1N19A

Structure of the hsod a4v mutant
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
153
structure length
153
Chain Sequence
ATKVVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHSIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide Dismutase [Cu-Zn]
publication title Insights into Lou Gehrig's disease from the structure and instability of the A4V mutant of human Cu,Zn superoxide dismutase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 38
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2002-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1n19A00
2ZKXA 1IBHA 4A7TA 1SXZA 2NNXA 3MNDA 2WYZA 2JCWA 4BCZA 1U3NA 2GBVA 1JK9A 1SDYA 1TO5A 4A7QA 2AQPA 2XJLA 1F1GA 1FUNA 1DSWA 1P1VA 2VR6A 3F7LA 1SXNA 3S0PA 3GTTA 2VR8A 3H2QA 3QQDB 2Z7UA 2WZ6A 1OZUA 1B4TA 1F18A 1IBBA 2WZ0A 1UXLA 1E9PA 1BA9A 4MCNA 3HW7A 1DO5A 3MKGA 2ZOWA 3HOGA 2GBTA 4A7GA 1KMGA 1PU0A 4A7UA 2C9UA 1F1DA 2WZ5A 2WWNA 2Q2LA 3KH4A 4N3TA 3KM2A 1Q0EA 1Z9NA 1RK7A 1OEZW 4FF9A 2AQRA 1IBDA 3CQPA 1XSOA 2Z7ZA 4BCYA 2AF2A 5CU9A 3F7KA 1L3NA 1OZTG 3RE0A 1SDAB 2LU5A 2E47A 2ZKYA 4A7VA 1COBA 2WKOF 4OH2A 1IBFA 5KBKA 2AQQA 3L9EA 1HL4A 3HFFA 3KH3A 1MFMA 2WWOA 1OAJA 3KBEA 3GTVA 4U4IA 1E9OB 1CB4A 1YAIA 3ECUA 3ECVA 1SPDA 1E9QA 1PZSA 2Z7WA 3CQQA 1SOSA 1JCVA 2E46A 3KBFA 2WYTA 2R27A 1N18A 1XTMA 3PU7A 1PTZA 1E9PB 3GZOA 3CE1A 3K91A 5KBLA 2APSA 3SODB 3GZQA 1CBJA 1HL5A 4N3UA 1JK9B 1IB5A 1EQWA 1Z9PA 1BZOA 2XJKA 1SXAA 1XTLA 2AQTA 2SODB 2WKOA 4L05A 2JLPA 4OJAA 4B3EA 4A7GF 3ECWA 3GZPA 3QQDA 2C9VA 1F1AA 1YSOA 2GBUA 1N19A 1OALA 3GQFA 1ESOA 1B4LA 1SXSA 1SXCA 4MCMA 3T5WA 2AQSA 1S4IA 3LTVA 1QUPA 2AEOA 1AZVA 2V0AA 2ZKWA 1E9OA 1TO4A 3H2PA 1SRDA 3L9YA 1EJ8A 4BD4A 1UXMA 5KBMA 1YAZA 4A7SA 1SXBA 2Z7YA 2AQNA 2C9SA 2K4WA 1E9QB 2VR7A 3KM1A
chains in the Genus database with same CATH superfamily
5DJXB 4FABH 1CVSC 1DUYB 2AVFA 4QRUA 2JJSA 4PRDB 3LQMA 3KJ4C 2HFFB 5A40E 1I7UB 1OE1A 3VRLE 4KKAD 4PBWD 1MCDA 4QXUH 2H0JA 4YZFF 2W0FA 3MRQA 4OZIF 3QO0A 1U2CA 3BKJH 1E8YA 4JFED 2ADFL 2JKNA 2UVFA 3RZCC 4BXSV 1KF9B 2NDFA 3ARDC 1QI4A 4WK2B 4Z7OF 5A6LA 1HWGB 4MRCA 5HPMA 5JHLA 3KYMA 4I18A 3SYOA 1IV8A 3OMZA 5DD3L 5D8JH 5KYYA 1HHHB 4X80H 3ML9A 3MROB 3DIFA 1K5NA 3LNFA 4J6RH 4JKNA 3VTAA 1BF8A 3DUUB 5C9JA 1BEXA 1HQ4A 2RB8A 4YFEA 2GJ6B 1ZVYA 5HHQA 3OAZK 2XV0A 5E5LA 1YEDA 3O6KH 4NQED 1CYXA 1M71A 5F7NC 4CSPA 1G0YR 4Z0XA 4S0HA 5K39A 4XMLL 4F8TA 3KNBB 1AS7A 5IG7B 2XKNB 1T04B 3C08L 5FA3A 1P1ZB 2L4OA 1X5YA 3ARBA 3RE0A 1E2ZA 5DYFA 4W9LC 4LOEA 3UBXG 1DVFB 4NZRH 3KWWA 3IDXL 2AEWA 4HJSA 1K3IA 4E5XB 4LASL 4UT9H 2EP6A 4G6MH 5A2BA 1YQVL 2EO7A 3HIZA 2PW2B 5IQNA 5J6HA 5EU4A 5D2LB 3QI9A 4P3CH 1CF8L 4Z76A 4JQXA 3NCYS 3NA4A 1TZHA 1JRHI 1XTMA 1ZANH 43C9B 1EZLA 5CF3A 2KQNA 4U1SA 2HRPH 3RWHB 3QEUB 4JANB 5LGHH 5DT1L 3KBPA 5BV7H 3LPOA 4M8QA 4K8RD 2BW5A 2PW1A 4MB1A 3FFCB 1GXEA 3FQTB 3SPGA 1SYVB 1EBPA 1S7UA 3HE6D 4JPQA 3RWEA 3LKOB 3MUZ1 5CSZA 4D0BA 5IW1A 1X7QB 1JZ6A 1IQDB 4P5SA 4OCMC 1SJVA 5IQ7H 2CJ3A 3MBXL 3IAGC 1B4LA 1GMIA 1SUJA 1KCKA 3MRCB 3UEZA 2HTLC 4KVPA 2L0DA 2MFNA 5LAXA 1R3JB 3TPUB 3AU1B 3AT8A 25C8H 4XCNA 4ZD3H 2CO6A 1AZVA 3UZVB 3T3MB 3W11C 5I2IB 1C1EH 4XZUA 1KCUH 5EOCJ 5CJXC 4HUXB 1CIUA 2O30A 4KZDL 1DANU 5T1KA 2FIKB 5EZOH 2GBAA 3BISA 5B4MD 1ZA3A 3G6JB 5IVXA 1J88A 1JDAA 2GSGB 3VI3A 3DXAB 5HDBB 3TC9A 4XBGA 4LEOB 1UHVA 1GZQB 4IOSD 5C07D 4TVUA 4FLRA 2VLKE 2P8PB 3LIUA 4LBAA 3RDTC 1B6DA 3CZGA 3IWVA 5D6DC 3GWJA 5LNEA 4KWUA 3W39A 3TXAA 4QDGA 5JPMB 2OYMA 3Q6FB 3OKLB 4FNSA 1QNIA 4O51A 5CUSL 2DN7A 1VPOH 2GG1A 2VIRA 4F27A 3JV6A 2OMUA 5ACLA 1MY5A 1XT5A 4TTDD 1BZ9B 4RFOH 4Q4IA 4ZMTA 5F7DB 4OZGF 4M6OL 2A73B 3UTSD 1X5HA 5F72S 1HFUA 1CICA 3E6FA 2BP8A 3MV7D 4W68A 4S11A 1YEEH 1FV1B 1BD2E 3GSNA 1MHPL 3ULVD 5EBMB 3EDDA 3CSYB 4X98A 3L3GA 2F74A 1HKLL 2ATAA 2A1WH 3FQNB 1IUZA 2ITEA 1YPZA 2ZD0A 1P7QD 5H94B 3C87A 4R9HA 2VDRH 3WLBA 1HWHB 4Z0BH 2EZ0D 5E00A 4GW4A 4C4KO 2VISB 1U8NB 2NY6D 1NOAA 2AKRB 4FQ2L 4DZBB 3D50A 3P73A 