2COVD

Crystal structure of cbm31 from beta-1,3-xylanase
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
92
structure length
92
Chain Sequence
PPENCQDDFNFNYVSDQEIEVYHVDKGWSAGWNYVCLNDYCLPGNKSNGAFRKTFNAVLGQDYKLTFKVEDRYGQGQQILDRNITFTTQVCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The first crystal structure of a family 31 carbohydrate-binding module with affinity to beta-1,3-xylan
pubmed doi rcsb
source organism Alcaligenes sp.
molecule tags Sugar binding protein
molecule keywords beta-1,3-xylanase
total genus 23
structure length 92
sequence length 92
chains with identical sequence E, F, G, H, I
ec nomenclature ec 3.2.1.32: Endo-1,3-beta-xylanase.
pdb deposition date 2005-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF11606 AlcCBM31 Family 31 carbohydrate binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2450 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2covD00
2COVD
chains in the Genus database with same CATH superfamily
2WXQA 4W9HC 3O4OB 3VYNA 5FK9B 4OB5H 2J8UF 3FOMA 3NSFA 4RESB 2BNRA 4JAMB 4MD0B 7PAZA 5L0QC 3OKKA 4JDTH 5GZOD 3L7EA 3V4VB 1HH6A 3EDJA 1DJGA 3B2XA 3D33A 5C0CD 5HGGS 4X5PA 5KZCB 1RZ7L 3WI9A 4I3GA 1BVKB 4OJAA 1DANT 3WTSA 3BCDA 5ISZB 1UUNA 4CADA 2OXGB 3R0MA 4ZPVB 3R0NA 2YFOA 2CLVB 3FFDA 1U8KA 2G9KA 3VH8A 4WV1C 4J3OH 2Y5EA 4B95C 4DOHB 5ICYA 1PDKB 2NQ3A 1OTUC 2E9IA 3BLKA 1RP9A 2HLFD 3KYMA 3MV8D 5HHXL 1QHQA 1P53A 5J3HD 3CC5B 2LVCA 4B9YA 1HYSD 3HHSB 4IKJA 4MCYB 4HS6A 2M2DA 1CXKA 2EH8L 2WD0A 4XPBH 3ES6B 5BVPH 1CB4A 2VR6A 1MWAB 3EXJA 2WZ0A 4PRPA 4G42A 5EEWA 3PUCA 1FHGA 2A0LD 5C0GA 3QIUB 1C7SA 3GBNL 4WENB 4Y16B 3T2NH 3LKNB 1SHMA 4HPYL 1IGCL 4JRYA 2A9DA 4Q97A 4Y2OB 5IEHA 5IB2B 4WUUE 4BSWA 2V37A 4KY2A 1JPSH 2J20A 4DJMA 2VLJD 5HHVH 2R1WA 4JHWL 1HHKB 5TE6L 5E9DB 2KPWA 3CZUB 1O6SB 2QHRH 3N1QC 2MJWA 3VI3B 2XQYG 2Q76B 1U8CA 2W07B 2H2SC 4N8VB 3SE9H 3HG5A 1XIWC 5F96H 3W11C 2VRKA 4AL8H 4KVNH 1YQ2A 2HSIA 3FC8A 2BHZA 4LB8A 5DF0A 4QLWA 1UD3A 2GT9A 4FZEH 3UABA 5B1AB 1W0WB 4PW9A 4LPWA 3STLA 3BDYL 3F04A 2XJKA 2CO6B 2R2BA 3RWFA 1FLTX 4JPQA 2VXQA 2OW7A 3ARBC 5D5ME 3BLBA 2A6JB 1A5FL 5PCYA 2WY3B 3AAZB 5KWYC 1OKEA 5F1OB 1Q8MA 4OZGF 1NAMH 3CLEL 3U2SB 4U1SB 2J5LC 4DUXA 4XPTH 2QVKA 1NSNH 4LSTH 5C70A 1W8EA 3I9IA 1MFEL 4CSPA 3UP1A 2XQYA 4RIRA 4RGMC 2F61A 4AW7A 4ZAKB 4CC4C 1WA2X 2FLBT 4D0CA 1AO7D 3E9UA 1RK7A 3SO3B 4DK6A 3ULVD 1XVSA 2B1HL 4O02H 4RMRA 3F5WA 4S0SD 1M6UA 3T8VA 1K72A 3OQRA 3AACA 4QUOA 3F8UB 2E9JA 2IADA 4DCQA 4IBVA 1HQRB 2J8UB 2IANA 1DCLA 5SV4A 3W39A 1YEIH 1M7DA 5F0PB 2NNCA 3KJ4B 4TKWA 3B8SA 4IEFA 1N5YH 1T1WB 4CMMB 4W4NA 3JWOH 4MNQA 3MNZB 3SKJL 3OKEA 3MV9D 3FQUA 1A6AA 4FXGA 4TQHA 4X5XB 4BQ6A 5EZJB 5EEVA 2P5EA 4MWFB 5F1NB 4FDWA 3BEVA 2FX9H 4GH7B 2N4IA 2DQTH 2VUYA 1FG9C 4NRXB 3V0GA 1RLWA 4A2EA 2APVA 3CHOA 2EDLA 2WZ5A 2GJRA 3BESR 2M8XA 3O6LH 3UTZB 2E6PA 4U4IA 5HHME 2AKRB 1ACYL 2VLJE 2EYTA 3HBPA 1S5IH 5SX4H 5DXWA 1ILUA 5EBLA 3B43A 4GMTH 4PWGA 3QNYA 1C12B 4NENA 1NGPH 1QQDB 1DUZB 3QVAA 1LEIB 1LMKA 3HFMH 3KD4A 4ODUB 1D5ZA 3DJ9A 3KXFD 3ZKNC 2VIRB 5JXAH 4P2QB 1F00I 1I8LA 1C8QA 1IC1A 3I9GH 2UUDH 4HH9A 3U48A 5C0AD 3CZJA 1GZHC 1VCAA 3CC1A 4X6CB 3EGDB 4I7ZC 5GGVH 4N6RB 4JM2C 4UM9B 3GMPA 1U8KB 4AYID 2VKWA 5J6GB 3KLDA 3OQ3B 3O6MH 3BWAA 3S8GB 4HC1H 4ZQTA 3LKOA 2B39A 1IGCH 3ME0B 1S7VB 4MJJA 4FI6A 5CILL 1G7LB 4PMFA 5BS0E 5I75B 3ZE0B 2UWEA 3DOIA 4JFXA 4WTZG 5I0VA 4PRPB 3RVUC 1JP5A 3N41F 3SQOH 4KKCC 4Y16A 1SXAA 3BRFA 2XICA 1UD4A 4FNUA 1XH2A 1OW0A 4BRJA 4XN1A 1CL7I 3N1FC 4DZBB 1FFTB 1K8DB 1XZ0A 1H0DA 4ZXBC 4M7KH 2Y7QA 1JPFA 2YA1A 1Z9OA 2GJ6B 1FNAA 2OQJA 2HYMA 2WBJA 4GSXA 4NUPA 1EXUA 2YK1H 1KULA 4B9PA 2V2TB 3C8KB 5HGAB 1E50A 4GIPD 3NQKA 1PX8A 3QZMA 4IBLT 5ISZA 2BVOB 3EYVB 3OJDB 3QO1B 5EU6E 3HNSL 3L9YA 4WTZA 3ZZLA 3KGTA 4B9GA 1EX0A 5INDA 3AS0A 3BUYA 3FH7A 32C2B 2EIBA 4ZUTA 1CK0L 3SDDC 3GSOA 2CDEA 3VSTA 2HN7A 1MZYA 4XMPH 3FT3B 2CM6A 5I5JA 4K7PL 5E03A 4NZTL 1NMAL 2VDNH 1IIIA 3CSTA 3C5JB 3L5HA 4BH8B 1VFOA 1YNTF 3QIUA 3BAEL 3CZSA 5E8DH 1BQHG 2ADJA 4F80A 5LWYL 3PWNA 3QJTB 1NCDH 4OKDA 3ARZA 4KUZH 3B2UD 5B3JF 2QKIB 1JWUA 1GGUA 3NCCB 4DPCX 2I32A 4R97C 3H6JA 2ED6A 5L88H 4O4YH 4XAWH 3S8WA 4NO2B 4L1SA 4PY8J 5BMFL 4Q9CA 4HGWA 3L6FB 4KQ4H 2JH2A 2HPOA 4RSYA 3LY6A 4XOEA 1YPZA 1O7VA 3FUEA 3H55A 5HVWA 4ZMXA 2J44A 1CFNB 5ES4B 1E40A 1DVFD 3QC5X 3MA9H 4KI5E 1A7NH 2WN3A 1KGXA 2YPLE 4HEPA 1HHHA 5IFJB 4P3CL 2Y3NA 4U1JA 2DWDB 5I1EL 3KZ8A 5IBLD 1TSHA 2R69L 5I5RA 1FF5A 1ML0A 2VM9A 3U2SA 4BXSV 4XP4L 4PLNC 4XC3L 2WLMA 1P84K 2CO3A 3T3PB 4FNQA 2YAQA 5HXMA 1UVQA 1L9SA 3PHQA 3VXUD 1PTZA 3BAWA 3U7WH 1FIGL 5HHMB 4ZFQA 5L2KA 4QAWA 5EZLB 4P46B 3BD5A 4NO0D 1MIMH 2BIPA 4OLUH 3K4AA 4MGXA 4YK4B 1BMZA 1R19A 2B0SH 1UYWL 2PW2A 3OAUH 5JIIA 2IDUA 3BKCH 1LO2L 2NCEA 4HUXB 2V5RA 2BOCB 4ZUWB 2WVUA 4QNPF 1ITBB 2BSDA 4AEEA 4I0PD 1SQMA 3B3IB 4EDWH 1XMWA 4HWNA 1N6QH 3B9KB 3NDZE 4JFYB 3B6SB 4MQ7B 5DRNB 5CUSL 2DWYA 2P5EE 2X4RB 9CGTA 4QRQB 5KSAD 2JIXB 3AS3A 2NX5D 3MNZA 1F2QA 3NIGE 4Z7UB 3WXWH 3DVFA 2PTTA 3FTWA 3U30B 4BCXA 4C4UA 1J8HB 2QSCL 4HOMA 3EO0B 5K59E 1YNLL 3D12B 4JJ5A 4CMHB 3SGKA 3C60A 2O6EA 3K6IA 3V4VH 3KPTA 4M93C 2X6MA 3W0WD 4KKQA 