB 4UILH 3V0VB 5DLML 5MEPA 3B8SA 1NAMH 4B7LA 1P7QA 2CDFB 2APVA 1IFHL 1CFBA 4WNQB 4XAKE 3K8KA 3U0WH 3MCKA 3VFVB 5K33A 5BV7C 4QT5B 1RIUH 3MOAH 2WANA 4GXUM 4MAYD 3PGFL 5JHDD 4UNTA 5FF6B 4OSUH 4MAYC 3DNKA 2HLFC 4OT1H 5ESVA 3Q0HA 1HIML 3QHFL 5MP6L 2MHAA 4EI6B 3ARGA 3QDJB 4PLNC 4FQ2H 3IDYC 1IAMA 3QQNA 4PS4L 3V4UH 4KPHH 4KKCD 4QRPE 2DBLH 1EZVY 5CBEA 4WENB 2AKRB 4KKCC 1W0YT 5MHSD 2IH3B 5L0QB 2MCPL 5ERWA 5IROC 4XBEL 3OKOA 3VG0H 4HS8L 2H32A 1RK0B 1FNSH 5C8JA 1S3KL 1SEQH 4J7RA 3B9DA 2R9HC 32C2A 3UDWA 3ILQC 2QQNL 5F89A 2IEPA 3BKML 1MWAB 4TYUA 1C5CL 1RZ8B 3LS4L 5D2LA 2IANB 4U7MA 4Y5YA 4OV6F 5GS3A 2FR4B 3KYOB 3TFKD 2AK4D 5DD0L 1MCBA 1A1OA 4IS6B 2R4RH 1LGVA 1EK3A 1CFQB 5F72S 1NANH 3DI2B 2H6PA 3CFBA 1P5VA 4JKKA 3SDCD 5CSBA 4R0LB 1P4BH 5F70A 2ATKA 2CLVA 2HKHL 1T2QH 5FB8B 2C4FT 4G7YH 3TA3D 2WBKA 3LB6D 4O5LL 5MERB 3TA3C 3VXPB 5E8OA 3NIGF 5ANMA 4JM2F 1FO0A 2IALA 5TGBA 3CFJB 3ULSA 3H8NA 4NZUL 5L7XL 3PHOA 5C07E 1X5GA 2OMNA 3OKKA 1D9KC 4BZ1L 2HN7A 5I1JH 3C6SA 4GAFB 1KENL 4XCCH 4EDWL 5MI0B 4MQ7B 4QXTA 3R8BB 1U8NB 4PREA 3V6BR 3IAPA 1EVTC 1VCAA 4H0HB 3MRJA 3KYNA 2C3VB 1AD0B 3MRPA 3W0WB 5DJXA 2CRMA 3AVEA 3WFHB 4NSKA 2XY1A 3BISA 3IDJA 1E4WL 4NN6C 3HUJA 1GIGL 4D9LH 4MCYA 3NH7H 3HC4H 3QWRD 3C6LB 4DQOH 3GSNL 1NFIB 4OFYA 3BP7A 3KNBA 1OP5H 1WWBX 5TE7L 1S7VB 4PJHB 3NCJH 3RY6C 3S96B 4NZTH 4EQ2A 4AEEA 1G7QA 2B8OT 2O5ZL 3U4BL 4G5ZH 4Z7QF 4ZTPH 3MC0A 4U1IA 3L3DA 4MNHB 3UZVB 4ERSL 4KK6D 4U3CA 4UT6L 3RTQA 4KK6C 5I75B 1FVEA 3S9DB 3VFMB 4EUPH 4U6YA 4HWBA 4JGUA 4LEXH 5C70A 2ZUTA 4GKZA 2V7HB 1MCOL 4ZAKA 5I66A 4N0YL 4KROB 4NKDB 1U8KA 1MHHB 3LV3A 3WIHA 3THML 2F19L 1Y6KR 4JFFE 3STZB 3Q1SH 2F74B 5GRZA 1Q0XH 2Z4QB 4OZ4B 2V5YA 2ADJA 5E4EC 3HC0B 1NBYA 5EN2B 3QIWD 1I1RA 1UEYA 2R23B 3CX5J 5EFIB 4KGJA 3LRGA 3QIWC 1CLOL 3CCHA 5JORB 3EYVA 3M8OH 3FTGA 4NO0A 4HC1H 3IETB 5IWLC 3VFTB 3MRDA 1P1ZA 2GJ6E 3ILPB 1DVFB 5BMFL 3N0PB 4R8WH 4YGVA 2R2EA 3QXVA 1F5WA 2EDKA 5D7IF 1B2WH 4XP6L 4HIJA 1PW3A 2HP4A 2ZP0T 3SGJA 4NRYB 1AIFB 3G04A 3IDMA 5DDHB 2V2TA 3WIIL 5DT1L 3O3DA 4M5YL 1RHFA 4X6DE 5ADOL 1M6OB 3MZGB 3U7AA 3G9AB 4TNVK 2GTWB 1URLA 3OKDB 1IZKA 5INCB 5KS9F 1K8IB 4OJFH 1S7SA 4HJGA 1MI5D 1TVBA 2HAZA 4YHNB 1PVHA 5TDNA 1T89C 2DQHH 4DOHB 4PJXB 2VLKD 1MAJA 5IW1A 3NFPA 3JV5A 2BNUA 3ZE2F 3BOVA 5GRXG 5E08L 4MQXD 2Z35A 1YY8A 2GITA 5DJAB 2QHRL 2VDMH 1FIEA 5IEHB 5LJYH 3FO0H 2HWZH 1G9ML 4H1LH 3OXSB 3ZKQD 4MNQE 1YMMA 3E8UL 5HGHB 1U3ZA 3LRHA 4XMKH 1RZJC 4YEFA 4MA7L 4F37F 2VUOA 5D96B 1NGWB 1WC7B 5C09B 3UTPE 3UXFA 1I85C 3CK0L 2F53E 4PRPA 5D1QB 3MGOA 3GI9H 5F7DB 4N8CH 4BZ2L 2NXZD 1DEEA 2G75B 1YN7B 4G8GA 3T0ED 3VXSD 3W2DL 3F5WA 5DYOB 4W4OA 1ORQB 3T0EC 1MFCL 2FBJL 3T77B 4Y5VB 2P47B 4ZFOB 5SWZA 5DHVB 1F6LL 1FFRA 3KVQA 4MD5A 1K6QL 2R1XB 3RVUD 4L3EB 2QADB 2WBJD 4MJ4A 4MS8D 5SX5K 3RVUC 1ZWIB 4LSRH 1G7MB 1Z5LA 2WBJC 2IF7A 2LFGA 1MVUA 3GM0A 5HVGB 3R06A 5CILL 4IRSD 3P4MA 3SKMA 4IRSC 3NZ8B 4GMTH 1O0VA 4JLRB 1FLTX 1AQKL 3VRJA 1JHTA 3PWPA 1PY4A 5ESQB 5KVDL 5GGSB 1QHOA 2HFFA 4PJEB 25C8H 1YQ2A 5D72L 4A6YL 1BBDL 3DXAB 2V2WB 5F71A 1RVFH 4JG0H 4HFUH 3KPOB 4WW2C 1AGCB 3CXHK 1FFPA 2DQCL 3AXLB 4XB8A 1JZ5A 5IFAH 1UWXK 5ILTH 4NPYA 2VISB 1T04A 3CC5A 5CKGA 1NCUA 1KFAL 1R3IH 3GJFH 3QUMA 3MCLL 2OTUB 5E99L 2Z91A 3CVHA 1KELH 5HGDA 5J8OA 3MLRH 1MCJA 1U6AH 1YPZE 3IU3B 1AE6L 2D7TL 4JPWL 4DGIH 5ICYB 4OLUL 1EH9A 1MEXL 2H1PL 1BZ7A 1ZA3A 3IFOB 5HVFB 4MXQC 1BIIA 8CGTA 5JDJA 2EDTA 5EBGA 2EDJA 3VGAC 5BJTA 2BFVL 1IGIH 5ESAB 4RBPH 4MGXA 5IHUH 3MXVH 3HUJF 4PJFE 1MAMH 1QRKA 4MAYA 5E03A 3V4VL 2ZNXA 1BFSA 1OOAA 4GG8B 3UAJD 3MUHL 4GAJL 3UAJC 2F54B 3QFJD 1H3PH 4P5KA 4WY7L 3LN5B 4I18C 1IFHH 4YHPB 3QDHA 1T7ZA 4DVRL 5IEKA 3F65A 3EAKA 3KPRA 5IROA 1ZHNB 5T1MA 5IBLD 2YZ8A 1YNLH 4M9OA 1X5KA 5M95B 5IBLC 4FMKA 4LKXB 2VKWA 3U9UB 1HIMH 1N0LA 1EHNA 1GHFL 3Q5TA 3F6IA 1YDPA 5E2JA 1U95A 1RJLB 4PS4H 1NUNB 4XPTL 3BGMB 1TQCB 1CFSA 2ZUQC 4GW4A 3WUWB 4U3HA 2Z8VC 4X6CE 4MXWL 2FL5A 3QXTA 3FL7A 5DGRA 2AK4A 3TT1H 2B4CL 3V7MA 4G8FA 4HS8H 4WU7A 2ZUWA 2KL6A 4OF5A 5FYJD 3MRGA 5E1AB 4J8RA 3MJ6A 4GKNA 1T20B 1X4ZA 2C9AA 5GGUB 1FGVH 1ODAA 1C5CH 5DMYA 1JPFA 4U2ZA 2FEEI 1NGXA 2ZCKH 2XA3A 5DJ2A 3TA3A 4PTTB 3L3KA 3BGAA 2BC4B 5DD0H 2X89D 3ULVD 5E56A 1A7QH 2I60L 3KPSD 1BVLA 2BOBB 1K8DB 1CLCA 1D9KA 4X7TA 2X4OA 2IMNA 2R56L 5DRXB 2X4PA 4JVWA 5FK9B 2UZIL 4NZDA 5IF0B 5GRYA 5LGJA 2CH8A 2VWEE 1FP5A 4D0BB 1U8PA 5J6GA 4N8VB 2X4NA 1VSCA 3QEQB 1R3LA 2EDQA 2HYMA 1R5VB 3P9MA 1SBSL 3UJJH 5I2IB 3G5XB 4HIIB 4NZUH 5L7XH 1NUGA 3RI5F 5ETUA 4BZ1H 5IR1A 4NN7B 5I6XC 1KENH 2UUDH 3ARQA 3EOAA 2DM7A 2APBA 3VA6A 2X1WL 3QWRA 1MRCH 1S7TA 1C5BH 4EVNB 3RY6A 2OL3B 3LQAC 3WNNA 1OAYH 4TULH 5CGYD 4XZUA 5CGYC 