2YMXH

Crystal structure of inhibitory anti-ache fab408
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
224
structure length
222
Chain Sequence
EVQLQQSGPELVKPGASVKISCKASGYSFTGYYMNWVKQSPEKSLEWIGEMSPSTGRTTYNQNFKAKATLTVDQSSSTAYMQLKSLTSEDSAVYYCARSVPLTTLIEDWYFDVWGTGTTVTVSSAKTTPPSVYPLAPGSAANSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB ANTIBODY HEAVY CHAIN
publication title Molecular Characterization of Monoclonal Antibodies that Inhibit Acetylcholinesterase by Targeting the Peripheral Site and Backdoor Region
pubmed doi rcsb
molecule tags Immune system
total genus 47
structure length 222
sequence length 224
ec nomenclature
pdb deposition date 2012-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ymxH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ymxH02
1BBJA 1PEWA 3LY6A 1EBPA 3MPCA 1NDMB 1RZKH 3RAJH 3NIGE 3QH3A 2XACC 5JO5B 2R0KL 2A9NL 4KTYA 2E27L 3T4YA 4YHYC 1HSBB 2GCYB 4Q6IC 1N2RA 2ATPB 2FZ3B 4I0PB 4QXGH 2XQBL 1QLRB 2J4WH 3NFNA 1MPAH 2Q6WB 4JFEA 4KZEH 3ZDYE 4XNUH 1WZLA 3LMJL 3NMEA 2IWGA 3K3QA 5CKGA 3OGCB 1U58A 2Z9TA 2HFFA 2LFGA 4KQ3L 1OVZA 1ZLVK 1QBML 4CNIA 2XA8L 1R6VA 1MCOL 5C09E 3DROA 1K4DB 4JKKA 2OP4H 4K3JH 1LO4L 4KXZH 3CLEH 1TZHA 2P5WA 2QSCH 4GRWE 1N0XH 4WY7L 5ADOL 1T04B 2HJKA 3BZFB 4ORZC 4CL7A 5CJXA 5AD0A 3MRPB 5FV1L 5ADPH 4Z78A 4FQHA 2HKFL 4N0CD 4MXVE 5IB4B 1TVBB 1OPGH 4XMKL 2E7BA 3BQUD 5EU6D 4M7KL 3UTOA 2YPLB 5D2NC 3GO1L 4R2GD 1Q9OB 1NL0H 2EDKA 1EO8H 2AK4A 4UI2A 3RBGA 4NQSA 4YHPA 1FO0H 3GSVB 3LQAL 3RIAF 4X98B 1CFNA 3FTGB 2MHAB 3P4OB 1N7MH 3F8UB 4OQTA 4F80A 3MJ9H 3P40A 3FCTB 2Y7QB 2YEZA 4LCWB 1WBZA 1T1YA 2F9BT 4KPHH 3H9YA 1RJCA 3TJHD 3F7YB 3IF1B 3P11L 1YN7B 3B9AA 5DEGB 2YD3A 4NQUA 1PG7X 1QRNE 2FJFB 3GIVB 3ORJA 1T2JA 3MR9B 1A7BA 4GH7B 4Q0XL 4IMLA 4X0KA 2VQTA 5IBLD 1JF1B 1Q9KB 3E6HB 1CT8A 4O00A 5F89B 1XGUA 5EO9B 3KJ4B 1NCWL 5FXCH 5F9AC 5C0AD 3QB7C 5HYJD 3BJ91 5IESL 3G5ZA 4MXWL 4TVPL 3EAKA 1UCBL 4D0CB 1CXFA 3RUGA 1IFHL 3QIBD 5KOMC 2J8UF 3QZWG 4LQ1A 3ULVC 3NA9H 3FN3A 5EPMA 5HBBA 2CMRH 3ARTA 3IDJA 5DQ9B 3SDAD 2NZ9C 4U0RB 5I9QB 1RI8A 5MEQB 4YDLC 3PGFL 4LLVA 4NN7C 3MRQA 2CXGA 3W39A 1C12A 1D5IH 4OM0L 4WW2B 1TJHL 4S10A 3BP5B 1PQZB 2R9HC 1DQLL 3IU3A 5FHBL 3T0VA 4OCLC 4YXHL 4G7VL 4ZFGH 2VAAA 2V2WA 5E95B 5DUPL 1H3PL 3QNXB 5T1KA 2EXYC 1IGYB 1YDPB 3HZKB 5C0BB 1MRFH 3LS4L 4JN1L 3RIFF 3IETB 4ZUVB 4HJ0D 1L6ZA 4DGIH 4BFBD 3MLWH 3P3YA 1CCZA 4LASL 4LVHB 2FRGP 4PP2A 3L9RB 4P2OD 4D8PB 5MENA 1XGYL 3MGAA 2V2XB 4I13B 2OQJB 1SYVB 4MNQA 5AG8A 3V95A 3H8NA 1NCDL 4KJYB 2XKSA 3F5WA 3FAWA 3NGBC 5D70L 3SGEI 5C07E 3SGDH 1T20B 2FX9L 2DS4A 2NY6C 1R3IL 4P3CH 4R9HA 4ELMA 4P2RD 1RZJL 2NW3A 3BX7C 5IVXE 1L0YA 1KBGH 1S7WA 4WHYH 4GW5A 5CZXD 5I8EB 4P5TB 3H42H 3ZKND 5I1EH 3KPSA 2ZSVA 4FQIL 4RRPG 3KXFE 2EYTB 4ZDHB 1W0VA 4PR5B 4FQQA 4K8RH 1R3JA 3RIAK 2R39A 2WWKT 1FE8H 1YNTA 1LP9B 4EVNA 2HJLA 1UZ6F 4HAGA 1FNGA 3QZWA 5E2JA 2X1QA 5I71B 1FGNH 1EBAA 1KN4H 3GJFA 5GPRA 1CK0H 2VN7A 2IPUK 3BGMB 3QDMD 4PJXE 2I5YH 1ED3B 1V7MH 4N1CA 3BP6A 4FQXC 1CFSA 4XHJD 2YA0A 1A2YA 3QR2A 5E9DD 1I1FA 3W0WA 3EDEA 5IUSA 1T7XA 2CKNA 1CL7I 2NY7L 2FIKB 5FKPB 3D5OF 4PUBH 5H37H 3SKJL 3U4EA 1MHPL 4HHAA 4NNPH 5C9JB 2ESVB 4YHZH 1PLGL 4JDZA 2P45B 3SPVA 4DQOH 1GZQA 1ZLUH 3MBED 1CDJA 2NW2A 1BQSA 3BGAA 3H3PH 3L3JA 4FFZL 1UENA 4QXTB 1MCRA 4NKDB 1RUAH 5D1XA 1IILE 3D85D 4ODWB 3PV6B 3EDFA 1H3VA 5I8OH 1YEIL 1ZEAL 4G6FD 3M07A 5CBEB 5K9JL 3IVKA 2DL9A 3HLAA 1NJ9B 3H9SB 1OAKH 1Q9LB 3B9KD 4P49A 3RUGF 4QXUH 1NCAL 1J8HD 1CTOA 3F62A 1SEBA 3BO8B 4OTXL 1S9VA 4IDJH 3U0WH 2CIIB 2P8LA 2F53D 5HHVL 3PWNB 3JWDC 1IC4H 5F7UA 3O6FB 4XP6L 2J8UB 4Z7OE 1JNHA 4NP4L 3FT4A 3QG7H 5D4QA 3EYSH 4Z9KB 2BSED 1HKLL 4G6AD 5FB8A 5GS1C 1NGWB 4YHNB 5JIPA 1S7VB 4Y0GA 2C1PB 4L3CA 4HLZH 1NBYA 1AO7A 1L7IH 1DQJA 3RIFK 4BZ1H 5A2JH 3KYNA 2R29H 1CF8L 2Y07L 3JV4A 1DANU 1KFAH 3REWA 4UTBH 1XF5B 3OR7A 3SGKA 5JHLL 3NZHL 1D5ZA 2YD8A 3C2AH 1AGFA 1T1WA 1BBJB 1CYGA 1K3IA 4DOHB 1MI5A 5T3ZL 3MBXH 1VGKA 5TQ2L 2VSCA 3T4YB 3FN9A 2XTJE 5D96B 4EN3C 2FNBA 3BIBX 1N2RB 3K74B 2Z35A 3LKQA 2ZUQC 5TGBB 3ILPB 2IALB 4JPWH 1J9CT 1U2HA 4JFEB 2OTPA 4JO2L 1FVCB 2VDQL 1I7TA 3SGJC 2VL4A 3EO0A 4YDIL 2X6MA 5D2LA 4ELMF 4LQFL 1NC2A 4HZLA 3VH8G 2APFA 4MD4B 1U58B 3RY5A 3BKJL 3ETBF 4EI5C 4NRYB 1QR4A 5FO8A 3DROB 4F9PA 5CEZE 1LO3L 4QRSA 1UJTA 1OTSC 2UV3A 4I2XE 1TZHB 2P5WB 2X4NB 3RPIB 2HJKB 4Y19A 1S3KL 5AD0B 2FL5B 1JZ4A 4Z78B 2R2CA 4FQHB 3U83A 2DBLH 3VWJA 4UU9A 5IJVA 3QCVL 2QQLH 4LGSB 4DKAA 1QG3A 1L7TH 2VLKD 5EZIH 3UJJH 2X1XR 4I48A 3EHBC 4TQEH 5ISZD 3BAEL 2V2TA 3HS0B 2A9ML 1I9IH 2AK4B 3NOIA 1XR9A 4NQSB 4GG6E 3OL2A 5IWLC 2Y36L 3FB6A 4MJ6A 4GAGL 2R0LL 1JGVL 5HHQA 3HNTH 3B2UD 1TLKA 4CDGC 1H5BA 2O5XL 3ARQA 2YEZB 2G2RA 4LHUA 1WBZB 1VA9A 1NKRA 5HPMA 4M6NH 3TP4A 3M1BB 4LP5A 1UT9A 2ZPKL 5GSVB 2P5EE 2QSQA 4HUXB 5B39A 5DA0B 4ZS7L 3RTQA 4IMLB 3PGCA 1YJDC 3MMEA 2AV7A 4X0KB 3QDGA 1CT8B 1DVFC 1XGUB 1CVSC 5I6XB 3MOBH 3QI9C 4UNTA 1IEBA 1RZ8A 4P3WA 3BHBB 1LDPL 4KDTA 3SKMA 3CH1B 2A6DA 4Y4KB 2QR0A 5EB9A 1CFTA 1MJ7L 3LH2H 2H41A 3G5ZB 2NXZB 5GRUL 3RUGB 2Q86B 5CEZH 4LSDA 1LE9B 4W81A 5EPMB 2PYED 2DLIA 4OQTL 1T66C 4OIAA 4TRPH 