2P8PB 4NLHA 3VI4B 3D85D 3FN3A 3WHXA 3D4ZA 3HFFA 3PAVA 4FQJH 4FQXD 4HKBA 2PPAA 3BSGA 1HWHB 1S9WB 2R0WH 4LLYA 1F3JB 4M6NH 3ARQA 5DD6B 3HKZA 3N42B 1V7MH 5HYSB 1J86A 1UA7A 5C0BB 4Z7OB 1BVNT 3HI1A 4NDMB 1INDL 4NO3A 3M7FB 4HX1B 4OF5A 5FCUL 3BZ4B 3E6HA 3WNMA 4Z1PA 2A0LC 4M8RA 4PEEA 6CGTA 2IQ9L 3IMWA 4WI6A 1IEBA 1E4XH 4Z5RA 4KHXL 4GB9A 1DQTA 4NGHL 2ZE0A 3SDAC 4AL8C 1SQ2N 4LGPB 5GS3A 2X2JA 1JGUL 1YQVL 3RX9A 2UWEB 3RNQB 2K6YA 1F90H 3SQBB 1P84J 4GINA 2EKSA 4EI6A 2C1PA 4WI2A 5ALCL 5FX3A 3H7BA 5D6CB 3VFVA 3X14A 2VXQL 5I1HL 5GXBB 1H15A 4E41E 5JNYB 3C5ZB 3GSUA 4XCCH 1A4AA 1OWWA 1PSKL 4B3VA 4MHHG 3BEWA 2IC2A 4MJIA 4MLIA 2Y72A 2C3XA 4Z3TA 3RWHB 4PFEA 3DMMA 3RLSA 5JOFA 4PG2A 1OAKH 1DJYA 3MNWB 4KO5A 4G8FB 3QXUA 5HYSG 2FNWA 3ARBD 3T1WA 2JCCF 3QJRB 5IJDC 1KIQA 4KFMA 2V4LA 3CXDH 1K5NB 3EJQA 3VXQB 2DWXA 3HZYB 3O0RL 1NUFA 1L3NA 3TA3A 3IWUA 3T3ME 4N2FA 2V7NA 4J2QA 3MOQA 4L8BB 4NLAA 35C8L 3L3KB 4OT1H 4P23A 5D2NE 12E8H 3HBQA 3CFKB 4CMHC 5DDHB 3BVNA 1MDAA 4UINL 2VSDA 3N04A 4A04A 2IAND 5A16A 1T6WA 1XF3A 1TTAA 2AEOA 3CXFA 4P2OA 4K3JH 1ZT1A 3UXFA 4ZFOL 3MUY1 4QOKD 2CRIA 2CM5A 5D7KE 5CBEA 3OD3A 2DYPD 2Y24A 1ZLSL 5ESAB 1F56A 4F2EA 1G5AA 2HCZX 1SN0A 1T5WB 3WTUA 3UAFA 5I1CL 4CNIA 1UKQA 4PRDB 3HCVA 1LEGA 3BKYL 1SYSA 1RJCA 1VF5C 5TD4A 2V5SA 4FJ6A 3K71B 2AJXL 2VDRB 1Y6NR 3BIBX 5C07B 2FJHA 3GXPA 1NCWL 4LSDA 5LAXB 2WWKO 3LRKA 5C09A 3WXWL 1N9PA 5HGHA 1Z32X 1HHIB 4K9EC 5AVZB 2OR9H 3TEZA 5GRZA 3P9MB 4JCWA 1IC5L 5HBBA 2ADGA 2CJTA 5C0IA 3UMNA 5K69A 1OP9A 1QPPA 2P4AB 1U8LB 2NMSA 1UT9A 3L4ZA 5CAYB 3RQ3A 1ADQH 3VAEA 1CDYA 2EECA 1QVOB 3FQRA 3I6LD 3K1DA 2ESVA 1AGCB 3MLZH 4LARH 1BOGA 3PV6B 2VWEC 1H6TA 5DCCA 5DEJA 4KMTH 3DIVA 2R2HB 1BVLA 2NY0D 3FHEA 3WL9A 1WJ3A 3FJTA 4WFGE 3FU9A 3R1GL 5FO7A 4DZ8A 1SJMA 3M1BA 4BWTA 3BRGC 4ZFGL 3HG2A 1AQHA 4G7RB 2NNRA 2XXCB 3D39A 4S0HA 5IFHL 5DQDH 5CP3A 1GOGA 4U7MA 4JAMA 4LLYB 2FWOB 5E5MB 5A2KH 5D8JL 2DWSA 4XZUB 2XVBA 2X4NB 4MRBA 2FECL 5FM4A 3L1GA 4ZUUA 3HC3L 4MXWL 5C6TH 3FO1B 4JFDA 3QQ9C 1CG9A 3OHMB 3MRKB 1HOCB 1LP9A 1ACXA 1OAZH 4FL4B 4RA3A 5CM1A 3BH9B 3G6DH 2ZCLH 4QRSB 1MLCB 4FXKA 1BIIB 4UQ2B 2GEQA 3QIWC 1SYVB 5B38A 3VH8G 4MZ2A 5DJ0A 2G2RB 4NJAL 4GQZA 1DBML 3GIZH 1WH0A 3IPFA 1YAIA 2YA0A 5D2NB 3SE4A 5IB3A 1NC2B 1NANH 4BFKA 3VG0H 3SQBA 1EAOA 1QTYT 2HH0L 4UILH 3GSNB 4KDVA 1JCVA 3BWZA 1IGMH 4DO5A 1ZGLB 4FQLL 3OKLA 2EDYA 3WS3A 2YD5A 3ULUC 4JFFD 4NN6C 4PJHF 4YN3A 3F58H 4GUQA 4AQ1B 4FNLH 5K9KB 1XR9A 2OP4H 4XWGH 5CHNA 3IXTB 2A4EA 3TVMC 4HKXB 4YK4C 3BE1L 3SYAA 4W9EC 4UDTB 2W60A 1ECZA 4CC4A 1W0WA 1X6NA 3RKDD 1JRHH 4ZD3L 5DDHA 4TNFA 1KFGA 2HFFA 1U3YA 3GMLA 2J8OA 2Q1EA 2D03H 3X1BA 2Y7NA 3L54A 1D6VL 1TT6A 3FB6A 3HAEA 1JNLH 3L08A 4HS3A 5E5LA 2FZ3B 1YNLH 4D7BA 4FG6D 2NTFB 3I3EA 3L17A 4J5VA 2CRYA 4JFOB 3VXTA 4NAMA 2D73A 3MACH 4F27A 3HE6A 4CVXA 1MHPH 2CNZA 4PM1A 4BA8A 4MMXC 4HMEA 4B97A 5GGSA 1J9TA 1XD1A 4BFFA 2VR4A 3B2MA 4F91B 4LEOA 3ZR5A 3AM8A 3I6SA 5C0BE 2BDNH 2C1PB 4JHBA 4LSSL 1F13A 1LEGB 3IE9A 1H15B 5JNYA 4G8EA 4X9HA 4S1QH 3WNOA 4H1LH 1FDLH 3WTWA 5B21A 3NSJA 3RDTD 2LT9A 1CFBA 2DEWX 3ARVA 1AC0A 3DDGA 3MLZL 1Q1JL 2I27N 2IBZX 3TT1L 2BFGA 1NGXA 3QORD 1HQRA 4IRSD 5DD0H 3GT6A 4PV8A 2J56A 5DQJB 1LO4H 3WO4C 2CIKB 1UWXK 2CXGA 4XCNA 1P4LA 1I8MA 5DJ6A 5I6KA 1XD0A 1FPTH 1UQSB 4H0IA 4P3DA 3GUFA 3R06A 3HR5B 3B8YA 4J2XA 1DJSA 1R6VA 2QDVA 1TNMA 5HD8D 4NM4H 4DKFH 4XBEH 5FB8B 5LCVH 2X4TB 4F7MB 1ODAA 3BN9D 5F72S 3UTQA 4YHLH 1VZGA 5IW6B 1H6EA 3I02A 1B3IA 5CLYA 5HPMB 2IAMB 1DUYA 4YGVB 1TZAA 4P2RB 4IIQB 2HTKD 2AKRA 3FN0H 3H53A 2E6JA 2DYPA 4WEUD 2P52A 4S2SB 3T0EA 1XGPA 3UAEA 3IBOA 4NWUH 3QNYB 4NENB 2XPZA 1TEYA 1NBQA 3KVDD 4HLZG 3RX8A 1AR1C 1XF4A 2X09A 1L9TA 3VFMA 3ATFA 4NJAH 5D7JA 4ERSH 1QWNA 3O2DL 3SDCD 3Q05A 3E6FA 4HH9B 5T3ZD 3LKPA 3VW3H 3NJGA 2FBRA 1Q0XL 35C8H 4Z7UF 5E00B 5D1QE 4C56E 4QAMB 2DQEL 2YPLB 2W81C 1CGWA 1KGWA 2X0UA 4X9IA 2P8LA 2I07A 5KVMC 4A6YH 3OPZL 4APXA 3S4SA 1G4RA 3AJ7A 1T66C 1U41A 4WUUD 4ZTOH 5GISL 4MQTB 5AUMB 1I7TA 3DK0A 5SX5H 4L4TB 2R2HA 1TYJA 5GS1B 2I5YL 3HPLA 4FNPA 2P26A 2NY2C 1A25A 3CLWA 5I8EB 3ULVF 1MFUA 5I1CH 1G94A 3AWGA 2DBLL 5IBTL 3CH8A 2MRYA 1I4FB 4FERA 2W88A 4JM2B 3VWKB 5KYWB 1FHNA 3FQNA 5IJVB 1C5DA 3HN3A 4LCWA 3JTTA 3KM2A 5KSVA 3VD1A 3EDDA 5FECA 1LL1A 1GGIH 4HKXA 3NCMA 4TLSA 3BN3B 3PNRB 3QIUC 4MQSB 4DP0X 3FYEB 3Q44A 1MLBA 1UH4A 3WU1A 1Q9KA 2VC2B 4KX8A 4DKTA 4X9BA 1ZLDA 4O4YL 1G6VK 3LIZL 4OZ4B 5GS0D 2PW1B 1HL5A 1ECYA 3GB7A 1KTLA 1Z9SA 1UXLA 1ONQB 3LNGA 4LT7A 5A7EA 1A66A 4G9DB 3K6SA 1KCRL 2WWKT 4WWKB 3IDNA 2ICEC 3ASOB 1AMYA 5LBVA 4W4OC 5JIMA 2BY0A 1JPEA 1ZLEA 2X4OA 5MHSD 5DZ9A 1JDAA 2Q3XA 2QFPA 3IRZA 4KGLA 1ZTXH 4AENB 4X83A 1N64H 5KSUB 1D9KC 2H3XC 3RTLA 3M86A 3T6XA 1MRCL 1CXLA 4XPGL 5DK3A 2COVD 5E2UH 4WHDA 5D4IA 1TENA 4R7DB 2J71A 3H4FA 4X4ME 5GGTA 4PJDA 2EXSA 3SOBH 5AB9A 1I3GH 4XN7A 3AGVA 3MBXH 4AVHA 4UZUA 1R24A 4MXWH 2DIAA 4GRWE 5C6TL 4PJEF 4Z7WE 5I30H 4F3FB 2NW3A 1NM4A 2OMUA 4KVPA 3K2IA 3UBXA 2R39A 3IXTA 2J6EL 4FE9A 4ADIA 4EPSA 4UIMA 4OM1H 4EDWL 4ALAH 1S9YA 3GMRA 4EXPX 2VDQB 5I1DB 5E8PB 3HR5A 2E9BA 4BDVA 3TVMD 2EUXA 8FABA 2HT4C 1TOXA 3V52H 2CR6A 3MRIA 5FM5O 4NPJA 1P5VA 2J5LB 4OQ1A 3SD2A 3ZDXF 1JK8A 5JPMC 