1N19A

Structure of the hsod a4v mutant
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
153
structure length
153
Chain Sequence
ATKVVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHSIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide Dismutase [Cu-Zn]
publication title Insights into Lou Gehrig's disease from the structure and instability of the A4V mutant of human Cu,Zn superoxide dismutase.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2002-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1n19A00
3KM2A 3GTTA 3S0PA 1SOSA 3GQFA 1E9OB 4U4IA 3KH3A 4A7GF 2Z7ZA 1CB4A 2LU5A 2WWOA 3KBFA 2SODB 1JCVA 2NNXA 3KM1A 3SODB 4B3EA 4MCNA 2V0AA 1DSWA 1E9OA 1F1AA 1F1DA 3L9YA 2Q2LA 4A7QA 4A7SA 4A7VA 3CE1A 1SXCA 3ECVA 3KH4A 1ESOA 1HL5A 3MNDA 1IBDA 3K91A 2GBTA 3GTVA 2WWNA 1BA9A 1Z9NA 2C9VA 3LTVA 1QUPA 1SDAB 1IBBA 2WKOF 1IB5A 1PTZA 1Z9PA 2AQNA 2C9SA 3KBEA 4BCYA 1OAJA 1SXSA 1B4LA 1B4TA 1E9QB 1TO5A 1EJ8A 1PZSA 1PU0A 1EQWA 1OEZW 2VR6A 3F7LA 1N18A 1RK7A 1F1GA 2Z7WA 1JK9B 1CBJA 3GZOA 3H2PA 1E9QA 1SXZA 4OJAA 1XSOA 2GBUA 1SDYA 1UXMA 2E47A 2JLPA 4BCZA 2AQTA 1TO4A 2XJKA 1YAIA 1JK9A 2ZKYA 1FUNA 1DO5A 2AF2A 1COBA 2VR7A 1OALA 2XJLA 3ECUA 4A7TA 2WZ0A 3PU7A 2ZKWA 2APSA 5CU9A 2JCWA 4N3UA 2WYZA 3GZQA 1E9PB 1U3NA 1SXBA 1AZVA 1SPDA 5KBLA 1OZUA 2AEOA 2WZ6A 1P1VA 4N3TA 2AQRA 3L9EA 1HL4A 2AQPA 2WKOA 1E9PA 1SXAA 2Z7YA 2R27A 2VR8A 2GBVA 2WYTA 2ZOWA 4A7GA 2Z7UA 1Q0EA 1S4IA 1N19A 2ZKXA 2AQQA 5KBKA 1YSOA 3F7KA 3HFFA 3QQDB 4MCMA 1UXLA 2E46A 4BD4A 3HOGA 1F18A 1KMGA 3GZPA 3HW7A 2K4WA 1XTLA 4A7UA 1SRDA 3T5WA 1MFMA 4FF9A 2C9UA 2WZ5A 1IBFA 3QQDA 3CQPA 1L3NA 3ECWA 4OH2A 1XTMA 5KBMA 4L05A 3H2QA 1YAZA 2AQSA 3MKGA 1IBHA 3CQQA 1BZOA 3RE0A 1OZTG 1SXNA
chains in the Genus database with same CATH superfamily
3GTTA 3RWIA 3D52A 2CMRH 3GKWH 4I9WD 4PJXA 5A1AA 3ULVL 2H8PA 4GAYA 2D7QA 4JO1H 2OZNA 4OM1H 4JQVC 2FGZA 2CRYA 4M61B 4D8PB 4DN3H 2PTUA 3QI9A 5INDB 4ANKA 3U6XA 2KPWA 2KDYA 2JB5H 2FEJA 3QCVL 4QTIL 3P0GB 3JVGC 1T7ZA 5BMFH 1KCRH 3QZPA 3CE1A 3GXPA 3BZDA 3COOA 2AJUH 4QRRB 1P5VB 5BXFB 1GC1C 1YC8A 3ARBD 3MRIB 5HDWA 5LB1A 3QNYA 2Z91A 4DKFL 5C0DB 3HPJA 4KI5F 2X9YA 4PV8A 3UC0L 4PJ7E 3MYJB 3CIAA 5DZOA 4MSWA 1FVCB 1YC7A 2K70A 1GYWA 1JV5B 1Y6MR 1EXGA 2HJKA 5EBWB 3MSPA 3X1EA 5IOKA 1YVLA 1WYJA 1GR7A 1R0AH 3HS0B 3H3PL 2YD8A 1T2QL 4NJ9L 1DJSA 3BIBX 3ZPDA 1JK9B 3V79C 3SBRA 1EJ6A 2IOIA 5IROC 4DP7X 5FB8A 1QSFE 4EZKA 3PWJB 4NPYA 1YMMB 5KAQG 4CVZA 5AB1A 1JGEA 1D5XB 1SDDB 3E1ZA 3KCWA 4MAYD 4ONGL 4BWWA 3U0TA 3RFRA 5DS2A 1ZLSL 4YBQD 3BZ5A 5T1KD 3CZKA 2XWTB 1U95B 2IH9A 3BGFC 4HWBL 4N2MA 4XVUC 4HPYH 4EXPX 2HVBA 1T80A 3SZKC 5C7ZA 3W0WD 4YAQA 3P0YH 4XE5B 2CO6B 5F96L 3N43F 4A38A 5FO7A 5SX5H 1CLYH 3QH3A 2UY6B 4HALA 1CYGA 5LGHL 3G04A 1G7QB 4PJ7A 3IFLH 1MJ7H 1PL3A 3V0EA 3K6DA 1TQBB 2NZ9C 4JVPA 1AGCA 4HT1H 5MEPB 4L4VE 4JPSA 4KWUA 5CN3A 1GGBL 4G7YL 1F5WA 5LQBL 3WKPA 3UO1L 1TG8A 5KBNC 4I4WB 5JHLL 5KYYA 5EDSA 2A74A 3W9DA 5EO0A 3FHAA 2FR4A 1QSFA 4IMKC 5DJAB 1HQRB 1ZV2A 5E5UB 5G55A 1H15B 1PW3A 2AEQH 2Z31A 4WWKB 5FKAA 1GIGH 2FL5A 3GB7B 2NY0C 2LV4A 3HMXL 4PS7A 4DK6A 3L4ZA 1Q72L 7PCYA 1HYRC 2LLGA 1E90A 4OD1L 5CMAB 1OAUH 4CN6A 5J6HB 4Y89A 5INCA 1I85A 2LU5A 1K3IA 4KK5D 4XP4L 5DJ0B 3V6OC 4LPWA 2F15A 5AW4B 4KMTH 4PP1D 1X5AA 2R0KL 3NYKA 4OQ1A 1F1DA 3QJFB 4PLNC 3EJTA 3BDXA 4Y19D 5I5IA 1XH3A 4FNPA 3B43A 4L4VA 4PJ9D 2OP4L 3ARFC 4PJFF 4M8QB 3FQNB 2AANA 3DROA 4HC1L 1FLRH 2FJFA 4U1GC 2EDFA 4Z9KB 4ZZFA 4NN6C 3FH8A 1YRKA 4Z7NF 4P5TB 4JFVA 2FBOJ 4IYKA 4R96A 3CPUA 4LL4A 3QUYD 4Q6IA 4E42B 1E30A 5IB2B 2OYKA 2NY5C 2ENSA 4G72B 2RACA 1KIQB 1BCIA 3VFTA 5GISH 2FBJL 3MJ6A 3L1EA 2Q1EA 3KWWB 3WKQA 5EC1B 2LAGB 4YE4H 4YXLL 1O7DE 5FYKH 3RI5F 1HJBC 3QZLA 1GGYA 2WB1A 3S34L 4EI6A 4M48H 4O2CB 2H6PB 3O41A 5FYKE 4X8JA 4E9VA 3NJVA 4N90D 4CILA 2J12B 2WVVB 1E4XH 4OZFH 2DEWX 5FCUL 4LEEA 3UJIH 3B1TA 3DOHA 4Y1AB 5K1NA 4MD4B 1QSED 4P48A 2JQAA 3ARBB 3T71A 4EE2A 4K3EL 5JDSA 1OB1B 1Q4NX 4LVOB 1OP4A 1OT1A 2D7MA 2DL2A 2OW6A 5C0FB 3LJ3A 2Z4QB 3O9WA 3MXWH 4HKZB 4XMXA 5DC4B 2BRRL 1OV8A 3PV6A 5KZCD 4HIQA 3N85L 2ED8A 1XF5B 5KTEH 1TJIH 2AABL 5FXCH 2YD5A 3SDCA 5KSAA 4I3GA 5FA3B 1ZE3C 3UP6A 5FHAH 3VW3L 1S8DA 3HOGA 1DJGA 2WLYA 1F8TL 5BOJA 1T1YA 2ODHA 2HFFA 3HZYB 3L2MA 1ACYL 1KCLA 4B60A 3TV3L 3MRMB 3WIHL 4JFXB 3SKUD 4XO5A 3VB8A 4PD4J 3FOMB 5FCSH 5E6ID 5FUOH 5GS2D 4YQXL 3IJSA 4DN4H 4RRPA 1SGKA 5T1KB 5AAPA 3ZHDA 2XN9B 2WYIA 1RZIA 1R3LA 3CN3A 4IHOB 4TNVF 3RWJA 3GDCA 5ADPH 1OT4A 3WV0A 1RIHL 1HHKA 3SZ6A 2IMMA 4FQPA 1B88A 4PB0H 5F9OH 3W0WB 5E99L 3ZT5A 4OZFA 4PW9A 1J11A 1SLWA 4NN5B 3CSPA 2GSIA 5CLXA 1RHHB 4JVUA 3KPTA 1GOFA 2ZXCA 2GITB 1HHGA 5EV7A 1UFGA 2IGLA 1ZT4B 1KB5L 2EDJA 1R3JA 1BVNP 2ADFH 2X9XA 3RFZC 1OIOA 4XMZA 1KXHA 1I1AD 4K3JL 4LLWA 4W9IC 4K55A 2JNZA 3ISRA 4KO9A 2LAAA 4N0CD 3CDGA 1UB5B 1OSPH 3B5GA 2WLIB 3ARUA 3O6FD 5BS0E 2FX9H 2XZZA 2AQ2A 4M3KB 2EXYC 4L0ZA 4APXB 1OEZW 3QUXC 3KR3H 3AVEA 4GRMB 1NGPL 6FABH 5LN8A 1L4IA 2W88A 2C3VB 4TTDC 43C9A 5KAQF 2A0LC 4R5XA 3EOYG 1WG3A 4F15C 1WP6A 3CUPB 4KRMB 3R1GL 4R97C 4OJYA 3RLSA 1EJFA 1HXYA 4GAAA 4TSBL 3TA3A 5BZDA 4RGNB 