1SJEA 1D9KC 5DD0H 5MEOA 5GS2D 3UPRA 1BD2A 3VW3H 4RIRA 5CSBA 4AIXA 4DFHA 4WFED 3MRQB 3NZ8A 5D7LE 4ZTOH 2FHFA 3W39B 1C12B 4OKDA 1GL4B 2OLDA 4XRCA 4MD0A 4OF7A 4NJ9L 3V5HA 3HC3H 4OD3H 1KXQE 3FONA 5E2TL 1HHGA 4BQBA 2ITDA 1UWXK 3JWNC 2V2WB 1DUZA 2Z31D 3WYRA 3ULVH 2A83B 5T1KB 3PP4H 3LQAC 3HPLA 1M05B 1LWRA 1R0AL 4U1KA 2GK0A 4HIHA 2WIIA 2XZQL 2YUXA 2AK1H 6FABH 4JRYE 2DN7A 1PX3A 1JHTB 3BYYA 4M1DH 5FGRA 5BRZE 4PP2B 5I19L 3T2QA 3RVVC 3BKMH 2Q7NA 1BECA 5MENB 1QFPA 4KK5D 4O02L 2AAVA 2R2EB 3AVEA 5I15H 4F7EB 1YNLL 1QO3A 3DX8A 2E7CA 1KJ3L 4Z6AT 3F5WB 2BVOA 3Q6GH 4I9WE 1HILA 1RZIB 4F58L 5DMKB 4ACPA 1H8OA 5E94A 4PY7A 1RUPH 1G7PA 4BSVA 2AEQH 3GJFK 3EYOA 4F3FA 4BZ2H 5MERA 1G9MH 2PO6D 1F3DH 5DI8A 4GW5B 4UBDC 2FR4B 1T7WA 5J6GA 2C5DC 4L3ED 4GFTB 3AY4C 3KPSB 4GUPB 4Q74A 2ZSVB 1T03L 4FG6C 4HWEL 3MV9D 3UYRH 4FQQB 2W0FB 1R3JB 1KCKA 1XGPA 2AJ3A 1YNTB 3RVUC 1ZHKA 4GRLA 4EVNB 3QUXA 3MRNA 2Y06L 1FNGB 3QZWB 4KKNA 3O0RH 1H0DA 5JIKA 5GS0D 1CGSL 1A5FL 1GGCL 4IDLA 5JA9A 1WEJH 2QBWA 1M7XA 1LEIB 1A6VH 3BP6B 1CFSB 4DGVH 1A2YB 1AI1H 1FL6A 2FYYA 1I1FB 3W0WB 4OLVL 2EXYD 1K6QL 3VXPA 5L9DL 3MRBB 1NAKL 3U4EB 4HHAB 5J8OA 4MS8C 5HGDA 3VRLF 4AEEA 2BVTA 5F72S 4JDZB 2D7TL 1GZQB 5CCKL 1E4KA 4X6DA 3EDDA 3L3JB 4F33A 4N0UE 4PRPA 3RU8L 3RJDA 3TIEA 5L7XH 5D1XB 1A14L 4LSTL 3MCKA 4XC1H 4R4NC 2MTPA 2VLME 3D0VA 1DLFL 1RJZB 3IVKB 1ZHBA 3HLAB 4P2QA 4UOW1 2VH5L 3FFCA 4PJCA 2VXUL 1HQ4A 1TFHA 2XZCL 1GOHA 2NXYD 4L8DB 3BH9A 4POYA 3IFNL 1WWAX 4G9FA 3A0OA 2XWBB 1YECH 2PUQT 3EYVA 1SEBB 4D9QD 1S9VB 4JRXA 4MQXC 2KUTA 3ZYOA 2DQHL 3KJ6H 2A74B 4HG4K 2P8LB 4WUKH 3H2WA 3ARFB 2ADFL 4IOIB 5KSVA 5ETUA 1XAUA 4I77H 4P9MH 5IM7A 1JNHB 5IQ7H 1KCLA 4GOSA 4N5EC 1F00I 2IAND 3DTXA 3AUVA 4OUOA 5INDA 2D9CA 2JKXA 3K8MA 3ZHDA 4YHOL 1MVFA 5IFAL 1J0IA 4L3CB 3VRIA 1A21A 1Y6KR 1NBYB 3O3EA 1DQJB 2VKWA 1ONQA 2Y4SA 4LVHC 1FYTE 5HGHA 3IXTB 1SM3H 1VEMA 2FHCA 4P4KC 3JV4B 4LLYA 5SV3A 3REWB 4H1LH 4YX2H 1KC5H 3JWDH 1UJ3A 3ZTNH 4K9EC 4ISVA 3SE3C 1AGFB 2XWJA 3QEQD 1QKZL 2FBJH 4R0LA 4RGNB 1NBVH 2P8MA 4Y5VA 1MI5B 1YEFH 1CDUA 3FN0H 2DQUL 1VGKB 3I3EA 2DF3A 3O2WL 5DR5L 3MCLH 3LKQB 1DEDA 2J2ZA 5FYJE 4LRNL 4ZXBD 2R8SL 4FFVD 3U7WL 4O2FB 4X9BA 4B50A 2OXGA 4JJ5A 1FG2A 4NFDA 3CSGA 4KAQH 1NC2B 5HSFA 4HZLB 4GRMB 2JF1A 4XVJH 4DAGL 5EFIA 5GISL 4HKJA 1QQDA 1RQ5A 2V6HA 2W59A 2GJ6E 4FP8H 4BELD 2W92A 5FO8B 3PWPD 4HMDA 4PJIE 2IADA 3DX7A 2X9XA 4ODHL 4ODTH 3RZWA 4WU7B 5B3NA 2EH8H 2UZYB 3EGSA 4KI5D 5FFLA 3HCVA 3B2VH 3K80A 3ARBC 1F6AA 3VFVA 2EE9A 4Y19B 2DD8L 3FQXA 4BUHA 3HE7D 1RD6A 2OZ4H 4G5ZH 3ECBA 1ZT7A 4UU9B 3VWJB 4ZYKA 5IJVB 4NNXA 4XAKD 5DXWA 4I48B 1S7XA 5J0BA 3RWIB 3DECA 3SDDB 2V2TB 2DTSA 2FIRT 2VQ1A 3TNNA 4IM8A 1SJVA 3RGVA 2I60L 1XR9B 1NGXA 4XBEL 1NGZB 4R4FH 3WIFB 3FB6B 2NY1D 5KSAA 3GBMH 3MQIA 5HHQB 1H5BB 4U0QB 3WN5A 1HIML 5K59E 2G2RB 4LHUB 3N85H 3ME0A 1CS6A 4JFFD 2H2PC 2JCCA 5HPMB 1BZ7A 4Z95H 3CDGA 2OTWA 4M9OA 3H0TB 5B39B 3O9WC 5FA4A 4EN3D 1YNKL 5FYKD 4KJWC 3BIKA 3RTQB 5F6HJ 1RUQH 2JB6A 3PGCB 4ZFFA 2NY3B 4PJCF 4XPBL 3MMEB 3O3BA 5JW4R 3QDGB 4NQDE 3M17A 5LGJB 3DV4B 1IEBB 4H5SB 1GIGH 2IFFH 4HUKB 3SKMB 2A6DB 4NN6B 1GOFA 2QR0B 2XY2A 4XH2A 1CFTB 2HFGL 1GSMA 3R1GH 3ZKXB 1JYNA 3BPNB 1I1AA 3UTSE 4LLQA 4EI5D 2BOCA 3SDCA 1LO5A 3MJ6A 5TE7H 3TA3A 3ZYZA 4NBZB 3GSUA 4QRRD 4JVUA 1SJEB 4N9GA 1UACH 5MEOB 3UPRB 2XQBH 5D72L 1PY9A 4X9FA 4RIRB 3S37X 2UUDK 1A47A 3NZ8B 1OQXA 2VWEE 3E1F1 4K2UH 2OMBA 2LU7A 2BMKA 4K7PX 5E5UB 2Z8VC 3LMJH 3V2AR 2D31A 3FONB 3HNVH 4C4KT 3EHBD 5I8KL 4KQ3H 1HHGB 2XQYK 4QRTA 1QBMH 2ITDB 3SQOL 2XA8H 3C60B 3QG6A 1DUZB 4JPIA 3MGOA 3HN3A 1T5XA 2VDML 2EDDA 3GBNH 3OGOE 3PIQA 2VQUA 1LO4H 3HPLB 3HC0B 5ADOH 4U1KB 2GK0B 2V5RA 2WIIB 1PYWB 5C7XH 2HKFH 2W91A 5GZOC 3OBAA 1N59A 4XMKH 2EXWC 4FXGA 4M7KH 3OKOA 3C5JB 4FTVA 3GO1H 3SDXA 1QO3B 3DX8B 3QCUH 3DMMA 1IKFL 3LQAH 2BVOB 1AE6L 1HILB 4LHQB 4LHJB 1DVFD 4XCCL 1CU4L 3QI9D 4PY7B 3TH4T 1ZGLA 1G7PB 4BSVB 2XWTB 1JNNL 4UT9L 2CK2A 4X4ZA 3EYOB 4F3FB 3U6RB 5MERB 5I1CH 4LSQL 3I3BA 3QEHA 1L0QA 2C3XA 5I8CA 3KPOA 2IQAA 3P11H 5DYOA 4F9LC 4IS6B 1P84K 4PRDA 3VXSB 3DXAD 5IJKA 1I9RL 1XR8A 4Q0XH 3O2VH 1XGPB 2AJ3B 1VB9A 1ZHKB 3QUXB 2FGWL 4HZAA 5DURD 3MRNB 4PG2A 4O9HL 1QSED 1H0DB 5DMJB 3WIIH 4RAVB 2WLZA 1QSVA 1C5CL 3I50H 4CU8A 1NCWH 4X6EA 2Y1VA 1X5FA 3CXDL 5EZLB 4JFPA 5IHLB 4WU5B 4MXWH 4TVPH 5I75B 4FABH 4FFWC 1IFHH 1MCHA 1FL6B 2JCCF 1OWRM 3AREA 5IB3A 3VXPB 4MWFB 4IJ3B 1LK3L 4Y4KC 4J23A 5LCVL 5IQ9A 1L4IA 2BNUB 1YMMA 1V8HA 3NN8A 4Q9BA 5J7CC 2NXZC 5F7DB 2YD9A 4MLSA 2DM7A 3TESA 3LEVL 4YGVA 1P7QD 4OM0H 3TIEB 2OXHA 3RVVD 1TJHH 1ZT1A 1IRAY 1CLZH 3MCKB 3UO1L 1TTFA 3BUTA 5HGGS 5T5FL 1YQVL 2A2QT 4MZ3A 1CVRA 1ZHBB 3N9GL 4TVSa 3FFCB 4PJCB 1HQ4B 1KCSL 2VDKL 5DUPH 1A6UL 1H3PH 1U8IA 3HR6A 4Z5RB 4WI8A 5FOBA 2ZJSH 4G9FB 3ULUC 3EYVB 5K9QI 3LS4H 3I6KA 4JN1H 5MHSD 3FO9B 3TJEL 4JRXB 2XKNA 3CFDB 3OG4B 5B8CA 1A7QL 4WNQA 5JDSB 4HUVA 3DURA 4UBDD 2OSLA 5KSVB 5ETUB 4FXKA 2VIRA 4KROB 4WIQA 3W9EA 2UZIH 4U7KA 5IMLA 1XGYH 1EUTA 2XPGA 3T0BA 3TM6A 5INDB 2BC4A 1FFNA 3CSYA 1F13A 3D3VE 1JZ7A 3VRIB 1VERA 1X4ZA 4L29A 2WQ8A 3O3EB 2GAZB 3SKOA 1ONQB 2ICWJ 3EJZD 5D70H 3G6DL 4P3DA 3TO4C 4WW1A 3DVFA 4C57C 4LLYB 