4UUJA 4B9KC 2PPDA 4FS0A 4UNIA 3WTVA 1S7RA 4H88L 1EFQA 4KK8D 4YFLF 4P2RA 4NKMA 3AMKA 3TBCA 3IDGA 5ADPH 1UD5A 2W65A 3ZE1F 3AG1B 4ZYKA 2YRBA 4FKKA 1YEWA 5F6HI 3RGHA 1KZYA 1EBPA 4GI8A 1DQDH 4I3RL 2QZ5A 2OXHA 5DA0B 2DS4A 1XF4B 1BSIA 3TBTB 2ZJSL 4QXGH 1AQ8A 1WIPA 3NRPA 4XWGL 1WFUA 5DGQA 2WXLA 2ZWLT 4QXUL 2GG1A 3REWB 1FYTA 1FFPA 2UZIH 2YD2A 4WHTB 1HZHL 4S1DD 1AXTL 5ACZB 5EUKB 1BYNA 1RSFA 1T7XA 4OZIF 4RDBA 2DQIH 3ROLA 4AYBA 3SBPA 3T1FB 4LCCC 5IBTH 4L1TA 4FQPA 3WG7B 4X9GA 3CN3A 3C75A 3QHFH 3V0DA 2APBA 1C1EH 2R56L 4NIKB 2CH8A 2IXQA 4IRZH 4HAGA 4WKXA 1P4IH 2AJSL 5FEBA 3G5WA 3L5WB 4K5LA 4UT9H 1JXDA 3MROA 4WFHE 5A6MA 3PY9A 5F70A 2BCKB 2QPUA 2HXAA 2YSTA 4MJID 1FN4B 2X4PA 4UTAL 3JXAA 5FAAA 4WV1A 1KLFA 3O8XA 4HWEL 3D0AA 3LIZH 1BWMA 2QTEA 4HHGA 4FP8L 1B2WL 3CFUA 4WI7A 3Q13A 4LIQL 1OWRM 4PVMA 5L2KE 2D3JA 3S34H 2X2IA 4I3SL 5DA4A 3FO2A 1CIUA 3PGCA 4YOKA 3ZTNH 1IBDA 4ZG1A 3G9AB 4HX1A 4RISH 3RILA 4QRRA 3NIDB 1OPOA 4MS6A 1IV8A 5AAMA 3U9UB 2OZNA 3IDIB 4K73A 5I28A 4NFBA 1KGYE 4B5ZA 3QPQC 5ICYB 1IO4C 1D2OA 5ANHA 4Z7VA 1CTMA 1PCSA 2L3BA 1EEQA 2MQGA 3MV01 4WWKC 1X5HA 4F7KA 1MRCH 4P2RE 4MS8C 4KMQA 1DJZA 2IQAA 4O02A 1X5MA 4P9HH 4PJ8D 5CNHA 2X1PA 1QLRB 4OZIB 4M56A 4P5MA 5BQDA 1OF0A 1B4LA 3UZQA 3GMMB 5DD3L 1T1ZA 2ARJA 3D4YA 2YXFA 1DFBL 2QADD 5TK2A 3MR9A 3NFPB 4KFZC 4OZHA 4FQXA 3VI3E 5J3HC 1NC2D 3QG7L 3NCYS 2CGRL 4XN8A 2A73A 4XPAH 1UH2A 4PJ8A 3SYOA 4PJBA 3NAAL 5FDWB 4IJTA 4DWHA 1EXHA 3GMPB 4MBOA 2VSCA 2QELA 1A1OB 4X7TA 1QSEB 2BNUA 2X2HA 1NKGA 3VXMB 2DLEA 3BO8B 1R3IL 4IBYA 1FCGA 1X5JA 6FABH 1DBAL 2VGLM 3AXHA 1B3JA 1JZHA 2Z9TA 2GUOA 4CAGA 1J5OH 2CG9X 2NX5A 5GS1C 3UG5A 5MEPB 4NQEA 3V55A 4KQ3L 3VD5A 3TYGL 3EJRA 3STLB 2GBTA 2N1KA 2AJVL 3DJTA 3L3OC 4AIOA 2IG2L 1IM3B 2DQJL 4W9ZA 5F7WC 1ONQA 1RJLB 2VKXA 1CD8A 2X4UB 4F9LA 4UZGA 5D1XE 1NEUA 4RMQA 4UUJB 4IS6B 5I16B 4A37A 4DKEL 4QRTB 4ZX4A 2GBAA 3AREA 1LK3L 3TYFB 3UAAA 2MCMA 3QXWA 4MNHA 4MA3A 5E6YA 4NAJA 1BQ5A 2Y1AA 3QWOA 4OLYL 5EOQL 1H9DA 2X6BA 4LDOB 4PJEB 5KBMA 5ICUA 3VQ2C 5CCGE 3PXJA 5D72H 4AQEA 1IGYB 4Q6IB 1Z66A 5E8OA 1E4JA 2HG5B 5J6HB 3NN8A 3G04B 4LBEA 5F7AA 1JF6A 4K5OA 2NW3B 1QYGL 4EZKA 3WY1A 1GOFA 2NSQA 4P0DA 2EINB 5C1MB 2KT6A 4H44C 1P4IL 1GZQA 3HRPA 3PL6A 3SPVB 1FYTD 1AAJA 2DZEA 5DFAA 1RIUL 4PB0H 2GJJA 3OXRA 4XR8C 4ICWA 5EZJA 4NC1E 1K4DB 4PRIB 1S9VA 4OZFG 5CJQL 1IBFA 2PCYA 1Y07A 5J1AA 5LLIC 5EBWA 3N40F 5FKAB 1FFQA 1RD6A 2ALWA 3CTTA 4J28A 2YWYA 1SVBA 3KBFA 3WFCL 3WNNA 4MB4A 4RISL 1EEZA 3GZOA 5IIEA 4PI2A 2Y5TB 5C8JA 2PR4L 4WVRA 3TP4A 2A3TA 5DURD 1ID2A 4KNSA 2FWOA 4WNJA 3QRBA 4JUSA 4S1RL 2CKBA 2EO9A 3EJYD 3K46A 4QTHB 1UZ8B 1YPZB 4R7LA 1T7ZA 1OAYH 4XZUA 4F5CE 1IM3D 3PGFH 4JQIA 1IKFL 4HYTB 1PLBA 3IDMB 2Z0UA 2WNXA 4FOMA 1EEUA 2GJZB 4FNLL 3BGFB 4R4FL 3ETTA 1DVXA 4I2XE 4QHKI 5DTFB 5EC2A 3RDTA 3ZRSA 1HOCA 4ALAL 5SWQA 2ARJQ 1TPXB 4XC1H 3KMDA 4Z7QB 2ZIDA 2RQ8A 4LNRA 4XE0A 1W8OA 3QDME 3SBQA 2NT1A 5K9JH 2K6WA 4CW1A 2VDKL 3QAZC 3LNEA 3M88A 4XVJH 3AS2A 3TNNA 3L3OA 5L2KB 4F7TB 2NY7H 5KVGH 4L4VD 3B7TA 4TOYL 4HS8H 4EIBA 3PJSB 3IDYB 3AQXA 3HE6D 4DK3A 4P5MB 1HCZA 4LSVL 4M7KL 3CXHK 5ADPL 1XGZA 5H94A 4YHPB 1XF1A 2CUIA 4Q9QL 3DV4A 3G9VA 4NQDE 5KBLA 2Q86A 5KOMC 1JGVH 1AE6H 3ZBMA 2WTPA 2ARWA 4NN6B 2YQ2A 3APDA 3B9VA 5GS0C 1RQ5A 2VR8A 1G6RH 1VFAA 4NPYB 4LCUB 4NQSA 2I24N 5EN2B 2AVFA 2YXVA 3GKWH 5E4IA 2OQJB 1UJ3C 2XG4A 3ARYA 3D3VB 1OP4A 2PTTB 5F7MC 2GCYA 1UA3A 1Q1JH 5KVDE 1I9RH 5EZOL 1J8KA 2ZKXA 2X41A 2RCSL 1MFAL 5EPMB 3WEXA 3U9PL 4IGBB 3MKKA 2V3FA 4XTRC 1Y1DA 4HIEA 4X6BB 4W9LC 3WNPA 5EFIB 1OP5K 2GTZB 1RZGA 3W38A 4KK5C 3B2UC 1M7XA 1K3ZA 4QHUA 4R3SB 2XZQH 1E27B 3UC2A 3ETSA 2OTWB 1N26A 4N2LA 1PKQE 2VERA 2YN3A 5D1ZI 1QTPA 5DD6A 1OP3H 4K71B 4HIHA 1EDHA 3LNFA 3PGDA 1PZAA 4QI3A 3UZQB 1SVCP 3GRBA 4WNQA 1KIUA 5C08E 3CU7A 1PY9A 1LO5B 1MWAH 3Q0HA 5F7LB 1MVFA 1IAII 2FYYA 3D48R 5HHPB 5ITBH 3HS8A 2A73B 5IOPB 5MEQA 5AALA 2HG5A 1PS3A 2HT4D 4HUKB 2AK4E 4GBXB 4BELD 2VDOL 4JFDD 3B9KD 3MA9L 2WWNA 2HJFB 1MY7A 5CJQH 3ZQWA 1F3RB 3ULVL 3O2DH 1ZHBA 2XG5A 4Z7OF 4JHZA 3MGTA 1C5BL 3UMTA 1SBBA 4U1KB 3VRJB 2FO4B 4HDIB 4KK8C 3QEQA 4XP4H 3WFCH 4NX0A 2NY1C 1A3LH 1DBBL 3PAUA 3IN2A 4LQFL 2WB7A 5DEZA 4YL9A 3X14B 1Q9WB 1MQ8A 2COQA 4C4BA 4JRYB 1FSKC 4DFIA 1E90A 2FECI 3DOHA 5I16A 4QIRA 3FTZA 1T1XB 5JZ7C 1N0LB 4LDLB 1AO7A 4JZNA 3KPOB 5HDBF 4C4KT 4OFYA 4AQZA 2OSWA 1R5VB 3PAYA 3OSVA 3EIFA 4KY1L 5ALBL 3K7UA 5F9WB 4U3HA 4OGYL 4EZLA 5C6WH 4IYKA 1OB0A 5D7JB 1FNEA 4Y8DC 1KIPB 2R9HC 4NQCB 3AQYA 4AQ8A 5M7QA 4AJWA 4KQ3H 3ESUF 1IKNA 3WS6A 2JE8A 3OZKA 4LKXB 3LQZA 4ZQKA 1RK0B 1OM3L 3RNKB 4I88A 5HYJE 1A6VL 1RLBA 5AL0A 4KK9D 1JGVL 3Q2NA 3LKRA 4HAKA 4H1LG 5SWZB 4JANB 4CC1A 2WSKA 1I7TB 4QCIA 5D2NC 4KDTA 5AVTB 4AGQA 4JDZB 1FO0L 3D1MC 5AOIA 5EIVA 4MDIA 1OCWH 3NJFA 3U4BL 4C54A 2ZICA 4P9ML 4H25A 4HT1L 1EEZB 2DLFH 3MJ8B 3EYFA 3QIBA 5F93C 2Q7AA 3PPEA 5EHFA 2BC4A 3F12B 3LZQA 3QEQD 2ZWSA 1BFOB 2RMNA 4GAYB 1MDTA 3TA3D 4P57A 3G3LA 4PJGF 1A6UL 1IC7L 4LSQL 3QUXC 3MBXL 1BWWA 1CR9H 2R29L 5E4EB 4WAFA 5J7CC 3A3YB 1AQKH 1MKFA 4X4XA 3GNML 4BWUA 3WEBA 5IWLC 1FL6B 1YEEL 3DGCR 2O6CA 5EN3A 4M9OA 3OZ9H 2YPVH 4CKQA 4NZ8A 4DP9X 3GEWB 3M1BB 3ET9F 1IEBB 1JVLA 3HE7C 1JVOA 1X9QA 