1N19A

Structure of the hsod a4v mutant
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
153
structure length
153
Chain Sequence
b'ATKVVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHSIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide Dismutase [Cu-Zn]
publication title Insights into Lou Gehrig's disease from the structure and instability of the A4V mutant of human Cu,Zn superoxide dismutase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 38
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2002-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1n19A00
4FF9A 1E9PB 1MFMA 2WKOF 3S0PA 1U3NA 1F1GA 2C9VA 3F7KA 3PU7A 2JCWA 4A7GA 3GZPA 1SRDA 2AQRA 2JLPA 3CQQA 2E46A 2WWNA 1F18A 3KH4A 2SODB 1B4TA 4OH2A 1OEZW 1SXBA 1CB4A 1IB5A 1JK9A 1N18A 2XJLA 3LTVA 2Z7WA 4BCZA 1IBDA 2ZKXA 3L9EA 1PZSA 2AEOA 1UXMA 2WWOA 3H2QA 1E9OA 1XSOA 1PTZA 2Z7UA 2V0AA 2ZKWA 2ZOWA 1E9QA 1OZUA 1Q0EA 1IBHA 1FUNA 3HOGA 2ZKYA 3GZOA 2E47A 1XTLA 2C9UA 5KBKA 3GTVA 1SXCA 1YAIA 1IBBA 3HW7A 1DSWA 4MCMA 1BZOA 1SXSA 3L9YA 1RK7A 2VR7A 2WZ6A 5KBLA 2AF2A 1JK9B 1SOSA 4U4IA 1AZVA 3QQDA 4A7UA 4BD4A 3GQFA 3CE1A 3T5WA 1CBJA 1E9OB 1SDAB 3KH3A 3GZQA 4N3TA 2GBUA 2Z7YA 1SXAA 2WKOA 3H2PA 2AQTA 1ESOA 3SODB 1COBA 2NNXA 4N3UA 4A7VA 2APSA 4OJAA 2WZ5A 1SXZA 2WYZA 3ECUA 3F7LA 1Z9NA 2GBVA 3CQPA 3KM1A 1SDYA 2C9SA 4A7QA 2AQPA 3GTTA 3KM2A 1OZTG 1EJ8A 1IBFA 1S4IA 2GBTA 1B4LA 5CU9A 3HFFA 1Z9PA 4L05A 1JCVA 1F1AA 1F1DA 1N19A 4MCNA 5KBMA 1OALA 1QUPA 1EQWA 4A7TA 2LU5A 1OAJA 1E9PA 1E9QB 1YSOA 1L3NA 1HL5A 3ECWA 1XTMA 1BA9A 4B3EA 3K91A 2AQSA 2AQNA 1KMGA 1TO5A 2K4WA 2VR6A 3KBFA 1DO5A 2Z7ZA 4A7GF 3RE0A 3ECVA 1SPDA 3MKGA 1YAZA 2VR8A 2WYTA 1SXNA 2AQQA 3QQDB 2XJKA 2Q2LA 1HL4A 3MNDA 1P1VA 2WZ0A 1PU0A 4BCYA 1UXLA 2R27A 4A7SA 3KBEA 1TO4A
chains in the Genus database with same CATH superfamily
4EBQL 4WW2B 3KPTA 1YA5A 3BKJH 2OMTA 3S34L 1YCSA 4NBYB 3GSUA 5D4JA 5C0CA 4EIBA 1XCTB 4MA1B 5C7ZA 2C34A 1I1AA 4ADGA 1D9KC 1Q72L 4XMLL 4YHKL 1HTYA 1FLTX 5AW7B 5FYKH 1I7TB 2NSXA 2X4PB 1WCBA 4O51A 3X1EA 4HWUA 4P9MH 4P2OA 5JHDD 1N5YL 2N01B 1MHHB 2CO3A 4XR8C 4KV5F 3TWCL 3MXVL 3QIWD 5L2JA 4RLDA 3ROLA 5EO0B 2PYED 5GS0L 4NZFA 1KN2L 4UDTB 5DA4A 3MLXH 5D1XA 5T1KB 1IJ9A 4NQEA 1YEEH 4QJ3B 2WLNA 1M7UA 4WUKH 3VYPA 3TO4B 2YUXA 4P2QA 3TONA 2VSKB 5FYLH 2BIOA 4O2EA 2W1NA 3O8XB 5IUCA 4WENB 1TT6A 3OTTA 3QPQC 5E1GA 4PV8B 3WS6A 3CZKA 2MMXA 1SMDA 1AZVA 2X53A 3AABA 1SN0A 3OKOA 2A9NL 4K5LA 2PCYA 3HG5A 4UAHA 4JJ5A 3T5WA 3EJRA 1BOYA 5FF6B 3IM1A 1RH8A 4AYMC 3W82A 3LRSA 3ULUD 5KG9A 3WGUB 3BO8B 2LVCA 4FKHA 3ET9F 4XWOC 5C0FB 2QHLA 1D5XB 2NNXA 3N9GL 4N20A 4NCC2 3WFEH 2Z31C 3CHQA 1IEAB 3EDEA 3SE6A 1WAPA 4B9GA 4Z7QE 4XH2B 5BO1L 1BVLB 2D0HA 5T5FL 3ZTEA 1BG1A 1WAAE 3OAWA 3VAEA 2VDQL 5DWUH 2CBPA 3CC1A 5IB2B 5D6CA 1UYWH 5M94B 4P5RA 3MV9A 5I1JH 4P57A 5E6ZA 1BVNP 2XX0A 2V5TA 3HLKA 4JM2B 3VGGA 1JHTB 1URIA 3CFMA 5DJYB 1VDGA 2EH7L 4GMTL 1BFOB 4QYAA 3RFRA 3KCPA 2YAHA 4LHQB 4W9GC 4BK8A 2F53A 5FOBB 4NQCA 2XFXB 5HVFB 1U8HB 3E8UL 1SJXA 3QUKA 2YJLA 1SMOA 5A40E 5E99L 3BAYA 2V2TB 3DX6A 4BQ9A 4HZLB 43C9A 3AT9A 2GJ6D 5DJCB 2EYTB 4H20H 5E7BA 5ELIA 3DO7A 2ORBL 1O75A 3ZRSA 3CLFH 2EILB 3DVNA 5EEUA 1MUJA 5E1IA 2OL3B 1MJJA 2JLLA 2J2ZA 3F6IA 4KZCA 5GRWA 4LLMA 3HC4L 3QO0B 4KNSA 5ITBH 4IJTA 3EYVA 4LE8A 1LEGA 2KQMA 3R4RA 5DHVB 5IEKA 5FO2A 3CN1A 1WUZA 1FWXA 5D93B 3MX0A 3EJZC 4YBHA 4ZOAA 2CMRH 4AVJA 2ZYHA 3EO0A 3DSFH 4GP8B 3VGHA 2ZONA 4G7RB 2VL5B 2BSED 1G0DA 1NFDF 3MLVL 4ZPVA 1ZT1A 5KOMC 3ZHNA 1RZ7H 2WWMC 3M6DA 1FDLH 3Q3GB 4HBCL 3FB5B 2ZX8A 4HK0B 3O6ML 2HX7A 2P8LA 1EO7A 1DANU 2LV4A 4URKA 1O5DT 3AREB 3DX7B 2HZHA 2VDKB 2QGCA 4H8VA 3WLWD 2XZZA 3FT1A 5E9DA 3GSRA 3CDGA 1P2CB 3I6LE 5L2KB 1GGTA 2PWDA 1T4WA 1ACXA 4NUJA 1HCYA 4MJHA 2VLKE 2UZYA 2WBJC 2IBBA 2WJ5A 1FNEB 3EUUA 5MEOB 4LNRA 4JLRA 2YPKA 1PLGL 1AQDA 2EP6A 2F8OA 2OR8A 4I88A 1RUKL 1BIIB 4JFZH 3HI5L 3TV3H 2VN6A 3CK0H 2C4FT 4HK3N 1AQKH 1DFXA 5GHWL 4ZODA 2W65B 1TZHB 4U1HA 2DMBA 2WYIA 3C8HA 4P5TD 4ACTA 3C5SA 3JTBA 4U1GC 2R4RL 3C60D 5IW6B 4ODTL 3MGTB 3RWIA 1T6VN 2F8VA 1FL3B 4GI6A 2APTA 4PRDB 4EZLA 5D7KD 3EFOB 4TQ8A 1FVEB 1S9YB 2O1AA 3FL7A 1XT5A 4F33B 3TIEA 5A2KH 3P73B 3MBXH 4FG2A 4ZMLA 1UKTA 4S1QH 3JVGC 4MZ2A 3VXNA 1YJDH 2NR6D 3QEGH 4WI6A 4ZQKB 5TGBB 4DKTA 1XX9C 1IGML 2C9PA 1RU9L 2BVUA 4M93B 1FNGA 3OG4B 3VGFA 5DS8B 1MRDH 2XN2A 1CL7I 5D72H 4TLUA 5DK2A 3AXIA 3U36A 3GB7B 4UM9B 3LS5L 4NAQA 4NP4L 3MLRL 2XXGA 1DVZA 3OKLA 4PRPB 3I84A 1CDUA 3F04A 4HISA 3TBSB 4P2RA 1OOAA 3U7WL 3Q44A 3Q2LA 4I2XE 3F5WA 1XHHA 5C0CE 3RPBA 4F5CA 2O5XL 4NO2B 5I66B 2GQHA 2AC0A 3THML 3FMGH 4FEIA 1AIFB 5F3BA 1OTSC 3NSDA 1MF2H 2R23B 3IFPA 3N44B 5IBTL 2XLLA 1LO3H 5FDWA 3TT3L 4JRLA 5B22A 1C12B 4HEMA 4M9PA 2BNRA 5C0ND 4YDLC 4PWKA 3WTYA 3PABA 2N56A 4GRMA 1PFCA 2BY3A 5IB3A 4H1LB 1KENL 1I82A 2E74C 4LF3B 3WEBA 1H8OA 4JFXA 4PJ9C 3EGSA 3E6HA 4KJWC 2H4EA 3OXSB 3V8OA 1TMQA 5D1XE 4KWUA 3UPCA 3OHMB 3ZE1E 2DY2A 4NQEE 4OFDA 2A4EA 2PPDA 3MTXA 3H56A 5BVPH 1H8NA 2HPOA 3U6XA 4MA8H 3IMTA 4U1KB 5I1EH 4P2QE 2KI6A 2DJ4A 4NFCA 1D6VH 3KW7A 3L9YA 2QKIA 3NCJH 2D3VA 1ZGLA 4AEIL 1NMBL 1TYRA 