2COVD

Crystal structure of cbm31 from beta-1,3-xylanase
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
92
structure length
92
Chain Sequence
PPENCQDDFNFNYVSDQEIEVYHVDKGWSAGWNYVCLNDYCLPGNKSNGAFRKTFNAVLGQDYKLTFKVEDRYGQGQQILDRNITFTTQVCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords beta-1,3-xylanase
publication title The first crystal structure of a family 31 carbohydrate-binding module with affinity to beta-1,3-xylan
pubmed doi rcsb
source organism Alcaligenes sp.
molecule tags Sugar binding protein
total genus 23
structure length 92
sequence length 92
chains with identical sequence E, F, G, H, I
ec nomenclature ec 3.2.1.32: Endo-1,3-beta-xylanase.
pdb deposition date 2005-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF11606 AlcCBM31 Family 31 carbohydrate binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2450 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2covD00
2COVD
chains in the Genus database with same CATH superfamily
2NXYD 5BPPA 3FFCB 5DQJA 4N6RA 3IAGC 2ZUQB 2ZWSA 3BGFB 3UTTE 3ZDZE 4E9YA 1YEEL 3M7OA 1OW0C 4MJ5B 1TQBB 3F7RA 4MKMA 3ZYIA 2DRUA 2X38A 2VIRA 4FFVD 5TK2A 3VFNB 3P4OA 5E2UL 2KPWA 5AVXB 2WXLA 5I8KL 4HUVB 3GSUA 1OCRB 4Z77A 3H2WA 3D0LA 2FDBP 2NY5L 2NR6C 5EEZA 1XCXA 3TF4A 2BMKA 1II4E 5D1XE 3OGCA 4RZCA 3SPHA 2B5IB 5E5MA 3UX9B 3K1DA 4Q9QL 4MZIA 1WK0A 1Z9SB 4LPUA 5DHMC 1JAEA 3CDGA 3ZYOA 1P69B 2DF3A 4I8DA 3QUXB 4KO5A 5F9OH 2YA2A 1GCYA 1U8OB 3ML8A 1AC0A 2OJEB 4R7NA 5FA4B 3KLSA 4MNQB 5FXCH 1RMFH 4KAQL 5DEZA 2P80D 4LKXB 3BAXA 2A74B 2V5MA 1RKRA 3C5ZB 3EZ8A 2YEVB 5I8OL 1JXFA 4ABUA 4PY7B 1BJ1H 2Z0BA 3CN0A 3OC5A 1U3ZA 4Z7VF 5BMFL 2QTVA 4EN3C 4QRPD 3D30A 4Z7QB 1O7DE 3QUXD 3I6KB 3N43F 3JT0A 3Q1SH 4MMZB 1FDLL 2MSPA 2DICA 2F53E 4NT6A 4FXGC 4N2FA 5JOPD 3RDTD 4MA1B 1ODAA 5BXFB 4ELMA 4Q6IC 3C5ZD 5D1QC 4LLWB 4AX3A 4A6YA 5KBPA 4WUUA 1PQZB 4NUQA 2WYZA 3BUDA 4KZCA 2D7TL 3RIKA 2O5ZH 4HS8L 2ZX7A 5E6UB 2VDRB 4HXAH 1UOVA 5LNDA 5CEYB 3V6OC 1E5UI 3WFHA 5AENA 2BWQA 5CJXC 1JTOA 2KZKA 5I24A 1QSEE 4ZDHB 4BFOA 5KVDH 1FGNH 3CSPA 4MJIB 25C8L 1CDBA 2Z4TA 4WJ5B 2ED6A 2JKNA 4YLCA 2VABB 3QQ4B 3I75B 3HB3B 4AMKL 2CQVA 1E4WL 4X7TA 1NFDE 4F20A 2HJLA 2NSXA 1DANT 4DAGL 4DUXA 1H6UA 4M5TA 3N42B 3QNYB 4X4ME 4X5LA 3RE0A 1AQMA 1D5ZB 4I88A 4X8XA 1ACCA 3CN3A 4YDKH 3IGLA 2FO4B 4Y5VC 5I5MA 4NQEE 2WYTA 3KBEA 4ABWA 2K6ZA 1QLRA 3U9PH 3BGMA 3CSYB 4KRMB 4MJID 3A24A 3BW9A 5CSZA 1CPUA 2X28A 1JV5B 5EF1A 2PPAA 4ZQTA 2VH5H 1INQB 3HB3D 1L7TH 1JWUB 3G7TA 3M1BB 4UNIA 1NKRA 2CCWA 1P7KB 3AQDA 4I7ZC 5D2NA 4I13B 1KBPA 1VGEL 5EU6A 1E5AA 3KS0H 3VXTB 3TF7C 2GEEA 3BT2L 3MV8A 4A2FA 1BVLB 4YE4L 4OD2A 5KYNA 3W1ZA 3FCTA 4MMYA 3RHWF 1XBRA 2EO1A 1MCCA 3C60A 1OCWH 5D4QA 2B20A 1BGXL 1L9OA 5EOCH 1XXDC 5HDQH 2Z4QA 1RPQA 1U9KA 3B5GA 4R26L 3UTTA 4EIGB 4GI8A 1YQVH 3H53A 43C9B 1YY9C 1ET7A 1AG0A 3MRHA 2H4EA 2ICEC 3RWGB 5I1KL 2IWFA 2VLRA 2DJMA 4G43B 5A2LH 5E99H 1DBAL 3K2KA 1RZQA 3BWUC 3ZIYA 1F41A 4M4RB 1T4WA 5H94A 5D1XA 4UNVA 3QO1B 4ZOBA 3REVA 2DPKA 4DGWC 3SYPA 3V6BR 5A2BA 1KGCD 1ZS2A 3CFDB 4PJEF 5JPNC 2VN7A 1PEWA 2MWCA 1DBJL 4JRXD 2R2EB 3AWFA 3KXFE 3RBSA 4KKAC 4UOW1 3RY6C 4AQ1C 4CL7A 5KWYC 3CZFB 1KLFB 4HUWB 4RSYA 3S97C 5GGUA 4DP9X 5HHXL 2FYYA 4M7JH 1MHHB 4Z9KB 2BIOA 5JR1H 1CE6A 4L4VB 5GGRY 4ZTOL 5F7HA 4MD5A 1ILUA 1N7ML 1WFOA 1T6BX 4QMEA 2YUWA 3ZE0B 5DSCA 2DYSB 5DD0L 1RULH 3QR0A 5IVOA 4UYPA 1FO0L 4Y4KA 1I1FB 2F53A 3NSCA 1RP9A 3LN4B 2A1WH 4WCYL 2HTLC 2YD3A 5AW1B 3VB9A 4HOZA 4UQIM 1U3NA 4KKBD 1UB5B 4UILL 1EANA 4PJFE 2BVTA 4OIIL 5D7KD 1KBWA 5IEHB 5A43C 4N4YB 2NSQA 3VFVA 2COVD 4FQIL 5AUMA 4G7QB 1A7NH 4L4VD 4F9PA 5G55A 4P59L 5D6CB 1IM9A 1T21A 4IOSA 4DZ8A 5F7WC 3V10A 1I1AA 5DQDH 1M9SA 1QSEA 1KGWA 2PCFA 1HINH 3QYCA 4AQ8C 3HC3L 5DTFA 2VN3A 3BD5A 4PG9B 4FS0A 4P2RB 1NAMH 1PSKL 3UAJA 1TSRA 1UUNA 3QRBA 3WSQH 1OKEA 1OCCB 3ETSA 4BQ8A 3IRPX 5D70H 1NFDA 4X7FC 2W5PA 3ILEA 3IMSA 1XF3B 4NHCH 4MCMA 4MJ2A 1XGYL 5C0DA 5ICZA 1JV2B 2AEPH 1NCDH 4LSQL 4X4MA 4DGVH 2R83A 4BZ2A 1CE1H 3IFPB 2K3HA 5E5UB 2XDHA 1YEFL 4WTZG 4NNYA 5E8OA 1YMMB 3N06B 1IC5L 3BH8B 3CHOA 4NQEA 4E5XB 1TNNA 3HE7A 3DO7B 1LM8V 3QJHB 3RFZC 2PPDA 3DRTA 1RIHL 1T7XA 3FQXA 3DGDA 4GMTL 1JPFA 4X6DB 2EH8L 4G1EB 5AVQB 1B3IA 3SE8H 4K5MA 4FFZL 2BP8A 2DDQH 1CS6A 1NL0H 4TQHA 4KKZA 4BFEA 2ADGB 4XXCA 1FL5A 4PJ9D 1OSPH 3RIFK 4TPRH 3TIEA 2VXTH 1MQKH 1WPCA 5HGAB 4YPGA 1GY1A 3SCMC 1MFUA 2C3WA 2OMWB 3CFKB 4XCYA 1V3JA 2BIIA 3LDBC 3OHXC 4LCWE 3VXOB 3WNPA 1MCWM 3NIGF 4FNLH 1YMMD 1EK3A 1XH1A 5DS1A 3QORA 1A9EB 3U1SH 4N0CD 2JJWA 1Q9OB 1SJEA 3SDCD 1IILE 2IWGA 4A7VA 4QHKJ 3BDBA 4LLMA 1BAFH 4JQXC 4ONHB 1M2VA 3TBVB 1WFJA 3T0BA 2CBOA 3B9EA 5CEZE 3E6FA 5F97E 2WTRA 1WHPA 5DCCA 4ZUSA 1UTDA 2G0KA 4E9QA 3QIWD 2CHZA 1SOKA 2FNBA 2NX5A 4I5BB 2ILLA 2X6BA 3P11H 5I75C 4GBXB 5KS9E 2PWDA 4G8IB 4NAMA 3C6SB 4NO3A 4PJCF 1EZSA 3N1MC 3X11A 2DWSA 2F1AA 2X4TA 3FTUA 1RZ8B 3MBEB 1JTPA 4HJGB 2ITCB 3TX4A 3VXUA 4EDWH 3WD5L 1SBSH 4XMTA 4RGOH 1IVLA 1DCLA 1ZANH 3KXFA 1K6QL 2JWYA 3K8KA 2OFQA 2HG5A 3PNWB 4TL4A 3QQNA 3JZ7A 5BVPH 1F97A 1FYTE 1CD1A 3ISWA 2AKRB 2CK0H 4HC1L 2XJLA 4A2LA 5HHVL 3MRPA 3THMH 3ZGIA 5A6LA 2FZ3A 2ICES 3U2SB 2ZUSA 3BCDA 3T6XA 