1N19A

Structure of the hsod a4v mutant
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
153
structure length
153
Chain Sequence
ATKVVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHSIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into Lou Gehrig's disease from the structure and instability of the A4V mutant of human Cu,Zn superoxide dismutase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Superoxide Dismutase [Cu-Zn]
total genus 38
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2002-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1n19A00
1F1DA 2XJKA 2ZKXA 4A7VA 2WYZA 3LTVA 4OH2A 4OJAA 1F1GA 2JCWA 1AZVA 3GQFA 2E47A 3GZOA 1F18A 1JK9B 3H2QA 3KM2A 1XSOA 3ECVA 2WKOF 3KBEA 3RE0A 1E9PA 1Z9NA 1E9QA 2APSA 3GTTA 3F7LA 3GZQA 3S0PA 4A7QA 1IBDA 2JLPA 4N3UA 3GZPA 1YAIA 1SXSA 1DSWA 4U4IA 1HL5A 2WZ0A 3K91A 3L9EA 4A7GA 2C9UA 1IBHA 1SPDA 2VR8A 3CQPA 1SXNA 2C9SA 1CB4A 3CE1A 1SRDA 1EJ8A 1PU0A 5KBKA 1RK7A 2WZ6A 3HW7A 1E9OB 1FUNA 2GBTA 1L3NA 1PTZA 3GTVA 1B4LA 1OALA 2WZ5A 1SOSA 2AEOA 3MKGA 1JK9A 1Q0EA 1TO4A 2Z7UA 3KH3A 2ZOWA 3SODB 1KMGA 1F1AA 1B4TA 4A7UA 1OAJA 3QQDA 1BA9A 1COBA 1E9QB 2C9VA 2AQPA 1MFMA 1ESOA 2AQNA 2WWNA 2VR7A 1OEZW 3HOGA 1SXBA 2WWOA 2ZKYA 1S4IA 4BCZA 1BZOA 1E9OA 2Q2LA 1YAZA 3KM1A 4MCNA 5KBMA 1JCVA 2GBVA 4FF9A 1IBFA 3F7KA 1PZSA 2VR6A 1OZTG 1YSOA 1N18A 4BD4A 1IB5A 3MNDA 3QQDB 1N19A 3ECUA 4B3EA 1HL4A 1EQWA 1SDAB 5KBLA 1IBBA 1TO5A 3T5WA 3HFFA 2K4WA 1SXAA 3CQQA 1UXMA 2Z7ZA 1DO5A 1Z9PA 2NNXA 2E46A 3KH4A 2AQQA 3PU7A 1OZUA 4N3TA 2Z7WA 3L9YA 2R27A 1XTMA 4L05A 4A7SA 3ECWA 2AQTA 2Z7YA 2GBUA 1UXLA 1CBJA 3H2PA 4A7TA 2LU5A 2WYTA 4BCYA 1U3NA 2SODB 2V0AA 2WKOA 2XJLA 2AQRA 1SXZA 3KBFA 2ZKWA 5CU9A 4A7GF 1E9PB 1QUPA 1P1VA 1XTLA 1SXCA 2AF2A 2AQSA 1SDYA 4MCMA
chains in the Genus database with same CATH superfamily
4U1KA 3APMA 5GISH 3GPEA 3VWKD 3O11A 4PLNC 3NIFB 3NCJH 2JJWA 2P45B 3TEXA 3MX0B 5DC2A 3CVHA 2IAMA 5DJAA 2CIIA 3MROB 4FZEH 3TWYA 3ZHNA 1JNNH 4JJ5A 2FIRT 1KIRA 5FHBH 3HN5A 4IGBD 5HDBB 3EFDL 4RMSA 3MUUA 3QI9D 5MEOA 4LU5L 3MRHA 1WFMA 1Q38A 2CKBA 4NUJA 2JJSA 4YPGB 2IADA 5DHVB 4U4BA 4XCFL 1OAKL 4JR9L 1D5ZA 3CHOA 3N42F 1ACCA 1ULVA 3SDAC 4GG8B 2VDPL 1CGVA 4QRRD 4LGSB 1JZ6A 1NGZB 1X5GA 2J5LB 1QKZH 3FL7A 4LEEA 4NN6C 5AG9A 2P49B 1UTDA 1FZJB 4X8JB 4JL2A 3FN9A 2B1AH 3IXTB 3FSVA 2F8IA 5BXFB 5EA0L 1VCBC 3EO1A 4C59B 2P26A 3W2DH 1ZHLB 2O6FA 5CGYC 4BZ1H 2BSDA 2WLIB 3DDGA 2AERT 3T08A 5C0FA 3CFMA 1JGUL 3GSNA 3QS2A 3PGDA 2HT4D 2VDMB 1BA9A 5GGTH 1U3HC 4TQ8A 2WUBH 1QR1B 2K7QA 4ZMNA 2V5YA 5C2BH 3LQAL 5CD5D 5GS0C 2FLRT 4BCZA 5IVXF 2WXNA 1EFXA 1RV6X 4LNVA 1OVZA 1EV2E 3GJFH 1B4RA 3KPMB 4X6CA 2P8PB 4QRSA 4H88L 2GITA 5F9JA 5T1LD 1PZ2A 5IB1A 3A4DA 3CQFA 4G8EA 1UJ3B 3QZLA 1BVNT 4WO4A 5FYJE 4O5LL 4C56B 4HCIA 1F4AA 1HL8A 4PJBA 1Y6NR 2NQCA 3LZNA 4TVPD 1SEQH 4Z7UB 3TJEH 4M5SA 4HWNA 2BWQA 3RP1A 1OF2A 2OMUB 2HFEA 3EDKA 3T3ME 3P11H 4TTGA 3TPUA 2OCJA 1DVFB 1X9UA 1E4KA 3HG1D 3UAJA 4CL7A 2NNXA 2RMNA 4HGWA 4NUPA 4JFEA 3BEVA 4NKOA 1A6VL 4K3JL 2X4NA 3V0EA 4W9ZA 3VW3H 3CSBA 1HQRB 2EZ0D 4XODA 4KK6D 1YEGL 3WIFB 1XGYL 5GJTL 1J5OH 1EDHA 4EBQH 4IBTA 4JNXA 2CLVA 4ZYKB 2WV3A 4MJ6A 2X42A 5LAXB 1ZWIB 3NAAL 4KVCL 4PLJD 3TJEL 2YD4A 3D3VE 3O3AA 1NGWA 3CFKB 2WN3A 2R56H 3MRQA 1CF8H 1YEKH 1QI4A 2AEPH 5F93C 4JPWH 3N55A 3WFDL 3HHSB 3SPJA 3P9LA 2ZICA 4O00A 1XL4A 4WDIA 5D7IF 2BJMH 3WG7B 2EDNA 3TEZA 1LE9A 1MNUL 2IDUA 3JV6B 2C3VB 3TVMB 4ZFOL 2R4SL 5JA9A 2JIXD 3BFQG 4JN2A 2YSTA 2ZQKA 4O4YL 5E94B 5I15L 4AX3A 1ITCA 4HWEL 4FTVE 4JRFA 1A7PL 1TYRA 5GGRY 1RZIA 4FNLH 3LEYL 1LQBC 4YNYB 2R56L 1DFBL 3NSCA 1YMMA 4XHJD 2DQUL 5EBWB 5DZNA 2X2YA 2GJRA 4DFIA 4KUCD 3V5KA 4MA3A 1E28A 1O6SA 3IE9A 1HH9A 2EE3A 3HI6L 3KLAB 4NM8H 5E8OB 3VI4E 1UD8A 2GB2A 2JVUA 2NX5D 4TSCH 4OFYA 1FFNA 3GSOA 2W1NA 3SDCD 5D4IA 3KEHA 3SIKA 3QT2A 4R97B 1KTKE 4L3CB 4XNUL 4OJFL 5KS9E 5ISZA 4GRWE 3LQZB 4JPKH 3L3HA 4NZUH 1R19A 5F9DC 4AE0A 4FCHA 5AALA 3WIIH 3L2NA 2OMZB 2LV4A 3QHFL 4AG4L 4F5CA 5E6ZA 3U4EB 4UDUB 1UWEH 3U1SH 4OCMC 4MXWH 4BFIB 3S3SA 3LAFA 5K1NA 1B4JL 3HE6D 3NJGA 1UD2A 1TQCB 4YSAA 3FT4B 3RWDA 5IFHL 3KYNB 5F0PB 4P23B 4LLUB 3CFKA 3VFVB 2ITCB 4P46A 5ERWB 4ETQB 4KV5F 3APNA 3QP3A 5EBLA 1U58B 2NY3C 4AEFA 1HL4A 2VXUH 1A3RL 5E00B 4WK2B 2HT4C 4YHMH 3JVGA 3ZOAA 1MQ8A 3UERA 2G3XA 2CO2A 1OK0A 3GD1C 3RWIB 4FI7A 2SEBA 4AIXA 2R29A 2EEXA 3ILEA 1FYTB 1XSKA 4W4OA 1FGNH 5E99L 1GVIA 3SGKC 2DQDL 4QHUB 4IK7A 5BO0D 4NQTA 1PNCA 4WW2F 3W2DL 1YMMB 1FE8L 4LIQL 3JWNG 5EBWA 4GUOA 2R2EB 3L3DB 3QIWC 2P8PA 1N5YH 5HI4D 3OJMB 4O51A 2XJKA 1J5HA 4CW1A 3ZKMD 5SWZB 1E65A 5E23A 3QEGH 1CLVA 1RERA 2EE6A 3ESVF 3QHZL 2OX5B 4DGUA 3TTSA 3CGTA 4L8SA 4YR6B 4YVNA 3ZIYA 1XR9B 2UY6B 4GLRI 2P8LA 2VSKB 3QNFA 4PD4J 5TQ2L 5SWSA 3L6FB 4EQ2A 4KRLB 3QCUH 4KZDH 4M00A 4YBLC 3NFNA 3SYQA 2WUCH 1VCAA 2BSEA 4QCIB 5F88B 4Y8DC 2GUOA 4NKOB 1B90A 4G9FE 4XWOD 2MNWA 3PL6A 4ZTOH 4K5PA 2COVD 4N90D 2D7QA 1TYJA 4G6KH 5EFIB 5LJYH 2ZX9A 2BVOB 3B1TA 1BDYA 2A9CA 5CBAB 3US1A 4H8WC 4AK2A 3NCWA 1JF5A 4HAGA 4OKVA 1I7UB 4WKZA 2ZCLL 3B7UX 2AQ2A 3Q5OA 4ECNA 3NPSB 5CGMA 4Q6IB 4ENEC 4AEHH 4N0CC 3AREA 1QFUL 