4JFOB 3DX9B 2XZQL 2HN7A 3HG1B 2R0LH 2VDPL 3CX5K 4IGBB 4QHUA 3CX2A 3P3UA 5ERWB 4W1TA 4Z95H 4JFPA 5GRJH 5CUSL 1JDDA 2X4OB 3FFCA 5DJ0B 1DYZA 2NUTA 5AW2B 3QPKA 3L3KB 5SWZB 4FZ8H 4ANVA 4N5EC 3BUPA 2N1TE 4MB4A 1SYVA 2GSGB 4NHUB 4Q6YA 3RL2B 2A9ML 3ARQA 2XWRA 1R24A 3N43F 3ZE2B 3S2CA 3HZVA 2FGWL 3X2QB 4F37F 5IHZB 5J06A 1YEDA 1WEJL 3L3GA 1OL0A 3QUMH 1KEGL 4WVRA 4HOZA 2GFBA 2HRPL 3OB8A 4Z3HA 1MXGA 5CJOH 3MV9E 4O5LL 3UTZA 1KTDA 1VADB 1N19A 4YWGL 4JDVA 1E6JH 2VDNH 1FBIL 5TE6H 1FF5A 2UX6A 3LN5B 2XN9B 3TU6A 2F53E 4NQCE 1Q9KB 4HH9A 4IKKA 3B1UA 3IXAB 1NJ9B 1HDMB 3BFWA 3SE9H 2XPGA 1CCZA 2OXHB 3LS4H 2EYRB 4UB0L 4OGQC 5E5MB 5KW9L 1RVFH 1RZKC 4F7PB 3F64A 3TVMB 4Y5VB 2XXFA 4G6ML 4APXB 4U6HA 5K5YA 1A6VL 2NY6C 3MLPA 1M9SA 2X0WA 3TYFA 4MS8D 2J21A 3UBXI 2Q2LA 5FOJA 1TG8A 4CILA 3X14B 1NDMB 3KPSB 4ONHB 1TTBA 4UT6L 4GG8A 1WA1X 4LCUA 2R69L 3ARGA 1T2QH 3FN0L 3HIZA 5AWNL 3SJVA 4P4KC 3V0WL 4N2BA 3CFJA 5HI5D 5HHVH 1AXTL 2EYSB 3QFGA 4XOCA 2W9LA 1NIDA 2A74A 2XI9A 4FJYA 2H32B 1KZYA 5I1HL 1E4WH 2R1WA 1QWNA 1PZBA 5AKSA 5FYLE 2EDOA 4S1RL 3W0WA 3WDIA 5I8OH 2CLVA 4ZOEA 4NO0A 3VSUA 3L3DB 5T1MA 2G2PA 6FABH 5LGJA 5IB5A 3FRPB 5JUEL 2IAMC 2PLTA 1YMMB 3L54A 5GSVA 1WQVT 2Y7QB 4QD2E 1HSBA 3SGKA 2ZXGA 4CL7A 2OCJA 1QLFA 1T89A 2OTWA 5G55A 5SX5K 2ZAHA 1ADWA 5KSAD 2BNUA 4PJCA 1NBVH 5BQ7B 1TEGA 1A5FL 1G7LA 3HNSL 4JO2H 1I7UA 4JZNA 5E9DE 3UO1L 2ZYRA 3B3IB 5F7EL 5B3JE 3DIFB 4Y2LA 2X2UA 3DO4A 3FAXA 2OJZL 4LLWA 1LLAA 3FU9A 4PGJA 4FQXD 4M3JA 3LYRA 4K3EL 2NNFA 2X38A 5EWIL 1ZGLP 1S9XB 3D39A 1Z5YD 4DEPC 4P23A 3JWDH 4CVXA 2BIQA 3UP1A 4R3SA 3VDBA 2WTPA 3AY4C 5E6UB 4EOWL 2QZQA 1MDAA 2HJLA 4FQHA 4L5FL 5IW1B 3EO9L 5CBAB 4U33A 2O26U 5GS2H 3D0LA 4KHTL 5D1ZA 3VYNA 3T2NH 1QBBA 3VFNB 5CU5A 4N87A 1REIA 3X13A 4JANB 4TQEL 4GG6B 2A0LD 3RIAF 4LASH 3CQPA 3NJVA 3MRLB 4M61B 4AQOA 1BZEA 2JQMA 2WUCL 1HXYB 1H9DA 2ZX5A 3MACL 3BD3A 4K23H 2JB5H 2IG2H 4KBPA 5G4MA 3U46B 4C59B 3QR0A 1FA4A 3P69A 1DBJH 3LHAA 1QI5A 2NYYD 3UEQA 4Z7OE 2Q6WB 1MJ7H 4GI9A 4K55A 4V2CB 4JFEA 1KNOB 3K8LA 2H41A 3CHSA 4F2MB 4F7TA 1CIDA 4HXBH 2YOAA 5CJXA 1HL5A 5ACMA 3CZEA 1GKEA 5FA3A 5BJTA 2X6MA 2HFTA 2ATPA 1NC2B 2W8CA 4MD0B 2EVJA 5HY9B 2HRLA 1UKSA 4XMKL 3WTXA 4U2YA 2BVOA 1U8PB 3KPQB 4I4WA 1M7DB 4F27A 1A6TA 5AYTA 1XGTA 2ZQKA 2XU9A 1RV6X 2AEPL 4KY2A 3QQDB 2CRYA 3BN9C 4BCYA 1ZVNA 4LSDA 5IFAH 4XBEH 3VXSA 3WEXB 4ZTPL 4ZUTA 3CPLB 2N4IA 1N8ZA 5KYWB 5FUCC 1E4JA 3S35L 1V8HA 2H2SD 2VDMH 1IM9D 3DX3A 1CQYA 2ICEA 1C8QA 3QIBC 4P2RE 4W9JC 1GSMA 3IDGA 2NXYC 3WXVH 2PTTB 4CNIB 4F5CE 3U2SA 3LKRB 2ZXAA 4FLSA 3GWJA 1I1YA 4U1SB 1LWRA 3TWYA 1WAAF 3V0AC 2YLHA 1IFRA 1FYTB 2QR0A 3CDZB 1DVFD 2G2RA 2XV0A 2ITDB 4XBPB 3ULVD 4HEME 2BNRE 4TOYH 5C8JB 4AKQA 3C5ZA 4MS6A 1LO2H 4YGVB 1KJVB 1UXMA 2HTLD 2XXCB 3DNKA 3QIWB 4S1DC 1S9WB 1NCWH 2JKJA 1TIUA 3KE0A 4V2BA 1Y0LA 1OZUA 4YHIB 5BRZD 3P4NB 3DVGA 3SO3C 1FVCA 2B59A 3ML8A 4XO8A 4DJMA 5BRPA 3CMOH 3GTVA 4WNJA 4KKAC 1DSWA 4PWGA 5F7YC 1DN2A 4NNXB 1NH6A 1SF5A 4WJ5A 1MFBH 1JNNH 2IADB 1FZOB 4DGYL 5EIIA 4R4NC 1IAII 2FB4L 4J7RA 3F2LA 1MH5A 3HI6L 4NN5C 5GGTL 5DZJA 4J8QA 4UYQA 4I0PA 2YD0A 1CU4H 3FTZA 4LBEB 2WKOA 2VR4A 1KZQA 2Y6TE 3FFCE 3O2DL 4BFNA 2XPYA 1M56B 2IV9A 2EDBA 1JHKH 1UM6H 3TA3C 4GBXD 4MDRA 4BXVA 1JNLL 1JJUA 2F7IA 2E56A 3P2BA 4YFLF 4DKDC 4N2NA 2GJZA 4KHXL 5JORA 3OKDB 1D6EB 3GRWA 3MA9H 4EKXA 1FFRA 1FLRH 1IILE 3M7OA 3ZDZF 4IIQA 4F58L 5BZXA 5L4MA 5KJ7E 3OWRA 2WZPA 2YO3A 4WI5A 4M8UA 5HD8C 5E95B 2CA4A 4XB7A 4IRJA 5IHBA 1HNGA 5TE7H 4HUUB 3ZUCA 3GUFA 1RULH 5F6HI 3MJ8B 5K39B 5C07B 1RIVH 5KYYB 2XYCA 4X6FA 1D9KB 3IPEA 4MSWB 5JDJA 2W95A 2Z93B 1SFHA 3QUYD 2WY3B 2OZNA 4HKXA 1FO0B 4R7DB 5I1DB 2EVFA 4PJBA 1UVQA 2AQNA 2EXTA 5I8KL 2A4CA 5K59E 2VQ4A 2YKKA 4M3HA 2D3NA 2VR6A 1EJOH 5AAMC 4PFEA 1BFVL 4HOWA 4S0HA 3H2WA 4EI0A 5LN8A 1J1XL 4R9HA 4NGHL 3N42B 1TSHA 2HKHH 1HCFX 4OUUB 2AXHA 3SBWC 4BM7A 4PGDB 4R90H 1UWYA 1CFNB 3APCA 3N85L 4KJQC 4PMFA 3FUFA 3A67H 4X6CB 5FW6A 1W16A 5TE4H 4I8DA 2A9CA 2WXNA 1F4YH 3ABMB 4K9JA 1HOCA 1ROCA 1WE5A 1Z2KA 1E40A 4L1TA 5ACZB 4JFQB 5FYJD 3SJVE 3RVXD 4CU6A 3PWVB 2EZ0C 1M2OA 3LV3B 3QIUB 4RFOH 4OGYL 1OY3B 4MYWB 4ENED 4RA3A 4BK5A 4QRQA 1W8NA 1BF8A 3M7FB 5AOMA 3W0WE 5EOCH 2Z31B 3WNPA 3GSOA 3SKJH 5FAAA 3QWQB 5MHSE 2YA2A 4OIFA 4PQXA 1KCUH 4KQ4L 1NC4B 4CVWA 1Q9LB 2Y5QA 3QEQA 1VGEL 1BV8A 1LHZA 2Z35A 4QRRA 1IGJA 2QPDB 4M8RA 4JHAL 3RWJB 4PJCE 1Z7JA 4JGUA 4RGND 5BQDA 4AVIA 1G7HB 4WHTA 3ZDXB 3GZOA 4DGIL 3ATEA 1CFQA 4MD4B 1C7TA 5EBLB 4W6WB 1WBXB 4AZ8A 4YQXL 5GZNC 4AV0A 2VJXA 3OMZA 3BUTA 4LKCB 3P3YA 3SGEI 3V6OA 1OIOA 4IBTA 3C2AL 4GKNB 4L3CB 4N8PA 3D39E 3B7YA 3SCMC 3QI9A 5TDNB 2NY3C 5I15H 1B2WH 3HS0C 3WIAA 1R46A 4BBWA 4NYLA 3QNXB 1A1MB 3FHQA 1TZGH 4NC0B 2Q3XA 4MJ6B 3TYGH 5TF0A 1TF4A 2E9WA 5GS3A 4C83A 3TP4A 1UG9A 2DWDB 1RZ8A 3M1BA 2VC2L 1IM3A 3KPOB 5HYSA 2P47B 1GPOH 4HCIA 1I4FA 3H3PH 2XUWA 3IU4L 4ANUA 3NBNA 1KJMA 1XIWC 4GMSH 4PRHA 4DESA 5LG6A 3TXAA 2Y22A 4ALAH 1Z9PA 3LNFA 1J8HD 3PWUA 5E6IC 1CXHA 2JQZA 3KYKL 4XO4A 2DQHH 4RAVB 2RHEA 3BKJL 4JFEE 3NZ8A 2HVBA 5BMFL 3ECWA 3DUUA 3EOBA 1N3NA 3K91A 2P44B 3MRFB 4GYBA 3WXWH 2CHWA 2H0FA 1ETZB 5F0JB 4GIAA 2EEDA 3GSWA 