2NZ9C 4QXGH 2UXVA 4UT7L 4G5ZL 3BE1L 2JJTC 3QIBB 3QYMA 1RZFH 4HX1B 1EXHA 4MVBD 3WE6B 4R3SA 1T03H 1AGBB 3PWLB 1M05A 4Z3IA 4DHLA 1IGML 1QLFA 2WMPB 2N3JA 4OCNC 2GYSA 2ZICA 1U8CA 3PJLA 3RWJA 3VDCA 5J6GB 3VI4F 4Y9FA 1EHKB 4ZAKA 4I0CC 2MH4A 4S1DC 4B9CA 3FO9B 1N67A 4PJFA 2WLYA 4O9HH 5E23A 1DL7L 5GSVA 4HOMA 3NGBC 2FX9L 5IF0B 2J1YA 4ORZC 3O2DL 1WA0X 2OZ4H 4YHPB 4YX2L 4M3KB 1IGTA 2B1AH 3OXSB 4TLKA 3MREA 5CN3A 1TCRA 1ZSDA 2R9HD 3KWWA 2LOEA 4Z7WE 2DLFL 1FNHA 1N8ZA 3KJ6L 4GRMA 5I0ZA 4WIQA 5DJ8B 1CDIA 1KN2L 1WP6A 4QJ4B 1DFBH 1RUQL 3WFEL 1INDH 1B2WL 2YK1L 4YAQA 1F6AA 5FUZL 3WDIA 4XBGA 1H6TA 5IR1B 3MUGB 2EE9A 3ARBA 4PCYA 4N22A 3VFUA 2CDFA 2OYLA 2K1MA 3ROLA 3TNNA 3QUMH 2WXGA 1X4YA 4IKNA 4ZW3A 1I9RL 3BUPA 3GNML 2WXMA 1U4EA 3NIDE 2VXQL 4WTWA 4ZMZA 4HJJH 2CLRB 2GI0A 1UATA 1QLEL 4I3RH 4QXUH 1WSST 2IGLA 1NCWL 4HKZA 3O45A 3DUUB 3GXDA 3CFCL 3RNKA 1A1NA 3S88L 5D7SH 5EO0B 3IVKA 1BXVA 4UTAH 4F7CA 4C56B 1ZEAH 1E65A 2W65A 4ODTH 3L4ZA 5J57B 4PTUB 1I8KB 4V1DE 3LYRA 1CDHA 4KXCA 4PBVC 5F3HA 2YPLD 5KYXA 5ITFB 2AANA 1QW9A 5FYKD 1EDHA 3N40F 1I8MB 1DVFB 4HWNA 2V17H 4GW1A 2QPEB 3QWQB 1WTLA 5C0IB 4K7PL 3GMMB 1U95A 2VR9A 4LCWA 3NACH 3O2WL 1S7VB 4RGMC 5C0BA 5DD3H 2HJKA 1N26A 3D08A 3L5WB 4L5FE 2ZYIA 3WKMH 5LVEA 4RMVA 4AC4A 4WO4A 1JZFA 2BP5M 1Q0XL 1FNSL 4LPYA 5FYJU 3GRWH 5CJQH 2HRPH 3MUJA 3F7VA 1S9XB 1NGPL 2VDPH 2YBRA 1DVFD 4OZGE 1ZHNA 3GSOB 3GIZH 5EO9B 1MCLA 2OL3A 4BK5C 5E5RB 5HYFA 5KS9A 2AJXL 3A3YB 4NOBA 1J87A 2E47A 3ARYA 1ZLSH 3BJLA 3HNVH 4HMCA 4MZRA 2VDNB 1IC7H 3PV6B 1H5BB 3FSZA 4AOFA 4A55A 3JTSB 3VFSA 3BN3B 5DRXB 5CSGA 1C8PA 1K72A 5D8JH 1ML0A 4P2OA 3C6LB 3CGTA 3FN0H 3VCLA 3BKYL 4JY6A 1ILSA 2Z7YA 4MS6A 1FYTA 2GK0A 3FU3A 3D85B 1RU9H 2BNUA 2BCMA 1FAIL 1NOFA 1HOCB 1F3JA 3O3DA 3RI5K 1DJWA 1A3RH 4U6HB 5ESAA 1TJGL 5EU5A 5EZJA 3E3QC 1H8OA 4JE4B 5K9KA 2VGLM 3K0YA 4JFWA 5JIQA 4K8RL 3IFNH 4IU3B 1HWGB 2GJ6D 4WDIB 1DSFL 1LEGB 3MNZA 1XSKA 2A3TA 4KKRA 1BWWA 2MOVA 3C6LD 1GYCA 1QVOB 3A6BL 3S48A 1QR1B 5FEBA 4J2QA 1WBZB 4IQHA 2RCSH 5I1GH 3S4SA 4M48L 4ZFOA 1UVQB 1JF5A 3MYJA 3P3SA 3VXMD 3BUYB 2DLHA 3EYQC 1QRNB 2I7SA 4KZ0A 1JXJA 4APXA 1MPAH 4Z7WA 2O72A 3IFLL 3MV9B 4LLDA 1GYUA 3VM7A 4NENA 4QRPE 1A14H 2J25A 1EEQA 3PXHA 4OCSL 3GMPB 2Q7AA 4LCCA 4G9FD 4ERSL 5HHNB 4DVRH 1ADQA 1KJVA 2R1XA 2YXMA 5JOPE 2R51A 4BE5A 5I74C 2PR9A 2PP8A 4M93C 3TA3A 1PZCA 4UBDD 1KT2B 1XSIA 4JRFA 3PDDA 1MCBA 2YQBA 4NZUH 4GUPB 1EZVY 3F7YA 5IW1A 3LEVL 3I2CL 5DJZA 5I18L 4F58L 2UXGA 1QRND 1HKLL 2FX8H 5AL8A 3CLFH 4A7UA 3GMQB 3MV9D 3BC9A 3SDYL 3WHXA 4FHJA 4Z7QE 1QP1A 2DL9A 4GOSA 1I7TB 5HYSG 3VH8B 5KYUB 4V1DA 5I5JA 3BXNA 4HZLB 1E5BA 1DJZA 3IRZA 5AW3B 5CJOH 3S98A 2WK2A 3V8OA 1MHPL 4I3SH 4OGAD 3LZNA 1UOKA 5D7JA 3VFTA 2E3VA 1MCOH 1O7SA 2ZXCA 2CLVA 1XB8A 1ERNA 3GLAA 1A02N 2XTJB 2DIBA 2QR0B 4P2AA 4OLWH 3H3KA 4GRLA 1I1YB 1GS8A 1NJ9A 4JB9H 2FUTA 3PGFH 3VSTA 4NGHL 4DN3H 3NFNB 4XB7A 3UTZB 4FP8H 4J6RL 5DO2D 4PP1D 3NZHL 4MJIE 1BVKA 2BC4B 2YD8A 3WTYA 3HI5H 1U8LA 1J0IA 3KPPA 5E95B 4LHJB 1UD8A 4CGUB 4YSRA 2X6VA 4F2FA 2N7BA 4PJAB 4OZGA 4YHLH 4X4XB 1GPOL 3HKZA 5EHFA 1AIZA 32C2B 4ABQA 5HGGS 4QHLA 3FAXA 2EECA 3CCHA 4OQTL 5EH1A 3QXUA 4KQ3H 1QBAA 1UD2A 4H25B 1YEJL 5CCJA 5HDLA 2WWOA 7PCYA 4LMQE 2J43A 1FORL 5FR3A 4PMEA 2DW5A 1UA3A 3TASA 1WAAF 5BJTA 3VFGH 4P2YA 5K39A 1OHQA 3PGDA 1NSNH 1K8DA 4IBWA 1KCUH 3ZUNC 2F0CA 4XI5C 3V4VL 3S96B 3B2MA 3QIUC 3LH2H 4WY7H 2DL2A 4MQ7A 5CHNB 4AITA 3EDEA 3ZGHA 5D5MA 1SLVA 5C9JA 4PUBL 4HIIA 4ODSL 1WE5A 1Z9LA 4HFWB 2RACA 5SX5H 4D7PA 4G82A 2KZWA 2KHAA 4OGYH 5A2FA 3L95B 4JQVA 4A04A 2NR6D 3QJTB 3GTNA 1KJ2B 1WEJH 2YA1A 4W9LC 2P80A 1E6OH 3BAEH 3NSYA 2BRRH 1HYRC 2AXFB 4M62H 4NQXB 1CLZH 3GC3A 3L1EA 1R9FA 1MFNA 2BSBA 4OIFA 2FATL 1JHKH 4HUVA 2Y5EA 1CXFA 3FQRB 5C0GA 2OYMA 4MB4A 1UACL 5KVEL 4MTMA 5FCUL 1T0MB 2AJUL 4PLJC 2DYPD 1OZUA 2X4NA 3KGSA 1KUMA 1NFDF 1A6TB 1Z9SA 1JZ6A 4QRPA 2P46B 3GDBA 2HJFB 1IBFA 2AK1H 3QUXA 3K6IA 1RLWA 2XWTB 2OJEA 4QRUB 1TZ8A 2WOBA 3RDTA 1LQBC 1HI6A 3GJFB 2A74A 4KK9C 4KGLA 3C5ZA 4H26A 5D7EA 4LXFA 3QJUB 3MGAA 1EERB 1W8EA 4K3DH 1EO8H 5B38B 3MOBL 4MJ6B 1MOEA 4L4VE 5E8EA 1YNLH 1AZUA 1PZAA 1WIUA 5HYEA 4LOEA 4GSDH 3ZMRA 2XU9A 4CUCA 5D1QD 4LO9A 5EF0A 4PBXA 3ZE0E 7FABH 3I6KA 1QBLH 1UGNA 4NWUH 5GGSA 1NCCH 4MMZA 4B3EA 3ZKSD 2X6AA 2YHGA 2WY3B 5EORH 3KD4A 4XN9A 2UYLA 3CMOL 1L6PA 1SJVA 2QVKA 4PQXA 5F1IA 4LLWA 1M4KA 2CM6A 1XD0A 1L9SA 4JRYD 3VSQA 4BYHA 2R4SL 1QI5A 1SN5A 2JQZA 3E1ZA 5KVMC 2AC0A 3VGEA 2VDOH 3MLVL 1UASA 4ZUWB 4KNQA 4Y5XC 3R4DA 1YEIH 2WQXA 1EPFA 3UYPA 5IHZB 3AS2A 2IIJA 4PV8B 3C8KA 2YAQA 1ZKAA 3G6AA 4YGAB 3E2HB 4P2RE 1BFVL 1MELA 2WXIA 3F6LA 4JFOA 3HZVA 3E6HA 2E5EA 1CFTA 2JELH 4WWOA 2XN0A 2ZXQA 2X4SB 4QF1A 1GGCL 1SHMA 4PIRF 1BDYA 5FK9B 3PWVA 5HDBE 3NRQA 1MCJA 2X5PA 3T8XB 4FFWD 4CGTA 1YMME 4K9EL 5F9AC 1A64A 3GS7A 5AOIA 4W9EC 3TEXA 3ISRA 3Q1EA 4XMXA 5DR5H 3RTQC 5GXBB 1R5IB 1JV5A 4X6DE 3I50L 4X9IA 2YOCA 1AIFA 1XH3A 4OVVA 3ZTNH 3KG5A 1ORQB 2EEFA 1X7QB 3TIDA 4JO4L 2IAMB 5JPNB 4M1GL 1GKEA 12E8L 1TZAA 2ITDA 5HDWA 2NY0C 1J88A 3VXTA 3HW7A 1U41A 4XNQB 1U6AH 1BVLA 1YY9D 3NMEA 4PJFF 1SOQA 2FRGP 3ABGA 5BRPA 5AVTB 1ITBB 6PCYA 1YUHB 4BQCA 2WLMA 4NN5B 1FQ9C 4JRXA 1NDGA 4BH8A 1C5DB 