2W0PA 1A6PA 5EEZA 2R29H 3WENA 5AW2B 2O5NA 1EJOL 2XU9A 3KH3A 2BP3A 2K6ZA 4FQHB 4OF8A 2CO7A 4ZUTB 3VQLA 3DDFA 2XZCL 5I6LA 2VAAB 3P4NB 4LQFL 4F7EA 1KY7A 5A6MA 4FQQB 4XBEL 3MNWB 2AJ3A 1UA6H 4RGMB 2QQKL 3MLSH 4KI5F 2Z91A 2CRIA 2VMFA 1JUFB 1MW1A 2LHAA 1MWAB 3Q9PA 5GISL 1GYAA 1N0LA 4Z77B 4TNGA 4R0LA 5HYQB 4JPIB 4LE8A 1D6EB 1EAQA 1BBJA 1YC8A 2Z35A 2R4SH 3IM1A 1VHPA 4QO1A 1BGXL 4JFVA 3C6SB 3CVHL 5INCB 4YC2B 5T5NG 4GRMB 3W0WA 1HSAA 4K3JL 1BM3H 1F1AA 1MY7A 3AGWA 3ZBMA 1PIFA 1B3JA 1S7VA 1T21B 1XD1A 3B2XA 1HC1A 5I1CH 1PX4A 1W9XA 3SDYL 4JKPL 3NUKA 4KJYA 4O58L 2YA2A 4L4TA 5F9DC 3AT9A 2MJWA 5ENWA 4YDIH 2F54B 4W81A 1C7SA 4XC3H 4J4PD 3KPPA 2COQA 1UCTA 3LZRA 1EJ8A 4ZUUB 4WAFA 5ABZA 1IM9D 3MNZB 3PQYD 4EPSA 3SN6N 2C9SA 1R24A 5GGVL 3ZL1A 4PW9A 1T0MB 5I1HL 5C0BA 1RUAL 4HA1A 2WYZA 5KEZA 4LT7A 1JK9A 3T0WA 2WLIB 5F6IC 1ICTA 1QSED 3DJRA 1SEQL 3HG1E 1WC7B 5IT2H 3OR6A 4O4YL 5EOTA 1LEIA 3MJ7A 2QFPA 1F5WA 1YUHA 3WTVA 1F3DH 2OL3A 3GI9L 1JI2A 4E2OA 3H0TB 4Y4KA 4XO8A 5BXFA 3Q06A 3ZUCA 1BG9A 1CXFA 4JY6B 1IE5A 2GEQA 3OF6D 4TM9A 4WY7H 3RZCD 4UYQA 2FWLB 5ALBL 1UACH 2G75B 3MJ9A 3O8XB 3WKYA 3E38A 3EBHA 1W8OA 4PVMA 3BSZL 1WG3A 3FHAA 1XCQA 3U1PA 2HWZH 1XIWC 1UH2A 4AGLA 2XYBA 5GIRA 2WNWA 4BXVA 2VDOB 3QR0A 5DTFA 3E8UL 1HI6B 1BXVA 3KM2A 1U3JA 3BQVA 3FL7A 3RGVA 2F1BA 3CCHA 4EVNA 1D5ZB 1TZ8A 1SHXA 4QTIL 4S2SA 5CJQH 2X70A 5AOKA 2JTYA 5B3JE 3O2DA 6PAZA 2P42B 4E9WA 3N42B 5DLMH 1FVDA 4KY1H 5E08L 3VRIB 1OGSA 3B9DA 1KUMA 5I1KH 1LO2L 4ZO9A 1HT6A 1EHNA 3I6KA 4LDOB 3MRMA 1V8HA 1IGFH 4LSQH 3KZ8A 3M88A 1N3NA 1RZJH 4NUJA 1ZHKB 1CD1B 4MHHG 2VLRA 4PIBA 4TS6A 4TVPD 5HGAA 4E9YA 4L9LC 3LCYA 1HQRA 1HIML 1U2HA 3L3IB 3QUYB 4FFYA 1XL6A 1D7CA 2X2IA 4CVXB 1YMHA 2WJ7A 4B95C 5SWQB 4Y9BA 2YS4A 3AT0A 1HEJC 1U36A 3B2VH 3GMOB 2CXKA 5HYJD 3A0OA 4OZFG 1J9SA 2AQTA 1K4CA 5DXWA 1CVRA 3VSQA 1BFVH 2D73A 3TVMA 1LO0H 1PD6A 1RU9H 3QZWA 4RMQA 5AOJA 2NX5E 1T2QL 4LCCC 1AI1L 4P57B 1R5VB 4PS7A 3Q2VA 4F2EA 1A4CA 4H20H 5HGDA 5L2JA 3HS0C 4H5SA 3UERA 4OFIA 4XPFL 3DKHA 1AGCB 2MPVA 2PCPA 2X1QA 3AY4C 2CH8A 2DTSA 2F8XC 2E86A 4R84A 1JIBA 2YC1B 2QGCA 1Z32X 2Z93B 3REVA 4OLWH 4URTB 3FQ1A 4MZIA 2YPKA 2ZKXA 4EDXB 1Q4NX 3BVUA 2WXNA 5I19L 1DQMH 2BSTA 2H1PH 1L7IL 1BECA 4IRSA 3RUGA 1U3NA 2AXGA 3ECBA 1SDYA 1NEZA 4GMSH 1H3TA 4DGUA 5IESH 4G43B 2AJSH 5AEAA 4L37A 4HXAL 5IB2A 1QTYT 4PHXA 3NA9H 4I9XA 1U6AL 3HEIB 4Y4HB 3RDTD 3FB5A 1MJUH 4ODUB 1EHLH 2W5PA 2W88A 4P46B 2WQSA 2ZXQA 1UWGH 1FORH 2XWEA 4QKXB 1A8JH 3CFMA 3BI9X 4JG1L 4YLQT 3NBNA 3FKUS 1NIDA 1B0GA 1VACA 2XXFA 4HS8H 4R5VA 3KCWA 2AV7A 3CAFA 4PGEA 4M7LL 2AXFA 4LB8A 2BP0B 3AW5A 4ZRGA 2FB4H 5I18H 4W9GC 2XVKA 1ZS2A 4OM1H 2WLYA 2ZG1A 5IHBA 1KCVH 4JZOA 4G7RB 2BLFA 5EZPA 3KH4A 2OMZB 3L95B 4PRAB 3PJSB 2ARJA 1ND0A 2EXWD 4JJ5B 3CFJB 4G1EA 3GSRA 2CO4A 3GSVB 4GMTL 4K71C 1MVFA 4J23A 1X9UA 4MKTA 2EIDA 4Y16D 2WQ8A 5E6UB 1AFVH 2OSXA 5JW3L 1SOKA 2I26N 5F7LB 4U1KB 1GYUA 2GAZA 4QR7A 4V2CB 4NO0A 5IY5B 4WWKB 2DMCA 1ZLSH 4H8QA 4N2OA 2H5UA 2UZYA 3L7EB 1A3RH 4MQ7B 4NO5A 3ZQWA 3BPCA 1FHGA 1U8OB 1UFUA 1RERA 2WIMA 4U7KA 4X4ME 1OM3L 4MAYC 2WYTA 3FCGA 4WTZA 3L3HB 4Z7QF 1O9WA 4JHWH 5BZDA 4WO4B 4FXGA 2CLZA 4F1ZA 2OSYA 3KYKL 4PTUB 2SEBA 3GEWB 3SYQA 1JPTL 3IGKA 1UUNA 3WNOA 2EXTA 2CR3A 4UANA 2ENJA 1HEHC 1I31A 3EHBB 2OTWB 3DVGA 4OI9A 1JWSB 2E9BA 5KYXB 4MJ5B 3LKPA 4AWJC 4E9QA 3I50H 3FT4A 3RKDD 2JKIS 2QPSA 1QPPA 2J8UE 3FZUC 2JJUA 1FGNL 2VTFA 2VE6B 1MIEL 2K4AA 4GQPH 4JUTA 4JFDB 1BMZA 1I9RL 4U6VH 1FZMA 4ZX4A 4LGRB 4WGWB 1JYWA 2YAMA 1FIEA 1S7XA 5T3XE 5D2NB 3QR2A 3SQOL 3WS6A 35C8L 4WI0A 1KWKA 1SHMA 1PKOA 5DC4B 1OQXA 3WNLA 2BHUA 1NFIB 3NRPA 4AUJA 4ZUVB 1P9MA 2GIXA 3QFDA 4PGBA 7FABL 3V4VB 1SFDA 1G9EA 3NK3A 1TETH 4HV8A 4ZFGL 2WW8A 5BS0E 4X8JA 3C6EA 5E9DA 2EKSB 3V0JA 4CJ1A 2R9HC 5KSUB 5IJCC 5D5MB 3FRPA 3F7YB 2KS0A 4RETB 1XMEB 5FC9A 4C8XA 1KFAH 3CBRA 3D39B 5JYLA 3BAYA 1NGPH 2WBWB 3OHMB 3HNTH 4PJGE 4PJDE 2X4SA 2V7HB 2PR9A 2Y1AA 1W80A 3UTTB 4QYOB 4H8WC 4BH8B 3K8MA 4LLUB 4B7LA 3HAEH 2G5BA 