2COVD

Crystal structure of cbm31 from beta-1,3-xylanase
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
92
structure length
92
Chain Sequence
PPENCQDDFNFNYVSDQEIEVYHVDKGWSAGWNYVCLNDYCLPGNKSNGAFRKTFNAVLGQDYKLTFKVEDRYGQGQQILDRNITFTTQVCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Sugar binding protein
molecule keywords beta-1,3-xylanase
publication title The first crystal structure of a family 31 carbohydrate-binding module with affinity to beta-1,3-xylan
pubmed doi rcsb
source organism Alcaligenes sp.
total genus 23
structure length 92
sequence length 92
chains with identical sequence E, F, G, H, I
ec nomenclature ec 3.2.1.32: Endo-1,3-beta-xylanase.
pdb deposition date 2005-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF11606 AlcCBM31 Family 31 carbohydrate binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2450 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2covD00
2COVD
chains in the Genus database with same CATH superfamily
2ZE0A 3TYGL 5AL8A 4KXAA 1UKTA 2KZKA 1L9PA 5CD5D 3IETA 4HIXH 2FWOA 1ZHKA 3ZUNC 3KYNA 2DJ4A 3X14B 3MRPB 1OAUL 4QHKI 5EBWA 4XMTA 4G5ZH 3W9EB 3WFHA 4NQCE 5JPMB 1NLBH 3WTUA 3TJEL 4WW1B 3UH8A 4TSAH 5DHXB 5E4AA 4I48A 4KVCH 2M2DA 5JOFB 2CCVA 3K2KA 4S1RL 2FEEL 5GRUH 3LKRA 1OT4A 3DOSB 1TZAA 4NDMA 3VTAA 3OZ9H 3CFEB 3VDCA 3ZYJA 1FFOA 1DDHB 1CDYA 5I1HH 1I82A 2PCFB 2E9IA 2O5NA 4AY0A 3N1GC 3NT0A 4XP5H 1ID2A 2DM4A 3EAKA 3NRQA 1PIGA 1KGCD 4JY4A 5EU6A 4P05A 2BSEA 5EBLA 4YHKH 3LRHA 1GH7A 3V0AC 4TPRH 3G6JE 2CD0A 4JGMA 2W9EL 3UP6A 3KNBB 5D5MF 2WINB 3WLBB 3WSQH 3P4MB 3KGRA 3RY6C 3G9AB 3ILDA 4HIIA 3TPKA 4LCCC 1ILUA 2VZVA 2WIIA 3KM2A 4Y9FA 4DGUA 4AH2B 5DCCA 4M1GL 4HJGB 3APCA 2CG9X 3ZT7A 4U1NA 4ZXBB 4PJ5B 1SVZA 3BAKA 3HW7A 4K3DL 4Z76B 3MXVH 2B1AH 3T4AA 2VDQH 2WLKA 2D3JA 3NOIA 3NRPA 4JE0A 1E42A 1JPEA 3DIDA 4PJEF 3VFTA 4MXVF 1P0SE 1DO5A 4HKZB 2YO3A 3K8MA 1TYJA 3T1FB 3LDBC 4ADIA 3BGFB 4P9HC 2F7OA 3MXWL 5CP3H 3X1GA 3EYFB 4UOW0 3WV0A 3S0PA 3QZMA 4MJ5B 3R7QA 5HD8C 1CTNA 4TL5A 2BOLA 1CB4A 2XKNA 3O4LD 1J9TA 2J6EH 2I5YL 3N6YA 4ZT1A 3ZQXA 1XH2A 4OQTL 4OIBA 3ULVH 3GI9H 4XPTL 5ABAA 4I18B 2XHNA 1F00I 2FIKA 1D3CA 2J8UB 2JKRM 5FOJA 3DO7A 3GSQA 4N2KA 1ETJA 4WI6A 5I0DA 3TTSA 2FATH 1YEEL 2H0FA 1LE5B 5F7FA 3FB5A 3VI3A 2FZ3B 3TGXA 4MCZA 2CRYA 4HG4K 1XH3B 3T65B 1B0IA 1DVTA 4J6RH 2WMPA 2CK0L 1CGTA 4UT7H 5BZDB 1UD3A 5E2UL 1NCAL 3REWA 2X1XR 4D9LL 5DMGC 4I1RA 2QV2A 3VGAC 1D5MA 3QDGA 4F7CB 1E27A 4XCFH 2WLLB 4S1QH 3WJMB 2Y7QB 1WFOA 4Y19E 3RUGA 4M00A 4DN3L 1FYTA 2AI0L 1ADQL 5GISL 1TR7A 2FAUA 1AXTL 4U2ZA 4A39A 3O6KH 1RUMH 3QUML 4F9LC 4XP6H 4PJBA 1BOGA 2R7EA 4X9HA 2QTEA 5D72L 4MS8C 5CS7A 4KNTA 2N0KA 2COVD 3FTSA 1UCTA 5EZLB 1DJHA 2VL4A 3DDGA 4MMZA 5I6OA 1UACL 3OJVC 3V0FA 1YN6B 5ECJE 2Q87A 5IM7A 2OMXA 4LOFA 1PZBA 2WP3O 1FDLH 5LWYH 4OSUH 2EYSB 1BW8A 2ZSVB 1JVLA 1X5HA 3GTTA 4PJ7F 4IOIA 1SN0A 1W0WB 3LMJL 1RURL 3VAEA 1FE8H 2CBMA 1N0LB 3QIWB 5IBUB 5DQ9A 3M1OA 4I5BA 4LIQH 5E2WL 1YYMH 4BBWA 3LKNA 4F57L 2VDMB 4WHDA 1A0QL 2Y22A 3ZHDA 1UVQB 3ARBC 1MFVA 2HCZX 4K23H 3WJJC 4D0CB 4P2RE 1AO7A 4EIUA 4LL1A 1XT5A 2N4IA 3WS3A 5D1XB 3TBSB 4N86A 5L7XH 5DC0A 5HGAB 1NGWB 1UWEH 2O5ZL 1YEGL 4N3TA 4IBYA 3TH4T 4V1DA 4QXGL 3ZY7A 2P46B 3FF8A 4UAOB 3WIAA 3TN0B 1NAMH 3V6OC 1WC7A 2YGNA 4E5XA 4HPHA 3EFDL 1F3DH 3T8XB 2A77L 4YXLL 4P3CH 1S78C 1MCWM 1FSKC 3X1NA 4LEBA 4KJPD 3HZVB 1HXKA 1QEWB 4X5QA 1NCBL 2VXTL 3KJ6L 2X89A 3EH2A 3BC9A 1G7IB 4X8XA 4PY8J 1K85A 4TSCH 1R3JB 2R2CA 5J56B 4X6DB 4QXTB 5KYXB 4NGHH 3U30B 1GIGL 3QUXB 2DBLL 2YGQA 1U95B 1XH1A 3QEQB 1CLVA 2G4GA 2OLDA 4J27A 4M1CC 5I1AA 5IW6B 3GSNH 4JO8A 1E40A 3SY0B 5CUSH 4PS8A 3VA6A 1UHVA 4NQDE 1PVHA 2MIZA 1C5DA 4XPAL 4G1EB 1GPOH 4PCSA 2A6JA 2H32B 2Y36H 4XZUA 3RX5A 2IBGA 2VJ8A 5FYJH 2DY2A 5KBLA 2BVTA 4L3ED 5FV1L 5FUCC 4X5WA 4ZMWA 4BH8A 5AYUH 1ZA3B 4M5YH 2Q6WB 1JYWA 1XCWA 2VW7A 4E36A 1MHCA 3ZBMA 3AQDA 3AUWB 3OG6B 2OQJB 1BBJB 3B3IA 2OI9B 1S7QA 3D2UD 1N59A 3GLZA 3MRIA 4KVPA 4OD2A 4XN5A 5DRNB 4H88H 1AGFA 2ZNXA 3HI5L 4MQ7B 2QZ5A 3NRFA 2MCG1 3IDUA 3KPRD 4GOSA 3QDJD 3HNVL 1WA1X 1TKWB 2JV6A 2VDQB 1CFVH 3HCVB 4Z7OB 3ARSA 3VD2A 2QVIA 3FBQA 4XAKD 3SGDI 1BQHA 4ICXA 5KSVA 3BDYH 4LPWA 4U0RB 5KSAA 1OM3H 4N0CD 2MCPH 4BFGA 2XQBH 4AEEA 2NY2C 2XCMC 2E9WA 4HKXA 1N10A 4ZO9A 4YSEA 5I71B 2KLTA 4LKXB 5I1IL 3WIFA 4Y16B 3QUHA 1SN2A 4DK3A 5K9JH 5B8CC 4RZCB 2HVJA 1KJMB 2EDRA 1RH8A 2YZ1A 4Q6IA 4BZ1H 3IMVA 3R8QA 2E0PA 2WNXA 1A3RH 1GS6X 1UH4A 2FUTA 1WZMA 2Y06L 3QUYB 1NM9A 4OZGE 2WWMC 1QUPA 4Z7QE 1JDAA 4XCCH 2OJEA 4L2LA 1JIBA 3SJVE 2VR5A 4GKSA 3EOBA 5BS0D 3J27A 4JO3L 4C57C 5FDWA 4HIQA 2QBWA 1PNDA 2ADJA 3ALPA 1F13A 3FO0L 1DBMH 2DL9A 3KD4A 2NXYC 3LH9A 2ED9A 4ZO6A 2ICWA 2FJGA 3ZDXF 3KS0H 1KELH 4KI5C 2F53A 4AMKH 1JRHI 1RUQL 4N2DA 3AWEA 1FFTB 1KGIA 2GABA 1JSYA 2X4UB 4ZFOA 5C0EB 1ONQA 3RL1B 2FQFA 3WLWC 2NY5L 4BRJA 5EULV 4JFDD 3NA9H 4EUPH 1UCBL 3V7MA 1N19A 1AHWA 1NTDA 3ZQ9A 1CWVA 1THAA 3AU0A 4P5TD 5CR8A 1ZV9A 4KY1H 2C3HA 2D2CC 4L5FL 5B38G 3BESR 3HG4A 3O6FA 4LSSH 1II4E 2ATKA 5CCKH 1NINA 2VDRL 1U3HA 1NOLA 3UIZA 4QD2E 3L1OL 1ADQA 2IPUG 1GMIA 3MLUL 3P77A 3NP4A 2E7MA 4GMSL 2R83A 3R06B 2X7LA 5DSCB 3CZFB 3LTVA 1WA2X 