4LFHG 4AEHH 4BUHA 4YEFA 1U8QA 2FX8H 4W6XB 3UOAB 5A2JH 5AYUL 5CCKL 1A9BB 4ZRGA 1HZKA 5L6YL 3FQYA 3PWPD 5FYKL 1ZSHA 1U9KA 4FFVD 1AY1L 3FO2A 4WTQA 3MRRB 4U3CA 3CXHJ 3D9AH 2EEAA 1OSPL 3QUZA 2PXYD 1P7KB 2ZUQB 5JMOC 4M7LT 5A7EA 4XI5C 1UA6L 2VERA 2GJPA 3UBFA 1YYCA 3VXSE 2BWDA 3U0TA 2WBJB 3GPSA 4JFFB 1FVDA 3VWJC 3WFHB 3WDJA 4EN3A 5B38A 3IVKB 1GGIL 2DBJA 4RIRB 4R4FH 1YEEL 5EIIG 4KI5E 1WFJA 3BAWA 3CFIC 4ILDA 4WUKL 1PLCA 4HIJB 1H6UA 2D7PA 4MD5B 4LEBA 1A3QA 2H6PA 1TOXA 5DJAA 4S0TD 2MCG1 5EIVA 4X9GA 3MYJA 4X9BA 2MCAA 2O93L 1JDCA 3SQBA 4AMXA 1UM5L 4F7CB 3KL3A 1LTXA 3N04A 1UACL 5E4IA 3ZKMD 3PXJA 2H47C 1UZ6F 1MHCA 1ET5A 3UTTD 1VGKB 1XF3B 3FBQA 4YSTA 2BNQB 2V9TA 3V5KB 4E41A 4OCYH 4GAGL 5MERA 1ET8A 3DBXA 4U6VL 1NM9A 3BH8A 4LCVA 4HAFA 1CE6B 3KPLB 3MRCA 3WNKA 4QY8B 3VI3A 1A8JH 3FTSA 1PYWA 5K9KA 2WZ6A 1UYWL 3F7VA 5I1JL 3V6FA 2XIDA 3CFKA 3PNRB 5D7JC 1NQBA 3QJTB 4A39A 3KMDA 5HVGB 3BESR 2WAHA 2IOIA 3NIFB 3PDOB 3QVAA 1CFSB 2J71A 2CZNA 3UJJL 2PABA 4NHCH 2G5BA 2DIJA 5EBGA 4PJHF 2X1XR 3QCVH 2D4DA 3NJHA 1THAA 5IIEA 4OI7A 2EDKA 5DJXA 1PKOA 4H20L 5GIRA 2DI9A 3FJTA 3OPZH 3VFUB 1HHKA 2RAMA 4HJJH 3NA9L 1XSKA 1LMIA 1S5IH 3ELAT 5LQBL 5FYJU 1RSFA 2J6WA 2HFFB 3NCBB 4N90E 5IVXB 5EEYA 3LNDA 4J12A 5KVFH 5ITBL 3JV6B 4Z6AT 4YDLB 1ZWIB 4KRPC 3JUYA 5EZJB 5DJ6B 1ILUA 4PJBE 2H3XC 2DMKA 1I1RA 1JZ5A 3BHBB 1XDTT 2CMRL 1X5AA 3DSFL 1CQKA 3DYMA 2YXWA 4QKXB 4OF5A 1S7UA 5DEJA 4NI3A 3K71A 1FDLL 2DTMH 2Y2YA 1K8IA 4LVNC 4QOKB 4BEIA 3QSKB 1FPTL 1ZD6A 1ECYA 4XVTH 4J1UA 2AQ1A 4J8RB 3T0EC 5JXAH 4DZBA 5T3XE 5JIPA 3P30H 5LDUA 3UJIH 2ZCLH 4HKJA 5F1IB 1FZKB 3GHEH 5E8NA 5HGBB 2J1YA 4HIXH 4BYHA 2GTZB 1CXLA 4DUWA 5ICZB 3IN0A 1A7OH 4M7JL 5A3IC 4JZJA 2OP4H 1T7XA 1NDTA 3W11D 3A3YB 4UDUB 5E4OA 4EI5D 3ZKNC 1QA9A 1MWAH 4KKPA 4QT5A 3AT8A 4QXUH 32C2A 4ISVB 5DJZB 1GOHA 1R3KB 2X4TA 1Y6NR 3ILPB 4LL1A 1PY9A 4LRNH 4JPQA 3K6SB 1JK9A 4OCMC 3HE6A 3LNHA 3GSXB 4OFYA 5IB4A 1R3HA 3H2QA 1MFCL 4JFZL 1O6TA 2Q9OA 5F7DA 1TMCB 4J23A 4Z7OF 5C1MB 5IMMB 2Y36H 3CK0L 4OD1H 3QEQE 4HWBH 3WFDL 3I75B 4QRRE 4B7IA 1AQKL 1T1ZB 4K5OA 3EJCA 5ICXA 5T3ZL 3QBTB 1Z0NA 1HL8A 4V33A 4HG4J 4Z7WA 1X5FA 4GB9A 2BX5A 5DJDA 1BX2A 4ZMAT 1SXSA 1IGCH 2J4WH 1JE6A 3NIDE 4HK3J 4YHZH 3V4VL 3V6OE 3DX4A 4QXWA 3FOLA 3T2OA 3VGAC 3X11A 2XTJC 3LKNB 1J8KA 3B2PA 4YDVB 3CZLA 1AG0A 4HSAC 2AXFB 4HKZA 3MBXL 4WHYG 1EK3A 2MFNA 2F61A 2GITA 3OF6D 2WQAA 3KDPB 2Z4QB 1YJDL 2I60H 3QEGL 4QHLA 4AIZB 5AVSB 3WN5B 3B2VL 1DQIA 1NSNH 4KKBD 4A6YL 4KXDA 1MKFA 3VFOA 4F7MB 3QWOB 5E8PB 3U30C 3VH8B 4TUOA 4P4KB 1EZLA 1KWGA 2HTKD 1F4XH 2DWEA 5D72L 3S3PA 4PRHE 3ZQXA 1U8JA 2I9TB 3DTUB 3KWTA 4KTDH 4ZUVA 5IREA 1M42A 1VRSA 4WKZB 1G87A 1WZ1L 1U91B 3RWHB 3AXLB 1PJ9A 1I8AA 1WIUA 3MGOA 4XXDB 5EZIL 1DSFH 4POYA 2G2NA 5D5MB 3E1F1 4BELD 3MFGB 3DTDA 4PV9A 1AKPA 3FMGL 3CSGA 1MWAA 4LOUD 4NQSA 4YSQA 3ESMA 4EUPB 1MF2L 2JXMB 4PCKA 4IRZH 1LO3L 3D3VD 4TF4A 3EGDA 3MKGA 4IBLT 1UWGH 3LEXA 4TUUA 4R26H 4MQ7B 2HA1A 4HP5A 1UXLA 1WAEA 2ADGA 1YQ2A 5JW3L 4LCWB 3EXJA 3NFNA 1UD4A 1JZ6A 3H3KA 3V9CA 2PTVA 4KUCF 4WV1A 4FEMA 4JFYA 2HT4C 5BVPL 1N0LA 4GS7C 4NPJA 1Q0YH 4OZHF 2BHYA 1FGVH 5I1EL 4NIKB 1VFBA 4QRPA 1TNNA 4FJZA 1C5BH 2FVNA 2JFCA 3DRQA 4GAYB 4H8HA 1EEZB 4KAQL 3QC6X 2R0LL 1ODUA 2P28B 5IEHB 3KG5A 4P5MA 3CGTA 1QFWH 3RUGB 4P04A 5H8DA 1W72H 2AKRB 3SPVA 4KXZI 4HJ1A 1GY1A 3F8UB 2KLTA 1U3ZA 2DBLH 5EDXA 3LQAH 4D9LH 2ZKYA 3D33A 2F1EA 5CJQH 5TQ2H 1IC5H 4KMLB 4E41E 4MNGB 4DP5X 3MOAL 1FG2B 4FLOA 3QB7C 3VM5A 1YY8A 5K59F 4ZAKA 3NFPA 4JRYB 5F89A 1BZOA 1WFUA 2B4CL 2J1KA 3QUML 3VI3E 4R4BB 2PCPB 2X2IA 3PLYA 5CJOL 1CN4A 1WHPA 1XO8A 1YPZB 5BZDB 3ARFA 5GS0D 2YAFA 2VDNL 1HILB 3AITA 3HHSB 4X7TA 3FFDA 2OTUB 1CG9B 3QXVA 4YDJB 1WGVA 4JFWA 1X5ZA 5INDA 3U79A 1NFKA 1VEOA 4JFVA 4F37K 4NS0A 4ZUWB 2GTQA 4KK5C 4AJVA 3HC3H 4ZXBA 1EBAA 5BS0B 3LS4L 2CIKA 4OFPA 4P3CH 2J88H 4IRZA 2IBGA 2NNCA 2XCMC 1DLFH 1R6VA 4QNPE 4GRLC 2CD0A 3QIBB 5CEXB 2G9HB 4PBVC 1YDPA 2NXYB 4N2FA 2WLKA 5IHWA 4GW4A 1KWKA 4FG6C 4AGPA 1BP3B 4PRNB 3AG1B 2V5YA 1T2QL 1AS7A 4L23A 3CCHA 5HHVL 4ZQTA 4LP4A 3DGGA 2K45A 2J5LC 5HTSA 2ZWKA 1E4WL 1HNYA 2P43B 3MAWA 2LW3A 2WVVA 2WXHA 4NQXA 2P8PB 2WWKT 3IJEA 2YRZA 5CFAA 2EIJB 1GYUA 2BHZA 4NPYB 4QR7A 3VB9A 4OV5A 5I8OL 2NY5H 2CDGA 6FABL 1GZPA 3MRDB 1X9QA 1IC1A 5HI4C 3SO3B 2WXQA 4M48L 3WIIL 4R7LA 1S9VB 1VESA 1EWHA 4J3TA 1VJSA 4DNLA 4ERSL 2XN0A 1ZHLB 3I2CH 4ELKB 1P6AB 1LXMA 4H5SB 3BDYH 3C6LD 3D25A 4X8JA 5IVNA 3T6WA 4AM0Q 4L1DA 4JO2L 1S7XA 5J56B 4F1ZA 1F1GA 1TQCC 4ZX5A 1RHHA 5I75B 4NN5B 3QPXH 1MW3A 1A3LH 2XZCL 2XWBA 4ZBJA 3BX7C 4XRCB 1OLLA 2E7LC 5CMAB 4O00A 3VI4A 5I8EA 5DVNA 5EFIA 4N2KA 3TA3B 3S35X 3T4YA 3KGUA 4UMSA 4H40A 4XZUB 1AP2A 4LDLB 3IDJB 4W9FC 4PG9B 2FTAA 3Q13A 2H9GB 2W81C 5CEZL 3F3HA 1BBDL 1ZHKA 1HKLL 4FQLH 3D5OF 4YHMH 1P69B 1QTPA 1S8DB 2E76C 3KJ6L 3MJ7A 1PZ2A 4LASL 5E2UH 2WB7A 3RWFB 1A6AB 1U0QA 3K6DA 4L1HA 4KXAA 4Z7WE 4OT1H 5A2FA 2LE9A 1WZKA 2IH9A 1RPKA 5L4FA 1V7ML 4K23L 2JB5L 2IG2L 4DKAA 1R0AH 3IMUA 2Q2EB 5DCCA 1RP8A 1CUOA 4LLDA 2WLLA 1MJ7L 4LEOB 4LPUA 1DR9A 4WW2A 4PREB 1H6FA 3ASOB 3FZUC 5KVFE 1OD7A 5EO1B 4HXBL 4PTUB 3MXWL 4P5SA 3RIAK 4Z0XA 2A6KA 