5I0ZA 4ZUUA 4MJ4A 5FECA 4WGVB 1LK2A 5IT2L 1UJ3B 3BPOB 4ISVB 5F97E 1EEYA 5ECJE 4FQIH 2P8MB 2UWEA 3SHSA 4Y5VB 3FT2A 5J1TC 3LD8B 3NIDF 4WHDA 2ESVE 4MGXA 4Z0BL 4JY6B 3MRGA 4MS8D 5JW3L 4LPVA 3SDXF 4CADA 4U31A 4BH7A 1FZOA 4EBQH 4PRIB 1HYRC 3PQYE 3SCMA 4BKLB 3CAFA 4KUCD 3QFJE 1FG2B 4JJ5B 1IQWL 5SWSD 4WEUD 3D39D 1T2XA 2DJ4A 2PNDA 5EUKA 4Q9QL 2O5ZL 4HKJB 4CBPA 1J5OL 1QQDB 1TJGL 3IDIA 4Y4FD 3S34L 4M93B 2IADB 3DX7B 1AQDA 1RZFL 3EGSB 4GKOA 5J1AA 3ZT7A 3HCVB 1JZ2A 3SKJH 1MHPH 3J8F7 1PLGH 4MQXD 4NUJA 3VFVB 4QTIH 3V4UH 4Z7NE 4L9LA 2GSIA 4FFZH 4WRLA 4JGUA 3ECBB 5EDXA 4UT7H 1ZT7B 5GGTA 4RGOL 1ETZB 4ZYKB 1WV7T 1QFUL 1DLHA 4MHHG 2JTDA 4NNXB 2X40A 5DJDA 4NHCH 5K9JH 3O11A 4YDVA 2VQ1B 3TNNB 3RGVB 3VFNA 1NCAH 1NGXB 5B3JE 1FNSL 2DQEL 4MJ5A 4OTXH 4P4KD 1F3DJ 4FQLL 2EDHA 5HHVH 3MRKA 4KQ4H 2X4SA 2AXJA 4DCQA 4WTZA 2JK5A 1N8ZA 3MGTB 2VC2L 3CVIL 4U6HB 4XP6H 2JCCB 1BZ7B 2IF7A 4NP4H 3MRRA 4ZAKC 4J3XA 3CDGB 3Q1SL 5EU3A 5FA4B 3QIUA 5HHMB 1J7VR 3ZDXF 1IAIL 1JNJA 3BIKB 5FEBA 4FXLA 3ARFC 1DE4B 2WBJA 4ZFFB 2JB6B 4JFEE 4MDIA 1RZGB 4CU7A 3D18B 2O93L 3O3BB 1IAKA 1CF8H 4IRSC 9CGTA 3PL6A 5GGVL 1KJ2A 2R15A 2FEDD 3QWRA 4QOKD 5JHLH 3NZHH 3AS2A 5T1LA 3WS6C 4GS7B 4NWTL 3QHZL 1B2WL 5EWIH 4LLQB 3TYGL 2B8OT 4G42A 4PJAE 4QF1A 1LO5B 5K33A 5T3ZH 2J5LC 3TA3B 2VKXA 3LQMA 5TQ2H 3GSUB 1DANT 5C0DA 1JMXA 5IHZA 5KTEL 2IH1A 1NMCB 2EKJA 4N9GB 5CFHA 3ARBD 1U8MA 5F88B 4CVUA 1Q38A 4RGNC 4JO2H 3QQ9C 5F96L 2VDQH 1IKNA 4JKWA 3QDJA 1BVKA 2CRYA 1JJUA 1DL7H 1A7NL 4E41D 2JELL 4KKCC 4LQFH 2D31B 2HTKC 4APQD 3MREB 4QGYA 4QRTB 3OWEA 1UQSB 4X6CA 5EORL 5JUEL 3BKJH 1UC6A 3QG6B 3IDXL 4QRPA 4X99A 2KZWA 3AB0B 1A1NA 1T5XB 5FGSA 2A6JA 1LO3H 2UWEF 4LFHD 3VFGL 3PIQB 4NFCA 2FEEL 1WAAE 5E7FA 4IRJC 1AXSA 4Z7VA 3JWOL 1S3KH 1QSFA 1QRKA 2ZNWA 4N0RA 2EDFA 1Z5LA 4TTGA 3TN0B 2AW2A 1B90A 3QCVH 2YXMA 1U8NA 1N59B 4C56A 4FXGB 3OKOB 3O9WD 4FTVB 4R7NA 4N0YL 3SDXB 2A9MH 3QNYA 3DMMB 5SWZA 2CDFB 2D7PA 1N64L 2Y36H 3N50A 4NCC1 2DLFL 4P46D 4M5ZL 1B0RA 1BZQK 1JGVH 1DP0A 1ZGLB 5I1GH 2NY4B 2G9HA 3SDDC 2O5XH 2XN9A 1QPXA 4HH9A 4HDIA 3RUGE 3QEHB 5DUBB 4WFGE 2IQAB 5DYOB 4PRDB 1NUDA 4R7DA 2ZPKH 4ZUTA 1PAMA 1YPZA 1G1CA 1AQKL 1AIFA 1F6LL 4X5XB 1XR8B 3QT2A 3V0WL 5FV2A 4UMGA 1SJXA 4ZSOE 5DJ8A 4Q2ZA 3EDKA 3OX8A 1IM3A 5C0EB 4X6EB 3C87A 4JFPB 5C09D 1MJ7H 2VZVA 3QJHA 5IG7A 3REVA 5GRUH 4JO3L 3CCHA 3ARWA 3AREB 1RUMH 4OQTH 1UVQA 5IQ9B 4C58B 1BWMA 4HFUL 1YMMB 1NGPL 2V7NB 2VZ1A 3BPNC 3NN8B 3VFRB 1WTGT 1FAKT 2C3VA 3CFEB 2NTSP 1WF5A 4PFEA 3GGWA 4YGVB 1TCMA 4NJ9H 4GMSL 1ZT1B 4XI5C 3ZMRA 4MNQE 3EFDH 2EXWD 3NBNA 4ODUA 5E2TH 2WP3T 2EIBA 1KIRB 4R4BA 4BQCA 3BDXA 1WFTA 5FOBB 3C8DA 5F1SA 2EZ0C 3CMGA 3O2DA 4U1SA 4K7PL 4ELME 4WWKB 3KHOA 1R0AH 4LSUH 3I6KB 1FORL 3C60C 1QRND 3DURB 1OARL 2OSLB 3VRJB 4F7TA 1EHAA 4FXKB 2VIRB 3W9EB 1U91A 1RHHA 5J3HD 1QR1A 4O02H 1MCKA 5IMLB 4O58L 2XPGB 1FVEB 2BC4B 3N1PC 1IEHA 2P44B 3CSYB 2GHWB 1E27B 1KJ3H 4X6CF 3MODL 4L29B 1MCWM 4P3DB 5T33L 1WUNT 4FZEH 4WW1B 4F58H 3ULUH 2V9RA 1K3ZA 1KIQB 4GBXD 4ZUUB 2WV3A 5SX4H 3VGEA 1PSKL 4Z7VF 1LK2B 4MX7B 3S9DB 5ICYA 4JGJA 3MA7A 1EVTC 4S1SL 1EEYB 1A8JH 4I4WA 4K8RD 4FFWD 2YPVL 4QWWC 1OP3K 2UWEB 4RMWA 1P1ZA 3FT2B 1HNFA 4S1RL 3OKYA 3CX5J 5E2VL 3NCEB 4G8EA 3MRGB 3MLSL 4CADB 5KVFL 1J11A 3I84A 1JV5A 5J9PB 2WBKA 1ZXQA 5CGMA 1CGSH 1A5FH 1GGCH 5JORA 3L3DA 3EUUA 3SCMB 2VJXA 4H25A 4H26A 3DIFA 1BFTA 1J0YA 1XIWC 5EUKB 2DQIL 2XY1A 2CO7B 1JN6A 1S7UB 5TQ0L 2D7NA 2YUWA 1JMZA 4MCYB 4IHOA 1JRHL 1K6QH 1AQDB 5CILL 1FGVL 1H3TA 1YPZF 1NC4A 5L9DH 1IVLA 4PLKD 1NAKH 3GSRA 5LXGL 2X41A 1FNFA 3UTPE 3RZCB 2F8XC 2D7TH 4G6ML 3BPLC 4XPHL 4NO2A 5CCKH 1JHKL 2GSIB 5DRZA 2A0LC 5JQ6H 4KK6D 4V2CB 3RU8H 3OKLB 3QIWA 4Y5YC 4ONHA 2X4PA 1F11B 4IJ3C 1A14H 4LSTH 1DLHB 4D2NA 4OD2A 5C07D 2R4RL 3P73A 3O11B 4H88L 1AO7E 2O5YL 2VXUH 2VZOA 4L9DA 1EFXB 4LOUD 4AMKL 4OFDA 2XZCH 3VFNB 3WUZA 1DBBH 3E3QC 3IFNH 4OZHA 3TO4D 5JOEA 1CG9A 4MJ5B 1JGLL 2F54A 4HEME 4JQIL 3RQ3A 2DQHH 1ACZA 4PJ8C 3KXFD 2EIDA 3MRKB 2X4SB 2DQCH 2JK5B 1N8ZB 2ADFH 2FCBA 1S8DA 5BS0B 4PTUA 1MI5E 3RGHA 1UFUA 2NX5E 3QPQC 4NN5B 4YHOH 5FK9A 4P9HC 5EU3B 1OT1A 5E1AA 4AENA 5IFAH 1FVDB 2WBJB 5JXAH 4RNRA 4MDIB 1RVFH 5F3BA 1U3JA 4KROC 5F3HA 3X13A 5GGTL 1IAKB 5M94B 3HUJE 4XPAL 1YEHL 5KVGL 3PL6B 1JNLL 3KYMA 5D2LE 1KJ2B 2EDNA 1MOEA 4K3DL 1FP5A 1LNUB 4J3VA 1YYLL 2ZG3A 4ZO7A 4HW6A 4OCXL 3IU4L 2H1PL 3QAZB 1NBZB 1QKZH 4G42B 1WBXA 3GMMA 4QF1B 4YEFA 3RVTC 4U05A 3WDJA 4LLWA 2DQUH 4HIXL 2RFXA 4KVCL 4P23B 5C0DB 5IHZB 2EDTA 5DR5H 3RNQA 3VD4A 2F74A 1F90L 3BPOC 5FYLE 3ARGD 2RHEA 4QCIA 3WCYA 2R8SH 4K94C 3SKUD 4MA1B 4ODVL 1TITA 4KFZC 3QDJB 1BVKB 1MCEA 3HRPA 4OSUL 3BZDA 2CSPA 2VDRL 4DAGH 4HH8A 5DK2A 3LEXA 5GISH 1CD1A 4X6CB 3NABL 2AV1A 4QRPB 4X99B 3RWCA 1A1NB 3QUKA 4WUUA 1KJ2L 2EDLA 4M8VA 4YUEL 1MFBL 4RFOL 2YRLA 1X5LA 1AXSB 4Z7VB 5E6YA 1FAIL 2PETA 3V6OE 2J8HA 4IBLT 1SVCP 3JV5A 1Z5LB 1N5YH 4U6XB 4U6YA 5ANME 1A1OB 3QRGL 1U8NB 4FQCL 4NQCA 4P0DA 4JZNB 1LD9B 3O6LH 3VRLE 4C56B 5ITFA 2Y9RT 4HS8H 3K46A 1AD9A 4K3GA 3BQUA 3QNYB 4FOMA 4JGMA 5SWZB 4HWZA 3WBDA 3FRPG 4IRSD 5KVEH 5C08B 3TIDA 4PGEA 1B0RB 4DUWA 3U7AA 4CDHA 5BVPH 5F9JB 1E4WL 4MNGE 5IIEA 2G9HB 1FDLL 1HIMH 