3MLYH 5FHAH 3NCFB 2EVFA 5I82A 4MRBA 2CJTA 1DP0A 4JG0H 5HHOB 4OLZH 4UYPA 4ZFZB 3CFKA 4IRSD 4PN6A 2VLRA 5CLWA 4U1GB 1A9BA 4JPIA 5HVFB 2QELA 1P7KA 4JFEA 4NQEE 2HTLD 1GZQA 2EILB 2GC7C 3B9KC 2X3AA 1R4XA 3QEHB 3UDWA 1G7HA 3RVTD 4WTZA 4LVEA 5D2NB 3BUIA 2IAMC 3MGTA 4NM8H 5CZKA 5FECB 3LS5H 3MSPA 1R0AH 4PJHF 2K8QA 1IEBA 4JN2A 5JMOC 2ETWA 4HCIA 4KC3B 3VXOA 4V33A 4GQZA 3WIHL 2APTA 4ZQTA 4MJIA 3D39E 2WCSA 1ZT1A 1NAMB 4JFZH 4Z7UA 4HEME 4UT9A 1TQUA 3C60B 3N41F 4P5MA 3LXBA 3ZO9A 3P02A 5T3XE 5E2JA 4K8RL 1EGJL 2VXQL 1AGDB 2WQWA 3GDCA 5E03A 5EUKA 5FYLH 3CDYA 3CH1B 1CS6A 1QNIA 1XWVA 2UYLB 2ITDA 3U9PL 4DP4X 1A4BA 4ZOAA 2A9BA 5DJAA 3MLZL 1T4WA 3V0IA 3MNVA 3HZKA 3K4ZA 3VTTA 3MC0A 1ASOA 7TAAA 2X2YA 4G71B 3O3EB 5C0DB 3GSNB 5KN5B 5KANI 1G7MB 5AZEH 1QD0A 2NX5A 1D7CA 5SX5H 2WAQA 3PXHA 5F9WB 2X4PB 1FNGA 3LRGA 3FRUB 7FABL 3DTXA 3RFZB 4KV5E 3ROLB 2GG1A 3N06B 2VWEE 2YEVB 4QIRA 3WFEL 4C58B 2EVIA 1BBDH 3EYVA 1B3IA 3QORC 2FR4A 3WKPA 2DKUA 3IMUA 5EOQL 3ES6B 1KTDB 1EDHA 2VR3A 3VJ6A 1TNNA 3DJTA 3VFGH 4Y5YB 3GO1L 2F18A 3OWRA 3U4KA 5JA9A 3ZMRA 5JNYA 1I9RH 1JXJA 1XR9B 2F54B 3V0WH 5I6MA 1OQXA 3V9FA 2YPLB 4APQB 4NNXB 4FA6A 1GXEA 3RVUD 2AEPH 3TC9A 1C08B 2N0MA 5KSUB 3GMPA 3H1ZA 3SGKA 3CTTA 1B4JL 4NUQA 1OB1B 2BIOA 5K59E 2AJYL 5IMOA 4Q2ZA 2XWBB 1IFRA 4HEPG 1TJGL 2H6UA 4YSTA 5LG6A 3T5WA 4QNPF 8PAZA 4U6HA 5C0RL 4ISVB 3SD5A 4ODTL 2P7TB 4TQIA 4LZKA 4HETA 5D7LA 2YPLE 1UJ3C 2WUCH 4PRIA 4ETQB 1S7VB 3MKGA 3BAYA 5E1GA 3ZKXC 3X3GH 1KTLA 5J1AB 2DWEA 2VXVH 4KK6C 1OP3H 2ADYA 4NBZB 2WXNA 4RWYL 4KXDA 1JWSA 1YG9A 3S34L 5F3BB 4QHNA 4PJIB 3L9RB 1MJUH 2YD8A 3FZUC 4X4XB 5IQNA 2N7SA 4P2QA 4B97A 4KJWD 3ULAB 3L1FA 1RJLB 2XRAL 3QI9A 5KVEE 1O5PA 4Z7IA 3IU3A 4L8DA 3WI9A 4M4PA 5SWZD 1VCBC 2NXZB 1BZ9A 3CFBB 3KYKL 3F7PC 2WKGA 1L9TA 4DQOL 1GKOA 5FGBA 5J4MA 2ADGB 4FNSA 3WL9B 1FAIL 2AW2A 4EUPB 4PRBB 3LZFL 5F0PB 1KIQB 4MA7H 3MUUA 3T3MB 5HGBA 5AALA 3TT1H 1QWUA 4XN9A 2HFFA 3IPFA 3SKUD 3AABA 3MRNA 1RPQA 1ZWIB 1AIFB 4ZSOA 4AG4H 1V3MA 3P9MA 2X9YA 3WGUB 2NY1B 1OAZH 4HZLA 4XX1G 2VAAB 1CXLA 5F1NB 4RAUA 1XTLA 4Z3EA 4NUGH 1DZ0A 5DJ6B 2UY7A 1LO4H 2RQEA 1MFDL 4UUJB 5FM4A 4ZZKA 2DH3A 3T3ME 2BSSB 5JW5A 3CDZB 1ZE3H 3IJ9A 5ANMA 2H7WA 3DURA 1JK9B 4RX4D 2OK0L 3SE9L 4J3TA 3IDGB 4NQUA 3GT6A 5CSZA 4CNIB 4YHZL 3FAXA 5DWUL 4RGNC 1NGZB 3UEZA 2HKHL 4ZX4A 1OE3A 4U6TA 5CBAB 3MV9E 4YDIL 5PAZA 4ZUVA 4MZ2A 4QRSA 4ZTOH 4JLRA 3GRWL 3ULSA 5DD5H 3PQYA 5FYKL 1Z3GH 1DJIA 1NLDH 1P1ZB 4OCRH 1AXSA 4QTFA 4HMCA 3HC0A 1OHQA 5FUCE 5I5JA 5JYLA 1KWKA 3LVEA 2ZCHL 2KQMA 3PY9A 5F1KC 5ISZB 3GZOA 3BFOA 4FQXC 4ZDHA 5DRXB 2OX5B 4Y2NA 2VH5H 1B6UA 5AB2A 5I2IB 4UF7C 1X5LA 1N8OE 2J8HA 3HNTH 2V2WB 3MOAL 3OD3A 4C56D 2BM3A 1KN2L 3BT2H 3ZL2A 3EO1A 3DWTA 2D8KA 3D4ZA 3WIHA 3O4OB 4X6CE 2RTTA 5ACZA 1B9KA 4S0HA 3DMMD 4Q56A 3SPVB 1M7XA 2X4NA 4XNYH 3A0OA 2DQCH 1MCOH 4J3VA 3Q2CA 3IDYC 1F58H 1QFWI 2WJ5A 1EGJA 1X44A 5D8JL 2ZG3A 4C47A 4XVTL 3FULA 1PGRB 1CL7H 4RCAA 5IF0A 3GMRB 3WU1A 2B7DT 2LFEA 1AZBA 3FUKA 4MBRA 1CYXA 2Y25A 4I4WA 2Z93A 3BWUF 2OL3A 4J4PD 4OZHA 3S36L 3WCYA 2EIEA 3S3DB 3UMNA 2E7CA 4LFHD 2H3XC 3P4OA 3EDJA 3WDHA 4JMNA 3M17A 3ASOB 4H0IA 2W38A 5DQDL 2MKLC 4JM2A 5EN2B 5L2JA 3FUJA 1TFPA 1ULVA 3LN5A 2NW3A 1MWAA 1JZDC 3UBXB 4AV5A 4JFFD 3KPMB 4XP1L 4XN1A 3WE1A 3FQRB 6FABH 1WHPA 2WD0A 4LQFL 2PXYC 2WXOA 5I73B 5FLVA 5EU5B 1OTTD 2ZYHA 4LCWD 2YFOA 2HX7A 3RZCB 4L37B 3MRGB 3U48A 2X09A 1BYOA 3RGBA 1JNLL 2HFEA 3EH5B 4WWKC 3NJIA 3X3FL 3C2SA 1Q90A 4PSRA 3CPLB 1DEEA 4PV1C 4FI6A 3DV6A 2XX0A 4CSPA 2H2PC 3I84A 4OCSL 3EBIA 4R0LA 3K4DA 4F20A 1RK0B 2JJTC 5SV4A 4Z7WA 4MZRA 5H35A 3L4XA 3FHEA 3H4HA 4QRBA 4I13B 4UZUA 3WD5L 2H2SC 4IIQC 4U33A 3D3VB 4RISH 4LGSB 3HFMH 3I9PA 3CAFA 4WK0B 5IUCA 4Z0BL 4G7SB 3VWJC 2V7NA 1EHLL 4UCFA 2AABL 1HILA 1EQWA 3AT9A 2L7EA 4J3OF 3BH8B 1RMFL 5C6WH 5KEZA 3BVDB 3IKCA 4ZS7H 2HN7A 3TJHC 2F5AL 4HCRL 3LIUA 2F15A 5IW1B 2GTWA 1GZHA 3FO9B 3QNXA 4MNQB 3TO4B 4ZMLA 3ARVA 3I75B 3IAPA 1VENA 2EIKB 5F6HI 2AK4D 1OP9A 4OD3L 2O5XL 1GYVA 1JRHL 3B7YA 2YPVA 5F9DC 4KJYB 1V10A 4ODXA 2DM7A 5D5MB 2IANE 4MMZC 3PHOB 4R90H 3OAYH 1N67A 1N3NB 4HIJA 4LNVA 1DBAH 1I1YA 4LCYB 5IVXB 4WAFA 3ROOA 3HR5B 4G7RB 3QDMB 1EO5A 4W1TA 4FQHB 3UZEC 3ABMB 2J8OA 3ZTEA 1FNHA 2P8LB 4U6VL 5GGSY 5TQ2H 5AOLA 1VEPA 2EADA 4DIXA 5F21B 1KJ2A 2KLSA 3OXRB 3QXDB 1U8OB 1IT9L 2FWUA 2J4WL 4R7NB 1SVCP 5CJQH 2EUVA 3QA3A 4D9QE 4IU2A 5D5ME 4PJEB 1WQVT 1DN2A 1R3LB 2FVNA 3MLXL 1EXUB 2X4RA 4ERSL 2ZSWB 5HYEA 4Z8FL 3MRKA 3O4LA 1F3JB 5IB2A 3L7FB 3APMA 2IXQA 4J3XA 3HC3H 3QDME 1PYWA 4YH6A 1KBBA 1RUKH 1E2VA 2EH7L 4PU2A 2OTUB 4X9GA 5BQ7B 5C0FA 4N2GA 4JR9L 4JM0A 2VDNL 1RZFH 1RIVH 1V7NL 3IS0X 4JY5H 4WGWB 2MNJB 2IDQA 4XOBA 5CBEB 1F0LA 4OTXL 3SD2A 3QCTH 4JQXC 4PJEE 5CEXA 4MXVE 3LB6C 3P3UA 3U7WL 1EMTL 4RBPK 3VDAA 4BE6A 2Q2LA 2R9HD 1BREA 3FPYA 4MB5A 4K7FA 4Y1AD 1XF2A 1E0OB 1VA9A 1L6ZA 4KRPC 3VG9B 5A16B 4M6OH 1IM3B 3WTSA 3TCLB 3NABH 2WBJD 4YHML 5K9OA 2ED6A 3OKEA 4JB9L 3DX3A 5HYQB 1HXMB 5D1QB 3GTNA 1VFUA 1NIEA 3QG6A 2E7HA 2Y0SA 3K81A 1EHAA 1K4CA 4H20L 5E5RB 3BIKA 3LEXB 3PJLA 5AW7B 3Q06A 5AAPA 4H25B 1WZAA 1KTKE 4JPQA 1M6UA 3RGVD 1CU4H 1SUHA 3DGGB 4ZTPL 2DIAA 3CD4A 2BSCA 2HFGH 2D7TH 1E6OL 3TM6A 2AVFA 1IM9B 