3FU7B 3EHBB 1CLOL 4TSAL 3VXPA 5DHYB 1PFCA 2G9HA 4K7FB 3DHPA 4WO4D 1T2QL 2JKWA 3BSZA 5BOPA 4PJAF 3ARDD 4P2QD 3THML 3FNKA 4OJYA 3QQXA 4AC2A 1KFAL 4ODTH 5KSUA 5IMLA 5IG7B 4LPTA 1GZPB 3FFOA 2KUTA 4G3YL 4PJ5A 1ED3A 3L5IA 4WFED 4YDMA 3BEWB 4R7DA 3KYKH 1HIMH 4Y4HA 3AXLA 3FXIC 5T33H 5IHBA 3RHWF 1OARH 4DVRH 2W0FA 1FO0B 5JORA 1F41A 1ZCRA 2GSIB 1J88A 2AQ1A 2YJQA 3D3VA 3UTPD 5D2NA 3H9SB 4M7LT 4XC1L 3UYPA 1NC2A 3BZFB 5I6NA 4NP9A 4JS7A 1CGYA 2HRPL 1OGAA 3QJOA 1HZHH 3KNBA 4PGCB 3ZO0A 4Z7WB 2XN2A 4WI0A 5DRWA 2HWZL 2XETA 3D85A 4ZBJA 3F64A 2ZOKB 1KYDA 2FATL 3IMSA 1Y6KR 1WAAE 4FFYH 5SV3A 3RUGE 3ZIYA 4P59H 1H6FA 1U2HA 1P5VB 1IKNC 2BJMH 3SKJH 1UHVA 2X9YA 3CFNA 1UM6H 1NINA 3ML9A 3R4DA 4AK2A 1QD0A 2F5AL 3GBEA 3ZHKA 2DLTA 4PJ9D 3QUKB 5J11C 4CN1A 2Q2EB 1QG3A 1Y18A 4PS4L 4UDTA 3OR7A 4BUGA 2CIIB 3GGWB 4GQPH 1CTOA 4MMZC 4YO0A 1CL7L 4E2OA 4AEHL 1L6XA 2RAMA 3HUJE 5D93B 3BGMA 2WLKA 3REWA 3GJFK 4PY7A 5BUGA 4P2YA 2D0HA 3O9WC 1SHXA 3QG6B 1BZ7B 1F4YH 5IOKA 2LU7A 5CGYD 5C0DA 3R1GH 4EN3C 1JRHI 1KBPA 2BVPA 3CIQA 3WFZA 3VE0B 3LDBB 2F54E 1E9PA 1YN6A 2NY1B 2XVKA 4ONHA 1QA9B 2N0KA 2NY1D 4YDZA 5BRPA 4G82A 3LRGA 4M61A 1D5MA 3SCMB 4JDZA 5I6XC 2AV1B 4K2UH 5A7BA 5MHSE 5E9DD 1I8KB 4NWTL 5IROA 4HG4K 1RK1B 2NUTB 5DI8A 1W8NA 1GHFH 2YEZA 2R29H 1U8IB 2FUQA 4NUJB 4FEIA 3WKMH 1FH5H 1QHOA 5JO5B 1SDDB 1HT6A 3I6GB 2WLIA 1SY6A 4LKCB 2AFNA 4JO1L 2GUYA 4GMSL 4NQVB 2XWBB 2X4NA 3QI9A 5FR3A 3DX9A 4X80L 1KIPA 4JO2L 3FO1A 1M7IB 4JFDB 4MBRA 3HMXL 4NQCA 3T77A 2JB6B 3ZDZF 3QO0A 2GAZA 1ZT4B 4EBQL 3RY6C 3UTSD 3DTDA 5DGRA 4J4PD 4Z7VB 4KKNA 4PCSA 2VLJB 3HKFA 2ATKB 3ARBA 4HUCA 4Y1TA 5H35A 3IMVA 2BP0B 3LQMA 1WFMA 4E9YA 2E7BA 4LPUA 4NCC1 5AOZA 1AOZA 5FYKD 4AJVA 3X3GL 2MCAA 4AYGA 4B0MM 3IVKB 3M8OL 1E5YA 3TVMA 4DVRL 5HYIA 2ZUXA 4XNMA 4HJJH 3BVUA 2FJFB 3HA0A 1TKWB 4YHZL 4AYEC 5DUJA 3B9KC 1WA1X 2HRPH 1RFDH 4OJDH 1MVUB 5E00A 1BF8A 5C0ND 3D2UD 5ACLA 3NZSA 3QDHA 4PWIA 1I8UA 3VXMA 4M29A 4BK5A 2VLLB 3P73B 2GSIA 4N2IA 2WBJD 4UT7L 4KDWA 5HJ3B 5T5NF 1WBZB 1BZOA 3F7PC 4N87A 1UUSA 2ZSWB 5HDOA 2VMCA 3ELAT 3Q9PA 1FRGH 1IILE 1RUKL 3CHSA 1ETJA 2QHLA 5KYXB 4PJCA 3ARDB 3A47A 1MOEA 3DO3A 1OT4A 3VFPB 1RIUH 3E38A 3FU7A 4PB0L 2YUWA 3AADB 3US1A 4AM0A 1B9ZA 5IBUB 1T5XA 4AEFA 3F7YB 2GHWB 5FGCB 1GY2A 5EZIH 3RZWA 3P0VH 3IEAA 3V4LA 4YH6A 3PP4H 1L0PA 2JKXA 5KVEE 5DD0L 3FO9A 1Z5YD 4NXKA 5DQDL 3MCLL 4PJEA 2DLIA 4Y19B 5AW3B 5JMRA 2WQVA 2F53A 5JHLH 3BZ4A 2FHFA 3FCTB 3MRLB 3TFKC 2VE6A 5F8QC 3G6AB 1AQMA 3CFJB 1HNFA 4UI2A 3GKZA 4XPFL 1M56B 4IMLA 2WINA 2K1MA 3O3DB 5KSAA 4G83A 4ZSOE 2HG0A 4D8PB 3JWNE 1BQUA 4LHQB 1IL1A 4NM4L 3D6GA 4WWID 5MERA 3RUGA 4PJBE 2HTKC 2NX5E 1BF2A 1OGAB 1SLUA 2LU3A 4Z7WA 5E7FA 3D0VB 2WXNA 1MWAA 1AZUA 1USZA 4EI6B 5IT2L 1CLOH 2MKLC 5C07D 1CXEA 3LKNA 5KSBB 1V3MA 3K1KC 2O26U 4N0UB 3NEXA 4YAQA 2Y4SA 1D5MB 3SCMA 1CQKA 4IRJC 4PCYA 5BS0A 5FB8A 3WKYA 3Q2LA 3G5XA 1U95B 2FAUA 2X1OA 2IAMA 7FABH 3UBHA 3UTSA 4O58H 4OD1H 4ES8A 2MIZA 4NRYA 2AJZB 1OGAE 3BOVA 3HVDA 1DL7L 2DYPB 2ENJA 1T22B 2W9EH 1A7QL 2I60L 4FQHA 5TE4L 3UTTE 5GGQL 5D7JD 4PIBA 1CGVA 1KT2A 3LKSA 1RY7B 3IN0A 4G5ZH 4GP8B 2PXYB 2IPKA 1JK9B 4IRSB 4Y5XC 1B4JL 1TETL 1Q0EA 2CO6A 4M3JA 1EA9C 3Q8CA 3BC9A 4ELKB 1NPJA 1PX3A 2GJZA 5EC2B 5C7XL 3A67L 4K9EL 3RFZC 1BLIA 3BP7A 3MLPA 3QS2A 4P2CG 5E4OA 1S46A 3FU5A 5CSZA 5AW6B 1ZGLP 5JR1H 4HUVA 4UOZA 1QLEL 1DYZA 2D03L 2PF6A 4P99A 4F7PA 5FGBA 5IP4A 2DQCH 2I07B 4WU7A 3SYCA 1KENH 3SGKC 1KN2L 1I82A 1YEJL 4JPKH 3CFQA 1KBBA 4JPIA 1QA9A 4KHXH 4KWUA 1MHPL 5AG8A 1PZ2A 2D7TH 1ADWA 1AFVL 1SEQH 1M6OB 3QAQA 4LDCA 4IQHA 3DVNB 4GXVL 5FGSA 5CEYA 3ZL1A 5DUBB 5A2FA 4KXAA 4M1DL 4RFNB 3F5WB 5KN5B 3N85L 5IW1A 2Q86B 3SKOA 3QFDA 3EFFB 1ZVNA 5JIHA 3V5DB 4PHZA 2VXQH 3GSXA 2ENPA 1MCDA 3KPLB 3UZVA 1WLHA 2AW2A 1MRDL 3BW9A 1KJMA 2PMZA 1G7HB 1E4HA 1YC7A 2EIMB 4WTQA 5C0JA 4N0YH 1PQZA 1UH3A 5DWUH 5FFGA 3MXWL 1A7PH 2EH7L 1QFHA 4LHUD 4JZOA 1AGCA 1NKOA 1UXSB 2G5BA 3HG1B 3F84A 1HCFX 2A6DA 3KWWA 5GGSY 1BVLB 2VITB 2TAAA 2V6HA 2BMKA 2FR4A 2HRLA 2EVFA 2F1AA 2O5XL 2W8CA 2KH2B 1ZT4A 4ZOAA 1ZE3C 4AIZB 2E8ZA 4OIIL 1FYTE 2Q5BA 3QJQB 2DM3A 2J1ZA 5DHEA 4X98A 4X42A 3CVDA 5FM5M 3STZB 3OAWA 4MAYC 5IFAL 4AM0B 4ZUSA 1QAWA 5DFVD 4N3UA 3GM0A 4UQ3A 2APTA 3NCXA 2ZAHA 4RBPH 5I9QB 4FGMA 2ZOWA 3KYNB 2RALA 1SM3H 4NC0B 1GGYA 2QHRL 1Q9LB 2HLAB 3UTTD 2LE9A 1BIHA 2KYIA 2L7QA 4MQXD 3W2DL 4HXAL 4RAUA 5H2BB 5GGVY 4AL8L 3MRQA 4PTUB 4JM4L 4LLWB 3QR0A 4LF3A 4A6YA 1XGQA 3VYOA 3NZUA 4JO1H 1MVUA 1E0OB 4XN5A 1S4IA 1TQWA 2DIBA 2VABA 3BWSA 4G2AA 4X80H 5EG6C 5IT2H 2D2OA 1SYVA 5B38B 1W72L 4U0QB 2HMID 2IOMA 4Y4HD 4WO0A 3QEHA 1J0YA 3QPKA 2P47B 3MGTB 2X9ZA 3DPBA 3QUZD 3CK0L 3MRMB 3LB6D 1N8OE 1WFTA 4KKLD 3DETC 5DMJB 1VRSA 5EC1A 4XPTL 5C0AA 2AF2A 5I1KH 4KUCD 4OD1L 2ED8A 3NTCL 4KRMB 1BEYL 4JFZL 4N1HB 3ZYIA 2Y9RT 4G43A 4OTXH 3NFNB 3WFHB 2JELH 2VISA 2D7MA 2WVVA 2XTSA 1RERA 1AS6A 3BUIA 3KCPB 3MYJB 5GRWA 3VXNB 4WFGD 1DQDL 3FU0A 1NMCB 1YJDH 4K3DL 4IMKC 5INCA 4AE0A 5EDSA 1AGDB 2WPGA 5FOJA 3MV7D 4X7TB 1AH1A 4RNRA 3MFFA 4YIQA 1MH5B 2AK4A 3QXTA 1XXFC 4NBXB 2UY6A 4PUBL 2W9DL 1OPGL 4OUUB 3MRHA 2DMCA 4YXKH 1BM3L 1CZ8H 2W59A 4K15A 5JQHC 3CDGA 3BUQA 2PABA 2W60B 1NMBH 1NC4B 4ZFOB 1EANA 3WNLA 