3U4AA 4Y4KC 4KXCA 1BMZA 4PWGA 1MFEH 4PAZA 4AGMA 3LS4H 3PQYD 5L2KE 4KXBA 1DN2A 4AV5A 5KN5B 3OMAB 1A3ZA 4OLXL 3RP1A 2A9NH 4Y19B 4FA6A 3UERA 3CCHA 2ORBL 4AQOA 4K3DL 4M6NL 1B0WA 3C75A 1EDHA 3MLYL 3L81A 4M6OL 2VLRB 2FJUB 4GOSA 1TTRA 3HLAB 2GW5A 2PP8A 5D7IF 1YEIH 1MCHA 1BIIB 2WINA 1FZOB 5F6HI 3QQXA 2R27A 4OI8A 1DDTA 1S7VB 2CBOA 2APVA 1X5JA 5D7EA 3M88A 1EAPB 3QUYB 2ILLA 3GHBL 3VA6A 4XVTL 5BS0A 3AQXA 2BSSA 4NQDD 4RZCB 2G0KA 2Y5QA 2JLLA 3NJXA 5G4MA 1TQVA 2P52A 3GWJA 2X3BA 4H8HA 2ZKMX 4DEPC 1KG0A 5TQ0H 4G7QB 3Q7JA 4FXGB 2ADGB 4AKPA 1G5AA 1R17A 2ZG2A 5LJYH 1V10A 1CLZH 3V4VH 4Y5YA 3ZN6A 5I1GL 5IMMA 4R4ND 1G5GA 2VXVH 4G8IA 4UM9A 3UX9B 4DZ8B 4ZS7H 3MRFA 3WSQL 4HD9A 1EEYA 4JBSA 4N8VB 3CLFL 2B2XH 1JTTA 1BFTA 4DP0X 5I1KH 2EICA 3UJTL 5L2KA 4P3CH 1JNLL 4O9HH 2EINB 4XPFL 3RGVC 2VB5A 1E4HA 5ADOH 4M9OA 4PSPA 4MB4A 1CB4A 3C6EA 2OV0A 1OGAB 2QQKH 3D18B 1M7XA 3TBTA 2B39A 4NP4L 4M4RB 5IVZA 5B38G 4Z3EA 1MJ8L 1QSZA 1AZRA 1L5GB 4HJ0C 4Z7QF 3G08B 1Q1JH 1GAFL 1T83C 2P26A 4MYWB 5MHSE 1LMIA 2UXVA 4B97A 1URIA 4YSTA 5FO8B 3VXSE 5B22A 4UANA 4YZWA 1BVNT 3WO3B 2HWZL 1LEGB 1PX8A 3L3OC 3LXBA 3MMEA 5E6IB 3UZEA 5F1NB 3W2DL 1X6NA 2R56H 2EDEA 5E70A 3I50H 5GGSB 1MFCH 2W0PA 4LB8A 3D3VE 1FFRA 5FW7A 3V4VA 1MCWW 3UTQB 5KVFH 2MKWA 3IB4A 4JANA 4V2BA 3V5DB 1RK0B 4JUSA 1H3TA 4KRLB 5DWPA 1DJIA 5A2JH 5KVFE 4MVBC 3UPRA 3JVFC 3LZQA 4WO4D 4X7FC 4KNTA 1QACA 5F97E 4FG0A 1JD7A 1JWUA 4GP5B 2BHFA 2F7RA 4W9FC 4MDJB 5B39B 4NWUL 1RUMH 4UM8B 3NK4A 3WO4C 1FUNA 5HPOA 1V54B 1IAOA 1S9YA 1LK3L 1GSKA 1OALA 5G2NA 3MI6A 3UADA 3EDJA 1IGCL 3LQAH 2I25N 1EUTA 1H6TA 3MNZA 1J8HE 3BH8B 2BSRB 1MKFA 4PCYA 4JZJC 5ABZA 1MZYA 4EN3A 3IDIB 3U6XS 1I1AB 3VSUA 5I1AA 2VXQL 1IGML 3VXSA 5JHAA 1FZMA 4BGDA 4LMQE 1E28B 2DD8H 2WC7A 1ZTMA 4J8QA 5SWSD 2L0DA 3CLWA 4LVHC 4AKOA 2YBGA 1PZ5A 1AQ8A 1WUNT 4GAFB 2N56A 3I6KB 4XMLL 4KRNA 3D3VA 4Y2NA 4UV4H 3MZGB 1G43A 4D0BB 4M7JH 2ADIB 3IVKA 3WKYA 1V7ML 3VDCA 3BWZA 3DPDA 4ORGB 1KJ2B 4NNXA 5AOKA 5EIQA 1QWHA 1EO8L 1W8OA 1HNGA 2EDXA 1S2EA 1QD0A 2Q3AA 1GPOL 3GIZH 5E23A 1AGFB 2OX5A 1WGOA 1ZLUH 4EUPB 3MBWA 5HGAB 3QRGH 2FO4A 3OG4B 4HK3J 3G6DH 3L7FA 1BMGA 4UF7C 2EO1A 2IGTA 4F33A 1AIFA 1SEQH 5AYUL 2ERJC 5GJTH 4LOUD 1CGWA 4G6MH 3N06B 5IFAH 4B9CA 4XI5C 4X8CA 3L45A 3HCVA 2QVFB 1J8HA 4HCFA 1X5YA 1BYNA 3H9HB 2OPCA 4GNKB 5IOPB 3PAYA 4CMMB 1HHHB 4R0LA 3DBXA 1AGEB 1ZHBA 4WV1A 1SLXA 4XN2A 2VAJA 3RIFF 3SE6A 4YL9A 5DHYB 2F7OA 3FRPG 4U1NA 4MWFA 3MPCA 3GUTA 4NQDB 3KH4A 5B7MA 4WAFA 5EH1A 4G1EA 1F6FB 1XB3A 4NLAA 2YLHA 3AREA 1WZKA 1RUPL 4YHIA 4DVBB 4LLQA 3MLWL 1U8HB 1DQMH 3IWVA 1DSFL 4D9QE 2QKIB 2DMBA 1AS8A 1W6LA 5C0BE 1FH5L 4AT6A 3BP4A 1TCRA 3C5XA 3ECBA 1PZSA 1U2HA 3QB7C 1DVFA 4QD2E 3MBED 4NQVB 4WW2F 4AQ1B 1P6WA 3AT8A 2APXA 3TZVC 1JZEA 3P40A 1CI5A 3FKUS 2Z92A 4PVNA 2Y7OA 3GMRB 5HVHB 2HPTA 1RI8A 4ELDA 3U82B 3MO1B 4JRWA 4PJCF 1FL5B 4B9JA 3WY3A 3I9IA 2OMWB 3RY6A 2K7PA 1CVRA 2VN5A 2WP3T 3UBXB 1OB0A 5BZWB 3VXME 5E1HB 1U91B 4FQQA 3BGMA 4Y2DA 2FJHB 4JN2B 2EIJB 3S35L 1PGRB 2VGLM 4L3CA 2X7LA 3F7PC 2RCSL 2GC7C 4LRIA 1NJ9A 2VZVA 1NGZA 2MMXA 1TJHH 2FB4L 5FM4A 3MGAA 2J20A 3EYSL 5C0BA 5GS1C 4A2LA 2XWDA 5CO1A 4BRVA 1ZK5A 3P0VL 5C6WH 4X0KA 3ABZA 3GI8L 4LLYA 1KV3A 1BQKA 4P2OA 5HBBA 4QRQB 1GSMA 1M4KA 2D0HA 2CKBL 3IN2A 4G43B 1DQLH 4HIJB 3FF7A 2NY2D 3NCYP 1Z5YD 2IPKB 4A39A 3APMA 2GJPA 4W68A 3WGUB 3DETC 1YAZA 3FOLA 3HNSL 4RISL 1AHWA 4BSWA 2VDNL 3FQYA 4A04A 2X4UB 3UGXA 5EZPA 4JFHE 2JCCE 4JPKL 4IEFA 2P7TB 3QNFA 3VXMA 3T4YA 5I19H 4LCWE 3K6SA 3LPOA 4KTYA 3GMMA 1VGEL 4KVCH 1OSZB 2J2ZB 2WK2A 5HP5A 1UT2A 2WBJD 3PREA 2VMDA 5E08H 1L7IH 1I7TB 2XV6B 1A0QL 3RZCD 3VG9C 1S7WA 4HCRL 1WIUA 2Q2LA 4TVSa 4A7QA 3AZUA 1AKJB 2J8HA 3MTXA 3BQVA 3RX9A 1GTNA 3LNHA 2YAFA 2WV3A 4A2HA 3D48R 2HTKD 1XZWA 3D39B 4HLZG 3WN6A 2C9VA 3QO0A 4H5SA 4RDQF 4JFZL 3HBGA 3FYEB 4BKTC 5KSUB 1KCBA 4R4BB 4XHJC 4AVHA 3L08A 1D7FA 5HYEA 4TOYH 1I9IH 2VXTL 5T8IA 5D71L 4KO6A 4PJBE 2WWKO 3V2AR 3V6FB 5JHMA 3DO7A 1RULH 2XWJB 4WHYH 1WA1X 3RGHA 4DW2L 1MW0A 3KLAA 5ALCH 1Z9LA 2YQBA 3FHQA 4G8GE 4BYHA 3MLRH 3WTTA 1IEBA 1I1YA 2JCCA 4TULL 5CZVH 2AW2A 3VXUD 5L8KB 2XXCB 2LU3A 3RVUC 2I24N 2XFXB 3HNVH 2WWMD 5AVZB 4LCWA 2BO0A 3H55A 4YOKA 2L04A 1WTLA 4WO0A 3CFKA 5JOFA 2Z8WC 3OB0K 1RU9L 2WZPA 5A16A 4J3BA 3ECUA 2A1WH 1LILA 1EZUA 2ZKWA 3EH4B 4PJEF 2JCWA 3GBEA 4J3OG 3UTOA 5DDHB 3T6WA 4KGLA 4OAWA 4L4TD 3EH2A 4FFVD 4ANVA 2BVYA 2FLMA 4KTEL 5IQ7L 1X5MA 4MAYC 4JKNA 2P9RA 2IDTA 1J86A 4YBQC 5JUEL 3UTTB 4GSUA 3DMMD 2N0KA 4EDWH 2OMVA 3FB6A 1I1FA 3I75B 2KKQA 1OLLA 3MBEB 1MCOL 4PJBA 4MKTA 5IBUB 3VFOB 3ROLB 4DP2X 1KMGA 2WXIA 4W6WB 4NWTL 5E4OA 4PJFB 4X7TB 5E8EB 3U9WA 4BCXA 4G8GA 4OLZH 4HAKA 4QRUA 1A1NA 2FNBA 3LRSA 5J56B 1V8HA 2V4LA 2KQNA 4R7DB 3H2QA 3L3DA 3CD4A 4XCNA 2EYSB 3B9AA 3VXRE 1K5NA 4C47A 3BEVB 5BV7H 3KPSB 4OFKA 1Y18B 3MCLL 1OY3B 4RMUA 2FIKB 4KI1A 5EZLB 2WN3A 4HF5H 4M43H 2M2DA 4AENA 2YOCA 4JZNA 1KIRB 5JW3H 5IUSA 2H1LM 4UQ3B 2X2HA 3MACH 2IAMA 4JDZA 1VFAA 1UATA 2FT8A 4ZFOB 3VD1A 2J88L 4RFEB 3CPLA 4OIIL 2G60L 3ELQA 3EIFA 4I88A 3L4YA 1R34A 3CFQA 1X5XA 4IBQA 2XWBB 1M7IA 3KYNA 5DMGC 1A3RH 2IH3B 4KK5C 4JO4L 4UNVA 