2COVD

Crystal structure of cbm31 from beta-1,3-xylanase
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
92
structure length
92
Chain Sequence
b'PPENCQDDFNFNYVSDQEIEVYHVDKGWSAGWNYVCLNDYCLPGNKSNGAFRKTFNAVLGQDYKLTFKVEDRYGQGQQILDRNITFTTQVCN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords beta-1,3-xylanase
molecule tags Sugar binding protein
source organism Alcaligenes sp.
publication title The first crystal structure of a family 31 carbohydrate-binding module with affinity to beta-1,3-xylan
pubmed doi rcsb
total genus 23
structure length 92
sequence length 92
chains with identical sequence E, F, G, H, I
ec nomenclature ec 3.2.1.32: Endo-1,3-beta-xylanase.
pdb deposition date 2005-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF11606 AlcCBM31 Family 31 carbohydrate binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2450 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2covD00
2COVD
chains in the Genus database with same CATH superfamily
5B1JA 3TWYA 1HHKB 5EOTA 2D7QA 4TUOB 4BFKA 2V0AA 2I5YL 3BKJH 1AMYA 2IF7A 4TVPL 3LD8B 2CUMA 3F7VB 4H1LG 3KLKA 4P49A 2P5EB 3S0PA 3WNKA 3MTRA 4BJLA 4OIIL 5EO0B 2MWCA 4ZSOB 1Z3GH 1U8HA 5D1ZI 3H4FA 4IJ3C 1MVUA 1RUAL 1KBPA 2AK1L 4YHNA 4PY7A 1FSKB 1Z5LB 4G8IB 5GGTH 5DSCA 5IT2L 1CLVA 2XJKA 3SYQA 3F8UB 2C5DC 4N6QA 4HH9A 3PUCA 5EEYA 1H3VA 5BZXA 2EILB 5TDOB 3KCPA 5HYJB 4HOXA 1IEHA 2VR6A 3U2IA 4L3FA 1IGFL 4DGIH 3BMVA 5FYJH 4CAGA 3IDMB 4F57H 2BNRA 5LB1A 4JRXA 3BVDB 4HWUA 2H2SC 1KYFA 1BD2A 1CFMA 2IXQA 1M7DB 3IJYB 4K07A 4YQXL 3IDIB 2ZCKL 1BCIA 4HZ1A 2VN6A 3WIHH 5IFHL 2DIJA 4LVNC 4AITA 5D70L 3FT0A 3HNTH 2Y1ZA 1NCDH 3VGAC 2L7UA 3MNZB 1J8HE 1XH0A 2DQTH 2FATH 4I3SH 4N2AA 4NZRL 4XAWL 4CC4C 5F9JB 4LARH 2R2EB 3ZMRA 2EUVA 2ZCLL 3ZDZF 3REVA 2LU7A 5ESAB 3VH8B 2BSTA 4E42B 3ESVF 5BQ7A 1FL3B 1H8LA 5CP3H 3C5ZD 4JY4A 3VXRB 4KRNA 2GW5A 4IMLB 3DMMC 1F1GA 4GIOA 4QRQA 3NAAL 1QSFE 4UV7L 4AENA 2P49B 3KR3L 3PPEA 4L0ZA 4YZFF 2NQDA 5DHDA 5L7XL 1WWAX 3AG2B 5C0FB 4J8RB 1LJMA 1AC6A 4M48H 5E95B 4KK6D 1GIGL 4AEEA 4J39A 4JFQA 3RWIA 4RISL 4OLZL 4Z7UE 3HS0C 4KFMA 4ALAH 5ILTH 1BX2A 1EERB 3ASWA 1IQDB 1YEKL 2X9ZA 5HHNA 3FFCA 2ARWA 2R69A 2WQ8A 3PNWB 4LCCB 4B3VA 1KJVB 4X8XA 3WNJA 1E30A 4UQ3B 1KJ3H 1YSOA 2GI7A 1WQVT 4MJJA 8FABB 1ZT7B 1X5HA 3C6LB 5F1OB 5ADPL 4HBCL 15C8H 3RPIA 1IBDA 2DQCH 5DVOA 4QXTB 1IKOP 3D0AA 1KY6A 4Z7WE 3AXLB 3VXRA 3EFFB 2VABB 3O6LH 1MCJA 3E2HC 3BUDA 4IQHA 2ICEB 4PJFA 1KYDA 2FJGB 2H9GB 4U6XA 2GJRA 1CQKA 5HI5D 1RUPH 1ZXQA 4LSRH 3EOBB 1J48A 2GIYA 4Z7NE 4MB5A 3DO7A 5JDSA 1M3JA 1J1OH 4AC4A 5GSVB 5C0CB 4N2GA 3BT2L 1HYSD 2WAHA 2XN2A 3CXFA 3UAFA 1E4XI 3VWJC 5L0QB 3PWNB 1X7QA 1K4CB 3KWVA 4N8VB 4M6AA 3U0PA 4D0DB 3BRDA 1IJNA 4IRJD 5CSZB 4QTIL 4RGOH 5D5MA 5E94A 1JPTL 2V3EA 2AJUH 4L29B 1PVHA 12E8L 4BFOA 2A0LD 3I2CH 4M56A 4BDVA 1T5KA 1KIUA 3OKDB 1P4IH 2AXJA 3FTXA 4QHMA 1VCAA 2W95A 3O2WH 4Z9KB 5KSAA 2PPFA 5AYTA 3SD2A 1UD5A 1M3IA 2GJ6B 2VO8A 3CSFA 4WUUA 5JNYB 5EUOF 4JANB 2KH2B 2ID5A 4Z5RB 2QDWA 2ZKYA 3RGVC 2BIQA 2XVGA 3NEXA 1BAWA 4NQTA 2KLTA 1KG0B 1DQDL 2PN5A 4PVMA 5LGKA 5BCAA 5DJAA 2WOBA 2EE2A 5KJ4A 2B59A 5EPMB 5A16A 1DDTA 1JGDA 5MEOA 1WIOA 1DQLL 1G43A 4NBZB 3A4DA 3P0GB 3N91A 3WJMB 3ZYIA 2D0HA 1KGCE 4X50A 1XR8A 2YPVH 1B3IA 1RK1B 4NQEE 5AB0A 4F7CA 5JW5B 2B4CL 3DUUA 4ZSOE 1PG7L 1SJVA 5K9QG 4BD4A 3F83A 3UYRL 1PZ5A 5DFTA 3TCTA 3HHRB 1UJTA 3GXUB 5DFVC 1N6UA 3IFPB 3Q6FA 5F9WC 3VFTA 4F3FB 1FNHA 1S7XB 2A9AA 1LILA 3O6FD 5J1AB 3TZVA 3GB7B 4FNLL 3NK3A 1E5ZA 4XO5A 4EI5D 1R0AH 4MS6A 3S97C 1M9SA 1UM5H 5CJOH 5L9DH 4QHUA 4MMYB 4KO5A 3CC5A 1HOEA 5F7UA 4YXKH 2H1XA 4P23A 3CFIC 3BKJL 4CVZA 4DVRH 1OHZA 1TPXC 5E1QA 5C86A 1E4KA 4R4FH 1GZQB 1TG8A 3ZDXB 1V7NL 1KCRL 2A4ZA 3FB7A 5ANMB 4ALAC 2JKWA 1GPOH 1OAYL 2NTFB 1JGIA 1Q1PA 2UZXA 2VR3A 1S7QA 4XC1H 5EBGA 3VD4A 1A6VH 2NYKA 5T33H 2X2JA 4XPGL 3NTCH 1J1XH 3OV6A 5HYJE 3Q5YA 2X7LA 4I0CC 1HSAA 5AVXB 1K8DA 3ESUF 3IN2A 4H2CA 4HK0B 2P5PA 3MUUA 2LABA 1RSYA 4OCNC 5CEZE 2Z91A 4XOBA 4ZOBA 2WLKA 3BPCB 1JTOA 4ZQKB 1A7PL 3H42H 3ZT7A 2ZAIA 1HQRA 3EYSH 5AOMA 4WFED 3UTPD 3QCTL 4LNRB 3I3EA 3BKYL 3PFQA 5CR1A 2QPDB 2QFPA 5D1QB 3QQDB 4PI0A 5CGMA 1OTUC 3UPRA 4O2FB 3OM3B 3FNKA 3V6OA 4ERSH 3MODL 4Q4IA 2YLKA 4LL4A 2NNXA 2VDOB 5FGCE 2KUTA 2JB5H 2Z31D 1SUHA 1RZIA 1MF2H 2FJHA 3BAKA 3O2VH 5INDA 4RAHA 4EIUA 3FN0H 5GZND 3QUXC 4P5KA 4F24A 5CGYD 1AGBA 3RB5A 4OFKA 3MUJA 3VFWA 4DEUA 3SDDB 4KO7A 3HI5H 4J6IA 3V0WH 5I0YA 5F7FA 1DQKA 3KHOA 2OMXA 3QFDB 4HKXB 1M7IA 1A6AB 4UDUA 4LSDA 3DIFB 3WDJA 3KYOA 3QZPA 4ZQKA 3TONA 4PN6A 4JO5A 1PCSA 5EIIG 4XP1L 4C47A 3BVNB 2MQGA 2CA4A 4WI6A 4IBLT 4QHUB 1GGCL 3OKMB 1UUNA 4FF9A 2R2CA 3K6OA 4GRWB 2RBLA 2R23A 2HX7A 2A9BA 4GBXC 1ZLVK 1S7QB 4UUJB 3TEYA 1P7HL 4DERA 6FABL 3HS9A 1IAII 3G5YA 3PJSB 4GAJL 1SF3A 2X4OB 4G8AC 4HBCH 5E4IA 3ZDZE 2KDGA 2DQCL 1CT8A 2HFGH 2PCPB 3BCFA 1P69B 2QHRL 5HYJD 4R5VA 3FUKA 1H3PH 1T04A 1J8HB 1BF2A 4S2SA 1UCTA 1S2EA 4JFOB 4Y5YB 3L1OL 1EEUA 3V4PB 5HYSG 1RIUL 1IGIH 4TM9A 1O6VA 2IMNA 2WPGA 4OTXL 1BF8A 3GS4A 3O4LE 3SDCD 1A7RH 1NMCB 5EA0H 4ELMB 4RRPG 2YD9A 4G42B 3KGTA 3FUMA 4A6YB 1ZVSA 5E5MB 4F7PB 4A2FA 4IJTA 1ITCA 3RVWC 2CHXA 2NNAB 3K6FA 