1MJ7L 1SMOA 3HMWL 2EDJA 5C0CE 4E42B 1NGXB 3CPUA 4ONGL 2FB4L 2HX9A 4QTIH 5HGHB 1KY6A 4TNVK 5AOMA 4Z7VA 3RQ3A 2PWEA 4JQIL 4U1KA 5GRXG 4PTUA 4WJ5A 5A40E 4HS3A 3OLGA 2EP6A 1A1NB 1KLGA 4ZMTA 4PJ7B 1D9KD 3SODB 3PV6B 4KVNH 1PDKA 3DX4A 5EOTB 5FOBA 5J12B 5KSAC 3L95B 4QXWA 4OM1L 1XF5A 1DSFL 5DRZA 1Q9WB 4LSVH 3A6CH 1MH5A 3LKOB 4XBGB 3NIFB 4H26A 4ANVA 1O6SB 2Z35A 3S3BB 1ACCA 4MX7A 1ORQA 4NJ9H 5EPMB 3EJZC 4Z7NF 1OAXL 2OPCA 1BVNP 2FWSA 4K9EC 5FO8A 5D2LB 3EDKA 4JQVC 5F9JB 2YSSB 3VFUA 4Z1PA 2Z8RA 2ZYSA 3SKJH 3VI4A 1WVZA 5T1LB 1JAEA 3V0VA 3CDFA 2DWDB 4PJ7E 5EZIL 5D7JD 3DX1A 3JXAA 3K8KA 4NC1E 4Q0XL 4M6NH 1R24A 5DQJB 4NO3B 1F4WL 4LAJH 2GW5A 1UWXH 1JGDB 1OGAE 3M1BA 5EO9B 4J3SA 4Y5XB 4IRZL 4UQ3B 4G7VL 4UV7H 2C9XA 3Q7JA 3KWXA 2JSFA 5ABDE 3OR7A 5I18H 3CU7A 4PJFA 2XFXB 4WKZA 2RJMA 3UAJD 2Z34A 2JI3A 3ZJAA 4KMTH 3DX9B 1USZA 4JJ5A 2JKSA 2P43B 2XSKA 3S3PA 2EO1A 4I87A 1IJNA 4YC2B 2H26B 1SJHB 4LSPH 4EI6B 2WVTA 3EGXB 2LVEA 1IC1A 4N0UB 4XB7A 2JKIS 5D7EA 4JKLA 4Y2LA 5DJXA 4G6KL 3SDYH 4PGEA 2ZOLA 3KHQA 2OP4H 1WBZA 1UJTA 1WK0A 3S97C 5KS9A 1B0RB 1CE1L 1RZJC 2CBQA 1SHMA 2DWXA 2DWTA 3KZ8A 1TQVA 5I1EH 2C3VB 2YIHA 4IHBA 5JQIB 4L3EA 1ZHLA 3O6FC 1PCSA 5KAQG 1SOQA 1N0XH 4NOBA 2R23A 3NIDF 4MB1A 1U3HC 3CZUB 5CILH 3FUHA 1J11A 1RJYA 5KVMC 3D2UA 4RNRA 2Z4QA 3P9LB 2R8SH 4HJJL 5G2NA 1VRSA 1UEYA 2WWNA 3OVUB 3WNMA 3VFOA 1MJJA 3MGOB 5FM8A 1QNZH 1Z9LA 2Q8BL 3KPRA 4B9PA 3QDJA 1BD2D 3LH2L 4CJ1A 2APVA 2J44A 2XKSA 4FGMA 4LVHB 2NY7H 4XO3A 1TTBA 3TNNB 1EHXA 4PVNA 2X12A 1TVHA 2VMJA 3M7OA 4YNYB 5EO1B 4AKPA 1AQKH 2DQHL 2GK0A 5EBGA 3UDWC 1BG9A 3PGDA 5DVKA 4R2GB 5HGDA 3A4AA 1QLRA 1J18A 4WCYL 3IU4L 3NEEA 2G5RA 3IMWA 4UZSA 5D1ZD 4XXDA 4JKKA 3UTZA 4HLZG 4P3WA 5EF3A 4M5ZH 1QI5A 3LAFA 2XXGA 4Y89A 3RDJA 2ZKHL 1Z9MA 4PJDF 5CJOL 5FFLA 2V3FA 1OK8A 1WITA 2EDWA 3WXVL 3OV6A 4OF8A 5IHUH 3GMNA 4Y9GA 1KENL 5K9QG 5F9AC 4DFHA 1CGUA 5BS0A 5GS1A 3IWUA 5I1DB 5I15L 1LTXA 2M83A 5CLTA 1I1AC 1ZTXE 2PWFA 5EOCL 5HYJE 4Q9CA 4OI7A 5ERWB 4JCLA 4ZS6D 1DQML 2XDHA 2AEIT 1A7NL 5IESH 3KDMB 1CE6B 3D25A 3L6FB 3MJWA 1HL4A 2OMWB 2QVTA 3EO9L 4WTQA 5DD3H 3UTSE 3N9GH 3BJLA 5LQBH 3BWUC 4N2NA 4HUWB 5KVFH 4JFDA 4GO6B 1FQ9C 1D5RA 1IE5A 2D2OA 4W9GC 3VFRA 5BZWA 1I4FB 1ITBB 2HG5B 2GPZA 4P5TA 3K6SA 3AW5A 1KNOA 4JFUA 3H42H 4PGBA 1QFWL 3NK4A 4HUVB 3MO1A 3ARDD 3SEPA 1HL8A 3ARFB 4TVPE 3CVHH 4MA3A 5D1ZI 2YAQA 1C5BH 4MWFA 5D55A 3PDOA 3CFMA 4HBCL 3ZDXE 1QR4A 3ZVVA 1FVEA 1XGTA 4XNBA 4PRHE 1X9RA 1EEZB 4LARL 5L6YH 2AGJH 5LGKA 1H0DA 4U6XB 1YEJH 2APWA 5KJ7E 5C8JA 1LEIB 2L8AA 1JZJA 1MG3C 1UXWB 3I6LD 4M6MH 5FUZL 3SGKC 4PRPD 4IRSA 1QATA 5DS1A 3VMPA 2YKKA 1OWWA 1JYVA 2CKNA 5SX4I 1ML0A 1A1OA 4G7YH 1IAKA 3WEBA 5CM1A 4XPFH 1H3UA 5EU7E 2AXGA 4YLQT 3VD9A 4KUCD 3IE4A 3GSVB 4X0KB 2NY6C 2VQ1B 2C1OA 2FDBP 4AYDC 2FSEA 3V8OA 1GGUA 1QO3B 4W9EC 5T1MB 3LRSB 3QJQB 1H5BB 3L4VA 3INUH 2AMUA 5DFWH 5TK2A 4E9RA 3DRTA 4DK5A 3EOAA 4G5ZL 1E9OA 1NLBL 1XF1A 1QMUA 4EI5D 5KVDE 1IILE 3HG1B 1SF3A 2CO6B 3AQZA 4KVCL 4UIMA 2TRYA 4OVVA 2BNQB 2JWYA 3JV6B 5F7NC 1HSAB 3EYQC 4HJIA 5B7MA 5I9QC 5GRUL 3GBNL 5AKRA 3CK0H 4J3OC 1IL1A 3MROA 1CD0A 3OZ9L 4NN5C 1BFOA 3KPPA 3V7AE 5I1HL 1N68A 5DUPH 1EEQA 3L5HA 3N41B 2EVHA 4PY7A 4L8BA 1TCRA 3KH3A 5MEOB 3BUPA 1P5VB 3TZVC 2R69A 1Y6KR 4TPRL 3VXNA 3CFJA 3MLSH 4ZI8A 1OD9A 2H6OA 3AROA 1KT2A 5LBSH 3VFVB 1H6FA 1J10A 4GMTH 3POCA 4PJHE 1RZIB 4JANB 5IJDC 3WSQL 4IK7A 5KTEH 4J8RA 3TYFB 1OL0A 3JTTB 4N0FB 1T5KA 4W81A 1UD5A 4BFIB 2ZT9C 3CX2A 5CFHA 4F7KA 2WKOF 2WQVA 5IWLA 4PJ6A 3ULUF 4N0YL 4I1NB 4L4JA 3B9AA 4X7TB 2YK1H 1VEOA 1NDMA 2R27A 3U1SH 2XXMB 2P5WA 5CMAA 3FB7A 5AAWA 2AV7A 2VMEA 1A6WH 4X8GA 2DKSA 2UWEA 1JERA 4NLHA 4LT7A 5E1QA 4BWTA 2XQ0A 2YUVA 5C0JA 2DJMA 3KR3H 5FO7B 4AJWA 3QEGH 5I23A 3LZPA 4AVJA 4XR8C 1E2WA 4PG9B 2COQA 4GS7C 1ETA1 2EC8A 2PLTA 1MVYA 2DF3A 3MX0A 3PDGA 1T20B 4PP1D 2YZ8A 1T3FB 2PETA 4MCNA 2H1LM 4OI8A 4WLCA 4WHYG 3N42B 3D52A 4E9XA 4HIHA 2J6EL 4FAAB 3N44F 3HKZA 1Z2KA 1I1FA 5C0GA 1HFUA 4TLSA 5TE6H 3RKDD 3UBHA 3ULVL 3GI9L 4KKZA 1XMWA 1MLBA 2ZF8A 3IDJA 2WSPA 3TEZA 5C09B 1GGTA 2ZIDA 1BSIA 1NOFA 3BZ4A 3MN8A 4HYTB 2VLJD 3TA3C 2FATL 2HH0H 3ATAA 3EJCA 2DYRB 2OYMA 4MMYB 4XT1C 4LLYA 4KQ3H 4OIAA 1EIBA 4AEIH 3GS4A 5HDOA 1BLNB 2AXWA 1S9WA 1R33A 2JI1A 3C09B 1UT1A 2LGNA 4DZBA 5IMMB 2CDGB 1C7SA 1RHFA 5E8EA 3F5WA 3S96A 2I9LB 3AM8C 5DS8B 2FGWH 4GYBA 4QNPE 1CBJA 1YECH 4UOZA 3LRLA 2Z1PA 4XCFL 4FFVD 4ZW8A 1BX2A 5C09E 4XE0A 4N1CA 4DW2L 5SWZA 4A37A 3OF6D 3QFDA 4U1LB 4BSJA 2EYTA 3QUZB 4YGAB 1U8HB 3O6KL 1RUML 1U2CA 2V33A 4XP6L 1ZGLM 1VFAB 1YNTF 2RD0A 4JDVA 2FBOJ 4UTBL 1FFRA 3F12A 1WUNT 4ZFGH 5CEZE 4O02A 3UG3A 5CKAA 3MJ7A 4FYSA 2AANA 3D08A 5GGQL 1YEDB 1MVUB 1K5NA 3ZTDC 1CGVA 4X50A 3FC8A 4MJ4A 5CN2A 3CVHB 5LWYL 4OSUL 2LVCA 1JHTA 1HHHA 3EYSH 4YIQA 3SYAA 3FRPG 5JORA 4GP8B 2JCCF 5DO2C 3UTTB 3IS1X 3MLPA 1H9VA 3IKKA 1NC4D 4FJYA 1HJBC 5FWQA 2J7LA 1NPNA 4Q8BA 4HWNA 4A7QA 2NUTB 4IKNA 1YYML 2OA9A 4QRPB 1CICD 3HS0A 3PHSA 5JHLA 4OLVH 4NO0B 1JK8A 4ZODA 1UZ8B 3H2WA 1EFXD 1JZFA 4RX4A 3L3DB 2AEWA 4K23L 1INQB 3ESMA 4S10A 1ZS8A 1UUNA 3EUUA 4JAMA 4PJXB 3SYPA 4YMPA 3GMLB 4KTGA 2AQQA 5L7XL 5GGTH 3QEUB 4QEGA 2WVSA 1ACXA 2R4RL 2VSKB 4Y0GA 1NAML 3G08B 3ESPA 