2YMXH

Crystal structure of inhibitory anti-ache fab408
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
224
structure length
222
Chain Sequence
EVQLQQSGPELVKPGASVKISCKASGYSFTGYYMNWVKQSPEKSLEWIGEMSPSTGRTTYNQNFKAKATLTVDQSSSTAYMQLKSLTSEDSAVYYCARSVPLTTLIEDWYFDVWGTGTTVTVSSAKTTPPSVYPLAPGSAANSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords FAB ANTIBODY HEAVY CHAIN
publication title Molecular Characterization of Monoclonal Antibodies that Inhibit Acetylcholinesterase by Targeting the Peripheral Site and Backdoor Region
pubmed doi rcsb
total genus 47
structure length 222
sequence length 224
ec nomenclature
pdb deposition date 2012-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ymxH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ymxH02
3P30L 1SHMA 3TO2B 1KLGA 2J1KA 3RGHA 3LQAL 3TLRA 4FQHB 3ZDZE 4QGTA 4XVJL 1Y6MR 4IDJL 3TBTB 1EHNA 1KN4L 1W0VA 1Q9WB 1JTOA 1XF1A 5JTWA 4KV5E 1MCOL 5TQ0H 1OVZA 2DMKA 2V2WB 3GBLA 3JVGA 1FL5B 3K74B 5E56A 1UZ8A 3FO1B 4EVNB 2UZXB 3M1BA 1JI1A 4F15B 2EYRA 1FVDA 4JFQA 1A02N 4H0GA 3SCMD 4Z95H 1VERA 2VABB 5ICYA 2P5EE 2HTLC 1GC1C 3RTQD 2YC1B 4NN5B 4PRDA 4RSVA 3DGGA 3HAEG 3VFPB 4LSVL 2QSVA 4P3WA 5IM7A 4R2GB 1Y6KR 2DTMH 3VD4A 1SJHA 4NHCL 4TVPD 5C2BH 1M1SA 1AKJB 3FO2B 3RGVC 2B2XL 3UCRA 2WP3T 2W0FB 2X1PA 4HAFA 3STBA 4Z77A 3MCKB 4HXAH 4U49A 1QNZL 3WFBH 4N1CA 1YNKH 1FYTB 3MLSH 1CZ8H 3DROA 3GSQB 4PRHD 4NQCE 3RY5A 2YN3A 5E94B 1OAZH 2DM2A 4JFHE 2Z35A 1ZE3C 4Y16D 5DA4A 5CBEB 3MRBB 4D9QD 5GS2D 4CNIB 4LKCB 3DETC 1NBQA 3TNNB 5DD3L 3SDCB 1A1OB 2HVKB 2BHUA 4X5LA 3VW3L 1NBVH 3IT8D 4JY5H 1MQ8A 3MO1A 3CX5J 3Q6GH 3NFNB 3LS5L 1FFQA 5C0BB 1UCBH 1FNEB 1H5BB 3TZVA 2BY2A 2ARJB 5DJYB 5C08D 2NXZC 3MRGA 4WO4B 1F58H 2HFFA 3MLWH 1PQZB 4QRPE 1C5CH 4HIEA 4W6XB 2FJHA 2VLRA 5TFSL 4NFBA 3L7FA 1JYNA 5TF0A 3OZ9L 3R06B 5CUSL 4NFCA 2A0LD 4LVNB 5FXCH 3S4SA 3RZCC 2BFVL 5D1ZB 5FIEA 5EU6A 1PY9A 5IESL 4G8GB 5CJXC 5HYQB 3MUZ1 1R3IH 5IMKA 4BJLA 1XGYL 3DXAA 1F6FB 3EO0A 3KHQA 4YHKL 4J1UA 2H8PA 5DSCA 4XHJD 1P9MC 3MV8D 5JOPD 4PJ7F 2HLFC 5AWNL 5FKPB 3BQUD 4Z7UA 2OZ4L 3ZDXE 1HQ4A 3NTCL 3KYAA 4KKCC 2VDQL 4LNRB 1ETZB 1TCRA 5ICXA 3TGXA 4J8RA 2HFEA 4DGVH 5KSUB 2AK1L 5GPRA 2K1MA 4NZTH 2CMRH 5FHBL 4WW1B 4KJQD 3WS6A 4U1LA 2FL5A 4LARH 3TYFA 1U8OA 4L3EA 4F3FB 3OKDA 3DI2B 3U7YL 3Q3GB 1IT9L 2DI7A 2CH8A 5DEGB 2NQCA 3EO1A 1JGUL 4KK8D 3FQTB 4G7YH 2XI9A 3ZSTA 5FO9A 4K3EL 3MRRB 1A9EA 3QI9B 2CO6B 1KGCE 2E7CA 5EIIA 3MNZA 1F11B 1RIHL 2K7PA 2XZAL 3FZUD 4BSVA 2ZWLT 4OF3A 2R23A 2MOVA 2APFA 4QWWD 3TVMB 1NMAL 1WWAX 2XA8L 4IOIB 1IQDB 5KSBF 4M6AA 4HWUA 5F7MC 4MXWL 2NZIA 4JZNB 4HIIA 4TUKL 43CAB 2VLJD 3PJSB 2MCG1 1VPOH 2WP3O 3LN4B 2X4SB 4WV1C 2VISB 3U1SL 5E1HB 5DZOA 2LU3A 1LEIB 2CRIA 4R26L 2VDML 1L0QA 5HHMB 2VLKD 3HAEA 1FYTE 1S8DB 4LAJH 4MWFB 4CJ1A 1LNUB 1ZGLB 2FDBP 2MNUA 2HN7B 4NO2A 2DQDL 1LO3L 2ZUQB 3WKML 1NFDE 4JFED 5AYUH 2AAVA 4CDHA 4Z5RB 3FL7A 4HUUB 1X7QA 1WIPA 2P24B 2J88H 2YZ1A 3RKDC 5DJAB 2IANB 3NCYS 5H35A 3RWFA 5F9JB 1ZLSL 3WIIH 5C0BE 1OAYL 1RJYA 4LPXA 3DUSB 2E7BA 5EIVA 4XBEL 2WUBH 4Z0XB 5E8PB 3S6CA 2G2RB 3PL6C 1A1MB 2AABL 2YPLA 5DFVC 5GGTL 3K1DA 4JB9L 2Z0BA 1S7VB 3NCBB 2PKDA 4KQ4H 4DGIL 1NANH 4RAUB 2ZSWB 4HK3J 1UXWA 4ISVB 1ZHBB 5E6IA 3SJVA 2DWEA 4ZS7H 1OT2A 3QUZC 4XPTL 5F3BB 1QEWA 4JHAL 2XN9B 1F4XH 3MRNA 4S11A 5JIPA 2DBJA 4G8GE 5GGRA 5IFAL 4U6HA 5CD5C 2VMFA 2WNGA 1NAMA 5IF0A 5CKAA 4GQ9H 3MV9B 3U4AA 5IW1A 5DLMH 1KTDB 3F12A 4PIRF 1RUQL 5JUEL 4IRJB 1O0VA 3SO5A 4PUBL 3ZYIA 1CLZL 3SDXA 1T22A 4Z7NF 3QQ4B 4MQTB 2VLMD 3CCHB 3VXNB 1TJIH 2VXQL 3ZTNL 1BM3H 3QDGA 4Z78B 5E2UH 1FH5H 5C0GA 1UKSA 4R2GC 2GAZB 5DTFA 1H3VA 1UACL 4KK6C 3O45B 3QRGL 3VXPA 4JAMA 1U93A 3VU2A 3T77B 1DJSA 1H0DB 1T83A 1MJ7L 1OTUD 2VH5L 5CJQH 3BZ4A 3B9KD 3ARDB 4XP4H 4ODBD 1ZA6A 3LPFA 1G7MA 2J5LB 2B20A 5A2KH 4AYFA 3AXLA 2FWOB 2GT9B 4I0CC 1AD0B 4CU8A 3M07A 3PWUB 3MBEA 5IHUH 3JV5A 4KKBC 2NW3A 1QSFB 4R90H 2XIDA 3PNWB 3KLHC 5C8JB 5C6PB 3SN6N 4N8CH 3CK0H 4EDXA 1X3DA 3OKKA 2J6EH 1DQQB 1MFEH 3A6CL 1PLGL 1MWAB 1YEFL 3O6MH 3F58L 4OLZL 3WS3A 4OZIB 2JTDA 3FQXA 4HQQH 4LQ1A 4C56A 4ZO8A 4U6VL 4KMQA 5M95B 1OD7A 4YXKH 3K8MA 4Z0BH 2YSSA 2BVEA 1NAKL 1EJOL 2Q7YB 2KQNA 4P3DA 4Q2ZB 4ZPTB 1XR9B 5GSRB 3QH3B 3ROLB 2ITDB 1OY3B 4OQTA 4XNZB 5HHME 5MERB 1EGJA 4HIJA 4ZFZA 5E6ZA 3DSFL 5CAYB 2ADGA 4LCWA 3STLB 5I76B 1NCAH 1B0WA 2LABA 5J13C 2D31A 3ARBA 5D1ZC 3B5HA 2XZQL 5I1LA 3N9GL 4JQVA 3TM6A 1F4YH 3GMNA 4RFEA 2GFBB 2OL3B 4LSSH 3VXMA 3MRDB 5E00B 5FO7A 3LIZL 3OV6A 1I1AA 3RFZC 3UPRA 1FFNA 3CJJA 2IANE 4JRXD 5DJZA 4HMEA 1J18A 5HJ3B 3U0PA 4K7FA 4LLQB 1BOGA 2HLAA 3G5XB 1YMHB 3TT1L 1KYOK 3MGOB 4HWNA 4GKSB 4GG6A 1L7TH 2GJZB 5H8DA 3GRWH 1S7SA 4R8WL 3DBXA 5I71C 3X17A 4L8DB 1HE7A 1S7RA 4NQEA 4AH2B 4Z7VB 5JIKA 3QFDB 5FK9A 4TUJB 1A2YB 3HI5L 5F89A 5E2TH 2DB8A 1YN6B 3NIGE 4LVHB 3FRUB 3C08H 4P9HH 5DRWA 5CWSA 2D03H 1KCVH 1JFQH 2LV4A 1UB6A 5SWSA 2XN9E 1OCWL 5IHZA 1PKQA 4Y1AE 3JV0A 1WBXA 3N1GC 5I19H 4P9ML 3MV9E 3AGVA 2EIDA 2V2XA 5K9QI 1KLGB 1RURH 3WUWG 3TVMC 2NW2A 3V6ZA 3IDXL 4PJ9D 3VGAB 1L9MA 4TULL 3WYRA 4QRSA 4RGOH 3CFEA 5DRXA 1OWWA 5C2UB 4WO4D 4M61A 1SYSA 1OF2B 2OI9C 1UZ8B 1EH9A 