4ZW5A 4QXWA 3CXDL 4UU9B 1JF6A 1S9XA 5JW5A 3DV6A 4UAOB 2NY2B 3RGBA 3HE6A 5TDOA 3ROOA 4H0GA 3MRPA 3MTRA 3HAEH 1ONQA 2AC0A 5DJ8B 5EWIL 4HJ1A 3CFJA 2IH1A 2VN6A 3D08A 3NCYS 4FLRA 3WJLC 2ZWNA 3QRFM 4PJ9C 3VXNA 1I8UA 4AX3A 4YMPA 3VXRA 3A24A 2A73A 2R4RL 3QW9A 2WQRA 3DRTB 2O5YH 1LO4L 3D2TA 4Q14A 2GBUA 2DICA 1XH0A 2F5AH 4XN5A 5GIRB 4ZW6A 4R8WL 3QIBD 3PNRB 4NSKA 3WXVH 1ZPLA 2EVGA 2WBJB 3KGSA 4AYSA 1ROWA 1D5IH 1QR4A 2IPTH 3CG8A 3HC4H 2X4QA 1X5GA 3BZ4A 3FCBA 4GXVL 4HWEH 1LWHA 4L3EE 3AQZA 2ZAHA 3F04A 1AZVA 3N1MC 5C0EA 1IFGA 2GTZB 3ZT7A 1KBGL 1OTUC 4HQQH 4F2FA 1IIIA 4DTGL 4UDUA 3BD3A 1HK6A 2E9BA 4L0PB 4WY7L 3ZKND 3C08L 2WSKA 3ZDYE 1MHCA 2KPNA 3FT4A 2TRYA 3IMVA 2A6IA 4HULB 2Z7UA 1FG2A 5LVEA 4OLYL 3O6KL 3HAEA 1KCKA 3PDDA 4OCSL 2ESVD 4XP6H 4I89A 1KIPA 1TQCC 1ECZA 4WZ9A 1O0VA 5IB5B 4IDJH 1MRCH 2EDNA 3TASA 2FE0A 1L3NA 3B7YA 1B4JH 1LP9B 1JHKH 1W15A 1XTMA 2N59A 2X3AA 3HS8A 1OVZA 3VD5A 1AQHA 1IEAB 3WFBL 3SKOA 4KV5F 2DQDH 4P4RB 3FFOA 3BSHA 3ZKQD 1S9WB 2AJXL 3VFSA 1YEDB 1CFSB 3DSFH 4F7TA 4GAJL 2J6EL 2FYVA 1IQDA 4L3EA 5DUPL 3KXFD 3H6JA 2CR0A 4Z7UE 2ICES 3D0LB 5ITBH 4LAJH 2FAUA 3UAJD 3DMMB 1S6NA 4FZ8L 2VYRE 5DD0H 2J1ZA 1A7PL 3FDWA 4P5SA 4XPHH 3T3PE 1MCJA 5AAMC 2GSGB 3HC3L 3O2VL 4WTZG 1SN5A 5C09B 1PJ9A 4F7MA 1N9PA 5GS0D 4BHUI 2L3BA 4P4KD 4AZUA 3DUUA 1LO5B 1U3JA 4KKCC 1HEHC 1ZS8B 3BN3B 1KGYE 5DGRA 4Z0XB 3VFWA 3VO0A 1MAML 1S46A 3OLDA 4MS8D 5D7IB 1PLGL 1WAAE 2CLZA 1CICC 2H1PH 4LNRB 1L0XA 3N9GL 1WC7A 1NMAL 3OAUH 5AYTA 4ZMZA 3V7AG 5LCVL 1UZGA 2C4FT 3F7LA 4AG4H 3ARGD 3V6ZA 3SKMA 4HV8B 3ZTJG 1YA5A 5L0QC 5D7JC 3BO8B 4NDMA 2O6PA 5L6YL 2NTSP 1BZ9A 1EHNA 3O6FC 4X98A 4Z7UA 4ZAKA 2V9QA 1QASA 1H3XA 2X4RA 3MNWA 4C57C 1FL6A 4O02H 4OSUL 2I60H 3FQTB 2D0FA 3VGAC 4BK4A 1Q9WB 1CN4A 1O6TA 2FJGB 1Y6KR 1RZKL 4Y88A 2R4SH 5GGQL 4PMEA 5HHPB 1TYEB 1TKWB 4GKZA 5EHFA 1F3JB 4IJTA 2DWEA 5DVNA 1G1YA 2HJLA 5IVXF 2J73A 2ZPKL 1JG9A 2J56A 1Q90A 1P0SE 3IKCA 2MKLC 2IQAA 2VC2H 1SXAA 1WAAA 3IJEA 3ZTNH 5I16B 1GGCH 3EBIA 1ID2A 2VRKA 3IFNL 5B8CA 1HWWA 4JJ5A 4ELME 1RZGA 4NXSA 3RY4A 1WZAA 3MX0B 1FYTD 3OHXB 4NHUB 5FW8A 1E3ZA 3IMRA 4Z3JA 3F58H 4HJIA 4RAUB 3SE3C 3BWSA 5EG6C 1K4DA 3FO1B 1I9EA 2NQ3A 3HC0A 1N6UA 2G30A 3QARA 3EXLA 1I7RA 4PRPE 4Z1PA 4I18B 4S10A 3C12A 4FQLL 3ARDD 4GSXA 3QHTC 2CALA 4HUXA 5FYLL 1CR9L 1L0QA 3LDBC 3GMNA 4XAKD 2QVTA 4NUGH 1KLUA 5KJ7E 5CHNA 2DQEL 3Q1SL 4FFYH 3W11D 1HOEA 2EE6A 1MUJB 2JTYA 3G5ZB 4DEWA 3D4GA 4O02A 1K4CA 5ITFA 5CZXC 3Q3GB 5D4QA 5FM8A 4CSZA 1N0XL 5DO8A 3H7BA 4R4NC 3QAZB 3Q2NA 3BVXA 4P3WA 5D7KD 1NMBH 4O5LH 4BZ2H 1HH6B 3TURA 1PY4A 4ANXA 3RTQC 1GMIA 4HFWA 1U30A 2Y07L 2B59A 3L9YA 4KC3B 2VR9A 3BOVA 5JW4N 5TF0A 3QXAA 1SFHA 4ELMA 1GKOA 1JWSB 5DS8A 4EBQL 3KNBB 1R3KA 4DHLA 3GSOB 2BZDA 3NACH 4M62H 4PMFA 4ANUA 5KBDA 4TQEL 4LCCB 2FHCA 4KI5E 5CD5C 1RZ7H 2MJWA 1DANU 4XZ4A 2V7NB 3SQBA 5I23A 4G6KH 2CCVA 2YAOA 2X1QA 4PRPA 2KZ1B 2OM5A 3CBJB 2CMRL 3GKWL 3QQ4B 1HNFA 4JFOB 5E9AA 3RL2B 3TBSA 3QIWD 3GXUB 3TCTA 4ZFZB 4JO1L 1PKOA 2EIMB 1NBCA 3FU9A 3NCJL 3BZEA 3NCEB 1JGUL 4JFSA 1YMHB 4FJ6A 5BUAA 1TYJA 2B9BA 1JXJA 1SUHA 3KDMB 3T2OA 3L3HA 2JB5L 4F8NA 1XIWA 3DTUB 5AOIA 2X70B 4X83A 3U0PB 1PZUB 4FFYA 4N0YH 5BMFL 1KCRL 4EZJA 4JO3H 4N20A 3US0A 1G4MA 1OP9A 2AF2A 2ZXEB 4G80A 4Q97A 4LKXA 2AJUL 3FFCD 4FYQA 1YCSA 4AEIL 4BZ2A 4P4KB 5J11C 5F7AA 2FO8A 2F7PA 3K2UH 1T4WA 3FB5B 1J9SA 4DP5X 3D07A 5BRZD 1XCXA 2OXGB 3BT0A 3D0AA 2XTJE 1KTLB 2QGDA 1QZ1A 3KLKA 1U21A 2PTVA 1U92A 5C6TH 2E7HA 3VFRB 3MRKB 1B3JA 3MFFA 3FZUD 5F93C 4AL8H 5AD0A 4BUQA 2ITCB 4K23H 1Q0EA 2NNCA 1FE8L 2Q5BA 5GGVH 2FQEA 5I1IH 3ARGB 3BXNA 1AS7A 4FG2A 1LO2H 2BY1A 3EJJX 4GT0A 5D7SL 5T3XH 3WNPA 2R0ZH 4JDTH 4AEHH 4WI8A 1XXFC 5AVSB 4NQCD 3DOSB 3VJ6B 4LPUA 4G8AC 2B7DT 2DJSA 4AV4A 4I85A 2AZAA 4A67A 1ODUA 1JVLA 4G5ZL 5D1QD 5C3IA 3ESVF 1CYWA 1FFNB 5FGBC 1DQJA 2BWDA 1PY9A 1UXSB 3P0YL 4NKQB 1F56A 1NIBA 2J8UE 4OVUA 4WW2B 4CVXB 1PKQB 5JIIA 5DFVD 5AVQB 5D9SB 1CLYL 1M05B 2XIBA 5HGDA 2VITA 1UWGL 1IKFL 4QTHA 5FM5O 5C0ND 4OF8A 2AFNA 4N8PA 3ZKXC 1OSEA 1MJ7L 4WK4B 4LPYA 3ZTDC 4ODUA 5C1MB 3Q8AA 4I0PC 3L2NA 3R06B 5C07D 2EKSA 1T6WA 4PJCB 1IT9H 1ZLEA 2NNFA 3E0GA 1QBLH 2CDGA 1AG6A 4KJWC 5I66A 4UWQB 5C8JA 3ZZSA 1FYTB 2X0VA 5JIMA 1Q9LB 2VQUA 1KY6A 1N7MH 5HPMA 1S7RA 3EG9B 3GNMH 1A4BA 4P5KB 5EIIG 1JPTH 4ORZC 1DJZA 2BCMA 2E59A 3HKFA 2AEQL 1FZJA 1GIGL 1E5UI 4JW3A 1W8NA 1QLEH 4NOFA 4IBLT 4GS7C 1DDHB 5DK0A 4AM0B 4Z7NE 3WTYA 1U3HD 1OAUL 4N5ED 5F7WC 3OG6B 4NUQA 4HCGA 2VUKA 1YUHB 4U2ZA 2J8UA 3ETBF 2WCGA 4PM1A 3V5KB 2XYCA 4L9LB 1WWWX 2EE0A 3K0YA 4M5ZH 1P4BH 1RUQL 1NPNA 4ODSL 1AFVL 5JHDE 3WS6A 4EDXB 4P5MA 4B9YA 5EZJB 1WK0A 2BX5A 5HVGB 5ETUA 2PNDA 1T0NB 3MFGB 2ROYA 1CXFA 1NDMA 4LSPH 1FLRL 2OR8A 2LW3A 3LZLA 4JHVA 5DHVH 4ERSL 4ES8A 5KG9B 4QRTA 4LXFA 4AXWA 5L4MA 3CN2A 5D2NB 5IQNA 5JMOC 3PG2A 4QRPE 2FLBT 3MR9A 2J1WA 1KDIA 3KJ6L 1NOAA 5B38B 3ALXA 1S5IH 2VZSA 1VAHA 3K4AA 4AZ8B 4GFTB 2ODIA 3TO4D 1ZGLB 2ZOWA 4N2IA 5GISL 5CEYA 5JOPE 1CLCA 1DLHA 5E1QA 3L3IA 5H2BB 2UZIH 5D6CA 5ID1A 4YE4L 4WFGD 5PCYA 3V52H 3FPYA 3RGVB 5FYKL 5A2LH 1GY1A 2VR4A 2PO6A 5K69A 1C16A 3FTVA 2QSCH 4FCHA 4FQ1H 1HI6A 5E7BA 4LCIH 