1OOAA 1N70A 1XSJA 3L9RA 3QRGH 1MFCL 3JWNE 1HIML 3O6LH 2LQRA 3LQZA 4XAWL 3Q2NA 4NP4L 4G43A 4TOYH 3EH1A 2ARJB 3QK0A 4M4RA 3QO1A 5IHLB 3UPRB 1JF1B 4N3TA 5LNEA 4PS4H 1V3LA 1IKFL 1J5IA 1A6AB 2FJHA 2J5LB 4U05A 2YD0A 1I7RB 3CFDA 5E8PA 4FLOA 3MNWB 2MFNA 1C5BH 2R2EA 3BP4B 3JUZA 1QZNA 3IXTB 5L4FA 3PGCA 3PHQB 3KLQA 1W72H 3IJYB 1JGIA 2ZYRA 4N1HB 3RZCC 3P2DA 4QHMA 4CSTA 2AEIT 1R3IH 5GZOC 4JY5L 2WXQA 4U0QB 4AKQA 3GBMH 3S3PA 3RWHB 1MHHA 3ZSTA 4J4PC 2Z31A 4NQUA 3GLEA 4L4VA 1F02I 2MTPA 4HUXB 2HKHH 2HTLD 1SY6H 3DV6A 4UIMB 4TNVF 2VDLB 5CP3A 3VRIB 4OTXL 1YN7B 1L0PA 1N0LA 4IGBB 4N90E 4ACPA 4XP6H 3KEHA 1I1FA 4H8QA 2JIXB 4PGJA 3HS0C 1AANA 2C7UB 2XFGB 2M26A 1KBKA 4YBLC 4QJ3B 5DJCB 1UB5A 2EUZA 4OCWL 3OAUL 2A6JB 4MX7A 2D7MA 3HHSB 3K80A 3RFZB 5ADPL 1DQLH 6PAZA 3HAEB 1TTFA 5GGTL 3VA6A 2NY6C 5D6CA 4ZPVA 1NA8A 3D50A 3H6JA 1B2YA 3L2LA 3GXUB 3CFIC 1I3GH 3SQOL 5CWSA 3EJUA 1IBYA 1CGSL 3INUH 2JIXD 4IRSB 4J3TA 1T83A 3KPOB 1O75A 2BVOB 2IH9A 2HN7B 4NLHA 5KS9F 4XVTL 4PVMA 2YPLE 2J7LA 1E28B 3ULVD 5FYKE 3LHPL 4PJ9A 3K4AA 4XCFL 4FMVA 3BZDA 1OAZH 4LSUH 4HH9B 4B50A 2VMJA 4HMEA 4U1LB 4BBWA 5GZNC 4APQC 1RI8A 1R19A 3J2PA 1KGXA 5DQ9B 1YMMA 3BH8A 4H88L 4AKOA 1A4CA 2I5YH 3DO7A 4KZDH 3N5AA 1AS8A 2XUWA 4G59C 4WTZA 3SDCA 2B59B 3DX6A 4IKKA 1YPZB 4X6DA 1BJ8A 5FV1L 1MNUL 4G1EA 2W94A 1E5ZA 1NGYB 3JV0A 4PJ8B 4I0PB 3OMIB 1R3KA 2ADGA 3L4YA 4LSVH 5E2WL 4OCRL 2WJ5A 3NJMA 1NBVH 1GOGA 2VR3A 3QIWA 4DIXA 5JXAL 3TBSA 4OD3H 1IGYB 3LX9A 3K8MA 3P2TA 4JVUA 4LIQH 2ZWYA 1U8HB 4X0NA 2PNDA 2Y69B 1QNZL 4U31A 1W91A 4G6JL 1Q9OA 4ZTEA 4YFLI 3MLZH 4HK0B 3NEOA 4ONHA 1M71B 3G9AB 4G1MA 3TYFB 3RYMA 3RDJA 4GY4A 2CKBL 4UAHA 5JW5A 1NBQA 5F1NA 3SPVB 1ZLUK 4DK3A 5KG9B 2C9SA 4AJWA 4KJQC 1Q0YH 4M00A 2XFXB 1OAKH 4G8IA 3C6SA 3VFWA 4YSQA 4FEMA 3G5VA 3KYNA 3NIDF 4HEPA 1RZ8A 1X4ZA 4GO6B 1SXCA 2ITCA 1I85A 4N2IA 1BZQK 4MA7H 3TCXA 4HP5A 2GBAA 3TH2T 1JNJA 1J7VR 2JVUA 4PS8A 1AVAA 4BUQA 1ZJBA 3O3AB 1CFQB 3PNWA 2NZ9D 3OL2A 1TPXB 4PGDA 5H8DA 4JKWA 4XMKH 3UXFA 1FNLA 3QHTC 4G7VH 3EJJX 1WCBA 5IG7B 1KTLA 1NIEA 3JUYA 4MXWH 3LIUA 2BVYA 5JW4R 3JTTB 2KDGA 3GMOB 4BA0A 1ZMYA 2QQNH 4GKNB 2YFOA 5B1JC 3UO8B 3RIFF 4XZ4A 2YRPA 4HX1A 3ERXA 3BSGA 1UD6A 3FPXA 4GT7A 4FYRA 4WAFA 3WE6A 3X14B 4OB5L 4WSGA 3PWLA 1MIML 2BERA 1UCBL 2J4WL 1IEHA 1Z7JA 4FNSA 1JS4A 4LNRB 5J6GA 3LJ3A 1X5XA 3GXNA 2EIKB 3G5WA 1N4XL 5C0JB 3NCCB 5F9WB 1OHZA 3OV6A 4I77H 5F1KC 3MRMA 3BQVA 4GH7B 4H1LH 1F13A 4PJDB 3WYRA 1OL0A 3FOLB 3EF4A 2BSRB 1ZTXL 3DIDA 1WFIA 1OAYH 4LARH 1BEYL 2YS4A 1HXKA 2L04A 3OXSA 1QRNE 2XSKA 1FSKC 1MDTA 3IK2A 3MV9E 5DJ8A 4BRVA 4OZGF 1OSEA 4U7SA 4I1RA 2WHVA 1WH0A 2YRBA 4L29B 3HR5A 4IDJH 2H0JA 2B3IA 1IKNC 2VAAA 2LU4A 4G6MH 4M7LH 4U1GC 3UZVA 1XO8A 2XKSA 5IR1A 3MUGA 3QZWB 2VXSH 2YPLA 1EHXA 4B9IA 2AEWA 4R8WL 2FGZA 2WNGA 3GJFK 1MW3A 5A2JH 3AB0C 4L1BA 4OFVA 2K8QA 4KHXL 2HUHA 3MLWH 3L45A 1UM4L 1XF5B 2AEOA 2JJSC 1ET5A 5I30H 1EHAA 3DUUA 5IY5B 4LLYB 5EO0A 3P3TA 1URIA 3N9GH 2DQTL 2GUYA 3EYFB 4PS3A 3LMJL 4DEUA 2KPNA 3FQ2A 5EEWA 4H8HA 2R0KH 1IKOP 5ITFA 3SDAB 4HOWA 2GTZB 3O4OB 4X6FA 2CO2A 5CU5A 2Y06H 1KPUB 5D9SB 3BUIA 4N1CA 1DVFA 3CH8A 5J1AA 3NH7L 4PJIB 5EIIG 3FUIA 1N18A 1PL3A 4HIJB 3FU7A 1TZOA 1S7VA 5KBDA 3NSDA 4FI6A 3EH4B 4LEXH 1IB5A 3N40P 4N2CA 3L5WA 4RA3A 3AFLA 1XGZA 3AITA 5AZEL 1MVUB 1NCAL 5BO0D 3DYPA 3KLAB 4OV5B 3CVHB 4KI5C 4X42A 4OZHB 1JXGA 4KXZI 1TLKA 2JE8A 4NQTA 3TO4B 5A16A 4XCCL 1NKGA 4PJAE 3Q5TA 1I8LA 3GSOA 4B5EA 3BQUC 3KCPB 1KXVA 4KH2A 2YC1B 3HFFA 3OB0K 4ZFZB 4ENZA 2VMFA 1NMCC 3F12B 1H3WM 4JZJC 5LNGA 1H19A 2EXWC 2DM7A 5I0DA 3EJYC 4OAWB 3SBWA 1GY2A 2F58H 2JXMB 3X1EA 1OAXH 1P9MA 3NCJH 3PV6A 1H5BA 4HYTB 4AZ8B 2GJ6A 3JTSA 4Y2DC 5E51A 3SODB 1UWEL 1MLBB 1LO3H 3T6WA 3FQ1A 2XOTA 3C6LA 3K2UL 4DEPC 1KXQE 4G7YL 4OF7A 5KSAB 1EEZA 1AJ7H 4Z7QF 3ZTDC 5CEXB 3GHBL 3B6SA 4YXHH 4B9JA 4MDJB 3MOAL 2P8MB 2VL5B 2X9YA 1J1PL 1TVBB 3IN0A 1MCPH 4H13C 3VXMA 2EYRA 5D7HA 3VFOB 4CC4C 1U3HB 5T5FH 3MRKB 4QHPA 2Q3AA 2FEJA 2QDWA 5TE4L 1F56A 1AZBA 3KPSD 3WS3A 1Y0LB 1P0SE 4IU3A 1UD4A 5FECA 2EC9T 5TF1L 1BQ5A 5EU3B 3ZKXC 1P7QB 4TXVB 4ATWA 4G9FA 2NY5C 2VLKB 3EYQD 1QR1A 1MREL 1Y1DA 4HXBL 5DWUL 4C47A 5DUPL 4K3EL 4O58L 4XNUH 3SJVB 1WBZA 2WIIA 4WFHD 2JLPA 3LNHA 3HA0A 4S2SA 5BUGA 2ZOKA 1HHJB 4HHGA 3BFWA 2PP7A 2DM4A 1XB3A 3BUYA 4JKKA 1QRNA 3FUFA 1U3HD 1NAMA 3CBJB 4YWGL 5FLVA 3CHRA 4O2CB 3MV9A 1X7TA 4JG1H 3WMQA 3QZNA 2F7PA 2HLEB 5B22A 1DFXA 4AJVA 2BS8A 1P7QD 2J6EL 5C0CA 3N42F 2FJGB 3FQUB 4UZSA 3X3FL 1QBML 3VG0L 2YA0A 3CQFA 1OB0A 4HWZA 5IQ9B 4M61B 2FQGA 3PIQA 5EV7A 2VKXA 5ILTL 2NY7L 2E6PA 3BP7B 2X12A 3W2DH 1HHGB 4JFZL 2ZOLB 3APNA 2CO7A 4YFDB 1E0OB 3S36H 1HHHA 4BA8A 3CZLA 4DJMA 4U49A 1TFPA 2NYYC 1Q9KB 2AAVA 3FO0L 4UQ2B 1AGDB 2CD0A 2QSQA 3BPOC 3BX7C 4NM8L 1NPUA 4H8UA 4Z0XA 3SDXB 2CIIB 3RI5F 4JUTA 1I7TA 4DO4A 2CUAA 2PO6B 3QR2A 4YHOL 2PWEA 3HBQA 4XP5H 2AJZB 2F68X 5GGSY 2J21A 3WEBA 4ZX5A 5K9QG 5JHDB 3O41B 3CV5A 4QXTB 2X2YA 1FGVL 3LIZA 3QG7H 4WHYG 4FQPA 4NWTH 4ZUVA 1NGQH 2Q86B 4LVNB 4AZUA 5J11B 2OMTB 4P3DB 3AWEA 4X5QA 1NOAA 1I1YA 1KEGH 1EHLL 1A8JH 1O5DT 4PJ7B 1HZKA 3NFNA 3N44B 4B9YA 2MIZA 2GJZA 3QIUB 3RTLA 1Y07A 4LF3A 2BC4A 4TNFA 1B0WA 2GEQA 1LK3H 5HYQB 3ECUA 3CK0L 4U6TA 