1WISA 3HI6L 1H5BC 1YMMA 3EYVA 3OJDA 3P2BA 4G8IA 1CU4L 4LVNC 4ANKA 4WI8A 5JIQA 4YHMH 1FNEB 5FGRA 1JVKA 3IMTA 3ISWA 4IMLB 1RJLA 2RFXB 3HRZC 1UACL 3WO3B 3T2OA 3BYTA 3OWRA 3QIBD 4PWFA 4DP6X 3U6RA 3OR6A 4WZ9A 4IS6A 5EUKA 4KO7A 4GXVH 4FQQB 1X5LA 2Y07H 2H1XA 4FLOA 3VTMA 2NYYD 3L1FA 4PJIF 5JTWA 2VDNB 2BSSB 2QR0A 4Y16C 3MFGB 5JQ6H 5AOLA 1EZVX 1KTKE 1MXGA 5F9OH 1J05A 4RAVB 3UTOA 3NCFB 3VXRA 4CILA 4YDKH 2HRHA 5BRZA 2ED7A 1CDGA 1PF3A 5EWIH 4JG5A 3CNKA 4X0KA 4I9WE 2YRPA 3P4NA 4JPVH 4PJAB 3V0VA 1WAEA 4LIQH 2R0ZH 1NEZG 1PG7L 4NN5B 4LBEB 1QI3A 2VXUL 3BLPX 2BCKA 4JW3A 1FN4A 2ATAA 4PG9B 1MFVA 3FH8A 2P8MB 2WCPA 5CZRA 2HFEB 4HGWB 5DJ6B 5IKCB 3CZNA 1ZLVH 2CA3A 4BZ2H 4EVNB 4M5ZH 4HSQA 4B9FA 3V7AE 5FYJU 5FO2A 5L0QB 1T4KB 3WLBB 5EF0A 3ZKMD 1WBYB 3DJRA 3X13A 3NCYP 4HMCA 2BIMA 2HKFL 2DTMH 4UTCA 2WZPD 4MJHA 4NQDA 3MRPA 4X6CE 3GS7A 5F89B 4GSDL 5IROC 4GI6A 3T08A 3RA7L 2VXTL 4RCAA 3QUMH 1TQTA 3WFBH 1N7MH 3OMAB 3FZUC 3OKOB 3P77B 1FFOB 1YSOA 2IQAB 2XX1A 4LRIC 4O02B 4P2QE 4S2SA 4Y4FC 4WWPA 4XN2A 3T0EB 4E5XA 3UPRB 1YVLA 3H0TA 2BNQB 2OL3A 3NBNA 1ET5A 1I31A 5C0EA 4EIZC 2CKBB 4LLMA 3X11A 3CV5A 1T5KA 4P23D 3TASA 2VLME 2OYLA 5AFAA 3A4AA 2E4FA 4KNQA 2FQEA 2YK1L 1LD9B 4PS8A 2DI9A 5CIPB 4LLWA 3WY2A 5DLMH 3FHQA 4CVWA 2NY4C 3NA9H 3TYGH 2DD8L 2DM4A 3B9KA 3V9FA 2VWEE 2V2WA 5GSVB 3CFMA 1T20A 3JT2A 4WK0B 3KYOA 3CSBA 4GKLA 4KZ0A 1OM9A 1VDGA 4EQ3A 5A1AA 4L05A 3PWVA 1KWKA 2IH1A 2FH6A 3PWJB 1CGSH 2SEBA 3DXAB 4FA8A 2VITA 4JFFA 1TJMA 3FFCE 2J8UE 4LP5A 4AIXA 1OQXA 2FR4B 4PUBH 1AI1L 4IDJH 2CKBH 1N19A 2A6IA 4PW3A 1RKRA 2P8PA 3OHXC 4GO8A 4IJ3C 2NTSP 3QUGA 3F6JA 3WHXB 4ZUSB 4JM2A 4TUKH 1WEJH 4E9SA 2BNRB 4Z7NE 4ZK8A 3SDAD 1RUQH 2VQTA 3OL2A 3T09A 2NZIA 3PP3H 4LCUA 3OZLA 4MNHB 4NQSB 5C2BL 2JB5L 3MV9E 1YEHH 2B9BA 3RWIB 3T2PA 4GSQA 5EB9A 2G0LA 4FMFA 5K9OA 3BQUA 3GZKA 3VACA 3MRQB 1JI1A 2AQTA 3LHPH 3SDYH 2ZWKA 3ZT7A 2FHBA 3WEXB 4MQXC 4OZFB 3D4CA 3ZDYB 5GJSL 3SBRA 3N5AA 2H7WA 3RX7A 5TFSH 1FP5A 4AGMA 2BSRB 4PQXA 1PU0A 1ITCA 2RFXA 4M48L 1XBDA 5EWIL 4QXTA 2BHYA 5CR8A 5B4MD 5KSBF 3K6SB 1E5UI 4YMPA 4X8JA 3WJMA 3PQYB 4RX4A 2HT3C 5KJ4A 2B5IC 2XNAA 2WZAA 3FFCD 3ZK0A 3B9DA 3W0WA 2VR9A 5B39A 1L5GA 1O7DE 4OIIH 4Y2DC 5J1SC 1A02N 2Y06H 5BRQA 3OBAA 2WVTA 3EOBB 3A5VA 3OTTA 2MCG1 3TBSB 5CCKH 3GSWA 5C0GB 2EAEA 1Z9NA 4XP5L 5F7EL 5C0AE 3D39D 2PETA 3GXTA 1RZFL 4NRZB 4Y4FA 5DFWH 1GY1A 2ZUQC 3OPZH 2V7HA 5J1AB 2F1BA 2CUAA 4PWJA 4DGVH 4K9JA 5GISH 1UCTA 5KBKA 5CKAA 1CF1A 2GITB 2BH0A 5F88A 1U93B 4N2NA 4RNRB 3K2KA 5EF3A 3APMA 3MXVL 5JDJA 3LSOA 4X50A 3NPSB 2ESVD 3CVIH 5PAZA 4F3FA 2CO7A 4PJ7B 2HKFH 4XB7A 5JO5A 1A0QL 4M62L 4DGIL 1FH2A 1LP9E 4MA7L 2WXIA 4G1EA 4BV1A 4H8PA 4F58L 3N0PB 3P9LA 3DX9B 4I18C 1KLGB 2DPKA 3VFTA 1QBML 4JPWL 1ID5I 1W91A 4WJG3 5C09D 1E8XA 3CZEA 3ZY7A 3H85A 3SCMD 1KJ2L 4L8SC 5LN4A 4IBTA 4U1GC 3B56A 1T7YA 4GIAA 3EJYC 2BSSA 3UYOD 4U6VL 4Q74A 3P77A 5BNXD 1KYUA 4QTFA 5EBMB 1QOKA 3H0TB 4Q2ZA 3HJEA 3NABH 1DVFA 4OFQA 4NUMA 3FAXA 4KXZH 2WN2A 3WLWC 3LRLA 4XNMB 4YHPA 5BQ7A 3CE1A 4H2CA 4XMUA 3CVCA 5DJZB 3RZCB 2RCSH 4XTRD 2J55A 3WIAA 1LE5A 3JTBA 1S9XA 2NLJB 4JRFA 3F65A 3MVSA 5T5FA 3DETD 1MCWW 4PN6A 1E3XA 4PJ9B 4EUPH 1QEWA 2Q2LA 4UMSA 3K6OA 5GRVL 1AYRA 1MJ7L 1OCOB 1UFUA 2BS9A 1ETA1 4UIKH 3RTQC 4EVNA 1MCLA 1A6AB 1BOGB 2E7MA 2LQRA 2YD4A 1JNJA 3IKCB 2MPAL 3CVHB 4Z77B 5H4ZA 4POUB 4KVNL 4XNBA 4AJYV 3IFOA 5FO8A 4AVKA 3HC4L 4ZZFA 1QNIA 2ITEA 5EIIG 3QIWA 5FO7B 2CDFA 4FZEL 2X7LB 4GS7C 1TCMA 4MD5A 1ZT7B 3DX8A 3FB5A 3V52L 4AW4A 1N18A 2DYSB 1CFQB 2PWDA 3BKJH 1TJIL 3A24A 1DVTA 2BC4B 1LO3H 5BPPA 1BVZA 3SDXA 4QHNB 3QDAA 1NWPA 4XAKD 1R0AH 1IARB 1LJMA 4FNTA 1O0VA 3ATDA 4NQED 5B1BB 1HH9A 1KACB 2A1WH 4GT0A 3S0PA 3ALWA 5E8EB 3QJHB 2QVFB 3QUMA 4LCVA 4S1RH 4X8GA 3PNWB 4OIAA 1XEDA 4H8WC 5F1IA 1BX2B 3GRWL 1CF8L 4GNKB 2D0FA 3UIZA 5CP7B 2F54D 2ZZUT 4PV1C 1V27A 3DX2A 3KWTA 3L95B 2YMTA 5FHAL 1MCPL 1QMUA 4BFOA 4A1RA 1GW6A 2XBZA 2B1HH 1FE8L 3IWVA 3PWVB 4K7FA 4PCKA 2ZOOA 1G7LA 3WMSA 3O3BB 5LGHH 1BFVH 2UZIL 1U30A 3QT2A 1XR8A 4POZD 4QRFA 3EOBA 3UTSE 4A2FA 4CADB 1R3JA 3SHSA 1KPUB 2CLRA 3BHBA 1J48A 5FOBB 4D0BA 4WUUB 5GQBA 4DGIH 2FDBP 4FQIL 3JWOL 1OALA 5IHUL 4WIQA 4HLEA 1I7UA 2AABH 3O9WB 3PF2A 4YSEA 4TL5A 3WS3B 1P7QA 4MDJB 3C2AH 3POHA 1K8DA 5F7NC 5IJKC 5C3TA 4Q9RH 1O6TA 4KH2A 2JKTM 2JI1A 3AQZA 1JPFB 2ZPKH 3LSOB 5MENE 4UF7C 2XY1A 1DQMH 3FB8A 1U3HD 4ONGL 1GKEA 1HWWA 2VB5A 3D8MA 4HWEH 3TBYA 1KTDA 2XFXB 3CZLA 3W0WE 2HFFB 4I0PA 4WWNA 4XMTA 1M57B 3L1OH 5E9DA 3FB6B 5IROD 4RWYH 5E2JA 3U0TB 3V8OA 4KMTL 5DO2D 3ZHFA 1D7CA 4CJ0A 5T3XL 2JKJA 3LH8A 1DN0B 3BH8A 2E9GA 3M1OA 4GKNA 2UWEF 4NUGH 5GPRA 3IAGC 3I74A 2DKSA 2CDGA 2ZOTA 4BH8A 5EULV 4NNXB 4OVVA 5I18L 1CN4A 4PRHD 4EUPG 4JCLA 2OCFD 5JOEA 5HDQL 4HBQA 5CIPH 3TA3C 3MV9A 3AG3B 4ZOBA 5T3ZL 1H19A 3ZE0F 3REVB 1PEWA 5DRXB 1KCUH 3AAZA 3GLAA 3L3DB 3LOWA 3ULUD 1YEHL 1QLFB 1HK6A 2VQ1B 1RZQA 3VFRB 1WS7A 3JVGC 4ZI8A 4XPHH 1GYWA 3FRPB 4IOFC 1JYVA 4MCZA 4ANUA 5I74C 1AHWB 2BFVL 1YEEH 1FI8C 3ABGA 3PWPA 3QG6A 1S7XB 5KS9F 5DQJA 4ZAKA 5GHWL 2DN7A 3FRUA 1ZS2A 3KHOA 4F2ME 3L6FA 4HJGB 4PJ9A 1NCIA 3N3EA 4P3DB 1HXKA 3IDXL 4HVBA 4IDLA 5E99H 2X3AA 3JVFC 2IV9A 2DM2A 3AM8C 4XO3A 3B37A 2X53A 4MYWB 