3T3PF 2IPTH 1IJNA 5TPWH 2AXHA 3FQ4A 1NGWB 4TUOB 1ZTXL 1HCVA 3WTTA 2R2BB 1AOZA 4DP1X 3TT3H 3LN4B 43CAB 1KGXA 3NP3A 5F7DB 4YHYC 4Y5VC 3T0BA 3MLPA 1D9KC 5T3ZD 3CLFL 5HVWA 2KMWA 4PGEB 5D7IB 2XDHA 2BVQB 5LB1A 1JRHL 4TTDD 4X50A 2BXYA 4C55A 1OGAE 1T1YB 4UZGA 4ZW5A 2ZYIA 1AFVH 4PAZA 4OIIH 4L9LC 1S7TA 4G7VH 2FSDA 4KQ0A 2VN7A 2A5UA 3WTYA 5J11B 1IBFA 3F6JA 3WUWB 4EN3C 5LBGA 5EOCH 2J21A 4CVZA 1FH5L 5IW1A 4G6MH 3SKMB 4R4FH 3TN0D 2VW6A 5EBMA 2FEEL 3CZFA 1G9NC 1VGKB 4JFFA 1PLCA 1XB8A 3TYGH 1E6JH 3D50A 4LAQH 4O02A 4QY8B 1EAPA 1VA9A 2OR9L 1RPQA 1IGMH 1OAUL 3BJLA 4P23C 1UT9A 4UYPA 1D5BA 3VXMD 2V2TA 1XO8A 4AIZA 3VD2A 1EZVX 2BCKB 3QEGL 1TQBC 3L95A 2C34A 2Q20A 3AUVA 4NNXA 4JM2A 2N0MA 4QXUL 3CXFA 2ZCHL 3PU7A 3QULB 4FA8A 3F5WA 4LLYB 4KO7A 5I19H 4W1TA 5ICXB 2ZSVA 1SN2A 2ZPKH 5EZLB 2R1YB 2VO8A 4X7DC 1MVYA 4YFLF 4JFXB 1THAA 2L3BA 1LVEA 2VIRA 1GW0A 1JTOA 4IYKA 4DP7X 3D0LB 2Q8AH 1BQKA 2AQSA 5AZ2H 3OMIB 5MP6H 1GZHC 1U8QA 1BAFH 3OJ2C 3SZ6A 1SFHA 5EO9B 2D0HA 2LU7A 2OS7A 4P3CH 4XN5A 5I1DA 4HJUA 1J10A 3BVNA 5AYUH 1RZ7H 4IS6B 1BBDH 1DN2A 1QSEA 3VXQA 4X9GA 4ZDHA 2DYPD 2KL6A 3VDCA 4N9OB 3SJVB 5FV2A 4AQ8C 1PJWA 5I6XB 1LTXA 1AQKL 2QKIB 3H9HA 1LD9A 4H13C 2C7UB 2WGXA 3LPPA 4LSDA 1BMZA 3MGOB 4NOBA 4TPRL 5HDWA 4Z23A 5IW3A 4APXB 4O2EA 2VDPB 3X13A 4L9LB 3DJSA 4WO4D 4FFWC 4BFKA 4ES9A 1XVSA 2A38A 4Y1AB 4KV5E 2CIIB 1EEZB 2FEDD 5F7MC 4AYFA 3QEHB 2AAVA 2BZCA 4P9HC 5CLWA 4Z7QE 2EC9U 3JTTA 4HEME 2DWDB 2B4CC 4NRYA 4OCRL 3KL5A 3VFTA 4XP4L 4XNUH 3DX3A 1BZ9B 5D1ZB 3SCMB 5DCCA 2UWEF 2X4QA 2W0KA 2APVA 4J3OC 1V05A 2BY0A 4BSVB 4K71C 4BQ9A 4MQXC 4Y4KD 1XIWD 4OV5B 3U48A 1L6ZA 1CBVL 2YN3A 3N1FC 3I3BA 4HUMB 1KF9B 2OCFD 3QORA 5GS3A 3QPXL 3SDXB 5HGDA 5TE4L 4NQEA 3QGVA 4JKNA 5C71A 3FTZA 3TN0B 1ONQB 3D4YA 4ELMB 4M93C 1M9WA 2NNAB 4FL4C 2UY7B 4JB9L 5KVFE 4QRRA 3QG7H 2HCZX 3CFJA 4UOQA 1HK6A 1J1XH 1DBAL 5CJXA 3QXAB 1M42A 3L7EA 3MCLL 3W1ZA 1P4UA 1NCCH 2QELA 2H3NB 4H26A 1WIOA 3D85A 4IMLB 3ZZSA 1GC1H 2XA8H 1IC0A 1VACA 2R2EA 4F8OA 2Y07H 3NG5A 1SJEB 3CQQA 2R2BA 4TLTA 5CWSA 5C07D 4ODTH 3BGFB 1FL6B 3DKHA 3TEYA 1UD3A 4M1GH 3CFDA 3AU0A 1OP5H 1MKFA 1QOKA 2HX7A 2XOTA 5D7IA 1BQRA 2IPUK 4L1DA 2HRHA 3EJTA 4PRDB 1Z2KA 1RULH 3FU0A 3U0WH 4WNJA 3O6KL 3AQDA 2YD7A 4K3HA 4R7DA 4LRIC 4MJ4A 1T3FA 3CTTA 2BSBA 4GRWB 1F56A 1JNHB 1KCUH 2J1WA 5K9KA 4QCIA 1W0YT 3EUUA 5FO9A 4FLOA 5H35B 1G7MB 3SZKC 3EZ8A 1R0AL 3P73A 1YQVL 4OJAA 4LCVA 2YWZA 3QDJB 3QYMA 3L9RB 5I5JA 3U9UB 3GJEB 4F7MB 5EBGA 4AMWA 3EXLA 2ZXWB 4HHGA 4NN5C 4QNPF 1ZE3H 1OSPH 2PYEA 5EU5A 3BWZA 3ILPA 1P7QD 4AL8H 3ME0A 1A3QA 1A4JB 1KDJA 1UFGA 2EDHA 4O5LH 5DRNB 1ZLVK 1ND0A 5I2IB 1EXUB 1R5WB 1ZWIA 4XO3A 3Q2VA 1IUZA 1C1EL 3VXUA 3V55A 3OQ3B 3FW6A 5KSAB 3P40A 1W15A 3O4LA 4YDJA 1WZ1L 2WCGA 2NTFB 1G6RH 5D1ZD 3SCMD 1E2WA 4D9LL 3O41B 4ZTPH 3BEWB 4G9FD 4UF7C 4G7RB 4PJGB 5CHNA 5DU7A 1J8HB 3H3KA 2A74B 3W0WE 1EHAA 4AYEC 4GW5B 1T6VN 1E9OB 3KYKL 3QUML 4IRSB 1FV1B 4YFEA 2J5WA 3PIQB 3W82A 1OALA 4TLUA 2ADJA 1QQDB 3H8NA 2NY0B 3S8FB 4Z3IA 2PO6C 1K72A 2NY6C 1IC7L 4GYBA 3KXFA 1SQ2N 4RX4D 1G7QA 2YRPA 2HZHA 1P6FA 2JK5B 3AVEA 3IS0X 2A6DB 1Q9LA 1BJ1H 2NY5L 1T21B 3QK0A 3T1FB 8FABA 4HC1H 1A1MA 5JOPE 5E5UB 1QHPA 1UXSA 1D9KA 4PG2A 3M8OL 4F58H 4KX9A 2Z3FA 4G11A 3VE0B 4RSYA 3FB7A 3JTTB 5HHVL 3CX2A 4CMHB 5DI8A 4U1IB 2J2ZA 4PJCE 3L3HB 4OI8A 3C2AH 3BUYA 3ZQXA 3O8XD 3I75B 1KBPA 1MCFA 1BD2E 1ED3A 3ULVL 2CO1A 3GKWL 5LBSL 4Z7WB 2VJ0A 4RWYL 1PIGA 2VAAA 4N90E 3KGTA 3DROA 4EIZC 3HZMB 3OAUL 4QOKD 3WIHH 2J57A 3L5WA 2IFGA 3UTSB 2AQRA 1OE2A 1NUGA 1U0QA 4FQHB 1OCCB 4JY6A 3NCYS 4PJHB 4NC0B 1MZZA 5MHSD 3WFCL 4LEOA 2EXYC 3ZTJH 1MW3A 4ZAKA 4NCC1 2NY2C 4IHOA 2I69A 1WWCA 4RLDA 4DGVL 3KPRA 4NPKA 2ID5A 3V4PH 4ATWA 1NCOA 1G43A 2GT9A 1Q9OB 3GRBA 5C0AE 3IFLH 3AB0B 1MI5B 1UD4A 3WY3A 1QBML 3FQWB 4O58H 4FXLA 2QQNH 3BFWA 1YEHL 2V8LA 4OZIE 4QGYA 1ADQA 2BSCA 4X0KA 2WGNB 4GXFA 2C9PA 2HRPH 2OULB 5DD0H 4HIIA 4R0LC 8FABB 1T0NB 1XFPA 1ZHNB 1Z5HA 2BWIA 4FQCH 5I0YA 4OLXL 4XPAH 1Z9MA 4HK3J 5JIIA 4XHQA 3OAYK 4BSVA 1NLDH 4U1NB 1ETJA 2MOQA 3UL4A 4DEPB 4P2CG 1UHVA 3BXNB 2OSLB 2NUTA 3V95A 4GIPD 5D7JB 3ASWA 3C6EA 3QIBA 4CSZA 3ARGD 4ZMTA 9PCYA 1WA2X 3FUHA 5IBLD 1NIFA 3FTGA 3FH5A 4KFMA 3SPVB 1Q8MA 4TRPH 2HN7B 4Z7WA 3QJTB 1XGPB 2Q5BA 5EF0A 2F61A 4W9FC 4UQBA 3L1FA 3I6LE 1NC2A 3UJTL 3MKGA 1KZYA 5EZIL 1U3HB 4J23A 4MXQC 4NQED 4HKZB 4F24A 1X5ZA 4PWKA 1UA6H 3E2HB 5I73B 2FBOJ 5FX3A 3KPSA 4XCCH 1W9XA 2YOAA 1L4IA 2HJLA 2ZKYA 3BSZH 4LHUG 4N8UA 4JPIB 2XN0A 3NIGE 1RK0B 3P4OA 4ELKB 2AEWA 3VXOA 2CBMA 5FECA 5L4MA 1FHNA 4FNSA 4JE0A 4OLUH 4PJIB 3QUXA 3IYLW 4KNUA 43CAA 1A9EB 5T1KD 2A0LC 3CLWA 3UTQA 1NKRA 2YFNA 3BGAA 5AQ0A 1KTJA 1B3IA 4P2RA 1JHKL 4GXVH 3EJYD 1U8HB 3BH9A 4NQVB 3WS3A 3DX8B 1RZKL 2I26N 4FADA 3KXFD 5LN8A 2YSSA 3T0WA 4ELME 3NN8B 4Z7WE 2CA3A 3IMUA 3Q01A 3C2SA 2QHRL 2EVIA 1HSBA 2FT8A 4M43H 3UTPD 3SDXE 1R3HA 3O6FB 4KO5A 4OGQC 2ZUUA 3HRPA 4BFBD 2W9DH 1FO0B 1HDMB 1I8MA 4J7RA 2VISA 1L9OA 4HW6A 4I3RH 2ZT9C 2X4RA 4MD5A 4OLEA 5BS0B 2ICEB 4P2OC 3IMTA 2G5UA 4RGNE 4ZO6A 2WYTA 5DUJA 1TYEB 2DYPA 4NZFA 5CEYB 1N12A 1TJIL 1D5BB 5DHYB 1FYTE 4OZIA 3OXRB 3LKNB 4L3EB 5HGHB 3QNZB 