4MNHA 4BFFA 1DQKA 1OAXL 2EYTB 4AJWA 4Z78B 5JOFA 3C5SA 5PCYA 1OHZA 3VXPA 1E4KC 4TSAH 2LLLA 1BHGA 1BYOA 2XTJD 3WDJA 2QHRL 1IQWH 1M57B 2XHNA 3HPJB 1FVCA 5SWSD 2A0LD 2ZXBA 2WIIA 5IQ7L 2JWYA 4LVHC 1BVLB 2WLLB 2A2QT 3WO4C 5ADOL 4FDWA 3RWCA 4KKPA 3V5KB 3WD5L 1NCHA 4JFHD 4ZD3L 5J56B 3CU1A 4H1LA 3MV9A 1SPDA 1ZRUA 1ZKAA 1T03H 2WLZA 5F7FA 1NDMB 4ZPTB 1OARL 1RFDH 3FN3A 2AITA 1N12A 5HVGB 3UTPD 5D7IB 4MJ2A 1PLGH 2WZPA 3GF8A 3PWPA 1F4WH 1OL0A 2OX5B 2VJ8A 2G3NA 3EJSA 5SWZE 1AGDA 1CFQB 4G6KH 4NUGL 2FLBT 3DYPA 1VA9A 4YXKL 5HYEA 4MD0B 4A55A 2J72A 2XBZA 3UJTL 1OPOA 2V9QA 4EI6A 3UO8B 2JXMB 4JY5L 3LRKA 5EU7E 4UDUA 2QSTA 1QASA 3EOYG 1ACXA 4L3ED 4Y8AA 5F88A 3S35L 3TLRA 2GYSA 4BUHA 4K5OA 5F9JA 4YXLH 3NAAH 5B7MA 5D7LA 4PYHA 2O93L 3DX4A 1AE6L 3U6XA 2WD0A 5D1QC 3UTZA 2E0PA 1U8QB 4LNRA 1M7UA 4AQ8A 3MLTB 1AIFA 1U92B 3F7VB 1LWRA 4JFFD 1SRDA 2EIEA 2MTPA 1DQTA 3CDGA 4H0LC 2ZOKA 3EFDL 4XNMA 3QIBA 5ETUB 5GJTH 1MAJA 1T89C 4Z5RA 1EEUA 1NMCC 3BDBA 2XWTB 1FSKB 1ET5A 2ZCKH 3B6SA 3TTSA 3EYUH 3RAJH 4PLNC 3CDYA 4ERSL 3DNKA 2BSSA 3U6XS 4MX7A 4TNVF 3PP4H 1QHQA 1SBSH 1I8IB 2KKQA 1QTPA 3NJFA 1M3IA 4ETQB 5JW5B 3OWEA 5K5YA 1AHMA 1PG7H 5DJZA 4QRTB 2MQ0A 3WN6A 5ESQB 5ILTL 3E3QE 3NIDB 4D94A 1T2JA 2FEEI 4XP6H 1X5FA 1JNNL 1AGEA 2NT0A 5TE6H 4H88H 3UZQB 3GNML 2JQMA 4ALAH 2D2CC 1N68A 4NZUH 1RIUH 5G5DB 5I8KL 3IBOA 1IRAY 4G2AA 1ZY9A 1P2CB 3L7FB 4PLKC 3CZSA 2FT6A 4B50A 4F8LA 1AD0B 4JY4A 2CWRA 1AC0A 5DJ6B 1RURL 4OQTA 4YX2H 1ZWIA 2OCFD 3QUXB 4R97B 5EUOF 4PBVC 4HOZA 2EVIA 2DW5A 1G7LB 5HGHB 4P2RB 1TTFA 2WXFA 3BKML 1C7TA 2WQWA 2XIDA 3DWTA 3RVVC 2F7RA 4NYLA 4F57H 3GMRB 5CILL 5I1JH 3AWFA 2R0WH 4I8DA 4N2NA 3ZZLA 1AR1C 4YHYB 5KW9L 3QAQA 1A0QH 3V7AE 3OQ3B 4POZD 5DA4A 3ESVF 4HXBL 5HI4C 1KB5B 4W70A 5I1CL 1NIFA 2E76C 4LSSL 4NSKA 2XV3A 5DHVA 1F6FB 1CB4A 2ZCHL 2Z7WA 3LN4B 1NCIA 5E8NB 4KUZH 1CL7L 2H8PB 4MMZB 4QRAA 4N0YH 3HC3L 1CZ8L 2PYFA 2WN2A 1HOCB 4UT6H 4RA0C 2NPLX 2ZSWA 1OAUL 4HPYH 5D70H 1CBJA 2EE9A 1GOFA 1EQWA 3FT3A 3MRDA 3P4MB 5TFSL 2WKOA 2YR3A 4D0CB 1WISA 1BQUA 1RUQH 2RALA 3DBXA 1CC3A 4FG6C 4UTCA 4JQIA 5IEKA 3OKDB 4IOIA 2GJJA 5DZ9A 2BIHA 5KVDH 2YGQA 3SJVD 3VD9A 4WJG3 1INEH 3FRUB 3TS8A 2RQEA 5TDPA 2HG5A 3QDGE 4DPAX 4JDEB 4NPYA 1ROWA 4PS8A 3O4OB 3CFCH 4N87A 1ZLWK 2AZUA 5DMIH 4A68A 2RFXA 1J0JA 5H37A 2CUIA 5FYKE 3TWCH 5FEBA 3R0NA 4HCRH 32C2A 4BQCA 1J11A 2ED9A 4JR9L 4PWEA 5C0JB 3RWIA 5BMFH 2VN3A 5T1DL 1V5JA 4XP1H 3F05A 3TYFB 4MXVF 1XFPA 1UWEL 1OCZB 1BPVA 4HPOH 1MCNA 3AABA 3SEPA 1A1MA 1HXYA 3BGAA 1KLGA 4G7YL 1OGAE 1LNUA 4N0RA 2ATKA 1XR9A 2R56L 3LZFH 2ARJQ 2BNRE 3MMEB 4HJUA 4LLVB 1B0RB 1FG2B 4I3SH 2R9HD 1HH6A 1UADC 1EO8H 2DQUL 2OLDA 4ZOAA 5BO0D 3ZE1E 4HS3A 2XWDA 5CWSB 1Z2KA 3P0VL 4EEEA 2X2HA 3LEYH 3C60D 1MZZA 1KC5H 3CZKA 5FECA 3EYSL 3U4BH 1P5UA 1MFVA 1PCSA 3X1NA 1PPIA 2QKSA 2P5WB 4L23A 5CZXC 2ZYHA 1UWFA 2GBTA 5LDSA 4BFOA 3U9PL 4NRYB 3AREA 3L2MA 4LCWD 4P3WA 1LP9A 3VXOA 1FIGL 3BE1L 2NY4D 2Y7QB 1GGIH 4X6BA 8FABA 5E4EC 2ZOOA 1X4YA 4QRUB 3ATBA 3CWGA 2JVUA 3MACH 4JM2C 1WYJA 4HYTB 4LVOC 1DSFL 4KKRA 4WW2C 1UM5L 1OHQA 4N85A 1CQYA 2W0FB 2RH0A 2EIBA 3AUVA 1JHTA 3ILQC 3SOBL 5KYNA 4Z7NF 2PP9A 4K2UL 4BWUA 3UO1H 3QO0B 2A3TA 5LB1A 1CT8A 1V7ML 3C5XA 3AU0A 1LQSR 3O3AA 3KXFD 1AQMA 3QORC 3S34L 4QRPA 5HPMB 4F7PA 4OV5B 3KYMB 3VXME 4A04A 5KYYB 4WSGA 3O4LD 2FECI 3L4CA 2RQ8A 3PAVA 3CDFA 4HAGA 3VH8A 4CAGA 4E36A 1XH1A 3DIFB 5BRZA 3T0ED 1K5NB 3OC5A 5FDWA 1OO2A 2I07A 2ZXAA 5JDSA 4LEBA 3VVWA 3UTOA 4Z3IA 5C9JB 5DMGC 5FHAL 3GB7A 3MCLL 5DI8A 3RDJA 4TKWA 3KPLA 3ZL4L 5HHQB 1YEDB 4FQXB 4M7ZB 1RIVH 2DKMA 2E7HA 1M71B 4N25A 5LBSL 4Z0XB 4EN3A 4ZFOL 1KTRL 5K39B 4CSZA 4OCXH 1EJFA 4DZ8A 5JW4Q 1A6AA 5FYJH 1CK0H 3QUKA 4KMTH 5DJAB 3MRBB 5GRUH 1USQA 5ACZA 2DQDH 2MNJB 3KWWB 1OT2A 5DFVD 3DA0A 3KG5A 3HVDA 4OLEA 5D1QD 5CCHE 3N3EA 4ANKA 3RPIB 1EHKB 3GGWA 2IOIA 3LN5A 1W0WA 2Q5BA 3S4SA 3QCUL 4QHNA 2Z8RA 2F19H 1M7DB 2PPCA 3PIQB 1ZGLP 1WZ1H 5EU4B 1K8DA 3A47A 1IBHA 1BQSA 4Z76B 1B4RA 3L4UA 5BVJB 4HWBL 1TZHB 1TZOA 2GVYA 