5CHNB 3TH3T 3RVWC 2CUAA 1AQ8A 2MKLC 2DI8A 4I77L 4KI5F 1FJ1B 4A2MA 2PR4H 3MHZA 4MKMA 1ZV2A 3ISWA 3SO5A 2WCGA 2XVGA 2A83B 1KGWA 3PAVA 1I7TA 4XXWA 4ZZKA 2X4PA 2AJXH 2VABB 1NCDH 4HUCA 1MHHA 4IS6B 2WMPA 4Y19A 4P8QA 1Z0MA 4HUMB 4J6RL 2XWJB 3IKCA 2XA8H 1QUPA 4XNMB 4CBPA 4OLWH 4XHQA 2EADA 2YBGA 1IKNA 4XCEB 2K70A 1E8YA 5PCYA 5DVLA 5T1KA 2VXQH 3WXVL 1CLCA 1QEWB 4WEUD 3TO4A 3ZW3A 4Q9CA 1GSKA 3VFTB 4XPGH 3J8F7 3O8XA 3PWPB 1QSZA 4Z3EA 4DUXA 3ECVA 2NSQA 2AQ3A 1U2YA 1SF3A 1JPFB 5AQ0A 3RVUD 4TOYL 1KJ2L 4JRXB 1LQSR 2GSIB 5FF6A 3OR7B 2BOBA 2WCPA 4YDNA 3MUZ1 2IBZY 3BO8A 5J12C 1S7RB 4BGLA 5C0FA 1T22B 1WSST 2WKOF 3PY9A 1IEAA 4P48A 3SCMB 2FLMA 2VB5A 2BMKB 2IFGA 2NY3B 3HS0B 3KS0H 3KPPA 3ZN6A 3WL9B 4DAGH 2NX5D 1EAJA 3CMOL 1JN6B 4L4VD 3VRJA 1XGUB 1FP5A 3A22A 3GEWB 4QRPE 4IRSA 2BP0B 3ETSA 4S10A 4L3ED 3C8KB 3EADA 2R51A 4L29B 3TBYB 4QGTA 1GIGH 4HIHB 3BLPX 3SE3A 4G1MB 4JGNA 4DT2A 5KWYC 4WY7L 4LP8A 3QDAA 5DJYA 3GINA 3RURA 1BFOA 4M8QA 1XIWB 1UXSB 1EX0A 1JHKL 2K3TA 3W39A 3AFLA 5D6DC 4YXHH 5AFAA 2B39A 1KULA 4PMEA 1H15A 1S7SB 3L16A 4LIQL 4ZSOA 5DYFA 2BP5M 3NUKA 3W37A 3STLA 4PJBF 2XY2A 3MA9L 2J44A 4HZLA 3ZGHA 1ND0A 5EU7E 2XVBA 4R5XA 5K9QG 1ED3B 5DJCA 2HH0H 1KJ3H 2ZYSA 1JFQH 2HSIA 1KTLA 1E5YA 5F6IC 4B41A 1C16B 1UQSB 5LXGL 4U4IA 1RIVL 3TO2B 4PRIB 2XBDA 3NSFA 3KXFA 1RJCA 4L0YA 5JA8B 1PQZB 1MIEH 2VXQA 5F6HJ 4XCYB 3FONA 5AUMA 2YZ1A 4DZ8A 5A2AA 2EC8A 3F01A 2Z92B 2K8QA 2CXKA 2NZIA 4KROC 4M4RB 3U1SH 5E5RB 3PL6D 1H19A 5IWLC 3JV4B 3VWJB 3T08A 1SFDA 5GJSH 3NRQA 4LAJH 2HKHL 3Q3GA 2F54D 4QXGH 4KKCD 1MLBA 4HK0A 2WM0A 2Q76B 4NZ8A 3MREB 1FI8C 2Y4SA 2K78A 3KBPA 5TE4L 2BM3A 3DX7A 3UG5A 3VXRD 5I76B 5E6RB 2DIEA 5FO8B 3NJLA 4RMVA 5HGDB 3K0WA 4CDGC 1BQUA 1YSOA 4K3HA 2C9AA 7TAAA 5I0YA 3WNOA 1I1CA 5BVJB 1KYFA 4TTDC 4BGDA 1OGTB 3VQ1C 3H54A 3DOSB 2PPCA 5FA4A 2QDWA 2F7QA 1OSYA 2A1WH 3B9AA 5EOCL 5FUZL 1FNEA 3SKJL 2VR8A 4FRWA 5DLML 1Y1DA 1KCUL 2BSSA 3T77B 1UC6A 3FRUB 4CGTA 5J6GA 3MUGA 1E9PB 1JXJA 3QNYB 2OR9H 2W65A 1TZHA 3O0LA 2VR9A 5D7JB 4L4TD 3RGVA 1Z66A 5D1QA 3JYBA 4JPSA 1AR1D 2WTRA 4BKSC 5IW6A 5F0MB 3VQLA 3S7GA 5DFTA 3CX5J 4LEEA 2Y06L 5HSFA 3VW3H 3OKEA 3VI4E 2VDLL 4PRDA 3X12B 1J0IA 3UYPB 2PW2A 3O0RH 3EFOA 1FVEA 4JN1L 3RKDC 1E28B 1SOXA 1ZY9A 4UV4H 4IMKA 1TZGL 2Z7UA 2ZKHH 1ODAA 3TYGL 2EXWC 3LZPA 1QRKA 5F0PB 1Q4NX 3NIGF 4KOCA 4K9EC 3GF8A 4E9XA 3OLGA 4CN4A 4J4PD 1GPOL 1BD2D 1LM8V 4OAWB 3H3PL 2R0KH 1IJNA 2UY6A 3PP4H 4UIMA 1S7TA 3B43A 4WO4A 3MOQA 3HE7D 4J3XA 1RJZB 5IFHH 5DS8A 1VHPA 1OAZH 2EDTA 5FV2A 4KRPB 4I0KA 3FU0A 1RP9A 3SIKA 3IBOA 4JR9H 1N6QL 4ALAL 1E5ZA 1MJ8H 3OJDA 2CO4A 2NZ9C 2A2QT 4TPRH 3MZTA 4NEHB 3VXUD 4QHNB 4M62L 2DQHL 2F74B 1VCBC 2DYPD 3ARBA 4ZW8A 1B0IA 2BC4B 4XOEA 2A4ZA 5G2NA 5TK2A 4PRPA 3TBSA 3U4KA 3KPMB 5JPNC 2VMJA 3FT4A 1E42A 2YIHA 3L3JB 4MX7A 5HI3D 3D2UA 3GXTA 1AGCB 4LVNB 4XBGA 3TT1H 3WXWL 4AEHL 3I9IA 5I66A 1USZA 5JLZA 2FX8L 5CD5D 2DOCA 2FUTA 2ARWA 3T0EB 3QDGB 3DHMA 2BRRL 4OVVA 2E9JA 2R23A 3OZ9H 4YUEH 1C12A 2AP2A 2P5EA 4QTIH 3ZO9A 3MJGX 5IB1B 2KS0A 1QLRB 3G5YA 3HFFA 4H13C 1A3ZA 5SV4A 4AXWB 1SBSH 4RFNC 5KANG 2NR6C 1KPVA 3AMLA 4LF3A 2F9BT 4PGCB 4EIUA 2GI0A 3BVNB 3RJOA 3G04B 3TNNA 4KO5A 4XP1H 4PJXB 2ICWB 3N6YA 1FNHA 2FH6A 3OXSA 3F65A 5TJWK 7FABH 2J8HA 3LPGA 4BFRA 2H32H 3SE8H 4KRMB 4OJFL 2NSMA 5I1CH 4F7KA 7PCYA 3BEWA 1I85A 2DDQH 2XNAB 1NFIB 4LSRL 3B2UC 4I3GA 3UTSA 5MENB 3VI3F 5GRUL 2F58H 1TJMA 1QSEB 4PBWD 3HG1A 2XQBH 4FNLL 1J0YA 2ZUVA 4JFSA 2NT1A 3NACH 4YSPA 4XMXA 1NEZA 1EHAA 3E9UA 4R96A 5KN5B 3LSOB 2IALA 4GKLA 2VO5A 1BYNA 2J56A 5SWZA 3STZB 3L3OC 1GAFH 2WQWA 3TZVA 1ZHBA 4L9LA 3VGAB 4OCYL 5EORL 3F00A 2XTJB 4EIZC 2JJTA 4XX1E 4PJ5D 4QHMA 4L8SC 3D87B 4N2GA 1I8LA 2F7PA 1DUZB 1PL3A 4ODHH 1RIUL 4OH2A 5ENWA 1QFOA 4CVUA 3PAUA 3TF4A 3LTVA 2V9RA 4MQXC 4F3FB 3PNWA 1EFXB 1A7PL 4FG4A 4UV7H 1JPGB 3B9KD 3U30B 4N25A 3WHXB 2ZOWA 5GGRB 4EEEA 3U83A 4ZG1A 7PAZA 5DMKA 1GKOA 4ODUA 4UZGA 3NABH 1NJ9A 4NHCL 4DO6A 4ZSOE 1LDPH 5AOIA 5DK0A 4R7NB 3QT2A 3QCVL 3D09A 3NCCB 1KFAH 2D7TH 1PSKH 1IFHH 1RZJL 5D7LB 3TVMA 5AB2A 4LQFH 1P1ZB 1WFNA 3E8VA 3PHAA 2ERJC 4S1SL 1AFVH 3MRHB 3RTQD 4AYFA 3GD1C 5E2WH 1A4CA 1IL1B 1DQJA 4NN7C 1T0NB 1XF2B 3W57A 3UX9B 2YR3A 3JV0A 2B77A 1DQQA 1JF1B 2Z8RA 3KXFE 1DEEB 2ADYA 2Y72A 3I6LD 4GUQA 1BAGA 1DQLH 2EYSA 1YEHL 2EDEA 3P2TA 3BP6B 1OGPA 4IHOA 4DP7X 1B0GA 3MO1B 4LKXA 4G5ZH 1DHKA 1IQDA 4LVOC 4NQVA 3LMJL 3SDAA 3QORC 1I8IB 4JFHE 1E2VA 4KH9A 4PWJA 2J7LA 3P0YH 2DTML 3EDDA 4Z9KB 5IQ9B 3EIFA 4GS7B 2APXA 2VSMB 2J25A 2Y7QA 1I1AC 1KG0B 1SHSA 1NMCB 2EEFA 4M7ZC 4XVTL 4Y4HC 5JQHC 5JIQA 2KL6A 4FNQA 4W9EC 3L8QA 3P30L 4WHDA 1MG3C 4YHYC 2ZCLL 2VXTH 2IGFH 3NP3A 3QXDA 4HIXL 4MJIA 4P2OC 2ZG3A 5TH2B 4B3EA 4BA8A 2HUEA 1G6RA 3DIFA 4U2ZA 3RNQB 3BGFC 2EIZA 1JTOA 3NP4A 5JYLA 5CGBA 5L2KE 1KCWA 1NFDB 4Z78B 3A21A 4X4ZA 1MWAL 3QWRA 4QXUL 1LE5B 1M6OB 1BWWA 3TFBA 3CUPB 4ABQA 4Q52A 4Z7WF 5D1XC 3D1MC 3H0TB 1FNFA 4FFWC 1S9XA 5KJRH 4FXGC 4JPIB 2UY7B 3BUQA 5CGYC 1OW0A 3B1TA 3CFDA 1AR2A 2OMWB 3N40F 4A7SA 5JHAA 5IW1A 2FIRT 3PG2A 4OD1L 4LPTA 5E8EB 4HWBL 4XGZB 1TYEB 1M7XA 3VFNA 2D7NA 3L2NA 4F20A 3WS6C 2OMVB 1BQ5A 2CDEA 3MRNA 4AYDC 2N7SA 