2XG4B 2R0LL 1ACYH 3CHXA 2O61B 4N4YB 3BWAB 3PJLA 1DQJB 4JFHE 1IBYA 5C0AA 5T5NF 4EI0A 3P3SA 1LO2L 1XMEB 1AD0A 5FDWA 3OGCA 3NZHH 1NCWL 2MCPL 1P7QA 5J1AB 3MV7A 3RWJB 2CJSA 4GS7B 2YFOA 5C0FB 1XSOA 3ZN6A 3EJCA 4EMZA 1AAJA 3DTDA 5DEJA 5BRZD 2CBQA 5BOJA 1LO5A 1WBYB 2X4TA 3RY6C 2MKLC 4KDWA 5CILH 1ZLDA 5ELIA 3GXIA 2G9HA 3KVQA 1WA1X 2E7CA 4RFOL 2WZPD 1F4XL 1T7ZA 3OR6B 1H15A 1MRCL 3E3QE 4IRSD 4X7SL 2P8LB 3UYRL 2QDVA 2IMNA 5BV7B 1WAPA 4HULB 3QJHB 1IM9A 3BAWA 1W0WB 4HKJB 2EH7L 5MI0B 1HCYA 5JYLA 1BD2A 4N2AA 1NMCC 4PB0L 5E8EB 3ZUCA 4P2QE 1L0QA 1AO7E 1ZHBB 5HJ3A 3MOAL 4K8RL 2FECL 4O58L 4PJCA 1UB5B 4WJKB 2FBJH 3TL5A 5I66A 3MRGA 5AVRB 1I31A 5HDOA 2YMOA 4CNIB 5KW9H 3IGKA 3HUJB 5CKGA 1G1CA 1MCWM 1MFBL 2NZ9D 2ORBH 2QMJA 4U1IA 1BM3H 2UUDH 4JFPB 3RWHB 3UH8A 1MF2L 1UH3A 5B22A 4MSWA 1IT9L 4DGIL 4IHBA 3PXLA 2XNAA 2CGZA 2F6AA 2W60B 3IAQA 3NZUA 3QJQB 3EFOB 4Y5YA 1JZEA 4I8DA 4JZOB 5GIRB 3UZQA 3FO0H 4HWZA 5CNHA 1IGYA 4J6RL 2MWCA 5HGHA 1MIEL 5F9WB 3HMXL 2HT2D 5HYEA 3FMGL 5C08A 4X9IA 3CAFA 4L5FL 1WAAE 5HYJB 2VAAB 1YA5A 4KKPA 4X4ZA 2XTLA 2P1YA 1QRNB 3S6CA 5CINL 2DBJA 5A2JH 1SF5A 1MCQA 1TVBA 3HHSA 1ZV9A 1F3JB 1FSKB 2ATPB 4QOKB 1BLIA 5HHME 3SB3A 3UBGA 3W0WA 2QHLA 4HZLB 3S5LB 3T5WA 4BH7B 2P24B 3O2VL 1LO5B 3QPKA 3TVMA 1NAMH 4K2UL 2O5NA 2W59A 5T5FL 1Z0MA 4A2MA 3VD1A 3BUDA 5D2NA 3MRKA 3E80A 4W9EC 2BINA 4X6BB 1WGOA 2PP7A 2Q8BL 1U8LA 1YNLH 3UEZA 1Y0LA 4D8OA 1RZGA 3CSTA 3KR3L 5IEKA 1OTTD 2E76C 3Q13A 1SXZA 5DHVH 3H4FA 3IE4A 3N43F 1EK3A 4BUQA 1P7HL 4EDXB 2PYEE 4MA3B 5C2UB 3HTLX 4G42A 1FL6A 4Y2LA 2H1XA 2E4FA 3CZEA 2R0ZH 4OH2A 3EOBB 3FUIA 2JSFA 1T83C 3STZB 2I7SA 1HKLL 2QR0B 2NOYA 2Q10A 3ECVA 4L4JA 2X70B 1OARH 2DL2A 2IJ0C 3DJTA 1H6FA 1FO0A 1I8MB 1OP4A 2ZONA 4XO9A 4UQEA 1ZPLA 2NW3A 1KV3A 4XB3A 3W5MA 3PAVA 3A5VA 3NRQA 1D5IH 4DESA 1NBYA 3VFNA 4YXKH 2ALAA 2R0ZL 3V5DA 1DJZA 5E1IA 4AJVA 4C56A 2XWBA 3PGDB 3PXHA 4Z7UA 2EE0A 1GPOH 3JV0A 3ULUL 5EN2B 4P46D 1ODUA 1SYVA 3P4OB 3GK8L 1C8QA 3CXHK 5T1LB 2HTKC 4C57C 2UZXB 2Y6SC 4K3EL 4GQRA 3VFRB 1TQWA 2XWDA 4FYSA 1F2XK 2DF3A 4PGBB 3R0NA 3FULA 1WWAX 1HXKA 2DLFL 2ZSWB 2DWDA 2NY0C 2Q9OA 3FBQA 3V6ZB 3FRUB 3HG3A 5B21A 3GKZA 1TCRA 4K7PY 3TIEB 4YDLB 1E67A 1SLXA 2Y36H 2EZ0C 2X2HA 3WEMA 1AE6L 4ZFGH 2D3VA 2DKMA 3LXUX 5FYKL 3VDAA 2X4QB 4V2CB 1XL6A 1RZ8A 3QQ3B 3L2MA 5D1QA 4R96A 1NCDL 1FNSH 3BKJH 3LRMA 1YJDH 3KLDA 1HILB 4UQCA 2VXSL 3IRZA 3HG0A 2C9AA 1XSJA 3DC0A 1BEXA 4YXHL 5KVGL 1N18A 4F15C 1UEYA 4NKIL 3NJKA 4Q6KA 2XA3A 3KNBA 4EVNB 3BZEB 1F90L 1JZ7A 1S7QA 3B8SA 3EOAA 3OTTA 5FCUH 5DMKA 1KB3A 1K8IA 1OLLA 4OLZH 4KJQC 4BA8A 5DTFB 4OD3H 4ZXBD 2ADYA 3BRFA 1BHGA 3UC0H 3N41B 1KGWA 2XY1A 2E59A 3WU1A 2PPDA 5IFAL 4JO4L 3OHXB 5FYJD 5GRUH 4I18A 3VXTB 3SE3C 4B5EA 4JRYA 4K8RH 4LARH 4M8QB 4PGZA 2E4TA 1TCMA 2BP0A 4KZCA 3ZUNC 1A1OB 5HYQA 5I8KL 1I1AC 3TO2A 1NBVH 4YSSA 4H5SA 3CSGA 4H8WL 2KHAA 1MJ8L 2R23B 3FONB 3WFEH 2BSED 1QSEE 2JNZA 1FYTD 1MHPL 5ALBH 2O5ZH 4OD1L 1B6DA 3CVHL 2BM3A 3HZMA 1OE3A 1O5DT 4LCWD 2PW2A 4JDTL 2NY1D 4K7PH 5IQOA 3CDZA 3RQ3A 2F8OA 1C5DA 4U0RB 4A2GA 2P24A 1Q0YH 1OPOA 2APSA 2AABH 1LEGB 2CRIA 3BPCB 5ID0B 5GZNA 2XTJE 5T1MB 4UDTA 1RZ8B 3MRKB 4X6BA 3TH2T 2VQ1B 4LLQA 3TYGL 2JKJA 4LDCA 4ZOBA 4XVOA 5I1JH 3KZ8A 4XP6L 1MOEA 4N0UB 4MAYD 4WQOA 2WN2A 5SV4A 2Y5QA 2MQ3A 2PW1A 2WXMA 1ITBB 5EOCL 4CMMB 4PW3A 2MPAH 2QVFB 4Z7VF 2XETA 3VFSA 5I8CB 1NLBH 1H3TA 2W8CA 5KVMC 1EGJH 3ARDC 2EIMB 3LDBB 1YNTB 4KVPA 4WFHE 4PJIE 4L1TA 2Y2YA 3RFZA 4JHBA 2KERA 4HS3A 4JFFE 4KK9C 3IJEB 4FE9A 1YPZE 4EOWL 3UBXB 3IKCA 3P02A 5FR3A 2IAND 1NLBL 3S48A 1UASA 4DF9A 1L5GA 4YSTA 4LLDA 5ETUA 2XCMC 1CCZA 3AQZA 2DTMH 3QDGE 1VLXA 4HLZH 2W9DL 4JO2H 4AQ8A 4G8GA 4LSPH 2FX7L 1E9OA 4IRSA 4XP6H 2R7EA 1JNLH 1SOXA 1X5HA 2Q8AL 3F83A 4ERSL 3MV01 1E8XA 4JFQA 3MLRH 3HS0A 4MGXA 1YECL 2SEBB 1ZS8B 2WIIB 3MNWA 3NSXA 4HP5A 2AABL 1MJ7L 3IM1A 4N5UA 3KPNB 3UPRA 2YC1B 3K3QA 2HFFA 4OKDA 4OD2A 3OHXC 3NACL 4LSSL 3CDYA 1W72H 1L9QA 2XPGB 2X4SB 1BEYL 4IM8A 4PWIA 3TBYB 3CSYA 2F54D 1M4KA 3ZDXF 2WXGA 4PBXA 1IGML 1KOAA 3P9MA 3ZKXB 4G42B 4NERA 1UA6L 3QCUL 4GXUM 4NKMA 1RJCA 2KZBA 5BUGA 3HPLA 2BY3A 3IETA 5A2CA 4OJDH 1DE4A 1TFPA 4KKNA 3QW9A 1RPUA 1XDTT 3UTSE 4AQ1A 3MLXH 4LP4A 5I16A 3R1GH 5EC1B 4F15B 4GBXC 4Q4EA 1HCZA 2WLNA 4ZPTB 5LG6A 1ASQA 4L8BA 4XVUD 5CJXC 1GZQA 3SDAD 1X5JA 3MRJB 4NBYB 5G5DA 5A1AA 3EF4A 3LD8B 3DOIA 3GFUA 4X4MA 1JXGA 5PAZA 1Q1JL 3MREA 3H7BA 2FRGP 3GXMA 2AJVL 3COOA 4R8WH 2IIJA 1U6AH 2BSRA 3PG2A 3AG4B 3O6LL 4ZS6D 7PAZA 5D72H 1AQ8A 4OZIB 3HC0A 5DA4A 5BZWA 2H3KA 4BFOA 1NCWH 4G6JH 2K4AA 3MODH 1DQJA 4Y19D 3B83A 3IEAA 4JQVC 3VG0L 5EOQH 3UJIH 1A7BA 2Z93A 1AI1H 5HVHC 1E5ZA 5IHZB 1AE6H 4ZFGL 4IDLA 2O26U 5CZKA 2ICES 2E86A 1TU2B 4K5LA 4QRQB 3D09A 1KZQA 4Z7VB 1KDIA 4I48B 5T1DH 1RIUL 4XNXL 1NEUA 1DVSA 1ZLSL 5A2BA 4F33B 1IEAA 3ROOA 5E4EB 4LEXL 3CSFA 3ZU8A 1VEMA 2N56A 2ZAGA 3F12B 3CCHA 4U2ZA 4L8SB 2NYYC 5DUPH 5TF0A 3T8XB 5CF3A 6FABH 4NZUL 5ICYB 2D7PA 1MIMH 4KKLC 2O6CA 1VADA 2FEJA 2O72A 1GPOL 1BGXH 4Z5RA 4XO5A 5BV7C 4BWWA 4WCYL 1OANA 3G04B 1DQLH 2R1XB 4TSCL 2CIKB 4TQEL 3TH3T 3I50L 1MW1A 4PP1C 1KFAL 2GBVA 4HJGB 4DPBX 2VR6A 1NC2B 4PCTA 4PQXA 1KB5L 