3OAZK 3U46A 1SJHB 3WTWA 4F7EB 4ODTL 2OMYA 1E4XL 4DZBB 4FNQA 2WPGA 3UJIL 2HVJA 3CH8A 5JHDA 5HDQL 3ZRFC 3NT0A 4U6YB 3DHMA 4MX7B 3GXDA 3AU1B 4WI7A 3GBMH 2KYIA 1V27A 5IV2A 1F4WH 3GPSA 3NJFA 4IOSD 4ES9A 4TTGA 4PI2A 4F3FA 1XX9C 1CFQA 3KS0H 4Y5VC 5E5MB 2WLLA 5I76B 1VRSA 3GJFB 1EFXD 2DBJA 3CHXA 4H1LA 3VWKA 2G2NA 5KTEL 3UG4A 5DHVA 1UT9A 4QRPA 5D1ZD 1NFIB 3NDZE 4U6XA 3IFOA 3MJ8A 1MHEA 1PCSA 2H32H 4MTMA 1TOXA 4PJEB 2ICWA 3FQWB 4NERA 3D87B 1HL5A 1PZ3A 1YY9D 2OKMA 4PREA 4AVJA 4DOHB 5I75C 3CDCA 3MCKB 2VDRH 1TZHB 3I9GL 3STBA 2IO5A 4WJG3 1D5RA 4NQCB 4Q7DA 3I6SA 4MJ5A 4YZFE 5FUOL 3CDFA 3GD1C 4F57H 1JYNA 2OZ4H 2WQAA 4LRNH 3Q05A 4DN4L 3CZSA 1PTZA 4R9HA 3RZCC 4HHGA 4S1QL 1KBWA 1WS8A 2AXJA 5JPNC 5ADPL 3GPEA 3KLDA 2IALB 4R6UA 2GQHA 4PB0L 2ZYRA 2HTKC 5F9OL 3EJCA 1UM5H 2ZOLB 5I8CB 1GC1H 2H3NA 5BQDA 1FNSL 2IJ0C 4JO2H 4WFHE 2NY1C 5AENA 1T5XB 2BHZA 4ZRGA 4JZJB 2FBRA 1RY7B 3B56A 2XN0A 3OPZL 5HDOA 5EF2A 4GB9A 3LNDA 3UBHA 1QWUA 3ULVF 4HGWB 3SJVB 3K8LA 2ZUTA 1P5UC 2WNXA 3X17A 2HT2D 1EDQA 4LVNC 4XTRD 2XC8A 1A6UH 3L5HA 3ZE1F 5JA9A 1AIZA 4ZOEA 3WHXA 1B0GA 1BVLB 1KCVH 4I0CC 4HS6B 4JAMA 4EJ1C 2KLRA 2F58H 3ES6A 4KQ4H 3U6RB 5CINL 4PVLA 2GJZA 2BWQA 2H32A 3FL7A 1RZ8B 5GRJL 5AW2B 3ZHFA 2Y7NA 5TFSH 1GXEA 1ASOA 1OSPL 4IHBA 3W9EA 1J87A 2P42B 5CUSH 2R29A 4M6ML 2FX9L 2PW1A 2JIXD 3BHBB 3QGVA 4JQVA 5KVEH 3FRPB 3KR3L 5MI0B 3QDME 6FABL 1NQBA 2K6ZA 3QJRB 5KVEE 4J3OD 2OZ4A 3PGCB 1U3HB 1OPGH 3JTBA 1JF1B 5H37G 3KMDA 2QSTA 2DIBA 2ENJA 1U36A 3JVGA 2FSEB 2IIJA 3IDUA 2QTVA 4K8RD 4MXVF 5TE6H 3EZJB 3O45A 4AIXA 5IHZB 1YYCA 2BMKB 5JLZB 1Q9OA 3HW7A 2XA8L 3JWNC 3AG3B 4PRAB 5EA0H 1NIDA 3SE9H 3LS4L 1U8MB 2WTOA 4L48A 1E4WH 2A9NL 1L6ZA 2ZUVA 3T1WA 4DJMA 2R15A 2WBWB 3HPLB 2DQIH 3F6IA 3OLGA 5IMOB 3NPSB 4OJCA 1N6QH 3WN5C 2OMZB 1W91A 1WD8A 3W3BA 1PG7W 2G5BA 5D1ZI 5FF6B 4XNDA 1YEIL 2I9LA 5IEKB 4NYLB 1MWAB 5AAWC 4QO1A 4PTUA 4JFDB 2XWEA 5IROA 2GPZA 4JG1H 3AABA 2NLJB 2Y7QB 3GSUA 5CGYD 4FXTA 1DFBH 4AGNA 5I6NA 1FFOA 1FGVH 2BK8A 2E9GA 5CILH 3TO4B 2ZE0A 1IL1A 2P45B 1A4KA 1MH5B 3GJEB 4MXQD 3REVA 1F45A 1UADC 1Z0MA 2DI7A 3QDMA 4FMFA 5TQ0L 3HRZB 4Z7QE 2Y4SA 3EFFA 3QFGA 3MNDA 1CLZL 4XCEA 2VMFA 2Y3AA 3V4VL 2AJ3A 2HRPH 3TTSA 3MJ7B 3WUWA 4Z76B 4ICWA 1SYSB 5CIPH 2VXVL 4P46B 1P4LB 4ZS7L 2YMOA 3BH4A 3V6OE 1F02I 5E2VL 2R23B 3IRPX 1G7MB 2B2XL 1X5FA 1B4TA 2AXFA 4P3CL 4O9HL 4G6FB 4LSRH 2GK0B 1KCSH 5L2JA 4HHAA 3MUGA 2HFGH 3MCYA 3UFIA 1FN4B 2QQKL 1DUYA 2NR6D 2GG1A 4RAVB 5IF0A 1MHHA 1VACA 4ZUUB 3CC1A 1JPSH 1Q1JL 1XGUB 1HDMA 4IMKA 3QPKA 2AJZB 1SOKA 3F5WB 4MD5A 3NSFA 2EUWA 1FIGL 3U7AA 3PAZA 5C9JB 5KWYC 4FL4C 3VWJD 1T0MA 1MREL 4TUJB 4G42A 4FS0A 4AEFA 1ROCA 3E1F1 3QIBC 3A4EA 4LQ1A 1AYRA 4TVPD 5JW4M 2R56L 4WLCA 2HN7A 4S0SD 2WYHA 2HG5A 5EZIH 3I50L 5K39A 1MFCL 5IFJB 2K9FB 3UO8B 4OCYH 4NBXB 3V6OA 3QUMH 4ZMTA 5KVFL 1KSRA 5CIPA 5I30L 2VJXA 3GBDA 4RFOH 1DN0B 4AQ8C 2C9AA 3DVNA 1KJMA 3GSRA 3U30B 4D0DB 1PX4A 2YAQA 3V0JA 4MDRA 2QSQA 3FCSA 3ZKNC 2ENQA 5GZND 5B3JF 4K7PH 5ICYA 2DQUH 5B1KA 3ARFA 3CDZB 4RA3A 2UXFA 3GFUA 1T1WB 3KL0A 3LQAL 4PCTA 5AKTA 5EOQH 4JO5A 5K59E 2CJTA 3RX8A 1XSJA 1OAQH 1MOEA 4YC2B 1TSRA 1ZE3H 3KW7A 5DFAA 2PETA 5CP7A 2BFVH 4AITA 4F2ME 3DX0A 4TUOA 3D2UA 3L5XH 3KPRD 1D2OA 5HGGS 1PBYA 2DD8L 1UOVA 4ZMNA 3D51A 1M7UA 1CZ8H 4OD3H 2FWSA 2EYTB 2IADB 1OOWA 3ZDXB 4Y2OB 3F84A 4UV4L 1GMEA 2Q86B 1M1SA 5D1XD 4HSAC 3TH4T 3GSVB 3KD4A 1SMOA 3KYKL 4M7JL 3TL5A 2D31B 5JPMC 1WZLA 1G4RA 3QUMA 4C55A 4N26A 4EI5B 3CFTA 2JWYA 4Z3GA 2R2EA 3ZE2F 4XX1E 4PJ8B 4Y5XB 1HILA 2KQMA 5JW4R 2F54D 3CX2A 3EGXB 4U49A 2EIZA 3ABKB 4O4YH 4FXKB 3NP4A 4RMBA 5D4IA 2X4SB 4NPJA 3G6DL 3WAJA 4U1HA 1GZQA 1SEQL 2B08A 1EH9A 5IFAL 4ZI8A 3WIIH 1E5YA 3X13A 5EN2B 2F9BT 4IK6A 5F89B 4MCYA 1B2WL 4F2MA 3QUZB 4G71B 4U1MB 3H0TB 1XGTA 4KDVA 3I6LD 3APDA 1UWFA 2DEXX 1U8JA 1JZGA 15C8L 2QZ5A 4IRSD 4LLUA 4ZMAT 3LYRA 4IS6B 3FH7A 4OF7A 5H4ZA 3GTNA 3T1FA 1NAMA 5GJSL 4QOKD 3CC5B 2DJUA 3O2DH 2IWKA 4NZTH 1YYMH 4N2NA 4J1UA 4J3SA 4F9LC 1A7BA 1VFBA 3MBXH 1DEDA 1HXMA 4OZGE 1DVSA 4OUUB 1ES0A 2AVGA 3UTZB 3GHEH 2A4ZA 3CVCA 1GZPA 5AL8A 3QC6X 4NP9A 4MMXB 4S1SH 3OMIB 1SVCP 1H6UA 3GLZA 4S2SA 3DRQB 3LNIA 3L16A 4ZXBC 3U2SA 4IJ3C 4FQJH 4PD4K 1BEXA 2NW3A 4TS6A 3TEWA 4RMTA 3MZTA 3SKNA 3WEOA 4P2RB 3BD5A 5EUOF 3VXOB 4LGPB 2CXKA 3BZFA 3V0WH 2NDFA 2GIXA 3ASOB 3OKLB 4PWJA 3RFZA 4NQQA 2Q8BH 3ARSA 3VXTB 3O3DB 3ISWA 1KN4H 1FVDA 1NKOA 3CTTA 5D96C 4DWHA 1CD0A 2V5TA 1QRNE 5F3BB 3BT2L 3OZ9L 1R3HB 4Z95H 5ICXA 3VE0A 3KPOA 2AXWA 4B9PA 3QDGD 2MHAA 3FC8A 4ENZA 3TYFA 4U0RC 3N41F 3ELAT 3QUXA 4K9JA 2JKTM 3L4WA 1R47A 1TJHL 1KBBA 3ZYJA 1NFDF 3ARDC 3IDGA 3DIFB 1NMCB 1FO0B 4GY4A 3O6LL 3QO1B 4JFFB 4L5FE 4OZGA 4DP1X 5IB3A 1B4RA 1CXKA 3TJHC 5EBMB 2EEFA 4HISA 4K94C 3AM8C 3NZ8B 4YLCA 4GW1B 1DFXA 3W11C 4Y4KA 4OZ4A 4I2XE 4A7VA 1WBYA 2P1YA 5EU6E 1QUNA 4LSVH 5EEVA 4AIZA 1DQLL 2GSMB 1NC2A 5HVWA 2XQYG 2D03H 2VABA 3KPPA 4HUUA 1QMUA 2YLKA 4MJIE 3CN1A 2Q7YA 1KACB 5C08E 4DGYH 5KSBF 1A1OB 4HIHB 1H6EA 2AI0H 1L9RA 2DLGA 4ACTA 2BHUA 2A9ML 3LH9A 2WQSA 4BSVB 5C0AD 3QULA 4MJHA 5F9WB 1QRNA 1HAWA 3QUGA 2MSPA 4YXHL 1HH9A 2LVCA 2E7CA 4QYOA 3VSQA 4E9QA 1RZJH 