3EO9H 2YR3A 3OTTA 1BFSA 2CO1A 4FFYL 3HBPA 4Z0BL 4H2CA 1R3JA 3VGAC 1BXUA 3FSVA 3TV8A 2IG2H 4X4XA 4DUWA 4DUVA 2V2TB 1B3JA 2WQUA 3MROB 4BKSC 5LGKA 3B9KC 1DO5A 3MAWA 1RURH 1KDJA 1ZPLA 3AQYA 1AKJB 1UQSB 2BX5A 5E9DD 2Z64C 4XI5D 5CEZL 5IVNA 1D5RA 3QIUD 3ISYA 4MXQC 4OFYD 3L3IA 3FT2A 3O9WC 3PYCA 4X6CB 3QPKA 2NR6A 4WU7A 1EUUA 1KXQA 3LRSB 3NPZB 3CN2A 4YGVB 2E6QA 3ZE0F 3LN9A 1N6QH 2MQ3A 3B2PA 1G87A 5T3XH 4WZ9A 2R4RL 4MS8C 5IB3A 5HP5A 1ICTA 5DHVH 1X5GA 3SOBL 5CHNA 3KYOB 3PWJB 2FL5B 4FADA 1QUNA 1TQCC 2DYPA 3OKKA 5EMYA 4NBXB 1RCYA 1AKJD 4N2BA 1NFIB 4NC0B 1DQMH 1NCUA 4HFWA 4UQ9A 3TEZA 4L2LA 4S1RL 5FKPA 1BQLH 3GT6A 1S7UB 3O0RL 5DC0A 5GGVH 2MPAL 1TO4A 1VSCA 3NFPA 2OZ4A 5T1KB 4PLJD 2HH0L 5CMAB 1CFMA 2HFFB 1A6UL 4JPIA 1DR9A 3AWGA 4E42B 4AENA 2WXHA 3QFGA 4ZXBC 3WXVH 3FQRA 3VXSD 2W80C 4ODUA 5K59E 5HXMA 2W1NA 2YPKA 1BAWA 4EOWL 1I7UB 4FXGA 1MWAL 2W9DH 4QRQB 3DJRA 4KK9D 3UFIA 4P23B 1S7WB 3POHA 5D1QA 2DQFB 4YXLL 4ZFOL 4DPAX 2XWTA 1D7FA 3S5LG 5C3LD 2VNCA 2ZSVB 2J1KA 5T1KD 5JQ6L 3EF7A 1SOXA 2DBLH 3GRGA 4ZO7A 1C12B 3UYRH 1GHFH 5EA0H 1BBJB 3V6OA 4H0IA 1BYOA 3MJ6A 2WXPA 5CJXA 3ZXAC 4XMWA 4UTAA 1SOSA 4JRYA 3PCYA 4X6DF 2EIJB 1CT8B 4MJ6A 1A6VL 5CCKH 4NN6B 4A2GA 2EDHA 1JHLH 3MRLB 4PN6A 5DZOA 4DW2H 4Z95H 2GTWB 1ZVSB 4POZC 4DWHA 3HG4A 1D2OA 3CXFA 1MFMA 2XICA 3IDJB 3X13B 3W9EB 3NA9H 1JZJA 1YDPA 2VL4A 4PRNB 5I0VA 4Y2LA 2QVFB 5F88B 5T1DL 3ULVE 3ZRSA 4Y5VA 1PMYA 3N2JA 1AXSB 4HCFA 1CGXA 1DVZA 4FDWA 4BK8A 3EHBC 4YVUA 5EEVA 5CF3A 4LSRL 2K4WA 2FWOB 3U6RA 2AK4D 2QELA 5DJAB 5EU7C 1ZGLA 1CZ8H 3HZKB 5JNYA 3VA2C 2WSPA 3KYKH 5D6DC 3WO4B 2OP4H 4D3CL 3B7YA 4LL9A 1UENA 2ZP9A 4PSRA 2MEJB 5C08A 3JV6B 4XWOC 4WK0B 4EE2A 4OLZH 5CZRA 5D7LB 1OWRM 2BHFA 4DQOL 3ULAB 2X4SA 3IDXL 4O4YH 5B1KA 2C9QA 3RTQD 3OWEA 1NPJA 2X6UA 3T1FA 4PAZA 1JFHA 4ZFFA 3WTUA 4YFEA 4HD5A 2SODB 4L1LA 3RWFB 4GFXA 2DWDA 3VD7A 4CSZA 1IAIH 5HGHB 2ICEA 3RGBA 1KIQB 5E56A 4ZPTB 4UV7H 2GPZA 1T7WA 4OI7A 2NY0D 4GLRH 1C1EL 4O5LH 1XF2B 1N2RB 3SYCA 5D7LD 2QMKA 2LLNA 1ORQA 2YSSB 1D5IH 4AEIL 1X7QA 1DSYA 3S8WA 5JPNA 4CMHB 4JO3H 3X1BA 1FFQA 2DEWX 3C09B 2ICWI 3LKOB 2X05A 5C09B 3HIZA 3U7YL 1G6RH 4WNSA 4XNQA 3SY0A 4MHHI 3RY6A 5FAAA 3S35L 4AQ1A 4P5KB 4A39A 3CVBA 2CA3A 1A6WL 3IF1B 2D8KA 1SYVA 2Q7YA 4FC3E 1Q1JL 1C5DA 1JVOA 1XH2A 3N85H 3PAYA 5KW9H 3IRCA 4N2NA 2VITA 3JT2A 3U48A 2Z35B 1FIGH 2LTQC 2VSCA 5CBAB 4MWFB 3KPTA 1MLCB 4TQEL 4UZGA 5L88L 3JBG7 3SKJL 2J3SA 3RAJL 1AZRA 5FYJD 2WXKA 1X5YA 1JZ5A 4ZW5A 3UPRA 4YBLB 2O6CA 3RZCD 1YEEH 1A6AA 4JJ5B 3EJZC 3JWOL 3PXLA 5GZOD 3P73A 1NGWB 5E2UH 5DZLA 2CE6A 4E9RA 1T5WB 5I8KH 3MNWA 4NKOB 4RFEA 4J4PD 1WGVA 2NY5H 1GW0A 3IJYA 3QJVB 1WS8A 3M8OL 1XIWC 4Q9QH 4JFDD 3WJMA 2F5AL 5EZIL 2M83A 2CJ3A 2WVSA 4AQ8A 4NAJA 5CGMA 1WUZA 2ZX8A 1UKTA 4HUXA 5M7QA 4KAQH 1JPST 4UIMA 4HWBL 1HEZB 4JO8A 3VRIA 1YN7A 4XNXL 4IIQB 4FQ1L 5I8OH 3SHSA 1IAII 2HRHA 2P7TB 1PCXA 1DBML 2XWJB 2JIXA 4IRZL 2ZG2A 3IKKA 4UDUB 2NY6D 3GSNL 4PVBA 5BMFH 5PAZA 4D9LL 3V5DB 2LLGA 4LHUB 4JGNA 4PJDE 3RL1A 3WTSA 4CMMA 3WCYA 1CXKA 2QT6A 3RFZA 3ULSB 1FDLH 3HAEA 2F1EA 4FCAA 2FH8A 3US0A 4AIEA 2Y6SD 1C16A 3OJDB 2IMNA 4G3YL 1FZOA 3FBKA 3MODL 3S37L 2IO5A 8FABB 5B1AB 4P5TC 3SCMA 5L7XL 2D7TH 2Y7OA 2MRYA 2WQRA 5GZND 2WVTA 2VDRL 4HS8H 4APQD 1TDQA 5E00B 4LHUD 2XWBB 4N8VA 4MJHA 3FFDB 3VWJC 4EUPB 3T0EC 4OFQA 5HD8C 5DK2A 4OZIB 3ESOA 3NRFA 4U1LA 25C8H 5FWRA 3VO0A 1VJSA 5C8JB 1ND0B 4JQXA 4AMKH 5DQ9A 1E4WH 3U46B 2O5XL 3VI3B 2G75B 3QRLA 4DAGH 3N1GC 4LCUB 3NJVA 2VZTA 1EDYA 1IZKA 4NZ8A 1JYWA 5IFAL 2R69L 1L9TA 1PDKB 1U58B 4G6FD 4BH7B 3C75A 2CHDA 4KDTC 3QEQB 4PJIE 4QAWA 3STZB 4NJAL 5DMJB 4TLSA 5IIEB 3D2UB 4DP5X 1P2CB 4H20L 1MHEB 5DVLA 1R3LB 3NVQA 4RRPA 1ZIAA 2VTFA 2R23B 1J9QA 2XN1A 5F3BA 1FNGB 3RGHA 1VGEH 3LRHA 5EUOB 4HK0A 4OZHE 1FJ1B 2XQYK 4GQ9L 3UADA 5T1MA 1M71A 3BT2H 2WW8A 4G9DB 3E3QE 4YE4H 2D73A 2JJTA 1A4KA 3VQ1C 3V0VA 5CR1A 3ZQ9A 4LHQB 5KANG 4QRAA 1HQRA 2L3BA 1BGXH 4ZS6C 5HVHC 4YE0A 1MVFA 4R26H 3D2UD 3JV4A 5L4IA 2LAGB 3HLAB 2Z8SA 1OEZW 5I1KH 3MRBA 1E3XA 4FJ6A 2ID5A 1RIUL 1DBAH 4GXFA 3O3AA 5KVFE 1J8HB 2H32B 5IVXE 4Z76A 4C57C 1FIEA 1XR8B 4WI3A 3BKML 4UMGA 4WFHE 1B4LA 2GY5A 5IG7A 5BZWA 1R4XA 4IJ3B 4K8RC 3JTTA 2DD8L 1DBJH 4XRCA 3ZU8A 4J3OG 3HKFA 4ES8A 3UIZA 4YVNA 3X14A 4TSAL 4YUEL 2WKOF 5I6KA 5HHXH 1U8KA 3K72A 3PPSA 3QA3B 3T2OA 2XY1A 5SWQB 1F2QA 2VDKB 2ZQKA 4CA4A 2XBZA 4TUUA 3QZMA 2VLKE 1PG7L 4KTGA 2K9UA 1KTKE 4ZTOH 3CX2A 4AIZA 5C0JA 1N7MH 1DHKA 4X80L 1FYHB 3H0TB 5DLLA 4A66A 3LKNA 2HFEB 5DD0H 1XCQB 3FOMB 4QUOA 3LRLA 3WL9B 1H3PL 1FO0H 4D7BA 2FTAA 1N9PA 1NMBL 3IMTA 3OR7A 1S5HA 4WCYH 2D2CC 4P9ML 2WCPA 1E9PB 4PJAF 4UILH 4OIIH 3L9YA 4GMSL 2FIKA 3DX7A 4BFRA 2VM3A 1JMXA 4FQIH 3BZ4B 2XI9A 3GBLA 4U6XB 1ZLWK 3TZVC 1CF1A 1ZT7A 2JJVA 4P59H 1RJLB 4LFHG 1HL9A 1YHPA 3IWVA 4X0KB 2IQAA 2P4AB 3RKDD 4A2DA 2PTTA 1ZV2A 1DEEB 5F7NC 4FKEA 2YN5A 3HC3H 1BX2B 1HCFX 4YZWA 5J3HC 1PSKH 3T04D 1D7BA 2PPFA 2NCEA 1JWMB 3ZMNA 4LLYA 5KSUB 1XX9C 4LGRB 1OTUC 1BFOB 2LU3A 3SDXE 4WW1B 2VLLA 5IMLB 5D4HA 4FGMA 1RIVL 2NY4C 1XGYH 3EYFA 4F33A 3OKLB 2UUDH 3RJQB 4BK5A 5A2KH 1TUPA 4LSQH 3S8FB 1AXIB 1JGUL 3L5IA 3R7RA 4MAYB 1NMCB 4GEIA 4HV8A 2GBTA 2GTZA 4QDGA 2OI9C 4MAUL 1EBAA 1NEUA 