4MA7H 4PJ7E 5F88B 4GAFB 1F0LA 3TPUB 4Y89A 2YPLB 4LLUB 4PRDA 3U0TA 1O7VA 5PAZA 1JWUA 5LBSL 1NGQH 1OPOA 3GJEB 3N55A 4NPYA 3KVDD 3OKDA 3NT0A 2JJTC 1F4HA 1OF0A 2VLKE 3U1QA 5ADOL 3F01A 2GUOA 1G94A 3KVPA 3V0JA 2ARJA 2W80C 4FI7A 3WIFB 3X12B 5TQ0H 5E9DA 4Q2ZB 4JFXA 5A2KH 3DGDA 4WO0A 1ACCA 2LE9A 2OMVA 5AVSB 1BM3H 3VRLF 2JKNA 2NNRA 5BPPA 5FYKH 3ZIYA 2QR0A 4UILL 5FYJL 4F57L 1X7QB 5I6OA 4MQTB 3JT0A 3EYUL 3SQBB 1GYWA 2WUCL 5FEBA 1AVAA 1ACYH 1JWSA 3MRKA 5KS9B 1XBRA 2R29L 1ZE3C 4F15B 3RU8H 2VZVA 3CFCH 3IDJA 2ENYA 5EC2A 4E5XB 1A7NL 3HNTL 2DQFA 4WNSA 4NNXB 3T4YB 3KPPA 4D8PB 4YNYA 3UBHA 3CH1B 2BZCA 1W0YT 2MTAA 2YOCA 2HPTA 2XXCB 2XLLA 3EGXB 4Y19A 3ULUC 4LGSB 4TVUA 1KGYE 1MHPH 3AITA 3CHOA 4CGTA 1CFSB 4X98B 1IGFH 2PR4H 1SMOA 4JZJC 3W9DB 4DGIL 4UZUA 3N1MC 2YD3A 2HFFA 2JJWA 2ZXDA 2AHIA 2NZ9D 2AQ3A 3QWRD 1RURL 5D7JD 1NC4D 4H8UA 1ZA3B 3UG3A 4DVBB 3LCYA 4U1GB 5EN2B 3N1QC 4UM8A 3ABKB 4MNQB 3HC4H 2Q6WB 1MHHB 1PEZA 4JLRB 3FTUA 1LVEA 2AJ3B 4IU3B 5HJ3A 2BOCB 3U48A 4XMUA 4FC3E 1XCQA 3PABB 4JBSA 4YHZL 5HJBA 5KSBA 3KYNB 3UL4A 2Y06H 4IRJC 1UB5B 2WGXA 1L9MA 3ZTNL 2J8OA 1IE4A 1ZSDA 3JZYA 3RY6A 5GS0H 4HIJB 2XXGA 1D6EB 2OTWA 5HDQL 5EOCL 1PD0A 3BAWA 4WU5B 2AEOA 3I85A 5GZOC 2VDMB 4NO0D 4UBDD 4JY4B 5A43C 3K81A 4PRHA 4FNTA 1SUJA 1NOFA 3P77A 3GNMH 4GMSH 5DJ8B 3KH3A 1UD2A 5KVGE 1AQMA 2CCWA 4MA3B 4HJTA 1EUTA 4U1NB 1WHOA 3MJ9A 2ZCHH 2Y7OA 1FG2A 4PLOB 5D7EA 3CVCA 3HG4A 4WNJA 4PGEA 1VKXA 1S3RA 5SX4I 1UOLA 3E8UH 4LCUB 3WN5B 4BUGA 2GI0A 2J1ZA 1YPZE 4NSKA 5B8CC 4NQVA 2JIXD 4YC2B 1WCQA 4UOQA 3QEHA 3PNRB 4Z7AA 4ZW5A 1PZBA 2CO6B 4OZFA 2VR7A 1WZAA 5LBVA 1RJLB 4MJID 1WS8A 2DWDB 4DQOH 3MRCB 3BZ5A 3MNVA 5IGXH 2FUQA 4ELME 5ADPH 1NC4B 1COBA 2C3WA 3M45A 3OAWA 3BPCA 3QEGH 2J1YA 5K9KB 4IMKA 2Z6FA 4YDMA 2AJUL 4GRLC 1IL1B 12E8H 1SYVA 3U79A 2QQQA 4YXLH 1XGPA 1ROCA 2BWDA 1MPAL 3O2WL 1EHLH 1TPXB 3ROLA 4HF5H 3K2UL 4TPRL 3DV6B 1GGYA 3K7UA 1VPOH 2CDGA 4FCAA 2XETA 2BMKA 2L4OA 3B2VH 3RAJL 2PXYC 4A55A 4UM9D 2GC7C 4HWZB 1L0QA 2RQ8A 1DEDA 2BINA 2XFXB 3U4AA 1YY9D 1QUNA 3IDYC 3B6SB 4W1TA 3BAEH 4K9EC 4JLRA 4NGHL 2N59A 3R06B 5J8OA 4AV0A 1F11A 1H5BC 4J27A 2X6MA 4LRIA 1HH6B 2NY0C 3CDFA 4X7DC 2ZX9A 4X6DA 2BNQD 3A3YB 4BHUI 5I1JH 3IMBA 1KNOB 1U92A 2HLFC 3R0NA 1HL4A 4FA6A 4L9LA 1P4IL 1I9IH 4I9XA 1S9KC 2CJUL 3BWAB 3O3UN 2X4UA 4ICWA 4RLDA 5D2LE 4OV5B 1ZTXE 25C8H 1PZ3A 2YFOA 4J3SA 4L4VA 1QSFD 1WJ3A 5H37H 4BFGA 2MCMA 1FP5A 2H2PD 3UOAB 4GUOA 3AMKA 3CLFH 1RZ7L 1GGIL 4MD5A 4Z77A 4OD3H 2WSPA 5F1KC 1QNZL 4WAFA 2RD0A 5MI0C 5D6DA 2FECI 3BAJA 2H8PB 1CDBA 2G2RA 3O9WD 2X4OA 2WZPA 3L2NA 1MHEB 2ZPKL 1U8CB 2IEPA 2AKRB 3B56A 3IPEA 2ESVE 1I1YA 4KKPA 5L8KB 2G60H 4LEEA 3GKZA 5A6IA 2P44B 1W72B 5TF0A 1HL9A 1KPUB 4HD9A 3FB6A 4WWKB 4LSVH 5F9OL 1TKWA 3FULA 1ACZA 5C8JA 5IV2A 1F11B 2N7AA 3KPSD 1MVUB 3SPIA 3EOTH 4RFNC 3Q7JA 4N0FB 1MFAL 1L7IH 1SYVB 3R7RA 4AGMA 2VH5L 1E65A 3WUWB 4DKTA 3IDNB 1M56B 2YSTA 1XD0A 4BKTC 4U1IB 2P5ED 4ZFZA 3ARBA 2JLLA 1CICC 1IAIH 1PKQB 2XACC 4ZFOL 4H8WL 2J21A 3CN0A 1I4FA 3LEVL 4M1CC 1XR9B 2GTZB 3GJEA 4NPYB 4RETB 4RA3A 3SGDH 5F7BA 3UJIL 4N3UA 2OL3A 1YN7B 1N4XL 1KJ2B 4XH2A 3EGDA 1UWYA 2GITA 3MKKA 4YSPA 5AG9A 3QHZL 3VAEA 1RZPA 4DOHB 1BZQK 3ZT5A 1E6JL 1UKSA 4X6DB 3QEQA 2ATKA 2O5YL 5IMMA 3S37H 4MAYA 5F1NA 2Q5BA 1TLKA 4EZLA 5FUOH 2GIMA 1OCWH 5E4EB 4U6HB 4MWFB 4TXVB 3I02A 3LH8A 4FQXB 5LHDA 1WUNT 1NEPA 3C2SA 4LEOA 3W3BA 2I9LB 4NWUL 4PJHF 4HS8H 3QJHA 4KX9A 1Q9LB 5CZXD 3UCRA 1T89A 4OFDA 5LQBH 8FABA 2EE6A 3BN9D 1MCBA 2GK0B 4M1GH 1MELA 3ZTJH 3QQ9C 2R0KL 2Y07H 1L5GB 1I7TB 2WQXA 4LDEB 5IQLA 1OF2B 5KVDE 4GIAA 1FE8L 5CEXA 3VQLA 3KJ4C 4NCC1 1IQDA 1TUPA 2DJSA 1EXUB 2WXJA 3BSZA 1B90A 3IGAA 2IADA 2C3HA 4HPYL 4PRHB 4PWHA 3WY4A 3DURA 4JZNA 2VMEA 4L3EA 2HFFB 1N59A 5LG6A 4V1DB 3FN0L 1EGJH 1JPEA 1KLGA 3D4YA 5DQJB 4OF5A 2PCXA 4JY5H 3B5GA 1YEWA 2UZIL 2AJ3A 4IU3A 2PYEB 1HXYA 3QUML 4UT9A 3FQ2A 4XX1E 4A2HA 4KJYA 4PAZA 1RIUH 4DKEH 1QFOA 4MMZC 3ZKND 4MNHA 1R33A 1WLHA 2EVIA 3CLEH 3TT1H 4LPVA 2R69L 2AK4D 4U3SA 5J9PB 4XXCA 1ZDSA 4Y16A 1SLWA 3O6KL 2GBAA 2XICA 4P2OD 1GOHA 4QKXB 1OT2A 2CGYA 2P42B 4FQXD 4L3CB 3U0WH 3TBVA 1UA6L 1ZVYA 1EDYA 1BAFH 6FABH 4RMVA 1XMEB 2YUXA 3FSWA 5GGQH 3W0WE 3HBGA 1UWEL 2MRYA 1KFAL 3INOA 5EIIB 1NAML 4HLEA 2P5WE 4PTTB 1N26A 5LGHL 1E2WA 3APMA 3ME0B 1LO4H 3BUQA 3SGDI 4C56D 3F84A 3HKZA 4LQ1A 4N8CH 1HK6A 5C9JB 1KCBA 4NPKA 2I25N 3B7UX 1BFVL 4CVXB 1MFMA 3L13A 5DC4B 5J4MA 2PWHA 3EYOB 5DK2B 3UTTE 3DX3A 5T3XE 3M07A 3SYPA 3ZMEA 2F7PA 4ZO8A 3MV11 4G1EA 3OZ9L 3QQ4A 4Q2ZA 3RWHA 4KVNH 1MOEA 4AY0A 5I5JA 4CVZB 1E8WA 3CQQA 1FH5H 3ES6B 1JGUL 2X38A 3JZ7A 2IQAB 4KY2A 5CSGA 2ZZUT 1UM4L 4BK8A 1HQ4A 3NCEB 4I13B 3WIHA 3UH8A 4M9OA 1BVNT 3HC0B 1W0VA 1U9KA 3ILDA 2XOTA 5EEVA 3UZQA 4HJ1A 3LQZB 4XP9L 2WXRA 1KWKA 3FHAA 3F12A 4FQ1L 4EBQL 1CU4H 4O02L 4UTBA 3VQ1C 4Z8FH 5LN8A 3S48A 3OL2A 4KJYB 3VWJB 1UJ3B 4OD2B 5C6WH 4QXUL 5L2KB 3JWOH 4JZJA 3EFFA 4K7PH 5KBNC 4L8SC 1OV8A 1SM3L 1RURH 4MA1C 5ELIA 2DY2A 1NL0L 3HUJB 1BMZA 5TE7H 4I0PB 2EVFA 4WNQA 5B39B 5ACLA 3S3CB 2LFGA 4LP4A 5GGVY 1FYTB 1WGOA 1HEZB 2AAVA 4OLVL 2AVGA 4QRTA 2FJFA 1SHMA 5CEYB 1SQMA 1UEMA 2YGVA 4FTVA 3PWPE 1RIVL 1J10A 4HS3A 1G1CA 4AVJA 3DTUB 5IQ9A 4WU7B 3QXDB 3H3BC 