3ECUA 5I1IH 4OCLC 3SDXF 3V6ZA 1PYWA 4QPEA 1C08B 4HIJB 1NLBL 4DPRA 2EDTA 2YBRA 4D0DA 1PZ5B 4TNVK 2BXZA 3LRSB 3FCSA 4ONFL 5D1QA 4C56A 2KLSA 2O6DA 1BEYH 3B5GA 3QIUD 4HUNB 4JFZH 2WQRA 1BQHA 3QUXD 4U0RB 5D4JA 1L0YA 4NKDB 4QNPE 1I9IL 3S35X 1C9SA 4ZDHB 4J12A 3VSVA 1OT2A 1UENA 2VDPH 3BPOB 1A4KA 1NL0L 3SJVE 3TZVD 3VU1A 1JZ6A 1EUTA 3TT3H 3MRFB 5EEZA 3CMGA 2A9ML 3VFMB 3RVUD 2GTQA 3QULA 4DEUA 4J3WA 1EHKB 2GFBB 1A9BB 4OR1A 5LGHL 4YDIH 1ZD6A 4MJ5A 3NIGF 1CJYA 1WITA 3BAEH 1JOIA 5ISZD 3K81A 1DUZA 4XNXL 2DQ6A 3UZEA 2OMZA 4AQAA 2UVFA 1S7SA 2ZAIA 3EUDA 1WGOA 4FQIH 2H9GA 4JEGB 4ODHL 4P2QA 2EO1A 1GS7A 2BJML 2QTVA 5CMAA 2DRUA 4ZMWA 2GPZA 4HEPG 2I7OA 4L37B 1A1NA 5BV7L 4GAFB 3WELA 5E08H 3AU1A 3CWGA 5DJXA 2PCFB 3RPBA 3H6AA 2FL5A 4N22A 3FUHA 1OQOA 4F8PA 3LZFL 4LOFA 1N59B 3FTSA 5C92A 3V5KB 1X9LA 1E5CA 4IKKA 4J1UA 1SXBA 3N91A 3V6OA 2MHAB 2B1OA 4YDKL 3G6JF 6PCYA 1UEYA 2OL3L 3STBA 3LPGA 2ZUUA 3WOVA 4KK6D 3BVDB 4O2CA 5EU5A 3OG6B 2EVIA 2VQUA 4DP1X 4MXQD 1VPOL 1Z9PA 1ZGLM 5A3IC 3FB8B 1NDMB 2A9NH 2WNKA 1HH9B 2VXUH 3DSNB 15C8L 2ZSWA 4X8CA 4WTXA 1BM7A 1BJ1H 4Y2DD 5DK2A 3SYQA 4F8QA 1XB3A 1Z2KA 1G7JB 5LG1A 3TBYB 1W9XA 4DN3H 3HB3C 4QKXB 4I0PB 4M6OH 5J13B 3BGMB 3U82B 5BRZE 1LVEA 4KOCA 3BXNB 1UOLA 1CFSA 1URLA 4PPTA 4TLTA 3GJEB 4XI5D 5DMKB 4NWTH 4LE8A 4GKZA 3JT0A 4H8VA 3IRPX 2WWMC 2YPVL 4WJ5A 4YHLL 3U0WH 2XZCH 4JHVA 3FQ2A 2N7AA 2XWEA 4WNQB 3NSYA 2NNAB 3CVBA 3TU6A 2JCCE 1WZMA 2B2XH 2O30A 5HY9A 3VXUE 4WUUA 2ITCA 4XBGA 5CZXD 1I7RB 3REVA 3D3VE 4AUYA 4YSTA 4YXLH 4F9PC 1AZNA 2ZX5A 5L8JB 5KVGL 3FQTB 2P9RA 3DMMB 4GMSH 1J0ZA 3EDFA 2VQ1A 5L4MA 1EUUA 5DI8B 1QR1A 5FFOA 5C9KA 2QKIC 2YRLA 1A4JA 3D06A 3CFCL 1R47A 4NUJA 4CDHA 3C6SB 1HS6A 1A9EB 4FFVD 4MNQD 3RTQD 3MGOA 1XSOA 4ZFZB 5KYYA 4JKPL 4LVOB 2PCXA 4P49A 3IFLH 4EIGB 2VZVA 1IGIL 4LRNL 2DQGL 4FQJL 1FNFA 2OMXA 4OSUH 4XCFH 3O4LA 5HYQB 2XN9B 2VOTA 3S36H 1OY3B 3CQQA 1SF3A 4L5FE 4XMWA 4WHYG 3QZBA 4AYDC 2V9UA 4UM8B 2B08A 3MRJA 2X70A 3O4LD 4J3OC 4MXVF 3CDYA 5FUCC 2QBWA 2ED9A 1Z9LA 5LO7A 2OMBA 1CICC 1N0LA 1UWXH 1XBRA 2CR0A 5EORH 3FU3A 5H35B 3FUFA 2DTSA 3OKOA 4Z7QE 4HK0A 4L1BA 4WCYH 3NYKA 5DHXB 3W57A 1TF4A 3NK4A 3KWUA 2DW5A 3UO1H 4H40A 4ZOCA 1AGFA 4RX4D 2V2XB 4KAQL 4M7ZC 4RGNC 1N8ZA 1VESA 2F5AH 2DWDA 3QPQD 3FQXA 4X7CC 1QBAA 5CEZH 4G59C 1I9JL 1MVYA 5IMMB 3QULB 2CBPA 1AD9A 4HFWB 2IPTH 1YY9D 4JUTA 1MW2A 5F8RC 3MLUH 4J3OG 2ZOUA 1F3DJ 4LVEA 5MP6L 3EF4A 3ZL4H 1LNUB 3LN9A 3DECA 3O6FB 4FQ1H 1JSYA 4ODVL 1H3XA 5GJSH 2VDOH 2NSMA 4LSRH 1J5CA 3OKMA 1FWXA 3WUWB 4K3GA 1ZY9A 1NDGB 1FQ9C 3O0RH 5EEXA 1UD2A 2VMEA 1BJMA 3LNHA 4JRXE 3EBIA 3QZNA 3SSGA 4V2CB 1YEGL 3RY6A 3TXAA 3FTVA 3GD1C 4XMLL 3UADA 3DROA 1SUHA 1AVAA 3D18A 3EGXA 4UINH 2X4PB 2Z91B 1KB5B 4B9ZA 4G80B 5AVSB 3T8XB 4YUEL 3D07A 2BIQA 3KPLA 1NPNA 4I9WD 2K70A 4YWGL 3SKNB 5L6YH 3B2VH 4K8RD 2D9CA 2JQAA 3NIDF 4X9YA 2EE0A 5TE6H 2Z8SA 4WFFE 2XUWA 2XVLA 4U1MA 3WKPA 5L4FA 4O9HL 1FH5L 1A22B 3MXVH 1KN4H 2AJUL 2E5EA 4HKZB 3X17A 2MKWA 3RX5A 5K1JA 2VLRE 3MRKA 4I1NB 1A0QH 1MIEH 3W5MA 1FYHB 1UM5H 1VA9A 1S9WA 5FS5A 2OMZB 2X2YA 4QYAA 1IGTB 2EYSB 1U8NA 1ZWIA 2WQSA 5HYSA 1HFUA 3IGAA 4U1HB 1UZGA 3MO1A 2ZXGA 3FQWA 4G6AC 5DMKA 2ZUTA 4JFHE 3CZFA 1OHQA 3L4WA 5EOTA 3SZKC 4X9FA 2F58L 2OR9L 3ZGHA 5B39B 1JHLH 4FXGC 1HL9A 5GZOA 3WCYA 3LIZA 3P4OA 3DUSB 2APXA 2M1KA 5K33A 3GSWB 1UWGL 2ARJB 2EVHA 4NXSA 3IGLA 1QSFB 4R4ND 4QT5A 5HGDA 4Q9BA 1PIGA 4HUMB 3X3GH 1QWHA 4PJ7E 5TDNB 1S7QA 4PJIA 1IGIH 4LRNH 3VO0A 3OKDA 4P4KB 3TT3L 1ND0A 1J1XH 5FLUA 3QH3A 2ZX7A 3UO8B 2Q10A 4KU1A 3ES6A 4F1ZA 3HN5A 3C6SA 5JW3L 2E59A 4CA4A 1A3RH 1NDMA 3H9SA 1KY6A 1P1ZB 3DPBB 2X89A 3VU2A 1TLKA 2CU9A 2GVYA 1RIHL 3GSUB 2GB2A 3L16A 1KTJA 3S2CA 4RGMB 5E2TL 3L45A 4CU7A 4GUCA 2XXMB 5IESH 2X3CA 2VH5H 2ZYRA 1WCBA 4EDXB 3GMLB 3VFTB 2KL6A 1HHKA 3IU4H 4PRAB 1F5WA 3IPBA 1BZEA 3QJVB 5D96C 4CN4A 1ZDQA 3VXNA 3BMVA 3LZPA 2AS5M 2HVJB 1U8PB 4Z3GA 3DYMA 4YR6A 3MMEA 5AW5B 2D4FA 2WSPA 5INCB 1ASQA 4GG6E 1IGFL 4WHYH 5SWSB 2RHEA 4Y9BA 3ZDXB 3I6KB 4M7ZB 4A7TA 4ZAKD 5IVXA 4GRMA 4RSVA 3CFKA 3ALXA 4H8HA 3J2PA 1B4RA 5I1LB 5A16B 4GMTL 1RZIB 5HY9B 4KZDH 1DVFB 3ZL2A 3CN2A 2FGWL 2CIIA 3GGWA 2A6JA 2ZG2A 4AQEB 4YO0B 3P0VL 1MELA 4ENEC 5J6HA 2UX7A 1P9MA 2Y2TA 2OTUB 2CUHA 5GS2H 1E3ZA 1D5IL 1HINL 1TYRA 4B7IA 3K6NA 1JZ7A 1GW0A 4FQQA 4HIIA 4XCNB 4HWZA 3UTPE 5DJDA 1JXKA 2EDRA 1JFHA 4IBZA 3EJJX 1IE4A 4NHUB 2N01B 3FONB 3BPOC 3NVQA 1JDCA 4TUOB 4FF9A 5C07A 3O4LB 1ZSHA 1J05B 2BVPB 3V6OE 5EU7C 3ARED 5I71B 5C09B 3DRQA 3OV6A 3H3PL 4L0YA 3SO5A 1L0QA 5FHAH 1FORH 1RHHA 2OP4L 1XH3A 4X4YA 3HE7A 1OSPH 1RZKH 4AIZA 2R8SH 3BWUC 2Q8BH 4OGAC 1BFVL 5IVNA 2PN5A 3PLYA 3I02B 3FW6A 5LBGA 1X7QA 3CBRA 1FFNB 4KK6C 2F5BL 3STZA 4XRCA 2YAFA 2YGNA 3KPRB 2L4OA 3LZLA 1ZHLB 3PV6A 4QTIL 1ZLUK 2HMIC 2R2EB 2EYRA 1R3KB 4MA8H 2ZUWA 2XACC 4JFSA 4Y2DA 5DFTA 3FQXB 4WW2B 2I9TA 1G84A 4ZW5A 4PRNB 4DK5A 4YHYC 4GBXD 3L9EA 5D7IE 5JHDD 3CN0A 3BAKA 2FX8L 3UTZA 4TULH 3POCA 3MZTA 1KJ3L 2EDEA 4K94C 2Q6WB 1EO8L 1JFQL 2NY3D 5EUOA 4XGZB 3MU3A 1KXTB 1GJWA 2BHUA 4ZUVB 3SN6N 1JZ3A 2XDHA 3CFBB 1OW0C 1KUMA 4X5WA 1LEIA 2IG2H 3PHOA 5DQ9B 4BZYA 5CP7A 4DO4A 1IGTA 4N2MA 2ATPB 3NH7L 4MCNA 1P4BL 5DUPL 3VMOA 4F15C 1JZDC 4U1HA 2A74B 