4GSQA 4Q9QL 1RL1A 1JJUA 1ZLVK 4U1SB 3SIKA 5JUEH 2DQJH 2PO6C 4XMXA 5E2TL 4XNZC 3SDAC 3X11A 1FUNA 3I9GL 1C8PA 1E4HA 3DOSA 1D6VL 3RWEB 1S7UB 3E2HC 5CSZB 5IW1B 2OYLA 3SCMC 4X6CA 2BCKA 4PJ6A 3P54A 4RESB 3IEAA 4AZUA 1SOXA 3MKKA 1ZT4A 1MSPA 5TDNB 4Q9CA 1N6QH 1AQKL 4XMKH 5LAXB 2PCFA 4BBWA 1LK2A 4XCNB 3IFNL 2CO6B 4N2LA 1A21A 1XD0A 4XZUB 1BAFH 2FJUB 1LLAA 4WQOA 4AMWA 2C9UA 1QFWH 3NJNA 4LEEA 4PLKD 5L4JA 1FQ9C 4F20A 4OCNC 4DIXA 4JO4L 1NM4A 3D34A 3VI3B 5C0EA 1Y1UA 4M1GL 4XBGB 1KEML 4PLJC 4HISA 4FC3E 4KUCF 4M6MH 4NO2A 4KQ0A 2EDOA 3MUHL 5FUOL 1OP3H 3GC3A 4NP4L 4WU7B 4HGWA 1AR1D 1M2OA 2QGBA 4XCCL 4HIXL 2EE3A 4YHML 4GYBA 1A1NB 5HI4D 4MCZA 3ZQ9A 2IANE 4DOHE 1GIGH 3HZVA 2ITFA 4AVJA 2KZKA 4XBMA 3N43B 4PRBA 2OMUB 3ZDYB 1CLYL 3FTGA 4NHUA 3I6GA 3ZYOA 3QUHA 2KYIA 3LY6A 4GRWH 1CICB 3E6FB 4TQHA 2BP8B 3BSHA 1OAZH 3B43A 1KGCD 3IU3A 1CLZH 2GQHA 3L3GB 4X98B 1Y6KR 4U3SA 3GSUA 1BYPA 1YPZB 2AQ1A 3ECWA 1NCTA 4W9EC 4DFHA 1PY4A 4KOCA 3U7YL 1KBWA 3M7FB 1ORSB 1WT5A 5TF1L 2DQTL 4GW4B 4FG6D 1FLRL 1FYTB 3FJTA 3IJSA 4ONGL 1ASPA 2V17L 1WPCA 1UOVA 3KPSA 3VXSE 5C0CD 3P73B 2ZAIA 2CUMA 3LXUX 5D6CB 3CN4A 4AL8C 4K23H 4JQVA 4BD4A 2BNQA 4QF1A 4G1MA 3MLZH 4EBQH 4F7EB 4NO3A 4P2QE 2AJ3B 3N9GL 3N04A 4IU2A 3P0YH 2H4EA 1MCPL 1MCOH 3T6XA 1H3GA 1L9RA 4PJCB 3B3BA 4F5CE 4F8QA 1BBJB 4R4FH 4ZDHA 4UB0L 1KIUA 1AG6A 3HE7A 5AWNH 4L1DA 4MAZA 4YWGL 3CG8A 4M43H 3VWJD 2VC2B 5ESAA 5FK9B 1YUKB 5MP6L 2ZYIA 5KSAC 4IEFA 1DE4A 3RU8H 4B9IA 1ZGLA 1S7VB 4KJPD 2BHZA 3VXUA 3TESA 4L4TB 1YG9A 1EFXD 4WVRA 5IZ7A 3ORJA 3MXWL 5ENWB 4CN4A 4ANVA 5IJDC 1BQRA 3HG3A 2XA8H 5I74B 4UIKL 3FAXA 4B6ZA 4JO2L 1EA9C 3NJIA 4UTBA 3D12B 1PYWA 1F3JA 2FAUA 4BEIA 3VI4F 4J8RB 4JRXD 4YSOA 4Y0GA 3EJYC 4IHBA 4DN4H 1NBVL 4PJHB 5CGTA 5MEOA 5JO5A 4I1NB 1GGBL 2C9AA 5FYKL 4FI7A 3N91A 5C0BB 3RWDA 3AG1B 3ISRA 2WY3B 4FTVA 1CU4L 4ELMF 1QW8A 5EZLA 4JM2D 1J9QA 1AVAA 4GBXA 5EOTB 1LEIB 3VUAA 1YUHB 2OL3B 4BZ2L 4WI4A 3UBXA 3ILQD 1M56B 4WU5A 5BXFB 1KGXA 3CVIH 4NWTL 1KNOA 3WHXA 2QSQA 3Q8BA 3QJRB 3FUNA 5FYKU 1XF2B 3HAEG 3QNYB 5DCCA 3QG7L 2F15A 1EGJH 3JVGC 4BFNA 4XAKD 1QR1A 3L1OL 1EDHA 1QD0A 2ZQKA 4XR8C 4BSWA 2JB6A 3VRLF 4S1QL 1M7XA 5GGSA 1BBDL 5GIRB 3RURA 1DJXA 3OX8A 1TZAA 2B20A 5DMGD 5DTFB 1CYGA 4NZ8A 4TULH 3TNNA 4N28A 3ZR5A 3FB6A 1BEYL 3QQDA 4AEFA 3RGVB 3ZTJH 4TPRL 4EVNB 4S2SB 3EOAB 3ROOA 4ZMWA 3F65A 2X70B 1SXCA 1VFBB 1G7IA 1WWWX 5I6PA 1JZGA 2OJ1A 3D07A 3K0WA 1AACA 1VEMA 4JO5A 4A6YB 5FWRA 3PRZA 1FVDB 1XGQA 4CN1A 4JFEA 2ZUQB 3BLKA 3MRMB 2Z7YA 1Q90A 1JGVL 2ZUSA 1FL5B 1SZNA 2BMKB 5E8PA 1RAMA 2W1NA 5MHSE 4JFZH 1KTKE 4NUJB 2ICES 2DRUA 2VLRB 3MGTA 4IBSA 5HGAB 3HNVL 1EH9A 1IAIH 1HQRB 3TIDB 3F6IA 1E65A 3UACA 1NGYB 1AZZC 1PFOA 1YMHB 2X9WA 5C0RH 2FATL 4X9GA 1PKQE 4WIQA 2ZUTA 5JIIA 4NQEA 2WGNB 4H26B 1E3ZA 5D1XE 4MVBC 4FD0A 2PO6D 4I9WD 5EOQH 3H6JA 1T83A 1TENA 3BN3B 3DROA 4G8IB 1ZVSA 1ZLUK 3VB9A 4ZMLA 4G9DB 5C0IB 3VWKC 3QZWB 1R3LA 4IRJC 4M56A 4UZGA 4UMSA 1W6LA 5CXPA 2H0EA 2Y1VA 5JPNA 4PJAA 5L2JB 3SKJL 4H5SB 2F53E 5FFOA 1E4WH 3CDZA 4WFGD 5KOMC 1KMGA 2YUXA 2VDML 4CL7A 2I7SA 2IMMA 3LOWA 2DJUA 2UYLA 2HJKA 4G72B 2CXGA 4R7XA 4FN0A 4N3TA 1ETJA 4JRLA 4WENB 2EDXA 4P5KB 2OZ4H 4PREA 1B9ZA 4CGTA 3SGDH 2KPNA 2YPKB 3SBQA 1XSOA 2HKFL 1UB5A 4S1DC 4XPTH 4FOMA 1EEYA 3MLVH 4IRSB 3M46A 3RUGB 2AXGB 3ECBB 1J1PH 2HUEA 2JNZA 1NEZB 1LM8V 2NY3C 2DLGA 3QPXH 3KL0A 4L37B 3HE6A 5HHXL 3L9EA 4MSWA 4TSBL 4QTHA 1E7VA 2KBGA 1RUML 3EFOA 4WJKB 4F37K 4NQXA 3QDJD 2WUCH 2ZKHH 2DM4A 1QFPA 2YKKA 3FOMA 3NCFB 2E46A 2ICWI 4Z3FA 4W9DC 3ZHFA 1IT9L 1B0GB 1RCYA 1VACB 4YHZH 2Y6SD 3VD3A 4XVTL 3EGDA 1FI8C 4PGEB 1I8LC 1PTZA 2P28B 4L8CA 3ABMB 3LQAL 2QPUA 3KYAA 4JPSA 4DN3L 2KLTA 1I8KB 3OB0H 4QHMA 1LD9A 2RIKA 1Q9LA 5DVOA 2ARJB 2OMVA 3D9AH 4LOUC 2DI9A 1MCWM 2IAAC 4IOSA 4XNAA 5FKPA 5DJ0A 5C07A 5ANHA 1RP8A 3W82A 2M2DA 1TYEB 4OF5A 1F2XK 4KK9D 4PV1C 4YZWA 2QDVA 2EVFA 2Y4SA 1GW0A 4XE0A 1TJXA 4KMLB 2AS5M 3B2PA 4YN3A 3OMIB 4NO0B 4PCKA 1D5XA 1QFWM 2KMWA 4ZNEA 1P84K 3UTSA 1JE6A 3V4PA 5LG1A 