4GT0A 4XHJD 2C3XA 5DR5H 5FB8A 3QUZA 2OTUB 1NCBH 4FKKA 5GZNC 4Z7VF 2YMTA 4Q6KA 1OAKL 2JELH 4PJBA 4J2XA 3O2DL 1FNEA 3NIDB 4FLQA 5HPMA 1JZGA 2G9KA 2QSCH 4QOKD 5INDB 4DHLA 1IO4C 1AXSA 3IXAB 1ETZB 5EV7A 2XNAA 5GGSA 3MLTB 5LGJB 1Z9OA 3DJTA 2ZCHL 4GG6E 3CQFA 3VI3B 2XY2A 3TVMC 4PCTA 5KVDH 4AJVA 4H5SA 2CO4A 3FONB 3I02B 2V5SA 1WBYB 2KQNA 4G7VH 3PWNA 2VZ3A 3K6DA 4PIBA 5DZLA 2EDDA 3Q8CA 5IMMB 1D6VH 1AGBB 4H25B 5B8CA 5EOCH 5B22A 2Y72A 1MJUL 3NIGB 2AZUA 2BNRD 3MA9H 3QS3A 4M8RA 4BQCA 2VDNB 3JWDL 3MLZH 1TTRA 3G5ZB 2VXTL 1JYXA 2CM5A 3UTSA 4JFVA 2UUDK 2VE6A 2IQ9H 3UADA 2HFGL 3RWFA 1YN7A 3SE8L 1ADQH 2EC8A 3V6FB 3IMWA 5DDHB 4PJDB 2ZSWA 2K7QA 3GC3A 4PJ9A 2BWIA 5IZ7A 1CD0A 3L1OH 1YN6A 3CG8A 3I75B 4G43B 4IKKA 4QOKB 3QUZB 4ZS7H 3AQDA 2NY3B 1AQ8A 5DEZA 4MS8D 1FCGA 1KLGB 1EHLL 2A83B 5CJQH 4AL8H 5F7LB 2VDQL 4N0CD 3KWUA 3M1OA 4ENED 1QFPA 3K1DA 3E9UA 2CJ3A 1PFCA 3O9WA 4WDIA 4WW1A 2KL6A 1VFMA 3MJ8B 3C75A 1IU1A 2DM3A 3E8VA 3DSNA 3DUHA 1NMAH 2IBZX 3DI2B 2ZP9A 5I16A 1RERA 2CHWA 2F68X 3QJZA 2PXYA 3OR7B 4X0KB 4AXWB 4MZ2A 1I7TA 3CD4A 5JXEC 2RJMA 5DJXA 2FEEI 1SPDA 1F3JA 2M1KA 1VEMA 2XI9A 1ZS2A 5D71L 1U3HD 3D3VD 1EO5A 2YUVA 1PZ5B 2KPNA 3OX8A 5I1AA 3NFNB 3T08A 3K0WA 1NMBL 4FNQA 3OAYH 3HZVA 3B2MA 3BEWA 3EDEA 4K3JH 4NJAL 2RACA 3FOLB 5DK3A 3ARGB 4D2NA 1HYSC 3FQNA 2OYPA 1D5MB 3WJMA 4GAYA 2P1YA 4XO4A 2NSMA 4FADA 5E70A 5I5RA 2VXVH 3DUSA 2BW4A 4ZTOL 1KT2B 4HSCX 1NCCL 3BZ4B 2FHFA 1IGYB 2ZXCA 4MB1A 2HT2C 2DICA 4NP9A 1U92B 3RTQB 4F3FA 5I30H 4QNPF 3NZSA 4TLTA 5EZOH 4EN3B 2CUIA 3IN0A 1K8DB 3QZNA 4HK0A 5D6DC 4P4KB 1T03L 1I9RH 2CMRH 4WWKA 1XBDA 4I0KA 3I3DA 2VDOH 1X5FA 3QEUB 2HSIA 2XDHA 1JGEA 4M7JL 5EUKB 3THMH 3GSRB 5IOKA 2AEPH 3ZHKA 5LGHH 2QQLH 2CO2A 5MEQA 3DGCR 4X5RA 2J6WA 2G2RB 2AFNA 3P73B 1SBSH 3AUWB 2YEQA 2LTQC 3MOQA 2YRLA 4U7KA 3NCYP 3HE6D 4JX0A 2PW2B 1X6NA 1ZAGA 1CC3A 4LLDA 4XTRD 3DHUA 1IFRA 3P54A 4UTCA 4M6OL 3VXTB 2NSXA 3IF1A 4LMQI 4V2BA 1P9MC 1ZLEA 4JR9H 1SLXA 4FYSA 5D1XB 1BYPA 2NW3A 2ZP8A 5CUSH 2JIXA 3CAFA 5HDBE 3LH2L 4X2UA 4E9YA 3MR9B 2BVQB 4UT9L 4PJ6A 3DRTB 2E56A 1WFJA 5I9QC 3QW9A 1ID5I 1DFBH 2OZ4A 3WXWH 1NC2B 3HRZC 4YN3A 1FNGA 2AK4B 1ZV2A 4Y5VA 1KN2H 1A65A 1QFWM 2VABA 3DX9A 4JKKA 2ZX6A 4KK9C 4MX7B 3ZDXE 5I1HL 2ENSA 3NCCB 4BFNA 2CUAA 2WNWA 3BEWB 3KPTA 3FN3A 4U1LA 2WNGA 1ZTMA 2WANA 3MVSA 1HS6A 4LSTH 3RWHB 3RX8A 3WN5A 3BUYB 1ZK9A 1QG3A 4JRXE 2PO6C 5L6YL 4U1NA 3K91A 1E8YA 1PTZA 1ES0A 3HZYA 3SO3C 1LWRA 1XIWB 2DMKA 5D70H 3LEXB 3V52H 1EAPA 1OF2A 5JORA 1YEGL 4L8CB 2OW6A 4L48A 5H37G 4KJPC 1HHJA 2OI9B 2H32B 1JTPA 1LO3H 4H8HA 3ZRFC 3BWSA 5I23A 3SCMD 1NKRA 3ZSTA 1T5XB 3HBQA 1BJMA 3BN9C 4DIXA 1HH9B 1RJLA 2E76C 3PRZA 4DT2A 1OQXA 3NGBB 5JA8B 3UTTD 4EPSA 1G7IB 1XGPB 4XVJH 5DGRA 3NAAH 2BSTB 2E9BA 3ASNB 5FGCB 1S6NA 2OJEA 4LRNH 4X6BB 3G5ZA 2UY6B 3AWEA 3BH4A 4HF5L 4HA1A 4TPRH 1JG9A 2APXA 4M48L 1IMHC 1I53A 4W6XB 5FYLH 3O0LA 4H0HB 1TTGA 5BS0B 3TO4A 4U2YA 3ZR6A 1REIA 4G7VL 1JPFB 3HC2A 4XOAA 4NNPL 4A2DA 3P3RA 1ZHKB 3ATDA 3RI5K 5D2LA 4JDZB 3KNBA 4ZX4A 4H5SB 3BAEL 4AKQA 1DBBL 1HOCA 1TXKA 2F61A 3EG9B 4YGAB 5FCSH 4LZKA 5HGHB 1EGJL 5L4MA 5GGSY 3W0WB 2K9FB 4MCZB 1LK2A 2IV9A 3KL3A 1ZT7A 4LVHC 4XP5L 3T6XA 5HHXH 5E9DD 1IC7H 2IDUA 1AZUA 3C87A 3MMEB 1D9KB 4AE0A 4J3VA 2M26A 1M57B 4LPYA 3T6QC 2GBTA 1J9SA 4XCFH 1YMMA 1Z9NA 1E7VA 4PJ7B 3S4SG 2JLPA 1GGIH 1CFTB 5I71C 3FN9A 2EH8H 1QOKA 5D5ME 5AVVB 4FFYH 2X2HA 1XF2B 4ZMZA 2O6EA 3NFPB 1INDL 4K7PX 4CSZA 5E9DB 2RAMA 3MSPA 4Z0BH 4GRLD 3WMSA 3HLAB 4MQ7A 3OC8A 1KCSH 3TURA 2CR6A 4X6FA 3PJNA 3LSOA 5ALBL 4AUUA 4XPHL 2BOCA 1VF5C 4EUPB 1S7UB 3DGGA 3N40F 3FQYA 2NZ9C 4PCKA 4K3EH 4JHWL 1T0MA 3CE1A 4Q6YA 5DS8B 3GD1C 5HI3D 5CLYA 3SJVA 1CF8L 1C1EH 5T1LB 1S46A 4M5YL 4Q6IA 4GRMB 4H8QA 4N8CL 1Z9LA 1MIML 4PTUA 2G4EA 5D1ZC 1KLFB 2DBLH 1NDTA 2JK5B 2VTFA 2BNRE 1TIUA 5GGRA 1G7PB 2H0PA 4GW5B 3EH3B 2YO3A 1BQHA 3UDWC 2D7PA 3S3SA 3ARGA 3GSVB 4XAKD 5C08B 2DTSA 1MEXH 4HJSA 4WHYG 4ZW8A 5FLVA 1RQ5A 3P0YL 1BEXA 5CFHA 1OAUH 2XWEA 3HLAA 4NKMA 4R2GD 2BK8A 1AXIB 1G1KA 2AQRA 4L1LA 4L1HA 1F58L 3CX5J 4O51A 3VXPB 1F90H 2PO6B 1KGUA 32C2A 4TSBH 3NA9L 1YNLL 2ZCLH 5AAMA 2X40A 4EDXB 2Y7NA 1DO5A 3CZUB 4PEEA 4HKZB 2FLBT 5FHBH 1WE5A 2H26B 5GZNA 5GRVK 4XB8A 4F8NA 1NIDA 3EFDH 1YA5A 3NIDE 5F3HA 4ZUSA 1MHCB 3H7BA 2QSCL 1BZEA 1Q94A 3CBJB 2KBGA 3KWTA 4Y4HD 3AY4C 3HS8A 4PJFF 4ELMA 3OSKA 4HXAL 1GS7A 2V5TA 4K94H 2HVBA 4YQXH 3EBHA 3DIDA 5FR3A 4QRBA 3ZE0B 3H0TA 4XCYA 4ESKA 1GYUA 2A74A 4DKFL 4QRSA 1JYVA 3DYOA 4NIYE 3D3VE 2RIKA 3GMOA 4PRDB 3WD5L 2WCGA 3H56A 4KXAA 3MJ9H 5EBWA 1E5UI 3GTTA 1U3ZA 3L7FA 3ZE2F 5FGBC 2R7EB 2AEIT 1JF1B 1FNAA 3G6AB 3L4TA 5F1SA 3T0BA 1BFOA 1PLGH 4XWGL 3ARRA 1YJDL 3MNWB 1A6VL 3GHPA 3H55A 4HUWB 3CGTA 1M9WA 4RZCA 3GMPB 4PB0H 5I0VA 1JF6A 2YMXL 3TU6A 3V8CA 4JY5L 4M8QA 1D5ZB 1R34A 3KMDA 3IAPA 4BXSV 4NYLA 1WISA 3T6VA 2YGPA 3N43B 1ND0A 3AGWA 1QUNB 3W5MA 4ZW3A 3VI3A 1FN4A 4HBQA 3LPWA 5F7DA 4XBPA 5KS9F 1AR1D 1YYLH 3BKML 3IE9A 4X7TB 1R4XA 1KLUA 1I8IB 3BUBA 1UGNA 1UXWB 3D5OF 3JWOC 4DK6A 4ZPVA 1P6AB 2WBXA 1CD9B 1JRHI 2F7QA 3N1GC 4ZX5A 4CMMA 1YY8A 3OAUH 4NOFA 2HLAB 4GQQA 1B88A 3P9WB 3GXNA 2B8OT 1UA6H 1LM8V 5GRWA 3W56A 3N2JA 3UTSB 3DX6A 3GHBH 4X8JB 2Z4TA 4XPAH 5ICYB 