1HCFX 1D3CA 2FD6L 2EYRB 1FVDB 3O0RH 1QP1A 4JFQB 5EC2B 1V3JA 3ARTA 4YDLC 1VEOA 4S1SH 4X7DC 2E27L 5J89A 2E6JA 3NMEA 4PBXA 3QPQC 4OFYA 4M48L 4PJFF 2Y5EA 4NRYA 5IFHL 2QKIA 4ZAKC 4OT1L 1SJHB 4TSAL 1R3KA 5DO2C 2ZP0T 5LGHH 5D7LA 1MHHA 1QSFE 4TNVK 4Z77B 1U8MA 1DUYB 3ELAT 4JN1H 1OTTD 3K4ZA 4FTVA 1JGEB 5E8DL 4GBXC 5HGBA 2Q20A 2EZ0D 5GZND 4AIXA 2J3SA 4PR5A 4PJ8A 1XZ0A 2OYPA 4RFOL 5HHXH 1A6VL 2HJKA 4OZIE 4CN4A 4HGWA 3HCVA 3ULVL 4EQ3A 2Y7QB 1BZ7B 1MCWW 4MB5A 2X89D 1KIPB 3MO1B 1N64H 3HLAB 3RVWC 1XIWB 3KXFB 4EJ1C 3L3KB 5JO5A 3SDAB 4N0FA 4XNXL 5C0DA 3S3SA 1ZANL 5EOQH 5E7FA 5DQJA 4LPCA 3B9DA 1LE9A 2R8SL 1CCZA 1UADC 3QI9D 1OLZA 2Q6WA 3ZKSD 4RISL 1K5NA 4PY7A 2AI0L 1UVQA 4XI5D 3S9DB 1EX0A 1LGVA 4TSBL 3V2AR 4L5FH 3MV11 3CLFH 4Z7WF 5KSAD 4F2MA 5KTEH 3FQWA 1QA9A 4IRJC 1S7QB 2FEEL 4X9GA 4PJBA 1MFAH 4KVNL 4ZXBC 1WT5A 2OR8A 5EA0L 5EU6B 2X1WL 4UT7H 2DM4A 4RMUA 4PB9L 4A2LA 4GXVH 5DS8B 4MA1B 3NAAL 5IMKB 1T6WA 4E42B 3EO0B 1CGVA 4J1UB 2H8PB 4MQSB 5DSCB 4S1QH 1P2CA 3AAZB 1C1EL 1AJ7L 1YYML 4OIIL 1TCRB 3CZJA 5TE4H 4BZ2H 1MHEB 4J8RB 3G6AA 2HFEB 3QDMA 3REWA 2FL5B 5I17A 4X5WA 1AR1D 3RU8H 1HKFA 2NY2D 1MWAH 3TYFB 4DOHB 1KTLB 1U8OB 3FFCE 4LQFL 3WCYA 3HRPA 3T1WA 1A7BA 1DBBL 4L3EB 2Y5TA 2CIIB 1CICB 4LF3A 3GGWA 3DECA 4YHNB 1MOEA 5HXMA 3C6SB 2Y4SA 4KROC 5FO9B 2H1PL 4Y4KA 1A9EB 3O3EA 4QOKA 2F5AH 1NGWA 1CLYL 4U1GC 4XAWH 3MNZB 4MGXA 5CS7A 4O2CB 5LCVH 1JN6A 1NGPH 3BRGC 1NANI 4FQXA 1HQRB 3S97C 4HWEH 3WUWA 1S5HA 2GSGA 4BSVB 1R3JA 1CDJA 4YDJB 2IGFL 4P46B 5EBWB 1N0XH 4L8BB 5C07E 2W1NA 5IVZA 3VG0L 2Z8RA 3K4AA 1FJ1A 3D39A 2MCPL 3ZKND 1JHLH 2YS4A 3LS4H 4BK4A 1UWEL 1TNMA 3V4PL 4MNHA 5GSVB 1N5AA 4OCYL 4O51A 4N8PA 5SX5K 3ZKMC 2VC2H 2DLHA 3AU1A 4TOYL 5GS0L 5JQ6H 3PP4L 4M43L 3B3IA 5BW7C 4PJGA 4ACPA 1JF5A 1NAML 1KJVA 1WBYA 2Y36H 1BFTA 4NBZB 2NY0D 4YFDB 2JB6B 4NOBA 1XF3A 4DGYH 4RA3A 2UY7A 5F70A 1NC4D 2DQUL 1VHPA 4OZGA 3RRQA 3C09B 1FIGL 3WFCH 2YA0A 4X4YA 5J1SC 2AJSH 3CDGA 4YNYA 4G6FB 4CVZA 3LSOB 4C4KT 5DMGC 4KGJA 2EXYC 3HZKA 3KXFE 1KB5A 1SYVB 3ARDD 4KJWD 5CSZA 4HKBA 1ZMYA 3UTSA 1RJYB 3BP6B 3TF7C 5E99L 4AENA 3WJJA 4U1JB 1DFBL 1G6VK 4X6CF 3PP3K 2UVFA 4WIQA 3PWJA 4GW5A 5ERWA 2EDHA 3GI8H 4N5ED 4DK3A 3QCVL 3BUTA 1DQML 4KVCH 5GIRB 2YPVL 1J1XL 5BVPL 2NR6C 1N5YL 4WEMB 1A7RH 4LPVA 1EHAA 5FYLL 3EJYC 4FXKA 3HG1A 1QRNA 2QQLH 1KENH 1JUFB 2KZWA 3HE7C 4M5ZH 3S3JA 1T1XA 3ZL4H 4NYLA 5E6IB 5F1NA 1RZ7H 4XH2B 2DWEB 2NY4C 1QEWB 3CFJA 3MRNB 3X11A 1G6RL 2ZJSH 3TBWA 2BXYA 2IF7A 4U6HB 1KTKE 1F3RB 3RVVD 3LV3B 4PTTA 3ESVF 5HHOD 4P4RA 3WFEH 5KVFH 5IW1B 3NA9L 3BWAA 1CGTA 1ZS8A 2WIIA 4BZ1L 5L2KD 1QOKA 3OR7B 4PJXF 3UJTH 3D9AL 3SDXB 2YRPA 4P5TC 3IKCA 4E41E 4NJ9H 1MCQA 3ULUE 4J3SA 4OQTL 2MTPA 4U6YA 1IC4H 3QDGB 1YEDA 3IVKB 5DTFB 1B0RB 3ARGC 3T0BA 4G43A 3VXPB 3S96A 4DOHE 3FOLB 4JAMB 3U79A 3O41B 3PGCB 4P2OA 4JFFD 4L3EE 4FFWD 1CGSH 3CXDL 1U92A 2XXMB 1ZA6B 1G7MB 1GC1L 3LHPL 4MVBC 2DIJA 1FN4A 4M3KB 5HDBF 4WEBH 5M94B 3MRFA 4MS8C 4P23B 3BSZH 1CD9B 5TE7L 3T65A 1T0PB 3MBEB 4ZG1A 3T1FA 3REVB 3V7MA 4ZUTA 4Z95L 2GUOA 3MFGB 4F7PA 4N68A 2I60L 1YQ2A 3BISA 4LLVA 4EDXB 1YMME 5L9DH 3MUGA 3OKKB 5HI5D 5IB5B 3T09A 2BX5A 3BVNA 1T7XA 3O6LH 1UFUA 2DTML 3SDAC 5FM4A 4I3RL 4YEEA 4U6XB 2XPGA 1QACA 3WS3B 5IW6B 1F3DH 5EPMB 3O6KL 4C56B 2RCSL 5F7FA 1UQSA 4TVSa 3PGDA 2YSSB 1MRFH 1YNKL 3MLSL 3E0GA 4ODHH 1OAZL 5JMRA 4X9HA 1B90A 5J9PB 2ZPKL 5ALBL 4NPYA 4HIJB 3QO0B 4ZFZB 2QADB 2GJ6A 3TH3T 1DEEA 4XPHH 4ALAH 3LKNA 4F9LC 2ADGB 2ZKHL 4LCWB 2CQVA 3G5ZB 5F6IC 5CEYA 4ONGH 1HHGA 3VFSA 5I1LB 3AREA 4O02H 1MIEH 1NBVL 4RFEB 4UTBL 4BUHA 4OLVH 3VXMB 1BD2D 5IK3A 4MA1C 5FO7B 1LO4H 3UPRB 1FFNB 1UCBL 1OSPH 3PUCA 4OJFL 4OZFH 5T1DL 1I3UA 3V6OA 3MRHB 4XC3H 4K7FB 1PZUB 1BOGB 5BMFL 2HLAB 3VFVA 4RA0C 4GG6B 1WAAF 2I26N 4KI5D 1X5HA 2J4WH 1C5CL 3DBXB 1MIMH 4F33A 4NQEB 5IMLA 1JE6A 3ZE0E 4HBCL 3L9RA 4PB0L 3FB5B 1CICC 4G5ZL 2XY1A 5DRWB 1K2DA 1IKNA 1NGQL 1UB6B 3VFMB 1CF8L 4HJ0D 1PKQB 1WBXB 3MJ9H 2X4TA 4YAQB 2V2XB 1WZLA 3QUXA 3BIKA 4P46C 2Y6SC 5I75B 4JM4L 2NW2B 3TNMA 4WWKA 3WXVH 5B4MC 1NGYA 1M4KA 3SDXE 1UM6H 3HPJA 4ZFOL 1A7PL 3KPOB 2CMRL 3TZVD 1UKQA 2W65B 2O5ZL 4LARL 3CFEB 4TQEH 4KK9C 5E08H 2A1WH 3ABZA 4M61B 1SYSB 5IEHA 3HC3H 2FNBA 2IEPA 4QHLA 5HPMA 3QO1A 2XQYG 2KBGA 4G7YL 1MAML 3SBWA 4TNWF 4EIGB 1WIUA 2VLRD 1T3FA 2VSCA 2W38A 3IDUA 2B1HL 1TQCB 4IJ3B 4MD0A 4EXPX 4NRYB 5ID0A 2YPKA 2B7DT 5EU6D 1KEML 3QSKB 3BJ91 2QKIB 3L3IA 1R3KB 5IGXL 4DN3L 4IS6A 5A2JH 5IB2A 1BX2A 3QA3A 1TETH 4OQ1A 4PGCA 3DXAD 5FECB 4QHNA 1U8MB 3G5VA 1P7KA 4JGJA 3HS0A 2F5BH 4FTVB 3ULUD 4HIXL 5HGBB 1VEMA 4Q9QH 3OTTA 1CS6A 1FZOA 3MGTA 4OZHF 4PR5B 2G60H 1VPOL 3ULVD 1OTSD 5LBSH 1FO0B 1U95A 2E9WA 4M6MH 1QSEB 5D2LF 3STZA 4LAQH 2YD4A 2C4FT 1SMOA 4KTDH 4H26A 5DQ9B 1IL1A 1AD9A 1G7IB 2BVQA 4KUCD 3NABH 4X4ZA 4B7IA 3QIUA 3ZDYE 4GW1A 1MVFA 4Z7OE 5C92A 2D0HA 2YWYA 5JO5B 1Z3GL 5IB1A 1WIOA 3CX2A 4N0FB 5C0DB 1UM4H 3AUVA 5LXGH 3BPOC 2PR4L 4QTHA 5DQJB 2RAMA 5ICZB 2EYSB 2Q6WB 4ODWA 1K5NB 4G9DA 4PY7B 5JDSB 2J88L 1UVQB 3K7UA 3RVXC 1L6ZA 3GO1L 4X7FC 3WIHA 3IGAA 5DEFA 4OM1H 5SX5H 3VXME 5I15H 3RL1B 4F2MB 2CPCA 5FF6A 3FQWB 3OBAA 4ZOAA 5B3NA 3SGKA 1QA9B 3L7EA 3WIIL 1KCSL 2W92A 4PJBB 