1KPUA 1YEFH 5DS2A 2Z91B 7PAZA 2FSEB 4TM9A 3AADB 3NZUA 2YUXA 3BAJA 2QQQA 5FO8B 2BP0B 3NAAL 3TT1L 2CALA 5DHDA 1AGFA 1P4BL 3QAQA 4PJIA 1M56B 4B41A 3GRBA 4XB8A 4KI5D 1RIHH 2BSTB 3SGKC 4GMTH 1A7QL 2EH8H 1YMHB 4FFZH 2W07B 3TEWA 3VXPA 4K7FA 2WZPD 5K1NA 5LQBL 1G7IA 1PD1A 4GP4B 3QDMD 4ODWB 5E6IB 3WENA 4ZFQA 4IRJC 3BQUD 4N0FA 4OV5A 5FF6B 4GQRA 3RX9A 4OZFH 5K9JL 4OZHA 4M43L 4GINA 5AKSA 2C3HA 4ONGH 1F4AA 3GBNL 2EXWD 4JFEB 3EJYD 4HULB 3IU3A 2XY2A 4YS4A 3ZTJG 3EOAB 4Y2DD 3FN3A 1VADB 2KZBA 4QNPF 2YC1A 4IKIA 1QHPA 4ZFZA 3F12A 2GKIA 1W72A 1MJJB 5I73C 1PYWA 4OAWA 3APMA 4O2FA 3KPSA 1BEXA 5E6ID 4WGKA 5D72L 1I3RA 3FH5A 1TJIL 4P46C 4D0BB 1MLBA 4OY9A 4X6CE 3TN0B 4Q2ZA 5IVXA 1E4XL 4UTBL 5DVOA 4FQHB 1SY6A 1V8HA 4AGQA 4HCGA 2J56A 1G94A 2MHAB 3KDMA 3EYOA 4MDJA 3Q05A 4XX1G 2XIDA 2BSED 3QDHA 2VL5A 4CVXB 1TVBA 5JA9A 3MX0A 3WD5H 2XG4A 4HJIA 4YSAA 1K6QH 2WVVB 1U3HA 2C9AA 1UH4A 2C7FA 1E2ZA 2OR9L 4CN6A 3DXAB 2FGWL 3NCWA 1PW3A 4LBEA 4HC1H 1VPOL 1WFTA 5HVGB 3BI9X 5HHVH 3T2QA 5EU3A 3WBDA 3QC5X 2PABA 4YO0B 1P7QA 2C8NA 1I3VA 2D7NA 2FQFA 1R75A 5A1AA 1BQHA 5HYIA 4U7KA 4IMLA 1CDJA 2NT0A 4G5ZH 4UT7H 3BPOB 3BE1H 1IM3B 2NYZA 1I53A 2DI9A 2ALWA 2B3RA 1YN6B 5DXWA 1KF9B 1T80A 3CFJB 4XVJL 1TVHB 2QGBA 3NCBB 1IGMH 5AL0A 4BSVB 4LOFA 4V11A 2AI0L 4F7PB 3T2NH 4JPWL 3DXAD 4FXLA 4AUYA 3IDMA 1N3NB 4MYPA 3UG3A 1DL7H 3DNKA 1E27B 2VXUL 2IV9A 2FX9H 1HU8A 1BZDA 2EKJA 2IDUA 4HKBB 4NFBA 3U9WA 5HYSB 2DM3A 4PGEB 5IB2B 3O6FB 2NYYD 3FQUA 3O2DH 2NY1C 4Y16C 5E94A 2HAZA 4JUSA 5IQ9A 4YX2H 1WA2X 1P1ZA 3PUUA 4ELKB 2XZAL 1IM3D 3EADA 4MD0A 4BWWA 2DLFH 3KJ6H 2XWDA 5BZDA 4WGVB 1I4FB 4OF5A 3KLDA 1HQ4B 3BP7A 1KN2H 3HE6B 4OIAA 4OJAA 2ZOLA 3EDKA 1RUQH 3WFEH 2YK1H 1B2WH 1D5BB 3BWUF 2FR4B 5FUZH 4GIAA 4JZNB 4JFVA 3ZE1B 3RVWC 2I69A 4L9DA 3ZR5A 2AK4E 5FYKL 1EAJA 4KQ4L 4ZD3L 1P6AB 2CIIA 1I9RH 2WZ6A 1MFEL 3GNMH 2F1BA 4KUCD 2VXQH 4G80A 1PZ3A 1SJMA 4MA3B 3FNKA 3KWXA 1QLEH 4NKMA 4KGJA 5CLXA 3SDDB 1UB6B 3ZO0A 4AXWA 3B9KB 1KCVL 1NCWH 1R34A 3VU1A 3CFCH 4QXTA 3S88H 4DOHE 4KDVA 1S3RA 1X9QA 1TETL 4YZFF 2Q86A 1CR9L 5DK0A 4RBPK 1AG6A 1LE5A 4FL4C 1NGXB 43CAB 1J8KA 4ACTA 2J73A 2E46A 2VR5A 4P3DA 1TEFA 5KBKA 3RNQA 5E9DA 3IN2A 3FO2B 3OKDB 4PW4A 5K59F 4OZ4B 1GCFA 3QIUA 2YXVA 2HX9A 4JGJA 4OFYA 3QNZA 4B27A 2M1KA 3PFQA 1KCKA 4K7PH 1HJBC 5FM5M 4U1NB 3B9KD 3FB7A 4BSJA 2UXTA 6FABL 3O2WH 3NZSA 4LOUC 3ASNB 4N24A 5HI5C 5D7LE 1UM5L 2CM5A 1JI2A 3LNEA 3LQAL 3T0VA 4K9EC 3QJFA 4M1CD 3GB7A 3MNVB 3WY2A 4MXQD 2VR6A 5L8LB 3O9WD 2G60L 3CDYA 3MROA 1K4CB 2XPGA 3OZ9L 1Q0XH 1FNSH 4K2UL 4ATTA 2YMTA 3NFSL 5ECJE 5ANHA 3LPWA 3DX3A 3WUWA 1AKJA 5JPMB 1NGPH 2JQAA 1U2CA 4M3JA 1T1ZB 3MV7D 4HHAB 4JG9A 3U82B 1WIPA 5KUKA 3T3PB 4X6CA 3LD8B 3PHOA 4FCHA 4NQCB 3SKMB 4JHVA 1HT6A 3LRSA 2AJXH 5EWIL 4HA1A 4YGVA 5B4MC 3QO0B 2FB4L 4F7KA 1M6OB 4Y2OA 2VDNL 1VF5C 3GSVB 3VXSA 4ISVB 4ZW8A 1TMQA 4PWHA 3P69A 5FYJE 3DHMA 1N64L 3ULVF 3TFBA 3BKYH 1NFIA 5DMKA 1JSYA 2NUTA 2QQLL 4H1LA 1L0YA 2X1WL 1S7UA 4DEWA 3FXIC 3DYMA 4ZXBD 2P44B 1FAIH 4M8QB 4AEFA 1LP9B 3HG5A 4X2UA 4U4IA 5T1KA 1M9WA 5CMAA 2J1WA 2UY6B 5FM4A 1TJGH 3VRLF 2ZKHL 2FJFA 3V8CA 3QQDB 5EU4A 4WHCA 4K8RH 3KGTA 1M7IB 2XXMB 1KCBA 1DSFH 4L8BB 3A6BH 3FQWB 3L54A 1JNHB 2KT6A 3D06A 1ROWA 4HUNB 3ILPA 5C6TL 4M48H 4B7IA 5I1DB 1MW1A 1SXZA 2FD6H 2YD2A 4XODA 4FQXC 1S7QB 5EBMB 3ZKNC 2TRYA 3K6NA 3UBHA 4Y5XA 2YZ8A 3IFLH 4QGTA 5ACMA 2WXJA 4POZD 5BCAA 5DMYA 4K5LA 4HIEA 5FLUA 4H4NA 4OCSH 4IEFB 5C0FB 1YPZF 4ERSH 1A9VA 5CD3B 5AW4B 2YWYA 2AK4A 2APWA 2GTWA 1ZVSA 3GF8A 2N0KA 2BHYA 4J3WA 4MXVE 3FQ4A 5J6SA 5T1LB 4P57B 4YOKA 1VFAA 3IDJA 2C1PA 3ARVA 3SZKC 3VM5A 4KKPA 3W9EA 3LEVH 3X13A 4EQ3A 5HPOA 3I2CH 3DPDA 1D5XA 4F58H 5I18H 3VD3A 1HKLH 2E7DA 5F88A 1X3DA 1JNLL 1G7HB 3SDYH 4BCZA 3WE1A 4MCYB 1XGPA 2Z92A 4NSKB 4U1HB 3GSRB 4MQXC 2VC2B 2KDYA 3RTQA 3ATAA 3GZKA 3PWPB 4XWOD 5LAXB 5DJAA 1VESA 4QRSB 3SGDH 1MHPH 3QAZC 5T1LD 3T77A 4PRPB 3TH3T 3IXAB 3DRQB 5IUCA 1CF8L 4Z7UB 4P5MB 5IUSA 1FNAA 1G7MB 1E7UA 2ZXDA 1BQRA 2OXHB 1OP9A 2R0LL 2AP2A 2CHNA 4NGHH 5KOVC 2ADJA 2JMRA 4J6RH 3EBAA 4CKVX 3NZHH 3PWPD 1RZIA 1Q0EA 4GSUA 4JREB 3UMTA 3N1FC 2EVGA 4H8PA 4PRPD 5FHBL 5HGHA 3VI3E 3CXHK 4XC3L 4AW7A 3JQOB 3W0WB 1GPOH 1AD9B 3X1FA 4ZI8A 4PLOB 2ESVB 1N2RA 1GKOA 4OQTH 5GRZA 3U4EB 4M6OL 1VIWA 1N68A 1J12A 1YEJH 1E9QB 4ORGA 5TJWK 4DP8X 5JDJA 1U36A 3QEQE 1FORH 4QO1A 5TFSL 4KITB 1UZ8A 3LKOA 1XGUB 4M6AA 3S34L 4IIZA 4HD9A 4R0LC 2VMDA 3GMNB 4R9HA 4PJDF 3RZCA 3BLKA 5GZOA 3IF1A 3V4VH 5LBVA 3I9IA 1T22B 3W0WD 5L2JB 3C60C 4NRZB 3ZHFA 4J4PA 2ESVD 4M03A 1Z3GL 1T3FA 5EUOE 3UDWC 2X4UB 2VAJA 4K5OA 1JN6B 2ZWZA 4PUBH 4WEBL 4JFDA 1I82A 3EJZD 4ODSH 3WFBL 1MLCA 1ZLVK 3E0GA 5IQLA 2NW2B 3QXDA 2RMNA 5DVPA 3MYZA 3S3DB 2EDJA 2VERA 3FT3A 4N5UA 1KJ2L 3DETC 3HS0A 4PG2C 3BH4A 3TJPA 1QTPA 3WTWA 3LKRB 3QISA 2G5RA 4JJ5A 5JW4N 3BAKA 1CDGA 5FFLA 3GXMA 3SGDI 5F9JB 2A5UA 2ALAA 3V9FA 2FATH 4HAFA 1GMIA 2M8XA 1OF2B 3P9MB 1F3RB 1UACH 5KVEH 4PY8J 1BJ1J 1GL4B 2AJUH 5FCUH 5BUAA 3RA7L 2YMXL 1VFUA 5MP6L 2NY2B 1KG0A 4F37K 4LPXA 5C0AB 5EDSA 4TTGA 3ZR6A 4IKLA 2FECI 1KB9K 5F1SA 2QFRA 5EEYA 2F8VA 1JK8B 1Z5YD 4FOMA 4XN4A 3HZYB 2AQRA 2CXGA 4OUUB 2NQCA 2I7OA 1NC2D 2OQJB 4GRWB 4L9LB 4YDVA 1O7DC 1VFOA 