3QEGH 4HK0A 3MV7A 1XEDA 3F5WA 5BZDB 4FXGB 2CLZB 4H0IA 2NTFA 1W72A 5F89B 4OCWL 2SEBB 5J6GB 2LU7A 3HC0A 3PAZA 3AGVA 1DSWA 4LQ1A 2MCPH 4PRIA 4WUUD 2CR0A 3UZEA 1P7QA 3BW9A 1F0LA 4XP9L 1HCVA 4GAGH 4ODVL 4F37F 3L2LA 1U8PB 1NCBH 2OR8A 4OZGB 3TBWA 3UPRA 1HXKA 3DVGB 5F7BA 3MOAL 3LKPB 1QSEE 2BK8A 3FT4B 3C6LD 3MUUA 3T77A 1TQCB 3WEBA 5KSAD 4YAQA 3DIDA 2QGDA 4FXLA 1NWPA 3O6LH 1X4ZA 2WZ0A 2PKDA 4IKIA 3OV6A 2O6EA 2X4QA 4HJJH 2L7QA 4APXA 5EU3A 2VDOH 5H2BA 4J2QA 3FH8A 5EORH 1KCSL 4KHXH 4XOEA 5CEZE 4OB5H 4PP2A 4YIQA 2H3NA 2X44D 4L4JA 1RJLB 1R0AL 3CPUA 5LGYA 3EJYD 5JORA 3T9WA 4YSPA 2A4ZA 2FO8A 5FYJD 1TKWA 1L3NA 4H8PA 3CJJA 4HV8B 4AC2A 4X8JB 2TAAA 2ZKYA 1NC2D 5E9DB 5BO1L 5E2VL 1AO7E 1XF5B 2E6QA 2VDKL 3FTVA 1NCAH 5KS9A 1V54B 3L1GA 5EULV 1PGRB 4U1JB 4FEMA 3H7BA 3A24A 5DK0A 3KPRE 1MPAL 2Z3FA 4FHBD 4MA8H 2X4SB 4J4PA 4A67A 2MEJB 1URIA 3A22A 1IGCH 4DEPB 2KDGA 3MXVH 1M05A 3L3OA 4W93A 5JPMC 3INOA 3GDBA 2WXKA 5FGCB 1IM9A 1KLFA 3FUMA 4MNHB 3WFEH 2N56A 3OAUH 3PQYA 5KAQF 3W38A 1L6PA 2XVBA 3LNGA 3RHWK 1T0OA 3SE3A 2MHAA 3C5SB 1OTUC 1RZ7L 2B14A 3NSJA 3JZYA 4XVJH 2Y36L 4DHLA 4OLZL 2WYIA 3TO4A 3HS9A 5IFAH 3WXVH 2XV6B 4OZFA 3LIZH 1ADQL 2WP3T 2VZOA 2BY2A 3MRFB 1M9SA 2AQ3A 1EANA 3VGAB 2LE9A 4HHAB 4M6NH 3EO1A 2MCAA 3IAQA 2WIIB 3V10A 5ALCH 3VTMA 5HD8D 5GSVA 2R0KH 3TTYA 1BV8A 3RWCB 1MXDA 3OF6A 5CZVL 2RR3A 1G9HA 3RZCA 3MV9B 2VR7A 3EGSA 3O6FD 1NFKA 2ADIA 2NDGA 2DYPB 4J3XA 4UI2A 3U4AA 2PYEE 5CP3H 2KZWA 3VXQB 1X9LA 2OR7A 3PWPB 5B3JF 4XWGH 1ZE3C 1XGYH 2H2PC 2QADD 3MOBL 1CFTA 1UQSA 5KVEH 1NFAA 4JM4L 3AB0B 5HJ3B 1ML0A 2DIJA 4AG4H 2BWDA 5JXEC 4NN5C 3L17A 3D3VE 1Q9OB 4Y2DD 3VSTA 4EI6B 1YMME 3X1BA 4Y4FC 2XX0A 1N26A 2WWMD 3WKMH 4UDUB 4EO5A 2PR4H 3OKEA 5F88B 4QOKE 1JI1A 2VDNL 1WZMA 5D1ZD 3VM7A 1GKOA 5F9JB 5D7LB 3VWKD 1JP5A 2P4AB 2XKUA 2RAMA 5L4FA 1NGWA 1NLDL 3UTZB 1P53A 4LNRB 4YC2C 1XXDC 1CFNA 2APFA 5ISZE 3K7UA 4UQDA 3S97C 1ANUA 1FH5H 4A2LA 2F18A 3CDGB 4G8GB 5DQDL 3RHWF 2ZOKB 3KHOA 3QIBB 1KGJA 5EZIL 1HNGA 1WUZA 2DMHA 4FNLL 1NSNH 3GMLB 4QYAA 4R7DA 4PTTA 3B6SB 4MRBA 4OAWA 4WSKA 5JMOC 2OJZL 4MX7B 1NBCA 2VLME 4S1DD 2K8MA 3WGUB 4C59B 3LN9A 2UY7A 4MZ2A 5HYJA 1OM9A 1MHCA 2WJ5A 4LIQH 2P26A 2NY3D 4NGHL 1HS6A 4Q7DA 5HHPA 2P8LA 3GSXB 4WFHE 1E9OB 2KZ1B 5GS0H 1I85A 3O3BB 2X40A 3CSFA 2F0CA 2MQCA 1PMYA 1QFUL 1HAUA 2B15A 2W8CA 2WQUA 3LXAA 4TQIA 3L08A 4UNIA 4NQUA 1ACZA 5I6OA 5HJGA 1IAIM 2YRZA 3W9DA 5TPWL 3V9FA 4UQ3A 4NHCH 2LU4A 2ZP8A 4R2GB 1BQKA 4JY4B 2AW2A 5ADPH 5GPRA 1FYHB 2H45A 1DQQA 4F58H 4IK7A 5AAWC 6TAAA 5I30H 1PZCA 3EBIA 3UPAA 3O8XC 1RPQA 2R59A 2JJVA 2QGEA 2QEJA 3ABZA 4NYLB 1MHEA 1KEGH 2PF6A 4ZZFA 5J1SC 3X14A 1E27A 4DUXA 5E5UB 3V5DB 2XDHA 4XH2A 5CIPA 2IBGA 3I74A 3NGBB 3BZ5A 5DHVB 3SE4A 1NCUA 3IMTA 4NT6A 4LSPL 2Y22A 1S5HB 3MCYA 4FJZA 1SY6H 4X4YB 2EDEA 3IT8D 3PAUA 2PYFB 3OD3A 1DVFD 4WO0A 5I1GH 4LXFA 1CE1L 1RULH 2X6CA 1H9DA 1WVZA 1IL1B 1DQJA 1U3ZA 3HB3B 3X1FA 2DPKA 2H1XA 3MRDB 2V37A 3W9EA 2BSBA 3QNZA 3LEVH 3DBXB 3NPSB 4EMZA 4YDLB 5IEKB 4IOIB 1VKXA 2YEZA 3FOLA 3LHPH 5G4NA 4F80A 4Y16A 4AC4A 1NH6A 2ZUXA 5TDPB 2HG5B 5TE7H 3PLYA 4CMMA 2HVJB 5IB3B 3SBRA 2CSPA 4DO4A 2RFXB 5I0WA 4YDJB 3QXDA 1DBKL 3ARGD 1T5KA 3DX6A 3SQBA 1NCCL 4AKQA 1PAMA 1MAML 3RWIB 3DPBA 3HPLB 2J25A 1KZQA 4NQCA 2EE2A 3ERXA 4NJ9L 1MJ8H 1MFBH 2OP4H 2X10A 2YLKA 3NZSA 2UXVA 2J8UF 2YKLH 4XCYA 4QRSB 3J27A 3RL1A 4R4BB 3MREB 1A1MB 1HXYB 3E8VA 4YL9A 4GG6E 3VG0H 5K9KB 2ATKB 1XR9B 2FGWH 1IFRA 2EICA 2ZUVA 3HLAA 5F1SA 2F1EA 3O3UN 4PAZA 2FNWA 1IO4C 4FGMA 1YNLH 2J1ZA 3GT6A 1V7NL 2D3VA 4LL1A 4R7NB 4F9PC 5FECB 3NEEA 3L3KA 4Y4HC 2WCPA 1TJGL 2FT7A 4I48A 4JFHE 2WBKA 5EO1A 1FO0H 3GXUB 4P46C 1CD0A 3LB6C 5H8DA 3AREB 4M5YL 5HBBA 3FU3A 4OGAC 1LP9B 2EH8L 3WTYA 2SODB 1QRNB 4PJ5B 3Q8AA 4U1HA 3V4LA 4X6BB 1XEUA 3MJWA 8FABB 4QWWC 4IDJH 3PS6A 2O61A 2FBRA 5CEZL 1S7SA 4PJGF 1FRGH 2H3XC 3WKQA 2GTZA 5CJOH 3HMXH 5IBUB 1BCIA 5DC2A 3TBVB 1E6OH 1E7UA 4WCYL 1JHTB 4UT9A 2APTA 5T3ZE 3CV5A 2OTPA 4L3EE 2ATPB 4QRBA 1X7SA 4UQ2A 4C54A 