2Q7YA 1H15B 2APXA 4PY8J 1BOGB 1GIGH 3JV6B 4U1SA 3RGVB 4Y88A 2OZ4H 4X80L 2GQHA 1I8IA 3GSNH 4WI8A 3BPLC 1A3LL 5TE7H 2YEZA 3H7BB 4LCWD 5FF6A 3RNQA 4MJ6B 3MRMB 3L95A 3MO1B 3MUGB 4IOIA 4WW1B 4IIQB 4LK4A 2O5ZH 1A47A 3QAZC 5I17A 5D4QA 4XH2A 3GBLA 4PJ5D 2BVOA 1Y18B 5L9DH 1Z9MA 4ERSH 4UT6H 4HWBL 3L1OL 4RMQA 3BGFB 4UTBL 3BVNA 1RY7B 4HIEA 5AD0B 1X5IA 3K2UL 4NQEE 5DFVD 1VGKA 4TSCH 3QIWA 1MCOH 3BT2L 4K7FB 2P24A 2Z31D 2NTSP 4N0YH 5B8CC 2E6JA 2XYCA 5I9QC 1U91B 3QDAA 1CZ8L 1J1PH 3LKSA 4HJ0D 4QO1A 3THMH 3H9YA 5I1DA 5IWLA 1I7UA 4HJ0C 5EZOL 1IM3B 3SE3C 5F21B 1RK1B 1A1MB 4JO3L 1UWEL 1KJ2B 1T5XA 1T1ZA 3FRUA 5D2NC 1D5MB 2P42B 3OV6A 5J12B 4BM7A 2NW3B 2NY4C 1CLOH 3FOMB 3MOBL 4HWZB 4MB4A 1QLFA 4C56B 5KAQG 4K8RD 4X8JA 5E94A 1S7RA 1I7RA 3O6LH 2ARJA 4L8SC 4CN1A 2BCKA 2VZ3A 5BMFH 3WO4B 1KEMH 4J3VA 4CKVX 15C8L 3HR5A 5FECA 5I1EH 4OCSL 4ONFH 2DI8A 4XP6H 1MI5A 1ORSB 1T89A 5LG1A 1DP0A 2J5LC 1UA6L 3DVGB 4G6AC 2VLKA 3DO7B 1K4DA 1QRND 4WI6A 3WIIH 5FUZL 3DMMB 4HGKC 4M5YH 2BSTA 3G6JE 3OB0K 1M71B 3QUYD 2BHYA 5F7EL 3QUYC 5IMLB 3LHPL 2H45A 5F9OL 1HXMA 1KG0A 3OHXA 3GMLA 3TJHC 4LSUL 3TT3H 1GCFA 3CLEL 4P2RE 1I85A 5E08H 3HC3L 3MREA 3IJSB 1OGAD 4Z7WE 4UT9L 2GAZA 3RJQB 2QHRH 3RPIB 3CFIC 1Z9SA 1G0YR 3T4AA 1AKJB 2PTVA 1I8KA 4WUUD 5JQ6L 3L3IB 1G9MH 4RFNB 1UZ6F 3T0EA 3E8UH 1T22B 1ACYL 2AV7A 4ELMB 1YEIL 2Y5EA 5DMGC 2V17L 2WBJA 2SEBB 1WIOA 3RWIA 9CGTA 4NQCB 4BZ2H 5ADPH 3DUHA 2C3GA 2VXTH 4IRSA 5C08D 1J0ZA 4Z7NF 5IB3B 3ZTJG 2L0DA 7FABH 1LO2L 3QDGD 5DI8A 3W2DH 4X6BA 1MFCH 4P2QB 4PJ9B 2OI9B 2FX7L 4HMCA 4NCC1 4KI1A 2ERJB 5D71L 3VWKD 3MLUL 4I13B 1DDHA 1ZSDA 5CIPB 3VWKC 5C7XL 4MQTB 4TRPL 1V3JA 4WW2A 3NA9L 4K94L 4ZQKA 1NGZA 3DIFA 2VLMD 5CILH 3PIQB 1ZTXH 1D3CA 1WISA 1N8ZB 4MMXC 2YPLD 3TIEA 1G9NC 4L8DA 1EXUA 2ADGB 3IFNL 1KB5A 1BBDH 2W60B 4LPVA 1LNUB 8FABA 5DTFB 5T5NG 3TCLB 2UWEA 3INUL 1INQA 3MRQB 4HPYL 4OZHA 3EJZD 5FUOH 2DQUH 2MCG1 2DQCH 2OQJB 3KPPB 1T1YA 4LLWB 3SDYL 3U6RA 5KSBE 2OLDA 2LAAA 4ZUTA 3RAJL 1BVKA 1WF5A 1L7IH 3T0WA 4X4ZA 4MJID 5J13B 4JM4H 5E99H 5SWQB 1VACB 1IL1B 3H0TB 1BMGA 2P4AB 4PJDB 3MNZA 4U1NA 4JEGB 1RD6A 2BP3A 5SWSB 4FFZL 3UTQA 1AE6H 2D7TH 4JPWH 5H37G 2LABA 1PQZB 5IGXL 1XR8A 3O45B 2XKUA 2H1PH 3LKNA 5D5ME 3VGHA 1XT5A 3MRRA 3T1WA 1AHWC 1FNAA 2DMKA 3BMVA 1LP9B 4HHAA 1S7UB 2AEWA 3RU8L 3ZHLA 3O41A 1I1CA 1OGTB 4I18A 3QFJA 1F6AB 3H3PL 4WHYH 2VDPL 5BZWB 2R69L 4FQ1L 2BNRD 3GSWB 4XHQA 3B43A 1PD6A 1TNMA 2CGRL 2YC1A 3DX7A 5BXFA 4PV9B 1MCKA 1A1NA 4F2MA 3BZ4A 3ETBF 5IIEA 1JGVL 1BQHG 4GG6A 1XF1A 3EJYD 4PV8B 4D9QE 4GAJH 1U8JA 3EJYC 4WY7H 1MY7A 1H3GA 4FTVE 3MGTA 2EZ0D 1RZGB 1Q38A 1KGCD 1KTRL 3OAUL 1YEGH 1HHIB 5IK3B 1ONQB 2CIIA 5JW3L 4HUXA 4ZPTA 3WHE1 1GHFH 1OAXH 2MKLC 3F12A 3MLWL 1OM3H 3FQXA 4PGBA 4XPTH 3V6ZB 3DETD 2EDRA 2QQLL 4YQXL 5C0BA 4PJ7E 2H32H 2B4CH 3W9EB 5DA4A 4JCMA 1QLEH 1MQ8A 4JR9L 1Q1JL 4IBLT 4ZUSA 1UJ3C 3ROLA 3GO1H 5C0CE 1QTYT 3ZL4H 1AGCA 1RJZB 3TO4D 1CGVA 1U8QA 1A4JA 2VDKH 3TO4C 3MODL 1RIHH 3U2SB 1RZIB 4S2SA 1PJ9A 1OCWL 3QUXB 4HDIB 3O3AB 3UO1L 1Z2KA 4Y4FD 1SEBB 3K3QA 4XNMA 5I1AA 1H3TA 1B88A 1QSFB 1KPVA 1ETZB 3HE7D 1L7TL 5HHVL 3IGAB 3T3MF 3HE7C 2D9QB 4HJJH 4C83A 1JYWA 5JO5A 2V7NA 2YWZA 1X3DA 1NEZG 1FO0H 4RIRB 2J6EL 3T4YA 4AEFA 4CU7A 2HVJA 4XRCB 3T3PF 2NY6D 3NTCL 4N8VG 2NY6C 4KJYA 2AJUL 3VFWB 4BSVB 1K4CA 3SKOB 2JJSC 2YUVA 1IGYB 1NFDA 4ZUVA 3EOTL 4DW2L 5HVHB 3HLAB 1UM6L 3TN0D 2YPKA 3IAQA 3S37H 2R2CA 4HZLA 3TN0C 1BQHA 3ZKNC 2RR3A 3SDXB 3T2PA 4MLIA 5EULV 4TUJB 5JA9A 4LCWA 3SN6N 4PR5A 3GIVB 1MHEB 4KHTH 3TBVA 5KTEL 1KPRB 1OAKL 1U8MB 3F7VB 2NCMA 2EXWD 3SE4A 1PKQA 4RZCA 2EXWC 2R2HB 4WHTB 4MVBD 4NUJB 4B41A 4AIZA 3VFPB 2WV3A 1JGEB 3RKDD 4X80H 5C0AE 3VGGA 5F3BA 3RKDC 1A3LH 1I9IH 4P2CG 4Y89A 4MA1B 4PRID 4U6VL 3DX8B 5IQ9B 4ZS6D 4NQXA 4UOJA 4OV5A 2Y07L 3PV6A 1OTTC 3D2UB 4PTUA 1UGNA 4PJAA 3EGSA 3D0VA 1S78C 2YD7A 3QIUB 1W72A 2WINB 5B8CA 4X99B 1RJYA 1XGRA 3VD7A 5JHDB 2E9BA 1AH1A 3EO1A 1HYRC 4HWBH 3L1OH 3SE3A 3V9FA 3RIAF 3JWDC 4NRZB 4LGRB 4E5XA 4UUJB 1G7IA 1CD8A 4OFDA 1MJUH 5HGGS 5D2NA 3GBNL 4PJGE 3QEHA 1MWAL 3C9NB 4YC2C 1NKRA 1BFVH 1YEKH 3MV8E 3N1GC 3ZE0E 2P5WA 1JI2A 4M43L 4Q7DA 4WW2F 1CZ8H 3G6AB 4M3JA 5KAQF 4KFZC 2J7LA 3S35X 3HCVB 4L8SA 5FYLL 3WN5C 3OPZH 3RL1B 2IBBA 4YBLB 1HYSD 3FT2A 4H0GA 3P73B 3WXWH 4YPJA 4YDLC 4QF1A 5BRZE 4RAUA 4Q6IB 3KYMB 4JO3H 1IAKA 1KCVL 1UWEH 5L2JA 1NEZA 4OQTA 1R3JB 2WIIA 1JWSB 4JFYA 5DR5L 3T65B 3S3SA 4KJWC 3SGEI 5IHZB 3MOBH 4WEMB 4Z78A 4YJZL 2UY7A 5IVZA 3LPFA 2X4UB 3X11A 4OCRH 1S9XB 5GIRB 5HDBF 3SDCB 5C0GB 1ZVHA 4GRLB 1MRFH 4GJTB 3OJMB 1ITBB 1ED3A 1HHKB 2AK1L 5FOJA 3QUYA 1H3WM 4X6FA 4OCSH 4UB0L 5I19H 3LKRA 4UIMA 1DBAL 4N5EC 3WLBB 3RY4A 2C1OA 2XQYG 