1JF1A 3W2DH 5TDNB 1RULH 5F1KC 2YXMA 4KMTL 1C7SA 1FFOA 3H0TA 1MRDH 5LQBL 4KJYA 1BEYL 1ROWA 3EDFA 1EAPB 6CGTA 3I6GA 3KLAA 4PLJC 2YD7A 5B39G 1YNTA 3N1QC 3OX8A 1S7UA 4IOFD 2H2PC 4UILH 5I0ZA 2WBJC 3SE4A 1L7IL 1P2CB 4YH6A 4Y19E 4ZS7L 3U4EA 3EW3B 4M1DL 5JORA 1G9EA 4HDIA 4MA8L 4WDIA 1NBYA 5DLML 1D5MB 3OPZL 3PP3H 5T1LB 1CDHA 1G7LB 3QUKA 3OB0K 5T3XL 4J6RH 3VFTA 4HFUL 4QKXB 3GIVA 3TBYB 1I85C 4LF3B 4XRCB 3SPVA 3GGWB 4W4NA 1TJIL 1J0JA 4WFFD 1BM3L 3DNKA 3IFOB 4NQSA 5C0IA 5E2UL 1FH5L 3V4UH 3O3EB 1K3ZA 4QOKB 5E8EA 5B8CC 1NGWB 4JZOA 2A6KA 2YPLD 3O8XD 5DR5L 5HI4D 1JN6B 1E0OB 4FQXB 3IF1B 3K3QA 1DE4A 3WUWB 5JZ7D 1S5HB 2RR3A 1QG3A 1TQBC 3HE7A 3SO3B 4LCIH 4M1GL 3VXUA 2IPKA 4OD2A 5E8OB 5IVZB 5BS0A 3EDJA 3IB4A 2ZOLA 1A0QH 4JY6B 1C12B 2F53B 5E6ID 3LZFH 3SJVD 2EIBA 5I1DA 4NBYB 1NLBH 5L8KB 5IHUL 5GRVK 5ADPL 1N5AB 5GS0D 5EU3B 3VRJA 1TENA 4KDTC 4R90L 2QSCH 3QWOB 2BRRH 4EUPG 2A83A 3B3IB 4N8CL 3CK0L 1UZ6F 4PJGB 3H9YA 4P5TA 3EDKA 1FNAA 1KJVB 2J6EL 1KUMA 2P43B 1MFEL 3GMLA 3R1GH 5C0CE 4FTVE 1ACZA 4KAQL 3RVTC 6FABH 1NUNB 4Q6YA 4PLNC 4HUWA 1H8NA 3V8CA 4NC0B 3QDGD 3ARGA 3DOSA 4YXKL 2I5YL 3GJFK 1QSEE 2V9TA 1AXSB 2AJVH 4YNYB 4CVZB 1U58B 3NCJH 1CFTA 5J11B 2YUWA 1KB5B 5D5MA 4M62H 3UTSB 5DGRA 1GGCL 3O6FC 3ZE1F 3VGEA 4Y5VA 4GW5B 1C08A 1F4YL 3MBED 2QQKL 5JXAH 4FXGA 2G5BB 5CCKH 1S7TA 4I5BA 1T0MA 2EKJA 5IUSA 4O58H 2BHZA 4PG9A 4BQ8A 5B3JE 3UTTA 1QRNB 2K3TA 1UJ3C 1T1XB 4NKOA 4NYLB 1NCDL 5EB9A 5F1NB 5I75C 3OKLB 2VNCA 4C59B 4M6NH 3L3JA 5HD8D 3IKKA 1QO3A 3CFJB 1L7TL 4PPTA 3X11B 4LMQE 3TBWB 4PJCB 1BWMA 2RB8A 4C56D 4XPAH 5DVKA 4ODVL 1A6AA 3OF6A 3I6LE 4P4RB 3VI3F 3BWAB 1PSKH 5KOVC 5KW9H 2DLFL 4PP2B 1ZS8B 2C4XA 4I0PB 2UY6A 1MFDH 1MCLA 4IMLB 5BQ7B 2DI8A 3IFLH 1FVCA 3IKCB 1P53A 3C08L 1DSFH 2QADD 1KCVL 1JFQL 4E0RB 4LCWD 2ATPA 4FQIH 1DZBA 4PGBA 5KVEH 4X6FA 2D0GA 3V9FA 4WUUD 3ARBD 7FABL 5B39A 1G7JA 5I19L 3VXRA 4M4PA 3KWWB 1I4FA 4PRIB 2GIYA 1HH6B 4JZJC 1RURL 1JNLL 2HRLA 1FO0H 4P2OB 3PG2A 5HYSG 4PTUB 1I1AD 3TYGL 1UWGL 3NFPB 3ZKQD 4AIOA 4Z18A 4I4WB 2OMBA 3T0XA 2XNAB 1FN4B 2R0ZH 1MHCA 3MRFB 3KPTA 2RQ8A 1P4IH 3BH9A 3SEPA 4N0CC 3GJFB 5BOZG 5E5MA 5CZVH 3EO9L 4NN7C 3O0RL 5FGSA 2ZUYA 2CKBA 4NM8L 1U8LB 2D0FA 2GUOB 4NQED 4PJEB 4YHYC 3CSBA 1T04A 4OGYH 3ULVF 4LLVB 4NZRH 1XGUA 4CN6A 2OP4L 3GHEH 4Y4FC 3VXQA 2LVCA 3BVNB 5ESQB 3CZFA 5FUZH 1I9IH 4KUCF 2F53E 5BOPA 3EYQC 2C4FU 2XPGB 4AZ8A 2XRAL 4DFIA 2EDLA 3JTSB 4HZLA 5LGHL 1M7IA 3ARUA 5SWSD 5D8JH 1XCQA 4JKPH 1NQBA 4ZTPL 2BSSB 5KS9A 1TZIB 1UQSB 4NKMB 1PKOA 2ATKA 3PGDB 1QRKA 4HLZH 5INDA 1A6WH 4JN1L 3LRSB 1LVEA 4Q6IC 4U1SA 4PJGE 1F8TH 1K4DA 4ZUVA 5MENB 3VMPA 4NPYB 5IB4A 2GJ6B 2GEEA 1DEEB 5D93B 3LKNB 3V4VH 4YGAB 4JVWA 3IDGB 1YEIH 5CEYB 2WWKT 3EFDH 1HHGB 4NQDA 3JV6B 3AC0A 1ZEAL 4ETQA 3DYMA 4EUPA 5IR1A 3KVQA 1M05B 1DQJA 3ME0A 1YDPA 4H25A 5IK3B 4AIZA 5JW4N 2CRYA 5D7IB 3CU1A 3CUPA 2D2OA 1B9ZA 1JHTB 5KAQG 3EJZD 1YEHH 1YEEL 4OFYD 2ZUSA 4ZUWA 4UINL 2XA3A 2UWEA 3UTSE 1FL6A 5HVFB 4N90D 5ESVA 5FB8A 4AEHH 5D7LD 4L5FL 4F33B 1J8HA 3CLFL 1YYLH 5IMLB 3P4OA 4KKCD 1MFAL 3GMPA 5FOJA 5C0RH 1BQHG 1QRNE 2R1XA 3NIFF 3VRLF 3FT4A 4CU6A 3SQBA 1R0AL 4PJ8D 4L29A 5CMAA 2E7LC 4ENEC 1GHFL 4XX1G 2X4UA 3I2CL 1LO0L 2NLJA 3U0WL 4PJCE 5HBBA 4ERSL 2DAVA 5IVXA 3O9WC 3C8DA 3QUXB 1I7TA 1D5BB 5DVNA 3K8KA 1KFAL 4UV7H 2WWMC 4BZ2L 3SQOL 3HPJB 4PJHF 4GH7B 1KJ2A 3EDDA 2FX8L 1X5YA 1BJ8A 4P2CG 3HMWH 4POZC 1MJUH 1RUKH 3OGCB 3JWNC 2ZCHH 4IMKC 4NN6B 1F4WH 3GMQA 1A22B 5IEHB 4X7TB 1QFUH 2R9HD 4X9IA 2CO7B 4PRIE 4QHLB 4BH7B 1RUMH 3QO1B 4V2BA 3WJLA 1T3FB 2KZ1B 2C3WA 1ZHKA 3P40A 5C7XH 4LVEA 3T2PA 2BZDA 3WBDA 3WXWL 5C9JB 1OW0A 1ITBB 4XAWL 1AC0A 2SEBA 2JJTA 1JV5A 1KB5H 5LCVL 1TVBA 3L3IB 4A6YA 4HWEL 3IXAA 5DUPL 5IB2B 3QA3B 5I8KH 3DARA 4P48A 4I1NB 1OGTA 5HYSA 1A14L 4JFXA 4W68A 4X99B 3G5VB 1JNJA 1NBZB 4PJEE 4KMLB 2E7HA 1CXIA 1JHLL 1ZHNB 5J11C 1ED3A 1FZMA 4BSWB 1FZOB 4DVBA 3MGTB 3T0DA 1LP9B 1CL7H 3QDMD 1L0XA 1FZKA 3RP1A 4ZOCA 2VC2L 5C6TH 2R4RH 2AGJH 5JQ6L 5EZJA 1D5IL 4H26B 1IL1B 1AD9B 3VWJA 1MF2H 2Y36L 4NCC1 4C83B 2JJUA 1C5DB 1QFPA 5IB1B 1MSPA 4YFEA 1OWRM 3WFDH 4U1HA 1OQOA 4E5XA 1OL0A 3P9LB 4XXDA 4C54A 4IHOA 1QKZL 5MENE 1D7FA 3IDIB 3WFZA 3HUJB 3VH8G 4Y4KD 4J3WA 1YEGL 5D2NE 4QOKD 1I1CA 4ODWB 5IMOA 2HJFA 4FQXD 3AS2A 3RIFF 2AJSL 4K71B 4HV8A 2EH8H 1VFOA 3DX7A 5BZDA 5JPNA 3IGAB 4Y8DC 3BPCB 3DGCR 5DEFB 5L6YH 1T0NB 2ZCLL 1KB9K 5L7XH 4OCLC 1KACB 1LDPL 4HCRA 2MMXA 5FF6B 3N1MC 5KVMC 3L7EB 3MR9A 5D7IE 3VD7A 4RIRA 4I0PC 4OF6A 5DD6A 3D39D 3MV7B 3QT2A 3PXHA 1RFDH 2PXYA 3V6OE 1PW3A 1A7NH 5CD5D 1SQ2N 1HN1A 5BV7B 1NC2B 4KJYB 4M9PA 3W9EB 1KCKA 1UM5H 3IJYA 1CTNA 1A7RL 3QCUH 1F2XK 1S7UB 3HE6A 2PO6A 3IFNH 4XAKE 2QQLL 3GJFH 4M5ZL 4NQXA 2XV6B 3QXAA 1RZ7L 4O9HH 3U4EB 1RVFH 1ODAA 4DUXA 3CDCA 1SBSL 4W70A 5BRZA 5J3HD 2V2TA 1A4JA 2CUIA 4PJIA 4WENB 3UTPD 5KVFL 5T3XD 1HI6A 3MMEB 5IQ9B 3RUGB 2DQHH 5SX4H 2OJEB 1OAUH 4KHXH 4NSKB 3UJTL 3VFTB 1NJ9B 1BQHA 3TCLA 2KDGA 5E24E 3GIVB 5AG8A 4YX2L 2ZG3A 3SPVB 3KPPA 3U48A 1IC4L 4G3YH 5GGVY 3RHWF 4NQSB 5CHNA 2HP4A 1JHKH 3PABA 4KKBD 5C09D 3KLHD 1TFHA 2VIRA 4HC1A 1HSBB 1QYGL 3NFSH 4KH2A 5B38G 3VXUB 2EDOA 1YPZB 2IPKB 4OD2B 4FN0A 5BS0B 1R5VA 