4K23H 4ABVA 4PJFA 3UH8A 4KROD 5ESQB 2R59A 4WU5A 1EEYA 3ULSB 4ZPTA 4PLKD 4FTVB 5L4IA 4NERA 3T65A 5EORL 1KYFA 3BH9A 3DYPA 4XPBL 1FLRL 4D9LH 3IFNH 2DQFB 5HGBA 2BSBA 4BZ2A 1FG2A 1RU9H 4RMVA 4JY6A 4JG1L 3ZHLA 1R75A 3VWKA 3H1ZA 4HPYH 2H0PA 4LHUA 5IGXL 4AZUA 1IAOA 4K2UL 1KCUL 4LCWB 4OQTH 3BPNB 1PFOA 2FE0A 1T89A 3PWPE 4G7SB 4JREC 5FECB 4Y7MA 4KNUA 2H8PA 3NJLA 2WWMD 2BZ7A 1TTRA 2AQQA 3NEEA 4P9HC 5DO8A 1MPAL 3VD0A 1BHGA 2H2PD 4MD4B 4BCYA 1EZUA 1EO5A 2JCCB 4FCHA 3KR3H 2VXSH 5F1SA 4J4PA 1UWEH 3UYRL 1UXWB 2VLKA 3ZDYE 1E27A 3QA3B 3QUHA 5EOTB 3UIYA 1DN0A 2XWDA 3B9EA 3BH8B 3I6KA 4KKBD 4ACPA 1NUDA 2ENQA 5I0ZA 4LHUG 2VR3A 3VFWA 3VFUA 4I48A 4G6ML 1KIUB 4U0RC 4JO3H 2WXGA 5IUSA 4H8WH 2C7UB 5BRZB 5TTRA 4Z7WF 4WI3A 4V33A 1A3QA 5IQ7H 1J10A 4JFOA 3OKDB 1OAYL 4P4KA 5FWQA 3DPDA 3GI8L 5IHLB 1X5YA 2XQBH 2Z31C 3BFOA 4UV7H 4CL7A 1E7VA 4NQEE 1Z0NA 5TQ2L 5BZDB 2MNUA 2DTML 4YSDA 5MERB 4HFUL 4X7SH 1AZCA 4JJOA 1UEMA 2BK8A 2Q0ZX 3FB7A 3QZWB 2PCPB 4QRBA 4OB5L 2QMKA 4DFHA 3KLAB 1XAKA 3ILQC 1PLCA 4XNXH 4L4TE 4MMXA 1WHPA 2PUQT 1UT1A 4FKEA 5IHHA 1TQSA 5LG6A 2FT7A 2UZYB 1SJVA 4ODHH 1LEKB 1ZSDA 1T03H 4YR6B 1I3UA 5DS1A 1FVEB 3WIHL 4M93B 5B7FA 2E7HA 4LMQI 1GMEA 2WYZA 3D52A 5CD5C 1FRGL 1RZJC 3EJSA 4AWJC 5F88B 4JQIL 4JLRB 1S7RB 5GGTL 2B9AA 5AD0B 2IH3A 4QOKB 2QEJA 4PVNA 5IVXB 5E08L 1HJCA 3MNVB 4XOBA 1YLBB 2PYEB 1GSMA 1XGUB 1GVIA 2XZAL 2QFRA 2AXHA 3PL6C 1KT2B 3LKSB 3JWDC 4I5BA 3MRNB 1DBJL 1BBDH 3T6VA 3NSCA 3ILPB 1PLGL 5DYOA 4ELMF 1E9OB 2NY2D 3EH3B 1HE7A 3BP6A 4N2HA 1U6AH 1IM9D 2XFGB 1FFPB 3FT4B 1RIHH 5ACZA 1VGKA 2Z92A 1P7QD 5DJ2B 4PGEB 4L5FH 3MLSH 2X6AA 2HRGA 3K72A 5E6IA 2C4FU 1GA2A 2Y1ZA 2ICCA 4TQ8A 3EGSA 4JHWH 4JO8A 4LLAA 4Q2ZB 3SBWC 4JANA 2DEXX 2AJ3A 1EV2E 3E6FB 4K8RC 4C8XA 2XTJC 1YQVH 4QGYA 4NOFA 1EGJH 3B1TA 2WSDA 3AREC 3DVNA 4PVBA 3DC0A 1IBYA 2YQ3A 3EBHA 3B6SA 1ZVSB 1WIUA 4MQ7A 4OM1L 4NM8L 2OYKA 3WV0A 5IB4A 1SRDA 2V8MA 4Z3FA 1B88A 3MROB 2F68X 1V3KA 2QQNL 4KZDL 2JI2A 4ODBD 5CR1A 3RDTC 1U3HB 5FO9A 1G9MC 4OGAD 5TQ0L 4OFKA 4KHTH 1ZK9A 2B2XL 2FJSA 2F7IA 3O2DA 3NIGB 1DANU 5J56B 1UOVA 4I0KA 1A5FH 4AGOA 3DO7A 2VJ0A 1LE9A 1CYGA 1OL0A 3S8FB 3HC0A 4LPVA 1HSBA 5D9SA 1D9KD 4OM0L 7FABL 1UXSA 3U1SL 4AMKL 1AP2B 1MUJA 3LN4B 5DZLA 4GRLC 1KDIA 1I1RA 5J12C 3GXDA 2C26A 2KPNA 3IPEA 4GBXC 4HKBB 4IIQC 5F7KC 4IKLA 4X7DC 1CXFA 3V2AR 1TNNA 4Y4KC 5FLVA 1F3JA 1ZPUA 1UZ6E 2APWA 2I85A 2Q7YA 3QCVL 4FTVD 2WLHA 1HNYA 1ZOXA 3KGRA 4K5NA 2ZYIA 5I0DA 2XIBA 1RZKL 5BZZA 3T0BA 3SDXB 2H6UA 4R90H 2D2CC 4YSSA 3BIAX 4PLJC 1YUHB 3RI5K 5EIIB 4U6HB 3C09B 1KV3A 4XE5B 5FYKL 1YEIL 1BMGA 3CN1A 3EYUL 4J3VA 1KTLB 3MYZA 3V7AG 2DQFA 2DQUH 4PTTA 5IQOA 5FUOL 4QOKE 2Y36L 3VDBA 3IDNB 2WYTA 1XGQB 3C5SA 4MA7H 4OCMC 5CZVH 1F58H 4YVUA 3FQTA 3W3BA 4PIRF 1W6WA 1RZ8B 4Y5VA 4DP7X 1MCOL 3FUIA 3FQ1A 4G7QB 3ULUF 2GSGB 3C08L 1AJ7H 3H4HA 4ZX3A 3GSQB 3H7BB 2GUOB 5D6CA 3OB8A 1PD1A 4PJ9C 1TZGH 2YRZA 3IJEB 3O3BA 3NESA 4WNSA 4YX2H 5MEPA 4KKRA 3FTUA 1IC0A 2VSKB 3BSZH 2QPEB 5L88L 5IB2A 4LL9A 1MRDH 4G43B 4U49A 1IC4H 4PJDE 5DEFA 1B2WH 1KTRL 5FOBA 4OF7A 4U3CA 5I6LA 4LOEA 1I85C 1FC2D 1M1SA 3MXWH 3HZYA 1I3VA 3RU8L 1Q38A 4B50A 4R96B 4LPYA 4P3CH 5DJYA 4JCMA 1A6PA 1AYOA 6PAZA 4YE4H 3L3KA 2B4CC 2AEPH 4GEJA 5B3JE 4BHUI 1NOAA 2ZKHH 4XBPB 3Q1EA 4TTDD 1VIWA 3T0DA 4K07A 4G8IB 4YWGH 1EJFA 1MJ7H 4UIKL 4YDVA 1KGCE 5IEKA 1SFHA 3GLEA 4AYFB 1K6QH 1MFDH 4KPHH 4PG2C 2VR7A 1P7KB 1VB9A 3BGFC 1L7TL 3MOAL 4QYOA 3U0TA 3WTTA 3OR6B 4ZYKB 1DFBH 4Y89A 5BZDA 4CNIB 3L4CA 4G6FD 4FULA 1JWMA 5AW8B 4XPAL 3PL6B 2GJ6E 4GKSA 1FNLA 1V7NH 2VZTA 2GBVA 3ZW3A 4V1DB 2QQNH 3CLFL 2P1YA 2MOGA 1DBMH 3GIZL 4JDVB 5DLLA 1JZFA 1TJIH 2VZ3A 5D1QC 5C0CE 2UY7B 4Y5VC 4YSRA 5C0NC 1QRKA 3EBAA 3IFOB 2YUVA 2MSPA 3WAJA 3CK0H 3UBFA 4G71B 4GUPA 1C16B 1EJ8A 3FFCA 3ZN6A 3EJTA 2PO6A 3E1F1 1YG9A 3QIWB 5KANG 3VFRA 1XF2B 3EO9H 5FW6A 4DVBA 3WYRA 1A1MA 3ATEA 5KVFE 5T1DL 4WSKA 5LXGL 3M6DA 2VDRH 3CHRA 1M42A 5IQMA 3I6GA 2ZXEB 4I5BB 3QUYA 4FX5A 2NUPA 1Q90A 2IXQB 3QI9B 4FC3E 4JM0A 4Z3JA 2R1YA 1RPUA 3IDMA 1Q9OB 2CJ3A 3PFUA 1IVTA 1M7IA 2UYLB 2VW6A 4IM8A 1NFAA 1UURA 3D39B 2GAZB 3GBMH 3NZ8A 2VTFA 3TIDA 4K4KA 2ADYA 2YBRB 2WLZA 4PJ5D 5DHVH 2BZCA 4KZCA 4PGBA 4WF7A 2NXYC 3MRBB 1QFWI 3VD9A 4E0RA 4XCEA 5IM7B 4CW1B 1MREH 1FFOA 3MV8E 1BQHB 2OR7A 3H7LA 4JHAH 1J0IA 4LL1A 2X0VA 3S3PA 4KKZA 4WO4A 3DVIA 3ZXAC 1C8PA 4P4RB 4NJ9H 1IFHL 5FGBC 4PRPD 3SPCA 1U3HC 3T0WA 4N2OA 1SY6H 1N6UA 3KPRE 3OHXB 4OFPA 1QSFA 3PG2A 5LVEA 1CVSC 3NABL 1PY0A 3MUJA 4F1SA 1FAIH 2P24B 1UB5A 3SJVA 4UV4H 1I7UB 4OCWL 5FIEA 3ULUH 5CJXC 4M4RA 2Z65C 1A7NL 1EBAA 1QSFD 1HEZA 2R4RL 3INUL 3LV3A 1AIZA 1VFAB 2HX7A 5C0BD 3UG4A 1JYNA 1H5BB 2NPLX 4KJPD 5GJTH 5KJRL 2R69H 4NO5A 3T5WA 2YBGA 2XG4B 4HUUB 4I85A 1PG7H 3KLQA 4HG4J 1KJVA 3D9AH 3O4LE 3O41B 1BQLH 1DHKA 2SEBB 1XIWB 3DXAA 1M9SA 4YBQD 2XQYK 5IF0B 5C0CA 1O9ZA 4JN2A 4LNVA 2F74B 5CINH 4RVBA 3M1CA 1YY8B 5IK3B 2WLLB 2PCFA 3RGVC 4EDXA 5EO0B 3R4RA 1YEKL 1DDTA 5AVWB 4Z8FL 4GRLD 3L5XH 3QCTH 5G55A 4DUWA 1BA9A 2VMJA 4F2MA 2LLLA 4V1DE 5IVZB 2QKSA 1DFXA 2V2TA 4O51B 1UXMA 5FUZL 4MZRA 1NQBA 5D6DA 4HIHB 4NI3A 2EVGA 2Q8BL 3RWIA 3VFSB 2YS4A 2LHAA 3Q9QA 1IQWH 1WZ1L 3AVEA 5F3FA 1PKOA 1YYCA 3L4XA 3MBWB 1IM3A 