5CFAA 2BVPA 3MJ9H 1K3IA 3FOMB 4ODUA 2CHZA 1M2VA 2CRIA 3E9UA 1FL5A 2OW6A 3SBPA 4E5XG 1CFQB 4C56A 4I85A 5T3ZE 1E28A 5GS0H 4KKPA 1YPZB 4IBUA 4F24A 1D5ZA 1AQMA 4HIPA 4K9JA 2UY6B 2HJLA 3D5OF 3GSNL 3DMMA 3PWVB 3FU8A 2GBAA 4UMSA 4NRYB 1ZEAH 5I24A 3QJSB 2FCBA 1C12A 5C07D 1PD6A 2CIKA 1MFUA 3UZVA 4AIXA 1AGBA 3ETBJ 4FMFA 1C8QA 1PY0A 4NZRH 4F7EA 2ZPKH 3O2WH 2C1PA 4M6AA 3UPCA 4J1UB 2YJLA 1KFAL 4R3SB 1FGVH 5AYUL 4J4PA 2X44D 2HYMA 4M5YL 5D70L 4G8GD 1L9RA 2HVBA 5EIVA 4ZAKC 3QYCA 5HDLA 3IDXH 4FQLH 4U1SA 1I85C 4MNGA 4YDLC 4JPWH 3QSKB 2CQVA 5JXEC 4E9QA 4DGVH 2K70A 4QRQB 4FP8H 5JW4Q 2WY3B 2APXA 2IDTA 1W72H 3QJHB 3U7YL 4LSTH 1U33A 3X1BA 2H3NA 1MVFA 4NZ8A 5IB4A 5KAQF 4JFFA 1LQSR 2KUTA 3BDYL 3HZYA 4WI0A 1OM3L 2BWIA 2MCPL 4BDVB 1EXGA 2HT3C 2XQBL 4LCWA 4LSRH 3QARA 4BQ6A 4F33A 4XNMB 2E27H 2D03H 2EO7A 2EXSA 1BZ7A 2AERT 3R0NA 4OUUB 5DD0L 1FV1B 1BQHG 3KM1A 2CJ3A 5EO0B 3WGVB 4JZOA 1E6JH 3BZFB 3JWNC 1D5BB 3E6FA 5DJCB 2VLMD 4URKA 1IBGH 3GSOA 3K7UA 3K71A 1KCRL 2MQ3A 1IAIM 4LNRA 5IQMA 1SEQL 1NFIA 2HX8A 2AXFA 4RGMC 5E1HB 1M71B 5I6XB 4PJCA 2P24B 4TQ8A 4BFOA 5K1NA 4WNQA 2BIIA 1Z0NA 3EGDB 2GJ6D 1I53A 2JFCA 5AOZA 5E70A 5GGSA 5E6RB 4ZUTA 5B22A 2ZUSA 3VXSE 1X4XA 4FKHA 5TFSH 3VUAA 4W6XB 2Y23A 4G8IB 1DBML 3DX7A 4B27A 3RWDA 1BDYA 3DX8A 4P46D 5JQ6H 1K8IA 1IAMA 1OXYA 1KELL 2YRLA 4FNLH 1ESOA 4AMKL 2QFPA 4MAYB 1ZY9A 1CJYA 3WO3B 2WB7A 2FJHB 1U3YA 4I9WE 2GHWB 1EJFA 5T8IA 3WFZA 4H8UA 3SBQA 3UADA 3EYUH 3NA9L 3RI5K 1USQA 5BMFH 3WAKA 1LDPH 1SDAB 3EYOA 1J86A 3S8FB 4QHMA 2PW2B 5D96C 2AK4A 3QO1B 2Y9RT 4PGCB 2QDVA 4PRDA 2X1QA 2QKIC 4H8WC 4LSSL 4M29A 5CCKL 3WY2A 3SKOB 3KW8A 1QSEE 2XG5B 1Y0LA 2EE3A 3I9IA 1TZHA 4GLRH 1QI3A 4Y4HB 5IHZA 3OAUL 4UILH 1ZT7A 2YUZA 2R59A 5ICYA 4UTBA 1JL8A 2PCPB 1A6TB 4OFVA 3GSUA 3G5YA 4URTB 3QG7L 2ZAGA 4R8WH 1KCVH 1T0MB 2F68X 3SGJC 3TVMB 4L8CB 1CDCA 1FO0A 2DQTH 1B0WA 4HPYL 4NWTH 3FSOA 3GJFK 5AVQB 4L3CA 3WFBH 3FB8B 5B38B 4CL7A 5I0WA 2ODHA 3BAWA 3CLEL 4XMZA 2MH4A 3HS9A 3UCRA 4JY6A 4BV1A 1G6RL 1M1XB 3FQWB 4A7UA 5F93C 4NM8L 2OSWA 4KKBD 1LO3L 3VQLA 4P2AA 1JCVA 2E6JA 2GJZB 4EQ3A 5HHMD 2BWDA 1BMWA 4S1SH 4JPKH 4GBXB 3RVVD 1ROWA 4I3SH 3PHQB 5I30L 4JFZL 2NTFB 3MRJA 5F8RC 1MCLA 2EDQA 3WNPA 4AQ1A 4DQAA 5JOPE 3QO0B 5HDWA 1SY6A 2E7LC 1PBYA 3HNSL 4NCDA 3WDJA 1MIEL 4NRXA 5HYIA 2J5LC 5HDQL 3ZL4H 1X6NA 4P9HH 3FOLA 3VGGA 4QRRE 2DTSA 4Y1AA 3TBYA 4DVRL 3OHMB 5HHXH 3O11B 1MW3A 4HP5A 2R2BB 4XPBH 1G0DA 2OMYA 2WBJA 1F6FB 3ZLQC 5AZEL 3DX2A 3TPUB 2N7AA 2JE8A 4ZOEA 5GSRA 1FL3B 4MVBC 1WGVA 3W57A 3O0RH 4L29B 2A83B 5FXCH 5ALBH 3FFDB 4QRFA 4L9LA 3QH3B 5DMYA 4OD1L 1BBDL 3EFOA 2X4SB 4GT7A 1E43A 1KYAA 1RP9A 3RGVA 4YXHH 1DVUA 2PP8A 3HUJA 1UA7A 4ZD3L 2DH2A 4F2MA 1A22B 3F7VA 3ZKSD 4AK1A 5IMLB 4L4VE 3SYQA 1KEGH 1GC1C 5LXGL 1NWOA 3MBWB 5LUMA 3GF8A 4NKIH 3VFGL 4QYOB 4AC4A 4AYFB 1I9RL 4R7DB 3V0WL 4F5CA 5IOPB 1QLFA 1IKFH 3QYNA 3KYOA 4N68A 5KYWA 1U3ZA 2OR7A 2AEPL 4PGJA 3RIAK 5A2KH 4HLJA 2G9KA 5IMKB 1U92B 4OIIL 1XB8A 1W72B 4A6YB 4QRUB 1MFMA 3BVNB 3ZE1F 3B1UA 1WV7T 3PDDA 3U4EB 2XWXA 2BOCB 1D9KA 2WLIB 3RIKA 1S9VA 2W0LA 1BZ8A 2OYKA 3BRFA 2VDLL 1VPOH 3D6GA 1U8KA 4N0CC 3WTYA 5E9DB 5E4OA 1B9ZA 3KWVA 2ORBL 2R56H 2WVVB 4F3FA 2AXJA 4LPYA 3V5KB 3DXAE 1TVBA 3CZEA 1NM4A 2WLYA 2VB5A 1JNHA 1AQDA 3SCMC 4PGZA 4HT1L 1NBVH 5HVWA 4RQQA 5B1JA 1A2YA 1M6OB 4YXKH 1WIOA 3L3HA 1RFDH 3X3GL 3D07A 1WA0X 1VFBB 3RWHB 3ZMEA 3Q8BA 4WUUE 5C08E 4PJ9D 2VXVL 3CVIH 3O3AA 4PRAB 5FC9A 5D7JA 4YHYB 2NR6C 4LVOB 4DH2A 5IG7B 4B9FA 4G6FD 5EU4B 3WE6A 2Z6FA 5DUBA 2ADIB 1A7QH 4HW6A 3ZIYA 3GUTA 2B4CL 1ZLWH 1D5IH 1RZ7H 1MNUH 2XYBA 1T7VA 4YUEH 5DDHB 5G4OA 4G3YH 1T04A 3KPQA 3CN3A 3UAJA 5JW4M 3Q43A 1D7BA 2GIMA 3N1PC 2EE2A 4Q7DA 3NZ8B 1DQLH 4FCHA 1OTSD 4Z7NE 2BPBA 2CHDA 4P3DA 4XHJC 3D33A 1E4XH 1KYFA 5KVGE 1XEUA 1GW0A 3HLAA 1P4BL 1A4AA 2Q10A 4ZZFA 4HS8H 5ADOH 3MV8B 4LCIH 3TT1L 3CFIC 4WFFE 3UP1A 2D0GA 3EDDA 1SEBA 3WMPA 4AJYV 1E9PB 5J3HC 4AG4L 5ACLA 1CGYA 2C34A 3DX6B 1ZLSH 1EAPA 4UV4L 3QT2A 2CDFA 2PYEB 3CMOH 3L1GA 3NIGB 4WV1B 4YR6B 4A63A 1A9VA 2PW1B 4PG2C 1A9EB 2ZWYA 4G80A 3APDA 4NUGL 2H3KA 2R2HB 2VDOL 2WTRA 4HV8B 1WBXB 4FLSA 3F8UB 4JN1H 2C26A 1JD7A 1YDPA 4RFEB 1BD2A 2OCFD 3OR6B 3QYMA 4L1HA 4AUJA 1OP4A 3F83A 4N90E 5IHLB 1IEAA 2AAVA 4HMDA 1EJOH 4YPJA 1FZMA 4NERA 4HC1H 4K71C 4LOUD 2WUBL 4XWOD 4QLWA 3E2HC 4YSAA 3BEWB 1YN7A 2KDGA 3RVTC 2LW3A 2PYEE 3NIGE 4OAWB 1SXBA 1ZRUA 1ZCRA 4L8SA 4LF3A 5D1ZA 4ZTOL 4U1JA 3UROR 1XV8A 2L3BA 1Z3GL 3AS0A 1NLDL 2OR9L 3Q6GH 5KYYA 3SO3C 5JLZB 4I89A 1UZ6F 3BN9C 5TJWK 3TIEB 3A47A 5FA4A 4F91B 4NQCD 2X70B 4X99A 2VH5L 1G6RA 2YXMA 3HNTL 4JO1H 1VGKA 5F9OH 4TTGA 4OGYH 3CUPA 4KGJA 1DJXA 3A67H 1T5WA 1BZEA 2QQNH 3BKYH 3DJ9A 2B1HH 3V5HA 2YQ2A 1MSPA 4DP5X 2Z8WC 3Q01A 4Y88A 1DJYA 3PWUB 3QPQD 2ITCB 1RU9L 4H8HA 1L0PA 2Q2EB 4FC3E 4XNYL 2DQCL 1FC1A 4DNLA 4N87A 2A38A 1I8IA 1SZNA 4JM4H 1JNJA 3MRDA 5G5DB 5ID0B 1CL7L 4RFOH 5DFVD 4PJDE 1P4UA 1U8QA 1AR2A 4NCC1 3RWIA 2I25N 1RHHB 2XV2A 3PWPB 3JWNE 1IC5H 1O6TA 2BVQB 3N85H 4FQCH 4IBTA 3EGSB 5IWLC 4NSKA 4ALAC 1AGEA 4B3VA 1U8JB 1YNKH 2PPDA 3CSGA 3ARDA 4I1PA 3SDXB 3G5VA 3QQ4A 4WWNA 2EIZA 2WZ0A 1TJMA 2PTVA 4OFDA 2BP8B 1WWBX 1J1XH 2G2NA 1T03H 1JXDA 3IXAB 1F6AB 1AD9B 2GJJA 