2G60L 3TV3H 1CT8B 1WBYA 5LG6A 4IBTA 1NOFA 2HRLA 2GKIA 4QRPB 3B8SA 3B9KC 4MA1C 3SDXE 2DIEA 1M2VA 3L5XL 4F7PB 5BOJA 5AVUB 1UTDA 3FO2A 3HI6H 4IDLA 3ILPA 3BCDA 3IFOA 4HT1H 2APWA 1FCGA 4JPVH 5BRZB 1KT2A 2O5YH 4OGXL 3Q1EA 4QXTA 5DVMA 3RVWC 2I07B 4OKVB 5I73B 3KLKA 1R34A 2VITB 4WWKC 5F0JB 3SPJA 3WEXB 1UUSA 4DP2X 5BOPA 5JDSB 3GB7B 3I2CH 5DI8B 3ZTJG 1FNHA 2AEPH 4KVCL 1IJ9A 1F90H 2AK4E 2NY7H 3EAKA 4NRXA 5IREA 3B7YA 1GZHA 3CXFA 5IB1B 1MFEL 5GHWH 3WTSA 4KRNA 4WO4C 4EN3B 3FUEA 2O6PA 1J5HA 2MH4A 3H9SE 2HTKD 4TL4A 2C3HA 1UA3A 1H8NA 4DZ8B 1RZQA 1MRCH 3QUKB 5EWIL 3WBDA 2F58L 4N0CC 1NPNA 4TRPL 4CC0A 5ANMB 5ACZB 1WFUA 1MCEA 3EHBC 4PWIA 1TZIA 3QIWC 5I6XB 3SO3C 1PW3A 3GGWB 4Y19E 1MG3C 2X4RA 3S4SB 2VDLB 4QHNB 4YUEH 3MRRA 1NMAL 4RQQA 4ZTPL 4QXGH 2GB2A 2J20A 2ZJSH 3MUY1 2EAEA 1GW6A 4G7SB 4WFFE 5E8EA 3HR6A 4NQTA 2HT3C 4CADA 1OZTG 5D2NC 3RIFF 2F54D 2LU5A 3K0YA 1EERB 1KB5H 4ATTA 4U6YB 3X11B 2VRQA 3GMNA 3OL2A 4FYRA 1MIMH 1CGTA 3DOSB 2R2CA 4MJIE 4WWID 4AJ0A 4N8CL 3KLLA 3OKYA 4JLRA 3EO9H 3U30B 3FQWA 1YC7A 3CZFA 1EWHA 4K3DH 3S96A 3HHMA 2BVQA 2NR6D 3PWVB 4FFZH 4N1CA 3CH1A 3T2PA 2OBGA 2WNGA 3WMPA 1X7TA 5GGSY 5CKGA 1DR9A 1LK2B 3DX8A 1MJ7H 4JFFA 1NIBA 3ATDA 5HGBA 2Q3XA 5I6NA 5J3HD 3ULUC 2ZOUA 1UXWA 4AKOA 4HLJA 2FWUA 2RCSL 4HKZA 3LXCA 5ICYA 3AY4A 2FHBA 1E8ZA 2LOEA 1DJHA 4RZKA 1QSFB 4AUYA 4NN7B 2BSDA 2WB7A 3IFLL 5E6ZA 4K9JA 2ZXGA 3RA7L 5C0EB 4JHBA 3DI3B 1N0XL 1N64H 2FSDA 2WSKA 3O8XD 1WSST 3RBGA 2PPAA 2XLLA 4PY8I 4OD3H 4XI5C 3KPQA 4LL4A 1QBLH 2ZWYA 4BK5A 2R29A 5IFJB 5AW4B 3I85A 4AMKL 5E0QA 3T8VA 3VQ2C 1Q9WA 2ZPKL 2QVKA 3GJEA 1RSYA 2GC4C 3DSNA 4MCZB 3HZVB 3N55A 4D7PA 4XCFH 1NZRA 4PRBB 5AW0B 1R5WA 2J5LB 4BWTA 4Y5YA 1G1OA 2VR5A 2D4DA 2VJXA 3FTGB 2JF1A 4KDVA 3I6GB 4WHCA 2DLFL 3LZNA 2AERT 4ZPVA 2XWXA 4LHJB 4NLHA 5CINH 1Z6JT 3B9VA 1KDIA 5I1EL 3QEQD 5IVZB 1P7BA 3QH3A 3RWFA 5I1IL 5K9QG 2VMEA 3IU3B 3CBKB 4LKXA 2FX9L 3VD2A 4X5RA 3DPDA 3IDYB 4U3SB 1NAKL 4P23C 3H3PH 1R19A 5E2UH 1JRHH 1G6RL 3BAKA 1A7NH 3H2QA 2G0LA 3JWDL 2E6PA 3QUYD 2D7TL 4OCSL 1L5GB 3BKYL 3IJSB 5IGXH 1NWOA 2IDUA 5L2KE 4PBXA 4XZ4A 1XAKA 4YXHL 2P49B 3KPSB 3MSPA 5AVZB 4CW1B 4NZTH 1L9NA 1LO4H 3GPEA 5CM1A 1H3PH 4Y88A 5DS1A 3VFSB 4OLXL 4O9HL 2M8XA 2OMTB 3BGMA 5F96H 1SYSA 5GGQH 1ET7A 1VFMA 5TK2A 4G1MB 4XPAH 4AK1A 2AXHA 4XVSH 1Q0EA 4X8GA 3EYQD 3TBSA 4HSAC 3JWNH 3VFTB 1NLBL 1Z7JA 3APFA 4G83A 4IU2B 5FM5M 4OI8A 1R1CA 2EDBA 4OTXH 2A9NH 1O0VA 1TVHB 2VDQL 4W6WB 2VH5H 1T7ZA 4HWNA 4YDKL 2GEEA 4E41E 1CGXA 4W9HC 1FSKC 1URLA 3HE7B 4BFEA 4G80B 3GTVA 1TEYA 2B5IB 3SJVA 1KBBA 4YLBA 1DE4B 5C7ZA 1ZHBA 5AB1A 1ITCA 3RI5F 1WRFA 3HC4L 1KCRH 5LUMA 2YARA 3J07A 3NCJL 1AD9B 2P24A 4D8PA 3ARRA 4DP7X 1ZLEA 2ZX7A 2EH7L 3NRQA 3CD4A 1QA9A 1PYWB 5T1MA 3MRPB 2ZAGA 2OKMA 2CR6A 4K7FA 9CGTA 1T0NB 4DKEH 2FJGA 5MEOB 4OGAD 5JO5B 1NMBH 5E94A 5G55A 2YQGA 3D48R 3ZE1F 1TTGA 4XO9A 3T4AA 2GJRA 4GRLD 3LXBA 5F6HI 1MF2H 1GS7A 3A67L 1KJ2B 4PJEE 3MLXL 3QUXC 4R97C 3ZDXE 5EZLB 4GBXB 1SLUA 3RBSA 2X2YA 2VW6A 3KYNA 2HA1A 1XF3A 3OXRA 3UBXB 1ZV5A 4WU5B 4JO3H 2JCCE 1KNOB 1JNLL 2XWZA 2E75C 4LO9A 3I3DA 4YHYC 3C60A 4RSVA 5CZRA 1KB3A 1FAIH 1N70A 2FT8A 3QDME 5D1QE 1CXHA 1YY9D 4BSWB 4LCWA 2EYRA 1T0PB 1CL7I 3RWGB 3M8OL 2ODHA 4EDWL 1JGLH 1F41A 3BAEL 3OX8B 3MLRH 3S7GA 2CGRL 5E95B 2DWEA 1UD8A 3TNNB 4MMZC 3ZDZE 1VZHA 4JZNA 2QQLH 1KJMA 3PAYA 1II4E 3FB6B 3K4AA 2HLFC 3QQDB 3AADB 4E42B 5GS0D 3N41F 2Z4TA 3LKQA 4G9FE 1E6JL 3U2JA 3UC0H 1EAPA 2DDQL 4WO4D 3U46A 2ADJA 4NKMA 4PJBE 2BJMH 4MCNA 3KEDA 4ONOA 5E99L 1S78C 2P5EA 2X89A 5DURB 3N1PC 4JFEB 4LSUL 4N0CD 3D0AA 1NEPA 4NNYA 5CP7A 3KXFA 2WWKO 2A4EA 3BDXA 1M7IB 1L6XA 5HYSB 3I9AA 3LZPA 3O4LA 1H5BA 2YN5A 3PGCA 5MEPB 2G3MA 1P5VB 3MV8B 5T3ZL 4YPGA 1OEZW 4ZUWB 1JYXA 3TEWA 3T0EA 3FCBA 1FNSL 4M00A 3O4OC 5FM5O 1FPTL 4KPHL 4RMWA 4Z7NB 1IGIL 3BEVA 3IE9A 3CSGA 3QQ4A 3NCMA 4JFDD 4N0UA 2VAJA 1XR8A 3QXUA 1CXKA 3VFPB 4NQEB 2DBLL 4ODSL 4B9CA 3MN8A 1WAEA 1DVZA 2KHAA 3WO3B 2HPTA 4KTDH 4PRPE 1ZVSB 2A74B 2OMBA 4X8CA 5I76A 3C5ZA 