1I1FA 5DWUH 5KS9A 5I1EH 3WS6C 3ZSTA 3ROLA 4FNLL 1R5IA 1RHHA 2WTOA 2CDGA 3JT0A 3GJEA 3MRCA 5DZOA 4F7MA 5JQIB 2A9AA 2W65B 1J5DA 3LZQA 5DZJA 2K78A 4P2AA 1NH6A 4KHTH 3R8QA 3G5ZA 3MUGA 3QJUB 3GMMB 4ZAKD 3RX5A 5FWQA 1KYAA 2KS0A 4KI5D 1FSKC 4PN6A 5E1QA 3KAAA 3TNMB 5I1DB 1HC1A 3CIAA 3DHUA 4JM4H 4XZUB 2H9GA 4QDGA 4S1RH 3NDYE 2ICEC 4XBEL 3FF7A 5C0EA 4TLSA 1CD8A 2VDOL 1HHJA 2Q8BH 2DWXA 5DFWH 1S8DA 5C0NC 3FQRB 1RZPA 3CWGA 1YEWA 4QAMB 5DVNA 4DERA 4HGWB 3RKDD 4MYPA 4OT1H 1YPZF 5ID0A 3NCFB 4NIKB 1J5OL 1OP9A 1KCUL 4N28A 5JIQA 4XMXA 5AUMA 3EYQC 3U4BL 1ASOA 2QQNL 4TL4A 3VFGH 1EWHA 1U8IB 2UUDK 2EYTB 4KVNH 5J1TC 4L8CA 1L0PA 4XNQB 3M1OA 1XX9C 2VRKA 5IBUG 2Z0BA 2BCKA 2LU4A 3AY2A 3BKCH 3B7SA 2BVPA 2QZQA 1FORL 4M7ZB 4GBXA 2FZ3A 1J12A 3C5SA 4FI6A 4FNUA 1OAZH 3QS3A 4ZX6A 1YAIA 4WI5A 3Q9QA 15C8L 1U91B 3CN2A 5F7NC 5DS1A 5FCSH 3P1VA 4IOSA 3VE0A 2BXZA 3IKCB 4ODWB 3MZTA 4H1LH 4KGLA 4LHQB 2Q3AA 5HI3D 1YYML 3FSAA 5IG7B 1LE9B 2NY4B 1NEZB 4QXVA 3U79A 3KPPB 2ZOKA 2QPFA 2YGNA 1KJ3H 2YGPA 2CK0L 1EHLL 1X5LA 3ARUA 4LO9A 3TO4D 4DETA 4E5XB 4XNYL 2ENPA 4PJBE 1WIPA 1CL7H 4B9PA 3BAXA 1A5FL 1Q0EA 1VKXA 1DQQA 5GZOC 3P0VH 5TQ0L 1VFBA 3B2UC 1J18A 4X98A 1IZJA 1F6AA 1KTBA 1OB1A 1IL1A 12E8H 1PY4A 1UM5L 2NY1B 5HHVH 1SYVB 3ARGB 4QRAA 3OZKA 1NBCA 2WXJA 4DKTA 2ZOTA 4ES8A 4WK0B 4KFZC 5GGSB 1WFTA 2IAAC 3VXUD 3UFIA 3VI3B 4EBQL 2W9EH 1VZIA 1YY8A 5H37H 4HC1L 4K9EL 4CBZA 2CPCA 3V4VB 5H35A 1MEXH 3JWDC 1GC1C 4Q0XH 1IB5A 3FRPA 5DLMH 3HCVA 3AUWB 1AMYA 3GMPA 4NM4L 4I88A 5JPNA 3SYPA 2AHIA 1KPUA 3CJJA 3SDDA 3KLLA 5E9DD 2CG9X 2EDFA 2G3ZA 2RR3A 2W9LA 3MBEC 4UAOC 4EDWH 5C0CD 1NTDA 1P9MA 2AITA 2ITDB 3BMWA 3P11L 3KWUA 4BSWA 2Q2EB 1OHQA 4NRXA 1ZY9A 3HJ0A 3MRIB 4GEIA 4HPOL 3UMTA 7PCYA 2OPCA 3BQUD 2P42B 4HJEA 3OM3B 3NVQA 2VDNH 3C5ZC 4IRJC 2DI8A 4NZRL 4NQSB 4M29A 4IEFB 3QXDA 4PJEB 3LVTA 1ADWA 3C6LB 3D08A 4EZMA 1SMOA 2P8MA 3E6HA 4I9WE 3FB8B 3UX9B 1H6UA 5D71H 1WJ3A 2O6EA 2ZF9A 3CVCA 1C5BH 3LIUA 5E2VL 1FV1A 5AW3B 4EI5A 5EIVA 5ACZB 3IAPA 3S3DB 4Y5YC 4BKSC 3JT2A 4AL8L 4V1DD 4NRZB 5E4IA 1NIEA 2ADGB 3BE1H 1AKPA 4XPHH 5I1LA 3JV4B 5BNXD 4GQ9L 5FLVA 4JQIA 3ESUF 2FL5A 4FFZL 2CJUL 4NUGL 1DQMH 2WK2A 4ODHL 1J5IA 4FFYL 2XRAL 2OR7A 1JHKH 4GXVL 1Z3GL 2VL5A 1BFTA 2A6DA 1IEAB 1IBDA 5E2UH 3AY4A 5E5RB 4F57L 1A1MB 2IDSA 5C09E 3QIUB 4G83A 1ZGLP 3IDXL 4YAQB 3ARFA 3LH2H 3MR9A 4KNQA 3ARED 5HY9B 1CFTA 2J43A 1OAKH 1U41A 4TNWF 1U3JA 4QO1A 1WWBX 3U25A 4JKMA 1RIVH 4D8PA 4ZTEA 4GH7B 4ETYA 4QHNA 2AGJH 1IBGL 2XKNA 3UTTB 2NW3B 2X1WL 4BHUA 4DW2L 4GO9A 1A65A 2WBKA 2EE9A 5FHBL 2NXYC 5I6MA 4UB0H 1CLZH 1IEHA 2HT3D 5C9JB 5IBUB 1JHTA 3P54A 2J7LA 3CBJB 1ZVNA 3SDDC 4F3FB 3QARA 1KMGA 5L4IA 1P7BA 4RCAA 2L8AA 3TBWA 5EU6D 2V5TA 3JWOH 5C07E 4PEEA 5KTEL 1EXUA 1R5WA 3FSOA 5FPIA 4Z77B 1JDCA 2NY2B 4PJIF 4YC2C 2R8SL 5LGKA 3OXRA 4A63A 1J1PL 3I9PA 1MELA 3RVWC 4E0RA 4KTEL 2YJLA 4PIRF 3RDTC 3RBGA 3QXWA 4OU3A 2P5PA 3U36A 3SY6A 5DEZA 3OC8A 2LTQB 3CN3A 5DMIH 3V7MA 2P5ED 1QFUH 5HGAA 4IKIA 4DKDC 1HE8A 2F5BL 3PYCA 3G5YA 3FUEA 4CU7A 2JCCF 4P5TA 1BJ1J 1UVQB 5GZOA 4OLVH 8PAZA 4HETA 4Z7NF 5JDSB 4HMCA 5SWZE 4HJ0D 2OL3B 4ZZKA 1KBGH 3L9BA 3GS0A 4HS8L 4Y1SA 4YQXH 1QA9A 1XH1A 2Q7AA 2XZQH 1JGDA 2QL1A 2FJFA 3TEUA 3WFCH 4IOFC 4HXBH 1QTPA 3EKCA 2Z91A 2AQTA 5FLUA 2I5YL 1A3LH 4WEEA 1OLZA 2OI9C 3H6JA 4YMPA 4K23L 2R0KH 1F3RB 4XPGH 1OCOB 1N59B 3KBFA 2Y7QA 4KTEH 5D6CB 1AR2A 4WO4C 2X05A 43C9B 1INEH 1G7JA 3GB7B 2X4PB 4NQXB 5L88H 4QF1B 4QRTA 1KLUA 3CMOH 2DQGH 4YDKL 4D9QD 3CZJA 3QDMD 4EF3A 4EJ1C 3GMOB 3HPLB 2OZ4H 1T1ZA 1HHHB 1G84A 5HJ3B 4B96A 1PX8A 2WYZA 4G8FB 1NUFA 1VPOL 1FFOB 4PJXF 3ZZQA 1N5YL 1U3HA 4B6ZA 1KCBA 3SKJH 3ZDYB 3GI9H 4PJ5D 3BJ91 3KMDA 1BBDL 2GJZB 2W92A 1AYOA 5F7EH 1NL0L 2W60A 5EO9A 1G9MC 1ZA3A 3OWEA 2DY2A 2VERN 2JXMA 1OD9A 2P3YA 4EE2A 5LGHL 2KZ1B 2P4AB 5TE7H 1GHFL 3BPNB 1MJUL 3QUXB 1I1YA 5JW4Q 3T6XA 5C09B 2PW2B 1QSFE 3K91A 2FTAA 4U0RC 3QHZH 4IEFA 4WI9A 3V9CA 3NA9H 2AZAA 5HHOD 1BWWA 4YDVB 5AAPA 4Y4HB 2VLJA 1MW0A 2AK1H 2ADFL 1S7VB 5FYKU 3MCG1 3S98A 3DX4A 3BPCA 3DPDA 2VLRE 2VN5A 3IGLA 2G0KA 3PHOB 3STLB 5B8CB 1KB5A 4Y2OA 5KVDH 3VXRD 3VI3A 1PYWA 4FG6C 3VB8A 3QDHA 2B5IC 4AYFB 5GSRB 1BD2D 2R15A 1N4XL 1HYSC 2ZOWA 3BEVB 5L88L 1NGPH 4L8DA 2YAQA 5BS0A 5I1GH 3V4UH 1YNKH 2CGRH 3DHJA 3E9UA 4JUTA 1MCHA 2DQCH 3U30C 1UH4A 5F3FA 5CGTA 1NCTA 3QIWA 2VDRH 3ESNA 4AKOA 3UGXA 1P4IH 3H3PH 3QNZA 1F4WH 5LDUA 3H0TA 4GAJL 1SBSL 2XQYK 1F3DJ 1OOAA 1IAIH 1RQ5A 1OE1A 1JWMA 4MHHI 4TS6A 2AJUL 2X3CA 3F65A 2YPLD 4PRID 2Z31C 35C8L 1H0DB 1O9ZA 1PEWA 5IK3A 1H3PL 1S78D 1JUFA 1IARB 3UMNA 1SDAB 4M56A 3LNEA 5B38A 5DYOB 1OGAB 4XCNB 3K6SA 3LD8C 3NCXA 5L6YL 3LNIA 5CR1A 4AL8C 2HTLD 4ATTA 2FUTA 4AQOA 2VZ3A 1CJYA 2Z7WA 1A4BA 3QUZC 3TO4B 2VDKL 2R1WA 4X7CC 1TVHB 2EXWD 3MX0A 2JI3A 3EGDA 2COQA 2HFGL 3N85H 1GJUA 1AKJB 4JFUA 1RUAL 2AVGA 2D9CA 4XO8A 1CGXA 1MCPH 4PJ8C 4UWQB 5DLLA 1YEJH 3U7WH 3RY6A 3WL9A 4DP4X 4AM0Q 4Z7VE 5J13C 1AZCA 1E5UI 1KJ2A 2GFBB 5DT1H 4ORGB 2VZSA 5EH1A 4FNQA 5T1LA 5D2LB 1XF4A 3H9SA 3LRHA 3D2UA 3OZ9L 5K33A 4TOYH 5JIKA 2G75A 3RI5F 2Z35B 4APQB 1VAHA 5IHBA 2A7BA 2RAMA 2XXMB 3L3DA 1PFCA 4JKPL 5I15H 4K71B 4J4PA 4BGDA 