4IRSB 3HG1D 3TA3A 3FO0H 4WEBL 4PJDA 2X44D 4HS3A 2ICWA 1Q1JL 2ICWJ 5D93C 4G9FA 2YRLA 4MQ7A 2APBA 5D2NC 2ILLA 4P2QB 2NY3B 5C1MB 3VRJB 4JLRB 3IS0X 2BXZA 5I73B 3GM8A 4JO4H 1XGPA 5HGAA 3QYCA 3BN9C 5D1XC 5L9DL 2VDNH 5E2WH 1KF9B 3CSYA 1E4KC 3Q6FA 3TIEA 3GMLB 3BMVA 1GZQA 2R39A 3RWJA 3QPXL 1CFNA 2EDFA 4ZUSA 4QRRA 4LFHG 1LP9E 3ZDZF 3VA6A 1DDHA 3EZJB 2Y25A 4JZJA 1MRFL 4OUUA 1XH3A 3TC9A 1Z6JT 3QP3A 3WHE1 1CFTB 4ALAL 1DR9A 4XHQA 5D5MB 5E8NB 2DN7A 4ONGL 3HUJE 3RY6A 3U7WH 4FNLL 3KLSA 1MIEL 2MJWA 4Y5VB 4HK0A 4OLVL 2VL5A 5HI3C 1S7TB 3MUHL 1AHWA 8FABB 1MAKA 1MLBA 2P5WE 1LO4L 4PG9B 1EVTC 2ZUXA 1OSPL 1UG9A 5I0DA 1RU9L 3VH8A 1CFQA 5H37G 4MHHI 2C26A 4NKOB 4XC3L 3QIWA 3KS0H 3MV7E 1QO3B 4LRIA 2J4WL 4LMQI 4HF5H 1AI1L 1IGCL 4M9OA 4D3CH 2OTUA 5T33H 2CDFA 1MIML 2KPNA 3GMMA 3D69B 4Q6IA 4XBPA 3FN3A 3U2SA 2R1YB 1OD9A 3QHTC 4S1RH 4LDLB 2XQBL 4JPIA 5LGKA 2V7NA 3ILQD 1Q9OA 1FVCB 3EGSB 2CIKB 2GJ6D 2OBGA 3T4YB 2ATPB 4JRYA 4X6FB 4Y2DB 3ARED 1BAFH 5B39B 1G7JB 3TN0B 5I16B 4ELME 1I4FB 3MJ9L 3RUGE 1YJDH 4NM4L 4Y5XA 1JK8A 1EBAA 1V5JA 1NGXA 2NY7H 2VE6B 3A67H 4JREB 5DO2D 1D5XA 1MHCB 1R5IA 4TQEL 4HXBH 1BJ1H 5E08L 3L3OA 1CDBA 3BH9B 2VAAB 4WW2C 2HH0L 5EBMB 3HC3L 2AEQH 1YJDC 4MCYA 5A40E 1T04B 1U36A 4Q0XL 3VXUE 1XGUB 3PXJA 1YPZE 5AEAA 5BS0E 4AY0A 1FGNH 1KN2L 2IFFH 2IPUK 1RJZB 2R4SH 4JO3L 1WBZB 2AKRA 3RPIA 2BVOA 2FSEA 3CZFB 5ISZE 2E7LA 4WI8A 5DJDA 4PGZA 1AY1L 4HZLB 5F8RC 3ZDXF 1M7IB 4P2QE 1JWUA 3RWIB 5B38A 5KS9B 1FCGA 4HKJB 2BVTA 3GHBH 2ATKB 4K71C 5BV7H 2F5BL 3MOBH 3EYSH 3QUXD 4U1SB 4Q9QL 4JJ5A 3V5HB 4WWKD 3S5LB 2G60L 1F6LL 1GGIL 4DAGH 5LBSL 4M6ML 3FO9A 4L3AA 2FATH 4EUPB 3NABL 1KJ2L 1KPUA 3TBSA 5CZXD 1A9BA 2BNRA 1DQJB 1YDPB 4H25B 1I75A 5ETUA 5EUKA 3MRPB 3CPLA 4AIZB 4KQ3H 4YIQA 3CVHA 4FFVC 1UM4L 2D7NA 3CUPB 1OOAA 1IGMH 5D5ME 4JKMA 4PV9A 3W0WA 4DN4L 1ACYH 4ZUWB 1DQLL 1X5LA 1JYWA 1FL6B 5EN2A 1NDMA 5K93A 3MFFA 1QLEH 5ESVB 4OI7A 2BY1A 5KANG 3THMH 1AR2A 4OM1L 5EOCJ 1UCTA 2DQCL 4WCYL 3LDBB 1J8HB 3HA0A 4JEGB 3FB7A 3P4OB 1JYXA 1RUPH 3W2DL 1RHFA 1CL7I 1WCBA 2AXGA 3VJ6B 2R1XB 3DRQA 3FT4B 4YDIH 4EOWH 1MNUH 1P84K 4L29B 5CMAB 2Y07H 2FRGP 3BW9A 4PJ7A 4FFZH 2X4UB 3BJLA 3H3PL 3QIUD 3EOTL 5IVXB 5FM5O 1AE6L 3S36H 1NFDF 3J7HA 4YPGB 1EXUA 2X05A 3TJHD 1I7TB 4PP1C 3TT3L 4IIQA 1J1PH 5HHPA 4PBWD 3WDHA 3P9MA 1A6ZA 4JM2C 5I1CH 4IRSC 2NY1D 1D6VH 4O00A 2P42B 1T1ZA 1HWHB 1OGAE 5DQDH 2Q76A 3K2UL 3ZHKA 3GMQB 3MXWH 1FHGA 3OQ3B 4GMTH 2VXTH 4J6RL 4APQC 4ZNEA 1CFVH 5I73C 3O4LA 3QFJB 3C5ZA 5A16A 5EORL 3LQMA 1IFHH 3OL2A 3F7VA 3V4UL 3GFUA 4HCRL 1K6QH 9CGTA 2WMPA 2SEBB 3V52H 4M6OH 3HMXH 1G9MH 3DHJA 1CXLA 4A6YB 5KSBA 4HLJA 4K94C 1OGTB 4WEUD 5HYSB 3HTLX 2AEWA 2Z31A 5LWYL 1S9WB 5D72H 1WV7T 3LZFL 2A9NL 4XTRD 4KDWA 1ED3B 1U3HA 2MQ0A 1G9MC 3H9HA 4DVBB 5IQ7H 2PETA 2JIXA 1FZKB 4QLRA 2QSCL 5ECJE 35C8H 5E4EC 2BRRL 5F44A 4PS4H 5JW3H 1ITCA 3IYLW 1JPST 5DF0A 5EZJB 5DRZA 3JWOC 5KS9E 2AJYL 3MRQA 4UB0L 2EXYD 1BQSA 3VWJB 4KZDL 5LVEA 1J87A 2UUDK 4U1HB 5C0AB 2B0SH 4XXDB 4IHOB 6FABL 2HT3D 1B3JA 3QDHA 4LHJB 3SDDC 2UYLA 3MCLH 2WQ8A 3QBTB 5ABDE 5IJKC 4CVUA 1U8PB 5TPWH 1D9KA 4K8RH 4DZBA 2NR6D 3NOIA 3OXRA 4U1MB 4W81A 2A2QT 3DX7B 5JPNB 4XZUB 2AJVL 3NBNA 3EJYD 3ZHDA 3HE7D 1UB5A 4N9OB 1QFWM 3VWKC 3EFFA 4PG2C 5DD6B 3KYKH 3QDJA 4PGDA 2DQJL 4K8RC 5KG9A 5JXAL 5JW4M 2NY3D 3KPSD 5HDOA 5CCKL 4Y2DC 1EAJA 4K23L 4P2YA 4MQXC 3BPLB 3TN0C 4O58L 2PO6B 1J8HE 2FEDC 4P5TD 1RK0A 4YBQC 4NQXB 5H2BA 5BJTA 4RAVA 1HHIA 4M6NL 1ZA3A 2LFGA 3BZDA 5IBLC 4L4VA 3TV3L 4PY8I 3MA9L 1WWBX 5BRZB 2V2TB 3ARGD 1A4JB 4PJIB 4YEFA 1C16B 3FAWA 1U0QA 1MFDL 1MVUA 5IVXE 1BQHB 3TCLB 2DKMA 4X6EB 5MEOA 5DD1H 3IFLL 1DSFL 5DURB 1FE8H 3UO1H 4Y88A 3RTQA 1CI5A 4FQIL 4V2CB 4PLKC 5CHNB 1CGXA 5DUBA 3PABB 1OARH 5LAXA 3WNMA 5EDXA 2W9EH 3SE9L 1X5JA 4NO5A 4ZFGH 3GKWH 1N6QH 3V0WL 4N0UE 1UYWL 1EEUA 3QFJE 3RVUD 4EUPH 1RZ8A 1R5VB 4PRHA 3UTTD 3SOBH 1QPPA 4YLQT 1SM3L 4JO2L 2R0ZL 4YFLI 4PJDB 4HS3B 2ICWB 4OLUH 4CAGA 1P4IL 5TDOA 5KN5B 4MQ7B 2NY5H 1DANT 3TEUA 3VDCA 3NIGF 5IKCB 3OF6D 4LCYA 1XGPB 3C60C 5I1IH 2IC2A 1IGFL 1MCBA 5I6XC 3O4OB 1V7MH 4HK3N 5IROC 3KS0J 3S34L 4BUGA 2ICEA 2F19H 2GK2A 5D7KD 4JFZH 3CSYB 3Q6FB 5JOFA 2CUHA 5FUZL 4UT6L 1I9IL 5FYJE 1GZQB 3CSPA 3C2SA 2ZUUA 1HYRC 3T4AA 1D6EB 5DZNA 1BZ9A 2XKNB 2FECI 3TBVB 2VLLB 2NY5C 4ZUSB 4KKLC 5D8JL 2IG2H 3IAGC 1ZWIA 4L4TB 3VXRD 4OUUB 1UA6L 4FFYH 3Q5YA 1ORQB 5I2IB 4M93B 4V1DE 3BP5B 3IXTB 4HS6B 5D7JB 3T0EE 5F1IA 5GRYA 5ELIA 3TO4A 3CDYA 3W9DB 5C0AE 1YEIL 4RZCA 3EFDL 5INCA 5A2IH 3D48R 5C0NC 4GKNA 2DWDB 3VDBA 3CH8A 4HUMB 1U41A 4HK0B 4HGMA 5CGYC 5GRUH 1SY6H 2B39A 4GRMA 4XMLH 3VFUA 2VL5B 4O5LH 4JO1H 3VI4F 4GJTB 4HH8A 2C1PA 1MLBB 4OB5H 4QCIA 4R6UA 2BSRA 1GGUA 1M7DB 1N2RB 1Q9KB 3CFBA 5IWLA 2CUMA 3QIWB 4F9PA 4NQVA 2XTJB 1AIFA 1BVLA 4N0RA 1CR9L 3PDOB 5CD3A 5ID1A 1T20B 2OTUB 3LAFA 1I9EA 2CDFB 2EKSA 3RDTC 3GMMB 1YYLL 1XCTA 2PYEE 1I8LC 2ARJQ 4FQ2H 4XXCC 4Z6AT 5CJ8A 2Y6SD 4XBPB 3F65A 4OZIF 3X13A 2AV7B 3JTTB 4JPIB 3AB0C 3UBXG 2V7NB 1XF4A 3G9VA 3UEZA 1Q9OB 4F7MA 5F88B 1AO7D 4XPGL 2R0KH 4KK9D 4NCC2 5FYJH 1R6VA 2HKHL 1VEPA 1GGBL 4NQDD 4ZOEA 5BRZE 4PJIE 2CRMA 1EO5A 4CJ0A 2VN7A 3PHSA 1LK2B 1MCHA 4U1IA 4UV7L 