5C9KA 1UH2A 4PJIF 5LBSL 2P7TA 1SF3A 2ZUTA 4NZRL 3NEXA 1KC5L 3TCLB 3MOBH 4IK7A 2ZKWA 3DBXB 5GZNA 2VJXA 3HFML 5TE6H 4APQA 2H3XC 4RISL 5DRNA 2NY2D 4FQ2L 2LR4A 4BHUI 4LHUA 5KN5B 4XH2A 1EZUA 5FW6A 3AC0A 3WFDL 5EOTB 3BP6B 3ULSA 2W91A 3T1WA 4OZHF 2G5BB 2XWZA 3UCRA 5FB8A 3CMOH 3RQ3A 4OT1L 4XP4L 4PHZA 1I8IB 3VWJD 3OJDA 1CI5A 4YSSA 3T0ED 2X40A 3H8NA 4BUGA 2R4SH 5HD8D 5EZLB 2R59A 3TH4T 5I71C 3S7GA 3D4ZA 3MLVH 3TWCL 3WUZA 5CSBA 4ADJA 3NDYE 4L8DB 4EUPA 1N5YL 1OGPA 2YPVA 3D4CA 1GGBL 3ES6B 2WO4A 1W6LA 2P5PA 4U1MB 4WTQA 4KI5E 3EJQA 2R0ZL 1IVTA 5C8JA 1BFVH 2W59A 4GIOA 1XZWA 4UQBA 1ED3B 4LAQL 3EOBB 1KNOA 1NCOA 3WS6A 4YFLF 1GGCH 1TTGA 1GRWA 5L9DL 4Y7OC 1HC1A 2GT9B 5DHVA 2P26A 1J0ZA 3NN8A 2JK5B 5CJBA 3KS0J 2P9RA 3BOVA 1PDKA 5DHYB 2LFGA 1MFBL 2RD0A 4K9EH 4BH7A 1RK0B 3DUHA 4QTFA 3V6ZB 1QOKA 2NNRA 3STZA 1JP5A 1JPGB 4ANVA 3UC2A 3I50H 4WFGD 3D2UA 5EOCJ 4XMLL 4XBMA 1MHEA 1R3LA 3ILQC 2OTUA 1BIHA 4JO4H 4M1GH 12E8H 4ZS6D 5EUOA 1AC6A 1FJ1A 3REWB 2BZ7A 3HPJB 1Z5HA 1A7OL 2BSSB 2WBJC 2CBQA 5BQDA 1FFNB 2LLLA 4EDXB 4HJSA 4JFEE 2B15A 1DLHB 3ARPA 1BA9A 5CU9A 1ZS8B 4MFHA 1RJZB 5F7KC 5FO2A 4JDTL 4Z5RB 1CL7L 5GS1C 4A7SA 3HLAA 1MFCH 1HIMH 1DCEA 1AP2A 4XAWH 1HK6A 3MRQA 1J1XL 2VXVL 4NP4H 1E30A 4MB5A 1WTGT 2QVTA 2ICWA 5BZXA 3CH1B 1IL1B 3NOIA 1UM6L 3KNBB 1U8JB 3RWEB 5E8DL 4YHYC 2TRHA 3TFKD 3SDXF 1IKFH 1UH3A 3PDOB 4WLCA 4NYLB 3QCTH 2QFPA 4XBPB 3NK4A 1KCRL 1ZPUA 1IKNA 1FFTB 1DQKA 2JLLA 4UT9L 4L3CB 3IPEA 5J12C 3ABKB 3PJNA 3TZVB 1UXSB 4ZK8A 3DXAE 5BRZB 2KLSA 3P0YL 3SKNB 4JY5H 4HHWA 3QA3A 3H42L 4QEGA 4G8EB 4R6UA 5ICXB 4LVOC 1BLNB 1D9KB 2GJRA 1XDTT 5AZ2L 1MUJB 1R5VB 5HJDA 5IEKA 4QLRA 2JJSA 4V2CB 2VDLL 1D6EB 1RD6A 4HIHB 1TZIA 4OV6F 2ZWLT 4PJ7F 3T6VA 2W92A 3N44F 2APVA 3H0TA 4OTXH 3AROA 3WL9A 1XV8A 3GMLB 4HZ1A 4JFQB 2WB1A 2Q7NA 3BAYA 3BEWA 3TZVD 5ABDE 1E9PA 3HC2A 2QZQA 3ULVL 3FB6B 1JPTL 2PXYC 3NSFA 3ATEA 4OCWH 3OAUH 4XO3A 3VRJB 3KW8A 3M17B 1FWXA 1LWJA 4PM1A 5ADPH 3UAAA 2MOGA 4U6XA 4IYKA 5GGTH 4R7VA 1U21A 3D4YA 1T5KA 3OKEB 4I18C 5DYOA 2CR0A 2WJ7A 4E41B 3IJ9A 5TPWL 1OTUD 3FSAA 4NFDA 3SQOH 5EUKA 3I84A 5IQNA 1DEEA 2NY4D 3L5JA 1F45A 1U8IA 2YBGA 3DOIA 4IRJB 2HLAB 4X6CF 1CGSH 3ETTA 2Y24A 5EIIB 1A5FL 3ZE1E 1JDCA 4XVTH 4OU3A 3FONB 3LHPH 2WZPA 1XSOA 4YDJA 5IMLA 2VDML 1F00I 1SQMA 1LNUB 4XCFH 2B1OA 3QDMA 3CHSA 3BQUA 3OKLA 3X3GL 2RFXB 4EKXA 3EUUA 4LPTA 4J39A 5B39B 3QZPA 5EPMA 1G6RA 3AT0A 4PMFA 3HG1B 4E41D 4JZJA 1AH1A 4OF3A 2X0UA 2GAZB 1OP3H 1OGSA 3D9AL 2FSEA 1GYAA 4H88H 3UJJL 4OKDA 4IRJD 1H8LA 4Y2DA 4ZNCD 3UTPE 3H54A 3FRUA 1MNUH 1YMHA 2W07A 2A9BA 2R7EB 3PV7A 5E2WH 3MV7E 5E6IA 4NUGL 4X5WB 4OCRH 3QUYC 5FF6A 3VWKB 3K2IA 5JXAH 4CC4A 4KRLB 1VFBB 4PP2B 2N7SA 4NQDB 3CSTA 1KB5B 3IS0X 5H37H 4ZFGL 2XACC 2BSEA 3EOAA 4P46D 4ANXA 3H4FA 1QNZH 2PCXA 5B7MA 1BD2D 1VADA 2CO6A 1FVDB 4G6JH 4LEEA 3UTOA 3T4AC 4OLXL 4JFFD 4UYQA 5I1AA 1ULVA 4RH4A 4OSUL 2WWMC 2WGNB 4QRFA 1G43A 2EIMB 2NTFB 3RGVC 3COOA 1T5XA 3IMVA 1KWKA 2CKBH 4RAHA 3VWKD 4BRJA 2IPKB 5T8IA 4F15B 1IRAY 4FQHA 1U2HA 1DO6A 1MW2A 4O2EB 4KFZC 1LO0L 3APFA 5ACZB 1JBJA 4B53A 3T4YB 5ESQA 5F9DC 1XZ0A 2R1WB 3MDJA 1BPLB 1ZIBA 1DUYB 1UEYA 4Y16B 1G7JA 3ARXA 1FHNA 3ARUA 3DXAA 2A99A 1URZA 3V0WL 3VFRA 5D93C 1G7QB 2J44A 3KPRB 1FE8L 1ASQA 4GUCA 4BQ9A 2NNCA 5EBWB 3JZYA 1BLIA 1ETJA 3GZQA 5DWPA 1LP9E 4RAUB 1HXMB 1NUGA 4U6YA 3JV5A 1ZHKB 1IM3A 3WAKA 2V0AA 2XG5B 4OB5H 4XXDB 5FGCB 1MIMH 2EDOA 5LGHL 4BSVA 1UCBH 2J4WH 2WBXA 1QA9B 1OSZB 2APTA 3DLQR 4Y16D 5F1OB 4F7PA 4AYEC 1BM7A 1J5CA 2NLJB 3KPRD 3QE5A 4MRCA 3IDYC 4ZS7L 2D9CA 3X12B 1QMUA 2CAKA 1ZTXH 3ARFC 1JZ4A 4JPKL 4PGEA 1BEYH 3S36X 5DFTA 1JI1A 3A0OA 3LSOA 4ELKA 4PJGB 2P8LA 3U4AA 1I4FA 3DOSB 1HQ4A 3WEXA 4ZX3A 1HNGA 1F42A 3GSWA 1D5BA 2FR4A 2OK0L 4XWGL 4JZNA 1AR1B 3LN5A 3OZKA 2RGSA 2IPTL 1JZ2A 3E1F1 3F7KA 4JY4B 4GAGH 4KUZL 5D1ZB 2VJ8A 4R8WH 1S8DA 1G4MA 2VUOA 1U92B 3ARQA 2X53A 1MEXL 1KTJA 3LNFA 4KHXH 3A6CL 4N2AA 3WLBB 1UM4H 3B9KA 4YEEA 3W39B 3AMKA 4I9WD 4N2EA 1RVFL 3O2VL 3IGKA 3OJMB 4N0UB 2DQTH 5D7JC 1E4KC 4MKTA 4YSPA 5C0NC 3O9WA 3PF2A 4HAGA 2ZJSL 4N20A 2P42B 1AZVA 43CAA 3LMJH 5KSBB 3PWPE 4LOUD 2FLBT 5HI5D 4GJTB 5FM8A 2D4FA 4M7ZB 4PRPE 5F70A 3MV7A 3FO2A 4G42B 4ZJ9A 4UOQA 4Z7UE 3L3GA 4I48B 2GBUA 4CNIA 1UJ3B 3NH7H 5HHQB 5T1JA 3B4NA 3PAUA 1VA9A 4KRPB 1T1YB 2VSKB 1DDTA 4UNTA 5E1AA 4HG4K 1VGKB 3VQLA 3MNVA 4B9ZA 3MLUL 4JFYB 5AZEH 3ZW3A 1NCAH 1X7SA 3CVHL 1X6NA 1C08A 3IGAA 3VXRD 1BZ7B 1HH6B 5TQ0H 5E1QA 4GI6A 2E7BA 3K6SA 5DVKA 1NCHA 3BMWA 3V5KB 3GM0A 4MMXB 4PRHB 5B4MD 3RWCB 4EI5B 5JPMA 1LWHA 4XCCH 4HHAA 5AW8B 3UEQA 2V2XB 3P54A 2W0PA 4ZXBA 3W0WE 3O3BB 2I9TB 2Y2YA 2YGVA 2ESVE 3SQRA 4NDMB 2QADC 3KWVA 2A6IA 4LLUB 1M6OA 2CDEA 1KDIA 3VE0A 2X7LA 2YAHA 4HCRL 4XR8C 1P6WA 1UWEH 4F2MB 4H8VA 5KVFL 2OXGB 3D3VD 4XO8A 3C5JA 3K2UH 4FQXB 2F7OA 4G7YH 5DVMA 1A7PL 4B97A 3U0PA 4RGNB 3CBRA 3GHBH 4YR6A 5GRWA 2VW6A 4HGWB 4OIBA 3MOAH 3HG2A 4MDIB 2VUYA 4M8QA 1J1PH 3A22A 3ZUCA 4ZQKA 1LP9A 4JFXB 3WN5C 1AZNA 3QARA 3BGFC 4XPFL 2UY6A 4QTIL 5E7BA 3SPIA 3STBA 4HS3A 2RA1A 4L05A 3ML9A 4MJJA 2D0GA 2UY7B 4JPSA 3PABB 1TQBC 5TE4H 4QLWA 1UADC 1MHCA 5HVWA 3JWOC 5CN2A 4ZUTB 4JO5A 4LPVA 5TF1H 3ZT6A 3NCMA 4QHNB 3LXAA 4I2XE 1KPVB 4K94L 4FQXD 1MREH 