4XP9H 4BKLA 2XWJA 4KX7A 2P8PB 3RVUC 5IVNA 1XB6A 4ZMZA 3RPIA 6FABL 1DN0A 2EE9A 3PWPE 4TNVF 5DZPA 3J7HA 4PRPA 3FO2A 3KPSB 2ZYRA 5TE4L 4E0RA 1I8KA 4FZEH 2B0SH 3EH3B 4A68A 4NYLB 3HRZA 5MENB 4MD5A 3SDXE 4X5XA 1ZHBA 5BUGA 3B3BA 4IU3A 4G72B 3HB3B 1S5HB 3LN4A 4JG5A 3KWWA 4LRIA 1NCUA 1OY3B 2DN7A 2EIMB 3L3IA 5AW2B 2LE9A 3IGFA 1UUSA 1AMYA 1J0KA 4B9JA 2VKXA 1MCNA 3MV11 4XBPB 5B39G 2DYPD 1DQVA 4KQ4L 4N8VA 1IAOB 4EI5A 2PPEA 4OZIA 1YMME 4KKNA 2E74C 2WQRA 4MD4B 3KPSE 1MPAL 4J28A 4RISL 3VFSB 3WHE1 4DGYH 3TCXA 4NZUL 2G30A 4R83A 2X1OA 4PJGB 2HRPL 3VD0A 1QZNA 3LV3A 4P2OC 4GW4A 5L2KA 3GXPA 2W92A 1QSZA 1CO1A 3DSNA 5FGRA 3ZDYB 2UUDH 4KJWC 4KKRA 1Q1PA 3C2AH 1FFNB 1QSFB 3MUY1 4R7VA 1AFVH 4ZS7L 5HDBF 4I0PD 1OCWH 5I5IA 4D0DA 1JGIA 4AQAA 3A3YB 4NFCA 3M1CA 5HYSA 3B2DC 2VM4A 4Y19D 1NIFA 4NUPA 3ZSSA 5JW3L 2QVMA 1U8IB 5DFTA 2JB5L 2E9GA 3CHSA 2OZ4H 2ZG1A 5HDRA 2X05A 5F1IA 4XCNA 3OKYA 3CN2A 1KFGA 2Y2WA 5DURD 2EDOA 4FXGB 1MXDA 4GAYB 4R90L 1FG2B 1I3VA 2F19H 4IMKC 5CINH 5BRZE 1BECA 1DBAL 2AEQL 3HE7C 1YUHA 1JVOA 1CR9H 4ZG1A 2OXHB 1IZKA 4FTVE 4HZ1A 2ENSA 2H45A 5TQ2L 5AVYB 5L9DH 1DQIA 1GW6A 2AV1B 3WEAA 3WJLA 4XXWC 3IGKA 5DUMH 3MRHA 5CJQL 3HS0C 2OMVB 4CVZB 3W0WB 4ZX3A 1AG0A 4MNHA 1GSKA 5HVGB 4HX1A 4X0NA 3EUDA 4RAVB 1PKQE 2KT6A 2ZWLT 1AE6H 2Z0UA 4ELKA 3FU5A 3VXTA 1PAZA 3CGTA 4MAUH 4NHCH 4P2RD 4CKQA 3ULUE 3OAZK 3HC3L 3TJPA 2J88L 3ASWA 1RUKL 1NQBA 4E9VA 5IEHA 5JTWA 3P2BA 3BXNB 1BIIB 3T0WA 1EZVY 3KW7A 2VUOA 1RIVL 5F70A 5DEFB 3S35L 1HAUA 1JS4A 3QIWD 5E8DH 1NCCH 4K2UL 5T5NF 2ZOKB 3QCTL 1HHGA 1K2DB 2EXWD 3C9NA 3FT2B 5E8NB 3DUHA 4KO9A 4M8UA 1DQJB 5EZJB 2Y6TE 1MLCA 4G6ML 3WTWA 4WFGE 4I88A 4QO1A 3V4VH 2MHAB 3S37H 1L0XA 4N2CA 3NABL 2J43A 1OCCB 1QFUH 2VR6A 3EJYC 3UJJH 5F6IB 2Y4SA 4D8OA 4FNUA 1SNRA 2PPAA 2CNZA 3H8NA 1IQDB 2E59A 3FMGL 3CCHB 3DVIA 3OF6A 3KL0A 2R0KL 1R3HB 4NQDD 5T5FL 3G6AB 4Y2DB 2VNCA 2XWTB 4W9LC 4ZMNA 1SJVA 1CU4L 1U4EA 2V5RA 2HFGL 3CHQA 1DE4B 1TTFA 3DTDA 3I2CH 2NZ9C 4J4PC 2D7TL 2AP2A 1GYAA 3AMKA 3L3OA 3SQBB 1RUPH 1EZLA 1NC2B 2ZKMX 3LZQA 1QBMH 4NM4H 4PQXA 1Z32X 3JWDH 3QUXD 2O30A 5D7IF 3MRBB 1Z6JT 5DMIH 4QTIL 2ZX8A 3DX0A 4HCGA 5C0IB 5INDA 1F6LL 2WXLA 4UMGA 4R4ND 2OMUA 1F3DJ 1G0YR 1I7RB 3PWLA 1G7QA 1NC4A 1ETB1 5TDPB 3STZB 1J0ZA 3POHA 2IALA 5AOJA 2F8XC 1JFHA 4FHBD 4N20A 1CICA 1ZVSB 4LSVL 4MLSA 5DK0B 1TJIH 1EFXA 3BP4B 4GQ9H 2FH6A 4ODBD 2OTWA 3ZKQD 3QQ3A 4NJ9L 1SHWA 3VFNA 4GSQA 3V4PA 2XV0A 5C0AE 4U7KA 3NFNA 2D7PA 2H0EA 4EN3D 2EDKA 4PPTA 3IN2A 2LV4A 4L1LA 1F42A 1V3JA 4AL8L 2BSRB 4GKZA 5E5MB 1BEXA 3CFNA 4PJAA 4XNAA 1PD1A 3MRCA 2JCCE 4M6NL 2VN7A 3F6IA 5AUMB 4F2EA 3SJVD 1XCQB 2IOMA 2HJFA 1LNUB 3NACH 1TQBC 4GH7B 4UV7L 3ZDWA 2EUZA 2NNXA 4AGLA 3ASNB 4BKSC 5DVPA 2ZCLH 4K5NA 3OZLA 3GIVB 4YHOH 3QNYB 1S7WB 3WEXA 1XSJA 1J8RA 4HFWA 3JWOH 1KIRB 3B9KB 1NPUA 3DHJA 5DYOA 3QNZA 1OE2A 1CGSH 1TJXA 2AJZA 3DJRA 3V0DA 3IGAA 3QUYD 5C07A 2OP4L 4UU9B 5H94A 5JDSA 3MUJA 5JDJA 4V2BA 2Q0ZX 4WHTB 1DANT 5EEUA 4ZUWB 3W2DH 1YNLH 5J9PB 5FUOH 1EEYA 3FU0A 4P49A 2DL2A 1WRFA 5GGRY 1S9YA 1N0XL 4AW7A 4Y9CA 1GS7A 4G8GA 2EEBA 3GMOA 1S9XA 2R8SL 5ICZA 2OSLA 4Z78B 5KBNC 2D7QA 1TTAA 4BWUA 4P8QA 3RWEB 3ZOAA 5HBBA 1X6LA 2BP5M 1SGKA 1T5XA 1BMGA 3G5ZB 3BLBA 1OARL 4FDWA 5ITBH 4NKOA 2ICEA 4KTDL 4M62H 2NY7L 1QVOA 1JZ8A 5I8EB 1M57B 2H9GA 1A4JB 2YA1A 2ZUQB 4QJ4B 1LK3L 2GIYA 4P04A 2FO1A 4NPKA 4NQED 4HSAC 1NBYB 1T6BX 3WFCH 1QLEB 3KS0J 1I8AA 1E9QA 3QORB 4TKWA 4XO9A 1KPUA 4POZD 2VZ3A 4FADA 2BMKB 2RBLA 5AVWB 5SWSB 3LQAH 1KXQA 2Y69B 3EG9A 2VSDA 4YFLI 3AG3B 4AQZA 5IHUL 2O93L 1QX1A 2X4OB 2A9MH 1SYVB 2IH1A 1QA9A 2VL5B 3B2UC 4A38A 3D39D 3CDGA 2YD2A 4C59B 1G9MC 2IPTL 4WHYH 2GJ6A 4MAZA 4AEHH 3MYJA 3UPRB 4OCNC 4KQ0A 4LRNH 3RWJB 5T3XD 1F02I 1LEKB 2E7BA 4QOKE 2IDCA 2XN9B 3RNKA 1U30A 4UANA 1S7SB 1HKFA 4P46A 3V4VB 3DROA 3SZKC 2I24N 2WHVA 1JGVH 2YJQA 1FJ1A 2Y5EA 2Z91B 5DD3L 2AJ3A 5LQBL 2EDBA 2D31B 2PWHA 4NNYB 1TU2B 3HE6C 4XTRC 5FFGA 3MYZA 4BSVB 4LHJB 1UJ3B 3WUWA 4L9LC 2XQYK 2WXFA 2BZ7A 5IHWA 1S2EA 2VABB 2WQ8A 3C60D 2NSXA 3ZKXB 1BVZA 1GVIA 3H42L 3REVB 1Q94B 3RGVC 2Z3FA 4GSUA 4MXWL 1DVQA 4ZYKB 1G6VK 1OIOA 2LLNA 1JPFA 3NSDA 3CVHL 3EF4A 4FYTA 5IB1A 5GS3A 3VWKB 1C5BL 2NY3D 2TSBA 4AYMC 1QASA 4PUBH 5DT1L 5E4EC 4IK6A 5I8OH 1HXYB 3RNQA 1MI5E 2J20A 3DIFB 5T5FA 1BEYH 1Z9SB 3DUUA 4KOCA 3WN5A 4DP1X 5HHNA 2C9VA 1V7MH 5L6YL 2AGJL 2YOAA 3ELAT 4KPHL 3FUIA 1JV5A 1YEJL 2OJZH 4GFTB 5I6NA 2IWEA 4HULB 3ISRA 4M6ML 2OXGB 1YEHH 1JZ2A 5F7HA 3FQUB 1T66C 1D9KC 1MHPH 3ECBB 4G7YL 4TLKA 1URLA 1W8NA 2FHFA 4LL9A 4XPFL 3OKDA 5KANG 4KO7A 5DMGD 4FQIH 3A6BH 4X6BA 4UYQA 3WAJA 5I8CA 5D6CA 3QJFA 4XVOA 3N2JA 4WGVB 1VADA 2A0LD 2WO4A 1I3GH 1A21A 1T0NB 3ZL1A 5I0XA 2H41A 4GI8A 1OPGH 1ZK9A 1NGQH 1XIWC 2J2ZA 4WEUD 5D7JC 5BV7C 1JZ5A 4Z7AA 3CK0L 2XC8A 3MDJA 3QQXA 1QR1B 4XNZB 4OT1H 1U8MA 4HHAA 2VSMB 3IJSA 2UVEA 2YBRB 2O5YH 4U31A 5DUPL 1NKGA 1VFMA 4TUOA 5DHVB 1Q9OB 1YY8A 2FD6L 3C5ZD 3C6SA 2XACC 2FYYB 2HP4A 1FF5A 2BHZA 3UAJC 1VGEL 2YR3A 4RGNB 1CFTB 4FFTA 2X4TB 2DV6A 2HUHA 4OJDH 3US1A 3EDFA 3MLSL 4JDEA 4CN1A 2BS71 2SEBB 4Y8DC 1I75A 2R2EA 3I74A 2KHAA 3D34A 1JPSH 1PPIA 5ALCH 3IETB 2FWOB 1ZHKB 2YN3A 3ARBD 3JVFC 1H15A 1A8ZA 2DIJA 3KYNB 3SZ6A 5EBWB 3T2PA 