5F3HA 5FGBC 2BSTA 5EU7E 1U91B 4NP4H 3GSWA 4HS8L 3HMWL 1MJUL 1RUKL 1RZGA 3L3OB 3RJQB 4WI9A 3V0VA 4PJFA 2GTZB 4MCYB 2NX5A 2Y72A 5EOCL 4YXHH 4BFIA 5HYEA 4GSDH 4NJAH 4YHLH 3T2NH 4YXLL 1A7OL 1WC7A 4HWBH 3PQYA 3T0EC 1QLFB 2AKRB 2QL1A 2FSEB 1MQKH 4QHKJ 1TTUA 5DJDB 4PJDE 5KVGH 5AZEH 1EJ6A 4RCAA 4JFEA 2AXFA 2OCFD 5I8KL 1PFCA 2F15A 3UTZB 2DKUA 5B38B 4Q9RH 3CXHJ 1CE6B 4OCWH 4AQOA 1MLCA 2XWTA 3VDAA 4JJ5B 4OZ4B 4FA8A 4J3XA 1F90H 4KTYA 3UJIH 2EO1A 1AGCA 3QNXA 1CE1H 2FGZA 4EI5C 2A9MH 2HRPL 1WUNT 5C6TL 2R4RL 3FO9B 4EI6B 2DLIA 2YXFA 1PY4A 3TBSB 4L4TE 1MF2L 1A9BB 4KY1H 2BNRB 1IJ9A 1KV3A 1KB9J 1N8ZA 2D3VA 5ETUB 3BPLC 5ILTH 3CPLB 4UT9H 3WFDL 4YIQB 1BQLH 2OTWA 5JA8B 3QZWG 1WICA 4GFTB 5CP3A 4XNQA 1JBJA 3W0WB 5J8OA 3SKJH 4Z7WA 1NDMB 3LD8C 3MFFB 1VCAA 4YPJA 1MPAL 1UJTA 5GRVL 3W82A 2NTFA 1P4BH 1BBDH 1I8MA 2H2PD 1FP5A 5L7XL 3ZMRA 4U7MA 4LGSB 1IMHC 3FB7B 3QQ3A 3AROA 3UAJD 3BFOA 5KBNC 2MQ3A 3QIBC 4ZDHB 4C55A 1WCBB 2AXGB 3LKQA 1N7MH 1A7NL 4XWOC 4AL8L 5EU7C 3BE1L 2UUDH 2PW2B 3KYMA 3BW9B 4PJ7B 5EIQA 1DQTA 1MUJB 5IEKA 3IFNL 5F8QC 1F4HA 3R8BB 4BSJA 3GSXA 1EXUB 4O9HL 3OMZA 5TQ2H 4H1LG 4F8TA 1IAMA 3P9MB 3QEHA 4I9WE 1RVFL 3MNWB 2P1YA 4HX1A 2CLRA 4IRZH 4RX4A 5IG7A 5F72S 1EFXB 3AFLA 4JANA 2Q76B 4RAHA 2IALA 1T5WB 3LEXA 5JHDB 1OAUL 4KHXL 4ONOA 3UBXA 3DV6A 4ODSL 4K9EH 1YQVH 3C5ZB 4ODUA 4WHTA 1YNLH 3O4OC 1CTOA 3KYOA 4P99A 5A16B 3WLBA 4G3YL 3VFGH 5DMKA 1MCIA 4LOUD 5DD5H 2XFXB 1JHKL 1DANU 2PXYD 1FGVH 3OKOA 4Y89A 3TWCH 1HDMA 4MA3A 2CXGA 1AFVH 4LBEA 4K9EC 3NFSL 3WL9A 1VGEH 2MPAL 5DHYA 3NCYP 3HE6D 4JDVA 2PO6D 4UIKH 5ENWA 4X0KB 5CILH 4M93C 4K7PH 1J5OH 4NDMB 4OCSL 4ZD3H 5DJCB 3FT2A 5D7JC 1KJMA 2NYYC 1R3LA 3ARFB 1GOHA 3H9HB 1XAUA 1YY9D 4EN3C 5CFHA 2H2SC 3GI9H 1DEDA 1JNHA 5HSFA 4JO4L 5IIEA 4OBSA 1I9RH 5DRZB 5T3ZL 2VDNL 5E2WL 5AD0A 3NPSB 4L9DA 4RWYH 3EOBA 2CLVA 2BRQA 4PV8A 1QR1A 4P5KA 5FM5M 5DURD 2ZSVA 1AXIB 1FAKT 1T2XA 4JRXA 4TNVF 4X5XA 4DVRL 1E27B 2VDLH 3C5JA 4LSUH 2EDDA 3LKPB 4G42B 4NNYB 2VWEE 4DZBB 1KLUB 4NNXA 3OXRB 4Y4HB 4FQLL 2FIKA 1JPFB 2FBJH 1CT8A 4KPHL 4U1KA 4H20H 1II4E 2X41A 1ZSDA 4QYOA 4X6CA 4TRPH 3R0MA 3TA3D 1S9KC 3EFFB 1RHHA 3DMMC 1DVFC 3U7WL 1AGDA 3KPQA 4PGDB 3W0WE 2VL4A 4G9FD 4LCUB 4GUPA 1JRHH 2ZCKH 3PGFH 3VGDA 4OV5B 3PWNA 1OAKH 1ONQB 3QZWA 5L0QC 1U8JB 1RK0B 3NACL 1KCRH 4L3CA 1WGOA 2IBZY 5H2BB 4MCZA 1P7QA 4RAVB 4R97B 1HHIB 1ZA3B 4FQQA 4PJ9A 4L4VB 1LHZA 2BDNL 2I27N 5D4QA 5D6CA 3QNZA 4D3CL 1XMWA 4QRRD 5T33L 2IBBA 4PJXA 2PUQT 1EHXA 3VXQB 4C58B 5IFJA 3S88L 2YD1A 1PX4A 1IBGL 5DUMH 2UWEF 2ADJB 1MVUB 1VACA 5MEOB 1JWSB 1LQSR 3P4LA 2A6DA 4DQOL 3O2WL 1JZ8A 3RTQB 4AMKH 3U0TA 5DUBB 1BAFL 2FECL 4HFWB 1JPGA 4PYHA 5LAXB 2HG5A 1BFSA 1RUAL 4GAGH 2J8OA 3KJ6H 2EDKA 4XPFH 1I1FA 5CJBA 2JK5A 4R7DA 1TVHB 3V8OA 5JHDE 1YJDL 5CEZL 4H1LA 4EXKA 4Y4FD 4Y5YC 1YUHA 3MODL 1DL7H 1RZ8B 4PRHB 2IAMA 3QR2A 3MOQA 2VR9A 1BREA 3A67L 3QIWD 5GS3A 4OLXH 3ZE0F 2XTJD 4Y16B 5TDOB 3RDTA 1Z9SA 4OM0H 1KTRL 4MJID 3WNOA 2J8UA 3LB6C 1RZKH 2VWEC 3RL2B 4LCYB 4G6MH 4R96B 1ZOXA 4XNMA 1YY8B 3CH1B 1FGNL 2IFFL 2R4SL 5DMJB 5JOFB 1INQA 5TE6L 1OP5K 4P4KC 3LEVH 5FYKD 3T4AB 5EU5A 1HILA 2RJMA 3LRGA 4YBLB 5AZ2L 3IDYB 1RZKC 4JRYD 1T7VA 3OJDA 4J2XA 1L6XA 1ZWIB 3GHBL 3H9SA 5L8LB 4KK5C 3UZVB 1T1WB 5EO1A 4KWUA 3WN5A 5KSAA 3FQNB 4XB8A 4KRNA 5F1IB 2DM7A 3MRKA 4YC2C 3ECBA 2FIRT 1FQ9C 4RZCB 2YN5A 4HUVB 5INCB 3U82B 1JYVA 3BMWA 4GKNB 2DQGH 4RMRA 2BHYA 4K3HA 3WMSA 3QUYC 2DM3A 4YHIB 4LSPH 4GRMB 3F6LA 4H0HB 3GSOA 2BOBB 3I50L 2C1PB 2OZ4A 4K3DH 4M5YH 3QUMB 4KQ3L 4QCIB 4LLUB 2BSRB 4PJAF 5CJOL 5GJSH 1WAAA 3BAEH 3CFBB 3BQUB 1HCVA 2YA2A 4XP1H 5GGVH 4BK5A 1AIFB 2JELH 1QLEL 1BVLB 2VQ1A 2XOTA 1T2JA 3W11C 4DUWA 3KPRA 4UIMA 2PTTA 4WU7A 2R1WB 2EKSB 4J4PA 3DX8A 1XCTB 5I1GL 4J7RA 4GRLC 1K8IA 1U8HA 1RUPL 2VQTA 4GOSA 4TSCL 3EIFA 4XC1H 3X13B 4D0DA 4ZSOB 2WWMD 4EI5A 1XF4B 1EPFA 3Q5TA 4EOWL 1MNUL 4F7MB 1CD1A 3ZDYF 4POZD 1N3NA 3H7BB 2IBZX 4FFZL 1O7SA 3GSNH 4XCFL 1WWCA 3G08B 4XBGA 1LD9B 1BWWA 1NCWH 4NQTA 2AJUL 4XCEB 3S36L 4Z7NE 2BNRD 3DUUA 3GBNH 4DKFH 4AEFA 5EU4B 2OR9H 1CD0A 4JQXC 1U8QA 4ONFH 2QV2A 2BOCA 4U1IB 5F3HB 2BSTB 5J6GA 4QXUH 4S10A 4LFHD 2ZOKA 2O5XL 3GSWB 3MLUL 5K9OA 2PCPA 2VLJB 5DQDL 3ARFC 3W39B 3MXWL 1FORH 2VUYA 5FHAH 1KPRA 4GMTL 2VXTL 4TVPE 5C71A 3PF2A 4LDOB 1GAFH 4PJFB 3QRFM 2NTSP 3QIBA 4K94L 2HJLB 5GGQH 2WANA 1IFHL 4OCXL 2VLKB 3X14A 4PRHE 1CIUA 1K6QL 3IRPX 1VFUA 4JFDA 3NZ8A 3V52L 3HMXL 1G9ML 4D9QE 4NKIH 2FJFB 2ESVD 4JFEB 3U36A 2C9AA 2BERA 1NCUA 4PJ5D 5HHQB 1IE5A 3V5DB 1SVZA 3D3VA 4NUGH 4OZHA 3JWOL 1U2HA 2VZUA 2XWTB 5D72L 5DT1H 4OLWH 4ETYA 5D2LA 1KPVA 4WJ5A 4M7JH 2BJMH 3QNXB 5IQ7L 5GGTA 4ZNCD 35C8L 4K3GA 2VKXA 4PS4L 3UPAA 3K0WA 4WY7H 3GSVA 4WTWA 2ERJC 3L3GB 1YC7A 3ARYA 1NFKA 4R0LA 5I66A 3O4LD 4LIQL 1N8ZB 3C5ZD 5F1SA 2OTWB 5HY9B 3BH8B 2OXGA 2ADFH 3MCLL 4MLSA 3SY0B 2X4PA 2EEDA 4Z7WB 1JNNH 5TPWL 2VITA 5GISL 3V7AE 2NTFB 1I8MB 1X6LA 1MREL 1DLFL 5HHOA 1XF2B 4DKEH 2W9DL 2OM5A 5ANMA 4TVPH 2Z31D 3MA7A 3MV8E 5JOPE 1DN0A 3QCTH 4K2UH 3SCMC 2V9QA 3BYTA 3LKQB 5MEPB 3PWPD 1U3HD 4OFIA 3KYMB 1N4XH 2JIXD 2EIEA 3DPBA 4ODTH 5F21B 1G1YA 5GS2H 2LVEA 4XVTH 4S0TD 2YUZA 4IOSD 3GSXB 2B8OT 3BO8A 2BNQD 3DYPA 