2HT4C 3QUZB 2CKBA 2DAVA 4LRIC 2XTJD 5CWSA 3DYOA 1K4CA 3QA3B 4YLQT 2A1WL 3EYFA 5IBTH 2W60A 2AABH 1EEQA 4R7DB 3DO3A 3FQWA 1I1CA 1YPZB 4ZPVA 5DS8B 1AIFB 1DQQA 3ROLA 1YNKH 4O2EA 1BD2E 2OI9B 1MCJA 2Z0BA 1F2XK 5DMYA 3IRPX 3ARPA 4XPBH 3DVNA 1CLCA 3DSFL 2PXYB 3GZKA 5DJ8B 3OX8B 3B9VA 5EO1A 4BYHA 3LEYL 4OZHF 3WFHA 1ZVSA 5EH1A 4RX4A 3VFSA 5C0AA 5CEZD 5CEXA 2HTKD 5HYJA 4TN9A 5IG7B 1UZ8A 3CUPA 1OSZA 3NIFF 3JVGA 1C1EL 3CCHB 3H6JA 3QIBA 3NCJL 2AXGA 2IEPA 1YN6A 4U1IA 4L4TE 1FO0A 4EJ1C 5CLWA 4LCUA 5GRYA 3OXSB 4IRJD 3SDAA 4CMHC 1J86A 4BQ9A 3JTSB 2C3VB 5TE6L 1EDQA 2OX5A 3GGWB 2R2HB 1EERB 2P48B 4NKIH 3MROA 3VWKB 5E6ZA 3O45A 3F7RA 4JLRA 2NY0B 1C7SA 5LBSL 3SQOH 1CFVL 1FLRL 2ZZUT 4D0BA 2VDMH 4G8GA 3ES6B 3HZVA 2VLRB 1VACA 4U1SB 4PJEF 1IGML 1SHMA 1ERNA 4F7CA 1OAUL 3LZFL 3H7BA 5E24E 4WI3A 3IT8D 1DEEA 4LVOB 1UB5A 2DICA 5EG6C 4XVSL 3T0EA 3R4DA 1X5GA 3S96A 1QUNA 4KKAC 4F7TB 3B43A 4E42B 1U91B 1WZMA 4JN2B 1QR1B 4NNYA 3CFCL 3BJLA 5TF1H 2B4CL 4L8SC 3X3GH 3I9GH 3WS3A 4MAYC 5GJSH 1AE6H 3TN0C 3JUYA 4XCCH 1ZTXL 3CH8A 1CU4H 4OLZL 4BA8A 1WIOA 1BM3L 1U8KA 4Z18A 1JNNH 4UT9H 3TWCL 3MLRL 3BKYH 4PGJA 4LSQH 4HUMB 5ICYB 3LVEA 3MA7B 3K1KC 3MRIA 2CK0L 2MKWA 1UB6A 2OCFD 2VN4A 2UUDH 3O2DL 4RSVA 3R0NA 1I9RH 4KKBC 5D7LD 1PKQA 1FPTL 3WFBL 4PGCA 1AY1L 5DMIL 1AHWC 4G8EB 2FGWH 4TPRH 4X6DE 4WHCA 5CHNA 4LLUA 1P4BH 4PRPE 1JV5B 4NGHL 1C5CH 3L3DB 5D1QB 4IIQC 4H26B 4QLRA 3DIFB 4XI5D 5AYQA 1I1YA 1KN2L 4P2QE 3WFCH 1JN6B 5H2BB 2L0DA 1NEZG 4XPTL 1OTTC 4IHOB 1Z0NA 4E5XA 1A6AA 4NCC2 1T21A 1FSKB 5E9DA 5T3XE 4JRXE 2ZUTA 1NC4B 1KELL 3I75A 3ESUF 4JRYD 4UDTA 4L5FL 1CLOL 3GSRB 5BRZD 1ZHLA 3F58L 1A1MA 3VXTA 4NO2B 1DTUA 3LEVH 3QIWB 4ONHB 2X4PB 5BV7C 1OGAD 2V17H 3WXWL 3F7VA 4U2YA 5ERWA 1IJ9A 5DJCA 2A6IB 4HBQA 2B2XL 3MV8E 3UO1H 3V5DA 2ERJB 1NLBL 3AM8A 4LEXL 4OD2B 3FMGH 3K81A 1RU9L 3D85A 4I9WD 5T5FH 3FB5A 3BWAA 2CGRL 3P73B 2XYCA 3PHQA 2VDKH 1KCSH 3D48R 4OCSL 1BEYL 3B9KA 4JE4B 2X4RA 1S7RA 3G08A 4YHIA 4OZHB 4P5KA 1GGBL 2F54B 4WJ5A 4ZTPH 3TJEH 1WQVT 4XNXL 1A7QH 5DHXB 2WINA 4M7ZC 1FRGL 3SJVE 5F1KC 2F53A 5E6IC 4TSCL 2P49B 1KG0B 1KPVA 4O51A 1S8DB 3LS5L 4PTUB 2C1OA 4FMFA 4WWKC 5HYFA 3UBXA 4M43L 5FK9B 4AENB 3WE6A 1CQKA 3U9PH 3PGDA 3WJJA 4J3SA 4RNRB 1ZA6A 3HTLX 5CD5C 5IGXL 4LL9A 5F3BB 5F3HB 2NQCA 3X13B 1I9EA 3A67L 2FH6A 1LGVA 3H9HA 4YIQB 3KYMB 2JJVA 4Y7MA 4M7LH 1ZHNA 4MA7L 3QXDB 5I66A 2AI0L 2CJUL 1XIWD 4PRHB 4RMTA 1G7MA 1BLNA 1WITA 5E4EC 4ERSL 5HGBA 1LILA 4YR6A 5KG9A 1WBXB 2G60L 3GMMB 2EICA 2BOBA 4G6JL 4LLWB 4WO4D 4LIQL 3U82B 4PJEB 4Z0BH 3SOBL 3RNQB 5F7MC 3ZYJA 2F74B 5JW3H 4QCIB 1PY4A 4OIBA 4LCCA 3GM8A 2A0LD 1ORSA 2QKIA 4OFIA 4HQQL 1IQWH 4L4VE 3VFWA 5AUMB 5DA4A 1BJ1H 4NC1E 5C1MB 1AC0A 2AVGA 4I5BB 4Q9QH 1SMOA 5DK2B 1FL3A 5EC2A 1CD1B 3K2UL 1J5OH 3MRHA 2NYYD 1BX2A 2AV1B 1TJGH 3RWCB 3S34H 1FLTX 1S9XA 4XCYB 4LSPL 3QUKB 4WUUB 5HHXL 1CICC 1RZFH 3VG0L 3CZFA 2X9WA 3P0VH 35C8L 1CDCA 5K93A 4H8WL 1IEAA 3OZ9H 5C2BH 1KIUA 4PJ8D 1T3FA 4OD1L 1H3XA 5KAQG 4U1JA 1F45A 2C4XA 3BKCH 3V52L 1QFUH 4NQCB 1FYTD 4K71C 1T7YA 2VLKA 3QPQD 5ITFB 3RZCC 1AD9B 2P8PB 1DUYA 1D5XB 4YHLH 1A6TA 4C55A 2W38A 3BQUB 5EU6B 4IRZH 5ISZA 4FQJL 5C8JB 4R2GB 2HWZL 2DQEH 1SEQL 4HKBA 5D5MA 1PD6A 3TIDB 4PGEB 3IDMA 2P42B 1W0WA 1Q94A 1T83C 5IIEB 4EKXA 2CKBB 5GGSA 2VC2H 3CVIH 3UTTA 5CWSB 3RDTD 4HBCL 3TH3T 5HJ3A 4B41A 1QBBA 3EYFB 3N1QC 3V6FA 4X80L 3K8KA 5FYJD 1P53A 4RMVA 3FQWB 5DK0A 4ZPVB 1DQQB 3H9ZA 3Q1SH 1OM3L 4F37F 3ARZA 4ZS6D 5TE4L 4Q6IA 5DVNA 3TZVD 3DVNB 2VXQL 4KK9C 2YS4A 1V3KA 5J06A 3HZMA 5EO1B 2XG5A 5GGVH 1FZMA 3WFHB 1T1ZB 1ZVSB 4NN5C 4PJ5D 2DJSA 2GJ6D 5EO0A 3VFSB 5K9OA 1H8NA 5C0AB 1HCFX 5HYJB 1UZ8B 3MOQA 4NWTH 3BIAX 3QHZH 1OSZB 3D1MC 3TYGH 4QXGL 2W9DH 1MPAL 3PL6C 3QIBB 2AXGB 1YN6B 5KTEH 4U1IB 2PYEA 3OKDA 4LCUB 5TDOA 2CKBL 7CGTA 3QAZC 2DKMA 4QNPE 5DEFA 3SDAB 5DMGC 5FCUL 5F96H 1NEUA 3ZTJH 1A7NH 3MROB 2PCPA 4P23C 5C0JB 2JELH 3FJTA 2F5BH 4ONOA 4K3JL 4JLRB 4F8QA 3CLEL 1N0XL 1UM6L 3IDXH 4P4RA 5D2NA 4EUPG 2AEIT 3GSXA 1T0NA 3DETC 2Z31A 1U8JA 2YA1A 3DRTA 5ADPL 3U0TB 3VFGH 4GXUN 5EBWA 1TXKA 3HZVB 1ZAGA 2P47B 3JWOH 4LCYA 3D0LA 3KLHC 3H7BB 2FD6L 3RRQA 2HT4D 4W6YB 2FECL 4HFWA 3L7FB 3S96B 5CJ8A 5EULV 3OKKA 1FO0L 1GYAA 4AG4H 4P2OB 1MNUL 2B5IB 4NNYB 4NQDD 4Y1AE 1N7ML 5D1ZC 1LE5A 2LTQB 2B20A 3TVMD 1N64H 4KPHL 4PJFE 4U49A 1KCUL 4M5ZH 3MFFA 1GZPA 3UTSD 2MPAH 5TDNA 1U8KB 1HSAB 2DYPD 4HGMA 4P2RB 3PDGA 4Y4HD 1UM4L 1JPGB 3TLRA 4UQ2B 1WTLA 4O2CA 3QEUB 4L3EA 3MLXH 4GLRH 2YZ1A 5KJRL 5KS9A 3NA4A 1GC1C 3KPRA 3MV9A 1YMME 2AJZA 1PKQB 4PGCB 3QUZC 3NCBB 4F2MA 2DJUA 2KKQA 3V0WH 1WJ3A 1M7DA 1RIHH 3ARXA 4G3YL 5CHNB 4LLUB 3UC0L 4PRNB 1MVUA 1J18A 2EIZA 3KLSA 1JIBA 4PBVC 5D5MF 3UPCA 3K8LA 3ZDXE 1HXMA 3B5GA 4JM2C 5CGYC 4H20L 4I1NB 4HG4J 1ITCA 4XXDA 3EOTL 2EO9A 3QDMB 3PV7A 5L0QB 2PXYC 3LDBC 4F37K 4J4PC 4PJDB 2EDOA 5DJ0B 3TCLB 3BN9D 5E9DB 5C2UB 3I75B 4UDTB 4HFUH 2N56A 4YDKL 2VXSL 1ZHLB 4EUPA 4R6UA 4GAJH 2R2BA 1A1MB 1ES0A 3VXTB 4DJMA 1OP9A 1MY5A 3MBEB 3LHPL 4KKAD 4GMSH 4LDEB 5E8DL 5ERWB 5DJCB 4KJPC 4DWHA 5IW1B 3D85B 3FB5B 4N1HB 3BWAB 3L95A 4NQEA 4G6FB 1SBSL 3PHQB 2QTEA 4MAYD 3F7QA 3B9KB 3MLWL 2X4RB 4G8IA 3G08B 4YFLI 3VWKC 4WJ5B 1HH9A 