1ZJAA 2O1AA 1HCVA 3AREC 3TV3H 1H6UA 5K5YA 1CQYA 3I9AA 2E56A 1PS3A 1MCCA 4I48B 3VFMB 1KIPA 3F7RA 4NAQA 1HKLH 4L1DA 1B4LA 2YK1L 3PJSA 3LKRB 1AJ7H 4YDVA 1PZ2A 4WI2A 3U1SL 4NDMB 3DVNA 1OAUH 4M7JH 1A47A 1FFOB 4MB4A 5FGSA 1IBZA 3TJEH 1T0PB 2YUWA 4V2CB 1XL6A 1E5YA 1KC5H 4JKMA 5HHQA 3KR3L 4S1RH 3QEGL 4JY4B 5EU6B 1HH6A 4JZNA 5EBLB 1RZKL 3MNDA 3SGEI 2B16A 3H9SE 4HHGA 3U7AA 3R4RA 3ZIMA 4IHOB 4LAQL 4AVIA 3QCUH 4JZJC 5C6TL 1KY7A 1UXSA 3ZE1B 4KKLC 3OHXC 1HIML 3FU7A 4HAKA 1WIPA 4UM8B 4MJHA 4HIIB 4ANWA 4UWQB 2R1XA 2EKJA 1K6QH 2WIIB 5TE6L 2Z9TA 2LQRA 3MV9D 3HOGA 1BG1A 2ROYA 2MQGA 4P4KD 3BHBA 4KZDH 1OCRB 1WHOA 1UYWL 5FW6A 5L4MA 4YK4C 4M8RA 4U1NB 4NPYA 2HH0L 1NMBL 2JJSC 4PJ9A 1UA6H 2WANA 3T4AB 4A67A 1HQRA 4KQ3L 2CWRA 4AEIL 2GBTA 3DRQA 2G75B 1U8NA 5EIIG 3VFTB 1OM9A 3ZE1E 2VLKE 4M1GH 4Q9QL 3NESA 4CC0A 2YD7A 5CJXC 4BK8A 1PZUB 1U8CB 4N0RA 4K3DH 2FGWL 1J8HE 1YVLA 1S46A 3NPSC 4OIFA 5DK2A 1QKZH 5IOKA 2DWSA 1CG9A 3QVAA 3QDHA 3MZGB 4G9FE 1QUNB 3MXWH 4M3JA 1XXFC 2FIKB 4ZFGL 3DO7B 3GSQB 1A25A 4FFYA 2NNFA 3RI5F 3QFJE 4K3JH 1P7QB 1WSST 5HHPA 4ONFH 3TO2B 3FB5B 4YZFF 3S9DB 3BKML 3ARDC 2WTPA 2HWZL 3FTVA 3TBWA 2WMPB 4JKNA 2Y7OA 2ZCZA 4FFZA 1UWYA 1NFDA 1LWRA 4HWZA 3REWB 3TESA 1T89C 5E00B 1DJWA 2A4EA 1D5MB 1F18A 3ARZA 3QDGB 4S11A 5SX5K 1B4RA 3D51A 5EUOF 1A65A 4G8EA 2DI9A 2NXYD 2V0AA 1FYTB 4OZFA 2OZNA 5AG9A 4YE4H 1OT1A 1RZJH 2CMRL 2NT1A 4KI5D 4M48H 1OF2B 5HI4C 1KGUA 5J13B 4PJBB 4D9LH 1BOGB 2WSKA 2R7EB 3RBGA 3ZYIA 1X5ZA 1OAQH 4MQSB 4QLRA 3T1WA 3BVXA 3TBTA 1E8WA 1R1CA 1G9NC 3GKZA 3VXUD 1Y1UA 4GG6F 5MI0B 2W59A 4YSUA 4GUOA 1ADQH 4MMZB 3APNA 3AUVA 3EH4B 1CD1A 3M46A 4KMQA 2WLNA 3P3RA 3HS8A 2OMXB 5IM7B 3MJ9L 3U46A 4KROC 5D72H 4AGQA 4P4RA 4JFOB 3FT1A 1UT9A 3GB7B 1JHLH 4IOIB 4NQCA 4K5MA 2P26A 3US9A 5KSBF 4FABH 1JZ7A 1UACH 3HZMB 5DQ9B 4I5BB 3RVWD 3AXLA 5F7LB 1FNEB 2NW2A 3LKNB 4KO6A 4OM0H 1R5VA 2BJMH 2L04A 4UBDD 3ETBF 3I9GH 3T3PF 1RURH 3D06A 5IGXL 1AO7B 1A14L 1ZEAL 4HU2A 3WS3B 3DI3B 9PCYA 2DQGL 4PCKA 1SYSB 1BAFH 2NY4D 5T1KD 3G6JA 4WW1A 2ZPKL 4V1DB 3VSTA 1UZ6E 4Z3HA 1H3PH 4E5XB 2IAMD 8FABA 4UT9H 5E6ZA 1EX0A 3JYCA 2W60A 1OP3K 3UTPD 1WG3A 4X80L 7PAZA 2CE6A 3DOSA 3Q2NA 5DZ9A 1NCJA 1REIA 1AVAA 1W80A 2IAND 3IDXL 4S2SA 1ETZA 1RUAL 4FQLL 3SKNB 2CBPA 2OMBA 4IIZA 4D2NA 2QHRH 4JPWL 2CGRL 1AZVA 3V6FA 3QAZC 4I2XE 4NT6A 2A77H 4XVSH 3R8BB 3SDCB 1KF9B 3MREA 4LFHG 5I1AB 5IJBC 5LNGA 1GTFA 4O2FA 3I6GA 3KAAA 1QRNE 4V1DE 4AM0A 4OCWH 2B8OT 1NCBH 4PJ8C 2IOOA 2VXTH 3KJ6H 4OLYH 3MRLA 3KNBA 3P4MA 4LSRL 3RIAF 4N2IA 2A6JB 1GIGH 4XZUB 2DBLH 2FQGA 4D9QD 4OCYH 1CLYH 3Q6FA 4WI3A 3L3JA 1TENA 2A1WL 3APFA 3TT3L 3V55A 1E6JL 2P45B 3L4YA 1J12A 2HPTA 2EEAA 4TQEL 4X5WB 4BH8B 5E99L 2NY0B 5BOJA 4AE1A 1TUPA 1MHCB 5CHNA 2A74C 4CADA 4PD4J 3Q5YA 3B3IB 3MRIB 2PTTB 3QDMD 1N59B 3LN9A 3V4LA 2ZX9A 1AGFB 3RTQC 1JNNH 1HZHL 5IZ7A 2XVGA 3G5WA 4B5EA 3MTXA 3IJEA 4KJQD 1NCGA 1VKXA 1Z9OA 2CR6A 4J2QA 4FQJL 1PZCA 5TFSL 3QGVA 4FG0A 4XE5B 1YYLH 2BX5A 1R3KB 4K55A 1BQHB 5KSVB 3EYFA 1CPUA 5JQ6L 5KSAB 4UQIM 4MJ5A 3D4YA 4FNLL 3KLAA 2QGEA 4HKXB 3OKNA 3HNVH 2X88A 3WIFB 4FQ2L 4AXWA 5DZLA 3B7UX 1THCA 1D5XA 4OB5L 3LPWA 4I0PA 3CSPA 3ALXA 1LO0H 4Q6IB 5BMFL 1YJDC 1LDPL 4JHVA 2NUPA 5KBKA 4KKQA 5IBTH 4Y19A 3E8UH 3NCEB 3LNHA 1SXCA 3S37X 5I1IH 1JYNA 2OJEB 3BQUB 5EEYA 3EOBB 1OZUA 3S2CA 1KULA 3ZQWA 2CBOA 3L3OC 3UMTA 1RQ5A 4L4TB 2K7QA 5EEXA 3ARXA 2ADJB 2ZG2A 4UILL 5L8JB 3N55A 5HPMA 2DQJH 4RMTA 4PGDA 1GJWA 5C0CD 4AYGA 3AJ7A 4KK6D 2JF1A 2ICWB 1TMQA 3BAIA 5TTRA 4R8WL 1OGTA 3MFFA 4JO3H 1KCVL 2WLLA 4XN7A 2CH8A 1INDL 2F53B 2Y7QA 5FO9A 4WI8A 2G3ZA 5HDBE 2VR7A 5IV2A 5LDUA 4TQHA 1SJEA 2DQTL 4NWTL 1ONQB 3FZUD 3GLAA 3SPIA 5HVHB 5CR1A 1OWRM 1CICC 4ZPVA 5CSBA 4B9ZA 2DQEH 1WZKA 1MHHB 3B7TA 1AHWB 4L4TE 2ERJB 3R0MA 2CLVA 1A3LH 4ZRGA 1JF1A 2BY2A 2E75C 3T04D 2KZ1B 1M4KA 4P2RA 3CZSA 5IKCA 2ATKB 1MQ8A 1OP5H 1BVLA 2EYSA 3KPTA 4JPKL 1I9EA 1V27A 1RZ8A 5IROC 4QT5A 1AC6A 1W0WA 4FXKC 3QUMB 1W8OA 2X7LB 3QZOA 3VFPB 3UBFA 3QIWA 4L5FH 6CGTA 3L54A 2XKUA 5DJ0B 3PUUA 1CDJA 3UO8B 1JUFA 3V9CA 4ZFFA 1YEWA 3ZL4L 4P9HL 1Z5LB 2VLRB 1OGAD 1A9BB 4JPIB 4FEIA 3RU8H 2GTZA 3KLKA 4JFEB 3SO5A 3MJ9A 4D0CA 4XPBL 3ZDZF 2K4AA 1TZOA 4ZMXA 1GZQB 3P4NB 1M3JA 4EDWH 3TBSA 1UFGA 5DLMH 1G7HB 2G2PA 3KWTA 3VD1A 4H8VA 5HGAA 1NGWA 4HUXA 1SFHA 4CJ0A 1U21A 2A9AA 2QADC 2MWCA 3MGTB 3O0RL 1HOCA 4D3CL 5ALBL 2CCLA 2PABA 3F01A 4P9MH 1DVSA 4NQDA 1IEBB 4JN2B 3T8XA 3KPNB 3VXOB 1EVTC 3EZJB 4FN0A 3AG4B 3QIUC 4LVNC 5JPNA 4DKEH 4YXHL 1XBDA 1ZT1B 3OPZH 2IQAA 4F8QA 3OMNB 3HZVA 5FWRA 2A73B 4YAQA 3VM7A 1S7RA 4P5MB 5E4IA 1R3JA 3O8XC 4ES8A 4NKIL 3TEYA 1MW2A 5EUKB 3AFLA 3A5VA 3WIHH 2JQZA 1RK7A 3QUXA 2ITDB 4FQXD 4OH2A 4XX5A 5E6YA 5DJAB 1GRWA 3SY0A 3MNVB 1C16A 3HZKB 2EEXA 3AXHA 4HU8A 4E9WA 1OK0A 5ID1A 1XAUA 1EGJH 2J73A 1SQMA 3AAZA 3EF7A 2H32A 4PD4K 2KKQA 5FHBL 1IMHC 3N5AA 3LCYA 1FNGB 1WO2A 2FLBT 1RSFA 3DTXB 3NCXA 3T0EB 3UJIL 4LSUH 3T0VA 2F2HA 4PTTB 2R56L 3QZNA 2YD4A 3MODL 3P30H 2OL3H 2UXGA 1BOYA 1ZA3A 3EZ8A 2FR4B 5CO1A 5CEYA 2W8CA 2IG2L 3OJMB 1WFUA 3T6ZA 3OAYK 4FNPA 2BIMA 2P49B 4YXKL 4EN3A 7FABH 1JZ6A 1RFDL 1RIHH 2Z31C 3C8DA 4MMXA 3VJ6B 5D7IE 2NLJA 3FYEB 4ANKA 5I17B 4P07A 4KNSA 5LKNA 1MWAH 1OO2A 5JNYB 