4X8JA 1KEGH 2AJZA 2I9TB 3GIZH 3KPLA 4ZSOE 3QEHB 1VFAA 1XEDA 1F13A 2CLRB 3BYYA 3D18A 4Y16C 2C3VA 5IG7B 3OG4B 3FMGH 2H41A 1EEYA 5KVDH 1D9KD 2IALB 3LEXB 4QXTB 4Q97A 4RQQA 3DX9A 3UBXB 3P3YA 2WZPD 3KHOA 5DD1L 5J12B 4ODUB 4WHTB 1FE8L 3O2VH 1DVFA 5GGRY 3UO1L 3WLBB 1W72A 3RQ3A 2AQ2A 4DUVA 4F7EA 5D6DC 1JTTA 3C6LA 1OARL 3QJHA 1JRHI 1MFCH 3L5WA 1KCUH 2VTFA 3QDJD 5B3JF 2YD9A 3U46B 4YBLC 2VLJE 3IDYC 4MA3B 2W9EL 4G8EB 4K55A 4UOW1 3ZKXB 3GKWL 5T1KD 1N6QL 3QEUB 4GLRH 4CBPA 5GS1C 4DW2H 4JDVB 4PJFE 3LRHA 3SOBL 5ENWB 1NUDA 1PX3A 3I9GL 3MXVL 2VLKE 1H3PH 5D96B 3FT2B 4JR9H 4OLUL 1PG7H 5D71L 3QUMH 2CDGA 1R3LB 2KH2B 3LCYA 4L4VD 2R2BA 2BMKA 2GITA 4OGZA 2A0LC 5EC1A 2NY5L 2C1OA 4F58H 5T3ZD 2YK1L 4UTAH 4XP9H 1RZIB 5I1IL 1NMBH 3AY4C 4JFEE 1JCKA 2OTPA 3DX6A 2DBLH 3HFML 5JXEC 4NNPH 3WUZA 1TPXB 3AMLA 1BD2A 3MRJB 4HAGA 1QR1B 3AS0A 3L6FB 2HYMA 4JRXB 3FFDA 1A1NB 3BQUC 1RIVL 4X5XB 2AEIT 3MLTB 2IG2L 3V79C 5A43C 5HI3D 4EDWH 1PVHA 4FFYL 3O2DH 4XGZA 4NNXB 2FIKB 4KJQC 2GTWA 3SGEH 1CT8B 1ADQH 4MJ5A 1ZSDB 4QYOB 4X6CB 1KC5H 1XGRA 4RMSA 5EUOB 4ORZC 1ORSA 4UDTB 1A8JH 5I8CA 2VXVH 3HI1A 1RHHB 1T89C 4KK8C 3S35H 1OP5H 1B4JH 1EO8L 32C2A 1WFNA 1SY6L 4XMLL 4G80A 4GUPB 4JO1L 3GM0A 2H3NB 4Z8FH 4OB5L 3LKRA 3M8OH 1RMFH 3PWNB 2L0DA 3QXWA 3FZUC 3QZWB 5F9WB 4L3CB 2LU4A 4HJJL 2JJSC 4MCZB 4E9LA 1P7QB 2R2EA 1ZV5A 3EYFB 4FQQB 3HNTL 2AK4A 4L8SA 4PJ9B 3UZQA 3UX9B 1WFUA 5D6CB 1AGFA 2VLME 3QNZB 3IDJB 4RFNC 5JDJA 1G7HB 1IGIH 2VERN 3TESA 4M00A 4PJXB 4FQ2L 5CEXA 1GJIA 3RNKA 5IFJB 2OXHA 1REIA 4BH8A 4YBHA 5HVHB 1LE5A 3CFCH 4U05A 3BP7A 3B6SA 1NGZA 1VACB 4JG1H 3P4MB 4RGMC 3HC4H 2A6DB 2F58H 1NEZG 3TO4D 2XT1B 2DL2A 4BFEA 3U0TB 3LPGA 3BDBA 3GNMH 5FYJL 4K3JL 1WWWX 4HEPG 4D9RD 4KHTL 2R69H 1JPGB 2HG5B 1OLLA 3G6DH 1VADB 3W81A 2X4QB 1I1FB 2XZZA 2JK5B 4R7DB 4UU9B 3KNBA 5EOTB 4R4NC 3RBSA 5JHLH 4PRPA 5C9KA 3LOWA 4MAYA 3CC5A 4NP4L 1J11A 1I7ZA 4HJGB 4HBQA 3LH2H 4PBVC 4PD4K 4GAJL 1NDGA 4HPOH 3CFKB 3RWGB 4OTXL 2P8PA 3A6BH 4YHLL 4NJAL 4FG6C 1WF5A 3QDAA 3T2NL 4HWBL 2Z92A 3MJGX 1ZT1A 1INQB 1MQKL 3DVNA 3D1MC 4I18A 4OI9A 2P8MA 1LO2H 1SJEB 5KVGL 1KG0A 5EU5B 1O5DT 1EEZA 1HILB 3BGMA 1AQDA 4MD4A 2FBOJ 3EOYG 4UV4H 3OJDB 3MROA 4JDTH 3ES6A 4Q9RL 4TN9A 4HPYH 1ZHLA 3H9SB 2IH3A 4OCWL 1E6OH 4MNGA 3ZTJH 4JKLA 3LN5B 2I9LB 3T8XB 2HT4D 4I13B 5KSAB 4MAUH 1F90L 4HKXA 3MRKB 3O3BB 3RJDA 3SE3C 5SWZA 3ECBB 1FLRH 1BJMA 2G75A 4YHZH 4JRXE 1VKXB 1XF5A 1PZ5A 3MPCA 4YHOH 4G7VL 2NXYC 1Y18A 5DK0A 3VGBA 1MRCH 3FT3A 1HHHA 1TZGH 2NX5D 1M7XA 1QTYT 2FX7L 5DEZA 4JFOA 2ZUVA 4XP6H 5EWIH 4LCCA 1NMCB 4X6CE 3RIAK 3JZ7A 3PQYD 5EUOE 2EH7L 3QEGH 3B9KC 1A6TA 1PAMA 1XGQA 4M8QA 2VQ1B 4KUZH 3RWHA 3KPRB 1BBDL 3HNVL 4WTXA 2PTTB 4WU7B 1FNGB 2VB5A 2NY2B 2DQIH 4PP1D 4X4MA 3VD3A 4Z76B 5D1QA 1QFWH 1F97A 5D9SB 4D0DB 3UJJH 1KIQA 3QQNA 1KXVC 1V7NH 1HXYB 1CD1B 1AQKH 4DTGH 1CFSA 5M7QA 3WD5L 4U4BA 3HZVA 1ND0B 3BT2H 1CDUA 4U1NA 1Z9LA 3O8XA 4APQD 4XBGB 1P1ZA 2AEPL 4YK4B 2QJDA 1KBGH 5F7DA 3DUHA 4ZO9A 5F7UA 4PJHA 3ZKXC 5E2VH 3BXNB 4PRNA 1G0XA 5TQ2L 3VRIA 1U8QB 3BPNB 5LKNA 3NCEB 2R0WH 5ITBH 5KSVA 1F02I 2W9LA 1B88A 1EEQA 2VDKH 2ZOKB 5A2FA 5D96C 4IRZL 4LP4A 4M4RA 5K9OB 1G7PA 2PCPB 5D7IF 1KPRB 3ARZA 2PN5A 2ITCB 2Z8VC 4K9EL 1YQVL 4JY4A 2WBKA 1E28A 1VDGA 2XWJA 1NEZA 5HDBE 4XNUH 1TPXC 4F15C 5K9QG 3VFGL 3P0VL 2NNAA 2NY0B 3UDWA 2M8XA 4WRLA 4GS7B 3NZ8B 1S9XA 4DCQB 2QBWA 1HOCA 2JJVA 4CKVX 3TWCL 4NN5C 3QULA 1WSST 3VXOA 1NC4B 1UH4A 2JKXA 4BELD 4JPWH 1VGEL 4RDQF 3MOAH 2OS7A 5DFTA 1Q72H 4UIKL 5CIPA 4PREB 5CILL 3FN0H 4KGLA 1LK3L 4K7PL 2D9QB 2N56A 1QBMH 5EZLA 2OK0H 1XGTA 3FB8A 1MJJA 3SDDD 1WISA 5D2LB 1KPVB 3LQAH 4XVJH 4CW1A 4X7SL 4RX4D 3F5WA 1I9RL 2FGWL 5DC4B 1J0ZA 3GSVB 2VR5A 3H9SE 2YMXL 3SDCC 5I66B 3VWKD 5HYJA 1DQDL 3MRCA 3LQAC 1UH3A 4EIZC 2CDEA 1U8NB 1G6RA 2EC8A 3S37X 4LSUL 2YBRB 1W72L 1JP5A 3FB6A 4GLRI 4WU5A 1GOGA 1H5BC 4XCNA 5E9DA 4YFLF 2FBJL 4H20L 5HHOB 2PTUA 4RGND 2B2XH 4WO4C 1X9QA 4QY8B 5HHNA 4TRPL 5FGCB 2W0KA 5L2KB 5HVHC 2UZYB 3MA7B 3BKCH 1DN0B 2V7HA 5DI8A 1A3RL 1WAAE 5MEQA 2QLVB 4U7KA 5GXBB 1H8OA 1YC8A 1FV1A 2YKLH 3AY4A 4LVNC 2GSIA 2WUCH 2APXA 4WUUA 1JRHL 1I7UA 3RWEA 5DD3H 4HG4K 1OAKL 2JCCB 1KCRL 4WI4A 4WW2F 4X8JB 4FP8H 4JFFB 1KIRB 3SGJC 1FYHB 5F97E 1OTTC 1VFAB 4FZ8H 2ENSA 3ARQA 2EZ0C 1T5XB 2ZUTA 2FHFA 3GBMH 3MREA 2C3VB 3RGVA 3SGEI 2FJGA 4BYHA 5DUML 1FAIH 2A6JA 3LEYL 4RQQB 3DX9B 3CX5K 4Y0GA 2CXKA 2B4CH 4JHZA 8CGTA 1I3RA 4IBLT 3VCLA 5FOBA 3HPLA 4AMKL 2O93L 5TFSH 2XY2A 4MX7A 3OZ9H 2LAGB 1KXTB 3D2UA 3QJHB 3L5WB 4FZEL 2BFVH 5GGUB 2R2HB 5FUCE 3MLPA 4AM0A 3RI5K 3C60D 5IESH 2KKQA 4XPFL 3DO7A 3QI9C 4L9LB 4MSWA 1IEHA 3B2UD 3P11L 1QLRB 2B4CC 4G6KH 4LEOA 1X4XA 1F3JA 1DL7L 2JJSA 3IS1X 5KZCB 4YHKH 2CRZA 4P9HC 1P7QD 3HR6A 3HB3D 1HSAA 2CDGB 1V3LA 4OM0L 1W0VB 2BMKB 5HDQH 1RZKL 2DMCA 1NCCH 4O2EA 3NIDE 2AK1H 3E6FA 5FHBH 4OGXL 4G6ML 3DX6B 3M1BB 2WQRA 3WE6A 5BXFA 1BD2B 2CLZA 4JJHA 3MBXL 5ICYB 1U6AH 4ELMF 3RZCA 1T80A 1NMCC 5D2LE 4PRDB 4MXQD 5F7NC 3RUGF 2ZG1A 2VRAA 3DGGB 5CJXA 5IM7B 5L88L 1OAXH 3SE8L 2BC4A 4UBDD 1NFIA 1FPTL 2ZUQC 4XGZB 1P9MA 1RIHH 3ARPA 2GTWB 4JKKA 2XZAH 3CVIL 1AR1C 4MJ5B 2P5EA 4QT5A 1J12A 1XGRB 4CN1A 4CMMA 3BEWA 3DROB 