1G7PB 2IBZY 2P48B 2RBLA 4HXBH 4K3EH 4O58H 5DWUH 3ZKND 4CAGA 5MEOA 5E2VL 3BPNB 4RGND 3Q6FB 4X98B 5IV2B 2B14A 1KBGL 1A2YB 5G5DB 4AL8L 2CDGA 1A1OB 4OZIF 3VXNA 2FSDA 4DF9A 5J8OA 4GO9A 4UUJB 35C8L 1KLGB 3MFGB 2QJDA 1E4HA 5BVJB 1FPTL 4ZOCA 1IAMA 4YWGH 1IEBB 3DSNB 2FEDD 3X2QB 1B0IA 5C0AE 3CIQA 3VI3F 3C5ZC 4RIRB 3MR9B 1QHOA 4TUJB 4HW6A 1FV1B 2N1KA 1U8PB 1IE4A 1OE1A 2GSMB 3OR6B 4FNUA 5C0FA 2R8SL 2J6EH 2PPCA 3X3FH 1QBMH 3VG0H 1LO2L 2E59A 3KPLB 5T1LA 5IQOA 5ILTH 4Y1TA 2NY7H 2OCCB 5DYFA 1NC4D 3T0EE 4JFZH 2AQ3A 1PZBA 3FH8A 4MQXD 4YDZA 3GLZA 3IJSA 4MMZC 3SPCA 3H9SB 1A1MB 3FO0H 1IEAA 1U3JA 4KTDL 2F74B 3QS3A 2TSAA 1X9UA 3I9AA 3DOHA 4MA1C 4O02B 3BKJL 2OMUB 1DEDA 4FFZA 3C8HA 4NM8H 5C86A 2IH3B 1KBBA 1KGIA 3HMWL 4GUQA 3MACL 4NSKA 4U1HA 2VJ0A 3GSRA 4LEOB 2ZSWB 4YHOH 5EUOF 3QUZB 3PWPA 4OZFA 4OF8A 1J10A 2F19L 4AT6A 5HVFB 3QXAB 4WFFD 5F7MC 5TDPB 2PCYA 5CCGE 4ONFL 4QRSA 5BZZA 3GXPA 4PRPA 3DRQA 1FGVH 2E0PA 1T04A 2VZUA 3D18A 1R33A 3H9SD 2H7WA 2AJ3B 3AQZA 3O81A 3OJVC 1G7MA 1RJCA 4NCDA 4P5MA 2ZCHL 4LRNL 2ZP8A 1BZ8A 2WAQA 4KX7A 1EHLH 2WLNA 2EQDA 2DQ6A 1ZVNA 3BVWA 4RMTA 4GQZA 3G5YB 5JHLA 3DYOA 1I9JL 3ZK0A 2Q9OA 1P4LB 4J8RA 3CK0H 2PKDA 1ACYL 3V7MA 4NI6A 2ZUVA 4MB1A 4HLJA 1ONQA 4FFYH 4Z0BH 3W0WA 3BVNB 3MTRA 4OLYL 5JORB 1DE4B 3CFMA 2ESVA 2ROXA 1H3XA 3AXLA 2Q8BL 1YEWA 2A6DB 5CEZH 4HC1A 2EDDA 3C5SA 3CLEL 1S9VA 1OZTG 4N9GB 4HG4J 2JI1A 1XGUA 4OJYA 5GGVY 4J27A 3PP3K 4JPVL 5EN2A 4W6XB 2AS5M 3GMNA 3ATBA 1QPKA 5IMKA 3MCLL 1T22A 2OYPA 1O9WA 4HDIB 5ES4B 2R4RH 4NRZA 5F7LB 3QJRB 4YSCA 2XYCA 3LKSB 3DETD 3SOBH 4F2EA 2BFVL 4LRIC 5B3SB 4R2GB 2X4UA 3NCEB 4JHAL 4FG2A 1SXNA 4FA7B 4R7DA 4S1RH 1IGJB 3UZQA 4UM9B 3O0RH 3G04B 5IFJB 1EZLA 2MPAH 4XCNB 4E2OA 4ZMLA 4I2XA 1WD9A 3G5ZB 3O2DA 3TV3L 2HH0H 4C54A 1HVXA 3MI6A 1A6UH 1LEIB 3OSVA 2OJ1A 4F7EB 1NC2A 4FQLL 2Y5TB 3FTGA 3BWAA 1MIEL 1OF2A 4QCIB 1EV2E 3AJ7A 3QI9C 1BZ9B 4R2GD 4EOWH 3IPBA 1MWAH 4AQEB 3EGXB 3GUTB 4KKBC 3MLTB 4QGYA 5AVSB 5ENWB 4Y19B 3T65A 5FOJA 4YXLH 4XVUD 4N6QA 2VXQA 2ENSA 1WG3A 5I71B 3MLPA 1FRGL 5HPMA 5JQ6H 4DP7X 5DDHA 1DQQA 3Q3GA 3HZYA 4OUUA 4XNMA 3PQYB 3VWJA 1JRHL 4L9LA 3FUKA 1NBYB 3T0EA 4XCEA 5F8QC 3P4MA 1E2WA 3MKKA 2QKIB 4JAMB 1KXHA 1A6VH 1V3KA 3NIFB 1FC1A 5ANMB 2K7QA 3BISA 3INOA 4QY8B 4B60A 2WUBL 3C9NA 3H9HB 3UGUA 4HUUB 3H7LA 3MJGX 1RSFA 3DARA 4AUUA 3BP6A 1EBPA 2E6JA 2G5BA 2J8UB 2AV1A 3OSKA 5F21B 4U2YA 3QNXA 2BJML 3WNNA 4PB9L 5HHMB 5CAYB 4PB0L 3PQYD 4MSWA 1I8IA 5T1DH 2OX5A 3IGFA 3CSGA 4NNXB 4AIOA 1DLFL 1DVUA 2XNAB 4KDTA 2JKXA 2C1OB 1SHSA 5EZLA 4JHWL 3CJJA 4M7KL 3HVDA 1LDSA 4LSRH 4P2CG 2B9AA 1P7HL 4PGCB 4E41E 4L8DA 1X5MA 2DQJL 4F7TB 1WO2A 3BH9B 4X6EA 3RVTC 4N2KA 1W16A 1T0NA 2XBTA 3QHFL 3UJIL 4ZYKA 4GG6B 4D3CH 1YEDB 2IBGA 1GSMA 2Z6FA 1HHKB 2N4IA 4U1MA 5T5NF 4F37F 5AVWB 2ADIB 4G6AD 4L3EB 3UBGA 1X5FA 5FUOL 4DQOH 5JMRA 4BD4A 3VXQB 2YOAA 3IDXH 1IC4L 1TKWB 2CLZB 5F7DA 3B2VL 3T0AA 4R7XA 3BP5B 5I16A 5A6IA 5AB1A 4FA8A 3L3JA 3T2LA 5ETUB 1OQOA 5GS1B 2IXQB 4BELD 5DHYA 2Q2EB 4K5NA 1G9EA 3ILQD 2EIEA 4GPVA 5CZKA 5DO8A 3V6ZA 3PNRB 2AGJL 2OKMA 1JYNA 1BD2E 4XTRD 4PU2A 1Q72L 3IKCA 2WBJD 6CGTA 3IDIA 2Q0ZX 4AEIH 4TKWA 4JO1L 4P9HL 3TBWA 1K9TA 2DMCA 2DQDL 2Y23A 2YKKA 3HPJA 4R4ND 4OD1L 3REWA 3U7YH 2BSSA 3B2UC 4HWUA 4DSYA 3OX8B 4Z7AA 1AOZA 1FFNA 3S35H 3JWNC 3ZSSA 2K70A 1EEYB 4NQDE 4GAFB 5A2CA 1A6WH 1EAPB 3UO1L 4XPBL 1ZDSA 3QPQD 1ZS8A 2CIKB 2V3FA 5IB4B 4G2AA 1Q1JH 3ZE2B 5KVEE 1BG9A 4Z5RA 2VSMB 1JHTA 4K23L 4GBXC 1DQVA 1KY6A 3H56A 3I6GB 4UF7C 5TD4A 5KUMA 4L8SB 4Z18A 4TQEH 3MBEC 4XPTL 4FTDA 4WK2B 2H45A 4JG5A 3VFPA 3SKJH 4WI5A 4FN0A 3CH1A 1NCJA 1IL1A 1FL3A 3IFOB 1FAKT 5HGBB 4NQVB 1J1OL 4NKIL 1U8JA 3RAJH 3GHPA 3WKPA 4GAJL 1IFRA 4XMUA 1BIIB 2P45B 5KTEL 3SQBA 3WNKA 3H9ZA 5GRUL 2QEJA 3WV0A 3JWOH 4AW4A 2OLDA 4XBPA 2WINB 1QHQA 3FMGL 1FFPB 3QWOA 3WY3A 1R0AL 4G8FB 3RB5A 2EXYC 1SNRA 3HMXL 1VACB 1J05B 1UXSA 3TZVA 3FB8B 4K15A 4I18B 2Y36L 1W0VB 3FT9A 3M8OH 5HBBA 3POCA 3QIBC 2F5AH 5EZIH 3KPRE 4PJCE 2XZQH 3NJGA 5I76A 4PRDA 4G8EA 4RMSA 1BLNA 2BXZA 2WV3A 3CG8A 4PJEA 1MUJA 4RRPM 1TG8A 5MI0B 3BPCB 1D6EA 1OIOA 4HWBH 1EDQA 2PXYD 2WQ8A 3ESMA 4XNXH 2D31B 2JV6A 4FQ1H 4YL4A 4HETA 5FGCE 3A5VA 4AVIA 3UBXI 5DFVC 3ULUL 1DBMH 2YO3A 3BZFA 4IRZH 4LASL 5TQ2L 3GSNH 4KK8C 1EGJL 1F1DA 2CJUL 3ALWA 3H55A 3U30B 3W56A 1N59B 4BFIB 1CVSC 4D9LH 1KZQA 3KVPA 1NCTA 2EE2A 1RUML 1ETZB 4JVWA 3ZE1F 3EG9B 1HSAA 1NCBL 2X4RB 5F7EL 2FT7A 2IALA 4JG0L 1E90A 4GB9A 1FG2A 3SGKA 4KROB 4KNSA 5B3NA 3MRNB 4QTHB 5I0WA 4AV5A 3O0LA 1E2VA 1JCVA 1M1XB 2E9BA 4G3YH 3T3PF 2JJUA 3P9LB 3GEWB 1OAJA 1SDAB 3M7FB 3MODH 4H5SB 2HLAA 4IRJA 4YXKL 4MD4A 4LCIL 1CG9B 4HIXL 5L7XH 4PD4J 4N8UA 2VDRH 1QWNA 4GT0A 4BHUA 4OQTA 3MJ8A 1J48A 2VYRE 4NJ9L 5CGBA 2YPVL 3LEXB 4PJXB 2B0SL 4H0HB 2A73B 2X4QB 3G3LA 5B39A 1Q94A 5CBEB 1SF5A 3T4AB 3MZGB 2XX1A 3KL5A 4LCYB 3P1VA 3ARGB 1NWPA 2GAZA 4NXKA 5CIPH 2O5XH 4PLKC 1J0HA 4N0UE 5HJBA 5JYMA 3LTVA 3V4VA 1DVFC 4Y4HC 1E40A 4P46A 3R8BB 1LP9F 3QUYD 1BD2A 3VU2A 4NHUA 4AIXA 2UVFA 5KSBE 1NDMB 3F6JA 2WKGA 5IFAH 4JFFA 3D07A 4JHUA 2R69H 5KYYB 2EVIA 4WWKC 3PAZA 3LPPA 4RSVA 1EXUB 1UUSA 3LQAC 1TITA 4JGUA 2R27A 3QJOA 4UTCA 4X5WA 5SX4I 2UX6A 3VWKA 4PR5A 3H1ZA 4NJAH 4PREB 