3R8QA 2HVKA 1FORH 2DKUA 2WINB 1P2CA 2K3TA 4UAOB 1ZLUK 3QNZA 4HKZB 5BMFH 1OARH 2V9QA 2F53B 5BZDA 1JI1A 4BQ8A 5E56A 1IE5A 2IPTH 3HE6D 4KKBD 3UBXB 1ZGLM 5E03A 3VGHA 4P3CL 1UEYA 3OHXA 3WE6B 3PGDB 3V79C 2PTUA 2QADC 3MODH 5EU4A 4LKCA 1UYWH 2F8OA 1ZA6B 5T1DH 3L7EA 3D2UA 3G5XB 5T33H 3WUWA 3ZT6A 4WFHE 1UH4A 5I1EL 1GXEA 1Z9MA 4OKVA 1XMWA 5D93B 1JI2A 1ZHNB 3CD4A 1YY8A 1PSKH 2EYSA 4NUGL 3QQ4B 5I66B 2P43B 4XP9L 3FHQA 3WIHH 1FE8L 5IP4A 4S1SH 5HGBB 4YR6B 1XF4A 2YPVH 5KG9B 3QEQA 5D9SA 5F7FA 1RZ7H 2AEWA 3RJQB 1P7HL 1FGNL 2HRLA 1V3JA 4S1RH 3MUY1 3RL1A 5AYUL 4Z7WF 1NEZB 1N3NA 1U93A 5DQJA 1N5AA 4YAQA 3CFBB 3AFLA 4JQXC 3C9NA 1T6VN 5KVFH 3IDNA 4I18B 2XNAA 3U4AA 3SE4C 2I5YL 2I24N 4LCCB 3EO1B 5M7QA 1MCBA 3WLBA 5I1LA 4XGZA 3VGBA 3STBA 1U92A 3VFWB 3ZE0F 2GY7B 3MJ7A 2DQIH 5ENWA 2VNCA 1IZKA 5TQ0H 4XXCC 3O4LA 4Y2DC 2BNRA 32C2B 3MRHB 4YHZL 1BX2B 4DQOL 5DFVC 3LKRA 5D1QC 1JRHH 1S9XB 3ARYA 4P5TD 3DGCR 3H3PL 4OZIA 1IM9D 1FGVH 2ZG1A 5KS9F 5F6IB 5DJXA 2OMNA 3CJJA 3QJFA 3CZFB 4N0FA 2YRPA 5LXGH 1RUAL 3ULVF 4K7FA 3P9WB 3EW3B 1IEAB 4G6MH 5I8OL 4S1DC 4XPHH 3IXAB 2BVPA 1JHKH 1JYVA 4MQ7A 5E6ID 1OAKL 1FSKC 3EYQC 4U1JB 1T4KA 3HE7A 3D3VD 1JWUA 4QXUL 3T2PA 4DTGL 2BY0A 2R4RH 2VLKB 3LPWA 5CGTA 4S1QL 1DUYB 5GS1A 1A6TB 2O5YH 5ISZB 2WWMC 2GIYA 4WI2A 2DM2A 3Q5OA 2NCMA 4PJGA 4LSRL 1DJSA 1TNMA 4HKBB 4X5LA 2COQA 5D5MB 1JGLH 5FA3A 4JQIH 3IDMB 1A4KB 1W0WB 2N1KA 1MJUH 1HI6A 4XP4H 4JRWA 4NZUL 3MYJA 5IBUG 5HI5D 1I7UA 3O81A 1KTRL 5GGSB 4NT6B 4PYGA 4MNHA 2ESVD 2PN5A 1HDMB 4OF6A 5HJ3B 4JZOA 4JFFA 3V6FB 1OP5K 3WNKA 2R29L 5DGRA 5DK0B 2JJTC 4LBEA 2X05A 1HHJA 3PQYD 4EN3A 3IJHA 3QFJD 4YHYB 3AS0A 3N1FC 4Q6IB 1RAMA 2R23A 5GGTH 1JPFB 4XPAH 1YEHH 3HZMB 2LAAA 3B3IA 1JNLH 1FZMB 4K3DH 1YYLH 3FL7A 2GYSA 1FZKA 2HP4A 2OZ4A 5K9OB 3SGJA 4RA0C 1XF3A 2F19H 3ZKQD 4OCXH 4JEGB 4X9HA 3OJ2C 2H1PH 1M71A 2LU4A 4TSAL 4X6CE 5E99L 2RJMA 4QRPE 2LVCA 5L2KE 3MRFB 4O5LL 4EI5A 1KLUA 2EECA 4N8PA 4HIXH 4KVCH 1WISA 1CICD 5FO9A 1J0HA 5E0QA 4QRRA 2PYEB 4HSQA 3OKDB 1F90H 5TDOB 1QSFE 5DEFB 2IFGA 2HH0H 1CR9H 2VZUA 3O8XD 3OTTA 4ODVH 1MIMH 4Q9RH 5EU7E 4UDUA 3KLAA 2PCPB 2VDRH 2ZUUA 5EA0H 5DVKA 2YD7A 1ZA3A 3U0PA 1F4WL 1MRDH 3NABH 5EIIA 2ZUSA 2VXTL 1OB1A 1KJ2H 1T0NB 1P84J 4JFDE 2Z31B 3STLA 3V6OC 4G8FA 4YUEH 1U3ZA 2DBLL 5EBWB 4RFOH 1QBAA 5IWLA 2XN9E 1R5IA 2QQLL 3BP7B 4GXUM 1A6ZA 1EAPB 4LCYB 3D87B 3VFUA 1TZIB 2GI7A 3GEWB 3L3KB 4MQSB 3SEPA 4HC1H 2Q8AL 1K8IA 1HWGB 3QQ3A 3OKKB 4EIZC 3GMQA 3QRGH 4FQCH 1HZHL 1U3HC 4Z7WB 4XZUA 1ZT4A 3CNKA 2DM4A 2BY3A 4OI7A 3HNTL 3BESR 2Z91A 3ZHLA 1GGYA 3QXWA 1XGTA 4KK9D 4GAYA 4ODXA 4DN4H 4OZIF 1GZPB 2MJWA 1DVFA 1JGEB 5IHUL 3QI9A 4TUOA 4U1LA 1JYXA 4KI5F 2HYMA 3MTRA 4XX1E 1KLGA 2ADGA 2CDEB 3KPPA 3MRJB 1ZANH 2R4SL 3ISWA 4R2GC 2PO6B 1IAII 4HPYH 5D7JC 2A1WH 5EIQA 1AGBA 4L3EB 5JPNB 5KS9B 3MV9B 1SVZA 2AJZB 4MMXC 1L6XA 4X9GA 5I30L 4F2MB 4HS6A 3VFOA 1D9KA 1M7DB 3IS1X 1TMCB 5C0FA 4YDLB 2EIZB 1BJ1J 1QSEA 3LEYH 1U95A 4PJGF 5EIVA 2EH7L 1MIEL 3T3PE 1VFUA 2IPKB 1HXMB 4BSWA 3MXWL 2OR8A 5JW5B 4XXDB 5DD0L 3VW3L 2DQJH 1QLRA 5IBLC 4Q97A 2Q6WA 3NCJH 1GC1H 2IAMC 2PTVA 3DJ9A 3HC3L 1EVUA 4EUPB 2J6EH 3OGCA 3KLHD 5L8JB 4JKPL 4QHLA 5TE6H 1NFKA 5I74B 3EZ8A 5SV4A 1MLCB 4ZUWA 1P7QA 3ULVL 2CUHA 5DFWH 5FGBC 3PP4L 3SDAC 5LBSH 4HKXA 3S5LG 5C6PB 3BZFA 2IGFL 2GUOA 2NPLX 3RVXC 3DUUA 5D1ZD 2EO1A 2NXYB 4YBQD 4M1DL 1IGMH 4WFGD 1HH9B 5IB4A 1TVBA 1OAUH 3LZFH 4Y16C 2YPLA 3VI3F 4XVSH 3UCRA 1JPTL 5BZDB 4KTDL 4R90L 1JGDB 2YN5A 4PB0L 4M61A 5F1NB 3AY4A 5F70A 1KYOK 2VO5A 3BZEA 2IANB 3CFCH 2MHAA 5I16A 3P4OA 2B4CH 1RUPL 1Z0MA 3OHXB 3TPKA 3B4NA 4ELKA 1UH3A 2AEQL 3UROR 5E1HB 5F93C 4BZ2L 3P2TA 4LKCB 5EU4B 5E8EB 5J57B 4PP1D 4LCWA 1CFBA 3L7EB 3HR5A 3X11A 1ZTXH 3F7YA 4XNMA 3B8SA 1YN7A 4P2OC 15C8H 1IC5L 3T04D 4OKVB 1Q0YL 3B9DA 4OFKA 5DEGA 1BM3H 5T1KD 3TWCH 1YY8B 3MLRH 1U8LA 2EYSB 3LQZA 1O0VA 1NAMA 2D7MA 1BIIB 2CK0H 2N7BA 4J4PD 3O2DH 3QEQB 1Q9KA 1IQDA 3E6HA 5D9SB 1YQ2A 5F89A 5F1OB 4OCYH 4OFVA 3RL1B 3WFZA 1FPTH 3WFBH 1J87A 1N3NB 1AY1H 1U93B 2M1KA 1LEGA 5DQJB 3I85A 3BMVA 1WEJL 3IDNB 2XNAB 4MNQD 5EZOH 1OY3B 4ZXBB 4CRPA 2YN3A 3PG2A 5I1LB 4XGZB 1AI1L 1U92B 4PBXA 4HXBL 4KJPD 5SWSA 2CPCA 5IR1A 4CU6A 1HOCB 3D39A 5ALBH 4XPTH 1QLEH 1PGRB 3HNSL 3ZE1E 4OZIB 2YUVA 5DJXB 2HVJB 4LIQE 1KELH 1G7JB 3QJFB 4L5FH 4N0FB 2SEBB 1RK1B 5L7XL 4TOYH 1KTKE 2DQDH 4N5UA 1JTTA 3GJEB 2BVPB 4J8RB 2BNQD 4MQ7B 1CBVH 4FQPA 4XHJC 3WXWH 1BQLL 5GGQL 3HE7B 4G80A 3TYFA 1KPRA 3GKWL 4LEXH 1RU9H 3HZKA 2JE8A 1MELA 2CGRH 5DTFB 5GS1B 1AGDA 1KB5B 3RHWF 3KJ6L 4OCSH 5MP6L 3L5XL 1EFQA 3MBEC 1BEYH 2ZOLB 5JA8B 2P24B 4RFEA 1GGBH 3W2DL 2HJFA 4P9ML 4X4MA 4P4KA 2ATKA 1PJ9A 3WD5L 4YDJA 1MUJA 1FRGH 2NY1B 2J1KA 3MYJB 5D7KE 1I7UB 4TSCH 1FBIH 4MNHB 3PNWA 1XF1A 3LS5H 3SE3A 2MQ3A 4JZOB 3PWVA 3U7YL 4JFFB 4DUXA 1SM3L 2D2OA 4M43H 4GSDH 1ZGLP 3CXHK 1BJMA 1HHJB 3V9FA 2K7PA 4JR9L 1DN0A 1X5IA 4R3SA 5EOQL 4EN3B 3IJHB 2OM5A 4HMEA 2Z8RA 4JG1L 2EC9U 3WLWD 2R23B 3JWDL 3ZTNL 2X10A 3B3IB 3CPLA 1Q1JL 3ALWA 5J13B 4PS4H 5JXEC 2EYTA 3CVHB 3QXAA 4ZDHA 4MA7H 1FZKB 3PABB 4JKMA 1XF3B 2CJUH 5J11C 2CDGA 1KENH 1LP9A 4P99A 4ERSH 4Y2DD 3MCLL 1MREL 4WUUE 2G60H 5DFVD 4G6JH 4EI5B 2OJEA 