1JK8B 1A7RH 1S7SB 3F6JA 3GSNH 3O3EB 4ATTA 2E86A 3C60C 4LP4A 3VI4E 5FUCC 4UDTA 5TK2A 1M42A 3Q2CA 4FQHB 1L7IL 4UOW0 1FF5A 3QIWC 4JHWH 1XGQB 4KZCA 5FDWB 3FFDB 4FI7A 1AJ7H 1YEFH 2EACA 5I0ZA 3B7RL 1YN6A 3ZSSA 1O75A 3CFCH 5AUMB 4BA0A 1TFHA 1QI5A 2P8LB 4IGBD 2ED6A 2I5YL 4F2EA 1CGUA 4I2XA 5DURD 5EU6A 3X3GH 1T20B 2HXAA 3FTZA 1XF2A 1A6AB 4FFTA 3D09A 3G9VA 4AI7A 1SM3L 3RNQA 4F80A 1I9IL 3GGWB 4MJIA 4G83A 1NCNA 3D1MC 1ILUA 1BFOA 5C08A 3SDXF 1SFDA 1R5WB 4S11A 3T0ED 2QADD 1Z9SA 1I9RH 4I77H 5ALCL 3C2AH 4KXZH 2OMXA 1HZHH 3QZOA 5CZVL 1CGVA 4WFFE 4F37F 1XMWA 3OKOB 3EO9H 5G5DB 3C5SA 3GO1L 4FYTA 1T83A 3HNVL 4CAGA 3G9AB 2F53D 3P3YA 1CFNA 3CAFA 2XACC 5FUZH 4IRSB 3EJRA 3FZUC 4X6BA 4LEOA 2A1WL 3VI4A 3P73A 5HDRA 4I48A 3GSNA 3LQZB 3SD2A 1QEWB 4OV6F 1ASQA 3L3OA 5HYSA 4XCYA 1GTFA 4QTFA 2AP2A 4Y1SA 1TT6A 4G1MB 3RUGF 4JL1A 3TA4D 2FDBP 1OZTG 3ZOAA 1OOAA 2ICCA 2KLTA 2WVSA 1MXGA 2W65B 2Y25A 2FEEI 2RFXB 3DUHA 1U93A 2DQCH 2VDMB 3FUNA 4UT7H 5DD6B 5IGXH 4TKWA 5KS9E 1S7UB 5D1QC 1FNFA 2IANE 3G5WA 4L2YA 3C5ZD 3DTXB 2K6WA 1NGQH 1MELA 2DL9A 5HJBA 1BBDH 5DFVC 2AMUA 1G6RH 3LV3A 4HUKB 1E9OA 3HHSA 4O00A 4OCWL 4EIGB 1QRKA 1WWCA 4FCAA 5DRNB 4I7ZC 2DWXA 3BDYH 1HS6A 5J5EA 2BSEA 2BVUA 2GCYA 3LKNA 5I17B 1ED3A 5BV7L 2BW5A 3NK3A 3RNKA 1F00I 3E7JA 4ZMWA 2VLKD 5T33L 4H13C 2VIRA 4XPGL 3WL9A 3WXWH 3QDGB 1Q94A 4HF5L 3T4AB 4Z7WF 3K72B 4M43L 3KYAA 4NZ8A 4MA1B 4F8QA 4GBXD 5JW3L 4PGCA 4MYPA 2BNRE 2LTQC 1JV2B 4X4ZA 1ETZA 1WZ1H 3QFJE 5KS9A 1TTBA 1G87A 2WXQA 1G7JA 3EDEA 2GHZA 2WN2A 3FU0A 4N5EC 1NCHA 5SWZE 3QUKA 4WTQA 2IANA 4NO0D 2CBMA 2L8AA 5DVOA 3LHAA 1A3RL 4MJ6B 1KPRA 2YRBA 1G6VK 1INEH 4XMVA 3D25B 4K3HA 4X8GA 3CJJA 1AXSA 1NINA 1G6RA 1AYOA 2OMTA 1E27B 3B2VH 5I0YA 3CH1B 2KHAA 1NZRA 1SHXA 3F7QA 3PNWA 5DD1L 5IHWA 3LPFA 5L4IA 4X6DF 5BRQA 3AW5A 4FQXB 2UUDK 3T8XA 5C0AB 4JS7A 4L3FA 1M6OA 2O5YL 2V6HA 4LLAA 3D85D 2Q10A 2B1HH 2Y1VA 4X5XB 5IG7B 2EEBA 5DJ6B 3SDDD 4X5RA 4RNRB 5C2BL 3FONA 3JSSA 1FGNH 3WXVL 1LDPH 5BW7C 1KPVA 3T65A 5I1EH 2BNRA 1D5IL 1T1XB 1MHPH 2IPTL 2XZCH 3UCRA 2OMUA 3QFJA 3HC4L 4QNPF 5HD8D 4PVMA 1Y0LB 5SWZA 1DEEA 1OAZL 1A9BA 4HEPG 3BWUC 1L6PA 2NXYC 4HQQL 1MLCB 3QORD 5DURB 2MCG1 3KGUA 3IT8D 1BM3H 1ZA3B 1NTDA 2CRZA 3TPUB 4EIBA 1NCUA 4FLOA 3TZVA 1FAKT 1R9FA 4N24A 4C56E 1R46A 4GKNB 4PCKA 1J5HA 2F7IA 4HIEA 5LNGA 4HDIA 4UQDA 5FV2A 4H40A 3CMOH 2QADB 4XP6L 4NBZB 1JPST 1PZ2A 2QT6A 3SHSA 3QJZA 3MRRB 4F7KA 2EAEA 3OZKA 4PJGF 3H42L 4MNQD 2G75B 2F53B 3QFDA 3QZWA 4IDJL 1MRCL 3FN9A 3MRHA 1BZ8A 3WE6B 5CBAB 3FN0H 3KJ4B 1JHKL 2R9HC 5D1ZC 1ZLDA 5FHBH 5HI5D 1RSYA 4XOAA 3OKDA 4YH6A 5E4EB 1LEIB 1A6ZA 1ZHLA 1EANA 1C7TA 3Q01A 5TGBB 5HDBF 3DSFL 4NKMA 2ATKA 4KK8C 4P3DB 2CA3A 3EOBA 4RSYA 5GS1A 1RJLB 2WLZA 3OB0H 1NCBH 2VDQL 1S7TA 4NQSA 1LE9B 1UEYA 1T22A 4GKSA 3FUEA 4N2OA 5ITBL 4F58H 3I74A 5L8LB 3OL2A 5DD0L 1T21B 5F7DB 1ZIAA 4LCUA 2Q8AH 4CVWA 3C5ZB 4C56A 1T4KA 3DX7A 1JGIA 2C9RA 5GRYA 1FJ1B 5FO9B 1WA0X 4K4KA 2VDPH 3BVVA 4ZNCD 2VL5A 3AY2A 2XJLA 1VESA 2YAEA 2FH6A 1DUZB 2Q6WA 1O7SA 4D0CA 5J12B 5E9DD 3JTSB 3HZVB 4KVNH 4XCCH 5T3ZD 5D7LD 5KBLA 5EU4A 2LOEA 5ENWB 5F9WC 5IVXE 1KBVA 2BH0A 3OAUL 5IEHA 4NT6B 1AO7D 1P1VA 3EDFA 1ET5A 1IUZA 4TF4A 4X5PA 4GRLD 3MLZH 2J7LA 3MROA 3RWEB 1H3UA 2VLKB 3HN5A 2FQGA 4XNBA 5I2IA 1CFTB 4Y0GA 1QQDB 3ME0B 3UCQA 1N19A 2C7FA 2J4WH 5I18H 2BZ7A 1MCPH 3N3EA 5EIIB 4F7PB 2VZTA 3P02A 1P7HL 3FB7B 1HEZB 3IXAA 4QJ4B 4B9ZA 1LO0H 1MFNA 4QJ5B 2DMHA 1F58H 4PS4H 3KGTA 1UD8A 2EXWC 4O02L 2VSKB 4I0PB 1IM9A 4J2QA 3TNNA 3NIFB 2AV1B 5J1SC 3HNTH 3BAJA 3EO1A 4K8RC 2R4SL 3TBWA 4E9RA 4OGAC 3MLPA 1SXNA 5FOBB 1WGVA 3N1QC 4OB5H 4PHXA 2FZ3B 1U8CB 2BVOA 2PWDA 3S35X 2VC2L 4W9ZA 3ZTNL 4RMSA 2HT3C 4UOJA 3P9LB 4ACPA 1N2RA 1SYVA 4PV1C 5IVXA 4HS3B 1WBXA 2HA1A 3KS0J 3VRJB 2CIIA 4KVPA 3SPCA 3F58L 5JO5B 5H35A 4X4YA 4HW6A 2FH8A 3LKPA 3BW9A 3DWTA 5DMKB 1OHQA 3NQKA 3SDDB 3W38A 4BFKA 2M83A 2FNWA 4NQUA 2TRHA 1KTDA 4Q6YA 4M56A 4YHKH 2R51A 5E94A 4MAYA 4Y8AA 5DJ2B 5F9JA 5IQLA 1TPXC 3SPIA 1A9EB 3STLA 1TQWA 5ACLA 3AROA 4Z3IA 4Y4HC 4BCYA 3SQRA 1SXSA 4L23A 4FFYL 5EOCH 1EXUA 1KN2H 1KPUA 1N64H 4LLMB 4Z77B 1JHLL 4U3SB 1TZIB 1PU0A 2X4NB 3QORB 3FPXA 2E0PA 2IAAC 3FU7B 4PJHE 2OQJA 2NSXA 3UROR 2XN2A 3QPQD 4BZ2L 2UZXA 1AACA 1WPCA 1YEKH 2UVFA 2BY0A 1WBZA 1NDGB 2MOGA 4XNAA 2ZKHH 2IWEA 2W07A 2CH8A 1ZVSA 2ZOOA 32C2A 1G7LA 2EO7A 3JWDC 1SVZA 4OVVA 5E95B 3NACL 2DBLH 2I07B 1E2WA 4JFYA 4H25A 4M62L 5FK9B 5EO9A 5CEXA 2WXPA 4OFYA 3D0VA 4BK5C 2NR6C 3EYVB 3RVTD 2MPVA 1TZOA 5PAZA 1GOHA 3KCPA 1E9PB 3MREA 3VXQA 3T6QC 1O6VA 3X12B 2PYFB 4PI0A 1A3LL 2WZ6A 4KUCF 4GG6F 3OR6A 4ZUSB 3L9EA 4PRBB 4GG8B 5EUKA 2P8MB 2ZYHA 2BNQD 5DJDA 3VWJC 3LQMA 3QK0A 2WYTA 2NQDA 5E24E 1I8IA 4HWUA 4F9PC 3EH3B 3QISA 2BS8A 1ZIBA 4MCMA 4NQXB 4MMZB 3IAQA 3BQUD 3ZE2B 3EO0B 4N2EA 1RJCA 1A4AA 2BIHA 2K9UA 4PJHA 4JO3L 4AVKA 5DYOB 3GK8H 1JAEA 2YD1A 4PR5B 4IBUA 4JDVA 2BOBB 2BSDA 2X1OA 5E8OB 3NFPA 5HJ3B 2UX7A 2UY7A 1LK2B 4G59C 5DC2A 3DJTA 4J4PD 4OFIA 4YSPA 1QSEE 4JKLA 4K71B 3WFHA 2A74C 3WJLA 1BZOA 4R5VA 1MFDL 3VH8A 4PJ9A 1DVUA 2LFGA 5E9DB 2IMNA 3KHOA 4NZRL 3RWDB 4APQB 3REWA 2VQ1A 5D7LB 4DESA 3U1SH 5C6TL 3UTPE 