1VZGA 2J4WL 3M46A 5D7LD 1OIOA 5JTWA 5DMGD 4QRAA 4X83A 4HISA 1KFAH 1S9XA 4H4NA 4NENA 1P5UB 2J8UF 2F74A 3GDBA 3TX4A 1B0RB 3OKLB 3BQUA 1EBPA 4EOWH 4NN6B 2HJLB 1NLDL 2HXAA 3WFBL 4UI2A 4MS8C 2XG5A 5ISZB 2CRIA 2BVPB 3WTUA 3B1TA 2I7OA 4YLBA 3TA3D 3TWCL 1KYUA 2IANA 3ARFA 5E8EB 1BOYA 5IVXE 2XRAL 2NXYC 4MFHA 3PDOA 4KROB 3R4RA 3F12B 2VUKA 4B7IA 1DBKL 1ZCRA 3WIIL 1R3JB 2CRZA 5A2JH 4R7VA 2X9YA 2W9DL 5BZDB 2IOIA 2E27L 3AWGA 1DBBH 1AR1C 2C9RA 2G9HB 3PWPD 4Q58C 3GSWB 1A6ZA 4OZHF 5MHSD 2Y5TB 4HIQA 2NX5D 4BQBA 2ZX7A 3PV6A 3QUZD 2EO9A 3LKQB 4XP5H 5GGVH 5IM7A 4GO9A 2EDNA 1NCHA 3X13A 2BY1A 5MEQB 1MW0A 4PY8I 1S9YB 1NUFA 1XGRA 4IRJA 2VW7A 3LIZH 1XL6A 4HZLA 5C8JB 4HWEH 2BNUB 2P28B 4NZJA 1VERA 1UM5L 3DMMB 1UASA 4OD2A 3BZDA 2X41A 3ATFA 3MV7D 1JPSH 2YQBA 3OLEA 2ZG2A 3AB0B 1U93A 1CBVH 1ZVHA 4PJHA 3K5SA 3GZPA 2EDRA 4LQFH 3I9GL 1DBJL 4W6YB 1T3FA 1XEDA 2QBWA 3I6KB 5LBSH 2D3NA 1HEZA 2EIKB 2FGWL 4TRPL 1A25A 3MCG1 3V9FA 1VCBC 5A2AA 1OW0A 3FAWA 4RGND 1DTUA 1NBZB 4QHPA 2LV4A 3I50L 3LMJL 3E6HA 5D6CB 2MNWA 4JREC 4KRPD 3BH8A 3QULB 4FP8L 1SBSL 1IBBA 1BBJB 4XNXH 4YBLB 1RHFA 1TTUA 3SDAA 3TVMD 3C8HA 3K72B 3NPSB 4LSTL 1C16B 3VVWA 4C59B 5LLIC 4FG6D 4F7CB 4YEFA 5JQIB 1CICB 5JW5A 3CHXA 4JO1L 4OZFH 2ERJB 5C08E 2Z0UA 1T22A 4WVRA 4YHLH 5GSRB 1WHPA 3BLPX 2ZQKA 1T5WB 3BD3A 2OCJA 3WTWA 1NFDF 2E9JA 4I85A 2IOOA 2A9ML 1KN4L 3QDJB 3CV5A 3ZE0E 4M7KH 4WV1C 4NN5B 3RWEA 1G87A 3CZLA 4ZAKA 1Z3RA 3P4LA 5BOZG 5ABAA 3TBSA 3VD0A 4WCYH 1MJUH 1N59B 5CD3B 3WNMA 4FKEA 1S3KH 4HUVA 2NX5E 1U30A 4ZUVB 3WJJC 5T1KA 2GSIB 3O0RL 4PH8A 5DJCA 2QGBA 4O58L 4RBPK 2YXMA 4PJ9B 1EMTH 5G5DA 5FKPB 2X28A 1WA2X 4ZDHB 2BP5M 5BRPA 1IL1A 5J11B 3U7WL 3G6JA 3TTYA 3NABL 4JGNA 3PWUB 3TCXA 4HXAH 5ANHA 4NQXB 3U6XA 3VMNA 2AQTA 3IFNL 2A9CA 5A2IH 5C6PB 4LRNL 5EHFA 2A1WH 2XPYA 1NEZG 3L5XL 4U6XB 1SVCP 4X9FA 1MY5A 2XG4A 2EO7A 1XHHA 2CA3A 2VERN 1YEGH 4GG8A 4P2QD 5AVRB 1KMGA 1CVSC 1Z0MA 1EIBA 1K4CA 1U8JA 1DN2A 4KROC 1A7QH 1OLZA 3T8XB 1TMQA 1WBYA 4NB7A 3SKJH 1YO4A 2X2UA 2AV1B 3GMPA 5BRZA 43CAA 2IGTA 5EZJA 1Q0XL 2CGRH 4RQQA 4XBEH 4PJGF 5B1CA 1JOIA 4QJ4B 4BFJA 4L5FE 3TA4D 1LEGA 1IAOA 4DZBB 4NUMA 5EULV 4FYRA 1S9WB 3ZPDA 3ZJAA 1ZXKA 2CKBB 3FO0H 3BZEA 4GMSL 4PS3A 1ZRUA 2NUPA 3Q6GL 2CLVA 1H3PL 1XZ0B 1W6WA 4A7GA 3V0AC 4Z7IA 3WUWG 1IEAA 3IJEB 4JHBA 4BWWA 4N1EA 1AR2A 2V4LA 4Z7QE 2EDTA 3CNKA 3T0EE 5HVHB 1BOGA 1E3ZA 1VEPA 3WLWC 4K71C 2L8AA 2EDBA 1DO6A 3L3OC 1N7ML 4OF6A 5IVXF 2O93L 5ACZB 1RU9L 1D5BB 3ETBF 5IK3A 4EZMA 2EDFA 4YHIB 2BM3A 3OB8A 4HV8B 4PJHE 5CIPA 3HB3B 4KNSA 1BZ7B 1I8KB 3RDTC 1KPUA 4JZJB 2C7UB 1OSEA 2UWEA 4XCCH 3RJDA 3U2SB 4M3HA 4FQXC 2BVYA 5ADOH 2IAND 5DRNB 3Q6FB 5ES4B 3ZL4L 1WZLA 1MCFA 2FSDA 7TAAA 5D72H 3O6FB 1L3NA 4WW2F 4Y4HB 1AFVH 2K4AA 3MXVL 4MWFA 4DAGL 4K23L 4ZBJA 5HDWA 4OCRH 4U4BA 1RMFL 2Y24A 5A16B 4QRUB 4Z0BL 5JQHC 2WWKO 4PD4J 5CLXA 3LZFH 1M2VA 4MXWH 3ZHLA 3MYZA 3TM6A 3ARBD 2NUTB 4AVIA 5ITFB 2EACA 1Q90A 4XPHH 4U6YB 3VYNA 3ZHFA 2GITB 2FEEL 4AYBA 3CU7A 2PPDA 3OHXB 4MMXB 4BQ9A 5KBDA 2AEWA 1SY6L 2QR0B 3IDIA 3V7AE 3B4NA 3KPSA 5EU7E 3H9SE 1QEWA 5IBTL 2W9LA 4LHUG 2OMVB 3EZ8A 3P1VA 4P99A 3S5YA 5LGYA 3EJZD 4RMRA 1BXUA 3HE7A 1S5IH 2R1XA 3HUJE 4IJ3B 4KZDH 3LV3A 3CFQA 5DO2C 3WOVA 1GZQA 4EDWL 3FB8B 3NJVA 3V4UH 2YGNA 2HUHA 2QVTA 1CDIA 3T6ZA 1T0NA 3QR2A 4ODXB 1T6WA 2OP4H 1ILUA 1URZA 5JPNB 4ZUUB 4L3CA 1BYOA 1I75A 4KI5E 4DEPC 4ACPA 2DLGA 2MHAA 3MOAH 1QSFA 2UY7A 2C9AA 3IYLW 5AVWB 2Q7YB 2UXTA 1I7ZB 3M17A 5HHOE 3T9WA 3LS5L 2YAEA 4GRWE 1YCSA 1FDLL 2BSEA 2C7UA 3QJSB 3W39B 5I5MA 1BPVA 1U58B 2E7LC 4QCIB 3MACL 3SBWC 2O30A 5CCKH 1CGSH 5HHPB 4JO4L 3U4KA 1HXYB 4UNVA 1JZDC 1UFGA 3D7PA 3KNBB 1T1XB 2V3FA 1F4XL 4MQXC 3VGHA 3TBYA 4Y4HA 4WEBL 2HFTA 5TE6H 5T3ZE 2VITA 5DVKA 3AABA 1YMHB 4GKZA 3CVIL 1W80A 3GBNL 4FERA 1N12A 4YR6A 1IM3B 5EIQA 4DPAX 1HCVA 1KNOA 3C6LD 2NT1A 4S1QL 2DEWX 1XF4B 4N9GB 3OKMA 2YAHA 2BO0A 3DSNB 1YMMB 4YEEA 1WUZA 1U36A 1KN4H 2J56A 4UQ2B 4NFBA 4UZSA 5IROD 3ULVE 1MXDA 1TZGH 4XWOD 4BKLA 2AJYL 1MFNA 5TK2A 1E7UA 4C56E 2ZYSA 4PV8A 4EI0A 3D25B 4U2ZA 1XD1A 3H3KA 1GZPB 3CXHK 4MCZA 3WAKA 5ESVB 4DCQA 3QNZA 2ROYA 4R0LB 5E94B 4AMKH 3WTTA 3MROA 1A6UH 4O58H 4KNTA 3U46A 4WFFE 3B3IA 2ADGA 4NRZB 5HJGA 4CUCA 2XWRA 4N8VA 1VEOA 3TNMA 3NZ8A 4MNQA 3QWQB 2HP4A 3P3YA 3KJ6L 2CXKA 3UG5A 4F9PA 2FEDC 2EDEA 1KYOK 4I1PA 5AUMA 4OCMC 1Y1UA 1CFNB 1UG9A 2DKUA 4DZBA 1R75A 3L5XH 2OXGB 4OBSA 1P53A 3PWUA 1OAXL 4W4OA 4MCMA 2ODIA 4RQQB 1O7DC 4JM2A 4MA3A 2V8MA 1LMKA 4ZW6A 1DLHA 2EEDA 1KJ2A 2WJ7A 1MNNA 4YHKH 5FYKD 1DBAH 4BWTA 4JN2B 3H53A 2E7MA 5SWZB 4JFZH 1F2QA 1M7DA 4XPAL 4QTHA 1ET7A 1U95B 4OFYA 4BSWB 3GPSA 5KVFE 3P9MB 3V0VB 5DUML 2NLJB 4X7EC 3UAAA 1PLBA 3IDMA 4YSSA 1MCQA 2WLNA 5IHUH 3QNZB 2YJQA 3ECWA 1J87A 4FRWA 4E5XG 2I69A 3BWZA 4DN3L 3US0A 4YXLL 1OEZW 1ITBB 1WP6A 1SY6A 1GMEA 3IDGA 2XA8L 1IGCH 1A1NA 4B3EA 2PYED 3MA7B 3FJTA 4HIXL 5T5FA 2ZIDA 3OKKB 4OCSL 1BX2B 5BW7A 3C09C 5JYLA 2EXWC 4HWEL 3WU1A 3CSYB 3QUZC 2YPLE 5GRUL 1SJHA 2R69H 1XGUB 4LLVB 1N67A 4PLJD 3SDDC 3HEIB 1EJFA 4D9LL 3CUPA 4Z1PA 4B9GA 1OXYA 3KWXA 3J2PA 4EI6B 5IEKA 4N0UB 1E67A 3H7LA 5HGDA 4NQDE 1CI3M 1CDYA 2XN9B 3CC5B 3VFVB 3II2A 4JM2D 4MX7A 2DIEA 3AXIA 3BZFB 2FT8A 2X6AA 4XCCL 