3EBGA 1KGCE 4Y5YC 3GSNB 2Q3ZA 5D1QE 2F8IA 3MRLA 3Q6FA 1MN4A 2Z34A 4GY4A 1QSFB 1IBYA 2DICA 3WUWB 1HXYA 5EN3A 3DKHA 2JQAA 5FO9B 3P11H 3I6KA 4WSGA 5I16B 2X3BA 2AEOA 4CN6A 1P7QD 1IGIH 4FFYH 5DSCB 1KNOA 4I3SL 4Q6KA 4B9IA 4FLHA 2HLFC 4GRLB 4F2MA 2PTUA 1W0VA 2F1BA 4QYOB 2I60L 3JTTB 2EDLA 4MD0A 2AHIA 4LLYB 1NSNL 1CICA 4JQXA 1BF2A 4YFLI 4OCXH 5F9WB 3LEYH 1W0WA 4Y7MA 3UTQA 1KPRB 4KITB 1MAML 4UBDC 2WUBL 2J5LB 3EYFA 3QQDA 4FTVA 3IAGC 3OAZH 1WVZA 2N0KA 1JF6A 3HZMB 3CPLA 4LLVB 4PLKC 6PAZA 1MZYA 2W0FB 3L5XL 3MLZH 4PRPE 2UXGA 4G8AC 2P5PA 3LVEA 3O9WC 4ZFOB 4P2QD 2PTTA 1CL7H 3FQUB 1P7HL 3LKRA 1MCCA 1O7DE 5JPMC 1VA9A 3WV0A 1KTKE 1NEZG 4U1SA 5C0IB 4MJJA 1SDDB 2ENQA 1L9SA 1FFOA 3CDZA 4I1RA 3UPRB 2CRZA 1TQCB 1BZQK 1NUNB 1PG7H 2P5EE 1ZS8A 4XBPA 3ZHLA 3D85B 5EZPA 3VXPB 5C8JA 3QUXD 4B5ZA 4HA1A 1D7DA 3ZSTA 1A6ZB 1ZT7B 5L7XL 1TTAA 1S9WA 1XXFC 2B2XH 1DBMH 5HHXL 5F7MC 2LU5A 3BQVA 3KL0A 2W80C 4PJ6A 2FZ3B 1CURA 5C0JA 4AH2B 1SJHA 4XMUA 3DXAB 1FFPB 2NY0D 2V6HA 3FUNA 1C5BL 3APNA 3GKWH 3M46A 4NNXA 1BAWA 5LAXA 3MYZA 2IADA 5SWQA 3DPBA 3MV9D 3PWLB 3L7FB 5EU6B 4PY8J 4L3AA 1IGYA 2R9HC 2XJKA 1Z6JT 4KQ3H 3HG1E 5DEFA 4ZUSB 4FFYA 4KMTH 1QFWL 3MLSH 2C3VB 4LBEA 1W72L 1AXIB 2ZUYA 3KVPA 2WQSA 3EYQD 2F53D 2MHAB 3QDJD 1CFBA 1M53A 2ESVA 2ZWSA 4G42A 2YKLH 3LQAL 5SWZE 4D9LL 5AG9A 2H26B 1IC5L 2VISB 5LNGA 3AS2A 3HZYB 2F19H 1D6EA 5TFSH 4L4VB 3T8VA 4ODSH 5FYKD 3ROOB 4CDHA 3DYOA 3OKKB 4JPWH 3Q6GL 5IJCC 1W0YT 3B83A 3CZUB 4DH2A 1BQLL 4W4NA 5K39A 4RMTA 3FTGA 3L9EA 4O2CB 1A14L 5KVDL 2AJ3A 4KPHH 3CZGA 1O9WA 1UD8A 3VXTB 4HOMA 3NH7H 4L8CB 3VDAA 3N43B 3MRIB 5K69A 2Q5BA 1UFGA 5I1DA 3DHUA 1NPJA 4XAKE 1IC0A 2JNZA 2AK4B 2HXAA 3HC3L 4OJEH 4FADA 1CYWA 1S5HB 2GJRA 1PD0A 3FU6A 4PI2A 4OZIA 1P5UC 1OQOA 4P3CL 2J88L 4WUUA 1U4FA 4NUMA 5F1OB 5A2IH 1FZJB 3IFOB 5DS2A 1HEJC 2ZPKH 4PJ8A 3S3SA 1WHOA 5KUMA 2AF2A 2CO1A 5IT2H 1OAUH 4X6CA 1CFNA 1ZLSH 1LK3H 4L48A 1PS3A 3Q8AA 3ARDD 3FQ2A 5I6NA 1S7VA 3CSYB 2AQTA 5BZWA 4GSDL 4K07A 5ACZA 3DMMA 4OQTA 3OR6B 5C09A 3VFVA 2HT2D 3QG7L 3PWVA 3ECUA 3MRBB 5HHPB 1DJHA 2GBVA 2QHRL 3V0FA 2X6BA 2WKGA 3WY4A 3L3IB 1MWOA 2NY5L 3BQUD 5HHMB 1JZ4A 3VI4F 5CU9A 3S9DB 1SJEA 2MNUA 2IPUK 3C75A 1LNUB 2ICWJ 3UG3A 4D8PA 3I2CL 1IGTB 3FT2B 3P9LB 1T5XB 1DVQA 3WY2A 3BDYL 4X0KA 2ENJA 2GCYA 2LLLA 5EC1B 5LDSA 1TJIH 3I02B 3HR5A 1M71A 1T1XB 2HVKB 4XHJC 3RWJA 4B27A 4EQ2A 1ORSA 1FQ9C 3QPXL 4MJIE 5DGRA 2OV0A 1NMAL 4HUWB 4MD4A 5EBLA 2OZ4L 1N8OE 1UXWB 2ADIA 2FX9H 4IOFD 4BH8A 4DP4X 3U9UB 1MLCB 1U3HA 4LKCA 3K4DA 3CLWA 1GMIA 2O6EA 2A6IB 4E0RA 5DMIH 2D4FA 1SOQA 5C08B 2VITA 2VZSA 3FKUS 1T5WB 3MVSA 3QZWA 3NGBC 4FQLL 1A7QH 1YG9A 1I8KB 4CA4A 4UWQB 4D0CA 4YHML 1R4XA 4OJYA 2VLME 4YHNA 3KPOA 5HHOA 1TJGH 2DV6A 2R8SL 3QRLA 3REWB 1MCPL 4E5XG 5E2UL 4GXUN 5A43C 1ZCRA 1K85A 3FQTA 4PY7B 1KGUA 5GISL 3RWDA 3VD5A 1GW0A 2YEZB 3UZQB 4O4YL 5ABAA 2G4EA 4XMPH 4KROB 3O45B 1QVOB 4BKLB 4W9KC 4U7MA 2Y7MA 4RISH 3VM7A 4RAVA 3FH8A 1D2PA 3L5IA 4P2RD 4KZEH 1GGUA 3MOBH 4F2ME 2G75B 4JPVH 5D2LA 1E3XA 3WTVA 5AVVB 3FQRB 2WXOA 3H9HA 1YC7A 2PR4L 3UBXA 4JB9L 1SYSB 5DRXB 1U92B 2WBXA 3HE7B 1NGPH 3SKMB 5JQ6H 2LABA 1AKJA 3MRRA 2AJXL 1NCDL 1AC6A 4XTRD 1JGDA 1YYLH 2YZ8A 4BZ2L 4AK2A 2OL3L 2Q20A 4FTVE 5DQ9B 12E8L 2BHUA 2L4OA 5GS1C 4OLWL 4JFFA 1RIHL 4GO6B 3IVKA 1X4YA 5T3ZD 4J6IA 2VXQL 1IU1A 3BDBA 1FV1A 1N26A 1Q9WB 3CD4A 5DD0L 4MD5A 4OLVH 2LVEA 1CVRA 2XG5B 4XPGL 3U25A 4J2XA 4I9XA 5HVWA 4YZFE 3ARGC 2TRHA 1NCNA 3BRFA 2WQXA 1HYRC 5HGGS 2NQ3A 4WCYH 4D0BA 4NZRL 2A74C 3N06B 3B8SA 1WZLA 1H3GA 4TUKH 4PLNC 1CGTA 4CADB 2RCSH 4LT7A 2ICES 5EU3A 2VDKL 3MRJB 4X6BA 1N0XH 3FTUA 5FYKU 5BV7B 4Z7QB 2P46B 3TH4T 2NXZD 3ZMNA 4JBSA 4FFVC 5I1AB 4ZX4A 2BXYA 1QBMH 1I7RB 3EF4A 4PRAA 3BMVA 4YR6B 2K4WA 2YD7A 1YEKH 4QY8A 5C9KA 4APQD 3IGLA 3IJYB 5T1LB 4Q4EA 3RDTA 4A7GF 4HJSA 4XP5H 3TN0D 3JVGA 4NWTH 1KBPA 1A6WH 1Z9SB 3NK3A 5DUPL 1DQVA 3VQ2C 2CE6A 4X0NA 1TZOA 3RWCB 2E4TA 5EUOA 2WW8A 3UO8B 3VFPB 4FF9A 3MRGB 2ZOTA 1QLEB 1BFSA 1AQMA 1W80A 2R0WH 3U6RB 4YXHL 1J8SA 2ESVE 5ESAA 2GK0A 1PD1A 4IMLB 4ICWA 3IJ9A 2CUIA 3GMNA 5E1AB 1BYOA 5TPWL 1IAIH 2Z9TA 1J05B 4AV4A 2ZX7A 3RAJH 3ZMRA 1HHIB 4AYBA 3V95A 5JPNB 2YRPA 4PB0H 2L3BA 5D2NC 1I9JH 3FO1B 5J89A 4MQTB 4XPBL 3VFUA 5J1SC 1KPUA 1U8CA 3O6LH 4E9YA 3VMOA 4YZWA 4BSWA 3V6ZA 2R29H 4HUVB 3K7UA 2ROXA 4L1BA 2HFFA 3B7TA 1RZKH 4YEEA 3BPCA 3HMXH 4G9FA 5DRZB 4BE5A 4U4BA 1JPTL 1FUNA 1MDTA 5EZJA 4Y9CA 3EYSL 4C54A 2WXJA 5DO2D 4IHBA 5F88A 4MXWL 3ZDZB 4AJYV 1UB6B 1NBQA 3U1SL 2CKBH 1MEXH 4PJ9A 4OZIE 4JRWA 4NOBA 4XVSH 3W0WD 4BSVA 1YN6B 4WUUE 1MCQA 2WAQA 2QMKA 3VG9C 1QFUL 1QUNA 3ESNA 5GJSL 5MHSD 5DEGA 1AGEB 4WF7A 4QOKA 3B7SA 4X6CE 2FYVA 3OJ2C 4YX2L 2X05A 4J8RA 1QYGH 3K2UH 1P84J 1XMWA 1JOIA 4JPKH 4K7PY 1PEZA 1FZKA 4I48B 5F1IA 3WO3B 5C09E 3T6XA 4XBMA 5HGBA 5ICZA 3VSQA 4XCNA 3DBSA 4X5XA 3V4UH 1KTBA 3V10A 2VLKB 3QFJA 4JHWH 4R2GD 1OB0A 1XGYH 3L3OB 5J4MA 1R3KA 5DC0A 3QZWG 3X1FA 3TA4D 1EJ8A 2WB1A 4KI5C 2ICEC 5KEZA 5E5LA 4KDTC 2OLDA 4P23D 3L3HA 2ZKMX 3KWXA 4PJIA 2BZDA 2RD0A 1DLHA 5JQIB 2ADFL 3OM3B 2VWEE 1LDSA 5IMMA 4L8SB 2PO6A 4TRPL 1ASQA 3OGOE 4DGUA 1LD9B 1YMHB 2QLYA 3V4PB 5D1ZD 1E9QB 3I75A 