1AZZC 3RKDD 3QBTB 5IM7A 4F8LA 4PFEA 1QFWH 1UTDA 1W16A 1VFOA 3FMGL 4AL8L 1F90H 3PAVA 1C12A 9PCYA 3NTCH 1YY8B 2K0RA 1S7XA 3QR0A 5GGVL 4M93B 1DQQB 3A47A 3MRNA 5TE4H 4F8PA 2QLVB 1LO2L 2Z64C 4GRWH 2WOBA 4LARH 4QHPA 4JDTL 4AEHL 5IQ9B 4GRWE 5AVWB 2LR4A 4C83B 1HE8A 2TSBA 5ICZA 3EGDA 3MYZA 5F7EH 2BPBA 3T77A 4F7CB 4NO5A 2GBTA 3R4DA 3DECA 1YPZE 1KB5B 3P3RA 4WWPA 1CDGA 1K9TA 1MW2A 4HPHA 1U8PB 3L4XA 1IQWH 5D1XC 1D6EB 3LCYA 2X6AA 3F65A 4YHZL 1A5FL 1JDCA 3S2CA 5CD3A 8FABA 4HUNB 4ZTPH 3AXHA 2N4IA 1K72A 1INQA 2XZQH 4H4NA 2EO9A 2V8LA 2ZX8A 2XOTA 3IGLA 1EVUA 1CIDA 3VCLA 1QSEA 2DYRB 4BA8A 3QNZB 2GHWB 5EUOB 1XXDC 4L37B 4ZMOA 3KLHD 1O6SA 1E5CA 4QHLB 5LBSH 3M1CA 3OD3A 2GKIA 2QSVA 1IT9L 5FIEA 4PSRA 3LKSB 1QBLL 4YBHA 1EFQA 5IJBC 3BPOB 2P80D 4BKLB 4JHAH 4M29A 1N5AA 2CPCA 4W1TA 3GNML 1SLUA 2NTFA 4YK4C 3OKNB 2DWYA 2YXWA 5SX5K 5I24A 3WTSA 1CTOA 1QLEL 5HJGA 2LFEA 1G7PB 1NFDB 4OF5A 4XNYH 1YQVH 4CBZA 1G9MC 1YPZA 2R2HA 3FRUA 1MFAH 4KROC 5E6IA 4G6JH 5A6LA 3QZBA 2CO7A 5T1MA 3LY6A 1M2VB 4F91B 5AAMA 4NIYE 3MRJB 1KJ2H 1EWHA 3BPCB 4ODWA 4ZPTA 1OF2A 1JCKA 2JJVA 3UAAA 1FA4A 5EFIB 4M5ZL 4UUJA 1P4BL 4QT5B 3D69A 5ESQA 4NGHH 3TV8A 2LU7A 4EQ2A 3OKMA 3ATFA 3ARVA 5KSBB 1AY1L 2PTTB 2YAPA 3SCMD 1AOZA 2E4FA 2OS7A 5EN3A 3PQYE 3RKPA 2ZZUT 1VDGA 3IGAB 1PLCA 3F62A 4JY4B 1GS6X 1F41A 1CICA 4ODXA 3FQRB 3UGUA 5LBSA 2VM4A 1H9DA 4KFZC 3HI5H 4LSPL 1ZSDB 2VW6A 3N1GC 1NUFA 3ULUD 2QPSA 3PL6C 3O3BA 2ID5A 1S5HA 4MA3A 3EYOB 4Z7OF 2CIKB 2EADA 2Y72A 4PTTA 3FSAA 5E00A 1HTYA 3MNMA 5ALBL 3UACA 5D7JA 4PUBH 3KH3A 4X9IA 5D70H 1UZ8B 3O6FA 5CR1A 1J5OL 1GRWA 3F05A 4N0RA 3BH9B 4HMCA 2YN3A 1AR1D 2V0AA 4AKQA 1W0WB 2QSCL 5KJRH 5J13B 4LCIL 1R5VA 2C3GA 3BQUB 4P9HC 4XC3H 3WNMA 5GSVA 2V2XB 2UYLA 4K2UH 3GIVB 1MAKA 4Z7VF 4XVJH 1AQMA 4A55A 1CD1B 2LABA 3OJDB 3PQYA 4P2YA 3GBML 1VCAA 3V9EA 1J8KA 2F5BH 3N44F 1SMAA 2W95A 2XCMC 1F4WL 1Z32X 3PWPE 5C70A 2HJFA 2VR6A 5DC9B 3MCG1 3K81A 1EHAA 1HL8A 3K8KA 5JNYA 3NABH 2A3TA 1E5ZA 2DWTA 4ZMYA 4OV5B 1HYSC 1BQUA 5J4MA 3ZE0F 3STZB 2Y7LA 4QHNB 2ZUQC 3DJ9A 4W93A 2DLHA 2DQFA 1BOGB 5DVPA 2R29L 2FD6H 2FQDA 4JM2C 4H0IA 5DJZB 3S4SG 3RUGB 3ZE1E 1XF3B 1MQ8A 5LGKA 2W0FB 1MJUH 3FO9A 2OZ4L 1OAKH 4LRNL 4DETA 4X5WA 5CF3A 4JGNA 1RIUH 2OI9C 3BPLC 5DUML 4P9MH 2CJ3A 1ZXKA 3LRKA 4X6EB 1D9KC 2VE6A 2Y3NA 3K1DA 1FBIH 4FFWD 3MJ9H 1I7ZB 4G5AA 3WG7B 1GC1L 2CO4A 4XN9A 1QKZH 4JO2L 4IGBC 4CC4C 4CMHC 3VFMB 5CSZA 1TVHA 3RTQA 4YSQA 4RGMC 3JYCA 2E75C 4YBLB 3U4BH 1SUJA 3AMKA 3PWPA 4L18A 5E6SB 5GHWH 1NC4A 5IIEA 2VUOA 2PCPA 3FUIA 4DKDC 5HDLA 1JRHI 1RD6A 4YR6A 4R7XA 1IGJB 1CMOA 3UG3A 3T0EC 1BZ7A 4AE1A 2DIEA 2F7QA 3ZSTA 1A6UL 3IXTB 1TU2B 1H5BB 3MRQB 1KJVA 3AADB 3TN0D 1KCVL 4O51B 2F58L 3CHRA 3OC8A 1J8RA 4KQ4L 2YS4A 1FORH 4KJQC 4Z7WB 2C3WA 3HC2A 5TFSL 1IBHA 1OGSA 1PPIA 1AZBA 1HSBB 2ATPB 5CUSL 2FJHA 1WO2A 1IVLA 1QI4A 4OJFL 5KVEL 3RDTC 5SWSE 7PAZA 1WFMA 1Y6NR 4JFWA 4X6FB 4JRYE 4PJ7F 2WTRB 3GLDA 4U4BA 4UQEA 1DSYA 1QLRA 1OPGL 4PGEB 4G8FA 2QKSA 4H8VA 4Y16D 3TT1L 5TE6L 4WI2A 3BUPA 3ULAB 3TF7C 5AB9A 2H26B 3MJ9A 3QG6A 1J9CT 4TQIA 5DT1H 4PWHA 5J57B 5EA0L 3MV8B 4WO4A 3VSVA 3LB6D 1VLXA 4JY6B 2XPGB 4H8WC 3UYPA 1E4WL 3EYQC 4LLVB 3SCMB 4L1DA 1TSHA 2X2YA 3KPLB 1MVFA 1IGYA 3LEYL 4XH2B 1PD6A 3CFEB 3IJ8A 4OLEA 12E8H 4JFTA 5LHDA 4X6DB 1OTTC 1N6QL 3WLBB 2XVLA 3FCTA 3MOQA 3Q44A 2ZUWA 2YEQA 4LGRB 3UEQA 1PFOA 1HSAA 3CFDB 3G3LA 1N18A 5KVMC 4JG1L 4PG9B 1AR2A 3BP6A 1LQSR 1TETH 1QPKA 1QLFA 3IDNA 1LM8V 3SDAD 5I1LB 4I3SH 2H0JA 4TN9A 5SWSA 1KLFA 4N9GB 3QDJD 1JGVL 4JRYA 2F1AA 3LZNA 1CJYA 4DAGL 4NC0B 5F0JB 3WY4A 3INUL 4ETQA 2QHLA 3M17A 4GBXC 4XNQB 5E5RB 3LZFH 5J1AA 2YA1A 3CZLA 5FGBA 1N8OE 4LDCA 1LTXA 3ABGA 1FNEA 1XB8A 3HMWL 4LCVA 3PPSA 1EX0A 2WIMA 4R7NB 4WWID 3L3KB 3INOA 2CK0L 3LMJL 4C4KO 2FWUA 1H3PH 2IV9A 5AKRA 2XBZA 4PGZA 4LSRL 4Y2LA 2XZAL 2MIZA 4MQ7B 1KCSL 3X11A 3OAZH 1MVUA 2HFGL 2P4AB 2VR8A 3GKZA 2NY4B 4KKLC 2NCEA 3WS3A 1S4IA 4PGBA 1ZWIB 3TVMD 4RMWA 5E8PB 4RZKA 3OXRA 4L8SC 5JXAH 1JPSL 2DYPD 3GZPA 4RFNB 4Z78A 4JRXE 2MCPH 3HA0A 1V3LA 2NY5L 4KUCD 2JKRM 2EYRB 4V33A 2CKBB 1MI5B 4YPGA 2BSCA 4D7PA 1FC1A 4M7KH 2HX8A 2X4OB 4XXWC 5C0IA 3K46A 5K9KA 1JZJA 3HFMH 4M6AA 1DTUA 2CU9A 1DQDH 2L7JA 5EZIL 5IB1A 4WNQA 3G5XB 1PG7H 1G9EA 2HKAA 1KT2A 1XR9B 3QUML 4CGTA 3C9NB 5CM1A 4BH8B 2VDKB 2X2IA 5HD8C 4YX2L 1ET7A 4KKAD 4RFOL 4XE0A 4XPTL 1RIVH 1Z9OA 3NRFA 1PFCA 3O2WH 5AVYB 5EZOH 1Z3RA 4NN7C 5DCCA 1JD9A 3AAZB 1VFUA 2DLEA 1T5WB 4QHUA 4ILDA 4YSCA 4K7PL 1N8ZA 1VZGA 1F3DH 1N59A 1NAKH 1GKEA 1FPTL 1RV6X 1B0RA 2W9DH 3GSXA 4JQXC 1HN1A 3KYMB 5GRZA 5TDPA 3BIKA 4R26L 3N5AA 4U7SA 1S78C 1MDTA 1OAQL 5ISZE 5CBEA 3UZQB 4JRXA 5T1LD 4GO8A 3B37A 3DX3A 3RPBA 3TN0B 1IAMA 1ZOXA 4ZPVB 3US9A 1SJEA 4WU7B 2ZWLT 1TQUA 3NIDB 5CAYB 3MLSH 5HGBB 3K6OA 4D9RE 1BD2D 2IDUA 2GT9A 1X5LA 3RYMA 1J05A 2CLRB 2J1YA 2Y2WA 4OD3L 2JXMB 1JNHB 1NAML 4LE8A 4PJAE 5DTFB 4HOXA 3CSYA 1UC6A 2MOVA 4XNUH 4Y16B 1LNUA 3K6NA 2AXGB 4QDGA 2OR7A 3ZGHA 4NRXB 1AXIB 2X9ZA 2Z93A 3EUDA 5HHXH 2SEBB 4HZAA 2XG4A 5I82A 4KQ3H 4HIPA 1E6OL 1U8NB 3GLAA 4LSDA 2V2TB 2QDVA 5FYKU 4HOZA 3BGAA 1FNGA 4NKOB 3PLYA 5HHNA 2PCFB 4FNTA 4Y5VA 4YSEA 4MBOA 3WIIL 