4JFFB 5JW4Q 1X5HA 1T0NA 1IAIL 1NL0L 4G9DA 2KDGA 4L4TE 1A9BA 1WBXA 3C87A 1N3NB 1BZQK 3UTTD 3IDNA 3AROA 5FUZH 4NT6B 2XZCL 3FQWB 4NNPH 4PJXF 2YBRA 3NFNB 1BHGA 3MV9D 4R4FH 3CVIH 4M6MH 3P4NB 5F7EH 1XGQB 4K9EC 1CS6A 1FGNH 3LHPH 3DLQR 1QP1A 4RGMC 1RZJL 4G9FE 3QNZA 3GSXA 4OD2A 2ZUSA 1U3HC 4R4BA 2CDGA 1CGSL 4F57L 3CLEH 5B38B 1IC7L 4FNLH 3I75B 4S1SL 3HC3H 4Y19D 5EOQH 3PDOA 4KI5F 2M2DA 3QNXB 4UT9H 3QDME 4L29A 1N59A 4DKEL 4GG6F 3GMQB 5JQ6H 2KZ1B 3QDGA 3HE6B 4N0FB 1ACYH 1OW0C 2Y5TB 3CSBA 1YEIH 2XWBA 3ARZA 2IBGA 2V17H 3VWKA 3CU1A 4DVBB 2C4FU 2AS5M 3UTOA 3OWEA 3ELAT 4QRUA 4D0CA 1ZHKA 5F8RC 3CLFH 3KWWB 4YHYB 2FYYB 1F45A 4UZGA 3J8F7 1IC1A 4DFIA 2W0FA 4QRSA 4RNRB 2YPLA 5DUML 4G7VH 2FX7H 4XXCC 4LPYA 4HULB 3DUSA 3F7YB 3RHWF 2ILLA 3V0WL 5KVFL 4LPWA 5D71H 5HGBA 5DQJA 4DGVL 3DRQB 5T5NF 4LLMA 1IEAA 3BN9C 3LKOA 5C7XH 5E7BA 4PJEF 2XZAL 3H9HB 3NA9H 4K94H 4NN5C 3CXHJ 2DWEB 3UMTA 4M00A 5E4IA 1ZA6A 1J05B 2FIKA 3FB7B 3FB8B 3MLZH 5HI4D 2CXGA 3EFFA 3EHBC 2IQ9L 3WFDL 1KB5L 1ZVYA 1KB9J 1Q9OA 1W0WB 4Q58C 2A6IA 2X4TB 4MJIA 2VAJA 1A2YA 1R5WA 4NQSB 5IBTH 4F7EA 3W5NA 1QVOA 5DMKA 1ZOXA 3QHTC 3NCBB 4U6HB 2XNAA 2VKXA 5KVGH 4DEPB 2OSLB 4L4VD 3SDYH 4K3DH 1KTDA 1JNHA 3NFSH 1QOKA 1AHWA 5HYJD 2Q8AL 1F4XL 3QUMH 4OLYL 3CVHH 3UTSE 3HRZA 3OJVC 2BXYA 2BNQD 1GAFL 5MEOB 1CFNA 3HKFA 3K4AA 4A2MA 4K3EL 1XZ0B 4CN6A 5GGTL 4X8XA 5BVPL 1UCTA 3MLPA 1U58A 5FIEA 4XCNB 2JIXD 5DJ8A 3FB6B 2BNRA 4FFZH 4WI9A 2FCBA 5IGXH 5IFHL 2RJMA 3O4LD 1T1WB 1KIRA 3N1QC 1FFNA 1A6ZB 4MD4A 4JFHE 2IPUG 2NLJA 1N64L 3PWJB 2FECL 5DEFB 1AP2B 4ZOAA 3HZYB 2VSCA 4MDJA 5BV7H 3NCFB 3E1F1 1XCTB 2VDPH 2R69H 5HVWA 3MXWL 3EZ8A 2CGRH 4U7SA 4EZMA 1PEWA 4HH9B 3ZYOA 3FT3A 2GJ6D 3NIGE 3PGDB 3U79A 3UTZA 1F11B 4M1CD 2E9WA 1JGVH 2HTLD 4HQQH 4M1CC 3REWB 1L0YA 2BVUA 1YPZB 1MLCB 2HTLC 3U30B 1P7KB 5AZEL 4HUWB 4PFEA 4MQSB 1C16B 1LEKA 3UC0L 4ZFOL 1U8HA 4PJAF 3GSQA 4XP5H 1J18A 3OAUH 2YK1H 3LN9A 2XICA 3VD5A 1KN4L 3MA9L 4LLYA 5B39A 5JW3H 4PRAA 2ZSVB 3O9WB 1UJ3A 4LNRB 5FYJU 4U1KA 2OX5A 3MLWH 4ETQA 3VXSB 2V2XB 2LAGB 4QTHB 3TJEL 3M1BB 4OFIA 4RWHA 4PJFB 1BJMA 1W0VB 4JFDE 3TO4A 1F97A 4PPTA 3ARPA 5C0EB 2N7AA 3RVXC 1TTUA 1PG7H 5LVEA 4TTDD 3O6ML 1TETL 2FHFA 4PGCA 4Z7QE 4JR9H 4PJBE 2VDOL 3X12B 3HMXA 1Q1JH 3C5SB 3C5ZB 2FSEB 3HE7A 5LKNA 2ZCLL 3TBTB 5EUOA 5GS0D 4NO2A 3MODH 3PUCA 4L8CA 3OJDA 1IQDB 4GUPA 1OCWH 4JO1H 4KV5E 4QLRA 3UTPD 3O6FD 1JMXA 2F53D 3OTTA 3MR9B 2YUWA 2EYSA 2JJSA 1WWCA 3AAZB 4JB9L 4RFOL 3VJ6B 3QG6A 3TN0A 3HNSL 3NOIA 4HPOL 4AT6A 5ID0A 3P30L 3OL2A 4DZ8A 3UROR 3S4SB 4HX1A 4OFPA 4DUVA 1IQWL 3VE0B 1UQSB 3HAEA 3FQUB 3MUZ1 3NTCH 1E4XL 1B0WA 5LAXB 1FNGB 2AJUH 2H3NB 1S7QB 4DW2H 4AQOA 1UM6H 3CXDL 4GLRI 4OI9A 5CJQL 4IOFD 1F3DJ 1I7TB 3CSYA 2VZ1A 3MV11 1KNOB 3HPJB 4N0UE 5KTEH 4ISVB 4PB9L 1OAKH 5JNYB 2HG5B 4OLWL 3AB0C 2P48B 3VFOA 1I1AB 3C60B 1DL7H 5EOCL 1OTUD 4NGHL 1OTUC 3RY5A 4PP1D 3B6SB 4WHCA 4JJHA 3NPSC 4Q9BA 1L6ZA 2CRYA 5HHXL 3AFLA 3MFFB 4U6VH 2OTWA 4RFEA 5C0ND 4G8EB 4GW1A 2AXFA 3RDTB 2NX5E 2Y07H 4F33B 1W72L 1GOHA 3QSKB 4N9OB 5KS9E 2WUBL 4OGAC 3B5HA 1S9YA 3OGOE 4TUKL 4KTEL 5FFLA 5I1CL 1D5BA 1VERA 2DDQH 1QYGL 1UH2A 4Z5RA 1BZ9B 2Y7QA 5EBMB 3BW9A 5J7CC 2YD5A 3NCEB 3BP5A 1ZT4B 3WN5A 5K59E 5GISL 4P48A 3D87B 3ZE2E 4QOKB 1M4KA 2J88L 3HS0B 3WFBL 4AH2B 4H5SB 4LSDA 1OSZB 1F6FB 1P4LA 3FO1B 3UYRL 3GBNH 4WV1C 1MWAH 5A16A 1KEGL 5D9SB 1KT2A 3AU1B 2WW8A 4J3OC 5MENB 1CDHA 1VKXA 2X09A 4WEBH 5DK0A 3DURB 5E5UB 3KPLA 2BOCB 4M43H 3DVNA 2APFA 4JZJB 3RX8A 1G6RA 1MSPA 1CBVL 1QFOA 1QLRB 5FYLH 1JZ2A 2VXUL 1ZT1A 2E5EA 4F3FA 4OQTL 4MYWB 4OCYL 1KCSL 3F7RA 4QRPA 3MRHB 4ZSOE 1JPTL 3PL6D 3QULB 3GSRB 3ZT6A 5C3TA 2NW2B 3KPSB 4KRPC 4R2GD 4XNZC 4GAYA 4D8PB 2I27N 4LVOB 4R2GC 1HE7A 3UTTA 5I18L 5I30H 1WQVT 4GKSA 5E0QA 3HZMA 1T7WA 3G5ZB 1TLKA 4JKLA 1EGJA 1D5ZB 3D0LA 3PQYB 2DOCA 2OL3L 3DGCR 1HH9B 3MYJB 1DBAH 3UBXB 1U3HA 2YXFA 3N85H 3QUZD 1IAIH 1NL0H 2E9JA 2Q7NA 3L5WA 1Q94A 2DM4A 3QWOB 3RGHA 1YUHB 1XF5B 3A6BL 3SY0A 2XZCH 4UQ2A 4Y19A 3D9AL 1DANT 1K5NA 4HG4J 2XQBL 2GTZB 3VH8A 1K2DA 1U2HA 5F8QC 4LP4A 4XB7A 4CVXA 3O3EB 4RQQB 4NC1E 1A22B 5EZJA 1PAMA 2I5YL 1OW0A 1RZJH 4L4JA 3TIDA 4MXVF 3SKNA 1DZBA 2PTUA 1CGSH 1WTGT 5C07A 4F57H 4FXKA 1BREA 1FYTE 1IC7H 4OFVA 2AXGA 3D3VD 1AC0A 1TVHA 4ELMF 5JPMA 2QSCL 2VLJE 5T1KB 2XT1B 4TSBH 2VWEC 4DKEH 2HFEA 5B38G 2X4SA 1FL6A 3OGCB 2OJEA 3DUUA 3PWVB 4XTRD 1CFTA 3MJ8B 4WFEE 3LVEA 4XTRC 4XXCA 1BD2E 4QRRD 4G6MH 3LN4A 4NQVA 1KIUA 3CZJA 4BH7B 4PJ5B 5IT2L 4IJ3B 5JLZA 4IRJC 1J0IA 2VMFA 4X7FC 4OAWA 1S5IL 2C7UA 5DO2C 2FO4B 3LZFL 4N90D 2NNAB 5IFJA 3QIBD 3SJVD 4V1DE 2AQ2A 5CMAA 5AWNL 2XG4A 1MCEA 3DX6A 3QIBC 3FZUD 4P2RB 1G1CA 2L4OA 3ES6A 3KS0H 2AABL 3V0WH 