1T1ZA 4OZGA 4QKXB 1CLOH 5EOQH 3SIKA 1ZLEA 5GRVL 1A7QL 3SJVA 3STBA 4MSWB 3T0EE 3K5RA 4RFNB 1SUJA 1HHIB 1EAOA 3GMPB 1JVKA 2PWDA 3F00A 4X7SH 1MNUL 2JH2A 3BWAB 2C7FA 4DP2X 1KPRA 4Q2ZB 4YUEL 4G3YL 4R2GD 3MLTA 4P46C 5C2BH 5HYJD 1CXHA 1DBJH 4RZCA 5IW3A 1DQLL 2EE6A 4CC4A 4P23C 3IJ8A 2ZX5A 1QBLH 2PXYD 4U6HB 3SOBL 3L9YA 1N5YH 1QQDB 3JZ7A 3MVSA 1E4XL 3QUYA 2AJYH 2JKNA 4PRIB 5CLXA 3UTSD 3ZHFA 4HS8L 1X5FA 1ZDQA 4FXLA 4LCIL 5C9JA 2K6YA 1LHZA 2VO5A 4WWKD 1ZGLA 2CNYA 1KTLB 2AJXH 2WN3A 2J8UF 4DT2A 5C0RH 4GAAA 4ODTH 3A21A 3VNYA 3RIFK 1QFOA 1AGCA 4ICWA 1I8MA 3W3BA 1ZLSL 1MXGA 1JWSB 1ET5A 3CMOL 1UG9A 2EDLA 4NN5B 4LLVA 1SOKA 4QHNB 5I16B 3IJHA 2H2SD 4NFDA 4P2QB 1ERNA 3GEFA 2ENJA 4LBEA 2C9UA 5EDSA 5AD0A 2QFRA 1QTPA 1ZOXA 3QI9B 3F7KA 4RWYH 1GY2A 3DA0A 3RL1A 4PRHD 1F56A 3IU3B 4L8DB 1PY4A 4YDJA 4DP7X 4JG1H 3VWJD 3FW6A 5BVPH 2APFA 1BZ9B 3DHMA 3LS4H 2WXPA 3CN4A 4Q4IA 3S34H 3T77B 4BFBD 3IAGC 1JZGA 2PO6C 2GVYA 2YPVH 4NQEA 5HGBB 2G2RA 2MQCA 2UZXA 3K46A 4M7ZB 4RETB 5D4JA 3AGWA 2DLIA 4JL1A 2HFFB 3KYKH 5AW0B 3MRNB 3Q6GL 5C70A 2DMGA 4ZSOB 5LGHH 4K5PA 3R06A 1UM5H 1FAIH 1PMYA 3P9MB 3OB0H 3CZFA 1SQ2N 3RY6A 4NC2B 3BIAX 4LCCA 3FQYA 5F9OL 3D39A 1KJ2H 2UY7B 4JG9A 4OGYL 4HEMA 1BQSA 3A67L 2QQNL 3MV7D 4HUNB 3BKYL 3X1EA 1WAPA 2AQPA 5JW5B 3FCBA 4U7MA 1UQSA 4Y5VA 2ZXGA 3FSVA 4MKMA 2N01B 3DURB 1Y6NR 5ANMB 5B3JF 3A22A 2BS9A 5IFHH 5FK9A 4NN6B 1GCFA 1Y07A 4ZSOE 3GJEA 4N2FA 1KXVA 3MRRA 1S9KC 4ZUVB 2VSCA 4QRSB 4HWBA 4JLRB 3ULSB 1ZANH 3SE9H 3PQYB 3QAQA 5KYUA 4YHZH 3UYRH 4HXAH 1AXSB 5DWUH 3HC0B 1IC5L 4ANXA 2YA2A 3C60A 1KLFA 3CE1A 4LLQA 1EO8H 3TXAA 1RPKA 4GIOA 3G3LA 3QC6X 1UWXK 2WN2A 1YNKL 5DVMA 4BFFA 4F8PA 1DLFL 1XSKA 2KYIA 3FCTA 3DI2B 1PEWA 2DQFB 4HCFA 4M7LT 3EO1B 3MOQA 3ZT5A 1P9MA 3ZYZA 5E0FA 5ACZB 3NCCB 2C9QA 4X6DF 2OSXA 1T03L 2P42B 3JVGA 4XP9L 3LB6D 2X4NB 3MCYA 1IBDA 3MOAH 3SE6A 4PBVC 4K3GA 3BPCA 3RVXC 1KN2H 4KGLA 3FRUA 3MR9A 1F2XK 2NYYD 1E5ZA 4KRPD 3ROLA 4UTCA 2MTAA 4FZEL 1FZJA 3FUEA 1FVCA 3TFKC 5DEZA 5IF0B 4CVUA 2AAAA 4U1IA 4WQOA 2XTJC 4I4WB 1HINL 2Z93B 2VDPL 3ES6A 1KTDA 2OL3B 4OZHB 2CCWA 5AOKA 4GAJL 1JGUH 3N43B 3JSSA 3TWCH 3PNRB 4XVTH 5A6IA 4KTYA 3P4OB 2WXHA 1MKFA 2GCYA 4MD0A 2DPKA 2W07B 1XR9A 3M17B 2CO7A 4OF0A 1ZSDA 4JM2B 3HC4L 5L2JB 1MRCH 4PJ9C 3LN5B 4DJMA 1BQLH 2NW3B 1FVDB 4IRJC 4ZFQA 4PHZA 1P84J 3IPEA 4ZNEE 3OKKA 4N8VG 1YSOA 4U3CA 3THMH 3CC5A 2XWBA 3BPOB 4Z7OF 3VD4A 2WC7A 1OTUC 4BD4A 3C5ZA 3LQMA 3C2AL 2KPWA 3O3BA 4NZFA 4DUVA 4R97C 4ZW5A 3LIZL 5B39B 1AFVL 2QSTA 1L9QA 1ZHNA 2HFEB 4DOHB 1OCWL 1WFMA 2ZXAA 1OTSC 1OCOB 1Q9LA 2NSQA 3FT3A 4L9DA 3ML8A 2YS4A 4BCZA 2Q7YA 2C3XA 1DEEB 4Z23A 3DV6B 3ARBA 2N7BA 4R0LB 3O3DA 3WJJA 2XWDA 2OZ4L 4HKBA 4Z7WB 1JNLH 5H35B 3EJZD 2VO8A 3ULVF 5CEZD 1U93A 5ACMA 3X3FH 3C87A 4JHUA 3M8OL 3SGDH 5HYSG 2F19L 2UXTA 4CW1A 3L9RA 5C7ZA 3FH5A 1R46A 2V7NB 1NKOA 1FH5L 4TRPH 4HLEA 1HILB 2JKWA 5GXBB 2Q3XA 4YDKH 4ZOCA 3WS6C 3CFBA 5L9DL 3D8MA 1KGWA 4A7SA 3IKCB 3W38A 2XPGB 4JVWA 4Z0BH 2X6UA 1R3IH 2GTWB 4PRBA 3N1MC 4ZMOA 4JO5A 1OAJA 4NJAH 4CGUB 1AE6L 2V17H 4LOUC 4MB3A 4N2LA 4XWOC 4X83A 4MAUL 3FFCE 4NHCL 3TF7C 1WT5C 3ABGA 5DHEA 1BM3L 1MUJA 1ZWIA 1RERA 1GC1H 2F5AH 5CCJA 3CN0A 2V5TA 4KH9A 3T6QC 3MV9A 3DLQR 3E6HA 4P4KA 2QGBA 2VAAA 1X7TA 2XZAH 3NAAH 1G9EA 4HIJB 4M56A 2BNRB 2J71A 3BW9A 4NZTH 1I1YB 1TEYA 5E8DL 3ROOB 2WIMA 1NCCL 1JCKA 4NB7A 4KFZC 2AQNA 4UUJA 1U3HD 5CWSB 1RJZA 1LEGA 1XGRA 4HWEH 1JK9A 1G4MA 5J06A 1GGCL 2QHLA 2V37A 4XCYA 5FKPB 3T8MA 4PVLA 3QA3B 3K0YA 3QHFH 4IU2B 4P2CG 5T3ZD 1IKNA 1QFUL 1E5CA 1IUZA 2X1PA 4KZEH 4X6CA 4X4ZA 2W0KA 4X9FA 3MRKB 2BNRE 3O4LB 5IB2B 1IT9H 1D2PA 2H0PA 2IXQB 4CAGA 5JPMC 1P1ZA 1X5IA 3PIQB 4YLBA 1FIGL 4MKTA 1FZKA 1J5OL 2IBBA 3H4FA 3HBGA 4MDIB 3L3KA 4LKCA 2OX5A 5C0FB 1Y18A 2OSYA 2PCYA 2VR4A 2AJVH 5B8CA 1J5IA 2V2WA 5T1JA 3DC0A 4XAWH 5CEXB 1QBML 3JWDL 4GJTB 4PBDA 25C8L 2ENPA 4J23A 1H8NA 2EH7H 3L2MA 5DMIL 4K7FB 3VCLA 2X87A 1XF2B 1UEMA 4HAGA 4HDIA 3SPVA 1TIUA 4H2CA 2XBZA 4WGKA 5GZNC 4TSBH 2EIDA 5K9OB 1P6FA 1S7XA 3OKEB 1S7UA 3K80A 1EMTH 3U2SA 1I1AD 3QG6B 4ACTA 3F62A 4A2MA 1FYHB 5IJKA 3MLVH 3MA7A 1K4CB 3L4CA 1TJIL 5ITFA 4GQ9L 2LU3A 3H3PL 3BIKB 4BJLA 4YSSA 3MUGB 4R6UA 2BERA 1Z5HA 1P84K 2IWFA 4RSVA 1Z3RA 5FYKE 4YZFE 2FBJH 1RLWA 3VXUA 5DVOA 4NENA 2EUWA 1WAAF 3HBQA 3GJFB 4WI5A 1J05A 4FA8A 4OFKA 3RWFA 4HK3J 1QI4A 2D7OA 3D0LB 2IDSA 4Z7VB 3KPMA 3V0EA 4HJ0C 1FFPA 3BAJA 1JD9A 1WWAX 1E6OH 4WJ5B 4NHUA 3BGFC 3VXSD 5EUOE 3RZCA 1BYNA 2DOCA 1MELA 1PDKB 1FL6A 2FB4H 3J2PA 4ONGH 4YHOL 4PRNB 5LNDA 5LN4A 1XF5B 3F6LA 3FONA 3IDNA 1MH5B 3BRDA 1XBRA 3NCJL 5M95B 2F7IA 3RB7A 4IMLA 2RCSH 2Z35B 3L81A 4MX7B 1ORQB 3MA9L 4DPBX 4GG6E 4I18C 3QXVA 4I9WD 4A2GA 5FO8B 4Z3IA 3RG1C 1VEMA 2NSMA 5T1KA 3W2DL 1DSFH 5FUOL 3T0DA 1JPTL 3VI4B 2NY6D 4QY8A 3V0VB 4OJFH 2BW4A 3DNKA 2IAMA 2OJ1A 3LIZA 4EIBA 2DJSA 5HJGA 5KSBE 1R24B 1OAXH 4D9RE 1O7DE 2F8IA 3IFPA 1LGVA 1U36A 2HSIA 2VDKH 2W5PA 1SM3H 1JPGA 2DQ6A 3M1BB 4ANUA 2IANA 3ZSTA 1QSED 2A9DA 4OLEA 4IGBD 4PB9H 3OR7B 1P1VA 4PJFB 4WKZB 5EZIH 5J5EA 1CURA 4KX8A 4PJIF 4Q0XH 5AZ2L 2R69H 3T3PE 1F41A 4I0CC 4JJ5B 5FW8A 1F4WH 4X9IA 3N50A 3ARTA 4J3OD 3IB4A 2V3DA 5IW1A 1XX9C 5AVXB 4O58H 4HH9A 4POYA 5DJXB 3F3HA 1U8PA 