3HTLX 3FQWB 1T1ZA 1L3NA 2PW1A 3ES6B 1OP3K 1HZHL 2EXYD 3JWDC 4WSKA 3BZFA 3C5ZC 1FNLA 4AENA 3ETTA 2HAZA 2P26A 3GC3A 1PEWA 4UYPA 4A2EA 1UCTA 3GO1H 1KACB 5LGYA 4DK6A 4AQEA 3VW3L 2AJYL 1SPDA 2VZOA 3WSQL 1MVFA 4PJEA 4EAEA 3WE6B 3N1QC 4YOKA 1I53A 2FQGA 2XIBA 3BC9A 5E2TL 5ACLA 3PXHA 2XICA 3LKNA 3LVTA 4FJ6A 3EFDH 1ZGLM 3KBEA 4YDVA 1BVNT 3IE4A 2Q7YA 3HMXA 1NBCA 3ARRA 2ZKHL 4PBXA 2AEWA 3SZ6A 1L9PA 3QNZA 3O41B 5BUPA 4AT6B 1E5CA 1U8IB 1ADQL 3KLAB 4NN7B 2OMUB 2CKBA 3MC0A 5HHOE 2NY4B 2R0KL 4PRBB 1CD1A 1K2DA 3O3BA 3QDHA 4F7MA 1UD6A 3QWOA 5IFHL 4X4XB 2IWKA 1VFMA 1TQTA 3P77A 1Q1JH 2XRAL 5I5MA 5F97E 5ISZB 1XGQB 5D4QA 2OW6A 3GI8H 4GSXA 2W0KA 4JY6A 2XETA 4TPRL 4M43H 1TQBC 3QORB 3BSGA 2OMTB 4I1PA 3D0AA 1HHHB 4WKZA 5F7UA 1PVHA 4JM4H 3QEUA 3GSUB 5B1CA 5C0CB 3RWHA 3Q2VA 4XXDA 2IAMA 2YMXH 4IRJC 1P4IH 5D2LE 2WBKA 1I1AB 1U2HA 3IMSA 5D5MA 4NOFA 1QHOA 2FSEA 4M7ZB 4Y4HB 1JBJA 3FT0A 3DC0A 4F7EA 2JXMA 3OZ9L 1TZIB 1WCBB 4O51B 2R39A 1WLHA 3NTCL 4P2OB 4A2GA 3WTSA 1KDJA 4OCNC 2FBJH 3ZDWA 3BGFB 2LR4A 4MQ7A 1SBSL 3NJKA 2BWIA 3ROLB 3RRQA 3V0HA 1BQRA 5CEZD 4GEIA 3OSVA 3HHRB 4LCWA 3W9EB 5D1XB 3R06A 4XP1L 3ZE1B 1T3FA 4JFFE 4NQEB 4EPSA 1GTNA 2BIPA 2N0MA 3BKML 4FXGB 4F24A 1ZIBA 8PAZA 7FABL 1AE6L 4GI8A 2IPTL 4GQ9L 1IIKA 3AY4A 3CAFA 3EGXA 4MAYD 3LB6C 2DQIH 2HT3C 2EAEA 5I1CL 1BBJA 3GHBH 4KXCA 2DDQL 4PJ7F 2QKSA 3KL5A 3KM2A 4GAYA 2QSCH 3OGCA 1RFDH 4ATWA 2A77H 3EDJA 2XQBL 3H9SD 3OKOB 2EVIA 4Y5YB 2FLRT 4JJ5B 2FWSA 5D4HA 4I0PD 5IEHA 2VDRB 3NACL 5JDSA 3FPXA 2VM3A 3ZU8A 1VFAA 3CFNA 3LRSB 3N0AA 1HEZA 1T2XA 2DH3A 2DQDH 4AVHA 4N2IA 5H37A 1I31A 3O3DB 5SX5H 1MSPA 4HJ0D 1M2VA 2AAAA 3MRKA 3ATFA 4PD4K 5CKGA 4AL8C 2CDFA 5C0RH 2VM9A 1UJTA 1F3JA 3KYMB 4HV8B 2PN5A 3R4DA 3TEWA 4MNGA 1CGSH 2EH8H 3KLHD 2GAZA 2PWEA 1KC5H 2P3YA 4JRYA 1QR4A 4HYTB 4LLQB 1DJGA 1UOKA 3CDYA 4R4BA 5D6CB 4P57B 1N4XL 5J57B 2YPLB 5CGTA 3SZKC 5EUOE 3X17A 5E08H 3GK8H 4UV7L 1CG9A 4HS3A 4YDJA 3K6IA 4NQCB 5LN4A 1TR7A 3V6OC 1KYOK 3OZLA 2BSDA 1F4HA 2X10A 3NIFE 3QUKB 3W81A 1OGAD 4IBWA 1GGBH 1H3TA 3NSXA 1LDPL 3QI9C 4G71B 3DX6B 43C9B 1KUMA 4BSJA 2D7TL 1PSKL 4G6KL 2ODHA 4XC3H 4LQFL 2HP4A 4BFGA 3W5MA 3DO7B 5I0DA 5A6MA 1T83A 3DVNB 5DFVC 1AFVL 1MUJB 3O9WB 5IHHA 2SEBB 5IV2A 5C97A 2Y07H 2VMDA 5JPMB 2EUWA 3EFFB 4XN2A 2ODIA 2J2ZB 5DWPA 4PRNA 4QF1A 4LLMB 4TLTA 3K4AA 1FNAA 4GJTB 1KDIA 5EH1A 3EYVB 4MMYB 2VL4A 5EV7A 4I3RL 4G9FE 1FC1A 1W8EA 3MR9A 3H4HA 4PJHB 1SNRA 1DQLL 5DUJA 3MX0B 5E2VH 1TVBA 3EO0B 2P8PA 1OAXH 1XF1A 2X9YA 2R2BB 2VTFA 1PZ5A 5IBLD 4OGZA 3FHAA 4G7SB 2CBOA 1Q38A 1ZT1B 2KHAA 4ZPVB 3QJUB 3P0YL 4ZFGL 5MP6H 1PAZA 1Z5HA 1C9SA 2P8LB 1S9VA 4QOKE 3NJNA 4M02A 3KBHE 3QEQD 4JL2A 1V5JA 4AGMA 4ELKA 1CS6A 5E9DB 4H7VA 4YHLL 3CDGB 1KIUA 1OQXA 3IRCA 2FD6L 1KXQA 3TCXA 1MFAH 3A4FA 3TTYA 2X9WA 2XWCA 4WDIA 4E9VA 3QUZC 4DP6X 3P3RA 3KR3H 3VFGL 4NUJB 2ZCZA 3KDMA 1B0WA 3CFEB 2ARJQ 3BKYL 3QFJE 2UZYB 4IK6A 3T0XA 4EN3C 1IC4H 3TA3A 3SQOL 4Z5RB 4HZAA 2QPUA 4LNRB 4JLRB 5KJRL 3RY5A 2YPKB 1AQDB 4XZUA 3K81A 2RBLA 5JOPE 2D8KA 3T0DA 3Q1SH 2ZUUA 1F86A 1O7VA 4PJIE 1CBVH 1ZAGA 3WKMH 4XVUC 4Z7VF 3S4SA 3INUH 5FFLA 4ESKA 1INDH 3O3UN 3CC5A 1IM3D 2A6JA 3C5SB 1OAKL 5JIKA 1JHLH 1S8DA 2VXSL 1KOAA 5E23A 2CM5A 3RWFA 4YE0A 3PJSA 1M05A 3BPLC 1NUGA 4PRHD 3MJ9A 4PJEE 4JG1H 2G3ZA 3SD5A 4Z7OB 3IXTA 3LNGA 3TF7C 1P5UB 1FH5L 5BZZA 3X3GH 3WN6A 4FFYL 1DE4A 1U33A 1NLBH 2O61A 3W38A 3AW5A 4PREA 2FHCA 1LWJA 3QA3A 4WEBL 4Y9BA 5HGHB 2Y6SD 4AGOA 1U6AH 3SBWA 1A47A 3RBGA 3S37H 4X7FC 4ZD3L 4NN6C 4OJCA 4XB8A 1G94A 3MI6A 3B7UX 3MLYH 2E4FA 5IVZA 4XP9H 1KB5A 3CU1A 4LHUA 4ODWA 3MV8B 1IQWL 4B95C 3LEYL 2VXVH 5AOZA 4BJLA 1SXBA 3S88L 4LCIH 4WI9A 3EH5B 1KN4H 1QO3A 3K74B 4EI6B 3OKLB 4KJYA 1FL5A 3QYNA 3UYRL 3OMIB 4YFEA 2OAAA 5HYIA 4PS3A 1EAPA 1YEGL 2JI3A 3I3DA 4HHGA 3AC0A 2QQNL 3CH1A 1FO0L 4XNAA 3F62A 5E4AA 1CL7L 2Y23A 4TMPA 3LIUA 5D5ME 2BFVL 3T3MF 4F8PA 3VFTA 5F3BB 5FDWB 4RRPG 4HJEA 4UT7H 4N0CD 2BNRB 5H37G 2J8UF 1HS6A 3PABB 4Y9EA 4JRXA 5IB3B 1AXSA 4EQ3A 4GUCA 2QTVA 3RZCC 3EGSB 3E6HB 1S7RA 3FF7A 4LCWE 5DZOA 1I9RH 4M03A 4U31A 1YEFL 4E41D 5HJBA 3ZHFA 2DMCA 4A38A 3SCMA 2CCVA 3E7JA 3HS0A 4ETYA 2NQCA 3L7EB 2X6UA 4RGOH 4B9ZA 3GKWL 4Y4FD 3NGBB 2BP0A 2JKTM 2HG5B 4HIIA 4F92B 2EO7A 1E8WA 3TBYA 3BD4A 4KQ3L 3HFMH 1UWFA 2N1KA 4MZRA 3FFCB 3MLSL 3GBEA 3DETD 3AQDA 2DEWX 2NUTB 5FKPB 1XIWA 4P0DA 5IMOA 4ZNEA 2QSQA 5HHQB 3BRGC 2YD3A 1SYVB 1N67A 2YKLL 1MHPH 4OZHB 1SLWA 1JGVH 1DBKL 1R24B 5E6IA 1NCOA 3V5HA 3HZVB 2F19L 5TFSL 4MNGE 1CXEA 5DD5H 1DQTA 1YEDB 4HC1H 4P5KA 1RUAH 1QZNA 5CSBA 4OZIF 4JPWL 4JRYE 1TFPA 3SPIA 3K2MC 4OD3H 1I8MB 4KXZH 3BZ5A 4E9SA 1C16A 3HN3A 1UQSA 3AMKA 3QP3A 4M7KH 3QARA 3UTZB 4P3DA 3TO2A 4ELMF 3QDMB 4MJ2A 2V33A 1FIGH 4OF8A 3SOBH 1JZEA 1J86A 1PQZA 5GGVH 4DPAX 2I07A 4HH9B 4GAAA 1EVUA 3CZJA 3HHMA 3UC2A 4HCGA 1F6FB 3D6GA 1SY6H 5GS1B 4CVZB 3JV4A 1DQDH 5FUCE 3VWJA 2DQ6A 1HYSD 3L1EA 3O4OC 3Q2WA 2ZPKL 1GS7A 3TYFB 3AT0A 1OAUL 4Y4KD 4WGKA 1ZLSL 4OJDH 2Q76A 1TU2A 2B0SH 1VZGA 4OZGA 4OCRH 2X1WL 3S98A 1CD0A 4X7CC 3GM8A 5CILH 4GG8B 5I76A 3UACA 3QEHB 4LCUB 1P5VA 3ARGB 4XCCH 1TVHB 4YL9A 3SJVB 2NW3B 2I85A 3VFMA 4XNYL 5I1KL 3CFJB 3DJZA 