3U0TB 4ZMTA 3VTAA 5I73B 5JHBA 5ESAA 1NGZB 3I50H 2IAMA 3FO1A 3QUKA 5DEGB 1RZFH 2WWMD 4ODUA 1OW0C 2WQUA 1AD0B 5L2KD 3U7AA 4PGDB 3TEXA 1L9OA 2IALB 3NIGE 3HZMB 4NO0B 4LPUA 4R0LC 4ZS6C 1IAIL 2B1OA 3VXSA 4DKAA 4PLKD 2ESVD 2X1WL 3K0YA 4WW2A 4AI7A 3X2QB 3K2IA 4NBXB 4YSTA 3A4AA 3SPVA 2CBTA 3ECUA 3R8QA 3SOBH 4ODVL 4C4UA 2G60L 2UX7A 1KB5B 1N64L 4KMTH 3UACA 3ZDYB 3ZRSA 1Z3GL 2VJXA 3SO3B 1AGDA 1PZAA 1SBBA 2WSKA 2ZUYA 1H8SA 4HW6A 1LP9E 2X0WA 4FG6C 4WCYL 1HHHA 5IW6B 5D7IA 2D0GA 2KZWA 1N0LA 5EU7C 1KGJA 2DQIL 3OR7A 4X0KA 3WL9A 4QHMB 4YHNB 4FULA 4MMXA 5HHVH 3EOYG 4FQ1H 3VTMA 5DD0H 5IKCB 2F7IA 1JFHA 1IC4L 1NJ9B 1OAQH 4H8WH 4JDEB 3CDGA 4BZYA 2JQZA 3VYPA 3SY6A 2L04A 3HHSA 2K6ZA 1A14L 1M7IB 4WJG3 5DURB 3W1ZA 2MNJB 4MA8L 2XXFA 1M2OA 3HPJA 4N6RB 5IMOB 3KLHD 1TJHL 5DRWA 1ZGLA 4NO2A 5EU5B 4G8GB 5I1IH 3EBIA 3LKSB 3FQRB 4HLJA 3IVKB 1QSEB 4ADJA 2UUDH 3GJFK 4CW1A 2CDEB 4PWFA 2OKMA 1W72L 3NFNA 4CKVX 2K8QA 4HPYH 1L0YA 4UIKH 1MFBL 3NJJA 1F97A 3R7QA 4L4VE 2ITDA 3LRSB 3GUTA 3EYFA 1OOAA 2R0WH 5DEFA 4Z7UA 5DJXB 4N3TA 4JFFD 1VADB 4G7YL 4LLYB 4ELKA 4JMXA 4RFEA 4IIQB 4TULH 1T89C 3NH7L 3KR3H 5GRXG 1ZHNA 5ESVA 3D34A 2F74B 3DBSA 3HE7D 5EC1A 5C0EA 2XA3A 3VD5A 4RDQF 4OLWL 1FN4B 4L3EB 3F7YB 2JVUA 5T5NG 4K73A 1X9LA 4BM7A 1D5XA 2X4TA 1CO1A 1N10A 2X4QA 4PJ5A 1QWUA 4F27A 1EZVX 5CJXA 3RWDB 4PG2A 4RWHA 4XBEL 2CLVB 3NJLA 4I77L 4JCLA 4CGUB 3L3OA 3PHOA 5I1EL 3GIZL 2NY1B 1E6OH 2DQJL 5J56B 3QG7H 4OCWH 5DUPL 2EQDA 3JT2A 1SXZA 5F97E 1J8KA 5GGVL 2B9AA 1X5AA 4KI5D 3UBGA 3FQRA 4CVWA 1NPJA 4A67A 1M53A 4P23B 3VMOA 5KBPA 1PDKA 4JRFA 2Z4QB 3CFJB 1H8OA 4JHAH 2FX7L 3NACL 3LDBB 5DD5H 3VFGH 5I8EB 5DI8A 4HPHA 3IT8D 4Z76A 5E1IA 1VADA 4WHCA 1N8ZB 4P2RA 4QEGA 2QADB 3UGEA 5KG9B 4OCRL 4HJ0C 4X6DE 2N1TE 4CRPA 3G04B 4DGUA 5SWSA 4Z0XA 2B39A 1MCHA 3FQ4A 4JCMA 1AXSB 4HUCA 5AAWA 2YUWA 2E0PA 4CW1B 3V0EA 5E8PB 1USZA 2Q7AA 2W8CA 2XPGB 4NI3A 4WO4C 4KTYA 3L95B 1C8QA 2A0LC 3LRKA 4NO2B 1FGNL 5ID1A 1QBMH 1WICA 2N7SA 3EJTA 3GRGA 3A22A 3G5WA 3PP4H 4HH8A 4IBZA 4B9CA 3ULVH 4S0SD 2XN9E 1MAMH 4DN3H 2YS4A 4PP1D 3HAEA 2CPCA 4G1EB 3DJZA 3BLBA 3VM7A 3OWEA 1PPIA 2VDQB 2B1HL 2QPSA 2AQ1A 4JQVA 1M05B 2VXSH 2VC2L 3EFOA 5EORH 5FUZH 2VRKA 4ZZFA 4P23D 3SGEI 3D0LB 3F7LA 3JV6A 1FFNB 1Z5HA 3HFFA 2WBJB 1B3JA 2VDLH 2VLJE 2OP4L 1P84J 2NUTA 4RX4A 2WXOA 1MHEA 1FZMB 4BK4A 2WQRA 2P48B 3MBEA 4EO5A 2IOMA 4O2EA 2RCSH 3EF7A 4TS6A 1GSMA 2D3JA 4JJHA 3U0PB 1A6WL 2CSPA 5IVXB 4ETYA 1NCWL 4LPCA 4TLKA 4JFOA 2QPUA 2EIBA 2AABL 3TTSA 3VFOA 2Z93A 2DMCA 2Y1AA 3DX7A 4J3OF 3BVTA 4MRCA 5EU6B 4TOYH 2VDRL 4YDVB 1YNTA 4GAGH 5I1DA 1TYJA 2XQYA 1VACA 2DQEH 5C7XH 4U7MA 4FQCH 3HN3A 3U4BH 4PS7A 3LSOB 2R8SL 3QAZB 1DQML 3OMIB 2GY7B 2J8UA 3BSHA 3OKNB 4WKZB 3SQOL 4PUBH 2AP2A 2ZYHA 5DLMH 5GISL 1TZGL 2AJYH 1BVLB 5D5MB 1XSOA 4FLRA 4PV9A 4XC1L 1HOCB 4IBWA 1FLTX 5CILL 4FNRA 2K7PA 2DL2A 4ZAKD 3JWDH 4K94C 5EF1A 4IKLA 2NUPB 1AZBA 4PJ7A 2D4FA 1ZPUA 4LBAA 1MCIA 1IUZA 2G3XA 3DOIA 2X2YA 2GSGA 4RFOL 1L9SA 1R3KA 3HLKA 5CR8A 3TVMA 4XWOC 3CBKB 1IAOB 1CK0H 2HJFB 1EZSA 3RFZA 3L16A 1FPTL 3NQKA 1A14H 2VR9A 5L6YH 3K6SA 1FFOB 3C08L 1BZ8A 3CFBA 2WLLA 3GHEH 2UWEF 5E00B 2RA1A 5F3BB 4XN2A 4PRPA 2VIRB 5DFVD 4P5TB 4U0QB 4UOW1 5I1IL 4XX5A 4YBLC 2VLRD 4WJ5B 5DWUL 2ADGB 1GAFL 1U8LA 2XV0A 1HZKA 3GI9L 4HC1H 1IBFA 2A6IA 1W72H 2OMYB 2HFEB 2WBJC 5GXBB 2HH0L 4NOBA 4PRIE 2NY6C 2E6PA 2OXGA 1A6TA 4ILDA 1E5YA 3CVHB 1FV1A 1S7SB 1FL5A 4M03A 1I9EA 2P7TA 3RUGF 2XTLA 5I6XB 3E3QE 3ZE2E 2R4RH 1ORSB 5B4MD 3B7SA 1AXTL 1MJ7H 4H40A 1YEIH 4IBVA 1LDSA 3RPIB 1AHWA 4ELMF 5HTSA 1GCFA 1UWGH 3QISA 5I17B 4E41A 3QCVH 5JXEA 1U2HA 2ENJA 2FIRT 3S8FB 3RGHA 3ALWA 5JORB 4WJ5A 3DTXA 2Y69B 3HMXL 4XOCA 2FX9H 3FQXB 3QPQC 1NOLA 4OCXL 3FMGL 2YEZB 3DJ9A 2WLLB 1LO2H 2X2IA 4YUEH 5HGBA 2CIKB 1K85A 1XCTB 2P3YA 3RIFF 4IBYA 3RZCB 1AG0A 2AANA 1IC0A 3THML 3VUAA 3VXUE 1NOAA 3H3PH 2CO7A 3CIQA 43C9A 1L9TA 2ZXWB 2EP6A 1FL6A 2ADIB 2NXZD 2QL1A 3EGDB 3UPCA 2WUBL 4JG0L 1G9ML 4HGMA 1H0DA 3T0XA 1KUMA 3KPQB 1RVFL 1C5BH 1RJCA 4KTEH 5GHWL 3LKRA 3RBGA 3AS2A 3B7RL 2CLRB 3IJSB 1E9OB 1YNKL 3KEDA 3FDWA 4M6OH 3UIZA 4KJPD 3IU4H 5D7LA 2X3BA 4MA7L 1L7TL 1OP9A 1X5ZA 1Y6MR 3MOAL 1ZVNA 4U1IA 1U8QB 4AYSA 2VDKL 5KN5B 3L5WA 4PJDE 4PHZA 1T7YA 2EEAA 3KPLA 1NGQL 3MRNA 3LH9A 3JTBA 4PJXA 1GGUA 5IHZA 2F15A 5D1QD 4LLDB 5BJTA 5SWSE 3IMUA 4K7FB 2HLEB 2D7OA 2R0LH 2MCAA 4K5PA 4WSGA 3BZ4A 4GSDH 4HALA 2BSCA 2F8IA 4N2IA 4IRZA 1PQZB 3C5JA 1C12A 3ZDZB 4KV5E 4BCXA 4ONFH 1PX3A 1A3LL 2CUHA 4ZUTA 4E9XA 5IF0A 4ORGA 2DWSA 1RUQL 3OF6D 2HCZX 4S1QH 4XRCA 1IV8A 3CIAA 3JUYA 3N85L 1QFWH 4D9RE 1U8HB 3BQUC 4Y2LA 4MJ5B 2YD1A 1MFVA 3IMRA 4PBVC 3UAEA 5KYNA 2QSVA 3X1EA 4OI7A 2ZOKB 2AQQA 4IRSC 3FT3B 2BVEA 4IHOB 1MKFA 4WEMB 2D0FA 3SZKC 3BO8A 1UZ6F 1MDTA 1T0MB 2DL9A 1S9VB 5D2LF 4XPFL 4GMTL 1E9QB 3QIWA 3A6OA 4KQ0A 1LO5B 3IJHB 4S2SB 1FVCA 3EH5B 2GSMB 5J3HC 3TLRA 1XEUA 2A83A 1KFGA 3KPRB 4UAHA 4QOKE 1TCRA 3MRJB 4Z23A 5E4AA 1X9RA 4RAVB 5FFLA 1ZEAH 4F8QA 1DBML 3DSFL 3L3GA 5C09E 5F7YC 1CR9H 4AXWA 5IUSA 4WV1B 2NNFA 2XZQL 5DLML 1MLBA 1OAJA 3L9YA 1ZDQA 4RFNB 1WWCA 2IBGA 1ZV9A 3FQTA 5C7ZA 4JRYE 4DP4X 4J8RA 1WA0X 4MJ6B 4HIJA 4MD0A 4K4KA 3C6EA 4HT1L 4HU2A 4JDTH 5TK4A 1LE9B 4IIQA 2XTJB 