4Z7WB 5J89A 5KVFH 3KPNA 3MUJA 5FYKD 4O9HL 4H8WC 1A7BA 5FGBC 2Z31B 2XZAH 2O61A 5FKAB 4HH8A 3V8CA 2D0GA 1HOCB 4UQ3B 2I9LA 2VL4A 1C7TA 3PNWA 3IF1A 1M7DB 1CR9L 1CXKA 4CMMA 1ZGLM 4G6KH 4X7SL 3WFDH 1KB5H 4Z0BL 5HYJA 2EECA 43C9B 1I1YB 2XTJD 3MLTB 5IOPB 4U1LA 3FCTB 1YEDA 1FH5L 3OSKA 5KN5A 4I2XB 2H2SD 4HIXL 2JIXA 5EU6D 2XV6B 2H2SC 3QI9D 1VESA 1NH6A 3O4LA 3GMRB 5FCUL 4PJDF 3EBAA 5JOFA 1Y0LB 2Q8AH 4KVCL 4WCYL 1I8MA 2PYED 5E5MB 4OLYH 3ME0A 2EYTB 2Y6SC 3FO9A 1GAFH 3IFLH 5GSRA 5BVPH 4YAQB 3MRLA 4Z77B 4I1NB 3P4OA 3D25B 1F3DH 3RWFA 1TVDA 2MFNA 4EDXA 2GY5A 1ERNA 2VOTA 1OAQL 1Y6NR 3O0RL 1I1FA 1FNEB 1QRNB 2GJ6A 3ULUF 4RCAA 4QXUL 4NO5B 4BSWB 1N64H 4ODUA 1XFPA 2BY1A 3KYKL 5EC2A 2HT4D 5CD3A 1JZ8A 3TZVD 5F9JB 5I76B 1KBGL 1DBJL 4NHUA 3VRLF 5CP3A 5IESL 1UC6A 1J5OL 4JREC 1DJSA 2HJLB 5T3ZD 1AI1H 3JV4A 4I77L 4E41B 4X6DA 3FHQA 5FXCH 2ED8A 1WAAF 1OGAB 4DTGL 5KSVB 4NRXA 5EUKB 2C5DC 1KF9B 5DK2B 3MRCA 4GXUN 1CIUA 4H26A 4CN4A 3BRGC 4HEPG 3VXQB 5AZEH 4WUUB 1FAKT 1U8IA 1O7VA 4XI5D 2BVTA 4K2UL 4XI5C 1K85A 5DJDB 1OP3K 1A6AB 1DE4B 1MCIA 2DI9A 2IADA 1ZLSL 4YO0A 1A64A 1BP3B 3VXUE 2WWKO 5I8CB 1KN4H 3RVTD 3MA9H 1OF2A 5ICXA 2VITB 4HFWA 5K9OA 4KDTC 4Y7MA 4QRQB 1CU4H 5C08B 4JN2B 2P46B 1I75A 4XVJL 4NYLB 3TJEH 4TVPL 4MNQA 3MMEA 1JGUH 4KHXL 2HFTA 4ZXBD 4LHUB 3MJ7A 3EOBA 2RAMA 2R2BA 1NJ9A 2F53A 1AGDA 2D7QA 2X4QB 2XPGA 1TETH 5IB4A 1D7FA 1JHKL 4FTVB 4MB3A 1SYVA 5C0DB 3QZWA 4NP4H 2WK2A 4R9HA 1PYWB 2XTLA 1QSZA 1T66D 4GT7A 1A7OL 3MNVA 3ZDXF 1DQML 2FX9H 3QUKA 3U0TB 1GZPB 1QR1A 2XKNA 4JO2L 1YMHA 2AJYH 3RQ3A 3D69B 3BKYL 5ID1B 1OT1A 3KJ4B 3IDGA 5H37H 1OP9A 1UACL 2QR0B 4ORGB 1N6QL 1RU9L 5J1AB 4LQFL 4ZUWA 5IVOA 1JN6B 5DRZB 1UM4H 4JB9H 4Y2DD 3V5HA 1HXYA 5MEQB 1KTLB 1HSBA 3QWQB 4Y2DC 3LQAH 3FFDA 4EBQL 4KQ3L 4HPOH 1F2QA 4PJ7B 1MY5A 3P30H 1DQJB 2PCPA 1K3IA 2DKMA 5DQ9A 1IQWH 4M7ZB 3SDXF 3D1MC 1KCKA 2NY3D 2ICWB 4U2YA 4G80A 3A6CL 1E4XH 4CVZA 5HYFA 4YDJB 4P4RB 5J9PA 1CVRA 3QXWA 3ULUL 4U1GC 2NY1B 4CDGC 4LEOA 1DQQB 5DQDL 2CPCA 5CJQH 4JZNA 1T0MB 2Z92B 1A6TB 1YY9D 2DWDB 2V9TA 3MLVH 2ZSWA 4Q2ZA 5I0DA 1T80A 4KKLD 1WWAX 2PF6A 3QRGL 4PB9H 3EDJA 4KKLC 5GRJL 3IXTB 5DVNA 3JWOL 1N5YL 2VH5L 4YHML 5EOCH 4APQD 4MX7B 2CDEB 4NGHH 1J0HA 2X7LB 3LS5L 5E6ZA 3FJTA 2VDQH 3I3DA 4YE4L 5A3ID 4P57A 3FKUS 3JWDL 3CFDA 4F7MB 4NQDE 3RUGE 4GXVL 4WFHE 2R0ZL 3H2WA 3OXRB 2GT9A 1NUFA 2HRPL 4WV1A 2V5RA 3SO3C 5T3XL 5K93A 1W72H 5EO9A 1SJHB 5ICZA 2DD8L 2ESVE 3U0PA 4TUKH 4KTEH 4GAGL 5C0RH 5I1CH 4LIQL 1LEGB 1FVCA 3A6OA 4ZS7L 1CDBA 2IQAB 5I8OL 3M17A 2DMCA 3E6HB 4YDVB 1UB5B 5AYQA 3L7FA 2J88H 1X7QB 4D9RE 5BZDB 2FJHB 4YBQD 1KEGH 5C0AB 3DTXB 3U4AA 3FFCE 4OF0A 4KRNA 4YBQC 2RGSA 3RPKA 4HWEL 5E2WL 4FQHA 3CFEA 2GJJA 4Y1AD 1VPOL 5D7LE 4XX1E 1T0PB 2OS7A 3ZKMC 1CBVH 1FFOB 5CBAB 3KXFD 2VXUH 4FQXD 4OQTH 1O5DT 1I3VA 5HHPB 4NBXB 2CRZA 2OMBA 3FONA 2B2XL 4O2FA 1LEIB 1KCSH 1R5IB 1TZGL 43CAA 4G42A 5DJYB 4ONGL 1T7VA 4X6CA 3SGDI 2FB4L 3U46B 4CNIB 3LEXA 4Y4FB 5HHOE 3QUZA 3DBXB 5DRWB 1QHPA 4PJGB 3DGGB 1IM9D 4PJCE 5H2BA 5I18H 2EDXA 1EFXA 3C08H 4JFPA 5ELIA 2GIYA 1SY6L 4BH8B 2VQ1A 5CSZB 2MKWA 5I16A 1H5BC 1MHCB 4KMTL 4JDVB 4JPVL 4FFVD 4TN9A 1IAIM 3B9KD 3IS1X 5JOPD 5BRZB 1ULVA 3B9KC 1YYMH 5GRUH 1NFKA 1IGML 3UBXG 4P0DA 2JE8A 5C0CD 3D3VA 1OP5K 2QQKL 3RFZC 5D6CA 1XF3B 2XQBH 5EPMB 3H9SB 3BH9A 1JRHL 4X4XA 5C9JB 3LH2L 3D39E 3QPXH 2GSGB 5KSAB 3L3OA 3ZKXC 4DJMA 3HN3A 5GZND 3MCG1 2IFGA 4PGEA 2R4SL 3MRBB 2G2RA 5ECJE 4WI3A 1IGJA 5CWSA 3VD3A 1PEZA 1Q9KA 3GK8H 4PUBH 4M03A 1T1XA 4IRJA 3WXVL 4BFEA 2HJFB 2QSCH 3I6KB 4X6DF 1P5UA 1KJMB 1XH3A 3HG1D 5IB1A 1WUNT 5TPWL 3AS3A 5EU3B 4EN3D 4PP2A 1L0XA 4PRIB 2GHWB 2VLRD 3QIBA 4U1MA 4PRHD 2GW5A 4FN0A 2ICEB 3UX9B 3U1SL 4XPAL 1V3MA 2ICCA 3HPLA 3K8LA 1F3RB 1AD9A 2CJUH 5FGBA 2MQCA 2WM0A 5IT2H 3FQNB 3JSSA 1DBBL 5E2VL 1ZLVK 1IARB 4W70A 3S5LA 3S36H 4PY7A 1FVDB 3OAYH 5E9DD 2QSVA 1CGTA 1G9NH 2CKBA 3MRNA 2AJ3B 5DRNA 4HS6A 2P8LB 1EBPA 3TBYB 1BAFL 2A73B 5GRWA 1DQTA 3KHQA 4M6NL 3K1DA 3IKCB 4O9HH 3GHEL 1TPXB 1QEWB 3IFPA 4QTIL 4LLDA 1NBZA 1MNUH 3FT4A 5EU6A 3LKPB 1EJOL 4WFGE 4X7SH 5BVJB 1T4KB 4OCNC 4Z0BH 3VCLA 4NQEA 2VXQL 4P5TD 2PYEA 5JIIA 4HSQA 3EDDA 5JHLL 3SHSA 5T33L 2X41A 5AG8A 1FH5H 2X1XR 1R0AH 4HIXH 4JRXD 4Q6YA 4YFDB 4M93B 3EYOA 4QYOA 3WMSA 5FCUH 5D1ZC 3QA3A 1LO4H 3PWLB 3UJIL 4A2LA 4D0DA 4MWFB 4KZEL 5TFSL 3HTLX 3QCVL 1JK8B 1DSFL 4LBEB 4RGND 2AXJA 3MV8D 4TQEH 4F58L 4LLAA 4RGNC 4R26L 4EI5B 3V5KB 3CZFA 4O2EB 1HSAA 1A4KA 1OAQH 1XIWC 5FA3A 4FXGA 5KSUA 3ARWA 2BSSA 2YD8A 2YSSB 3KG5A 4HIHA 4L5FL 4QXUH 5C1MB 1NCTA 2PTTA 3MV9B 3GUTA 2LV4A 1DR9A 1G6VK 1OT2A 3RL2A 3T0XA 1KBGH 1DBJH 3S37X 3DX9B 4L9LC 5JIKA 3QQ3A 2Y25A 1YPZF 1J5OH 3CDCA 2I26N 3O8XB 