3KVPA 3VJ6B 4Q6YA 1HKFA 1JPSL 2VXUH 1X5AA 2NNAA 2Z4QB 3BD5A 3BH8B 3O2WL 3QXTA 4GAFB 4OCYL 3IAPA 4YR6A 4HFWA 5B39B 5JPNB 5FX3A 3WN5C 3DDGA 2RD0A 5DWUH 5G4MA 2OQJA 4HWBA 4WUKH 4TUKH 2AAVA 3WSQH 1ACCA 1U4FA 2G3XA 3AJ7A 3OSVA 3R4RA 5DQJA 2A83A 2K78A 3NIFE 4FA8A 1TMCB 5EEYA 4KQ4L 2ALAA 2VM9A 1ETZA 4A7GF 3D39D 2ENQA 4KITB 4KKQA 1FZOA 1BZ7B 1FH2A 1UB5B 1YEFL 1HN1A 3UTTD 1BDYA 5B7FA 1JV2A 5AOIA 1BJ1H 3ZE0E 4ACTA 1T1XA 4MNGB 4PJ7A 4JZJC 5KUKA 5HYIA 1JERA 3HE6B 4NPKA 4MSWB 2AABH 1ZPLA 3EFOB 3BIAX 4KDTC 2JJSC 1UZ6E 3Q2LA 2ALWA 3SGKA 3SOTA 3B2UD 4RNRA 5FWQA 4WI6A 3FOMB 3ROLA 1B6UA 4FCAA 5I8CB 4YFDB 5DUMH 2P8MA 4UAOB 3V4UL 4EF3A 3JYCA 2JFCA 2FJFA 4HWEL 3CFNA 3EGDB 4L8CB 4BDVA 1T5XA 2R0ZL 1DQLH 1K5WA 3M1OA 1BAGA 3II3A 2C1PB 1T4KA 1T20A 4I18C 2BSED 2VC2H 5DVPA 4KJWD 4QHMB 1LD9B 1QSZA 3GDCA 2IH9A 2RJMA 1Q9LB 3FFOA 5DC9B 2K1MA 1G9MH 1TTRA 1IC0A 1U3YA 4G42A 5KYUA 2YMXH 4WK4B 2W9EL 2WO2B 2BNUB 3GS4A 1Z5YD 4WEMB 5CO1A 1JXKA 4O02H 5C07B 5FKPB 2EXSA 5DJ0B 3W3BA 2JSFA 3VX0A 4M93B 1UGNA 1I9JH 2IJ0C 7PAZA 3HFMH 4ELKA 4MDJA 3N2JA 1IE4A 4KH2A 3U2SB 4U6HB 3TA3D 4HF5L 3TONA 5MENE 4OBRA 2O6DA 3MRHB 3QJHB 2BVPA 3BPLB 2EABA 2NNRA 3TU6A 4J2XA 1K6QH 1TPXB 2AVGA 3DTXA 3RY4A 3IVKA 1DDHB 4XCEA 1D5XB 2OM5A 2XG4A 5T5FL 3JT2A 4F2MA 1S7QA 3QNXA 2FX7L 2WVVA 1J0YA 3MV7B 3F5WB 3QZNA 5DZLA 4BFGA 3QAZC 1W72B 3GYRA 5FW6A 4H8VA 1RY7B 1IGTB 1FL3A 3HC0B 4PRHA 3FSVA 4DCQA 3F6JA 3BMVA 4HD5A 4M1CC 1LWHA 4XOAA 4QEGA 2YD7A 4PRIB 4R90L 4JG0H 5AW9B 3L3DA 1P7QB 3BW9B 4JQXC 1P6FA 4NKQB 5KVGH 3UPRB 2Y1ZA 1NCGA 5IM7A 3T77B 5C0CA 4YPJA 1J05B 3GXMA 3GK8L 1ZLUH 1QLFB 1RMFL 1I1RA 5JIQA 3HAEA 3NFSH 1U8MB 1IILE 4APXB 2AEQH 1FE8L 5EU3B 2XKSA 1WEJH 2E4FA 2IPTH 2EINB 5I0YA 4X7TA 5HY9B 5JIKA 1T6VN 4L05A 3MYZA 1ZXKA 4PP2B 5ECGA 1GGCH 3ELAT 3STLA 2EIKB 4ZFFB 3EH1A 3VYNA 3UX9B 5JORB 5AZEH 3RWJA 4A6YH 5C0AD 4NQSA 1TKWB 3RIKA 3U0TB 3JTTA 4YE4L 3FUDA 1OLLA 4HJGA 2R4RL 1TTUA 3VWJA 4NUPA 5DEJA 1WO2A 4H8WL 3T3PB 3QUXD 4LOVA 4HWZB 4Z95L 3RILA 2ZUUA 4CUCA 4P2RD 3O9WB 1F8TH 4YHLH 5DD6A 4U6XA 1EFXA 3H7BB 2FBJH 5DK0B 1WBXA 3LNDA 5LCVH 5CEYA 4BFBD 5TQ2H 1OAKH 1Z9SA 1CFVL 4RBPK 3DSFH 3BLBA 2YSSA 1M05B 5AKVA 3BUPA 3HKZA 4JRXA 1KLFB 2Q2EB 2KQMA 3PQYB 1MFDH 1W8NA 2VR6A 3NCBB 4CGUB 2MHAB 2IO5A 1R3KB 5C1MB 4K15A 3S0PA 2WUBL 5JMRA 1XCWA 4QIRA 3VTTA 3TO4B 1CICC 3MAWA 4OD2A 4OZFB 3VGFA 2HVBA 1DHKA 4N86A 2OSWA 1MQKH 3RB7A 3KLHD 4RMUA 4JM2A 2IH1A 3EO1B 1UCBL 4L4VE 4K7PL 2XV2A 4ODBD 5L9DH 4GKZB 5C09E 2ORBL 4DP0X 3W5MA 1BIIB 3RY6A 3RIAF 3QUML 1NCWH 3MLYH 2VXSH 4Z7VE 3TNMB 3UEQA 3CK0L 2DLIA 1BXUA 4ZYKA 5E7BA 4ELMB 2ADIB 1NBYA 3F00A 1NUGA 2IDQA 3ZRFC 3ZSSA 3EF4A 1Q9KA 4K94H 4XPBH 2Q7AA 1WBZA 2R51A 2WBJD 4HQQL 3US0A 2VQ4A 3LPGA 1UJ3A 4GRWF 4RMVA 3VACA 4PG9A 3VX1A 3K3QA 3KLAA 3GM8A 3T2NH 4CKQA 1C9SA 4QRRE 2CJUH 2DI8A 3DX9B 2LW3A 5MI0B 3TCLA 4FQLL 4ENED 2DQHH 1I1AD 4M9OA 4LDLB 4N0FA 4UNTA 4R0LC 3OKEB 4OLVL 2BOBA 3THML 2OCCB 3DETC 4WI5A 5DR5L 1YEKH 4HC1L 2BY1A 1E40A 4TLKA 1LE5B 3QXVA 1WIUA 4QGTA 3SBPA 3FN0H 1GMEA 4WEBH 5IW6B 1CFNB 4RX4A 1RV6X 2UWEE 4M9PA 2XJKA 3AITA 1BVKB 1PLBA 5LQBL 5GGTH 4CILA 3MA9L 1DCLA 5I0ZA 3R18A 3SDDB 4R7DB 4C83A 3AXLA 4PTTB 5DO8A 4XVOA 5HHVH 3QNFA 3OAZH 2EEDA 4JEGB 5IUCA 5FOBB 2AXWA 2P5WD 3BAJA 3CVDA 4F33A 1DL7H 3MUGB 2PO6A 2UY7B 4CU8A 4ZBJA 4WLCA 1MHCB 3AC0A 2R7EA 3UOAB 1FNGA 5CBAA 4MNQE 1CS6A 2PWEA 3KJ6H 1L0PA 5C8JA 1F3RB 1MCQA 4PP1C 4XO4A 5HHPB 1J5OL 4C56E 5E8DH 4FFYL 3IPFA 3BPNB 1SEBA 4OZHE 3ZMEA 5DJYB 4HOWA 1JZHA 1NAML 2D9QB 4UT6A 1O5PA 2IDTA 2WO3B 4UOW1 2GUOA 5IJKC 2CUAA 2H6UA 4KVNL 3W9DB 3L4TA 2Q86A 4Y4KC 4QXWA 4UQ3B 5ERWA 4B60A 2EVJA 3MU3A 5CU5A 1M53A 1QLEB 3MFGB 3T1WA 3P9MA 1DQQB 2R0LL 5C6PB 3OPZH 5KBNC 2X7LA 2WLNA 5GRXG 1HH9A 5IFHL 4L3CB 2Z6FA 1PD0A 1XSJA 3CDCA 2BO0A 2CO3A 2EO1A 5I8OL 1OP5H 1E9PA 1E27B 1OGTA 2IWFA 4NQDA 1L7TH 4YDNA 4HG4J 4ODHL 1MRFH 1RZFL 1UWXH 1ZS8A 4XH2B 4A7GA 3GSQA 4KXCA 5CIPB 5A2FA 4ODWA 3QDJA 3MYJB 4HCRA 1U33A 3RGVC 4FQXD 4PMEA 4MLSA 