4QXTB 5E6UB 1HI6A 3MO1B 5AD0A 1NUDA 1SLUA 1ZE3C 1P4LB 3BKML 1D3CA 1ORSA 4HWBH 1IGYB 4DKFL 3QO1A 2WLLA 5B1JA 1RURH 4WAFA 3SJVD 2GC7C 3B7TA 5HGGS 3HAEB 3WDHA 5LQBL 3LPFA 2G60L 4BE5A 1P5VA 4U1SB 1I7TA 4M7LL 5D7LA 3P3YA 4Y2DC 3DGGA 3GWJA 4YIQA 4P23D 5J4MA 2VUKA 3H85A 5C92A 1IBZA 3DSNB 3JVFC 5E99H 1XB6A 5KYNA 5HI5D 3D4CA 3RZCA 4NDMA 3RZWA 2GIXA 1INQB 1OT2A 4ICXA 4ISVA 5D2NB 3HC2A 5F21B 5IW6A 3WS6A 1COBA 3ZZLA 1U8LB 1NAMB 4PJHE 1BFVH 2LLNA 3MGTA 2ZOLB 3KM1A 2VDNL 4DUXA 5KYUA 5FUOH 2PP8A 3WHXB 3HLAA 2ADJB 3OX8A 4MZRA 3VH8A 4DGYH 3GHEH 4YNYA 2VN6A 4KJPC 4YDVA 2K6WA 2AK1L 1JP5A 3EYUL 4UIKL 1XZ0B 2AXJA 4AC2A 1UT1A 1URZA 3D51A 5BQ7A 5C09D 3WEXA 2ZAHA 1UGKA 1A6WH 1EZVY 3HE7D 3NIDB 4OCYL 2VERA 1LO4L 1OQXA 3CBRA 1FCCA 3D39D 3F7RA 4JCLA 3H2WA 4JFOA 1EUTA 4YS4A 1TQTA 2C26A 5M95B 3DXAE 3HUJA 1ORSB 3V6OC 5E9DA 3GHBH 3BUYB 4MAUL 2QFPA 4N0UA 2CXGA 3LEVL 2XJLA 4PTTA 1ZXQA 4XCEA 2QEJA 4XN4A 2HXAA 1ZGLA 5LQBH 3HI1A 2DAVA 1WBXB 5TQ0H 5J11C 3QFJD 2DWEB 2V6HA 1QRNA 4W9CC 3REVA 3LIZH 5E9AA 4OZHB 1WRFA 5I30L 4YFLI 1YUHA 1INEL 2YMXH 2ATPA 2NT1A 2WKOF 3W0WB 5IJBC 4O2CB 4PRHA 3K71A 3K2UH 3GSWA 5EG6C 5EC2A 1F4HA 3RU8H 2QADC 2ZE0A 1FH5H 4P59L 3RIFF 3GZQA 4AKQA 1MCWW 2JCCB 2YPVA 4YSPA 2V17L 1J9QA 4P9HH 4BQCA 3UO8B 1FIGH 5CJOH 1CDIA 4AQ1C 1G7IA 2LFGA 5JA8B 4TQHA 1DJHA 3FDWA 4G1EA 2VW4A 5CZXC 4ZJ9A 2X4UA 4WUUA 1TUPA 4IOSD 3GDBA 1BPVA 1Z66A 2AEQL 3NIGF 1KCRL 1BXVA 4NHUB 4RVBA 2AJYH 3GBNL 4XVUC 4NIYE 2YXVA 3QEQD 4YAQA 2IPTL 5ID1B 3VSUA 1E4WH 1ZA6A 4YHOL 1NGQH 3FT4A 2E7HA 1JV2B 2CJTA 3VMOA 5M94B 5B8CC 1A66A 1K4CA 2Q6WB 1WZMA 3QJFB 1JPST 4MAZA 3LPWA 3S4SA 3VXSB 5C0JB 5HHNA 1Q1PA 2Q2LA 1FIGL 2BNRD 5HYQB 3AT0A 3D0LA 5E03A 3RX9A 2WSKA 4KO9A 1IE4A 4UTCA 1PDKB 3U83A 4ALAC 5L0QC 1W0VA 5IJKC 5DHEA 3RU8L 5HD8D 3D7PA 2UXGA 4XHJC 2YEVB 2AGJL 1I75A 1UOLA 2CH8A 4QHKI 1MUJA 3NIDE 5DD6B 4KZEH 3HZKB 4RMVA 1QPPA 3DSNA 3WO3B 5HDQH 5I30H 1QABA 3HBGA 4LSUL 4Y5XC 2X41A 3VTMA 4B9IA 2I60L 4CGTA 3ARDA 3BOVA 3MJ9H 1PKQB 1I4FB 3CFJB 5E0QA 2HP4A 1B0GB 3RGVB 5E6YA 4BCXA 3K2MC 4KROC 3D2UB 3HAEG 1IJ9A 3ZMRA 1DQML 2I85A 3DBSA 5DJYA 1S5HA 3S5ZA 6PCYA 5ICZB 3OR7A 1NDGA 2BWDA 2WIMA 3AGWA 1C5DB 3SDDB 4WCYH 2VDPH 2ESVA 2PTVA 1DSFL 1R6VA 3F7QA 1BZ9A 3BUBA 4PRBB 4BSWB 3VGAC 4NJ9H 1IGJA 2OYKA 3WNNA 4GSUA 5DUPL 1KACB 4OQTA 2RA1A 2F7RA 1A6WL 2Z31A 4OCYH 2LLLA 3DV6B 4AQAA 4PRPB 3EYUH 3BZEA 3MLZL 5IROA 3EXJA 1E9PA 3X3GH 2ZTBA 2IPUG 1TPXB 4MQ7A 3B4NA 1NANH 3F6IA 3LZRA 3BP5A 4M4PA 4GAGL 4HOWA 2EO7A 2DQJL 4MNGA 4YDKH 3PNRB 1NA8A 1CIUA 3RB5A 1HNFA 5CS7A 1CYGA 3VRJB 1WPCA 3LEXA 5EEYA 4UT7L 3WIIL 2DB8A 2PXYB 2GYSA 4Q2ZB 2DWSA 4O02L 2UXVA 1QASA 2HVKA 3TBVB 4Q6YA 1SUJA 4LCWE 1U3YA 4GFXA 4W9JC 2UZPA 3FFCD 4QT5B 4R8WL 2AXGB 1HE7A 1UA3A 3FUKA 2JJUA 4FKEA 4TQIA 2FHCA 4KXDA 3US9A 1PNDA 5JOFB 4L37A 3VX0A 2UWEE 2EIDA 4ABQA 2VSCA 1XGZA 1W72B 1RUMH 5MENE 1XBDA 3WENA 5E8DL 3US0A 4ZODA 5F7UA 1DEEB 1IFRA 2GEEA 2XN9E 1I8IA 2CMRL 4HAFA 4UIMA 3V79C 5IQ7L 4MASA 4XTRC 5T8IA 1OP3K 3MLXL 1JG9A 3DMMB 1L0XA 4WFHD 1BECA 3ZHDA 2RTTA 4GPVA 2OBGA 4CADA 5C9JA 1S9KC 3QWNA 2R8SH 3GSNL 1TNNA 3FT3A 4U6TA 1MNUH 5DA0B 2VSMB 3QG6A 5LBVA 5L2KA 1BEYH 3BCFA 1EH9A 1Z9LA 2DM7A 4K3GA 2WXFA 5HHOB 4HK0B 4Z77A 2OTWB 4XC3L 5KBLA 1QVOB 5H37G 4FQJL 2YO3A 1TR7A 5CMAA 1NFDB 3IF1B 5EEWA 4A2HA 3U4AA 3ECQA 1F90H 2GY7B 1OQOA 1JV2A 3LNDA 1S7UB 1C7SA 3N2JA 1IBGH 5CLTA 2OV0A 4ZQTA 4PJ9C 3SE9L 5JPMB 2NY6B 1ZT7A 4E9WA 2EJ1A 2NZIA 2OQJB 3F84A 1NGYA 1XQ4A 2DOCA 3POHA 4DAGL 4DQOH 4PRHB 3VG9C 3K71B 3G5VA 1I7RA 5GS1A 3PAUA 3FTWA 5CCKH 4FNRA 3F3HA 1M7IA 4J12A 5A6MA 4WSGA 2MNUA 2GEQA 5B39A 3WJJC 2JELL 4XN8A 1FZMB 1XF3B 3F12A 3T8XA 3SYAA 4OCLC 4N0CD 5IHZA 4ODHH 2NTFA 2ODIA 3IFOB 4X8CA 4HLJA 4LRNL 1RIHH 3O41A 4BKTC 2CR0A 3AS2A 3D69B 1ZSHA 1JSYA 4IGBB 1TG8A 3F00A 1E9QA 1WDAA 2I7OA 1MW2A 5IEHB 1JXJA 2AV1A 2JK5A 2J55A 2WP3T 3J2PA 3R18A 3CHQA 1DDTA 4PSPA 4RETB 1IO4C 1QSFB 3L4WA 4HJGA 1E43A 3FRPG 4PP1D 4AENA 3PLYA 4PRAB 1OWWA 3P3UA 1OXYA 4PWGA 5AAWA 1TTRA 4PRDA 4HT1H 5HXMA 1SMDA 2E7BA 3WFHB 3EJZD 1D5IL 4PWFA 3P69A 1K85A 3GSVB 3CFTA 5F0LB 4MMXB 4V33A 4HIJA 4NEHB 1NGPL 3MRJA 4J3OH 1F11A 1UA7A 2RCSL 1CGSH 4FLHA 2BLFA 4QRFA 2WZ6A 3UBXG 3WXVL 4E9SA 5J9PB 5IHLB 2ITFA 2J6EH 4AVHA 3G6DL 5DURB 3AXLA 2L04A 4KMQA 5T5FA 1L0YA 2BNRB 3INOA 3DXAD 1FDLL 5D7JC 4ZUVB 5KYWA 2V33A 2OFQA 3ENEA 3PFQA 1PW3A 2F54E 2D0FA 4ELMF 4JDVA 5BZWB 4PJ5A 2A9NL 1ND0B 2Y5EA 2NSXA 3V10A 4Q0XL 3RA7H 5HDLA 4BKLA 3QA3B 4G9FB 5KBMA 1UM4L 1HEHC 3BP7B 1EPFA 3AAZA 4N1HB 3VWKB 4OZFG 4WTZG 3PHAA 1QNZL 4PBVC 5C0ND 5ESAA 5ACLA 2IH3A 2RQ8A 1I3UA 4G1MA 5T1JA 5DXWA 1JVLA 4HKBB 3PHQB 1ET7A 1T7WA 4B3EA 3ARXA 2H2PC 2X89A 4BV1A 5JHBA 1A1NB 5C6WH 1AGBB 2F1AA 4K2UH 3UZEA 2BDNL 4UTBA 5JXEC 1MREH 2VXQH 1HZHH 1SXAA 5JOFA 3NCJL 4OAWA 2CCWA 4LCUA 3QZWB 1UXMA 4G80A 4U33A 4DP9X 4LVNB 4QTIL 4KMTH 2VZOA 4L2YA 2WXKA 5JIDA 3MODL 5DD3H 1G0DA 4FLQA 3ZGHA 5FF6A 3VFUA 2JH2A 2NSMA 3QIBC 1IQDA 3WELA 2DJ4A 5I18L 1CXEA 1R3HB 1PG7L 3HMXH 5CU9A 5DFVD 4KPHL 5IG7A 1BAWA 4UTBL 1ZJAA 2WB7A 1MG2C 3ELAT 4Y4FB 3CZNA 1LDPL 1IT9H 1KIPB 3EJJX 4LPUA 3U7YL 4DGIH 2QVIA 1NJ9B 4G43B 