5ISZA 1UH4A 1IARB 2HLAA 4P2QB 4JM2F 3QXUA 1F11B 3DTDA 3U9UA 3QQ3B 3B2XA 4ZO9A 3IGFA 5EU3A 2BOCB 2NZIA 3VXUE 2PW2B 2FT7A 1XD0A 2WAQA 4IRJD 3QHZH 4PJAA 1H8SA 3SBWC 3TEZA 5I1DB 4B41A 3BWAA 5E7FA 3SDAB 4N0UB 1KC5H 2X4PB 4OF0A 4X99B 3U1QA 4EF3A 3QDJB 3DK0A 2RB8A 4MDIA 2EUVA 4NZTL 1GGUA 1BBJB 3RZCA 2JB6B 4J3VA 43CAB 4L4TE 2YPLD 4GO6B 25C8H 1X7QB 5JPNA 3K2MC 1X7SA 1SHSA 3ZZQA 4FTVD 2VLJB 4XMWA 3GRWL 4CUCA 2XUWA 4S1SL 1A7OH 3JWNE 1CXLA 3B2UD 1CT8A 2NT0A 4Q2ZB 2J5WA 4FQJL 1G0XA 1OM3H 4OD2B 4ECNA 1P5UA 1S9VB 4FP8L 3IPEA 4HFUH 5F88B 1IKOP 4UQBA 5C0RL 1TJMA 5I5RA 5IY5B 4L29A 5FC9A 1JXKA 3BE1H 3V0WL 1QG3A 3SYAA 3TVMB 4RETB 4JVWA 3VXUA 1KN4L 2OCCB 1E65A 3B9KD 1UXWB 2ZF8A 4X2UA 3SYOA 1U58A 2F74A 2OYPA 1NKRA 4GG6B 5CLYA 4JCMA 4HMDA 1W0YT 2Y1ZA 3QNXA 4XBGB 3B9EA 1DBAL 7FABH 4G3YL 5E8NA 3D9AH 2NY6B 3DKHA 2GJ6D 4L5FL 3P54A 4L4TA 2F6AA 2UXTA 4MHHG 3DPBA 5F6IC 4HKXA 1UD5A 1MNUL 3HZ3A 1YYLH 1BMWA 5I6XC 4GFXA 2WTPA 1BYOA 1QABA 5SV4A 2CDFA 5IR1A 3U7WH 2WMPB 2E47A 1XF4A 2E7BA 4IKKA 1JWMB 4ZTOH 4FKHA 3L95A 4LSVL 2JI1A 1KXQE 3S3PA 2I32A 1A6TB 2OXHB 2D03L 4U3CA 3U2JA 3KEDA 4NFCA 1ZA6A 3QZMA 4MNGB 4JB9L 1BFVH 1JPFA 3UTSB 2AI0L 3DX4A 1U3NA 3O4OB 3QI9D 5AZ2H 3WN5A 4KFMA 3GMLA 2ARJB 1UGKA 4UOW1 5DZAA 5AAWA 3VQ1C 5T1LB 4LZKA 4P5RA 5ILTL 2P3YA 3SDXE 1N5YH 1X9LA 2VMEA 1X9RA 3TIDA 5IMKB 1JE6A 1LE5B 2P28B 3DOIA 3RVTC 4PY7B 1DR9A 1A7RL 2YUXA 3GSNL 3PP3K 3AGWA 5C0CD 3PIQA 4LCYB 1K6QL 5FECA 2R7EB 4OQTH 4KZEH 2FK9A 1E6JL 4J8RA 5B7EA 4AC2A 2EE3A 2J5LB 2MPAH 1YN7B 3DSNA 4JHWL 3GBLA 1DQTA 5D5ME 1K2DA 1E3XA 3EOTL 1AJ7L 3QIUD 5CP3H 3NN8B 2A6JA 2AGJL 3B9VA 3CFCL 5BQ7B 4YS4A 1NKGA 1QFPA 4K5OA 3E8VA 4WUUD 5C0GB 3D06A 1HQ4B 3G6JB 2F61A 3O8XC 3U36A 4ESKA 1KXQA 1LO3H 2X9WA 4PJDE 1BZQK 2UX6A 3RL1A 5FYJD 1BLNB 1ZMYA 4OKVB 1F4YH 4BHUA 4MD0B 4DKEH 4XMUA 4JPVL 4I77L 2GTWB 1I9RL 3CX5K 4JDEB 3F7YB 3QCTH 3RQ3A 4J4PC 3C2AL 3RPIB 3FXIC 3ARZA 4LBEB 4JFUA 2BERA 4M1CD 3EO9L 3A5VA 3SDXA 2H9GA 2NNXA 4XCFH 2ESVE 5CLZA 2XXFA 4ZUTB 4LF3A 4U2YA 4U6HB 4WWNA 5FUZL 3L5WB 3RKDC 3VQ2C 1YNTF 1R1CA 1KIUB 1Q38A 2ZSVB 3PXJA 3RWGB 3ZBMA 5BNXD 1F6AA 1TZAA 4NI6A 2VM3A 2O93L 5TH2A 1GYCA 5HY9A 1SN0A 2G4EA 2WXLA 3QIBA 1AZCA 4OQTA 5E56A 3PGDB 3CFBB 4QY8A 3L3JB 2G9HA 5D5MA 2R1YA 4OIBA 2YPLB 5CP3A 5AZUA 2DZEA 3KXFE 4UT7L 4AQ8A 3V0AC 5CGTA 5C0JA 2VJ8A 4NQED 2OJZH 3P9MA 4XGZB 3H9SD 5IBTL 1JZHA 3RJDA 1SXZA 2YFOA 2YGQA 3OJ2C 4PJDA 2Z31D 1BBDL 3P69A 2XDHA 3CVHA 4PV9B 1G6RL 2X1WL 4P06A 5C97A 1PMYA 1B90A 4IU3B 4R7LA 3QCUH 5DU7A 2XU9A 1RQ5A 1FZKB 1CXHA 5EF0A 1EMTH 1PDKA 2BP8B 3WEBA 3BDYL 1LEKA 2ITDB 4D9LH 3WEAA 3KLHC 2YRZA 2ESVA 5IKCB 5EBLB 4P57A 3LEVH 3KPQB 2X6BA 2HG0A 2V7HA 5HGHA 4CNIB 2WM0A 3DGGB 3C87A 1T3FB 4QR7A 4GQQA 4GUPB 5CJQH 3RG1C 3TBCA 3BUTA 3OWRA 2A7BA 1T2XA 2FJSA 3I6GB 4UIMB 3WXWL 1VKXA 3ZVVA 5DLML 4NOBA 5KANI 3FB8B 4KJYB 3S98A 2HRHA 1X6LA 3DURA 3DX2A 4L4VD 2QMJA 2B15A 4BJLA 3B7UX 4YNYA 1WZ1L 4Y1TA 1MCWM 3KPMA 3KXFA 4N0FA 1G84A 5JPMA 2JQMA 2XNAB 1Y7VA 3IS1X 5D93C 4YHNB 5CWSA 4QEGA 1UKTA 3RWFB 4OFQA 1USZA 3BKYH 4Z7VB 2HUHA 4FF9A 3ECWA 3RWIB 4PJXB 1INEL 4M4PA 4FQCL 2H8PB 3TBVA 1A8ZA 4ABVA 4GAYB 3FQXA 2OL3H 1G7HA 3BKML 1CDHA 3B2VL 4PBWD 3WFZA 1FI8C 3QI9B 4KGJA 4BBWA 1GHFL 3SKJL 4DPCX 3RVWD 1KLGA 1IAKA 4NNYA 3ZE0B 1DBJL 1XGRA 4JL2A 1H0DA 1KJ3L 2VR3A 1AI1H 3ULUC 1NGWA 5I6OA 2Z8RA 3RA7H 4BELD 3HAEG 4F5CE 4QGYA 1FGNL 3QNYB 2Z91B 2Y0SA 5F3HA 3HPJB 3PGFH 4PJGE 3QQ9D 5I1EL 4PV8B 3AITA 4FEIA 2MWCA 5HHME 1MHPL 3O9WD 2XZCL 4MSWB 4FERA 1RK1A 3GI9H 3EJQA 4K94H 2HJKB 4UILL 4F9LA 5F7KC 1QUPA 1OP3K 1G1KA 2W38A 4J6IA 1AR1C 4K5PA 4XAKE 2P5WE 5KSAD 3OAWA 1TTAA 4B95C 5HDBE 3SEPA 3C6LC 1BM3L 5FB8B 4YFLF 4ZXBA 3IMTA 4DUVA 1RVFH 4NPYB 1YUKB 3V4UH 4Y9CA 4CVZB 4UI2A 1JGEB 4ZK8A 2YAHA 5BOZG 3U0TB 1LVEA 1R6VA 1ZXQA 2P49B 3I9PA 5LUMA 1MPAH 2OL3A 3CMOL 2WNGA 1DE4A 1JZ6A 3V9FA 4Q74A 4WFED 3NAAL 2VQTA 3HG1E 1BJ1H 3CU1A 3X1FA 1L9MA 4YAQB 3NFNA 3IDYB 5F8RC 3FN0L 2Y7MA 2YRPA 5FO7B 2F1EA 1XH2A 5FHBL 4F5CA 4UTAH 1HJCA 3QH3B 2QPFA 1JZFA 5TDNA 3PFQA 4PJGA 5AG9A 5IP4A 3G04B 4PJ7B 2DLFL 5FUCE 3WGVB 3ARDA 3BUIA 3ET9F 1AGCB 1J0YA 1NCBL 2DI8A 3AM8A 2G3NA 2NY3D 4WSKA 2P5WA 2A6KA 2CCLA 4CJ0A 4KZDH 3JXAA 5HYQA 2A74B 1L7TH 3W9DB 1MG3C 4X42A 5EO0B 2E7DA 2FR4B 1W80A 3BPNC 1QSFB 4L8BA 4UIKH 5K9OA 4MJJA 3WJJC 1YEHL 4M1DH 4FFWC 2A77H 2KZWA 2CBQA 2Z31B 5FKAB 2BSTA 2YR3A 3BAXA 5B8CC 1VERA 2FL5B 1UZ6F 1YEWA 2VDPL 3FFCE 4XBPA 3GBNH 1ASPA 3Q6FA 3ZHKA 3ARXA 1TQSA 3QQDA 3BN9D 2DQGH 3CVIL 1ND0A 3HG1A 5DJXA 1OK0A 1JXDA 2DJMA 5BRZE 5INCB 3CVDA 1ACCA 1S7QA 1YO4A 4WU5A 2W91A 4OU3A 2HSIA 4AE0A 3MLZL 1DBMH 3MXVH 3RY5A 4XXDA 3C60A 4UTAA 5KW9H 4XNXH 1JF5A 4M7LT 2APFA 4LK4A 4PJBF 5I18L 1MCPL 1XH3B 3QIWA 3TO2A 4L4VB 1OGTA 4EUPG 2DDQH 4HOWA 4U1SA 3WKMH 2IDFA 2DN7A 3DROB 4DQAA 2FJFB 2KZKA 4IMLA 1W72H 4NM8L 4KKRA 4KDWA 4QJ3B 3HNTL 5D1QE 4R96B 3GT6A 4XR8C 2GK2A 4CVUA 4Q6IB 2B8OT 4I87A 4OLWH 4CW1A 3FUKA 4BIKA 3FFCA 3B9DA 3P2TA 4FFZH 1B3IA 4YDKL 3VFTB 3VFUA 4OB5L 3BMVA 1ITCA 3EJZD 3LB6C 5FEBA 3RIAF 1IM3A 4PP2A 5BRZA 1WZMA 1ZVHA 5DVLA 4KRPC 2B0SH 3TCLA 1RLBA 5LXGH 5C07E 4EI6B 3O41B 