5M95B 3AG1B 1VFBA 4PP2A 4PJHB 3QDGB 5E4OA 4H20H 5MEQB 3RGVD 4JKMA 5E6YA 3ZTEA 5IJDC 1UOLA 2ZXAA 1FVDA 1KXVC 2P47B 4QI3A 3PWNB 3D3VE 1IQWL 2Z0UA 4GQ9H 1T1XB 3S4SG 4W81A 2V9QA 3QG6B 4PRHE 1PKQB 2EDLA 2KQNA 2IV8A 3WELA 5IMMA 3V55A 2NTFA 1Q38A 4XN1A 5IHHA 1I7ZA 1P9MC 5C0RL 1H5BC 1W0WA 2IFGA 4CBZA 3LS5L 2YGOA 2IPKA 4HSQA 1I9IL 3C6LC 1RUPL 3DHPA 3G6DL 1QBBA 4ELDA 5IGXL 3EYVB 1U0QA 3IDYB 1DSWA 3HZMB 2WIMA 3DX2A 1RIUH 4F2ME 4NQQA 1DUYA 3IJHA 4Y16A 4ZG1A 3GYRA 1XCWA 2H0EA 1T4KB 5DEGB 3G9VA 4UAOB 4XXWC 2NPLX 3BKMH 5IHUL 4FLHA 4RGNE 2VQTA 4XX5A 3KPRA 2IQ9L 4PJCA 4P2QB 5DURD 5DUJA 4F24A 4JBSA 3TVMC 2Q5BA 5IKCA 2DD8H 4P5RA 5ID0B 1MCEA 3B1UA 4P48A 4RAUA 3TGXA 4L48A 2ZYHA 1IV8A 5FO7A 2IDCA 2UXFA 1ZHKA 3LV3B 2QV4A 4TNGA 4TSAH 3FU0A 4DCQB 4Z7UF 2XG5A 4YUEH 2UZPA 2Y7MA 2E7LC 3D39D 2VDKL 4LKCB 5LCVL 2ED8A 4PI2A 1X5KA 1TYRA 2ZT9C 4EAEA 1PG7H 1QFPA 3L3OC 1FL6B 5E8NA 1H0DA 3I74A 2BCKA 4X80H 4HCIA 5DJ0B 4DZBB 2EC8A 4P07A 3F7PC 4P2QD 5DA0B 3X12A 3ZZ1A 3WHE1 4FF9A 5IK3B 1H3PH 1NMBH 5JIDA 3FW6A 3P9WB 4P9MH 1P4IL 1FVCA 2HRLA 2WZ5A 3DOSA 3MUZ1 4GMSH 4MNHA 3V95A 2DH3A 3DVGB 4JZOA 1IBDA 2F7IA 1XEUA 4LLVB 4WFFE 1L5GB 1ZCRA 4WEMB 5KAQF 1NCIA 1S46A 2WWKO 2XPYA 3P0VL 1AS6A 2XWCA 1U92A 2HT2C 5C0ND 3H9SE 1Q1PA 5C07B 3RBGA 3S2AA 2H5UA 4XGZA 3W39A 1C9SA 4GNKB 2J20A 3U0WL 3BVTA 1HE8A 4N0UA 3CC5B 1V5JA 2K6YA 1KV3A 1RIVH 3L4XA 3EXJA 3MCKB 3VXRA 5KSBA 2XTJC 2HLFC 3K91A 4BFKA 1JGUH 4K7PX 1V7ML 2QADB 2YAPA 5D4IA 4MAUH 1RXLA 2WSDA 1NGZA 1RFDL 2W0FA 1S9YB 3OWRA 3U0TA 3BVVA 3NAAH 3TT1H 1P4BH 2QPFA 2CSPA 4XVOA 2H1LM 4X99A 4ZTPL 1T1YA 1NIFA 1A7QH 2K6WA 2XA3A 3FRPA 3K71B 1EFXB 1LHZA 1K5NB 5MENB 5LQBH 4R5VA 1BOYA 2Q1EA 4FYQA 4Z8FL 1SHXA 4JFYA 3MA9L 1BZ7A 2BIMA 3D3VA 5K9JH 3F6IA 3WN5B 1JERA 3WIFB 4M43H 3V5KA 2QADD 4AYGA 3RWCA 3LCYA 3GBNH 1JPEA 1JDAA 1XTMA 4ZOAA 3UIYA 2BVPA 2V2XA 1VERA 2X9XA 4N28A 4PV9B 4IK6A 1KTDA 1WV7T 5DHEA 3ARDB 3QCUL 4NDMA 3L2NA 4XMPL 1U8MA 1ES0A 2OMXB 3W11D 4KY2A 1JZ3A 3JWNH 1EFXD 1KWGA 1MFVA 4GRWF 1HS6A 4LLUA 5MEND 5F6HI 1DJIA 1FN4B 2CGYA 2PCPA 1RUAL 4UIKL 3EBHA 3FFCD 2QGDA 3IS1X 1TJIH 2Q76B 5HY9A 3DA0A 2OXGA 2YAEA 3HUJB 3FB5B 1E4XH 4FQXA 4UTBH 5INCB 2QGCA 2XCMC 5C0CB 3RL2B 3MV01 5HGDB 4HGWA 5F89B 5L0QB 3B2DC 4L1HA 5DJXA 2GSIB 3ARDD 3LZLA 3HTLX 1WAAE 3GSNB 1JWSB 1M1SA 2G3XA 2OR9H 1TF4A 2FGWH 3CE1A 4YNYB 2KS0A 4XAKD 4ZW6A 1VPOH 1WZLA 3AY2A 4K5PA 1XR9A 1ZTXE 2GVYA 3CHPA 3TBBA 2GK2A 3FHAA 4MNQD 5DJ2B 3ARTA 3QBTB 1J8SA 5GGTA 2OCFD 1G7PA 4PWJA 4FX5A 1XEDA 4ODVL 2HVJB 4KJYB 1TZGL 3AS0A 3UMNA 1NC4A 1A1OA 4OBRA 3X1GA 4JFTA 3FFOA 3ME0A 4XVJH 3UJTL 1NDTA 1KLGA 1X5AA 5BVJA 3AS3A 4PBWD 5TE7L 4NXSA 1IEBA 2F7QA 3DSNA 4JPWH 3MR9A 1SXBA 1GVIA 1FV1A 1U8PA 2VXUH 4JDEB 5MERB 2CO4A 4PWGA 1AOHA 1T1WA 2BS9A 1PEZA 4WHTB 3O4LB 3BSHA 3FHQA 5ITBH 3HCVA 2XZAH 1URLA 3PQYE 5CILL 2RAMA 5CIPB 3KHQA 2LVEA 2X70A 3W3BA 4LSTL 3FSWA 3T6QC 5I0YA 3H9SA 4JN2A 3RPIB 1A1MA 4GP5B 1AD0B 4L37A 5ANME 2G9HB 2F74A 2CBPA 2W9LA 1LDPL 4M5ZL 5FYKH 4KQ4H 4ZD3H 2IH3A 1PZ5B 1MFEH 4TQIA 3IEAA 3I02A 5DJ6B 4MB3A 3KJ4B 1OXYA 2A4EA 3A6OA 3UPAA 2J8UE 3O4LD 3E9UA 3EYUL 3QXAA 4GKOA 4C4BA 5HHME 4YHZH 1KCVH 4EI0A 3WXWL 4S1QL 1E4XI 1Y18A 1KYOJ 3ZHNA 4K7PY 4FFWC 3KLKA 4AQAA 1F4XL 1UOWA 4U1IA 5EC2A 5H37A 3I9GL 3MRJB 4UM8B 1TETH 1TU2A 1CR9H 4KRNA 2AJ3A 2Q3ZA 3B83A 3E2HC 2AJSL 5DMGC 1KIPA 2P24A 3WLWC 2QKSA 1OB1B 4ICXA 1PLCA 4R0LA 3HNSL 3MRRB 3A47A 4GG8A 4FXKB 5E7FA 3ZL4L 2CKBA 3G5YA 4GG6E 2VM4A 1R17A 3CFBA 4JHBA 1MRFL 2VQ4A 3UDWA 4L3EE 3AU0A 2YEZA 2BY1A 3PFUA 6FABH 3H3PL 3BMVA 3MMEB 1EAOA 1REIA 1UM5H 3T3MB 5KYWB 3EDFA 4NQSA 1M6UA 3AXIA 3V5HB 2X44D 3LQAH 5TGBA 2J57A 4IM8A 5CCHE 2G60H 1COBA 1CURA 3OZ9H 4PG2A 3MRGA 1GSKA 4K2UH 4AG4L 3NFSH 2GIMA 4LVHB 4Y8DC 4C83A 1TTUA 3ESVF 4R4BB 1A4BA 3MFFB 2X3CA 2I85A 4BFBD 3G08A 4NIYE 2IAMC 4N9GA 1V10A 2CNZA 1T6WA 1NIBA 2W9EL 3QI9B 3P3RA 2VZ1A 4KMTL 1J9SA 1NBZB 4EF3A 3PWUB 4AEHL 5EWIH 2FB4H 4NRYB 2VDNH 2CBTA 4HDIA 5C3TA 4NN5C 3VSVA 2QSTA 2C5DC 5I82A 2BVQA 2EDXA 1WAAA 2JB5L 3BO8A 1N64H 3IPFA 1SLWA 4PTTA 4YBQC 1ACZA 4YSUA 2QQLH 1ZA6B 1JFQL 1QEWB 5D96B 3VTAA 4ZMNA 3GK8L 4XCNA 1P6FA 1HE7A 3WO3B 4YSOA 3QI9D 3DURB 1MFDL 2FO8A 1XGQA 3ZE2E 4DVBB 5JOFB 3DIFB 5HI4D 4F7MA 2ZKHH 3IETB 3MRDB 3VQMA 3A67L 4F7EA 4ADIA 2J5LC 2HYMA 1T89C 3J07A 1OP5K 1QKZL 2X4PB 2ITFA 4QCIA 4J1UA 2A83B 4LK4A 4BCXA 1K8IB 2ICWJ 3MRCB 4W70A 3ZZLA 5E03A 2ZUWA 2R2BB 3GUTA 3MLTA 3NZ8B 1NLBL 3GPEA 3HS8A 4HALA 1KB3A 3NACL 3V4PB 5C6TH 1PZUB 1HCVA 2OMYB 4JN1L 4NIKB 1H3VA 1SVZA 5B8CB 3CSFA 4O00A 2H3NB 2WANA 3PQYA 4A38A 1AI1L 2H26B 4G83A 1H9DA 3P4NB 4IGBC 1NBYA 1A6ZB 4KNUA 1K2DB 1PKOA 3TJHC 1IJ9A 4X9GA 5DJDB 5ANMA 1EJFA 4J8QA 3RWIA 3QQ3A 4QY8A 3KWUA 3OXRB 1ZT4B 3ULVC 1ZA3A 5LLIC 5IOPA 1YA5A 1G7LA 1U8NB 2J8UA 4P2RD 1Q9LA 1QPXA 3OPUA 1D7CA 2OMZB 5FOBA 4AVJA 1JNLH 1R46A 1OE2A 4NNXA 3RVTD 2GSGA 2XKNB 3NSJA 2IC2A 2C1OA 2VC2L 3TT3L 3V79C 1L3NA 5LGYA 4IRSC 2ZG1A 3ZYZA 1KXTB 1RK1B 1F58L 5B21A 1RZGA 2SEBA 2VN4A 4GEJA 4PGCA 2NW3A 4B0MB 1NIDA 3OLIA 4OFPA 5JUEL 2XX0A 4YJZL 1UA7A 3GBDA 3LIZH 5GS3A 3V0IA 1HCZA 1CF8H 2CGZA 3R18A 3ZZQA 5J1TC 1GA2A 4EQ2A 2DMGA 1HHKA 1MJ7L 4PRBB 4U1SB 3ECBB 3BZ5A 2WBJA 5GGRB