5T3XD 3BKJL 4NIYE 3DI2B 1UFGA 1QFUH 5DK2B 3HAEB 4HH8A 5K1NA 3FCTA 3C6LA 3N40P 3WNKA 4OZFA 1GGCL 3VXTB 3G6AA 1QZ1A 3CLFH 2GKIA 2P5WE 4XO8A 2OTUA 3AY4C 4DT2A 2WINB 3HNVH 4ISVA 1KYOJ 1GZHA 3UGEA 5B38G 4N28A 5HI3C 2J43A 3LCYA 3CDCA 4HWZB 4UQEA 3KDPB 4HJGA 1ZHKB 4L2YA 4OFYD 1LDSA 3EO9L 3FONA 3VXRD 3QCVH 3ARGB 5EIQA 5GRXG 4RFOH 2Y3AA 1JPGB 3TWCL 3NH7H 1I8IA 1REIA 2F6AA 2VDRL 3O4OC 4UU9B 3UEZA 3V6ZB 1EZLA 5KANI 4PMEA 2LOEA 4U2YA 3KE0A 1JAEA 2ZWZA 4AKQA 2CIKA 5EZOH 1U95A 4HZ1A 5B3NA 2V3EA 2VRQA 5T3XE 5FW7A 4LOUD 4N26A 3R06B 1QSFE 1TJGH 1EVTC 1A7OL 2XPGA 2WMPB 3DI3B 2C3HA 3IFNL 4LCCB 1RU9L 2UXVA 5FKPB 4Q9RL 1DSFL 2EYRB 2YA2A 4UAOC 1IU1A 2QQQA 1HILB 4BSWB 2IWKA 4K5PA 4XHJC 2YZ8A 3MLTA 2E8YA 3PWUA 1UATA 3ESOA 4LGSB 3TCXA 2WC7A 3V8CA 2JCWA 4EI5B 1VFBB 3ZQ9A 4YX2L 3QRLA 2BWDA 4UM8A 4WW1B 1NBZB 4Z7VE 3RWJA 3OB0K 4TUUA 2CWRA 4M5YL 4ORGB 1SMAA 5DQ9A 4E0RB 2F8OA 3QDMA 3GRWA 4EO5A 1TQCC 5F7HA 4WU7B 4QRRE 1DVFC 5AVUB 1ZE3H 1FL3B 1KCRH 3LKRB 2R23A 4O2FB 5IQLA 2G3ZA 4OCWH 1T1YB 3G5ZA 1GYCA 3VG9C 4GYBA 2QGBA 2VZSA 3NIFE 3P0YH 3QXDB 1QSZA 3LMJH 2BVTA 4MDIB 3IJSA 4M6AA 3WE6A 1NIFA 4DQOL 4PAZA 4ZW8A 3HS9A 3BIKB 3MCLH 1BD2E 3N43B 1AD9B 4HFWA 2HA1A 4PJGE 5HDQH 4XPGH 1F4WH 2BY1A 3LH2L 5B22A 4OCNC 3TNNB 3D25B 1RZFH 3II1A 4JFEA 4TNVF 1HWGB 5AVXB 2B15A 1YEKH 4FQLH 4NCDA 2J88H 4OV5B 4HZLB 4BINA 1AD0B 3B5HA 3L1EA 1KIRB 3SE9L 1AZVA 1T0MA 5B8CA 5KG9A 1KEMH 2C5DC 2KDGA 3C5XA 4Z9KB 4Y1AB 2AQ3A 3HEIB 4AUJA 5C0CB 1CLVA 5ANMA 3GTNA 2IOOA 1G43A 4PJAE 4X7SL 4P4KC 4EXKA 1RPQA 1U8JA 4ZO9A 2Z1KA 3L7EB 3V4VA 1JHTA 2EE9A 3F62A 1CO1A 1E65A 5EN2A 3D05A 4X6DF 3ECWA 4CMMA 4DP2X 3B1UA 4G80A 2DMKA 2ADFH 4NSKB 4UT6A 1INEL 1ILSA 2I69A 2KZWA 3ZYOA 4L3CB 1HZKA 1MRFL 3NRQA 2F08A 4M1GH 1N5AA 2KS0A 5DT1H 2ZCHL 3ZR6A 3IAQA 4F7EB 1QWUA 4H88H 4ONFH 4UB0H 3FDWA 3LQAL 4TLKA 2NNAA 1ADQL 4QGTA 1JV5A 3VMNA 5GGQH 4WTWA 2H0EA 1WFNA 4Q0XH 1IT9H 1E2ZA 5EEYA 5DJAA 1ORQB 5C0FB 1C12A 1LXMA 4JFUA 4AG4H 4RFEA 3ZE2E 4KV5E 3S36L 1D5ZB 2Y6SD 3GRGA 3PYCA 2OMVA 1IBGL 4TPRL 4IKIA 3BQUC 3QUXA 3L5JA 3SE6A 4ZFGH 2X9WA 5ADOH 4ATWA 2DLFL 4UQ9A 5IFHH 3TOPA 2F18A 2XKNA 3MTXA 2XIIA 1YY8A 1KPUA 2CLRB 3VWKC 5CCJA 4HLZH 3WFHA 3HE6C 3NRFA 4Z78B 1ZLUH 4D0BB 4ODXB 1QTSA 1Q4NX 1HSAB 3HG0A 4LSQH 3MRJB 3QI9D 2NY5L 4WHCA 3HZMA 3P0GB 5I1AB 4X4MA 4NT6B 1GIGL 3GNMH 4BQ9A 3OAZK 4PB9H 2VW7A 1XCQA 2G75A 3HZKB 4ADJA 5LNDA 5IJCC 1F0LA 3GPSA 3GHBH 4U6XB 5E6ZA 2WMPA 2V3DA 5DVLA 3HG4A 43C9A 1GXEA 3TV3H 5C08B 3EOAB 3QEGL 4KHTL 1E2WA 1HILA 3N2JA 1VCBC 3FUNA 3DGGB 1K5WA 2PYED 1XZ0B 5D96B 2F53E 2HKHH 1IAKA 5E56A 2DJ4A 1AO7B 4JZNB 5HSFA 1H3PH 1D5XA 2H0FA 4GXUM 4E9VA 3QUZC 1G0XA 2FQDA 2DQDL 2TSAA 4RIRB 5DMGD 5FA3A 3VRIA 4F57H 1KB9J 4AJ0A 3HMWH 1JZ2A 1JV2B 2AV7B 4Q6YA 5HJBA 5B7MA 4OZHF 5I8KH 3EUUA 2H32H 4ZS6C 4XBMA 1MCNA 3T6ZA 4XVUC 8PAZA 3G5ZB 2EUVA 4R7NA 4ZTPL 3RVWC 3UJIL 1HHGB 4J6IA 3EFOB 3O3AA 2K78A 4MZ3A 5J89A 2K3TA 1G1YA 2CCLA 4L29A 4NKOA 5D7SH 4IRJB 3WE6B 1NLDH 5K9QG 2NOYA 1G6RA 1OAQH 2F9BT 1KEML 2I5YH 5IHZB 5I6MA 1NA8A 2L8AA 1U92B 3AS1A 1YECH 1EHNA 2H3KA 2Z91A 1BZ8A 1F8TH 4LSPH 5F1KC 3ABKB 4P59L 4Y4FD 1JNLL 4YE0A 1IEAB 2VM4A 5M95B 2FBJL 2FIRT 4LKCA 5CZVL 1S5HB 4N4YB 4XB8A 3G5VA 1J8RA 4DESA 3IXAB 3MV7B 4XMKL 3KS0H 3CCHB 2X5PA 3QIBC 3ZSTA 1C5CL 5HVGB 3K3QA 1U8QA 1DQML 1GGIL 5AVYB 2B3IA 4M7JH 4D0DB 1IBHA 4PJFE 2ORBL 1KCVH 2VN3A 5G4MA 5I76B 1ZWIB 5EF1A 2K4AA 4J8RA 4OD3H 1WBXA 3K8MA 3GTTA 3MO1B 1FZMA 4XP9L 4RQQA 3LDBC 1DJWA 2BWQA 5HI4C 4HGMA 2VW4A 1JXGA 2CMRH 4I9XA 4XXCC 2GBUA 5G4OA 3VD2A 3JV5A 4WKZA 1R3HB 2BVEA 4N2CA 1MJUL 5TH2A 3O0LA 4QHLB 2X1QA 3GBLA 3SDAA 3QDGA 4CGTA 3VUAA 3VXMD 3DHUA 2Q6WA 3IETA 4HSCX 1KBVA 4BSVB 2BS8A 4G6AD 5CEZL 3VXPB 2AC0A 1VENA 4G8GE 1OHZA 5CFAA 3Q7JA 4XBEL 1WIOA 3S96B 1XGYH 2JJTA 3GMMA 1WBZA 1B6DA 5HTSA 2IPTL 2WQUA 1A7BA 2C1OB 3CHPA 5MEOB 1Z3GH 4ZAKC 1L7TH 1GIGH 2H6PA 3OLDA 5D1ZA 1HXMA 3HG3A 2JI3A 2R4SH 3TV8A 3FBQA 3J27A 5GHWH 4ETYA 5CS7A 4NS0A 2J4WL 4AITA 5KBPA 3K4DA 1KNOA 4LCYA 3RP1A 3LRMA 1ZANL 1M2VB 4H7VA 2P5ED 2AZUA 3SKMA 4I77L 4YXHL 2FJGB 3DX6B 5FF6A 3IYLW 2IWFA 4P06A 4LHUB 5JHDA 2NX5B 4NQEB 2FJUB 4PGCA 1PX4A 3HN8A 2N1TE 4EOWL 5GZOC 2OK0H 1FJ1B 3VFOB 1R17A 4XHJD 5TGBB 5F7BA 2PNDA 4ZSOB 4WDIB 5FA4B 4Y19A 5LGKA 4CVZA 2CLZA 4PJEE 5E6UB 3WHE0 5I1IL 32C2A 3TZVB 3MUGA 3MRLA 4UQBA 1VEMA 4ABWA 2HN7B 1Z5LB 2EIZA 3BKCL 4N1CA 4AVJA 2GQHA 2OX5B 2QMJA 1MW0A 3TURA 4L4VB 4Y19E 1OTUD 1R34A 2R1XA 2WZPA 1IUZA 1CFSB 1RV6X 3C9NA 3HI1B 2V33A 5FA3B 3VRIB 3WD5L 3GMOA 3I2CH 1UM5L 2L0DA 1HXYB 3ZDXE 4ANVA 4GKSB 3JYBA 2F5BH 1PAMA 3ZUCA 4C55A 4TUJA 3UACA 2QQKH 4G7VL 1N68A 1T0NA 1EHLL 1KTBA 1WAAA 2KZKA 4YAQB 3EJPA 3S88H 2VRAA 4WFHD 2EDKA 3LKQB 3VXME 4EKXA 3SCMC 4PHXA 3QORA 1YNKL 4BKSC 1I8MB 4HOWA 1SXCA 4XXCA 4OCSL 4N1EA 1U9KA 4FYRA 4IRZL 1F4HA 5AW1B 1BLNB 1W72B 5LDSA 4OF0A 3MREB 2PLTA 3W11D 4HOZA 1BMWA 3P11L 4X6DA 3BVWA 3KW8A 1K4DA 1S7TB 3M17B 3MRGA 4N9GB 4ZMQA 1G7IB 1WDAA 4G8GA 2PCPA 3BQVA 5HYQA 2GYSA 3EYOB 2R4RH 3INUH 5LXVA 2BRRH 3HHMA 5GJTL 5KJRH 4L3AA 4CGUB 4HIXH 1RMFH 4R5XA 4TV3A 3TGXA 1MNNA 1O6SA 2WLNA 4IIQA 2XXFA 2BP8B 5DZNA 5CLWA 4A63A 1CLYH 1KXTA 4ZUVA 2EABA 1MHCB 4POYA 4MMZB 4UWQB