4BK4A 2YPVL 1F41A 5BRQA 3CH1B 1TVHA 2R39A 4OLVL 3ZDZF 1S7RB 2L7JA 2QLYA 4D0CB 4CMHC 4XCYA 1HXYB 4XOEA 1UCBL 3DYOA 1SN5A 2X0WA 3BZ4A 1S2EA 3HI1B 5J12C 2VLKE 3X3FL 5CMAB 3KPSB 4X5RA 1MI5D 4N2KA 2XTSA 5F72S 2X1OA 4QWWC 2VC2H 1BFSA 2R23A 4G2AA 5HVHB 2RACA 2O61A 1UZ8B 5I5MA 3BKYL 4HHWA 2C9XA 5E8PA 3N0AA 1NCBL 1G5AA 2QSTA 3PE9A 3JQOB 4FTVB 2FWUA 2DDQH 3I3DA 1JVOA 4JS7A 3RAJL 3V4VA 4C4UA 3WS3B 4NS0A 3RUGE 2N0KA 3K2IA 2PCXA 2IG2H 3GSRB 4Z1PA 4RFOH 2L7EA 3NN8A 1G1OA 4JE4B 3GMQB 2V37A 1RZJL 2OMTA 4KUCF 1TZGL 4PD4K 2Z92A 1CLZL 2JV6A 2VYRE 2GBAA 4LVOC 5T1MA 1XF3A 3GTVA 3AITA 3C60D 4RH4A 5C0AD 5A16A 1A9EA 1HSAA 4X6FB 2OKMA 5DEFB 1A02N 1CDGA 4PJEF 4N2OA 1BX2A 4NBZB 1IFGA 3MRIA 4PTUA 2D31A 1A8JH 2X4RB 3FTVA 4MD5B 4W9KC 4EXPX 1AP2B 4IBUA 1A9BA 4K5NA 5CUSH 1S4IA 1U95B 2L7UA 4DO5A 3NCEB 1WFIA 2DQTL 3B5GA 3L3OC 4B27A 2VDNB 4OZHF 4R90L 2W94A 3SKJL 5AB1A 2AJXL 1TEYA 2NY7L 1Q9KB 3ULUC 4FFYH 1NJ9A 4R2GD 2NUTB 3O2VH 4HHAB 4KKAC 2CXKA 3QJFA 2OK0H 1U8KB 4ONGH 1WWWX 1QTSA 2DM2A 5DJXB 5IGXH 3G6JE 3B2VL 4S0TD 4HOZA 3A67L 3R0MA 4PM1A 3IDGB 2EH8L 1LP9F 3PDOA 1RXLA 1U42A 4XPTH 4F7PA 2IBGA 2EVHA 5HHXL 2DJSA 3MJGX 5TE6L 2UV3A 4XX5A 2IWEA 2X28A 4P4KA 4CC0A 1ZJBA 4R4ND 1Y6MR 5DUML 4HA1A 2EIZA 4L3AA 4LL9A 3A6CL 4M62H 3OJDB 3LHAA 1QPXA 4GFTB 1SHMA 3FK3A 1J86A 1KIRB 2R69L 1HYSD 1NEZG 5FYLL 4NPJA 3RBSA 3OPZL 5I1AA 4XVTL 5CN1A 5FKAA 5KW9L 2BP5M 1QG3A 5A2AA 2QPSA 3BN9D 1KIUB 3UO1H 1PD1A 5KYYA 2F5BH 4K9JA 2HX9A 3ERXA 1AACA 5IMMA 3WV0A 1MJ8H 3D3VD 3ATBA 3JWOC 4AJWA 1PJ9A 1ODAA 3PDGA 1N0LB 3RWCB 4LMQE 1YEDB 4BK5A 3DYPA 3FO9B 4FXKB 4I2XA 4OZGF 3UTTE 1UH2A 1T04A 1UWGL 3IRPX 3KPOB 1VF5C 1NGZA 3NBNA 3QIBD 2MCMA 4G8IB 2NXZB 1MEXL 2DIEA 2YEZB 1NDMA 1R3JA 5GRUL 4MLIA 2C9QA 4OFKA 4OGYH 4TSAH 3ZO9A 4FG0A 4QAWA 1IGJB 5AOJA 2YWYA 1UJTA 2H0EA 1ETB1 4KY2A 5FYJU 3O4OB 2YD1A 4MXVE 5FIEA 3CN4A 3KYMA 2XHNA 1UG9A 2DLEA 3Q9PA 4ZUWA 3RDTD 4P5RA 5FW7A 4JGMA 1LP9B 3OKOB 1X6LA 1PZ3A 5C3IA 3FQUB 3TBTB 3VRIA 2ENSA 5F7WC 3LMJH 4Q7DA 2NR6C 4KK5C 4U1KB 2FGWL 3W9EA 5CIPA 3WDIA 5FGSA 1U3ZA 2D2CC 4UMGA 5D1ZC 3SCMC 3HMWL 1NBYB 4Z7UF 1KJ3L 3ILDA 4DSYA 4BK8A 2B2XL 4M02A 4N6QA 3KW8A 5I6KA 1NFAA 3BWUC 3M86A 4F93B 5DD1H 4ZMPA 2OL3H 2R69H 2J88L 1YDPA 2D7TH 5FKPA 3NYKA 4WUUB 5K1JA 2F74A 4Q8BA 5E08L 2Y6TE 2A99A 1UVQA 4QOKA 3HZ3A 5TJWK 4ZMZA 3M7FB 3VJ6B 5IZ7A 4GQ9H 4U6XA 4MB4A 1WTLA 2DLIA 4QF1A 4QRTB 5CLYA 1FFRA 2J3SA 4L4VD 2ADIB 5C0RL 3WTVA 1MRFH 1NFIA 4LSPL 1H8NA 4G8FA 2MOVA 3QAQA 3OKEA 4POYA 3NJMA 4X9FA 4K9EC 3P4MA 5D55A 3GUFA 4TYUA 5SWSB 3IXAB 1M7DB 2YD3A 3L1EA 4FTVD 4UDUA 3UG5A 4JDEA 2CLZB 4IJTA 1ZHBA 4Z8FH 1G7JB 4YXKL 4H1LG 5EF3A 4JBSA 3BX7C 4U3CA 4DP2X 1J87A 4P2QD 2E9BA 1B0RA 3P3RA 1C12B 3AG2B 4C4BA 1GW6A 2GG1A 1A0QL 3REWA 5ISZB 2NPLX 3PL6B 3GMRA 2R59A 1IFHH 3EBIA 1VESA 1SVCP 1XH3A 3VI4B 3KYMB 3FUNA 3TF7C 2QPDB 2FX9L 3MXWH 1MZYA 3CHRA 3N91A 1FVCB 4O2FA 3PWLB 2VZUA 2ZJSL 3D3VB 4F7TA 1OAJA 1MH5A 3ZL4L 3LHPH 3K5RA 5SWZD 3VRIB 4E0RB 3CXDL 4W93A 1FG2B 4CRPA 2N1KA 5E94A 3QUXD 4AOFA 4PP2A 3VFVA 2HMID 4P46B 4ETQA 3UCQA 1KTCA 1BXXA 2EUZA 3GQFA 4RGNB 2ZJSH 1JIBA 1KY6A 4TSBL 1BFOB 4QTHA 3T4AA 4FAAB 1CS6A 1Y18B 2AI0L 2WVSA 2Y1YA 2ZYSA 2A73B 1GS8A 3ISYA 1FJ1B 3NSFA 4HKJA 4YSDA 1CI5A 3CVHH 5IREA 1N5AB 1T1WA 3L5XH 4ELDA 3D12B 1BJ8A 1AS8A 2HA1A 5IMOA 4D0DA 4QJ5B 4N2CA 5B7FA 1AXSA 2BRQA 1A6ZA 5KVEH 2FE0A 1TETH 1ZLWK 4B41A 2X6UA 1O6VA 1QLFA 4U6XB 3EO9H 3FTUA 2IF7A 3B9KC 1NBVL 2V3DA 3JXAA 5TFSL 4B9CA 3SBQA 4Z8FL 1Q0XH 2AAAA 4G3YH 1B9KA 4Q89A 1NFIB 3QC5X 5DO2C 2PYED 1CE1L 2ZUQC 1VGEH 4R7VA 4ZMLA 3MBEA 5D5MA 1DVYA 4XXCA 4E42A 3T6ZA 3MUJA 2A4ZA 2XZAH 5CINH 4DZBA 5IFAH 4XBMA 2Z31D 3BP6A 4AQEB 4FXKC 1MFNA 4LCCB 4M7LT 1U8OB 2V2TB 4TKWA 4YBQD 4P9MH 3ESPA 4GG6A 3RVVD 1H9DA 3NK3A 5KSBA 3UPAA 5GRJH 1RFDL 1IGIL 1O7VA 3P9LB 1ZTXE 1NCGA 4PJGE 2B0SH 2GABA 3LKPB 3RGBA 5FHAH 2X3BA 4B9ZA 1F00I 2WWOA 2CO4A 5E2WH 2QMKA 4PMFA 3RFZB 3V0JA 6CGTA 3EGSA 3BDYH 4X0NA 4YSRA 1KJVA 5EOQL 3UJIL 4WV1C 2OI9B 5IT2H 2YUVA 1EVTC 1CE1H 1WVZA 5DTFA 4DZ8B 4ESKA 2YA1A 5BOZG 1MI5E 2QTVA 1BYNA 3VXTA 2WNWA 5GHWH 1E28B 2OXGA 3CVIL 4RQQB 3RTQD 2YBRA 2VWEC 5GS2D 5KVEL 1R9FA 2N4IA 2LFEA 2YA2A 4LLWB 1J8RA 1GIGH 1JWUA 1RHFA 3ARFC 4DN4H 3MUZ1 3G9VA 3S5YA 5CEZH 5KN5A 1GGBL 5KS9F 1AOHA 4HJSA 3FTXA 4LVNC 1NC4D 3GMPB 3WBDA 1URIA 2RALA 3A4AA 3OKKA 5LWYL 1ML0A 1QUPA 4N85A 1P1VA 4LQFL 4X7FC 4X5WB 3VXSE 1BMGA 3CD4A 2EDQA 1MXDA 4XP5H 4K07A 1CICD 1TTFA 4HAKA 1FNLA 4UANA 1TXKA 2JJTC 3BC9A 3ZT7A 4UQ2A 3LTVA 3X11A 3FQYA 3KWWB 4G82A 1EXHA 4ANWA 3KYKH 5A7EA 2R1YA 4TNEA 2E47A 4N24A 5FYLH 1HH6A 4JFTA 4M4RA 4XPBH 3QH3B 1F6LL 1M71A 2BS71 2XWBB 3FPYA 3MBWA 4LP5A 2P8MB 1KFAH 5FKPB 3LKPA 5GRWA 2E56A 2KDYA 3C8KA 1X5YA 4UV4H 4JFDA 4KC3B 4OCRH 5AW6B 4BUHA 4KRPD 4B9YA 1KJVB 3S3CB 1ZHKA 1SM3H 3LN4A 1P9MC 3VXQB 1F58H 4CJ1A 2O5YH 3R8BB 4A66A 4S0HA 4P4RB 1CLYL 1MUJB 3LRGA 3ZGIA 3DOSA 5JPNC 1WE5A 1DL7L 1XF1A 4HDIA 1DZBA 2IANE 3O9WA 4MAYA 5KEZA 4UV7H 5DS2A 3HE6B 1I8LA 4OM0H 2W0LA 2OX5A 3ZE0F 1T03L 4Q9QH 4L3ED 4M5YH 5LCVH 5C8JA 4B0MM 2GCYB 3WN5B 5IB1B 1TOXA 3SEPA 2DQTH 1WZAA 2WJ5A 1DDHB 2PYFA 5IQLA 3VTTA 