1JRHI 4BFIA 3L9RA 2P7TB 3RWCA 3STLB 3WFEL 3BXNB 3FMGL 4DTGH 3CPLB 3G6JA 3GMOB 3PABA 4KDTA 1RIVH 4LDLB 1FN4A 3W0WE 5C6WH 2FWOB 4K2UH 2WNGA 2Y06H 5D7JC 4R7DA 3C8KA 1V7NL 4JPIB 3VXRD 5J3HC 1H9VA 2ZKHL 3G5VB 4PJFF 1CFVL 3UCRA 4GFTB 3ZT5A 3QCTL 1CF8L 3E2HC 4PJHE 3L3JA 4KUCF 3BIAX 4XVJH 4TVPH 5CHNA 2D03L 4KJPD 4KHXH 3WKNA 1JUFA 4KJPC 4WWKB 5IB2B 4OZGE 4ZPVB 5TH2A 3ABZA 4LKCB 1BIHA 3QDMD 1JHKH 3R1GL 2NR6D 4LHUG 5DZLA 1CD0A 4Y2DA 2NR6C 4LLUA 1E4JA 5DD6A 2R8SL 5F97E 1G7PB 5IMMB 4XC1L 1DQMH 1B90A 4X5WB 3IXAB 2K1MA 3KPQB 4LRNH 1ZLWH 4JO2H 3X3FL 2X70B 4M6OL 4X6CF 5E24E 3KLHD 1YN6A 1UACH 3NCYS 4HLJA 3KLHC 3HI1B 1RU9H 1VADB 4LQFH 3QEGL 5DJCB 4J3SA 4JDZA 4JFDB 3K80A 1LO0L 3BZEA 4L4VB 2VL5A 1U8OB 4YHIB 4EBQH 1LD9A 3TNMB 1UEMA 4LAJH 5CEYB 3LEVL 3PJSA 4U6XB 2MQ0A 3HAEH 1DBML 2GUOB 3RZCC 1BX2B 3EYQD 4PGDB 4RBPK 2BNQB 1TMCB 3VXMD 3WS3A 3GSUB 4PJBB 3GSVB 4XT1C 3BP6B 5C0JB 1EJ6A 1SHMA 3ULUH 3SEPA 3Q6FB 5F93C 1QKZH 4JHWH 2EIZB 5FDWA 5EU5A 5EC1A 1BPVA 1MF2H 5DQDH 3IU4L 4QWWC 1A6PA 3OF6D 5KSBA 4O00A 2BY3A 2ADFH 4X7DC 3MRIA 3MROA 4ZNCD 1DLHB 5DS8A 4POUB 1A14L 3O4OC 4I48B 5JXAL 4ZMAT 2JCCB 4WGVB 3LMJL 1AO7D 3I6LE 4TSAL 4YHMH 5H35B 2A6KA 2AQ3A 3VXOB 2N7BA 2XG5A 5DUBA 5CINL 5E6YA 3P40A 4AEHL 3Q5YA 4KUZL 3JWDH 5GSVB 5D5MA 4JQXC 4HGWA 1FJ1A 2G60L 1M05A 3VXTA 2NY2B 3N06B 1NCBL 2RHEA 1G7LA 1Z0NA 4M7JL 4GXVH 5CP7B 3CFCH 4DCQA 3RWEA 2ORBH 2QJDA 4ELKB 1H8SA 4DOHE 4PJXE 2HRPH 5TDOB 1IEHA 1WJ3A 2K3TA 5T3XH 5CZXC 4GQ9L 2DD8H 3MTRA 4R7NA 3IDIB 3W39B 4ODVL 3V6FA 3LSOA 4GAGH 5HHQB 5ENWB 3X3GL 4JFHD 5BS0D 4JKPL 3O2WH 3ARDB 1T03L 1EHAA 2ZG1A 4K7PL 1AJ7L 5I8OH 3VXNA 1I9EA 3KXFA 1J8HD 3TO2B 1RQ5A 2XZQL 1UVQB 5CJBA 1KIPA 5C0IB 1ZHLB 1NGPL 3SDAD 4TUOA 3BEWB 1Z9LA 1FZMB 4OUUB 3RA7L 3SDAC 2A6DA 3HFMH 4X6EB 4Z95L 3RWHB 2UY6A 2WWKT 3FB5B 4JM2D 4QGYA 4JM2C 1VPOH 4G8IA 1XF4B 5JPNA 4OZIB 3WNLA 1UKTA 4XNQA 1NGYB 3ULVF 2W91A 5I74B 1JWMA 3G08B 4KVNL 2D4FA 5K9KA 3RWDA 2B2XH 3QPQD 4L3EE 1H5BA 3PP4H 3BUYA 3QPQC 2A9NH 2KZWA 4P3DA 3B8YA 2X42A 4K3JL 5GHWL 2FB4H 3BQUD 5IM7B 1JCKA 3Q5OA 3ARBB 3QEUA 3O6FB 4K71C 2ADIA 2EKSA 4CADB 3B9KA 2GKIA 5E00B 2UUDK 1WITA 1UZ8A 4YPGA 3DRTB 2YUZA 3QQ4A 4H1LA 3S88L 3L7EA 1FE8L 2IH1B 5C0CA 1OVZA 1RZKL 1UCBH 4K9EH 4YWGL 4CVUA 3QRFM 5A2LH 4CGTA 2FJGB 3VGDA 5ACZA 1IC5H 4KMTH 4YNYB 3RX5A 1I3GH 2BMKB 4Y16B 5GGQL 5F1NB 2OK0L 1MFBL 1FLRH 1I4FB 1FL3B 2A74A 4LQ1A 2G9HA 5FGRA 3BIKB 3SCMC 4X4YA 3E6FB 4HKXB 2VE6A 1HNFA 3EFDH 4XHJD 1II4E 1R3KB 3I84A 1JF5A 3RWJA 6FABH 5ITFA 3LH2H 3BEVB 1OSPL 4YX2L 4XVSH 3ZDYE 2VLRA 4KKAD 1J12A 2VR5A 4PRHA 5E8NA 2W65A 2AJVL 4GMSH 4KKAC 1LO5B 4DGYL 3EYSL 1IGCH 2A6JA 1GPOH 5AAWA 3WXVH 3SPVB 3S3JA 4HT1L 4F8TA 4QRTB 4I3GA 4U1JA 5TPWH 2IJ0C 4IDJL 4EIGB 2H9GB 2VQUA 5C0FB 1MHPL 4JQVA 5FO7B 4XCYB 4OGXL 3VG9C 3ARED 5FM4A 4XXDA 2B39A 4R97C 1HQRB 3AREC 4XPAH 4H8WL 1SVZA 3HZVB 3L6FB 2YKLL 4O51B 5CEZL 5FYKU 4HGMA 4N0CC 1JV5A 3QXDA 4F7PB 1DBBH 5E2VH 2X4RA 4Z7WF 1B9ZA 2PXYD 4P5MA 1TZHA 1U41A 2F54E 3BFOA 3EO0B 1G7JB 4AEIL 5E70A 3BH8A 1ZLUK 1FYTB 2C1PA 4GRMA 1ZS8B 1JP5A 1WTLA 4ZFFA 1FSKC 3HI6H 5IG7B 3AS1A 4JJ5A 5HYQB 3O3BB 1UWGH 4POYA 3GEWB 4AK1A 4L3CB 5BQ7B 4QTIH 3K4DA 3ULVL 1N5AB 4K55A 3O2VL 5HSFA 4HMDA 4JRXA 4YIQA 3TV3L 5I8EA 3TBWB 1HKLH 1RFDL 4P23D 5D1ZA 5DVOA 1PG7X 3U7YL 1RHHA 12E8L 1EJOH 1KXVC 4P23C 2P49B 4AL8L 2Q87A 2ZZUT 1JHLL 2NX5D 5L8KB 1IZJA 1NBVH 1RPQA 1JF1A 2VXQH 5L8LB 1QACA 1Q72L 1UB6B 3MV8A 4B0MM 5L2KD 4PRDA 4TOYL 3PL6B 5JHLH 1QBAA 5JUEL 4B50A 2I9TB 4V1DB 1XIWA 5CKAA 3BZFB 1ND0A 2A83A 3UZEA 4HUUA 4Q9RL 5IBUG 4XBPB 1IGTA 3PGCB 1IEBB 2P43B 3UJIH 5JDSA 5LCVH 4KZEH 4UDTB 1AXSB 2DLEA 5TFSH 1WZ1L 1DSFH 2QKIB 4L9LA 4FA8A 1HI6B 1P2CB 5C9KA 1JGDA 3W9DA 3QJFB 1MUJB 4ALAL 4DZBB 2CQVA 1QO3A 2BRRL 4Y16C 7CGTA 2XN9D 2ARJQ 3BAEL 3G5YA 5HPMB 4P9HL 4L5FH 2Y9RT 4LCCB 3REVA 4U31A 1CT8B 4P4KD 1CL7H 3QEQE 1S7WB 2P8PA 4NO3B 4P4KC 3QNYA 2WMPA 3FQTB 2IWGA 2FDBP 5DC4B 4I4WA 1QNZL 2VERN 3WLWD 2J8UB 3ARGD 3JBG7 1NCWH 3T1FB 3WLWC 5D7JA 1HDMB 3GSOA 3WHXA 2Y72A 1QFWI 4L4TA 4XWGL 3VXRA 1Q0YL 3ARFC 1F13A 3HNTL 4OZFB 2ATPB 4RMSA 3QJHA 3ZO0A 3WFEH 4CW1A 3FMGH 1MH5A 5D5MF 2DJUA 4OM1H 1I7ZB 3ROOB 4HKBA 1RUML 3HR6A 5C2UB 4JFEE 5HD8D 3LRSB 1SM3L 4Y8AA 5AZ2L 1L9MA 1HHJB 2PNDA 5HD8C 3V95A 4G9FA 5LWYL 3DYMA 1HQ4A 3R4DA 5DWUL 1CGWA 1GC1C 4QRRB 4MCZA 5FO8A 5DJ6A 3UJTL 5EO1A 4JCLA 2ZKHH 1CFVH 2BVPA 2F15A 2R29L 3QCTH 3X13A 1CF8H 4BFBD 5A40E 3QDMA 2CKNA 5I1HL 3VU2A 3CUPA 4WIQA 2CIKB 1F4YL 5IV2B 2JELH 4HAGA 4N0RA 3SJVB 1LILA 1XGPB 2D03H 5IJVA 4MAUL 4MA8H 3NAAH 2PO6B 5BVJA 4ODTL 5CEXB 2VUYA 1Z0MA 5DUPL 1U9KA 1KCUL 1MLBB 3R1GH 1XGUB 1EIBA 4ZO7A 2YA0A 1OWRM 5F9WB 2R8SH 