2A74B 1ZVHA 4Q89A 2R1WB 5J9PA 3PHQB 3WTTA 4D3CH 3CXDH 3MDJA 1IBBA 5CP3H 4RX4D 3S4SG 2CLRB 4NO0B 5A16A 5T1MB 4BUQA 3ULSB 5IB5B 3CBJB 1NCCH 3VX0A 3FQNA 1MFEL 3HE6D 1IUZA 5GSVB 3D8MA 4QWWD 1IVLA 3T8XA 4F8TA 1ZT4A 3PCYA 1HSBB 3T77A 1A1OA 1QHPA 5DJ8A 3IMBA 1EEQA 1QLFB 2OTWB 2Z7YA 3MCLH 4OSUH 3SYOA 3GMOA 2BNUB 1B6UA 2JJVA 4DZ8B 1G7LB 3QNYA 4ADIA 1I7UB 4NKOA 2L7JA 2E7DA 2FT8A 1ITCA 3CNKA 1KXQE 3LAFA 3L4VA 4LSUL 5EA0L 4LLWB 1BQSA 3VVWA 4MVBD 4HC1A 4HPOH 1JPSH 2FX9L 2WD0A 3EO1A 4U7SA 1WIOA 2FEEI 2PCFB 1KIPB 4LDEB 2WQUA 5EEXA 3D39B 4WV1C 4N26A 4CVXB 1CR9L 5DMIL 4N6QA 4X5WA 4R3SB 1KTJA 2DLGA 1E28A 3I6GA 4MZIA 1FGNL 5CZXC 3H4FA 5ESVA 1EA9C 3A4AA 1EGJH 3DGCR 5LBSH 1BOGA 3FCTA 4XVJH 3VDCA 1B9KA 1UENA 3D0LB 5D2NB 1GJUA 4U1NA 15C8H 1A7QL 2HLAA 3W9DB 3U0WH 4KOBA 5BUGA 3X13B 3AS1A 5FWQA 5JHLA 1TJGL 2X88A 4OFIA 5D2LF 1K4CA 1EXUB 1E30A 2LLNA 1JTTA 3PJLA 2DLFH 3ZUNC 2DLEA 1MVUB 5LGHH 2YA0A 4KY1L 4M00A 1AHWA 2CU9A 1OGSA 5K9JH 4Q9RH 3EJYD 4XMPL 4WFGE 5AVTB 1KLUB 5E9NA 4CW1A 4RISL 2HMID 4JFEB 4QHNA 4ZAKC 5IZ7A 2Y1AA 3TX4A 3TTSA 3VG9B 5CINH 3CQFA 3MOBL 2VLRD 4TNFA 5FA3B 5BJTB 2ATPB 1AGCA 2AGJH 3DK0A 1WWAX 2BWQA 4OGAC 3KAAA 2JCWA 2ZX9A 4MTMA 5DD3L 3GMPA 3ARFC 3P3SA 3HA0A 3PGFL 4H88H 2BVOB 2KBGA 3QDGA 4JX0A 4WWKA 5CP3A 3T0EA 5DURB 3TBBA 1JZJA 4I4WB 1IE5A 1NGPL 4YGAB 3RB5A 5JQ6L 1XR8A 1XGTB 4G6FD 3LNEA 3UZEC 4DERA 4TN9A 2XJLA 4TSCL 4YPJA 3FQXB 3OAYK 2OX5B 4AXWA 4M8VA 4ZXBC 3VXSB 2Y5TB 4ZUTB 2NY2D 1MFVA 1N8ZB 3ZL2A 1L6XA 1XD0A 1IV8A 3UCQA 3NZSA 3BVNA 1QAWA 3G04A 4JDTL 3BXNA 2ICEB 2ICWA 4Z76B 3IDGB 4HXAL 4KXBA 4NQDD 3U2SB 5F7FA 3K8KA 1I1YB 5I0XA 4OLVL 3VO0A 3OD3A 4MMXC 2RB8A 3DDFA 3FXIC 4AX3A 2DM2A 4K2UL 1NFIA 2QR0B 1C08A 2G2RB 4XODA 3QRBA 4AE0A 2BZCA 4ODVH 3TCLA 3ARUA 4Q2ZA 4YSDA 4QGYA 1QSEA 3C5ZB 1A7NL 4RMQA 3GJEA 3CE1A 4ONGH 1W8OA 4TULL 4JRXE 2AQ2A 4TUKL 5LBSA 3ZK0A 2RCSL 1WFIA 1EEUA 2DQEL 3LSOA 4AW4A 1Y0LB 4O02H 3STZA 3RWEB 1XH2A 4AQAA 3PQYD 4RBPK 1FVCB 3NJXA 3GS0A 4YDKH 2B59B 1MIMH 4QCIA 3U7YH 4WK2B 3IETA 1YEKL 2F18A 4AQZA 5GZOD 1BMWA 2AANA 1M1XA 4WJ5B 4UQEA 5C0AD 2GIXA 4XP5L 2Y5EA 3UXFA 5EIIB 4PW3A 5JOFA 2WO3B 4RMWA 1MH5B 3WJLC 5TD4A 3BDXA 4H8UA 4LSPH 3NQKA 5B4MD 3OAUH 4LPXA 3UGXA 2FL5B 3VXQA 2R0WL 3DX8A 2H6OA 3KW8A 5IHUH 4ZNEE 3RY6A 2HFGL 5F1SA 1Y18A 1D5RA 2GJZB 5JORB 1DL7H 3Q5TA 4R7NA 1TQBB 4PLJD 2EC9U 1G84A 3MBED 4RAHA 3TIDA 5BOZG 1T7YA 4N2MA 4JUSA 1JG9A 5AL8A 4PB0L 1JPEA 4IRJB 3MRHA 3O6LL 4URTB 2Y1ZA 3KD4A 2R29L 4X98A 2ATKA 3CTTA 1XF2A 1SN2A 4W9IC 1U95A 1MI5A 1Z9OA 2VDMB 3GYRA 4HKXB 3PGDA 4PJBB 1UVQB 4NUQA 3OLIA 2DWYA 2DEXX 3VSTA 3SGDI 5CCHE 4N5UA 1MEXL 1E5BA 2WINB 5ECGA 2DIBA 2FT6A 3MN8A 2XT1B 5IQOA 3AQYA 1ID2A 3B9EA 4GIOA 1HI6A 5JW4R 1T2JA 5EOQH 2XPZA 5IQ9A 1RHFA 4QUOA 3V0IA 1H5BA 4OI8A 3LZNA 4OZGE 2QADC 1IIIA 5K9OA 1U41A 2D03L 3K2UL 4PJIF 4HALA 4O02A 4XXWC 4QPEA 3F12A 4CMMA 3AQZA 1OO2A 2X4NA 1OM3H 2QJDA 4CKQA 5AALA 5FCUH 4UT9H 2XQYA 3V4UL 1NFDA 3Q7JA 5LHDA 3EXLA 4QRQB 4NM4H 4NJAH 1LE5A 1M6OA 1XGYL 4U6XA 3CUPA 3TJHC 1IKNC 2CPUA 1BVKA 3GSOB 3H0TA 3VFWB 1QP1A 4OB5L 1W15A 3PFQA 2W9EH 4PJEF 1I9IH 1L9TA 1S78C 2OMWA 3F85A 4K5PA 1ZTXE 5BXFA 5IQ7L 1A66A 4C56A 4QRRB 1IGJB 3ME0A 4OKDA 3NJGA 3NZHH 4UU9B 4EXKA 1NBZB 5F9JA 4KK8C 4RDQG 2OMVA 2RTTA 5CCGE 1CFQB 1FNSH 3RVVC 2P24A 1RUMH 1E50A 4BZ1A 1SDYA 3RG1C 2VN4A 4P46D 3RL1B 3POCA 2EJ1A 4X7DC 1G9MH 3BUBA 5C86A 3ULVL 4NDMB 1IT9H 2OTPA 3EJSA 3I50H 4PCSA 3QI9B 4HPYL 1P0SE 3AU1B 3EFDL 3QJRB 4NYLB 1NCJA 2CO7A 3L5WB 4MDIA 1L9MA 5DSCA 1X5HA 3WHE0 4IRSC 4GRLA 1WYJA 5DD1H 2WGXA 1UGNA 1YNLH 4C83B 1H3VA 3M1BB 1IM3B 1OF2A 5HYSB 2DLHA 4WU5A 3VU2A 2H2PC 2F08A 3SE3C 3W1ZA 1I4FB 5B1AB 2QVFB 5BO0D 2ITCA 4RMBA 3QISA 1JSYA 1KPRA 1SVBA 3VD1A 2CHNA 3BAJA 1Q1JL 5F96H 4MJ4A 5KZCB 3L4ZA 2P5WA 4EZKA 3GI8L 5BRQA 1J0KA 3MNDA 2EE2A 4M43L 1O9ZA 4LLVA 2CLZB 5CN3A 3B3BA 2W0FA 5ANMA 4NENB 3NIGB 3NZ8B 5I0WA 1F4WL 5T1KD 2ZWNA 4FXLA 1FH2A 1N3NB 2CGYA 3LZLA 3O6FA 5CGMA 3GSWB 3C08H 4K8RH 4HWNA 4UT9A 3TO4D 5K9QI 2YAMA 4MNHA 2PPFA 4PWIA 4BRJA 3HAEH 4F8OA 3O8XD 4N28A 3C8DA 2DD8L 3D48R 3QDGE 3T0EE 4ZMPA 1WF5A 3KH4A 5AAWC 1TPXC 3FO2B 3HB3B 1SDDA 4YNYA 4ZMOA 1XF4A 1G4RA 2RMNA 1THCA 4M6OH 5MEQA 2MOQA 3GPEA 3EOTH 3D85A 3QUZB 3VXPA 5JYMA 4RNRB 1CDHA 2E7LA 1G5AA 1JZGA 1HH9B 1FVDB 4EN3B 3HMWH 4HS8L 5FXCH 4NP9A 1NWOA 1OWWA 3HPJA 5JTWA 2MPAH 2C9UA 5KBKA 1QD0A 2IFFL 2H6PB 3PV6A 5DJAB 4W68A 3P0GB 3GHBL 4N2HA 3B4NA 2CGRL 3MYJB 3TPUB 1KBWA 2JCCF 2QSCL 1S3KH 2X4QB 5KVGE 5EU6A 3U4AA 3SQBB 2A77L 5KBDA 4KV5E 1WCQA 5GRVK 5IJKC 1QSEE 4JM2D 2LU4A 3U7AA 4ACPA 2C3VA 2QPEB 3BPLB 2DQDL 1U93A 2MHAA 1KYDA 1MHCB 1QFWM 3CVHH 3MNVA 4GLRH 1OSEA 5MERB 2H26A 4AGNA 2QQLL 3BH8B 4JQVC 4PJGA 3MRCB 2P7TA 1UUNA 3IDIA 1KC5L 4RMSA 2GT9A 3S8WA 3VI3B 1BPVA 3ROOA 4H2AA 3DDGA 3WI9A 2X89D 2HWZH 1PYWB 1CDCA 3MODL 3F7VB 2PETA 3APFA 4A2LA 3CFKB 4NN6B 4Q9BA 3IMRA 2QVMA 3RGVC 5G4NA 1A3RH 2AXJA 2LTQC 2MQGA 1G43A 2ED6A 4H0IA 1OK0A 3DV4A 3GDCA 2G3NA 4ZO8A 1GGBL 2AK4A 5L9DH 1SJVA 3HAEA 3WLBA 1ZA3A 4LAQH 3TJEL 4DVRH 5IIEB 4JFHD 4QRBA 4WKXA 4HFWA 1NOAA 5GIRB 4DN4H 1PY4A 1X9LA 2ZIDA 3Q2CA 1NA8A 3MA7A 3ZGIA 2Y07L 