2UY7A 3FQRA 2XICA 4LIQH 5DUML 2VDNL 4TUKH 3VE0A 3SOBH 1I3VA 4QRRB 5HDBE 3BRFA 3BGMA 3OSKA 4RAUB 2UYLB 3QWOB 2V7HA 4HGWB 3ARBA 1G9NC 4NQVB 4S1DD 5EOCL 4NC1C 1HXYA 1DBAL 1Q72H 1BHGA 1I75A 3EYQD 1AO7D 3KLAB 4NQCE 5JZ7C 4KJQC 5EC1B 4JDTL 4V2BA 1BGXL 4KY1L 4U3HA 4E41A 2FIKA 3VXUE 1KEGH 3B2VL 4I18C 3K2UH 1WSST 2DI9A 4MD5A 4IOFC 2WWMD 2LQRA 4LSPH 5HHXH 1N6QL 1NCNA 2DQFA 1WFNA 2OZ4L 4G5ZL 35C8H 4LPCA 3UP1A 1MI5D 5LQBL 5CBEA 2NX5D 3ZDZF 1NJ9A 3H9SA 4KRPC 3QQ3B 2EDWA 3G5VA 2X4OA 2CXKA 5MI0C 3GMQB 4R4FL 4KUCF 3BO8A 3ROOA 4XZUB 1ZT4B 1A7PH 2O26U 4OV5A 1MAML 4OAWA 3O9WA 2Z91B 3GKZA 4JHWL 4X4XA 3MACH 1UM5L 1XGTB 1SEQH 4PREA 4OZGA 4GAYB 1UCTA 2R1YA 2J8UA 1WT5C 5HHOD 4Z95L 1JP5A 1MHCA 4ODBD 4TUJA 1DVFB 1QLFA 4L1DA 3QI9B 2BERA 4TUOB 3S88L 1MFDL 1NGWA 1QHOA 1TZGL 1KLGB 2ADGB 4YHNA 3KPPB 2OJZL 1B6UA 4K23L 1OW0C 1A3RL 4HBCH 2XRAL 3DV6B 1MFNA 1QFWI 1AGBB 5FYLD 4J3TA 3RHWK 5JOFB 4HWNA 2P4AB 3NFPB 5JPMB 4JY5H 5BCAA 1GIGL 3B2UC 3MA9L 1XF5A 2BVEA 3FQUB 4HS6B 3VFOB 3R1GL 5DURB 3MUHL 5C0FB 1QSEB 3I2CH 1U95B 4U3CA 2XIDA 2JJSC 5TE7L 5F1IB 3T77A 1YEDB 4BSWB 3W81A 2PF6A 4DN3L 1UACL 4ETYA 1XGQA 5TGBA 3ILPA 4G8GE 1YJDL 2IALA 3GMPA 3VXRE 4K2UL 1FVCA 4PJHB 3VG9B 3HAEG 1CXIA 3WL9A 1VKXB 2CKBH 2Z92B 2BVYA 4X7SL 4JFXA 4HX1A 3VGAC 3ZE2F 3HNVL 4MD4A 3AXLA 4QHLB 3T0EE 4YNYA 5C0ND 2QSTA 5FCUH 2MWCA 1LO2H 4NRYA 4ZUWB 5ACZA 1P7QB 3GBNL 4B5EA 3B6SA 3HC4H 1U3HD 5H37G 3ZZ1A 4HKXB 2X4NA 1UM6H 3RPIA 1LP9F 2XZAL 4Z7QF 2GUOB 3S3SA 3DUUB 1WWBX 2FL5A 5C7XL 5E8NA 4CGTA 1SQ2N 3ZT5A 2FD6H 4UIMA 1X6LA 3HS0A 5D7JD 1CXKA 1XCQB 1EMTL 1QRNA 1BD2D 3QCUL 2Z31C 4F9LA 1RY7B 5CUSL 3IDYC 4M61B 3K4DA 1PKQE 1MNUH 3BZEB 1OCWL 5I16B 3RFZC 1MHEB 4ELKB 5T5NG 3QDHA 2GITA 1UXSA 1WVZA 3P9LA 4FHBD 5I1CL 4RZCA 3KNBA 3T3MF 4NM8H 2D0FA 3HR5B 2YPKB 3X11B 4XNMB 1KCUH 4OGYH 4OBRA 2BHYA 3M1BA 4FZ8H 2X1OA 2X4QB 1XGRA 5GSVA 4KK5C 4PGBB 4HUXA 3UPAA 1U8LB 3LQZB 3OF6D 3IAQA 1FNEB 4G9DA 2D4FA 3TGXA 4OZFG 1NAMB 1UM4H 4FFYL 4PJ7B 3O2VL 4L4TD 2WIMA 1R5VA 4HUWA 4BUGA 5KJRH 1IQDB 1KTDB 3QWQB 3WIIL 3I50L 2IAMD 4KU1A 3BHBA 5F7YC 3QYCA 1LEGB 3CH1A 4Y4KA 1DCLA 3A6BL 1S78D 2PO6C 4G3YH 4Y89A 4LARH 3UC0H 2VUYA 4ZFZB 1RK0B 4FABL 3D25A 2Q86A 4OZGF 1DBJL 3PF2A 5AWNH 1NANI 1LE9A 4IMKC 1BQHG 5SWSB 4H20H 5IR1B 3HA0A 3EOTH 2BDNL 3D39B 1YY9C 3NIGF 5GIRA 5IVOA 1G9EA 3RVXD 5GS0C 4HT1L 5A2KH 4V1DE 4Y4FB 5F7LB 2A6KA 2DQTL 1R3LA 2CLRA 3TO2A 1SJHB 4LGRB 1DDHA 5JDJA 4YDKH 1NAML 1WCQA 2VXSH 3EO9L 1CLZL 4Y16D 2F53E 4TNWF 4G43A 5HVWA 1KEML 3LHPH 4GRLD 3RNKA 1QOKA 5E8DH 4PIRF 5CAYB 4G80B 2A83A 3SO5A 3UZEA 3TYFB 1KPRB 5FM8A 2ZJSL 1M05A 3WJLC 5C07A 1C16B 1SBSH 1AGDB 25C8H 4LPTA 4R26L 5I74C 5HXMA 5EOTA 3DX6A 4RFEB 1JHTA 2JIXD 2HJFB 4HIJA 3TO4A 2UZIL 3BD5A 3LKNB 4P4KB 2ATKB 2HFTA 2VE6A 4YDJB 1MUJB 5ESVA 2R2EA 3BD4A 1X5XA 5HVHC 1FIGL 2BSRA 4F7EA 3KXFA 2Q7YA 3MRLA 5BQ7B 3PNWB 1AFVL 3DGGA 2NXYC 4WI7A 4UTAH 4U7MA 2P7TB 4LPYA 3PWVB 5AZEL 2R0WL 1RZIA 1BFVL 3FO0L 4PRPD 5DMKA 4AT6B 4LP4A 1HCVA 1KACB 1I3GL 1JF6A 2QQKL 1DN0B 4R3SB 4CN1A 3FOLA 2FR4A 5JHDD 4P2QD 4W4OC 3ALPA 4PJXA 4GUPA 3CPLB 3QXAB 1WC7B 4NUGH 3MFGB 1M1SA 2W0FA 4XP9H 3VFMA 2I26N 2CDGB 5T3XD 4QOKB 4JRXD 2APBA 3T65A 5L88L 4ZNCD 2YD2A 2OJEB 4EBQL 1JZ3A 1EJ6A 3FQRB 3AS1A 3VE0B 4HWBA 5AYUH 4S0SD 4XB8A 1IMHC 1TPXC 2V7HB 3CU1A 3MV8D 3ARBB 3VI4F 1LEIA 1RMFH 4K9EL 1HXYB 1V7NL 5IEKA 3L3OA 1U0QA 1F58H 3VXNA 5AAMA 4LLAA 2H32A 4E41B 4C83B 3MRBA 1IT9H 4HXAH 4RGMB 1I7ZA 4APQB 4MD5B 4QTIL 3MLZL 4ZXBC 3V4UL 4FFVC 3ZSTA 1JWSA 2DQFB 3SJVD 4OFPA 4ZNEE 4JG0L 1NCBL 1NLDH 4UT7L 4FQ1L 1X7QA 5HDQL 5KVDH 1P4LB 4OLUH 5GGRY 2VR5A 4NHCL 3UTTE 1RJZA 1T1XA 3L3HB 3L1OH 3V7MA 3G5VB 4L8DA 2X4OB 4XVTH 4NZJA 2YA2A 4DTGH 2JLLA 12E8L 2XWBA 4KI5C 4ZAKA 4HCRA 3ROOB 1P5VA 3AROA 4S1QH 3C08L 4ZODA 4OV5B 5IOPB 4OAWB 3O9WB 3AMLA 2A74A 4X4XB 3TCXA 2VLLB 4KQ4L 4XWGL 1AXTH 1MFAH 3ARFA 4QXWA 1OD7A 4XMPL 4UNVA 3HE7C 4IOIA 4LSRH 4OZGB 4PREB 1BPVA 1IC7H 4B7LA 2R1YB 5K9QG 4LAJH 4WCYL 3O4OB 1MHCB 4IRSA 1J1PL 4TUJB 1QLFB 3CMOL 4P46B 5JXED 3ULUF 3OPZH 4NZUH 2OK0L 2CD0A 3V8OA 1NMBH 5TJWK 5DHYA 1KULA 4RRPA 3WS6A 3SBWC 3IXTA 1O7SA 4X8XA 4U6VL 2NY1C 5DC9B 4L4VD 5C0CE 4KKLC 1OD9A 4U33A 2ZWLT 2LE9A 1CQYA 4N90E 5EWIL 1T0MA 5IVXF 4M48L 5JZ7D 1X5ZA 4KJQD 5T5NF 1E4XH 3T77B 4NWUL 5E99H 4TSAH 5D2NE 5KSAD 1XGQB 4IOFD 4I2XA 5I1JH 4O5LH 4GRWB 1UWGH 3GMPB 4O2FA 5J13C 3FFDA 4F7MA 3C8KB 2HRPL 5EU7C 1DL7L 3WL9B 2QJDA 4QRQB 4JFXB 4HX1B 3UYOD 3TV3L 1U8PB 4GRMA 3PWUA 1UKQA 4IRJA 3AXLB 2AJVL 3WHE0 43C9B 3GM0A 3BH8B 3K1DA 4YNYB 1JBJA 4KRPD 3PHOA 5ACZB 2HLAB 3C6LD 4PJXF 4WU7A 3WO4C 3B6SB 1GCFA 1F4WH 2RBLA 4LPXA 5DRWB 4MJIA 2VXTH 1I1AD 5E8NB 5FOJA 3SDCD 3QUMA 3N1GC 1OP5H 3GDBA 5H94A 4KWUA 3RWIA 4MDJA 3WXVL 2RAMA 3SDDA 4UIMB 2Q8AH 1HHKB 1QRNB 4L3EE 3OJDA 2Q76A 3UTZB 1NGZA 1HZHH 3DVGA 3KPRE 3ULVE 3WIFA 1OAZH 4JPKL 5AG9A 1VHPA 4NBYB 4MA3A 3DUSB 5I1GL 5JW4Q 1QACA 1X5KA 2GITB 4PRBA 1UXSB 3P9LB 3KPMA 1NFDE 3KNBB 2QQQA 4RZCB 2I07A 4HWUA 4JANA 1YEEH 2H9GB 5IHUH 1XGRB 3BN3B 4XBGA 3H0TA 4GBXB 1E6OL 3T0XA 1HINL 4G9DB 5IW3A 2R4SH 4J3WA 5TF0A 4Z7OF 1I7RB 5T1MA 5CBAA 3QP3A 1MH5B 1R5VB 4HUWB 2ORBL 3S37H 5EUOA 4HD9A 5LGJA 