4F91B 3KJ4C 3R06A 3TT1L 3VG0H 1QEWB 1GOGA 5AWNH 4JQXA 5C6TH 2G4GA 2XXFA 2PCYA 2WNGA 5IUCA 3FJTA 5EUOB 1BOGB 3GRWL 5JNYA 2C1PB 2MH4A 2QBWA 3GYRA 2H6OA 5D72L 1HSAB 5JMOC 4HSCX 1B0RB 4AH2B 1FFQA 2V7HB 4HH9B 4IIQB 1DJYA 1TMCB 1CXIA 3LS5L 2Y7SA 4LQ1A 5JR1L 4HS6A 1RJZA 3PWPB 4JQIL 5L8LB 2VE6B 2WMPB 3IKKA 5D70H 3GMLA 4E9VA 4TM9A 1ZGLB 4EAEA 4XGZA 1MCLA 2E0PA 2NTSP 2X2JA 1A7QH 4PB9H 5G5DB 3CC5B 3MLTA 1JPGB 2E46A 1V5JA 3ARQA 1XGQA 1QTYT 4ZW6A 1E4JA 2FEEI 2Z93B 1G0XA 1C5CL 1G6VK 2ZUWA 4KXCA 4YH6A 2E8ZA 4A6YB 2XWEA 2XN1A 1BFOA 5JDSA 4OV6F 3ZMNA 4KOBA 1B6UA 4ABUA 1N8OE 3S96B 3U2JA 5D70L 3F7PC 4JM2F 1F1DA 2TAAA 4LEBA 2Z8WC 4L29B 5BUPA 5FFGA 2UXFA 5FC9A 3ILQC 4XRCB 3ULUE 3C6LD 3CFQA 1A47A 4GRLC 4FA6A 4Z5RB 4AEEA 2WQAA 43C9A 2A77L 3ARWA 5TE6H 1UUSA 4WHCA 4EI6B 5TPWL 1ZXKA 1JFHA 1W16A 5LKNA 3FQTA 4OTXH 5DK2A 4AUYA 2DN7A 1T1ZB 3CV5A 3ROOB 1BOGA 5JNYB 2GIMA 1D7FA 5T5NG 3B2VH 2ZP0T 1UXSB 4GW4A 2D3JA 1AGDA 4GIAA 1UGNA 3NH7H 1FFNB 4XP1H 5KSBB 3QFGA 1S7RA 3O8XB 3IU4L 4J3VA 1JXKA 2J1YA 1NKOA 4RAUA 4B7LA 4F2MB 2FB4H 1MDAA 4UM9A 3PWPA 3PNWA 1CQYA 5IQ9A 5T3XD 4M6NH 4AGPA 1UZ8A 2JKNA 2Z1KA 4MMZA 3EBGA 1WITA 2EQDA 2YAHA 3AT9A 3O2WH 3EGXA 1MFCL 4J1UA 4MWFA 3L3JA 5D7KD 3FO2A 5BJTA 1TT6A 1XGQB 3Q5YA 4UT9L 3SPIA 1S7UA 5CJ8A 5LVEA 1YY9C 1LP9A 3OKOA 4G7SB 3QQDA 2ICWA 4XMPL 3KYOA 4N8CL 5CO1A 1ESOA 3JUYA 1NGYB 1HCFX 1HXMB 4MCNA 2OP4L 4FQ1L 1QFWI 5DSCB 7TAAA 3WTSA 1S9YB 2P5EA 2Y2WA 1JYVA 2YA0A 4PJAF 3PV7A 5JOPD 1FLRL 1BF8A 3D8MA 4NO5B 1X5KA 2CUAA 1LK2B 3UAAA 2Z4QA 3ML8A 3DUUA 3S35X 5AVXB 1KBKA 2IALB 1A22B 4KX8A 1AXIB 3K4AA 4PV1C 4LLMB 4OVUA 4X98B 5I16B 4OJCA 4WTZA 2OTUA 4H8WH 1XXDC 3KHOA 4PV9B 1HNGA 1KYOK 1V3MA 3PQYE 1GKOA 3D05A 5H94A 1EJ6A 4I0PD 1DBKL 3BWUF 1FQ9C 4OV5A 1T0NA 1RZJH 2BNRE 2KZKA 2Y7NA 5ADOL 2MOGA 3FRPB 1CBJA 3HFMH 2LU5A 4P2OA 1WCBB 5J6GA 2J25A 2PCPA 1T03H 4XAWL 1SHWA 5KVFH 4Q9QL 5HGDB 4ODUB 4FKHA 1K2DA 1LDPH 5DYOA 5M7QA 1M71B 1E4HA 1Z5LA 4WU5B 5KVGE 3INUH 1ZV5A 4PJFE 1YQVH 4FQCL 1E6OL 3C8KB 5MHSE 4ZXBA 2BVPB 3MV9B 2FYVA 5I6LA 3L7EB 1TQVA 3GM0A 2QQKH 4WW2C 5F9AC 4HJIA 1WK0A 1ZHKB 4GMSH 2EDKA 1AHMA 2VGLM 3X3FH 4D94A 5KBNC 2PXYD 3GSXA 1VKXB 2D9QB 3RUGF 1NCDH 2CO6B 4TN9A 4XOCA 1TTAA 1QR1A 4ZK8A 3FB6B 4V1DA 2IH1A 4TNFA 3QBTB 1KYFA 5ABAA 4ONFL 3VXOB 1S3KH 3GO1H 3K1DA 4ZW7A 4Q58C 4ODTL 3WN5C 2BSSA 1SY6L 4PJ7F 4BGLA 5ICZA 1L6PA 4JM0A 2WW8A 3QUYC 4J27A 2JI1A 4P99A 1N6QH 4JDZB 3BDXA 5GJSL 4HMEA 4BEIA 5F9OH 1FBIH 2BRRL 2ILLA 2VM3A 5EUOA 1DBAH 4QHKJ 4HCRA 2DQHH 1OPGL 4WRLA 4XRCA 2ITDA 1RJYB 2QSQA 1AANA 4PW9A 4PRPA 4HG4K 4QLRA 1MI5A 3AMKA 3VXSD 2UZYA 1XMWA 3VFMA 3VXMB 5JDJA 3ZYOA 4A7UA 1OSZA 1T5WA 5JPNB 3FSWA 2UWEB 3CFBB 5HYSA 2VN3A 5B1AB 3SPVA 2DQDH 2X3AA 1PZCA 1FVEA 2YQ2A 3BLBA 2CM5A 3CVIH 3I6KB 3OKNA 4Q9BA 2MEJB 3G5ZB 4RBPH 4Y1AD 5C3LD 4WUKL 1KEGL 3L13A 4GSDH 4LPVA 3O11B 1GGIL 2OSLA 4JFYA 2WYIA 4AW7A 2PXYA 4Q2ZA 5IMKB 4U3XA 5G55A 3TNMA 3I2CH 3M88A 4P5MB 5KANI 1ETA1 3QCVH 1KN2H 1TZHA 4F27A 3HNVL 2FUQA 4CA4A 4ZNEE 5JW4N 2WYHA 1M9SA 2CCVA 4JFXA 1KLGA 4ZAKC 1WIUA 3OMZA 4JHZA 3FT9A 3GSQB 4L37B 3QJXA 2B0SL 4PI0A 4DZ8A 4EUPB 2DQFB 4N3TA 3RLSA 4HKZA 3TESA 5FUOL 3DYMA 5E1HB 1S9VA 2IWFA 2PO6D 2Z7YA 4I9WD 4M1DL 4HOXA 1A0QH 3MU3A 4AG4H 4IOFD 2IO5A 1FNGA 4IS6A 4AIOA 1IL1B 3VYPA 5EDXA 4I0PA 1NAML 2QT6A 3BVWA 1UEMA 3OJVC 4N25A 4WEMB 3UBXI 4CVXB 4CN1A 3FC8A 2BW4A 3UP6A 3GMQA 1O0VA 4P3CL 2WXHA 1UCTA 4B50A 3BI9X 1CTMA 1ET8A 1R3LA 1CZ8H 2J8OA 4MX7B 1Q0XL 5DJDB 3VQMA 1T2XA 1FVDA 3NPZB 3VWJB 1CD1B 2YAOA 1CICA 2QTEA 3I75A 1FN4B 1YQ2A 1Z9SA 2VTFA 1U4EA 3CH8A 2Z9TA 3GGWA 2OAAA 2I9TB 4N8VA 4A2EA 3BT0A 4O2FB 2CA4A 3GSVA 3QHTC 1A64A 1JN6A 4Y0GA 1FPTH 3Q0HA 3P0GB 1R0AH 2VJ8A 2AI0H 2EYSA 3GMOA 4NUMA 5C0CE 4UQDA 3T65B 2D7TL 5JHLA 5DHDA 4PJAB 4F8PA 1WCQA 4FL4B 2WSPA 4LSUH 4QRPB 3KYNA 2BIHA 2FBJL 2IH3B 1K2DB 4RZCB 4FQXD 3WUZA 4Z3TA 3TBWB 3PHQA 3ZDZB 4B9GA 2W91A 2ZUQB 3UJTH 3AMLA 1BF5A 1HXMA 2YQBA 3QA3A 3TV3H 2C8NA 3MMEA 1FZMA 4NWTH 3RFRA 2YD6A 1GA2A 1IKFL 3IGUA 3VWKA 4YHKH 5I1IL 4L8SC 2EEFA 3NIFE 5CP7B 5B7EA 1Z0NA 3ZE1E 4M8VA 1IM9B 2CO6A 3E8UH 4NSKB 5F7FA 5TK2A 2WLHA 1WUZA 2A2QT 4FABH 1E9QB 1QX1A 3CZSA 2DEWX 1KWGA 4JG1H 5CILL 1BD2B 2HFGH 3LXCA 4XPAL 1ZLVH 1KB9J 3DBXB 1OAQL 4FQPA 5DFVC 3FZUD 3MTRA 1JZ5A 3N9GL 3K2KA 2Q0ZX 4O51B 4R26L 3MRGB 4WWPA 4BRJA 3SGKA 3D6GA 4U6HA 5LNGA 4MXVF 5JQ6H 3QC6X 4G43A 5L6YH 3LQZA 2P47B 1ECZA 3DJ9A 1NFDE 1DANT 5HP5A 4G6FB 2FATH 2QR0A 4OGXL 1IM3D 5E6RB 2DQJH 3UC2A 4JZOA 1LGVA 1HOCA 3MBED 5GIRA 5GGQH 1JN6B 4WY7L 1XIWB 4PJCB 1S3RA 5IMLB 4R5VA 5C08B 3KH4A 1KV7A 4ZXBB 4P46C 3GJFB 2PP9A 4L05A 1KTDA 1YEEL 2BC4B 3C5JB 3ECWA 3IS1X 1JPEA 1NCAH 1P7QB 1OAYH 4XAKE 4EI5B 5ACZA 1QZ1A 1PX3A 1T89C 3EH4B 2VC2B 4PIBA 5IVXA 1C16A 4I77H 5EU6E 1S9WB 3DTXA 2VMDA 3BP4B 5D96B 3W11D 2EDJA 5EIIG 1K3IA 1TZOA 2NZ1A 5EU5B 3ZE0B 5CGYD 1I85C 3V5KB 1N4XH 1EZUA 4GP8B 3B6SA 1U36A 3DETD 1I1AD 3ULVE 4H8UA 4WI6A 1NSNL 3ZW3A 4J8RA 1NMAH 1F45A 2CE6A 4TL5A 3GSUA 1LEIB 3NPSC 4MZIA 3O3EB 2AJ3B 4N2FA 3GKWH 3IBEA 5LBSH 4B5ZA 4YVUA 2Q1EA 2VMJA 2XG5B 4XOAA 4FFWD 4Y9EA 4R90H 3LRSB 1ILUA 3G6JF 4FZ8L 5FGBC 5ES4B 