1HILA 2UYLA 5IJKC 1LK2A 1TFHA 3RZCA 2PW2A 2XTJB 4P59L 3X3FH 2NYYC 3GSNA 5AUMA 4BA8A 3SE9L 3KLAA 4XP9L 3S8WA 4PJ7F 1SJXA 4Y4HC 4GS7B 5T1LD 3QEGH 1ZHBA 1GGIL 4LGPB 2FHBA 1LO0H 1Q9WA 4PRBA 4O58H 3QI9B 4OLVL 3U7WL 1MCWM 5HHNA 4LLVA 2HKFH 1Q9LA 3KDMB 4OFYD 4RAVB 4UIKL 3K1KC 1IT9L 4JO4H 1DBMH 3FOLB 1VGEH 4PYGA 1MJJA 1JGLL 1TQBC 4C56E 5HI5C 2FD6H 5EDXA 2QHLA 1NAMB 3QFDB 3SKJH 3QCUL 2C3XA 1A7NL 5I71B 1D6VL 1G7HB 4LVNC 2XKSA 3IU4H 4ONHA 4JQXA 1CE6B 5EU4B 4I5BB 2EDFA 4HXAL 5D2LE 5GS1B 3P11L 3RNKB 3UTSA 1A14H 3KPMA 4F37K 3TZVB 5JXAH 1MQKL 1A5FH 3WEXB 4I9WD 1LE9B 2BVQB 5BCAA 3TPUB 4PGZA 1VENA 3U9PL 1FG2A 4UU9B 2GSIA 5CINH 5EO0B 4ZAKD 1S9WA 4AEHH 1FC1A 4S10A 3DV6B 1NDGA 2P8MA 5BS0A 1SQ2N 4Y4KB 5TQ2H 2COQA 2G60H 4M8QB 5J0BA 4J3WA 4MJ5A 3DSNA 4XGZA 1SJEB 5DURB 4EIZC 4W6WB 4M7JH 5ANME 3NMEA 4AENB 1FV1A 1J8HA 3Q3GB 3WL9A 1BQUA 1RUQH 3U83A 1AXTL 2ITDB 1S8DB 4GQ9H 3SDAA 1JYVA 3PV7A 1MCWW 3O11B 4JM2A 3SE8L 3B9EA 4PRNB 1T03H 4MXVE 1WBYA 5HI3D 1AJ7H 3PHQB 3WNPA 4RX4D 2BY2A 1U8LA 3R0NA 1NEUA 3GIZL 3VWJB 2D31B 1JZ7A 1NGPH 4IHOB 5E6IB 1VFAA 2I07B 3RA7H 4JE4B 4ZXBB 4Z95H 1CTOA 2OJZH 5M7QA 4NQCE 3BQUA 2ED7A 1YA5A 2HJKA 1C5DB 2EC9U 5E2UL 2Q76A 2ITCA 2VDLL 4P2QE 3VI4F 4KVNH 4F15B 4WO4D 1CLYL 1U42A 2F58L 2XWTB 4WO4C 2HLAA 2FEDD 1MJ8L 1W8OA 3D85A 4PJGF 4UV7L 5EU7E 1C12B 2FEDC 4HAFA 2ARWA 5L6YH 4GBXD 2CUMA 2CSPA 4U4BA 4KH2A 3JTSB 4GBXC 1RUKL 4YBHA 4GRWH 3SCMA 3S88H 3T0VA 5H94B 1JWUB 1KYOJ 3BPOC 5DJZB 3FFCB 4FQJH 5GRVL 2AEIT 1U93B 4OBRA 5ABDE 4LOUC 1E6OL 4NKMB 1KLGA 4JY6A 4MHHG 2YMXL 3W11D 1MCLA 5GGQH 4JFOA 1R24B 2NY3B 3EO9L 1UXSB 1YMMD 4P99A 2OK0H 4XBGB 4BUHA 1MFBH 3UPRB 2ZUVA 3F58L 3S98A 3T8XA 1CICD 4M4RA 2H8PB 1JMZA 2N4IA 3K81A 1CICC 4PRPD 2VZOA 4PJIB 4YXLL 5IKCB 2VLLB 4HKZA 4WTZG 2NXYD 5HHOB 1H8NA 5EOTA 1N4XL 4G8GD 5ISZB 4PJDE 5DHYA 3DV4A 3AREA 2AJVH 3MBED 4JFXB 3ECBB 4X0KA 4YR6A 5F7HA 4EUPB 4DKFL 3MBEC 5HGAA 1JPSL 2PYFA 1DUYB 4APQB 3HHRB 1P4IL 4M48H 3UEZA 2B0SL 4A6YA 2LVEA 3GFUA 1LP9E 3L3HA 5LXGL 2CLZB 4IDJH 3UPAA 3MA7A 1MHPH 1FL5B 4N0UA 4NDMB 2OR8A 3OKMA 4MA3B 4OGXH 1JIBA 4J1UA 4QHUA 4F7CB 1RUAL 4XWOC 4BELD 2L7UA 1TCRA 5JR1L 2D4DA 4H8WH 3EYFA 4S1DD 5D7SL 1ZAGA 4YUEL 4AM0B 2YKLH 5F9DC 4S1DC 3KGRA 1EX0A 5EIIA 4LSQL 5D7IA 2J1KA 5J6HA 1G84A 1OHQA 3CH1A 4HWNA 2CKBH 1H0DB 4P23A 2VN4A 5INDB 4PJ8C 2VDNL 2W0KA 4JRYB 1YNTA 4XCEA 1NGYA 1IILE 2NX5A 3FQRA 1GZQA 4R96A 4AZ8A 5KS9A 4CU8A 5SX4I 2X10A 4MSWB 4QXGL 5DXWA 3LDBB 3MRKB 2VO5A 4Y1AB 2HFGL 1J7VR 3GMMA 3N1MC 1ZVSB 1RFDH 4QHNA 2R0LH 4WFHD 5F88B 2R0KL 4H88L 3U7YH 12E8H 2DIJA 1QBMH 4HK3J 5DJ0B 1X5LA 4AL8H 4FQXB 1JHLH 5D6DC 5IVXB 1DN0A 3ZKSD 1FZOB 3RI5K 4LIQE 1SYSB 1WK0A 4L8BB 1QSEB 1QFUL 4TOYH 4K3HA 4F15C 5JW4R 4G43A 3B5GA 5JUEH 1KN2L 1OD9A 2CLRA 3BPNB 4U49A 2DQTL 2UZYB 5TDPA 2LTQB 2EH7H 4J4PD 4WU5A 2JJUA 3MRFA 4ODXA 4S0SD 1RULL 4J4PC 4MDIB 3RVWC 1IM9B 2XN9A 4OLXH 5DMJB 1I3RA 4S0TD 5SWZE 2HLFD 4P4KA 4LCYA 5HDLA 2A0LC 1T2XA 1WZ1H 3GRWL 4ZSOA 2ICWI 3NACH 4CUCA 4Z76B 1EAPA 1NC2A 5D7LD 5T3ZH 3ZDXE 3ZE1E 3ARFA 1QSFE 3FRPG 4ZDHB 2EYRB 5IP4A 4ZUUB 2BRRH 1RSFA 4LDEB 2HT3C 5EZLA 4WI7A 4E0RB 4R3SB 3KPRD 3BAEH 4BFGA 4P9HH 4NNYB 3WIFB 1VFBA 3LQZA 4Z7UB 2R9HD 2ZJSH 4M61A 2FZ3A 2FX8H 1P6FA 4Y2OA 4WI5A 3ILQD 3OQ3B 4QY8A 1YEHH 1LE5A 3IJYB 3BD3A 2OXGA 5F7YC 1UXWB 3SDXE 3TBSA 3HG1B 2WUCL 1BFOB 1YZZA 4X98B 3I02A 4FQQB 1A9EB 5EBWB 4EN3B 4F9LC 5CGMA 2PW1B 1SM3H 5AZ2H 4GH7B 5FKPB 4MLSA 2XWJB 3WD5L 4YXKH 2Z93B 3BHBA 5FO9A 1AGFB 2HVKA 5EIVA 1J9CT 5DWUH 1RAMA 1X5AA 4KTDL 5D7KE 4ZG1A 1EMTL 5DGQA 2YN3A 4OKVA 3UJTH 5EH1A 4NJAH 2O5YL 4B53A 4JVUA 5KG9B 2VLJA 3U4EA 5I73B 1D9KD 1JPGB 5I1HH 2XFXA 1HWHB 5DEGB 5E9DB 4XMLL 5FOBB 1BECA 3EW3B 3VFRA 1BGXL 4Z18A 3GJEA 5IJKA 4ZYKB 1AGBA 1BD2A 3F7QA 3MACH 2X5PA 2N1KA 4Z7VB 1QD0A 2EE3A 1HHGA 5JHDE 3TVMD 3GGWA 4ZO6A 4Z0XA 4Y4HA 5DUPH 2AEPL 3TVMC 3WHE0 1KCUH 3GJFB 5T1LA 1R3HA 1TZIA 3I6GB 3NCMA 4OLZH 1F90H 2DTML 4U0RC 1X5FA 2JB6A 5IW6B 1B0RA 4ODWB 5CLWA 3P9LA 1ES0A 1OAZL 1EEZA 1A7PL 4RGOH 4LCUA 3JVGC 4P5TB 3GMNA 1YYLL 4I3RL 3RJDA 1E28A 4CMHC 1JZ4A 3BPCB 3SE9H 1YEEH 4XP9H 3O6KH 5F6HI 3ORJA 5CD5C 2P5EB 5E8EA 1DTUA 1GGIH 4TPRH 5GGVL 2VR4A 3U36B 4PJBF 4NIKB 4OLVH 3U7WH 4FHBD 3NGBB 4LSSL 4NZJA 4OZGB 3ISWA 3RZWA 1M7IB 5LGHL 1HCFX 2AK4E 1LO3H 2OP4H 3ALWA 4KV5F 3QO1A 5I1LA 2IFFH 5ALCH 3QDJD 3GMPA 4ODSL 1H3UA 3QCUH 4MNGA 1A7NH 4HK0B 5GGRA 1T5WA 3UPCA 2Q6WB 3DVIA 4HXAH 3QB7C 5A2FA 2GK0A 1MOEA 1N2RB 1GOGA 3NN8B 1ZLVH 1S9VB 2GFBA 5L0QC 1MQKH 1F4WH 1WBZA 2BSED 4ZO9A 5SV3A 2VIRA 4M1DL 1DN2A 4XC3L 2P44B 2FJFA 1A6VL 2GEEA 4JY4A 1TTGA 2Q86A 4JANB 3ALXA 5T5FL 3U9PH 3CDGA 5F3HB 5I1GH 1PZ5A 1EAJA 1NCAL 2YUXA 