1HE7A 2ED7A 5L8LB 2WK2A 5CP7A 3KPLB 1NBQA 3DV4A 4H5SA 3DO7A 3BT2L 5D7LA 5I30H 3TEUA 5HDOA 1WFUA 4H1LG 3MV7E 1OLZA 3MXVH 1EH9A 3VFTA 5IEHA 4JQVA 4YFDB 4DVRL 3HAEB 3IKCA 4TTDC 2IQ9L 3D25B 4M62H 2EH7H 1MIEH 2VERN 3WV0A 5L6YL 1WLHA 3V6ZB 3VH8A 1F42A 2DIJA 3LN4A 1RUML 3MXWH 4NQEE 4LKXA 3WEXB 4JFHD 2NY4D 5GIRB 4ENED 3QQNA 3D9AL 4Y2OA 4NRXA 4JZJC 4UNUA 4XNYL 1U36A 1T89C 3HKFA 2A6KB 1R3LB 3ELAT 2CLRB 3TO2B 5M95B 4XC3L 1DDHB 2X42A 4XCEB 1GPOH 3EFDL 4JKPH 1MY7A 4G43B 4KXZI 4MXQC 2QHRL 3C60A 4CJ0A 3RNKB 4Y1AD 4POUB 2O61A 5E8PB 3VG9C 4CN4A 1OGAA 5F7KC 3MNVA 3SDYL 1KB9K 4DKEH 3U4BH 3HC0A 3GBLA 4LSUL 3K7UA 5C07B 4X7EC 3NTCH 2IGFH 1VFMA 3KVQA 5D7IE 5EOTB 5GS0H 1PYWA 2FECI 3DX6B 4WHTA 5IVXB 1IZJA 4HIJB 3TO4B 2FATL 4GXVL 2VZTA 1K5NB 2VE6B 3ARED 5ESVB 3TBWA 3VXOA 3C5JA 4XP5H 3LV3B 2BSRB 5ILTL 1BOGA 1JPTH 3KXFB 4KTDH 2Q7YB 3MRLB 3QEQE 3DGGB 3C6SA 4HUUA 3KWWB 4R90H 4PB0H 4PB9L 1R24B 1YC7A 4FZEL 3ULUL 4OZFB 1FYHB 3WNPA 4EUPH 3DRQA 3LB6D 2NMSA 2XWTA 3U6RA 3LRGA 3FOLB 4Y5XB 1M4KA 2ED9A 4GMTL 1IC5H 4IS6A 4PJXB 1Q0YH 5F8QC 1S5IL 3VXSA 1NUNB 1WBYB 3O4LE 1ULVA 3RPKA 2BNRE 1I3UA 1JTOA 3VFMB 4EOWL 4HPOL 5SX5H 1XIWA 1YY9D 3T65B 3RKDC 1CZ8L 3WNOA 5FUCC 3EJZC 3VDBA 4OZIE 1BQHB 2M8XA 5DRNB 4RAVA 2KH2B 1GHFL 1MSPA 1IGFL 1CIDA 5EZLA 4N0UA 3CDFA 3B83A 3NAAL 4M4RA 4WU5A 3HG1D 5IKCA 1PZ5B 3ARGB 4XTRC 1RULL 5IEKB 3L3OB 5LKNA 2DOCA 3MV11 3VXNB 4HXBH 4Y5YA 2X7LA 4EDXA 2BSSA 2H32B 4MWFA 4JVWA 4G6KH 5B38G 3NCCB 1T5WB 5HYSG 1MCPL 1QYGL 5GRVK 5LG1A 2BNUA 1I7ZB 4KHXL 4QTHA 5HY9A 4YBHA 5F7DA 3HNSH 4PJGE 1OAXL 5JQ6L 1WWWX 2CUMA 1JWSB 5EUOF 4LSSL 3HI5L 1B3JA 1Q8MA 3ARDD 3THMH 2A77L 1X7QB 1PX4A 2CUIA 1RFDL 4PJ8A 1T1XB 1KF9B 1NGYA 2ILLA 1BQLH 4Y4FC 5GGQH 2YSSA 4HWBL 4Z5RA 1DBBL 1NDGA 3GKWH 2L4OA 2D03H 5D6DC 4PRAA 4ZAKB 4RISL 5F71A 5IMOA 3WKNA 2MQCA 1FYTA 3AS3A 4WFHD 3FO9A 5HYQA 3CFDA 2BSTA 2MKLC 4W6XB 1UXWA 3BYTA 3L5XH 4NO3A 5MP6H 1D5MA 5JDSA 2QEJA 4RMQA 2DQCL 1MJJB 4WV1B 5FGCE 3W2DH 1KT2A 2GY5A 4IRSB 2V9TA 3WD5H 3SGDI 3RWGB 5H8DA 3U36B 1YEKH 4CAGA 1G7IA 1ZVHA 1A7OL 5DHYB 2GEEA 5JXAL 3EOYG 2GAZA 2XTJB 5EBLA 1RVFL 3EJYC 3U7YH 4D9RE 2XI9A 5FO7A 4LCIL 3VGGA 4NDMA 2J5LB 1INDL 4JR9H 3VI3E 5EOQH 3EOAA 2NY2D 2C4FU 2X09A 2MOVA 1T6WA 3IFOA 1X5AA 4JG1H 3T0AA 1URLA 3FRUA 3HRZA 5GRVL 1T0MB 1Q1JH 1JPSL 5GRWA 4U1HA 4HCRL 2EDXA 3L3GB 3DVIA 1KB5H 4PJ5A 2GJ6A 5F6HI 4L1HA 4JY6A 4LAQL 5HGAA 2EC9T 1A9EA 4YC2B 1MREH 2VL5A 5B22A 4I2XB 4PRIA 5TDPB 5DUMH 2VDNH 1NCTA 1INEH 3GSNA 4BKLA 3FFDB 4F7MB 2RQ8A 2BVUA 3OKMA 2FEDC 1RZKC 3LOWA 5EOCH 3PWUB 4IRJB 3QIUD 1DBAH 5B4MD 1I8IB 2LVEA 3PHOB 4JDTH 1BGXH 3QHFL 4JHAL 4KY1H 3VXMD 2VLJE 1XT5A 5FYKH 1XH3B 1B88A 4MJIB 1T22A 1N6QH 5T1LD 3CVHH 1ZSDB 1LQSR 4KZDL 1N5YL 1ETZA 3N0PB 5CMAA 3QUMB 5IB5A 5LQBH 4RGMC 3O6LL 4APQC 5IROC 5H94B 4I3GA 4HS8L 4MDJB 1TQBC 2APTA 4MCZB 4LRIA 3OJDB 4KMQA 1BFSA 2Q76B 4AH2B 3DVGB 4UB0H 4XPFL 5KVEL 3X12B 5IFJA 1MAMH 4X8JB 4MA3B 3S98A 4NQDA 5BVPL 4JHWH 4PRBB 4KKLD 1UM5H 1QSEE 3MGTA 3KPMB 4N8VG 3ILQC 4U6HA 2I07B 2X89D 4C59B 4JANB 5FHAL 5L2KD 5IBTL 2AABL 4KHTL 3UTSA 1MFDH 3S88H 4XBGB 1TZGH 1NKOA 1RURL 2DYPA 2OJZH 1I4FA 4K23H 1A3RH 5T1MB 1DE4A 5CBAB 2XRAH 3HB3C 1RZGA 5KANI 3D18A 3BSZH 2YD5A 1B4JL 1QSFD 5EUOB 3O4OC 3O6KL 3QUML 4P46C 5CP7B 4NSKA 4XCNB 3DO7B 3MA9H 4OV6F 2MCPL 5D7LB 1QTYT 4JJHA 2DL2A 3VFTB 5IEHB 1A3LL 4PJ9C 4EDWH 3IKCB 1F4YL 3ABZA 3UEZA 3VH8B 3LN4B 2WNGA 4JFDD 4LKXB 1HQRA 4DN3H 2MSPA 5F88A 3TC9A 1YJDH 2XN9D 3OKEA 4NRXB 3V8CA 3TBYA 1H15A 3X17A 1CXHA 3SGEH 2RIKA 5JW4N 4NKIL 1TJIH 1Q0XL 4X7SH 5IB2A 4JRYB 2YPLE 1TTGA 5BRZB 3IDGB 2D7QA 3MREA 5CSZA 1J8KA 1UQSA 4TVPE 2APXA 4GQPH 2O61B 1QVOB 5DC4B 3JV6A 1OGAB 3MNVB 4ZMAT 3OAZH 2J3SA 3GMRA 1AD0B 2G75A 1W8NA 3VJ6B 4GT7A 3VD9A 1C7TA 4DEPC 4LCWE 2XZAH 4GG8A 4L8SA 5D6CB 1TVHA 3F7PC 4MAYA 1DN2A 4WHTB 3TN0A 3AGVA 4L8BA 1BWWA 5JMRA 1NQBA 3TBWB 4OT1H 1IGIH 1MQKL 1UKSA 3VXOB 5TF1L 2MQ0A 2FBOJ 1BOGB 1GGUA 1EMTH 1KNOA 3X3GL 3I9GL 4NCDA 1QBLL 4HUUB 2ADIA 3C6SB 3DWTA 5CUSH 5GJSL 4YPJA 1P9MC 2CR6A 2CDFA 4GKSA 3OR6A 3FB8B 1OCWH 5BJTA 3DRQB 1CL7H 3IAPA 4QYOB 3ZDZE 3MX0A 3OKNA 2GJZA 5IHBA 4B7IA 3BKYL 1NUFA 1AHWA 2F58H 1BMGA 2IBGA 5DUBA 5TFSH 2Q1EA 4TTDD 5SWSE 5J3HC 1S9YB 5A3IC 4CMMB 3D39E 4X5XA 4IIQA 3FZUC 2ICWI 4FFYH 1EZVY 2IPUG 4M7JL 4LPWA 1XIWB 3C09B 3QPXL 4TPRL 1EO7A 1NCUA 4RFNC 1VGEL 1P4BL 2QSVA 4GKZA 4MB4A 5IMMB 3MOAL 3SE8L 2CLVA 3GMNA 4WO4B 2YHGA 5C0EA 4GBXC 3RVWD 3ARRA 4N0UB 3A6BH 4HIIB 3STZB 4GJTB 5IKCB 3WFCL 4MXQD 3MJGX 4JY4A 3BPLB 4K8RC 2KZ1B 1DBJH 3EZJB 2AJXL 2NTFA 1I1RA 4Y5YB 5FUOH 2X7LB 5C0BE 4EDXB 2BSSB 4PBWD 1B4RA 1K9TA 2BDNH 3WFEL 2V7NA 3VFRA 4QTHB 5HY9B 3EOBA 3CFEA 4HT1H 2DQTH 2ZCHL 2BCKA 1IM9A 2V17L 1RIUL 1NAMH 4PV9A 3EO9H 3DOSA 5KSBA 3FMGL 5KZCB 1KEMH 5JIIA 1ZOXA 4PJ8B 1KIRA 4YWGH 3DYMA 1NGYB 2WM0A 1C08B 5E6IA 1QA9A 3WIHA 5E08H 2YSSB 1NDGB 3D3VA 3ZKSD 1H8SA 4PRAB 4PLKC 4WWKA 5IMOB 3K4ZA 4IOSD 1FYTB 1ODAA 4ZTPL 5HYQB 2BSTB 4R26H 1G7QA 1UXWB 4NO3B 4MYWB 1D5MB 1BREA 2FJGB 2V5TA 4KK6C 5I1DA 3VRJA 4HK3J 3OXRA 1KT2B 3Q0HA 4WDIA 4OF0A 3ARUA 1FVEA 1LP9E 1FIGH 3T2OA 2ZUVA 4Z7QE 3KGRA 2K9UA 4LOUC 3TNMB 1G7IB 2PR4L 3U9PL 1AFVH 