1N6VA 1CGTA 3STLB 2FWOB 4LSPH 1KBWA 2J8HA 3HPLA 4OB5L 5DDHA 3PAZA 4ZMWA 3N1PC 4YHPA 3HMWL 3WCYA 1T1YA 3CK0L 4DVBA 3G6AA 1J9TA 4H1LH 3EADA 1XDTT 3FFDA 5HHQA 3WEBA 5ESQA 2X5PA 5L88L 3MRDA 5CCJA 2BHZA 3NCXA 4YMPA 3IJ8A 2B20A 3EOAA 2VXQL 3VU2A 2NR6A 4NWTH 1KTJA 1D2PA 1NKOA 5BUAA 3GI9H 2GSGB 1DN0A 4L8DA 1LMIA 1I8AA 2W9EH 3BXNA 2WN2A 2JQMA 1OPGL 4XNQA 1QWNA 3H0TB 2K6YA 1ZLUK 4FJZA 4XO9A 2P52A 1DSWA 2GKIA 1XGYH 4JHWH 4L3AA 1MN4A 3AMLA 5MHSE 1A02N 1KEMH 4WUUE 3KCPB 1FZKB 4BGLA 3GO1L 3ZE2B 5ICXA 1QHPA 3MRPB 5DD5L 5C1MB 3N04A 3WJLA 5GSRA 5HPMB 1WAAA 4G8IA 1YUKB 5G5DB 1PD1A 3QFJA 4XP6L 5EORL 1C8PA 3QDGB 4MDRA 2J5LC 1WIUA 3PCYA 2EUWA 1JNJA 2XV3A 1KB5A 2F8VA 4ZG1A 3QDAA 4A7TA 1OTSD 3L3KB 5T1MA 4MJ2A 4S0HA 3EHBB 4KMTL 2E27H 2ROXA 5EO9B 1Z9MA 5A7EA 1N6QH 2FX9L 3ETSA 1KPRB 1A9EB 1EGJA 3HPJB 4QF1A 5GGRB 3SKUD 4W9IC 1WBZA 1IIIA 4KXZH 2VL5A 4ZI8A 2WXHA 4NZ8A 5FM5O 3DVFA 3ZBMA 4F58H 1ZOXA 3QRGL 3VFTB 2IAMD 1MFDH 1TQCB 3N41B 4ODUB 4NPJA 2WUBH 4JG0H 4XN1A 2Z8RA 2DIBA 5IQOA 1G7JB 3RQ3A 4APQC 2FD6L 4FYTA 1WCBB 1YECH 2AMGA 3VRJA 5C92A 5AW8B 2OXHA 3AM8A 4HETA 5EU6E 1MEXL 4ZMAT 5IQ7L 4KBPA 1XGRB 1RUAH 4IRJB 2QQNH 4PHXA 1FZKA 1CBVL 3MLRH 2BHUA 3SCMA 4G1MA 1N70A 1CGXA 1QRNB 4HHAA 5EU4B 1CUOA 4OZGB 3WD5H 4YSQA 5AZEH 2GJJA 2RCSL 1U8IA 1ZA6B 3RWJB 5FYKE 5GS1B 1I3RB 4JFYA 1QPPA 2XWJA 4KXBA 3HG3A 1A6ZB 3D51A 2UXGA 2BY3A 4O2CA 2EICA 1KGXA 3HI1A 3KPLB 5T5FL 5BZDA 3O81A 5K9OA 2ZCKH 3LXCA 3O3EB 1EAOA 5FF6A 3QYMA 4AM0A 1XGQA 4N0UE 2QELA 4F7EB 5K59F 5JW3L 4DFIA 1V7MH 4PJAE 1CLOL 1MWAL 3Q3GA 2MOGA 5IG7B 5TDNB 4EN3C 2COQA 1ZHKA 3B7TA 1NFDE 4WY7H 2A9MH 3EO0B 4FLHA 3MRQB 2ZWSA 3RGVD 1JTTA 3FOLA 2BZDA 2G3MA 3W2DL 1J5DA 1FO0A 4U1KB 1MCEA 3VU1A 4HHWA 4N0YH 2X4PB 4GO6B 4HU8A 4HOWA 4JUTA 3KDMA 5L8LB 4H7VA 3JV5A 1HU8A 3S36H 2VQTA 2ZD0A 1YUHB 4JZOB 3QIUA 5FUOL 1HWWA 2PW1A 1KTBA 1AKJD 4IIZA 2FK9A 1G7IA 4X5QA 5FECA 1AIFA 2W07B 5ERWA 2DTMH 2N7BA 3C08H 2WZ6A 1GA2A 1V3LA 4MD0B 1AXTH 1MJ7L 4ZFOB 1AKPA 3MJ7B 1OZTG 4YDJB 4YPGA 1RCYA 1AHWB 3JVGC 3FT2A 1OM3L 5J7CC 2BDNL 3NOIA 4L2LA 3FQTB 5BMFH 1JNLL 4JFFB 5FGRA 2EUZA 2JXMB 1DQQA 4N8UA 3UTSE 1FZOB 5HYQA 3GHBL 2BVTA 1EANA 1QI4A 2ZP0T 1PZDA 2NY1D 3U9UB 2CBMA 1QBML 2FEDD 4ZPVB 2B3RA 4GLRI 2F0CA 4J7RA 4UAOC 4AGPA 4G8FB 1TCRB 1NFAA 3ULUF 4XBPB 1UZ6E 4QRRE 1VJSA 4QHLB 4G8GE 3ARFC 2O61B 2O5XL 4PJEF 3L81A 1BZDA 3MTXA 4G6KH 2IGFL 5I6MA 4P05A 3L6FB 1ZIAA 4ANKA 2D31A 5BQ7B 2EC9U 2N0MA 4G6ML 1EX0A 1FNGB 3HFML 2QV2A 3SBPA 3WO4B 1RVFH 2VLKA 3B9DA 3TT1L 5C6TH 4A63A 4Y4KA 3RZCD 5JHLL 3J07A 5J1AA 4JRWA 2W9DH 2YA1A 4PV8B 1YYML 2NW3B 2WYTA 3MLTA 5LGJA 3DVGB 1OCRB 1HX0A 1LHZA 4HMDA 4Y4HC 3U0WL 1LNUB 1HKFA 3OF6A 1RK1A 1LO2L 4FFVD 4PJAA 2OX5B 4R8WL 2IXQB 2PXYD 4HWBL 3L4UA 4TF4A 4UQBA 3O3BA 1KGWA 3TH3T 2OSWA 1J0KA 1EHAA 1NAKL 1LO4L 5LDSA 1BF5A 2EDQA 5CF3A 3ET9F 1ZHLA 2FUTA 5GS1C 1AE6L 2H26A 1QZNA 3RUGB 1GH7A 1LWJA 3SGEH 2XQBH 2Z31A 3KG5A 3MLVL 3AVEA 1E9PB 3QDGE 1Q4NX 3UBXB 4H8PA 3SE3C 3IPBA 3ZUNC 1J0JA 4RGNE 2N3JA 2R2BA 3ZO0A 4C57C 5LAXA 1PIFA 3DECA 3X1GA 2FRGP 2V2WA 2OMBA 3P30H 2V7HB 4WK2B 4DP2X 3EDKA 1G7QB 3D6GA 5C3IA 3KZ8A 2PF6A 1W8NA 2G30A 5M7QA 1IFGA 4AQAA 4QRFA 4F92B 3TYFA 3RRQA 3PIQB 1XXDC 2GB2A 2XFXA 4JMNA 3V7AG 2DYPD 4W6WB 3LXBA 4HSAC 1IM9B 3VI4B 4YPJA 1F3JB 3QIWC 4UT6A 4GKNA 1DQJB 4LLVA 1HYRC 1R3IH 1KJ2H 3C8DA 4EVNA 1T7WA 3G7TA 1ID2A 3U7YL 5DQ9A 2K45A 1VDGA 4LSSL 1JZ4A 2P7TB 1IEBB 4OLVH 4H8WC 2J88L 1G7LB 4WUUD 4NQCD 5F9AC 5C9JA 1OK8A 3CFMA 4TUJB 2UZPA 3A6CL 1KIPB 1YPZF 2E7HA 5BRZE 1CPUA 1UT1A 1XIWC 3ZGHA 3M1BB 4PJ5E 4PRBA 4R97B 4NNYB 2ZOLA 1OAKH 1TDQA 2J6EA 3AU1B 3LHPL 2QVMA 5JLZA 2ZCZA 3BYTA 4DF9A 5CLWA 2LAAA 4PJIA 2HTLC 2VIRA 4PY8J 4PJGE 4JPKH 3GDCA 4NSKB 4W9DC 4ZMLA 1P4BL 2V7NB 4JAMB 3VWKA 1FL5B 2H5UA 4OB5H 3BDYH 4Z78B 2I9TB 4X7FC 4DO4A 1ASOA 4OJYA 2WXQA 1LK2B 4AYDC 4K7PY 4U0RC 2F7OA 3ZE0F 1U4FA 4FXTA 2N1KA 1MZZA 4XVTH 3QC5X 4U1HB 4N87A 2YPVA 4P8QA 2HJKB 3FOMA 4PRID 1D7BA 5EBMB 4G82A 4YK4B 4JPWL 4KRPB 5L2KE 3NJFA 3GTVA 2BHFA 5FDYA 2GTWB 2PETA 5LCVA 2JI2A 4E41B 3TPKA 3E2HB 1N68A 1H6FA 3RKPA 2IQ9L 1XGZA 4LNVA 4TTDC 3QAQA 4M1DH 3IFLL 4XP1H 2IADB 5HYSA 1JP5A 2VISA 4TTGA 1T1WA 3WS6C 1INEL 5HHNB 4FQ2H 4NC1C 1BQHG 2DYRB 3HZYB 2R29A 3PWVB 2OL3L 1GGCH 3BWUF 4QRRB 4DW2L 4U31A 2WBJD 3VG0L 4AK1A 4RH4A 3X1FA 3RG1C 3MX0A 4WHDA 4FE9A 1E4HA 4JKPL 4QRTB 2JB6A 3VXSE 4OGAC 2IDQA 3EO1B 4Z18A 1KIPA 4FQXA 3FU3A 3SN6N 5FECB 5K5YA 1JZEA 2BVOB 1QO3B 4ZPTB 2XZAL 5GRJH 5DUMH 2BP3A 3AXHA 4XMPL 3TN0D 3HRZA 4B5EA 2AK4A 4QGYA 4M3JA 2V9TA 3B9EA 3AC0A 4AKPA 4BZ1L 2CKBL 4Y16D 2H4EA 3DX7B 3MNMA 4Y4FB 3KM1A 4KZEH 3QRGH 5EDXA 4NQDA 4ZUWB 3ZE1F 3S96A 3ZQ9A 1T6VN 3VACA 4OZHE 4YDIH 2OFQA 2NYYD 3QUGA 2JE8A 3S4SA 3TA3A 2Z1PA 1A3LH 3IK2A 4FZ8L 3FU6A 5E8NA 2Q8BH 4ONHA 1T3FB 2X4SA 1N5AA 3L3KA 3FS9A 3QJOA 4BKSC 3Q9PA 2DB8A 1PQZA 1AHKA 1DHKA 5B7EA 3TBSB 1QFWL 5A6LA 3MV7A 3AM8C 1U93B 4M7LL 3UYPB 4X6DF 1LDPL 5KBMA 3O3BB 4ZODA 3EYOA 2WKOF 1MW2A 1T5WA 3B8SA 3FFCD 3O3DA 2X4RA 5AZEL 1WH0A 3IDNA 5BRQA 4ZFFA 3G5XB 4JDVA 5SWZD 5HDBB 3VD2A 1RZJH 5F96H 1R3LB 1R3HB 2XBTA 1FZJB 5CM1A 1NGXB 3CVHH 3FQUA 4EE2A 1C16A 1SRDA 4ZD3L 1FJ1B 1CXHA 2QQLL 3D0VA 3NCFB 3RUGA 