2EEFA 4JFYB 2ZOLB 4LLMA 4OVUA 5I74B 1WBZB 2MQ0A 3TZVD 3GHBL 4W9CC 5KS9B 5E51A 32C2A 5D5MA 4KRMB 1NIAA 4BWWA 4ALAH 4AYSA 2XV6B 3PHOA 1B3JA 1ZHLB 4L3EB 3T3MF 1W0VA 2X2JA 3AWFA 1N3NA 5DD1L 3LQAL 4M8QA 2X53A 2IBZX 3S5ZA 2IADA 3KE0A 1RJYB 3MNMA 3LKSB 1NAKH 3D2UB 2Z4QB 3QDMA 4RNRB 2IGTA 2E5EA 4LLAA 5DJ8B 1ZTXL 2P8LA 5J1SC 3FKUS 3D2TA 3EJUA 1MJJB 3QIWC 4XMKH 3VFOB 4AEHL 3OXRA 3QXDA 4R7NA 5JOPD 3KPRB 2F1AA 2EXWC 3NH7H 3QDJB 2BNUA 2EKSA 5LCVA 3CFUA 4HH8A 2EDFA 1HEZA 4PJEA 5AW1B 3UO1L 5I76A 1PLCA 3FSZA 1R3LA 2A6KA 3H7BA 2ZUVA 1TVHB 3V2AR 2ZSWA 4QRRD 4EBQH 3WHXA 5A3ID 5D1XC 2Q8BH 2GK0B 1UZGA 3H54A 3L45A 3PGDB 5JHBA 5HGDB 3EHBD 3LH2H 1MEXH 2XTSA 3UBGA 1KDIA 5B1AB 3UTZB 4GBXD 4UAOC 1PZAA 2XTJE 4Y9EA 3TN0C 3QZWA 1DQQB 1BAWA 5DLLA 3PAYA 4HXBH 2P8MB 3QJTB 2VIRA 4Z3TA 3GMNB 3IU4H 3P0GB 5BS0B 5GS1B 5F7EH 5DJDA 4PUBL 4WY7H 2ZKHH 4L4VD 5J89A 3TA3D 3U30C 1Z1WA 3QUXC 3WXVH 1BEYL 4LLUA 2YFNA 4ZTEA 1I1CA 4YLCA 5C0CA 4Z3JA 1KENH 4XPHL 5DS2A 1V8HA 8CGTA 4XOEA 1IJ9A 3BUYA 2V8LA 4X4ME 5JXAL 4KDTC 1KTBA 5FB8A 5I15H 1UASA 7CGTA 1YEHL 4IDJH 3D25B 12E8H 1MHPL 3AS2A 5EOCH 2J25A 2QSVA 4H25A 4LGRB 4FQIL 4O02H 3VFRB 4HHWA 4MS6A 1XF4A 4M61A 2X0WA 3KYMB 2JELH 2ARJA 2X38A 3O2DL 4UQ2A 4Y7MA 5KVDL 1A7NH 2CALA 2HVKA 2JLLA 4P5TB 1SMDA 1KNOB 2WBXA 1IM9A 4PGBB 4A2HA 5CGMA 3DV4A 3DXAD 4E42A 3HN5A 4W6WB 2OI9C 1NWPA 1EDQA 1I3GL 2MOQA 3OC8A 4HUUA 4MA3B 4MWFB 1OPGL 1NIDA 1OV8A 1QP1A 2E3VA 3PDOB 3S8GB 4FS0A 3FTYA 4NC0B 3GS7A 3X11A 4F8OA 1FVEB 4F80A 1E30A 2CGZA 3MRQA 4YFDB 3EJJX 1XGTB 1KJVA 4WUUD 4O5LH 5C08D 3Q2VA 4PJ7A 3VXRE 4OT1L 1H0DB 4H0LC 2K45A 5BRQA 5JHLH 3MMEB 4IRSB 1KBKA 4HBCH 3VXMB 3VXPB 3M88A 5I71C 1OGAA 3H3BC 2VISA 5DO2D 3JV4B 1O6SA 4Y16C 3VA2C 2B14A 3KXFE 2AXGB 1ZK5A 1WEJH 3ARYA 4LARH 4CC4C 3HHSA 3X1FA 2C1OB 1A6VH 2WYHA 5FUZH 4YDMA 2FSEB 3D12B 1JPSL 5F9JA 5ALCL 2GUYA 2KQNA 3ZRCC 1L9NA 4TS6A 3RILA 3QUYC 1W6LA 3ULVC 1G1CA 4NEHB 5E7BA 3N40P 4EMZA 2A99A 3TV3L 2P5EB 3OBAA 2H47C 2DB8A 4UIMB 5MHSE 1HKLL 2QMKA 3VXME 1WIUA 2JKXA 1OCZB 4WFFD 3BZEA 1AJ7L 2TSAA 4UQ3A 5FGCE 5J57B 3BVVA 4WVRA 2ICES 2Z92A 3MROB 4M7JL 2VDKB 4FLQA 1AKJD 1ANUA 1JP5A 3Q8AA 3DX9A 4GIPD 4FQXA 1KC5L 3ZDZE 4U4IA 4PY7B 4NN7B 4L8BB 4X9YA 1TCRB 1VHPA 3S4SG 3GBNH 3UX9B 3EBAA 4LK4A 1T21A 1TTGA 2PNDA 2P5EE 4OZ4A 2YLKA 3CFJB 1HHKA 4RA0C 3VXNB 3ATDA 4ELDA 5L88H 1QHQA 1KT2B 4YBQD 5I0VA 2KC0A 1B0RA 1KOAA 4K7PH 1SJXA 3QCUL 4X98A 4N90D 4GUQA 1PCXA 3FN0H 4MQTB 5FDYA 4G9DA 2XX1A 2Y6SD 3FTUA 3H9ZA 1N9PA 1K6QL 4NIKB 1F4HA 3FU9A 2PYED 4POZC 5KWYC 4KZDL 3P11L 1J48A 4BXVA 1NDMB 3OJ2C 3OX8A 4K3HA 4X6FA 4QXUH 3FB7B 3MGOA 1UA6L 1KBGL 2UWEB 3KCPA 3O3UN 3P3YA 4N2MA 3LNEA 5IVXF 4N0YH 2BHYA 4ZAKD 1IRAY 4Y4FB 5C0JB 5IQ7H 4U1GC 1S6NA 2BXYA 2G3NA 5JXED 4EZMA 4NXSA 4Y5VC 1PZ5A 3MX0B 1U42A 4UNVA 4TVSa 5D2NC 5HYJA 1KZQA 1QKZL 1GYCA 5I66B 3H3KA 5HGGS 4UQBA 1KBVA 5CEZL 3G04B 2XG4B 3JTBA 2PXYA 1KXVC 3WFDH 1DFBL 1I1FB 1UENA 5C0GB 2HT3D 1XGUA 4PBXA 2UWEE 2IEPA 1T7XA 1BM7A 1MLBB 1TF4A 1U91B 3QIBD 3CH8A 3IDJB 3VQ1C 3UTSA 5EIIB 4C83B 1G5GA 4K3JL 3C60C 4WWKA 4ONFL 4PJ5E 2GQHA 2VWEC 2YRBA 3S88H 4OGAC 1FN4A 4N6RA 3DGDA 3N91A 4LLYB 1ZMYA 2HXAA 2F7QA 2NY3C 4G8AC 3X13A 3B37A 3F04A 5DMKB 1P9MC 2JJTA 2Y1ZA 3LPOA 1KB5A 5E8EB 5AOIA 3F5WB 2I7OA 4IIQA 3JVGC 3V10A 3KL5A 5F3FA 2QTVA 4ODVH 3GEWB 3S96B 4ZFOL 2OMWA 1RIUH 4I77L 5F9WC 5M94B 1GSMA 4FE9A 1BX2B 4DAGL 3DBXB 4PRHA 3KLHC 3MBED 3CLWA 5SWZB 3RFZC 2BOBA 3QFDB 3U4BH 3VWJA 1B4TA 1ZLVK 3PWPD 5I1CL 1I4FA 4YE4L 4YN3A 1RZJL 4M48L 4JDVB 2G0KA 3F12B 1OAQL 4AYEC 4O02B 2J8UE 3DDFA 5B3SB 2FJUB 2XWEA 3BPLB 4MJ2A 4DW2H 4OZFG 4GW5A 1SMAA 3MUHL 1K5NB 1AZZC 4R5TA 4Y5YC 4P59H 1H3VA 2A0LC 3ME0A 3NZSA 4UTBH 5E1IA 1HHHB 1JHTB 4APQC 1JHLL 3SYOA 3O2DA 5JORB 1URZA 3C8KA 4FABL 1BAGA 7PCYA 2G9HA 5GGQH 3I3EA 1YMMD 3RURA 3KPSD 5B21A 1KZYA 2EDYA 1FO0H 2KL6A 3ZMNA 4HJUA 3WHE0 1J87A 3MV7A 2VR9A 1MFCH 4IOFC 4E9SA 3HS0B 4OM0L 4PWHA 5EU3B 2E4FA 1JK8B 2Q86A 2BJML 3C5ZC 2AMGA 3UZEA 3I9GL 5C0NC 4N8CL 2VQ1A 5DC9B 4P99A 3CZNA 1HH9A 2X0UA 5E6ID 2CHXA 1ZS8B 4JAMB 1OOWA 4BH7B 2YSTA 3S36X 3LRSA 3NIFF 5HPOA 3UYPB 4XMPH 1BAFL 5KZCD 3SE8H 5L0QC 1BMZA 2VERN 5D2LF 3JT2A 4PJHA 1H3PL 4UAHA 1HSAA 1CTMA 1GL4B 4UT9L 3DHUA 1E8YA 2BVPB 1SY6H 1FWXA 2QV4A 3LPFA 3HAEA 4GSRA 3FTGA 1G9MH 1HI6A 3VG0H 4ODUB 4GRLD 3SPJA 1N8ZB 1FL5B 1HESA 1T2QH 4FLRA 3RFRA 3U36A 2QHRL 2R4RH 1ZLWK 3S3CB 4OLUH 3WNIA 4C56B 1E28B 4ZPTA 9CGTA 3C08H 1HK6A 2YEZA 1KXHA 5BRZD 1KGJA 4XVSL 5B3JE 5MEOA 2HJLB 2WBWB 3PABB 1UB6B 2ZWSA 3DMMB 2WAHA 4JQXA 4R26H 1ZVHA 4NBYB 4OCWL 2R4SH 4FTVD 3VFVA 4G83A 2K78A 4OLYL 1IVLA 4JANA 2YXWA 1TOXA 1C12B 4XN8A 3ML9A 1OQOA 1HNYA 4K94H 2CIKB 3C75A 5D1XE 1AGBB 1Q38A 1WTGT 4N0FA 4OCYL 1CLYL 1I7UA 1DQKA 4RMWA 5MP6H 3WIIL 4C4UA 4F7EB 2C1PB 4YBHA 5IBLD 1BVKA 2XNAB 5A2LH 5CJ5A 4MVBD 1FPTH 3PE9A 2UX6A 1KLUB 2NY1C 3ZYOA 4NRZA 5EMYA 4W9ZA 4P4KC 1TMCB 4IJ3B 2A9NL 1NMCB 2YN5A 5F89A 2Q8AH 3QQ9D 1JNNL 4MNGB 5J11B 4X6DE 1KFAH 5FO7A 3U4AA 1TFHA 3ISWA 1T4KA 1MCIA 5D70H 3QEQE 1WWCA 2NRDA 3HPJB 4XNXH 5IB4B 1YYLL 4JFFB 2DD8H 1T20A 1X5XA 4WI0B 2BY1A 1ZGLP 1J8KA 2V5SA 2JKTM 2XVBA 4UT6A 1LD9A 4LCWB 4F33B 1IKNC 3QPXL 3GXMA 3I02A 4WFGD 3BSHA