2IAMD 1ORSB 2YZ8A 2Z35B 1JVKA 3CD4A 3HI1B 5IBTH 4FS0A 2DQGL 4MXWH 2QTEA 3H7LA 3RDTD 1F6AA 3SKMA 32C2B 4JM2F 4P59H 4UDUA 4LSPL 5EZIL 1WLHA 1ES0A 4M5YL 3LKRB 3KPMA 4YK4C 5HHOE 3U1SH 2GY7B 5GJSL 3WKNA 3MQIA 4NQCA 4ESKA 4R26H 3DYOA 5FAAA 4ZFOA 5DD0L 2Z4QA 5L2KE 3MACL 5GGVL 3BPNC 1G0YR 2JELL 5DC0A 2AK4B 4L8SB 4I2XA 4D0BA 5K9KA 1AGFB 3TZVB 3FN9A 4U3CA 5FUCC 3WLWD 2DQDH 3MRGB 3H9SD 4R3SA 3RNKB 2HFFB 43C9A 5H94A 4BH8B 3VXSD 4MNQD 1LE5B 3BP7B 4HIEB 3HZYA 1MCWM 5F7WC 2JCCE 2FH6A 3B6SB 1NGZB 4JDZA 3MLRL 2FJHB 1HH9A 2VLRB 3L7FB 4JFFE 2I07A 3INUH 5E0QA 3GSNL 1ZLSH 3S4SB 2XICA 1DBMH 2GJJA 1LDSA 4XBEH 4WV1A 1NCWL 3LQZA 3GBNL 5GGTH 5GZOD 4MA7H 2OR9L 3PHOA 4F37F 3DXAB 4YWGH 5IVNA 3UBXI 4YQXH 3DVIA 4KRPD 4Z7VE 2X70A 4YE4L 4DGIH 4QXUL 3S3PA 2ID5A 5E95B 4LPWA 4D2NA 4Z7UB 3MUJA 4MAYB 2AERT 5EO0A 1NUGA 1HQ4B 4JGMA 3ARDC 4KJWC 2J5LC 1IGYA 5ICXB 1E6JL 1FORL 3KPRD 5FHAL 4JHAH 1NDGB 1CVSC 3HC0A 4JVUA 2VDRL 4J4PD 4U1LB 3OKNA 1GAFL 5ACLA 4NWTH 1QFWI 4OF7A 1HINH 5GGQL 4N5EC 3RAJH 3BDYH 1MCSA 3OKDB 2Z92B 1R24A 5JUEH 1ZT1B 3EO1B 5EH1A 4HSQA 4MDJA 4EI5D 3U9UA 4I18B 3H2WA 3G6JF 1T1YA 4NGHH 1CLZH 3H42L 4LKXA 3PL6A 1EEZB 4AEIH 1A5FL 3AM8C 2RGSA 3VXTA 4MD4B 1CXEA 5SV4A 5EIIB 4JFYA 3MROB 3ES6B 2ADIA 3OXSA 4NUGL 3TH4T 4ZOBA 2EDRA 1UACH 5A2LH 2R23B 3QRGH 3MLXH 5DT1L 3RVVC 1FSKB 3OR6A 1BD2E 2EICA 1BPVA 4GW4A 1MJ7H 4HKXB 4M7JL 4PGJA 5FFLA 2OL3H 3QUZA 5SWZB 2D4FA 3CNKA 3TBTA 2G75B 1ZVSA 4XNZC 1X5IA 4HIIB 2DYPD 3RY4A 3DSNA 1XF5B 1PZ5B 4WY7L 2R29L 3UPCA 2QHLA 2VZ3A 3IRZA 5DK0B 1FL5A 2K9UA 3QQ9D 5C86A 4KI5E 1NSNL 1X4YA 4NFDA 4ZO6A 1HHHB 3QXUA 3O11A 4XNYL 3QIBD 1AH1A 2EDTA 5HHVH 1FVEA 2ADFL 3HAEB 3ZE1E 3ALPA 2X4RA 2PTVA 5A3ID 1YEKH 2R56H 4JFDD 1JNNL 1A6TB 1XGQB 1IRAY 3A6CH 3RWHB 2P45B 4OD1H 1CGUA 2ICCA 4NO2B 1ZGLP 1YEFH 3F58H 1AKJA 1B6UA 4YHPA 4EZMA 4DKEL 4MXVF 4HT1L 4LU5L 1E4JA 1X7QB 4U6VH 3BGFB 1TLKA 2GHWB 3D3VD 5DXWA 3IU4H 1EJOH 1FYTA 1H3UA 5E6YA 15C8H 5H35B 1KIQB 3RWFB 4W4OC 1RIUH 3P2TA 5CLTA 3RIFK 3MRBA 2FO1A 3HNSL 5HI5C 3VI3E 3WFHA 1NFDA 4CNIA 5FCUH 2FLBT 3HZVB 4OAWA 4LVHC 4J3TA 4U1NB 2D7PA 1SBBA 2YPLB 3O8XB 5C09A 1A1OA 2XZQH 1Q8MA 3FQUA 1P1ZB 3N9GH 4L9LC 4TTGA 4PJHB 3ULSA 5EBGA 1KEGL 1OAQL 5AG9A 1UXWB 3BP4A 4NUJA 5KSVB 5C0BA 2VLRE 4MYWB 3SJVB 4LLAA 2IMMA 3EYVA 4UOW0 5J56B 2LU7A 2LTQB 5KVDL 5DJYA 5EU6E 4XPBL 3KJ4B 3VGAC 4M02A 5GGRB 4CADA 1NAMB 5IF0B 3H3BC 1PQZA 2J6EA 3JVGC 1E28B 3OKMA 2XWJB 3F12B 3DXAE 5DHVA 2NYYD 2QEJA 4GG8A 1V3MA 2OJZH 1LO5A 3R06A 1T22B 4Z7UE 1MFCL 2H2SD 1KCUL 4NZUH 5D1ZA 1A3LL 3QULB 4G8GA 3VXOB 5K59F 3VG9B 5GGSA 5C0GB 3ULVE 2DLEA 3MRMA 2DICA 5EO9A 4U2ZA 4DW2L 4KI5C 3VMOA 3IJHA 1U93B 4P9MH 5EZLB 3P4NA 1H3PL 3FB8B 1MJJB 3BZ4B 1PG7L 1G7QA 3QUML 2E9IA 1ETZA 4KU1A 1U3JA 4CW1B 5EFIA 4MDIA 3AXLB 1QBLH 5TQ0L 1GCFA 4BFBD 4UTAL 4TULH 1I3VA 1NMBL 4WW1A 3PWVA 2DBLL 3MGAA 2NW3B 5JOEA 3R4DA 5HYJB 3MRCB 2FD6H 3WNPA 1S7WA 3DMMD 1J0IA 1DVFD 2J8UF 3FQTA 3ARWA 1XIWC 1FIEA 2CDEB 5SWZE 5CLWA 4W6YB 3C6LD 4EDWL 3T08A 5C2BL 4CVXA 3FB6B 4WU5B 3O2DL 1I8IA 1A21A 3TZVC 1F11A 3FQXB 4WHYH 2XTLA 1ADQL 4HXAL 3WFBL 1KC5L 4DEPB 1CZ8L 4ZPVA 4P3DB 3TVMA 3KAAA 5KZCD 2A77H 3IFPA 2V7HB 3S35L 5E8DH 5MEQB 2EE3A 1B4JL 3CMOH 1IAKA 3F6IA 4QO1A 1BFVH 1JZ7A 3PJSA 2GSIB 2D31B 1VFMA 1IILE 4WUUB 3ULUH 3ARBB 3DV4A 3LN4A 1TDQA 4RFOH 4U31A 1A6VH 1S78D 2X4SA 4JY5L 5TJWK 1NLDH 3Q6GL 4WFED 3WSQH 3GMNB 4HW6A 1QFHA 3NIFE 3ULVH 2H9GA 4DFHA 4BKLA 1I1AB 3KLDA 1LNUA 1ZGLA 1PGRB 5E2JA 5DJZB 3S8WA 4XNXH 3ULUC 4ZAKA 2Q3ZA 4LLWA 3U0PB 1IGIL 4WFFE 3EZ8A 2HN7A 3UYRH 3MREB 2HAZA 1NCTA 1U3YA 1F58L 5AAMA 2FJGB 5L2JA 2GYSA 1FRGH 4Z5RA 4RISH 1S7SB 1T21A 3MLWL 2YPLE 3FCTA 1OTSC 1CLCA 2EC9T 2HA1A 5SWQA 1Z0NA 3WS6C 3ZT6A 2IBGA 1S7RB 4GBXA 3E1F1 4UNTA 4YDKH 5FK9B 5C6WH 3X3FH 3GNML 5F89B 1OT1A 5AAWA 2PYFA 2R69L 3SJVE 4PD4J 5CWSB 3LB6D 4Z0XA 3ARRA 3G6DL 5EA0H 5SWSB 1R3IL 3NH7H 3DO7B 3WNKA 5IHZB 4MSWB 1BF8A 4PB9H 1S7VA 4QF1A 4LEOB 1JIBA 5JHLL 4P4KD 3BEVA 2ZSWA 4WUKH 4WFGD 1YN7A 2E6PA 3V6ZB 1HSAB 1K9TA 2AK4D 4HIHA 4OIIH 3LH2L 4OSUH 4DGVL 2NXZB 4NZTL 1MFNA 3HAEH 4Y1AA 1L9NA 4HPOL 4KK5D 2NY6D 4QRSB 4O2EB 3QDGE 3M17A 5DRXB 3E6FB 1FC1A 3A6BL 3MV9A 4OFDA 3WE6B 1KTDA 4ZS6C 5BXFB 2CLZB 3ARSA 4IRJA 4ZXBA 4GRWF 4IOFC 1MCNA 4G6AD 4FOMA 5IP4A 3CCHA 4U0RB 3VXNA 1ZLUK 3OJMB 2IJ0C 4G6JH 4JDTL 2X1QA 4HPYL 2BC4B 4FQPA 2GAZA 1NFIB 5TDPA 5HTSA 5D7LB 1H9VA 4QHMA 4GXUN 2V17H 3C09C 1MHHB 4MAUL 2EE6A 3T77A 3TFKD 3BGFC 3PWLA 1FLRL 3VG0H 4PRPD 4YHZL 4MAYD 1T4KA 3V95A 3S36X 2FWOA 2GT9A 4PJ8B 2AJ3A 1F6AB 1I3GH 1XZ0B 4FQ1H 2DJSA 1UWEH 5ACZA 3I85A 4UDUB 4GRLD 5JW5A 3TIDA 2HJKB 3DVGA 3OAUH 4HGWB 3HCVB 4OCYH 4C56E 1QSFA 1ES0B 3KPMB 2FX9H 5EWIL 3P77A 5GS0H 4NQCB 5JZ7C 2DF3A 4OIBA 3QEGL 4ZFOB 1NAMH 3S7GA 2Z4QB 2UV3A 3FRPG 5IHBA 3K46A 4KUZL 1AGBA 2FHCA 3MRLA 4I2XB 4D0BB 5K9KB 4JHBA 4LCWE 2BCKA 1VGKA 5E6IC 2CR6A 5AYUL 1LE9B 4OZIA 2C3XA 4WUUE 2LTQC 2DQIL 4LEXH 2DQUH 4R3SB 43C9B 5H94B 2AJXH 2E3VA 4Q2ZA 4ZPTA 3WO4B 2P48B 2X40A 3HZYB 3QH3A 3UJJL 4C57C 5FA4A 4A2MA 1V7NL 1OM3H 5MERA 1AQKL 5SWZD 3DHMA 4JPVH 4DTGL 2I07B 3W5MA 5I76A 2WUBL 2MHAA 5C3LD 3U7AA 1DTUA 4WV1B 1KBGL 2E6QA 3LQZB 2D7QA 