4EN2A 4U6YA 5DMIH 3OB0K 1DUYA 3ISWA 4XCNA 3RU8L 5EIIA 2AKRA 4OUUA 4P2RB 5C70A 5DHXB 3IKCA 4MLIA 3QUYC 4Z76B 4KVCH 1J5OH 4NQCA 3ARTA 5I26A 5AZUA 1ZT4A 4KH2A 3BAYA 2YARA 2QQNL 2ED9A 4AQAB 2Z4QA 3CFJA 4GG6B 2LFEA 3QPXH 1WG3A 1MCRA 4JR9L 4L4TE 1VGEH 2EKSB 1UENA 2FAUA 3KGRA 4NEHB 3DOSB 4A68A 4N2NA 4EN3A 1CE1H 5CNHA 3ECBB 4MNQE 4Q7DA 3AJ7A 1URIA 3GMNB 4G42A 4NN6C 4D9QD 3PHOB 3ARFB 4XN5A 5DUBA 1ZD6A 2NMSA 5I1HH 3BZFA 3GK8L 4PRNB 4WEBH 2J43A 4LCWB 2NY1C 4JRXD 5DD1H 5AW1B 1OP5K 2VSKB 5I75C 4J6RH 1QHOA 1M05A 2NTSP 2CR0A 4GQ9H 4U6VL 2X1XR 3TCLA 2Z34A 3HZKB 1JHKH 2F8XC 5IB1A 3FTVA 5I8OH 3HAEB 2J12B 1BOGB 3U6RB 1UB6B 2HT4D 3NMEA 1AS6A 3G5YB 3PJSA 2MIZA 5EFIA 1SJXA 5HDQH 3GXPA 1CL7L 4V2CB 1PLAA 4J4PD 4DP7X 1DR9A 1YC7A 1AY1L 4XE5B 5SX5K 3NN8A 2HKHL 5E8PA 2NY2B 3BZEB 2C26A 3GZOA 2ZKHL 1CXLA 3KDMB 4WFFD 3ZTCC 1HTYA 5EWIH 1RIHL 3IU3B 3B2UD 2R27A 4CN1A 1OSZB 3UEQA 2BZ7A 2FB4L 1TNMA 3VJ6B 1JHTB 4N2LA 4Y9BA 3LB6D 4KUCD 4XHJC 5DQDL 5C71A 5AD0A 4H25A 4NDMB 4PJGB 5JW4M 3MCYA 1QFUL 5AW3B 2BFVH 5JIPA 5ERWB 2W88A 1DLHB 4P04A 7CGTA 3TIEB 2IPTH 2EVHA 2XA8H 2WIMA 5HHOA 3MGAA 2EIEA 5DMJB 5MI0B 5BVJB 3L7EA 4FD0A 4P59L 3VFRB 5JPMC 4Y4KD 2HX8A 4QDGA 1TR7A 2CK0L 5MEPA 1KYAA 1TTBA 5KBLA 4HFWB 2X7LB 4S1SL 5E6IB 4BH7A 3CLWA 1ACXA 5HY9B 3GKWL 2PTVA 1RH8A 3SDYL 5IOPB 4GUCA 3T5WA 3BPOC 5E9DE 3U46B 4X6CB 4X4XA 1Q0EA 4GRWH 1OM9A 1DLFL 5EMYA 5IHUL 1XH2A 4NO3A 2VKWA 3P11L 3F6IA 2J20A 3CDYA 1I9JH 3HNVH 5CD3A 3D05A 1CE6A 4H0LC 4PJIE 5KVEL 4FNSA 1XO8A 3C6SB 3MPCA 4YSDA 5BUGA 3VXMB 2VDLB 2HVKB 3G5VA 3WY3A 4DGYL 4KY1L 4GRLB 1KPVA 4N0CC 5E6SB 2Y1VA 4M93B 4X9BA 2Y36H 2OXHB 3K4ZA 4LDLB 4LVHB 3RLSA 4ELDA 5HYEA 2RFXB 5DHMC 4WFEE 1RLBA 4QRPD 1V54B 1CFVL 2DQDH 4IGBC 4KPHL 4TL5A 1UB6A 2FIKB 2HWZL 4MJIA 1Q9KA 3IRZA 1J18A 4MBRA 3V6ZB 1K2DB 2F5AL 2IAMC 3T65B 1QRNA 2C9QA 4YHOL 5BS0E 5F7EL 3F58L 5HXMA 1QVOB 1S9VA 1A9EA 4GSUA 2B59B 3WNPA 3MQIA 2BFGA 4WWPA 5DJ6B 2CKBH 2H45A 5L2KA 4U1SA 1GRWA 4JJ5B 2Q3AA 4LLWA 2ED7A 2ZAGA 2W0KA 2MCPL 1SHWA 4F7EA 3HBPA 3HC3L 3B8YA 4OJFL 4LFHG 4YSEA 3SKMA 4YDIL 3BIAX 5BXFA 4BUHA 5DK2A 3MBXH 4B95C 1EAQA 5KWYC 5E24E 2XTJD 3D9AH 2RFXA 4ZPTA 1AI1H 4YSAA 5KJ7E 3VGEA 3D0LA 4LSSH 3IS1X 4N28A 3T0EA 3KPNB 4XNYH 1NFIB 2I07B 5E9NA 4GRLA 3UJTH 1TVBA 5FO9B 4Q9CA 3IKCB 2W92A 4M6MH 1ED3B 3ZL2A 2V9QA 4G8EB 4J3OG 2F53D 1E28B 1YMMD 2DRUA 2WW8A 4JJOA 4Q14A 5CWSB 4GW5A 4ONGL 4X6CA 3FPYA 2OMUB 2AABH 5D7JA 4DSYA 4LHUB 1DCEA 3D06A 4LU5H 1YEDB 2QQKL 2C4XA 3DMMD 4OIIH 1I85C 1F4AA 4YC2C 1U33A 3SY0B 1UEYA 2C34A 3FU5A 4GRWF 5E8EA 5EU3B 4U1SB 3QZLA 2QPEB 4L4JA 1D9KD 4W68A 4XAWH 5AKRA 2NXZB 3B9KA 3OXRB 5JW4Q 4I3RL 4QO1A 5JPMB 2YKLL 4IK7A 1ZANL 5DZ9A 4UIKL 1DE4A 4PJAF 1GZHC 1U2YA 3U2JA 3KLLA 4XWGH 1GZPA 1DJGA 4O4YL 5FM8A 3LKPB 4Z7WA 4UV7H 5DYFA 2EDMA 4FFWC 4L4TA 5IB5B 1CTOA 1HC1A 2DQJH 3WGUB 2IDFA 4D0BA 2WVUA 5F21B 1KXTA 1Z1WA 3N9GH 4L1SA 3VFUA 2F18A 4Q4EA 3IFLH 2QLVB 1CICD 2GVYA 1UXSB 4YGVA 5CEZH 2Q1EA 1QRND 1UTDA 4F7KA 2FATL 4NZRH 3VFGL 1SMAA 2OPCA 1KOAA 4OF8A 3MRMB 3ULSB 2ZWZA 5KYUA 2FWSA 1OGSA 1CL7H 1FVDB 3CZEA 3QFDA 4R7DB 1X5IA 3O41B 4OZ4B 1NPUA 4K9EL 1JGVL 5D9SB 3OSVA 4HC1L 5D7LE 4FAAB 1KY7A 2UZIH 4P5KB 2NZ1A 5FUCE 1HEJC 4IYKA 3FH8A 3OD3A 3ROOB 4A1RA 2AJZA 3L17A 3OPZH 3LKPA 2GJ6E 3N6YA 4AYMC 5FWRA 5K1NA 3W9DA 2LOEA 2Z8VC 5FHAL 1NAKH 3SE4C 1TQBC 4YBQD 2FX7H 1PFOA 3NACH 2OL3H 3IBEA 4K5OA 1T1XA 1OTTC 3U30C 1QSEE 1WBXB 1LO5A 2IIJA 4OU3A 3S36X 3BI9X 4XOEA 4R90L 5EU3A 1BAFL 1T5XA 2OSYA 1O0VA 2CG9X 4R96A 4P3DB 1KTDB 1DBKH 3IBOA 3MKGA 1P6FA 3QCVL 5HYJA 1NCOA 3VJ6A 5CHNA 1QPKA 1TJGL 4KMQA 1A7OL 4MJ5A 1U3HA 5FKPA 4EUPG 1RZKL 4ZAKC 3I2CL 2PO6D 5T3ZD 2PABA 3HE6A 4NT6B 1XMWA 5BZWB 1MLCA 3KWWA 2IPKA 4HUVB 2PTTB 4FA8A 3US9A 1F1DA 2OMZB 3WENA 1UWXH 1Y7VA 5KSAC 5C09D 3DNKA 1B9KA 1JHLH 1GKOA 3HB3C 3IJ7A 3H9SD 1TU2B 3ARYA 2J2ZA 4UB0L 4TVPH 2FX8H 1QRNE 3GXIA 5B3NA 1OOWA 2ALAA 3V10A 3ZZ1A 1KJ2L 4R3SB 1IEBA 5IB2A 3MBEC 4UU9B 1IVTA 1T66D 3TPUA 2AK1H 1EFXA 2EIMB 3SPJA 3LRHA 3FZUD 2WSDA 5E5LA 3E1F1 3VMPA 2UWEB 3U2SA 2X6VA 4KKBD 3UTSD 1K72A 3MDJA 2OTPA 1EEYB 3LRMA 2MCG1 4N68A 1GY2A 5FC9A 3QIWD 5F7MC 3ULUE 1OD7A 2H6PB 2FQDA 4M4RB 4JQXC 3MRHB 4NC1E 3VXQB 4QXWA 1D5BA 1S7UA 4Z77B 4PS4H 5KTEL 1GS8A 1YZZA 1SVBA 4LL1A 4Z95H 3TZVC 3WIHL 5IFHH 1L6PA 3Q8EA 5C08D 2NR6C 43C9B 1ZHBB 2F1AA 3BW9B 1CXEA 1T4KB 5GJSL 3D30A 1XTLA 4QXVA 2EYSB 2CIKA 5DVLA 4A7QA 4ZNEA 1RJZB 3MOBH 4UBDC 4XMLL 5BJTB 2W81C 2R8SH 3UTZA 1KJMB 3GHEL 3V8OA 3VXME 4Z7NF 2AGJH 2EDYA 4TLUA 5DF0A 1AZNA 2NY5C 4PS8A 2DD8H 2VO5A 4LB8A 1U3HB 4OGZA 5ACZA 4JFED 1IBGL 3C2AL 2NCEA 4KQ3L 1J7VR 3MJ7A 1E43A 1S3KL 1EH9A 4K8RC 3PV6B 3I9AA 2X89D 3S3DB 5F93C 2XPZA 1YVLA 4BELD 3RDTA 2B14A 4FTVD 2GTWA 4ONGH 3KH4A 1EA9C 2EYTB 2H0JA 2ZICA 3CN2A 1UJ3C 3EDDA 2EYRA 1NCAL 5T1JA 1IFHH 4NBYB 5DGQA 5IB4B 3KWWB 2VLME 5SWZA 1TO5A 3OR6A 2FO4B 3INUH 3O6FA 4KQ4H 3N06B 2QTEA 4X6EB 5IB5A 2AI0L 5CXPA 3T2LA 1ZEAL 3NCJL 3PWLA 5AVQB 3EJQA 1NCTA 1FRGH 1D7CA 2P80D 3IKKA 3W57A 2BOBB 1M42A 3TVMB 1JFQL 3O45A 4KHTH 2JJUA 1BDYA 2YHGA 5E2UH 3EYVB 4P2QA 5DK0B 1YC8A 2ICES 2JJVA 3CZGA 4N1HB 4AEHH 3FFOA 4HX1A 4RAUA 2QKSA 3MGTA 3B9KB 2VR4A 1UYWH 4Z3IA 5TPWH 5J06A 3QEHB 