2CA3A 3UJTL 1C5DA 3LPWA 3ARED 2XQYG 3CXHK 2R27A 2CUMA 4M5YH 1FG9C 3SHSA 4PIRF 1H3PH 1U8NA 3MLWH 2LT9A 5GPRA 1MI5E 4G7VH 1HINL 4U1IA 3U2IA 3JVFC 4HWEH 5IUSA 4UQCA 3OJVC 5L2KD 4UCFA 3WNNA 5HHPA 5I30H 3RZCB 3L3IA 1S7UB 2YAEA 4GKSA 1K8IB 4Q6IC 5D4IA 1SLXA 5MP6L 3BT0A 4J3OD 5H4ZA 4BCZA 4DQOL 2ENPA 2O6DA 2Z3FA 3GMMA 2JKNA 4DKEL 4DZBB 2IDQA 4NO5A 3VFSA 3CVHA 4BUGA 2PYEA 4AW7A 5EC1A 1LEKA 3I02A 3NCFB 2R7EB 1T1XA 4JM0A 2HVKA 5E8NB 3S3JA 3KYNA 4OCSL 1ZDSA 4DGVH 1QA9B 3LZFL 2HUHA 1HEHC 1NFDE 5I73C 5I1IL 1JD7A 1JK9B 5KANI 2NNAA 2D31A 3Q1SL 1R3HB 2HT2C 3VXOA 1OE3A 2CO2A 2FJFA 2BERA 3QJQB 5F7DB 4PVNA 1MPAH 4WAFA 1KBKA 1JK8A 4ZS7H 4C56E 2VZ1A 5EBMA 2MCMA 2EDHA 2J73A 3LZOA 4OLUH 1B9ZA 5ICXB 1CJYA 1I8KA 4BDVA 5K33A 5DHXB 3IFLL 5HP5A 3ZPDA 4ONFL 4MXQC 4Z7WB 3CVIL 1BX2B 5TQ0H 1KCBA 5HDBF 3PP3K 3D34A 2PF6A 1KCSH 4EMZA 3UZQA 3TZVC 2GBTA 2GI7A 4UM9D 3X11B 4R83A 4JG1L 4K9EH 4N1EA 3T0WA 3O45A 4BKLA 2JJTC 1IEHA 5C9JB 1SEBB 3N2JA 1D2OA 1DZBA 1NLBL 4HKZB 4PRPD 2DQJH 2B14A 4FYQA 1I8LC 2GITB 5A6IA 1BLIA 1JXGA 1U6AL 5DD6B 5B7EA 4KGLA 2NUPA 1DBBL 2J8OA 4QHLB 4QTFA 3N1MC 3S37L 4GKOA 1OXYA 5DQDH 2I5YH 3MLYL 4JG5A 2RQ8A 4XP9L 2Q7NA 4ZFFA 4PJDF 3VFOB 3IJHB 1PCXA 2F2HA 3SDXA 2DWEB 5C0EB 25C8H 2VXVL 2GJ6A 1BECA 5LCVH 2X12A 4G6AC 5J8OA 1KN4L 3IT8D 2P5WE 3FFOA 4ZUVB 1UOLA 3BAKA 3EJTA 3G5ZA 3AWEA 1IC7H 5ANME 4C55A 4ADJA 4HUKB 3MGOB 4X4YA 3I9PA 3SPGA 3WIHL 4ZW5A 3GLAA 1Q9WA 3LX9A 4PV9B 2D2OA 4I0CC 5J1TC 4PGZA 2X4SA 4QIRA 1MCHA 3EGDB 4I7ZC 4JCMA 4F80A 4XPHL 3LEXB 3HG1D 1URLA 2BSEA 2F68X 4M7LH 3QQNA 1NEPA 2AVGA 4UM8A 3CBRA 4KVNH 4CADA 1E9OA 3SOTA 5IFJA 1BREA 3SDAC 3NFNB 5SWZD 4LP5A 1PMYA 5C6TL 3O6KL 4PN6A 1Q0EA 1I9RL 2R1XB 4WV1B 1FORH 1QFHA 1XR9B 4MBOA 4JFYB 4H44C 1N0LB 1I7RA 1LVEA 4YR6A 3MLUH 4L37A 2OK0H 4QRPB 3GDBA 3BN3B 1NCBH 4RGOL 4XAWL 3DRQB 2QQKH 3CFBA 5T1LA 3ZYZA 4HG4K 2WIMA 1RMFL 1Q1PA 3OWEA 1Z9SA 3OPUA 5EU6E 2VDOB 4D9QE 2E7HA 4P5MB 4JQIL 4F9PA 3AS0A 1BF5A 2WP3O 3SPVB 4Q56A 5E4EC 3QS3A 3TOPA 2XN9D 2Y7LA 4IBQA 4XAKD 3TBWA 3ZTJG 2GVYA 2XBTA 4BFFA 2NYKA 4WW1B 2LHAA 5ID0A 3OKMA 2B3RA 3CIAA 4GO8A 1YY8B 5E1AA 4ZAKB 4PJGE 3NFPB 4DPRA 4HC1L 5F89B 4YE4H 3TVMD 4MNQB 1PBYA 3WD5H 2IDCA 1FC2D 5JPNA 3FK3A 1I3RA 1B4LA 5LCVA 4M7KL 5ADOL 4FHJA 4MDJA 2YQBA 2V37A 3ARFB 3QAQA 4W9CC 3KPSD 4HUVA 5L88H 4W9HC 1FIGL 1D5ZA 4X7TB 3F7RA 4OZGF 4E9QA 4EE2A 1PD6A 2YA1A 5INDB 2CUHA 4WI4A 2IDUA 5DRZA 4LDCA 4APQC 4BFEA 5JZ7D 1LEIB 4FYSA 2KUTA 2ICCA 3TN0C 1NPNA 1I7ZA 1TQUA 3A4EA 3GEFA 2UXTA 4KK6D 2NR6A 2AK1L 4JKWA 1F2QA 2AK4E 2CIKB 3K6OA 4KI1A 4JO3H 1UEYA 4DP1X 1SY6L 2RR3A 1GYWA 4QAWA 4R7VA 4GUOA 3ALWA 1YDPB 1YMMD 3GLDA 4DGWC 4F8QA 2MTPA 4GW4B 1QRNB 3FNKA 4TQPA 3EOAA 1CICC 4XT1C 5HYJB 1J9TA 4MMXB 1PZUB 4H0HB 1EXHA 3L95A 2F5BL 3SY0B 1BM7A 1NUDA 1XF5A 4AC4A 4LSSH 5C92A 3DGGB 4UQ9A 5ICUA 4S2SA 1UT9A 2V4LA 4NQXB 5B8CC 1ACCA 1S6NA 5J6HA 3BPOB 4QXVA 3IJEB 2AQRA 2A6DA 3CXDL 3ZMEA 4ZTOH 4OV5B 2HRGA 4JCLA 5F1NA 4Y5XC 2YN3A 1GZPB 5HHNB 3ILEA 4FN0A 1NCCL 5LUMA 5HHME 1X5GA 2ZUXA 4QJ4B 2WIIB 2Z7WA 2K3HA 2KDGA 4OQ1A 4AYGA 3MV7B 4OTXL 4IJ3C 3MCLL 3WYRA 3QCTL 2ED7A 1PTZA 2KZKA 2V2XA 4L8SA 3ABGA 3D25B 3Q9QA 4X8JB 1LD9A 4XC1H 1J0JA 2E6QA 4Q8BA 1E9QA 1BIHA 2F7OA 2PYEE 1J5DA 3FQWA 4A04A 5DVOA 3ES6A 4BA0A 2XWBB 5CP7A 1T80A 1CFVL 3Q9PA 4HPOL 1JPSL 5D70H 1FL6A 3VI4B 2ZZUT 3OQRA 1CDIA 4RMUA 5EFIB 3T4YB 5DRWA 5AZ2H 3LOWA 4U1JA 3TEUA 1AP2B 2R2CA 4OY9A 5H2BA 4DVBA 2VDRH 3MRPB 5LBSL 1EGJL 3H2PA 4IYKA 2BOCA 3FULA 4M1CD 1L7TL 3O41A 4ZMYA 4AT6A 3ULUE 1NC2D 2DH2A 2FNWA 1U8IA 2ZJSH 4IBYA 3ZKXC 2WZ5A 2WYHA 2WYZA 1HFUA 1L6PA 2PR9A 4TXVB 3LKPA 3AVEA 3US0A 2DQCL 1JGLH 3RLSA 5L0QB 4JO5A 2VE6B 4WFHE 4FA6A 2TSAA 1M6UA 5ISZA 4YHPA 5K9JL 4Q9RL 1AQHA 4W6YB 3FU5A 2I32A 1CXKA 4H8WL 4LLDB 1Q94A 2WLLB 1G7IA 5HDOA 1F1DA 1KYOJ 4AVKA 3QORA 3NJIA 2FJHB 1AS6A 4XMTA 1HHHA 5CINL 4Z0XB 2A6KB 4PVBA 2BZ7A 1NAMH 2EIMB 2AGJL 3MTRA 4HDIB 4HJIA 2Y7SA 4Y4HA 2QADB 4H88L 1F90L 4YDMA 3BJLA 4TVPL 1G9EA 2HJKB 1FYTD 2C5DC 4HUNB 4MXVE 1UUSA 1TZIA 3O4LB 4QMEA 5DRNA 3SDXE 3LRGA 4PAZA 2GJ6E 2WMPB 4Y19B 1CGUA 4FC3E 3IKCB 3QQ9C 4LVHC 4QDGA 1SEQH 1K5NA 2NY7L 3ZZ1A 1CDGA 3H53A 2HLEB 4JFUA 2AJVH 3W9EA 4A55A 1WP6A 4ZFZA 4PJ8C 1UM4H 4YSUA 4FXGA 5KVEH 5LLIC 4X5RA 4YIQA 1LYQA 4POZC 4WTXA 3G5XB 5I23A 1CK0L 1PGRB 3HCVA 4GKZB 4OW6A 4NO3B 3DX0A 2Z1KA 2FE0A 5IMKA 3DMMC 3ESOA 3IGAA 3ABZA 4GQRA 4IU2A 3HBQA 3O2WL 3QE5A 4Y5YA 2BOBB 4CC4A 1LO5A 4TS6A 1NGXA 4PWHA 3O3DA 5KSAA 1NCTA 4YDKL 3KYMA 4BFJA 3KPPB 3EYUL 4HV8A 1MIML 3U7YL 4JDZA 5G5DA 2VWEC 3VRJB 1Z32X 2E27H 4GNKB 3M45A 4IRSB 2WQ8A 4HSQA 4LLQA 4QEGA 1EMTH 1LK2B 4OR1A 1CC3A 4FQXA 4ZMNA 3QG6A 3RU8L 4DN3H 5DA0B 5KBLA 3UYOD 5C07D 1EH9A 2YPLA 1D9KD 4PSPA 4DSYA 4PSRA 4TVSa 1SXAA 4M8QB 3FU3A 2B3IA 2GHWB 4TUJA 5L8KB 5CAYB 1U3HC 3W39B 5IHUL 1NAMA 4HLZG 1V7NL 2Z8WC 1H15B 4ZSOB 1AIZA 3M8OH 3STLB 3QHFH 3ZTDC 3GSVA 4K3DH 3GSNL 4WUUD 1ND0B 1G1CA 2D2CC 1D7FA 1KTLB 4XN8A 5DJ2A 3O9WA 1ZK5A 2SEBA 4FZEH 3J07A 4BK4A 1QG3A 5JPMA 3EFFA 2DQUH 1E4KA 3KXFB 1OTTC 1TPXB 3QPQD 1GCFA 4DP8X 3REVA 4MMYA 3LHPL 4M5ZL 5I1LB 3FONB 3KNBB 4PJHA 5AUMB 4GRWF 1BMZA 3EHBC 3QIUD