1E27A 4UIKL 3RKDD 2ARWA 5EBLB 5AZEH 3RDTB 2R0WH 1BFVH 3FO0H 5FO7B 2VR4A 5DF0A 4NDMB 1DQML 4J2XA 1FJ1A 1I3GH 1KIQA 2QQKH 5IB1A 4M7LL 3S36L 3EOAB 4MX7A 4WTXA 1MJ8L 3I6LE 3IFOB 2PTTA 4A2LA 1VCAA 3TZVB 3FRUB 3HRZB 4XTRD 4BM7A 2WANA 3L5JA 4U1HB 1MHHB 4E41E 2GTZB 5I17A 4PJ5B 2GJ6B 4XBPA 1CDHA 4JFZL 4P9HL 5LAXA 5C9KA 4Y5XC 5ACMA 3T3ME 5HGAB 1FH5L 1A9EB 5L88H 2VL5B 4QHNB 5J9PA 1LEKB 5DD6B 1J1OL 5FDYA 5GRXG 3MLTA 5HYSB 3GSNB 3S35L 1CICA 3OKMB 3I6GA 3H9SE 4K9EH 1S7UA 1GH7A 3RBSA 1V7NH 3MO1A 4MCYA 1W8OA 1CGWA 1P5UA 3W82A 1B6DA 1QPPA 5FYJL 4URTB 4OLXL 4OGXL 5T3ZE 4AJ0A 2NY5C 2OL3A 3P0VL 1M6OA 3RZCA 2CQVA 3ARGC 3MLZH 3OZ9L 5C2BL 4K94L 3NACH 4OZGE 1T22B 1CGUA 3V7AE 2J8UE 5DJ6A 3OKLA 5D7KD 4JG0H 1F11A 1NCBH 4FQ1H 1PZUB 3BKCL 5CMAB 5HDQH 5IB5B 3P9MB 1TQCC 1T83A 4YHLL 1S9KC 1F4AA 1EFXA 4IRZL 3KYAA 3HPJA 2D4DA 4J3UA 3QCTL 5GXBB 1AGCB 3MRDA 2E8YA 3FQTA 3GSNL 3EJYD 12E8H 2FO4B 3MZTA 4EIGB 1I9JL 2L7JA 1J88A 4P2YA 3C08H 5IFJB 4QHKJ 1TCRA 4NQDB 2H3NB 4XWGH 4YQXL 4XMPH 3P77B 1V3MA 4DOHE 5BS0A 3L5WB 4WCYH 1KCRL 3TVMB 1J1PH 3CMOH 5HHPB 4WUUD 1NPUA 3UTSB 1EJOL 5IMKA 4PJAA 2OK0H 2NZIA 2ENYA 3FHAA 2DYPB 5KSBF 4OF8A 1I4FB 2YD4A 1FVDA 3MUJA 4Y4HB 1ZKAA 2EYRA 4WV1C 1IBGL 4U6VH 4YXLL 3OB0K 4NSKB 2RB8A 1LNUA 2H2SD 1JZ6A 4NQCD 3S4SG 1CE6B 4ZO9A 4CMHB 1NBZA 2XTJC 3VXUD 2UVFA 4FNLL 2FJHA 3VD3A 4M48H 2W9DL 2VSDA 4HC1A 3WO3B 5HTSA 4NWUH 4P23A 2I9TA 2P5WE 3CDCA 4OZ4A 1HQRB 3LCYA 4Q58C 4NBXB 3K0WA 2Y25A 3C5ZC 4HF5L 2KDGA 5I73C 3OKEB 3TBYB 1H15B 1WAAA 4ONGL 1FNAA 5BZWB 1KYOJ 1L0XA 4O4YL 5GGUA 5TH2B 2YK1L 2HRPH 5I1KL 5IB2B 4R8WL 5JW4M 1FIEA 3TV3H 2F5BL 3P30H 2IMNA 1UZ6E 2AJVH 4YC2C 3ZL4L 5BOPA 3T1FA 5CSZB 1KCVL 1A6WH 2X9YA 2AK4E 5IK3B 4FRWA 4CVXA 3AAZA 3JV6B 4H0GA 3CGTA 3GMRB 4PD4K 2G75B 3VI4E 2XFXA 4RX4D 4Y8AA 6CGTA 5DD1L 1A0QH 4L3AA 3JXAA 4GG8B 4L8SB 2C7UA 1TVHB 4MAYB 1N4XH 5D1ZA 3ILQD 4JHBA 3VFPA 1G6RA 1ADQA 2XXMB 4U6XA 2FX8L 1A1OA 3UXFA 4Z7NF 1XCTA 4JZNA 4L8BB 4AG4L 1LD9A 4N8VB 3WXVH 1J1XL 2WWKO 2FO1A 3MNWB 3GSQA 1DR9A 3FO1B 2AJYL 4GRWH 1KNOB 4NYLB 1NUGA 2ADIB 3HB3D 2H26A 5F21B 1A64A 4JKLA 4LEOA 2EE2A 4NQTA 4GKSB 3OR6B 5C08A 4JPKH 4JHZA 4ZSOA 5BJTB 3HE6B 2W0KA 3RWDB 1RJLB 2MPAL 5F9JA 2DI7A 5B3JF 4NC2B 3O41A 2GJZB 3OKNB 3QUZA 1OQOA 3T4AA 1AHWB 2J6EA 3QA3A 5KW9H 4PJ9D 1R3HA 3RY6C 5E8OA 3ZKMD 3ESVF 4HJJL 3MLXL 4G8GD 3B8YA 3BRGC 3JUZA 3S4SA 2DLGA 4K3HA 4XNZB 5DS8A 1E6OH 1HINH 3DI2B 4IIQB 3VXRD 2WUBL 4JM2A 4OBSA 3CFKA 2VABA 1RUKL 1RIHL 2ORBH 2PXYA 4GKZB 4J4PA 2C3GA 1G9MC 2CLVB 3VMNA 3T0ED 1Z9OA 5EOCJ 3ULUE 4JFYA 3GMNB 3BT2H 2I25N 2E9JA 1J05B 2BJMH 3MJ8A 5HD8C 4U7SA 4M7LT 4DVRH 1JZ8A 4JY4B 2IQ9H 1WWCA 4M6OL 4YGAB 5CJQH 2W65B 2NTFB 5L6YH 5BV7B 2R1XB 4PJAF 3MC0A 2BHZA 4P48A 3OXSA 1VDGA 4CVZB 3D9AH 1R3KB 4JQVC 3ARVA 3JTSA 4GAJL 4XNYH 3T8XB 3EOBB 5JQHC 2R2HA 1DFBH 1JHLH 4JM4H 2BCKB 4XC3H 1IM9B 5MENE 3X14B 1OOAA 3CXHJ 3VWKA 4PV9B 1W0YT 5E5MB 3T2NL 5KSBB 4D3CL 2Y6SC 1QEWB 4M7ZB 2QHRH 4YEEA 2BNQA 5TPWL 5E6IB 1QA9B 3MUZ1 3ES6A 5CINL 3SDYH 3D3VB 1QSZA 2AERT 2VLRA 1BVZA 3GK8L 1REIA 1ZK9A 4AIZA 3F12B 3HAEH 1G7QB 4I3RH 3QISA 5BMFL 5I1DB 3H7LA 3KPSE 1WAAF 5BV7L 4E42A 2FATH 4GXVH 3OXRB 3CZJA 1EPFA 4JN2A 4WDIB 1TDQA 4Z77B 2VB5A 5A3ID 2IPTL 3FZUD 5ILTH 3WNLA 1EHNA 2WW8A 1G7HA 1UYWL 4PB9H 5E4EB 4XNQA 5T1DL 2GTWA 2M26A 3CFJB 5KSUA 5DHVB 2GKIA 4M6ML 3G04A 2AGJL 1FJ1B 5IB1B 3LRSA 3BVNA 3PQYB 4JQXA 3QFJB 1YC8A 2PTTB 3WIHL 4N68A 4GMTH 3SE4A 4EQ2A 4FS0A 4BFEA 3W0WE 4OCWL 2P46B 5DJZA 1S5IH 5GZND 1RZ7L 2WZPD 5E7BA 5I17B 2FWOA 3QULA 4D0DA 4XBPB 5LAXB 4V1DD 4L4JA 4EOWH 4HPOH 1HKFA 1UGNA 4U6TA 3L5HA 1CZ8H 4XXCA 2DTML 4OCMC 4Y2DA 1AGEB 2IBBA 3MLTB 4K3EH 5D1QA 1GHFH 3GB7A 4RWYL 1IGFH 3KDMA 1CICB 4UV7L 3I6GB 3OB8A 3NAAH 5LJYH 3C09C 5FCSH 5H2BA 1RULH 5D7SH 3MO1B 1QD0A 3O8XB 3E8UL 4OZFH 1YEGL 3QEGL 1S9WB 3FAXA 4WO4C 2FLRT 1MWAA 3IB4A 1EIBA 4JFOA 5DJAB 1S7TA 1MCPH 2OL3B 1QYGH 4Z7UA 4LHUG 4K71B 4KHXH 1M6OB 4JM2F 2EDYA 1DBMH 1N26A 1OAXH 1E0OB 5DJ6B 3T09A 4OLWL 4LSSH 3U79A 5B39G 5C0RL 3HI5H 1F02I 2A77H 1E28A 2A6IA 2E9IA 4BZYA 3QH3B 4MSWA 3IRZA 1CWVA 1RFDH 1U6AL 4YK4B 2B0SL 1CIUA 2NYYC 2NX5A 3HPJB 5CKAA 3S8WA 4HWBH 4LVNC 3MRDB 3FQTB 4R97C 3QRFM 3NFNB 4RISH 2NY5H 1LVEA 2QL1A 2ENSA 4MLIA 5F7EL 1TCRB 4MVBC 1OTUC 3HUJA 1MJUL 2JJTA 4XP4L 2C26A 3KR3H 4AEIL 4HV8A 1KG0A 4RGNE 4ZO6A 2HFFB 5BW7C 2H32H 4CNIB 4OGAD 4P5MA 5HHOA 2OL3L 2WBWB 4NZDA 3BFOA 1E4JA 5IMKB 4PJAB 2BXZA 4LPUA 2BFVL 1A7OH 2EYRB 5DZNA 3QXVA 4Y8DC 5FDWA 3A6CH 4LCIH 5CLTA 5IFHL 4YIQA 5I2IA 1INDH 1EO5A 1UA6L 3QXDA 2F19L 4DVBA 4PRHA 5C92A 5JIHA 3RDTC 2FJHB 1JPSH 3B9EA 3OJMB 4HCRH 3HFMH 4ETQA 4PJEA 4YHPB 3PXHA 3OAUH 2Z93A 4JB9H 2I9TB 4ZS6C 4OZ4B 3TBTA 4MJIE 3X3FL 2C4FT 4LAQH 4Y19E 5HDLA 1CFNB 3SE9H 3TZVC 2N7AA 2HH0L 1CR9L 2XQYG 1T0PB 3QUYC 1A02N 1MIML 3UTTD 3V0VA 4Q9RL 5GGUB 3V6OA 1T1YB 1MF2L 3JSSA 5AUMA 1YEJL 3GIZL 4LF3A 4I5BA 5EA0L 4UZGA 5ANMA 3T1FB 4NFBA 1MRDL 1JCKA 4CW1A 3K4AA 4CVXB 1AC6A 5KN5A 4XCYA 3AAZB 4JHAH 3B5HA 3QHFH 4I3SL 1WZ1L 3F6IA 5J12C 2XFXB 1U3HA 4NC0B 5A2IH 2V5YA 5DT1H 2C7UB 1QFHA 4PV8A 1FFPA 4MNGA 2BK8A 5D1ZB 4HC1L 1O7VA 5F7WC 5CZVH 3VFPB 1G6RB 4KZDH 1XCTB 5CD3A 2IH3A