1KC5L 4U7SA 1BMGA 5I1GH 2QVIA 1OSZA 1UOKA 3EO1A 2ATAA 1D6EA 2OTWB 3MN8A 3KL5A 2VDPH 4Z7VE 1UHVA 3N9GL 1U3JA 3SQRA 5C0NC 3HR5B 3CQPA 5K93A 3RY5A 3WL9B 4MD4A 5C0RL 1XF1A 3PV7A 2NY7H 2Z64C 4LASH 4A7VA 3D69B 3LZQA 3WAJA 2F53E 4AIOA 2LLLA 2TRYA 5DJCB 1AZVA 1NMAL 3K6IA 4WGWB 1R47A 4FQHB 3TT3L 1AANA 1FV1B 1S7SA 1NANI 3RWJA 2OQJA 4C56A 5DMYA 2VLJB 1T4KA 4WWID 3MAWA 1FO0B 3U1PA 1MIEH 4ZTPH 3SKNA 1EDHA 2CLZB 3WKNA 1GKEA 3SDXE 3WHE0 2AV1A 2YBGA 2W9EL 4WNQB 2WZ0A 2VDKH 1GHFL 5F0PB 3CHQA 5M94B 2EXSA 3FONA 3NSXA 3OC5A 5C0JA 3IMTA 2E7LA 2NX5B 4FZEL 4YE4L 5KVFL 1CGYA 3RUGE 3BEVB 2DQGL 3O6ML 5AW7B 3RKDD 3E9TA 1SDDB 2VJ0A 2P46B 4KK8D 4FQPA 4LLWB 1JXJA 4MAUH 2WIIB 4KX8A 2Y36L 3O3EA 2WMPB 1DL7H 4FMFA 4LFHD 3KYAA 3NZHL 1JMXA 3HHMA 4L37B 3K6NA 1FQ9C 1K8IB 3AQYA 4HMCA 1CLZH 5FCUL 3PHSA 1JYWA 2R0ZL 1CDUA 3EFOB 1PLCA 2DQDL 1JGDB 3K2MC 1PY9A 1GW6A 4IBUA 1RPUA 3P4NB 5DMGC 3R19A 4D7PA 3HZ3A 4N5EC 4C4BA 5J57B 2GQHA 3P3UA 1N2RA 2FH8A 3CDGB 3F7PC 3LKQA 4UT6H 4UCFA 4MKTA 4ZUSB 5EEXA 1YDPA 3ZN6A 5EC2B 3T0EC 2JJTA 5DJYB 4ADGA 4WI3A 1TYEB 2J8UB 3OKNA 5T3XD 2E5EA 2R1YA 2K4WA 1BLIA 5KUMA 5IBTH 4FHBD 3W38A 4F7MA 5CP3A 3MYJB 4QLRA 4YL4A 3KLAA 4PRAA 4HIIA 4UQIM 4HK3N 1JD9A 3RWGA 3SKMB 1SN5A 3FQWA 1I31A 4ZX6A 5CHNB 3KXFD 5LNEA 3X14A 1OSPH 3T4AC 4PLNC 1YECL 4Y4KB 4NQSB 3V4UL 2EEFA 1YG9A 4ZS6D 5E2VH 2P45B 3FO9A 4QRUA 1NFIA 1JK8A 3R8BB 3T0EB 2D31B 1I7UB 1B0GA 4TNVF 3ECQA 3LOWA 3EF4A 2WC7A 1NFKA 5GSVA 2X42A 4IEFA 2YFNA 1VFAB 2X70B 5F7AA 1F13A 2HKHH 3GSNB 3MHZA 4ISVA 4PGZA 4PJHB 5FWQA 1U42A 5DEGA 7PAZA 2YWZA 3U9UA 4JO4H 4GIPD 4EZKA 1WWWX 3PG2A 2WUCH 5BVPH 4PS4L 5KTEH 1OANA 3MUGA 2CQVA 3EUUA 2ZWKA 2XN9A 1QFUH 1G1OA 3DETD 5C0BB 1KPRA 2NDFA 2ZG1A 1BD2D 2SEBA 5CEZL 3LNGA 3QP3A 3S88H 1KYOJ 2Y06L 1MWAH 5D2NB 3ZTNH 4AIEA 1HWHB 2OMXB 4X8JA 4I3RH 1YEHH 5GS3A 1CR9L 3MFFB 1ORQA 1P4LB 2YD5A 4P2AA 3ZTEA 1VGKA 2BSSB 1S8DB 1RJYA 1A4KA 2VXQH 5JO5B 1AJ7H 3ZXAC 4K9EH 2HKAA 5H4ZA 4C83A 1G6RH 1LNUA 1T7ZA 4OLUL 2DDQH 4BFIA 4IIQC 1NGYA 3A4EA 5AENA 1C7TA 5DYOB 4AZUA 4L2YA 3HCVA 4XVSL 5SWSB 1CURA 3QI9A 1A6UL 4NXSA 4FS0A 1QAWA 3VW3H 2R15A 3HNVL 3PL6C 4LEOB 1Q1JH 43CAB 2HTKC 5F9WB 1NCUA 4YX2H 4X8GA 1BFSA 3GUFA 2AJVL 3REVB 3B3BA 5GJTH 2V17H 1R5WB 4JREB 1BJ1H 1KV7A 5T1LD 3TS8A 3CDCA 5ID0A 4W9KC 4DQOL 1AGCA 2OZ4H 5FOBB 4P2RD 1QSFB 1I3GL 4X6EA 4B27A 2GHWB 4UOZA 5DVNA 2O5ZH 3T0DA 5BV7C 3GSUB 1DBAL 1BEYL 3V55A 2QHRH 3ZQXA 3MLWH 5IVOA 3E6FB 3BRFA 3VXUB 1LEIA 4HLZH 5HYQB 5LWYL 4N6RA 3F58H 3FT1A 5IMOA 1DQQB 3NIDF 3S3PA 1ZT4B 1CXIA 2BNRB 4Z7WF 1ORQB 4Z7VB 5AW4B 1PCXA 4P48A 4PJEE 5KVGH 3F5WA 2GT9A 2XUWA 4P5RA 3T1FA 4LVOC 2IH3A 4AQ1B 2AQSA 3QQ3A 1EFXD 4CBZA 2SEBB 3JYBA 5IKCA 3BIKB 3ML9A 1FFRA 1OAZL 4HZAA 4XR8C 1HSAB 3R1GH 4WSKA 3UABA 3IGLA 1NDMB 2YAQA 4EKJA 5AOIA 3ZL1A 5F6IC 1LGVA 1R3HA 4PJ5D 1K4DA 4HDIB 4EVNB 4LXFA 5J6GA 1MREH 1OT1A 4WI8A 2QT6A 4P9ML 1KTCA 1OGAB 3FCBA 4PJ7F 5DEFB 3QORD 1N6QL 2PTUA 5J3HD 4NM4L 1RUMH 4V33A 2HRLA 1XL4A 4Y1TA 5F6HJ 3QHTC 2VLMD 4LBEA 5DRZA 3K2KA 3JYCA 5L8JB 1IVLA 3L4WA 4KI1A 1A3QA 4OCYL 3BP7A 1QBBA 1EDQA 1RUKL 2LVEA 4A39A 3QIWB 2R83A 2H6PA 4FQJH 4LCWA 4APQA 1QLFA 3V0DA 3JV4B 2VLLB 2XTJE 5IMKB 3P4OB 2ICWJ 2WHVA 3NZHH 5I19H 4ZO6A 1UD4A 1Q8MA 4JM2F 3GBML 3AAZA 5E6ID 4UU9A 4EXPX 3SGKA 5DMKB 5JW3H 1GTNA 5C0JB 4ORGB 3QJQB 1ZPLA 3TFBA 2XHNA 2QZ5A 2DLIA 1XT5A 5CJXC 2MJWA 4JM0A 3STZB 2XFGB 4GBXA 1RPKA 1XGUA 2WTPA 4P5SA 2XZCL 4F1ZA 1FI8C 3PXHA 5KVMC 3SCMB 4B5ZA 4KDWA 1EVUA 3F05A 1ADWA 1JPFA 4KKNA 3N5AA 4JPVH 2YXWA 3ASOB 1FLRL 4FFYA 2C8NA 4CU8A 5JUEH 4G8GD 3V5KB 1DQTA 1IILE 1T66C 2QGCA 3DI3B 2WP3T 2H0FA 1LP9F 1KTKE 2DI9A 4HGWB 3MRDB 1NC4A 4Y9CA 3DKHA 4UF7C 5E2VL 3VD7A 1T21B 1YJDC 1ZTXH 3CJJA 3OKEB 2HKFH 1WITA 1CLYH 1BW8A 1NINA 3MRGB 4WWOA 1HI6A 3OJDA 5AOJA 4K3DL 4RWYH 1TFPA 3UZEC 3D48R 5KZCB 2VN4A 3BD4A 1J5CA 1NEZA 2F54A 4FNUA 1FFPA 2FYYB 2HVJB 1X4YA 4NENB 2WYZA 1S7TB 1IZJA 3HAEG 4RDQG 4YVUA 2FO8A 1HNFA 1XF2A 4IBQA 3DURB 4JZNB 4FMKA 5BVPL 4XBGB 4F37K 4JRYD 1BVZA 3ZKXC 4LF3A 5EDSA 4M1GL 3QFJB 3CWGA 1XF4A 1ODAA 2O5XH 2OI9C 4N9GA 4OD1H 3C5SA 1HE8A 3S88L 3AT9A 2XWDA 1U3NA 4G9FD 4P0DA 2WINA 5C0FA 4NQED 3MNVB 3TC9A 3S2AA 4CN6A 4Y2DC 3NRPA 4R5TA 2FO1A 2FSEA 3N44F 3ATEA 3QFJD 2C9VA 2ZTBA 2YGQA 5EF2A 1A7OH 2P5WB 4LVOB 4LCCA 3QXUA 4Y5VB 3E1ZA 4NWUH 1KXVA 4OLUH 2A6JA 3KXFE 4JPIA 4CJ0A 5B4MC 3FUFA 5GGUB 3FC8A 5LQBL 5F89A 1Q72H 3FYEB 4PWKA 1EZLA 2BH0A 2E6QA 2PP8A 4IDLA 4NAQA 4TVSa 4RISH 1H3TA 4OFVA 2NY7L 4G11A 1KIQA 2VZOA 1NFDB 4U1MB 1H15B 1LQSR 2WBKA 4FQ2L 4HHGA 4MAUL 3HN5A 1TSHA 5EBWB 3CZJA 4BSVA 4R6UA 2WO2B 2H6OA 3M7FB 1CG9B 4RDBA 5JLZB 1AMXA 3KYMB 2YUZA 1P6WA 4TUKH 4Y7MA 3MLVH 4B0MM 2Y4SA 2O6CA 1MIEL 3WNLA 1BVLA 4M8UA 4QYOB 1PSKL 4NZTH 3DHPA 3QJUB 2W0FB 1UWEH 1AIZA 2OZNA 5JHMA 3TJEH 4WKZA 4PWGA 2Z92A 3TBWB 5EUOE 1R3KB 4GKLA 4LCWD 4O2CB 1AZCA 2ZE0A 4B9FA 1MWOA 4M7ZC 5CWSA 4TLSA 5ABZA 2FBOJ 2DQGH 3O6MH 5T1KB 4NJ9H 5GS1A 3MV8B 4Z3TA 3CLEL 3FB8A 1MQ8A 1WFMA 3W11D 3O4LA 4OKVA 2WWNA 4FCHA 2LT9A 3TOPA 1GC1L 1JPSL 1GJWA 4LT7A 3QORA 2VLJD 4TQIA 5FFGA 1IE5A 3DUSB 2H8PA 2VXSL 3R1GL 4GQPH 4OV6F 1IT9H 5IROA 1U8KA 4N22A 1OSPL 2QMJA 4XMWA 1TQSA 2VDLL 2WLHA 3U7YH 4OSUL