1JZ2A 4GG6E 5BW7A 3KDMA 5E2VL 1URLA 4KQ4L 1DQMH 2YPVH 1J1XH 1KNOA 3BKMH 4FHBD 5ITBL 4NQEE 2X70B 1BZQK 1SJXA 4KKAC 1C7TA 1QHOA 1T83C 5EO0B 1F4XL 1YMHA 1IGYB 4TTDD 3G6AB 4GKSA 3QDMB 1IEAA 1MHPH 4GQ9L 1DBAH 4P23C 3WDJA 3OKNB 5SWSE 5FUOH 3REWB 2DJ4A 4X5WB 5I17B 1PKQE 4L8DA 3MBEC 3ARVA 4XNUL 5D1QD 4OZFG 4ZYKA 1R24B 2Y5TB 3ALXA 1A2YA 4BZ1H 4MDJB 3U9UB 4BA8A 3D9AH 1YN6A 4S1DD 1UT9A 3FRUA 2EXWC 5E7BA 1EO7A 3UZEA 4Y4KB 3VXTB 3FHAA 4OQTH 3MOAL 1EGJH 5HD8C 4JFYB 2P8LA 2ADIB 3OXSB 1Q72L 1EIBA 3FFCA 3FN0L 3LVEA 2GSGB 1R3JB 1QBML 2OK0L 3OR6B 5CJQL 4XP4L 4DEPC 1FJ1B 4GW4B 1RZFH 1WK0A 3QUZB 3CXDH 3D39B 1ZVSB 2GK0A 1W8OA 1GC1H 3LHPH 2QADC 3MLVH 4MNHB 4MZ2A 1NKRA 1WTLA 2A73A 2VYRE 2X6MA 5TE7H 3KPSA 4O51B 4N90E 1IEBA 4X80H 1OF2A 1TTFA 3ARBC 4RNRA 3WHXA 5C07A 5D7LE 3AU1B 5EC2A 3O11B 4JQVC 3BESR 5DJ6A 1WVZA 3W5NA 2Z91A 1FVEB 1WBYB 2X4RB 2I60H 5F7EH 3LN9A 1I1AC 3O6ML 1XF3B 4I3RH 4HQQL 2BVPA 4YHPB 4OZGB 4Z0BL 4HG4J 4HULB 3O6KH 2RCSH 4X4YB 1DUYA 3CDGB 2JLLA 2UZIH 3BKCL 1UXSA 2F8OA 1H3WM 1JGEA 3HZKB 1MEXH 4X6DF 5CSZB 2ZPKH 5ALBH 4HKBB 2Q8BH 1NCAL 2YKLL 2WUCL 3D85A 2ZKHH 1NFDB 5DK2A 1KYOJ 3WFHB 4I2XE 4AENB 4OAWB 2EC9U 4WFHD 1WITA 3PWJB 5HDLA 5C09B 5ERWB 1TJHH 5IVOA 4LSSL 3FQUB 4ZFFA 5FYLD 1IC7H 2Y7QA 1BZ7A 1KIPA 3HLAA 3ULSB 4UTBH 2GQHA 4FP8L 5HYJD 1XIWA 3FRPA 3KXFA 4DJMA 3L3KA 3OJVC 1UENA 3SDAA 4FXKB 3HG1B 2F54D 2CSPA 4RMVA 3BP4B 4NUJB 4FZ8L 4OJFH 1GYAA 2X4OA 3EYVB 4PJBE 5T1DH 2WM0A 3GBML 2EDXA 3GRWL 5BMFH 2VJXA 5I1KH 1FAIL 5E9DD 4CADB 4CMHB 5DA0B 4PTTB 4QHUA 2B4CL 3OKMB 4U7SA 2V5SA 5DHVB 2WIIB 3GUTA 1N59A 3S37H 4F9LA 1N26A 3WIFA 4GG8B 4HBCH 5E2TL 1LO5B 4J3OC 1S7QA 3BRFA 1F3DJ 4PB0H 4P9HL 5J13B 2D03L 5JIHA 5MHSD 1TQCC 4G5ZH 3EJZC 4IJ3C 4U0RC 4U6YB 1NGQH 1YEDB 4LK4A 5GGSB 5JXED 3QDME 5DC9B 4G6KL 1CF8H 1Z9MA 3MRMB 5DS8A 5EO9B 4G43B 4E42A 3SHSA 3S96B 5F9OH 3IJHB 3ZO0A 4EQ2A 2HTLD 4WNQA 3LY6A 3P4NB 4E41A 3AAZA 5J06A 1G7QB 2YRZA 3M45A 5F1OB 1U92B 4JM4H 3SKNA 1CGYA 5EFIB 5HDQL 4MDIB 5IMMA 1MHEA 1NCCL 3I75A 4RGOL 1HKLH 4EKXA 1A7PH 3RGVD 3T65B 5I71B 4PJ8C 3PWVB 4QOKE 5CZKA 2O5ZH 3T1FB 1KTLA 4OZFA 4ZUTB 1U6AL 2FEEI 1S7WB 3RNQA 4F7PB 5IOPA 4KKNA 2CIIA 1CICA 4S1SL 25C8H 1MAMH 3MUGB 1HHJA 4L1HA 2QSTA 4YHNA 3C6SA 1FBIH 2B1HH 3DETD 1OAXL 1ZVYA 3BIBX 4NRZA 4HGKC 3D39E 3C8HA 3D2UD 2VXSH 4CVXB 1KEMH 4O2CA 3VMNA 1U9KA 1I8IB 2J2ZA 1T6VN 4GT7A 3UP1A 1HQRA 5IGXH 5JW4R 1T66C 4YDJA 4DN3H 3BD3A 4P46A 5EBWA 5TH2A 4L8BA 4ZPVB 1HEZA 1KIUA 1CLOH 1YMMA 4YZFF 2R9HC 5AUMA 3C9NA 3WO4C 1R5WA 5IBTL 3IFPB 3RWCA 2QR0A 4NT6A 4JN2A 4HIXH 1IAKB 1AO7A 4P59L 2NXZD 5GSVA 5HHXL 1WT5C 5ESAA 3MJ9A 3VFSB 1ZLUH 2OI9B 3DV4B 3AREB 1YEJH 3LKSA 5D7SH 1N64L 4OZGE 4U6TA 3UTPE 5T3XE 4UNUA 1XR8A 2H9GB 4YDLB 1RAMA 2LE9A 1JGLH 4BKLB 5EOQL 3RZCD 4K7PY 1Z3GH 2JB6A 3T3ME 4ZAKB 2Q8AH 4LLWB 2PR4H 3VFVB 3HN3A 3OG6B 5L2JB 3IDMA 1T21B 5C09E 4R4ND 3FCTB 4L4JA 5SWQB 3GO1H 2HLFD 5KTEL 2P5ED 3UXFA 5JA9A 3C5SA 4GBXB 3LSOA 1SYVA 3L9RB 3DI3B 3H3KA 3INUL 1PJ9A 3HG1E 1KCSH 3BP6A 2PYFB 1DBML 2CGRH 1FL3A 1K2DB 4U1JA 1BVKA 4UT7L 1J1OH 4KMTH 4Y4KC 4MA7L 4GXVL 4LSTH 5DJ8A 5BO1H 4FG6D 1RZJH 5LQBH 4QXWA 4P5MA 4YWGL 1BEYH 1SEBA 5GIRA 4QF1B 4YQXL 5HGDA 2AXJA 4S1QL 3FONA 4FQXC 3D0LA 2X4TB 4NQCD 3BEVB 4JFHD 3BIKB 1JUFA 1YN7B 1YECH 3SO3C 1L7IH 3TNMB 4WWKB 2MKLC 5TE4L 1NGYB 3H6JA 1Z5LA 4XH2A 2WINA 4HIHB 3OSKA 5C0FA 4M1DH 3C8KA 1BECA 3OWEA 1RZJC 1QPXA 4Y1AB 4NWTL 3M17B 3RU8L 1HINL 1MWAL 1H8SA 3LV3A 4MA8H 3RAJL 3BDYL 1EBPA 3OPZH 5HPMB 2MWCA 2AQ1A 4WI3A 3OR7A 4ZXBB 5I1HH 5T3XH 3B4NA 3L5HA 4NGHL 4HFUH 4AEIL 1DBJH 4MB4A 4OCMC 3FTGA 3K80A 1ZT4A 2NXYD 4MD0B 2F5AL 5ID0B 2YPKB 5CJ5A 3IVKA 3KGRA 1NGPL 1B0RA 5TDPB 4QRPD 1FDLH 1INDH 5DR5H 4IS6B 5J3HC 3MLXL 1BX2B 1N0XL 2WBJA 4PGCB 4QHMB 3FOLA 3O41A 3PGCA 4LPYA 4QHNB 1P7KB 3PWLB 3AMKA 2OL3L 1MCJA 3HS0B 4M1GH 1T4KB 5GJTH 1JF6A 3LS4L 4BFGA 5F93C 2AJ3B 4P23A 4PJAA 5ACZB 5JW5B 2EYTA 3TIDB 2E8YA 3WJJC 5ADPH 1U95B 3DVGB 3STZB 3REVA 2BVQB 4CVWA 3T3PF 5HHVL 3QIUB 3JUYA 3RKDD 4UNVA 3P77B 4R4FH 1I85A 3L1OH 4GW1B 4AK1A 2EDBA 4KROB 5IB5A 1YEKL 2R56L 4IEFB 2FYYA 5B8CA 4DGYL 1AGBB 3MRLB 2NY1B 3PL6D 4KAQH 4OD1L 4U1GB 2GJ6E 4QTHB 4U6XA 5DHVH 5DFVD 2BCKB 1VGKB 5IW6A 5EPMA 3WFCL 4G9DB 1J10A 4Z7QF 3IU4L 4QNPE 4RBPK 3E3QE 2I5YH 1CWVA 4CMHC 2HT2C 1S9VA 2XQYK 4YO0A 15C8L 5J9PA 5FA4B 3KG5A 1RIUL 5FV1L 3QUZD 3QO0A 1JF1B 4MHHG 5FV2A 5FCUL 3G5ZA 2MHAB 4J12A 1KGCD 4K7PX 4KDTA 3O3DA 2DL9A 1FFOB 3GI8L 1WEJH 3H0TB 4NKDA 1GGCH 5J1AA 4XMPH 4KVCL 3BUYA 4HLZG 3KDMB 4GKZA 3I6GB 2QQKH 3KLAB 1YNTB 4H88H 3OX8B 1KNOB 2DI9A 4AT6A 1KENL 3EYUH 3ZL4L 4NRXA 5BCAA 4P2OC 3OKYA 3MRHA 1NCDH 4R2GD 2ZJSL 1CFBA 5JORB 1IEAB 4KK6D 4HDIB 1S9YA 2EDNA 3WFEL 1AKJD 2ED7A 2H6PA 4WDIB 1NBYB 3BHBA 4D0CA 1FCCA 4ODVH 4QRQA 3QUKB 3JBG7 1MJ8H 2W60A 3TJEH 1FYTD 2OJZL 1J86A 2DLFH 3MNVA 5DRNA 4ZYKB 4ZMAT 1Z2KA 4Y19A 4N1HB 4NJ9L 1MY5A 3FB5A 4NZUL 3IDNA 4I3GA 5BZWA 1FLTX 5T5FH 3O6FA 4EEEA 5C0IB 3GSUA 4NO3A 3DVFA 5E8EB 3VFMA 4JZOB 2P8LB 2A6KB 3SDCD 7FABH 1NEUA 3FFCB 5EBLA 1DE4B 4YAQA 4ORGA 1UJ3A 3HE7B 2VXUH 1CGSL 1JNLH 4F57H 2E7MA 2ZOLB 5C0BD 3TYGH 5IV2A 1UWGH 2HFGH 2NY4B 5HPOA 1QBLL 2X42A 2GK0B 3ILQC