3VFNB 2IAND 2DJSA 3MV7B 4RX4A 3VFGL 4I0PB 2DQEH 1EEQA 1CD1A 1UG9A 5HY9A 4LF3B 1HHHB 5FYLD 3QO0B 2R1WB 2VXVL 1CVSC 2V5TA 5KVEL 4R0LC 5DZOA 1UM5H 3SE8H 2H26A 1A0QL 4NCDA 5GJSL 5SX4H 2YN5A 4QHKI 5HDOA 3BO8A 2EDOA 4BKLA 2J3SA 3VFSA 3S36X 2DLIA 1A3QA 4MD0B 4OZIF 5F7MC 4WO4A 5DHXB 1JNJA 2VAAA 1YEJL 3BYTA 4K07A 3VXUA 2NY5L 5MI0C 4GBXA 3OZ9L 1GGTA 1E27A 5E2UH 4JFQB 1EEYA 2GCYB 2QSTA 4LFHG 3EDFA 4GW5B 5K59F 2VDLH 3K2MC 2VABB 4L3AA 3BSZH 4OCWL 1CLYH 2F58H 2W0LA 1DUZA 1MFAL 4UV7H 3Q2CA 1UFUA 5I1IH 3TH3T 1E4KC 3C6LD 4X5XA 3OR6B 2YWYA 2EDWA 4KAQL 1D6EA 2C4XA 3C6LC 1RUKH 1CG9A 4NQTA 4HUVB 3BP4B 2EH8H 2D7MA 2FGWH 5E8PB 1MFEL 2BVEA 1KLFA 1NLBH 2BVYA 2VQTA 1JVKA 5F1IB 1A3RL 1CICA 4H25B 1MJ7H 1F2XK 4BQ6A 1E6OH 4JZOA 4N1HB 3V79C 2BSRA 5CZVL 1H3VA 4NKOA 3VXMB 1J88A 1AGEB 3CSGA 3MBEA 3GB7A 1XR9A 2G5BA 5I75C 4XX1G 3B3IA 3LEYL 2XXCB 4WI2A 2D2OA 2MSPA 1HEZB 2DQFA 1DFBL 2O5XH 2FEEL 1BBJB 5ITBL 4YXLH 1XCQB 2NY7L 1K9TA 4P2OB 1N4XH 4KROD 4O2CA 4GKOA 4P46B 2IAMB 1INDH 4KROC 4BQBA 3V5DB 1F8TL 1AO7B 4HV8B 3OR7B 1S7XA 1I8LC 5IQ7L 3QISA 2VC2L 2VNCA 4JAMA 2IPKB 4UV4H 1ZGLA 4UOW0 5IB5B 1PZUB 4Q0XL 5LXGH 4FG6D 4LPXA 4NM4L 1MI5E 4PJ8A 2DBJA 2DQIL 4FG6C 1VEMA 1JZ6A 1MPAH 4XAWL 4LPUA 3B2VL 4WJ5B 1RUAH 1BLNA 4XNYL 2VLKE 5JR1H 3VFUB 5D7SH 1KB9K 4WDIB 4LSQH 1V3LA 3BRFA 1DVFC 2X9YA 3BWAB 3FHAA 2WSKA 4RISH 2YD3A 5D1XB 3I50L 1CGYA 1NBQA 4NQDA 3RUGA 2CK0L 4F9PC 2EDLA 4HS3A 4U1HB 1FZKA 3JTTB 1JYNA 1B0GB 5TE6L 1LMKA 3IVKA 1U92A 2VDNH 5FA4A 5D6DA 4MXQD 3ZLQC 3L3GB 2R1YB 4RA3A 3C09B 1IAOB 3QH3A 4NBYB 1B4JL 2ESVA 4GSDH 4QXGH 4QHMB 1T3FA 1M1SA 1NMCB 4FQIH 3WE6B 2HFGH 2RFXB 3T0EE 3VXSE 4J4PA 4YLQT 4H88H 5C2BL 3VRIB 1D5XA 2IC2A 3P77B 4EOWL 4ZFZB 1S5HB 3MNWB 4LLQA 4DN3L 3OKNB 3QXAB 1VA9A 4Y0GA 2AV1B 3IAGC 1QFUH 5DLMH 1OB1A 5D7LA 5HJ3B 2DQTH 2C3HA 1KPUB 3HZKB 4ODHL 2JK5A 3DPBA 1RULH 2EC8A 4KWUA 3DHJA 3PGFH 1MVFA 4KI5D 5IMKB 4KI5C 3GHBL 3GRWH 3QHFH 5D96C 5MP6H 5C09D 4N68A 2ZOLA 2GJZA 5D1QC 5JW5B 1QQDB 3ARSA 3WJJC 3C5JA 2J8UF 1H8OA 4QHLA 4E42B 3BRDA 1XF2A 4PJCA 1FG9C 2NTFB 2MCPH 4Y5VC 1FZJB 1QPPA 2IGFL 35C8L 4J3TA 4XBEH 2QADD 5A2JH 3LKQA 4F9LA 4O02L 2QADC 1F3JB 3DROA 1S3KH 1GC1L 4RA0C 1LHZA 5FHAL 4QEGA 1KLUB 1X5ZA 2UWEE 2QQNH 3BKMH 4AIOA 4OZHE 1NDMA 3LS4H 1NC4B 3SDDB 5HYSB 3WCYA 3RIAK 4TTGA 4OF8A 1SVCP 2E7HA 5C0BD 1UH4A 2B1AL 4NNXB 3CFKB 3FO2A 5CAYB 3DXAD 3D39A 5J06A 4PBXA 3VGBA 4UDUB 2LQRA 3PXJA 2ZOKB 4HKJB 4E9LA 3P0VL 3GKWL 3TYFA 4N9GB 4F7TA 5DSCA 2HKHH 3OKEA 4KTDH 2E6QA 3DSFL 2WQRA 2O5YH 1WCBA 4O5LH 1T21A 3HI5L 3TVMA 3IJHA 2J6EA 4IMLB 5D8JL 5IMOA 2PXYB 1CDUA 4Y5XB 4XMLH 3QFJE 5DD1L 1BGXH 2J2ZA 4EDWH 1WT5C 2F5AL 3RWGA 3RIFF 3TNNB 3JVGA 2EE2A 1YEFL 4PG9A 1XGTA 1QA9A 3PWNB 3K8MA 1ZEAL 1C08B 1KIQA 1BWWA 2JKXA 2AEPH 2FLBT 5DD3L 4JFEB 1AQDA 1MREL 1HKFA 2BJML 1ZT7B 4QOKE 3V0VA 1E4WH 5JMRA 1TJIL 2DTMH 1HH6B 2CDFA 4ZOBA 4I3SL 4WNQA 1KJVB 3VFVA 5CEZE 1A6UL 1A7PH 3OKLB 4QT5A 5MENE 2DYPB 4J2XA 4FFYL 5F96L 3BD4A 4X83A 5L2KB 3PWUB 3Q6GL 4KJQD 3OX8B 4WTXA 2A9ML 1BQLL 4EI6A 4KJQC 3X14B 5FYJE 2F54D 3QDJA 3U4BH 4MHHI 1TENA 4HUMB 2X9XA 5EBLB 1N0XL 4HZAA 1DQLL 4LSSH 2AKRA 2EEBA 3ZT7A 5HHMD 2AJZB 4OQ1A 2IH3A 1LQSR 3ULVE 4U3XA 3D18B 4YK4B 3F8UB 2FIRT 1OAUL 3MGAA 4F8QA 3KPSE 5MEPB 1RK0A 1P7QB 1EV2E 3I85A 1EBAA 2EKJA 4P49A 2W9DL 5JXEC 3MCKB 3CMOL 4U33A 1MWAA 1RZ8A 1TQCC 3QHZL 3PQYE 2IANA 2FR4A 4WVRA 3KYOA 5ESVB 3RKPA 3S35L 1CTNA 4IS6A 3F7PC 2F19H 2MHAB 3QR2A 1ADQL 3ARGB 4XC3H 1CFQA 1AY1L 5IVNA 1RURL 4Z7OE 1ZLUH 4R0LA 5CBEB 2NY4D 3KAAA 4CAGA 5IUSA 1FCCA 5FB8A 2P5WD 5ERWB 5MERA 3OKOB 3A67L 3VXPA 3RHWK 2H32B 1KCLA 4S1RL 5C8JB 32C2B 3CFJA 4KK5C 2E7LC 4LASL 5F89B 1RMFL 1YQVL 1NFDE 4MQ7A 5KVEH 5D2LB 1U8NA 4Y5YB 4JDTL 2EIEA 2C3VA 1A1OB 4LMQI 4G6AD 3RUGF 1AD0A 3W0WA 2H6PB 3CFBB 5DT1H 2M8XA 3WFHA 2EDBA 3FN3A 5ADOH 2ATKB 2CLVB 4NN7C 4PJ5E 1YEJH 1E4KA 5E5RB 3L5JA 1D5IL 4N5UA 3OZ9H 3C6LA 1NFIA 5E8OB 5ANMB 1S7VA 3TJHD 4PJHA 1FO0B 2IALB 5TGBB 4YEEA 3S96A 1N6UA 3ULSB 3PHOB 3OKKB 2HN7B 3PDDA 3C6SB 4QXTB 1O7SA 4PREB 4CL7A 1MFAH 3RGVD 2HMID 3MRJB 4HG4K 1ITCA 1JFQL 3KYNB 4UAOB 3RGVC 2HMIC 5KZCB 4YFLF 4MNHA 4KAQH 4WRLA 2XIDA 3MRPB 3MV01 4RDQG 1LDPL 2FHCA 1A7RL 2EDNA 3VFMA 5DMGD 4NSKB 4UILL 3IDJB 4MA7H 1NAML 3HUJB 1TIUA 3U0WL 4IIQC 3VDBA 4MCYB 3CK0H 4NWUL 3T09A 2V7HA 4EXPX 3BP7B 3KNBB 1GJIA 4NKDA 5CZVH 1W2KT 4I2XE 1MHHA 4OT1L 1I8LA 1JTOA 2FBJH 1G7QB 1YNKL 3STZA 3DO3A 3LEYH 4Z9KB 1K6QH 2F74A 2Z4QA 4PJCF 3BGFC 4OZ4A 3V4UL 2B5IB 3EYUL 3V6OE 1DFBH 3HC0A 4U1IB 2EXYD 3L3DB 5EN2A 5C71A 5ITBH 2R23A 2EXYC 5EFIA 2NY7H 3RTQB 5FAAA 5E8DL 1FVEB 5JORA 4Q97A 1AQKH 4U6YB 1CXHA 5KVDH 5IQ7H 1FNSL 1QRNE 5J11B 2VC2H 3IETA 3VFTA 