4OGYL 4TSAL 4LVEA 2H0FA 1AD9A 2EC8A 5JLZB 1B0WA 2ARJB 4NUQA 2IXQB 3DX2A 1KJ2B 2GFBA 3MXVL 5DJ2B 5A6IA 3QRGL 5I5RA 1RK1B 1CR9H 3C12A 3W37A 4BFIA 1X5IA 1A4AA 1DSFH 4GB9A 4OZHE 4XMWA 4DKEL 4U4IA 4EN3B 1LO4H 2FIKB 5J5EA 1O7DE 4FQLH 2NW2A 2JWYA 4KJQD 1TLMA 5CEYA 4Y4FC 3MNVA 2D31B 2EUWA 4LSVH 1ZT1A 2EECA 3QQ4B 5DVOA 4KTGA 3FQXB 4CVXA 4L3EA 2E6PA 5DC0A 5LAXA 1BXUA 3ZYJA 5F7YC 3VQ1C 2QGEA 2GAZA 3GNMH 2NXYD 3IU3B 3POCA 4MX7A 5DJDA 5KJRL 1NMBL 3BAEH 4CKVX 1FZOA 5GISL 4XOBA 1JK9A 5HYJA 1AZNA 4P4KB 1DEDA 2NNFA 3FU7A 4JVPA 3UDWA 3A24A 4YHOH 1F86A 2EINB 4X8XA 5DD0L 3N1MC 4YHIA 2ZUXA 3HOGA 3JBG7 4JN1L 2VC2L 4JPKL 2AEIT 1DUZB 4H8VA 1XD1A 1KTLA 5DQJB 3WL9B 4ZNCD 4PRIE 3S97C 5T3ZE 1IU1A 3V7AG 3B37A 1XSIA 3UJJH 5F7DA 2OK0L 1CUOA 3J8F7 3B5TA 4UILH 4IKJA 4YUEH 4UINH 4HS8H 5D2LA 3K6DA 4DK6A 1CDUA 2RB8A 4F20A 2F19L 1N0XL 4HF5H 1KCVL 1MCNA 1N0LA 3MUHL 3RWCA 5IVZB 1CTOA 3EH2A 2M1KA 3LYRA 4APQA 1ZLWH 1U8NB 2NCEA 1GOFA 1DFBH 5KYUB 1JJUA 2A4EA 4G7YH 4ZUUA 5B3SB 1KGIA 4PUBL 2QKIA 4XNAA 1UWXH 1YO4A 2YEZA 1DO5A 4LEOB 2XQBH 4AH2A 1FNEA 3WIHL 1EDQA 3ALPA 1NKGA 3J27A 3AY4C 3RUGA 2DPKA 4APXA 3O6KH 2UXTA 3WJLC 1U93A 1TCRB 1RJZB 1Z7JA 4KMTL 2A6KA 3MYZA 4MJIA 2VH5H 2RFXA 4R97C 1TZGH 2KBGA 4XI5D 2O6DA 3QQ3A 4JPWL 1BVKA 3GS7A 4NI3A 2B3IA 4TVPH 3VFTB 2OW6A 1CF8L 4PJ7A 3VXME 4NNXB 3DV4A 3AW5A 2V9TA 3EJZC 5GRXG 1Q9KA 4KH9A 1JWMB 3ABLB 5F44A 3C8HA 2WUCL 4GQZA 2BOLA 1FCGA 2K70A 3FQNA 3I6SA 4HS3B 4P59H 4DW2H 4QHPA 2XA8L 3HG1B 4UNVA 3T09A 1JK9B 2XICA 1OCZB 3U7WL 3T3MF 3BKYH 1JUFB 3EOTL 2OYLA 1UM6H 1M1XB 2FH8A 1ZEAL 4IJ3B 4JFVA 3WD5H 1KYUA 2JB5H 1K8IB 1MVUB 1IGFL 1K6QH 3SJVE 1GRWA 3SPCA 4WWID 2NY3B 1GH7A 3AADB 5C7XH 2OMBA 1OL0A 4Y1AE 3MRBB 1PVHA 2WWMD 3S34L 4KXBA 2XYBA 4XT1C 4GJTB 4F2FA 4PGBA 1JCKA 1VFAA 2Y06H 1T5XA 4E5XG 4AYSA 3SKMA 2VZ1A 3TGXA 4DGYL 1AZBA 1MAMH 1QUNB 1G7HA 3CZLA 4NGHH 1H5BB 2AJUH 4X6DA 4KPHH 5GGVL 1BG9A 1QLRB 3TEWA 4GMTH 1RSFA 2GW5A 4WW2B 4OF5A 1XR8A 5CLZA 1FAIH 4LLYA 3MLUL 4F9PC 2I07B 3DSFL 3TCTA 2XZCH 3TZVB 1J9RA 2NMSA 4RNRA 5JW5A 4PG2C 3HS0C 3JTSA 1C1EH 4FYTA 4EQ3A 4PTTB 2IV8A 4MD0A 2CNZA 1KIQA 5IFHH 5DJZA 3TJPA 3KLSA 4BZ1L 1MH5B 1BVKB 4NN7C 5HI3C 1RIHL 4B60A 5GS1C 4JHUA 4B9JA 3QRLA 4PJXA 3M46A 3V5DB 1AQKH 4OKVB 3Q8FA 4FX5A 2NQ3A 5IESL 2GC4C 2BC4A 3C5JA 5TDOB 5I24A 3NESA 3M45A 2F8XC 4AUJA 3AREB 1IILE 3V0VA 2Y23A 3GXDA 4YN3A 1KENH 4Z18A 2FR4A 2WM0A 3MV8B 2YPLA 3ME0B 4JREB 3QUKA 1FJ1A 4X2UA 3SKNA 2WINB 4R83A 3U0WL 4NO5A 1MJUH 1I9RH 2BP3A 4JKPH 3FT1A 4XWGH 5ICUA 3SE9H 2BSTA 5D93C 5AZ2L 3T8MA 3CNKA 3OKYA 2XVGA 5KSAA 2ZX8A 4JY4B 5CSBA 4ZI8A 3BAYA 5H8DA 3MA7A 4E41E 2CNYA 4LPXA 5E6IA 5EZPA 4DWHA 3PS6A 4MB3A 5E4AA 3V0WL 3QDJD 2C3HA 5DT1L 3I9GL 2ZOUA 2GHWB 2K7PA 3U6XS 3M1BA 1M2OA 3QNYA 1J8HA 1J0HA 3WE6B 4ADJA 1M3IA 3P0VL 4MCMA 3E2HC 1JAEA 4WO0A 4MCYB 5FUZL 1LNUB 5L8JB 4Q56A 5EV7A 5FGCE 4KRPB 1VB9A 2FQEA 2JCWA 2FIKA 1AH1A 3CDFA 2VDKH 1E6JL 2PCFB 4WJ5A 3QG7L 4EN3D 2PWDA 2QDWA 1JRHI 3O0LA 2V9UA 2DQEL 1BBJA 1A3LL 2DZEA 5DJ6A 1GCYA 1X7QA 2MFNA 3ZDYE 4AXWA 3GUTB 1JL8A 3DVIA 5FO9B 1SBBA 3AQYA 3TM6A 2HTLC 1U8OA 3VACA 1CL7I 4NDMB 4EKXA 2WBJC 4ZOCA 5ID1A 1OV8A 4OZGB 1KELH 4L9DA 4NO0D 5E70A 1EJFA 2VO5A 5K39B 7CGTA 5E5MA 4TQPA 3BPOB 4HJJL 3DARA 3JUZA 3RWHA 1XCTA 3HN8A 3ZDWA 3VW3L 4G8GB 4AIEA 1BG1A 3AB0C 5TF1L 1FUNA 5MEPA 1TITA 4BUGA 1DFXA 2WXLA 4BE6A 5F6IB 3SKNB 1CPUA 4YDIH 3PABB 3E1F1 3FUDA 3GI8H 4MYWB 5GRYA 1U8MA 4F2ME 2Z7UA 4QYOB 3MLWL 1AGFA 3P9WB 2NCMA 3MOBL 4QD2E 3BWSA 4YUEL 1WLHA 1TVDA 1HHKB 2DQIH 2VQ1A 4GO6B 5J6SA 3MLYL 1SMAA 1A6TA 1W2KT 4DT2A 4GKLA 2E6QA 2YK1L 3U0PA 1XXFC 4GI6A 1CFSA 2Y3NA 4HD5A 3RNKA 3CBKB 3UGUA 5MENA 5E6IC 1NAKH 2HH0H 3MRMA 3DV6A 1VEOA 4FG4A 5LGHH 2XQBL 4B9FA 5L2JB 4XB7A 1DJSA 4MS8C 1AG6A 3MRRB 1GZQB 3D25A 1PY0A 3EW3B 2B1HL 3DOHA 1GYWA 2CMRH 3BT2L 4U1LA 3B9VA 3C60A 4QUOA 4BELD 4X4YB 3S8WA 4W68A 2IPKB 4RAVB 3SBPA 1SFDA 2R27A 2IDQA 2BFVL 4GW4B 4AVKA 4EN2A 3QJOA 4LASH 4KBPA 4UILL 4MS6A 2Z6FA 1FHGA 2CJUH 2NSQA 4NUGH 4P4KD 2ZKWA 3RWGB 2VXTL 3QH3A 3QWOA 1E4KC 2IMMA 2F5AL 3QJZA 4HKXA 4UT9H 4BQ8A 1PLAA 2XSKA 4K94H 4AYBA 3HE6A 2VR9A 2YUZA 3EH1A 4KNSA 3A4FA 4PVLA 1LL1A 1V8HA 2EIZB 5JPMA 2ZYRA 1JZ8A 2VMCA 3W11C 4NHCH 4A2DA 4IRSC 5C7ZA 3NIDF 4M1CD 1KNOB 5IBTH 2XPZA 5IFJB 1NGXA 5ISZD 3BPOC 4G7VL 2QZ5A 5HVFB 5D9SB 2ESVE 2YPKB 2AXGA 4R2GB 3II1A 4HBCH 3VH8G 1UKSA 2H3XC 4IBSA 1OGSA 3CMOL 1DBBL 1IGTB 4IRZA 3L9EA 5DJYB 1MDTA 3MV9E 4JO3L 5K9OA 4KRNA 3GI8L 4M6OH 2F18A 2YD2A 4J6IA 2WKGA 4HV8B 4WTQA 4G5AA 3W56A 3SBRA 5IUSA 5JW5B 4DK5A 2GTZA 1YEEH 2OTWA 5MEND 4FLRA 2IADB 2EAEA 3MRRA 4JAMB 4K9EH 1GR7A 1KCSH 4FZ8H 2EDDA 4YZFE 4U1NA 4NWUH 4XMKL 5C07B 3IDJB 4P2OD 1NWPA 4P49A 5DDHB 2IQ9L 4CSPA 3KL0A 3D9AH 3GPSA 2DQUH 5H2BB 2X89D 2VQUA 1F2QA 1S7XB 3BRDA 5BXFA 2W65A 4KUZH 4UI2A 1QI3A 2M2DA 3BAKA 4E5XA 2AJZB 2WP3O 2VJXA 3TS8A 3KG5A 4A6YH 1B0GA 2WHVA 4PS4H 4R7NB 5CGBA 2R4SH 2CDEA 1L9SA 5AW2B 2AW2A 2H1PL 4X9YA 3UABA 3G08A 4BD4A 2CKBL 3FFCA 2H32A 2J4WH 4JREC 5FUZH 2VOTA 3NCYP 4NAJA 1TPXC 3ABGA 5D7SL 2F08A 4HDIB 4JPQA 4G6AC 3SGJC 5I74C 1DBJH 1ZIAA 2EXYD 3AREC 5JR1H 5LNDA 3G3LA 1CLCA 3DJZA