4X8JB 5SX4I 4UM9D 3RB5A 3NFSH 3AC0A 3VVVA 2ZXBA 1N4XH 1KULA 3RHWK 3S37H 2E8ZA 5J3HD 5DRZA 4IIZA 2FYYA 1QPXA 4LDLB 4LSSH 2BY2A 2D8KA 3I02A 2EH8L 5JDSB 4I1RA 2UUDH 4YHKL 4G82A 3L2LA 3O9WB 5I9QC 3VQLA 1NGYA 2P5ED 5DMYA 5I8EA 3PV6B 2WW8A 3UJJH 3T8MA 2YPVH 5EOCL 3LEXA 3QT2A 1EVTC 5BRPA 4X80H 1KN2L 3UDWC 5DF0A 1N64L 3AG2B 5D1QA 1W72A 3SDCB 5KSAB 3TCXA 2XVKA 4Q9QL 3K2KA 1S8DB 1TTFA 1ETJA 1UH2A 1T1YB 1K85A 2HFFB 5CJXC 3CMGA 2Z35A 3ESUF 4HJSA 1P7QD 4ZUWA 1UT1A 1YEKL 5ANHA 2OW7A 2ZKHL 4LGSB 4TL5A 5A7BA 2VO8A 3HHMA 3IJSB 4YDZA 4EEEA 3ZDWA 3BUBA 2Y23A 5C07A 5LLIC 5DJCA 1RZIB 1TF4A 1R3LB 4HIIA 3WD5H 3RWJB 1CL7I 4OH2A 1NCAH 2IPUG 3ILPA 1OE3A 3HEIB 1HHKB 3H4HA 4JK0D 2M8XA 2CO1A 2WXKA 4OZFB 2QQNH 3CHPA 4XX5A 2GSIB 5I71B 4ZW3A 4BE5A 3HI6H 3NRPA 5F1IA 3SY0A 3ZKSD 1C08A 4GI6A 5IB4A 1HHGB 4AJVA 4FHJA 2HFTA 1U8IA 2XWRA 2Y9RT 1YNKH 5IJCC 1AD0A 1R3JB 4ETYA 2NY3B 3IE9A 2NXZD 2P24A 2A5UA 1JCVA 2YPVA 4PJIE 4GMTH 1BQRA 4PGDA 5MHSD 1MW1A 1IC5L 1F1AA 2NW2A 3NCCB 4LLWB 2DRUA 3J07A 4A7SA 3MRBA 4EN3D 5I8OL 1CF1A 3VXSD 3BRFA 4WSJA 3GK8L 3VRLF 4H20H 3CDGB 1C8PA 1QX1A 4KKAC 1KZYA 1P7BA 3QYCA 4CKQA 4JUTA 5IVNA 1G1CA 1WRFA 2V2WA 2YO3A 5CNHA 1IFRA 3D3VD 3IM1A 3FAWA 43C9B 1A22B 1PAMA 2ZNXA 4CADA 2YD3A 2E9IA 5L88L 3CZGA 4CBPA 3U1SL 1QTYT 4TSAH 2EDYA 3FQ1A 1HXYB 3DARA 1I3GH 4UINH 3LN5A 1F90L 3TA3B 5F0MB 5BZDB 2KZBA 3NTCL 4LPVA 2VQ4A 1CFVH 3FTXA 5TE4L 1FL3A 3DHUA 5BW7A 3ZDYF 2BHYA 3WIAA 3C8HA 1TJGH 3CCHB 4HXAH 4OF3A 4PH8A 5CFHA 4QRFA 3DYMA 5F7EL 1NUDA 4JZOA 2DWDA 1C9SA 2XXGA 1J8HD 4PJIA 1ZJAA 5I0DA 5CS7A 4ZYKA 1IQWL 2WINB 4FMKA 4RDBA 2NUTA 3NZSA 1O5DT 3WS6C 5ID0A 4Q9BA 3BP7A 4Q58C 1CPUA 1PIGA 4OY9A 2ISDA 2XZQL 4N3TA 5IHUH 2BVPA 5BS0B 2BSSB 1U6AH 5D2LF 1BGXL 3PWUA 4OGZA 3EADA 2JJTC 1YEJH 1KG0B 4BFOA 2EE2A 4KTDH 4GINA 2EVIA 4A7GA 4U0QB 5LBSL 5AVVB 4NUMA 4O58H 1B2YA 1JVOA 3EUUA 4Y5YB 4CDGC 3EYUH 2VT0A 5ABDE 2X0WA 4K3GA 1PZDA 1YMMD 1EFXA 1XGYH 4G8IB 4M5TA 5DK3A 3MJGX 4UM9B 4FGMA 3MRFB 3T3PF 1EEYB 3DX6A 3EH5B 3IFPA 5D1ZA 4YUEH 2YN5A 5DD5H 1DVFD 4IIQC 5L2KB 3KW8A 3GMOA 3PJNA 1T04A 1TITA 4JFPA 5E03A 3R4RA 4IRJC 4HP5A 2PO6C 4FJZA 5MEOA 2R0LH 5GGUA 3OKYA 4XNYL 5TE7H 4QRAA 1OAYH 1YQVL 5CCHE 3RE0A 4CN4A 3Q06A 4XNZC 1MFAL 4F92B 4G6JL 4Z7OE 4J3OH 3TJPA 1WH0A 2VLLA 3TBTB 1WAAF 1KXVC 4XWOD 5CZKA 1CGXA 1TTUA 1WDAA 5IVZB 4BUGA 4WF7A 4OZHF 4LESA 4K8RH 1OD7A 4KXZI 5CJ8A 1GJWA 4DP6X 4YDMA 4NGHL 2JE8A 2XYBA 3RWCA 1LQBC 4OCRH 5IMLA 4UB0H 1JFHA 4NZUL 3RDJA 2DWSA 3ECVA 3VTMA 3B2UC 4YN3A 4IDLA 3MMEB 2DKSA 3PABA 5FDYA 4TNWF 4AW7A 3FTUA 1F3DJ 5FFGA 1IZKA 4ZMXA 2QV2A 5C0BD 3T3MF 3P11L 5DRXA 1BQHA 3V4VB 2OLDA 1RFDL 3U7YH 4JANB 3E8UH 4P2OD 3UPRB 3B9KC 3SGEI 1WWAX 4LBAA 2UWEF 1E42A 4IRZH 3WFEH 1JWUB 3ARWA 3UYRH 3HJ0A 5AB2A 3GZOA 3N1PC 4H1LG 3P30H 2BY3A 4YVNA 1IAOB 1CF8L 1S9YB 2JIXA 4YDLC 2H2PD 1SDYA 2WXRA 3LRHA 4J2XA 1OCWL 5EEZA 5AZEH 2HT4D 4U1IA 2NXZB 4ALAH 4ELMF 5KJRL 4IU2A 3MNZB 5TPWH 4FA7B 1HHIA 4YHYC 1M71A 5EPMA 3VXMD 4EN3B 5I1AB 5J9PA 4XC3L 1CGSL 3VXSB 1JZ5A 1TVBA 1FZMB 3EOAA 1OAXH 4OFDA 4XVJL 1AANA 2ZG3A 1J1PH 3V95A 1PZ5B 2F5BL 3JWDH 1ORQA 4WHCA 1FLTX 1T7XA 1I75A 4J3TA 4E9YA 5JIPA 3D3VB 4LP8A 3HB3D 5HHOE 2NT1A 3E2HC 3NABL 3BEWA 3G5YA 3HZKA 3IVKB 4JR9L 5IHBA 4YDIL 2FIRT 5JR1H 4L8CA 3KWVA 4NNXB 2Z6FA 2MTPA 1T03L 3ZHNA 3EDDA 4PYGA 3U9PH 2JKWA 2OX5B 5I6PA 2FD6L 1CBVH 1M7DA 3MBWB 1IC7H 1SRDA 2FO4B 4XXCC 3R8BB 3L7FB 1NCDH 4F33B 5I6MA 4WNSA 1AIFB 3NP3A 3U4KA 1OAKL 4Y4HA 1U9KA 3WNNA 2PYEE 3LH2H 2MNJB 3HCVB 3TIEA 1J8HB 4PRDA 2V9TA 4Y1AD 1FC2D 1FBIL 1Z5LA 3V0VA 4LCWD 4R0LB 3DBXB 4WV1B 3K74B 3JWOC 4FADA 3CFIC 1ORSA 2ZCHL 3C8KA 2WQXA 1D5ZA 2A99A 4JG0H 1QKZL 4U1NB 3EBHA 4MWFB 1F4AA 3GUTB 3WNLA 1NGXA 4XOCA 1QNIA 4G1EB 3BKCH 3U4BL 1V5JA 4XB7A 3BFOA 2CLVB 3KBFA 4UNIA 3AREB 3ASWA 5GHWL 4YHIB 4LLQB 2IEPA 5HHOA 4NO2A 4M3HA 5DD3L 4X9BA 2PWGA 4JKWA 3IDXH 5GGVY 5SWQA 1HCVA 4BK5A 1P6FA 4WIQA 3ULSA 2NR6A 4AT6B 3QR2A 1EZVY 3BP4B 1OW0C 3MRDA 1AD9A 1TCRB 3ECBB 1FORL 2X28A 5E1AA 1MCSA 1BF5A 1DVFB 4WHTA 3BCFA 2XN9D 3KPRE 5CCKH 4FZEH 3VWJA 1QFUL 2K78A 2Z92B 2ZP9A 2PYEA 2I9TA 4PW4A 3NA4A 1U0QA 4F9PA 1KGJA 3FO0H 3HUJE 1JS4A 4X4XA 3HE7C 3RVXC 1I8KB 1XF1A 1Z3GH 2ALWA 2AZUA 3GRGA 1I3RA 4KK9C 5D1XE 2MNWA 4PBXA 5HI4D 3IAPA 1GA2A 3M1OA 3FUFA 3MGOA 4FQQB 2AJVH 3BGMB 3ASNB 4Y2DB 5GGRA 1RP8A 5K93A 1PD1A 4Y7MA 3C09B 3CN0A 4L3CB 4P49A 2X7LB 2NNRA 1CURA 4D7BA 4Q6KA 1NJ9B 1UA6H 2F54E 1NGZB 3WUWG 4RIRA 1I9JH 4U7MA 5F7YC 2DV6A 3P77A 5C0BB 1RZFL 4HIHA 4PRHE 3S96A 3N42F 4LU5H 4X0KB 2V37A 1LD9A 2RA1A 4GAGH 5FR3A 3B5HA 2W8CA 3DX9A 4LLYB 1WT5C 2EE9A 2D2CC 4P2OB 2J8UF 4TNFA 2IGFH 3I6LE 1A14H 3KPRA 1Q8MA 4DNLA 1TETL 4MA8L 2XX0A 4I3SL 3K3QA 5K9JL 1G9MH 4WW1A 3RWHA 2CSPA 1ANUA 1M56B 3TYGL 3CQFA 1GYVA 3FOLB 4BSWB 1AHWB 3HUJA 4DP9X 5E2TL 3MV9E 4RGND 2NQCA 4QOKE 4JX0A 3LZFL 4WI9A 4XNMA 2YXMA 4IOFD 3AB0B 3MA7A 5D1XA 3VXRD 1BPVA 4IEFB 3WFCH 2A83A 2H6UA 3VXMB 3T4YB 2BNUA 1ZVNA 3BVNA 3K6SB 3QEGH 3UP1A 1ILSA 4Z5RA 1H3PL 3KGRA 4XWGH 2WXGA 3GMMB 3NCXA 2VLRD 2F54A 3T2NH 3CXFA 3GF8A 2L7UA 1AQDA 5JOEA 3DV4A 2JH2A 2VH5L 1S7WB 1UKSA 3QRBA 1MIMH 3V0DA 2MQ0A 4GEIA