3ILPA 1DVFA 5D72H 2OBGA 4LVHB 3OAZK 4A6YH 4GKZB 2JJVA 4N8PA 1MCFA 4ZAKB 4YFEA 2XRAL 5I66B 4F9PA 1U8KB 5J12C 4NM4H 5JMOC 3LV3B 3QT2A 1JZ3A 1QFPA 3B2VH 2R4RL 4C56D 4NRYA 1AIFA 4XNYH 1A8JH 5EWIL 4LRIC 5DDHA 3BYYA 3W81A 2ADJB 4E41E 2ZPKL 3H6JA 1ZE3C 1NBYB 1KFAH 2AERT 1P4BL 3MCLH 1M6OA 4OIIL 1OGAE 2GTWA 3N1FC 3WO4C 3OKDA 3HA0A 3I50H 5I8KL 5INCA 1K8IA 3CCHB 1B6DA 3EYVB 4JFZL 3FTGB 3PXHA 4WUUE 4YHNA 5GGTA 4M1GL 4LU5L 4NO0B 4OLUH 4K23L 2YRZA 1MEXH 4PJXA 3MOQA 3MRDB 1P1ZB 1GGBL 1Y6MR 1B4JH 3DMMD 3MUY1 4YGVB 2R2EB 3DMMC 5DJAA 2BFVH 4HIJB 3S6CA 5IEHA 4TVSa 1IJ9A 1FDLL 3MJ9A 5C08E 5FGSA 3G04B 3IDMB 3FAXA 3OXSA 5C2BH 4DKDC 2V2TB 2BY0A 5HGHA 3V4VH 4XP1L 3O3DB 1MCQA 4EOWH 2DI7A 1NGWA 4DN3H 1WC7A 5C09A 3NH7L 4OF6A 3LD8B 5D1QA 1S7SB 4HJGB 3L5IA 1TVBB 5F7DA 4DQOL 2FATL 3VW3L 2H2PC 2VLME 5TDNB 2NY0B 3WJJA 3NCJL 2G75A 1YN7A 4DVRH 3JZ7A 4ODHH 5DYOA 1ORQA 1FRGL 4RFNC 5IW1B 3NFPB 3T77A 4Y5VA 2YPLE 3TC9A 3WDHA 2BNUB 4ZFOA 5DHVA 2Z35B 2R1XA 4L3EA 4I8DA 3GHBH 1YY8B 2GITB 4ZTPL 1ZWIA 5JIHA 3C8DA 2Q1EA 1G7MA 2J4WL 4NQCD 5T1DL 4Z7UF 2HA1A 1CGXA 1YMMB 3NZ8A 1P7HL 4JLRA 1X6NA 2V6HA 1JTTA 4PJ9D 1C7SA 3GDBA 4MXWH 5ESQA 5GGSA 4PJ9C 4PJEA 3SOBL 2IGFH 2OI9C 2RBLA 2ERJC 4PRPB 3MGOB 4O02H 3WUWG 3DXAA 2V2WA 2IG2L 1DEEB 1GC1H 2NXYB 1DLFL 4HLZG 2Y1VA 4G8GB 2QQQA 2D7NA 2VDRL 3KPOA 5F44A 3F5WB 5J1SC 4R90L 1WCQA 3AXLA 2JLLA 4TVPD 5SWZB 4MD5B 2CO6B 3Q1SL 4W68A 2C26A 2B1AH 1Q0XL 2VISA 3OAYK 1Z5LB 1UJTA 2J8HA 2I60H 1MVUB 3R06B 2OTUA 5HYSG 2R56H 3P4MB 3SKMB 2UZIH 1WT5A 3M8OL 3GKWH 3VRJB 1JHTB 3PWPB 3IU3A 2BNRE 5ICYA 1T2JA 2HFFB 1PFCA 1QBLL 3IFOA 1SBSH 5D8JH 1HINL 5J13C 1B2WL 1NANI 1FFPB 5DD1H 3TP4A 5ESAA 2JB5L 2XQYK 2F5AH 5SWSD 3ZKND 1YEFH 4NPYB 1KGCE 1UADC 4PB0L 1T04B 3CC5B 4HEME 2CR6A 5A1AA 1ZEAH 3QUMB 2Z91B 3CVHB 5DD3H 1UKSA 4GG8A 5HGDB 1MCHA 3NIDE 4PJHF 1MREH 4OJFL 2F54A 1TJIH 3LN5A 3ULUD 4YHPA 4I3SH 5C6PB 3VI3E 3F6LA 3ULUC 1A6UH 3IDXL 1BZ7B 1ZA3B 4JHZA 5LBSL 1BIIB 4FFYH 1ZHNA 1L4IA 4OZGF 4LKXA 2UZXB 3U9UA 5BJTB 2VDML 1GXEA 1OTTD 5JXEA 2HWZL 1S78D 2WZPD 5BV7B 4YFLI 3JWOC 1RJLA 3BGMA 2E6PA 1DQLH 4MAYB 3WUWA 1LWRA 1KTKE 3WO3B 2W92A 1TJHL 2XA8L 5J4MA 3IDYB 3GI9L 5DC0A 3VI4E 5FM5M 4N8CL 4P5KB 4UTBH 3K2UH 5E1AA 2W9DH 4YZFE 5IEKB 3CMOH 5TF0A 1T20A 5T3XD 5GGUA 3BT2H 3KPRB 5T1MB 2E9IA 3QHZH 4PTTA 1WFNA 2BC4A 2EEAA 1FFQA 2E7LA 5EZOH 4FOMA 2BOBA 1K8DA 1ADQH 2FNBA 4UTAL 1YDPB 5DRXA 5FK9A 1U95B 1KACB 4XAKD 1J0JA 1RURH 4GMTL 5IF0A 1CFSB 4GW4B 3CNKA 4KJWD 4D0BA 3KYAA 2FL5B 3H9SE 2AK4B 4N8VA 2BK8A 4DAGL 3QEQA 1VEPA 3A67H 3QUXD 4G8FB 4WU7B 1R5VA 2Z8SA 3QUXC 3NA4A 5I2IA 3G5XA 3MRGB 4J8RB 4JG0L 4HIIA 3VDCA 5I1KL 4GKNB 1RMFH 3EZJB 2UVFA 1L6XA 15C8H 4QRPD 1JPFB 1NGXB 3TA3B 1GYAA 5DJ2B 3QYCA 4N5ED 3CGTA 3L3KB 5ILTL 4EVNA 1UA6H 2OL3A 4PRIE 1BVLB 1R3IL 1D9KB 4X7TB 2X4OB 5A2KH 2X4PB 1KELL 1ZLWK 1U6AL 5LGJB 1H15A 1BOGA 2KUTA 3JV6A 3RGVA 1U8PB 2YS4A 5J6GB 2X4NB 5KW9L 1D5IH 5HVHC 1R3LB 4NQUA 4RDQF 2IPUK 5F9OH 3H7BA 3P9MB 1EO5A 1U3HD 4ENED 2EDYA 4MJ6A 3MRMA 4LSUH 2Y36L 3MO1A 4NN6B 4ENEC 3MUGA 1J10A 4WW1A 5ETUB 5IR1B 1IGIL 4IIQA 2LU3A 5DVMA 3EOAB 2JF1A 4R4ND 3U82B 5IHUL 1S7TB 4R4NC 1Y18A 1JFQH 1MAML 2WWMC 2AW2A 4DFHA 4XZUB 4MA1C 5C07D 2Q7YB 1H3PL 1EEUA 1FORL 5AD0A 4U1SB 3D2UD 4NWUH 1I8IB 3QIUD 5FGCB 4K7FA 2DLTA 3QIUC 2YEZB 2DLFL 2B7DT 1NMAL 1YNLL 3RNQB 1LO2H 1U91A 2NMSA 3L95B 5EZIL 3T0BA 4IOIB 4NC0B 1YNKH 1NGQL 1IM3A 5I17B 3K4ZA 4KC3B 4XH2B 1RK1A 1A1MA 3BN9D 3MLUH 2BVOB 3EYUH 1KJ2A 3ZYIA 2VRAA 4TRPH 1D5MA 4BK4A 1WFOA 3OKYA 2NW3A 3H42L 3WV0A 4UINL 5E8DH 3EHBD 3FOMA 3TT1L 2YOCA 4HWZA 4FQLL 4LRIA 1VB9A 1TITA 4C56A 3BVNB 4HIEB 5E4EB 3VD9A 2YD9A 1CIDA 3IFNH 3UTTE 4YBLC 4ONOA 1VGKB 1U3JA 3QIWB 3MV9E 2XRAH 2P24B 1FGVL 4Q6IC 2ZCKL 4G6FD 3INUH 2LE9A 1ORSA 4HPYH 3LKSB 1A7QL 3TFKC 3ZDYF 4D3CL 1J1OL 1FAIL 1OLLA 5I1DB 1I7UB 3DVGA 4ODBD 5EWIH 3DO7A 2PN5A 3RAJH 1T5XB 1T1ZB 2ZPKH 3FRUB 3DMMA 4GRLD 1NCCL 5HXMA 2AJSL 4Y19E 4OIIH 3SDCC 4GRLC 1M71A 4KK9D 5I8KH 4KK9C 4JFZH 5IMLA 1QLFB 4M1GH 4LU5H 3LB6C 4X8JB 3UJJL 4JFFD 1S7RB 5E94B 1I7RB 4K23H 2ARJB 2W1NA 2KKQA 2BCKB 1GGBH 4EKXA 4JKWA 3N50A 3HR5B 3IJSA 1T6VN 5FECB 3PP3H 3RU8H 1DCLA 3MJ9L 1MRCL 1MI5B 1V7ML 1C5BL 3H3PH 3RPIA 2A77L 1FDLH 3B83A 1AKJA 4FQ1H 3L3IA 1OAYL 4TULL 2VLKB 1K4DB 1T22A 4ELMA 4XP1H 5TQ0L 2BSTB 2SEBA 2OZ4L 4NQCA 4FZ8L 3J7HA 2FATH 3VW3H 4XPFL 1ZXQA 3D5OF 1HXMB 1KG0B 5IB3A 3OHXB 3GMLB 3HE6D 1FRGH 3HE6C 4P2QA 4PJ9A 1HK6A 4OLEA 3RVVD 2L7JA 3MREB 3BJ91 4CDHA 3RVVC 2GAZB 2D3VA 5CIPA 2NXZB 2J4WH 2O93L 1JF6A 5L9DL 3T4AB 1I8KB 2B20A 5T1DH 3T0EB 4LL9A 3PIQA 2AV7B 2E27L 4YHYC 4L4VE 3RVXD 1N8ZA 2QQLH 4YQXH 2WBJB 5HYJE 3RWIB 3SOBH 2ADGA 1KC5L