1S9VB 4G8FA 1XO8A 3TZVB 3FF8A 2AK1L 2N3JA 4IOFC 5FAAA 3HS8A 4FX5A 4Z7IA 4E0RA 4DO5A 4K3HA 1OANA 3ZMNA 3O0LA 5K9JL 3V0VA 3IDGB 2ZUQC 4JGNA 1ZTXH 4N2GA 4NOFA 1P4LB 4MLIA 3C2AL 3RPBA 4EXPX 5BNXD 1G0XA 4X7SH 5ICUA 5GRJH 1KIRB 2AGJH 3DX7A 1DQJB 3FCSA 1A4KA 2WXMA 4HBCH 3BP4A 2VWEC 4OUUB 3GRWH 1YAIA 3PXHA 5DU7A 1V3JA 1N4XH 2R1WA 1CGVA 3FOLB 3QW9A 1OLZA 3GMPA 3QUGA 2VLKB 4DEUA 5C0ND 3FK3A 4MQXD 4CN6A 5KTEH 4CMMB 3ZMRA 3JWNG 1TCRB 1HINL 3LNEA 3WFDH 5FKAA 1XH0A 2J1KA 3H7LA 4M02A 2WLKA 3AG2B 4OZ4A 2VRKA 2N59A 1IC1A 3OZ9H 3SQBB 2Y06H 4XNYH 4UBDC 3VFGH 1WA0X 2BWIA 4NQCB 3A4DA 5CN3A 4AEEA 1GC1H 3PHOA 4NC0B 3SDCB 5FFLA 3D2TA 3QA3B 4FQ1L 4K9EC 5E56A 3RL1B 1WV7T 1U95B 3WMSA 4WUUA 5F7KC 3TBTB 5CMAA 4NNPL 4UIMA 4A2MA 3MR9A 1UM4H 1OY3B 1A66A 1XGTB 5FFGA 4IRZH 3T1FA 3S36H 2UUDH 3HLAB 1I8AA 4PJFA 3C6LA 5D71L 3EG9B 4IRSC 2K9FB 2B2XH 3S36X 4QHKJ 1BVZA 1I1CA 3DJZA 1IAOA 3DECA 4NM8H 1JGUL 1REIA 3ZK0A 5HHMD 3WFBL 4DP5X 1TO5A 3L3KB 4Z3TA 4D9RE 3C8HA 4CJ0A 5EO1B 4FMVA 2O5ZL 1MCIA 2QKIB 3PF2A 4RVBA 3D30A 2ZYSA 4P2QA 3VDCA 4G5ZL 4IMLA 3OAYH 4Y1AD 4KX7A 4U1HB 1IAKA 4EZLA 2R1XA 1GHFL 3JT0A 5TD4A 1NC2A 2V8MA 2O61B 3LH2L 3HUJE 1CICD 1IBBA 1KELH 5DO2D 1U58A 1DVSA 1N8ZA 4KNSA 2FEDC 3TO2A 1ASQA 3NP3A 2X87A 4GKNB 1HZHH 2BVTA 3INUL 2CHWA 1WBYB 1JK8B 2W9DH 2X12A 2Q8AL 1T7XA 2DH3A 1M2VB 3S98A 1H8LA 4XPGH 3FO2B 1FYTD 1VFUA 2UZIL 1UYWL 3GLEA 3ILPB 3Q48A 4Z7UA 2N7AA 1KT2B 1ZT7A 4QXTB 3UJIL 5BV7B 3FPXA 3LYRA 3R1GL 4HUWB 5EU6E 5IROD 1TIUA 5INDA 2GK2A 2DM3A 1OCOB 1YNTA 1HL4A 2B0SH 4AENA 4KQ3L 1DEEA 2VUYA 4HW6A 4LLYB 3D33A 5AW5B 3ECVA 2FLRT 4FXGC 1AXTH 3FN9A 1BP3B 2XIIA 3PUCA 2NQCA 2QSCL 3D18A 1MVUB 3VW3L 3ARFB 5D72L 3N85L 2BPBA 1OTSD 4XP5L 4KZEL 3F58L 3MRLA 4XT1C 2AMUA 3CZEA 3DETD 4JN2A 2JJTA 4OQTH 3VGGA 2MRYA 4IIQA 1JXGA 1UFGA 2FX8H 3Q2NA 4KK6C 4D0DB 3KCPB 1TQCC 3O6FA 1J1OH 4GKOA 3MLUH 4Z7WA 3MRRB 2JTDA 4ANXA 1WWBX 2ZP9A 2F7QA 3BVNA 4ZT1A 2HPOA 1TJIL 1A7OH 1UZ8A 2I5YH 4RDQG 4IBVA 5F3BB 5EUKA 3WS6C 4OCRL 4BZ1H 3GMMA 5DRZB 2ZKWA 3VD1A 1LDPL 3RLSA 4KMQA 1QACA 3HNSL 3KL3A 3IJYB 4Y2DA 4WNSA 3EOTH 4ONHB 1RVFL 4JLRB 4GSDH 1G1YA 4JBSA 1P9MC 4N90E 3UP1A 4BSJA 1Q72L 2XRAL 1C5BH 3TA4D 3OG4B 1JGEB 3F7QA 5D1ZA 3OB8A 3HRZA 3L13A 4FYQA 3VWKA 4MYWB 2EE0A 4PP1D 2GJ6E 5C0BD 2CA3A 4GFXA 2D3NA 4PG2A 1W8EA 3FFDB 4OIFA 3DX8B 5D7KE 1MRDL 2AQPA 1CR9L 2WTRA 4KI5C 3K1KC 4O5LL 1UT1A 3VFOA 2FWOB 4HKZB 2X38A 5ICYB 3QFGA 5KYWA 3TN0D 3BP5B 2VR8A 2VDRB 4UQIM 4DEPC 5M94B 1Q0YL 4JVUA 3GI8L 4FLSA 2FQEA 2ZCLH 4WF7A 3E6HA 3P1VA 1W0YT 2NYYD 4YHOH 4DGVH 1PCXA 3KPQB 5KVGL 3ZOAA 2OXHB 3HW7A 2BY3A 5H37H 2AMGA 3JWOH 1H15B 5D2LE 1TNNA 4XN2A 3EZJB 3QYCA 3O11A 3GJEB 2OMYB 2WZ5A 2WWNA 1DUYA 1R6VA 2GT9B 4S10A 1YN7B 4N8PA 2XQBL 3WTTA 1JNHA 2NX5B 5DVNA 1I7UA 4OT1H 1R5WB 3OGCA 3FFCE 4QHPA 4FHKA 3IU4L 4ODTH 4ZPVB 1A3QA 4GY4A 4LSDA 5ESVA 2DD8L 4UINL 1N2RA 3I9IA 1MOEA 2FJHA 3QH3B 5AZEL 1A1OB 2XY1A 1P7KA 1GVIA 2NSXA 3HFFA 3H42L 4LKXB 1HHHA 3CXHJ 2BSRA 4XMTA 4ZS6C 3T3ME 3MDJA 1KTJA 1D9KB 3AB0C 5CR1A 3PNWB 5K33A 4QD2E 4RFEB 2VSMB 4F8PA 5EDSA 3DXAE 1A7PL 5HDBE 1FBIL 2X2JA 3K46A 4JPKL 2AFNA 4X5WA 5IG7A 4DGYH 2XKNA 2W38A 3A21A 1XGRA 2GFBA 2FNBA 3BGMB 5LBVA 4DAGL 2CHXA 5LXVA 1A9BA 4LAQH 3JBG7 1S8DA 1OTTD 2G9HB 1L9QA 2HT4C 4ONFH 4AQ8C 1QWNA 1DVFA 2VXVL 3O2VL 1YEJL 4QHLA 3BMWA 5KBPA 3QIBC 3SE9H 3M1CA 1PJWA 4XHQA 1MQKL 5C08A 3MUJA 3QULA 4PB0L 4X9FA 3PDDA 3CZLA 1GJUA 4MMXB 43C9A 3TT1H 1QO3A 1EGJA 1ZHBB 3RWHA 3QEUA 4JANA 2XG5B 1QZNA 1SXZA 3DGCR 4HFUL 2P24B 3MLYL 3BAIA 1TVBB 4HIHA 1KXQA 1OB0A 3CIAA 3ARGA 5FM8A 5ICXA 1QA9B 2R39A 4XAWH 2DWDB 5J7CC 4J3OC 2EXYC 1DN2A 3MRCA 2FJGB 3GTTA 1JHLL 1R3JA 3NH7H 2XWCA 3TPUA 3AU1A 5E94B 4I0PB 2K7QA 4RISL 2OR9L 1AZUA 5KSVA 1JZ3A 3UZVA 4U0RB 3T4AB 5I2IA 2CO2A 1ECYA 1BQLH 1G9NH 1QNZL 4M4RA 1DJSA 2Y07L 5GRZA 3WJLA 1IZJA 2VDLH 2FEDD 3KYNB 4PJIE 3OXRB 1XF3B 2V5YA 3ZYZA 4IBWA 3SE8H 3SPIA 1YY8B 1OIOA 3PWNB 4ZSOA 2J8UB 1ZDQA 4HHWA 1BM7A 3NGBC 3HG4A 2ZSVA 3QFJE 3IB4A 2C4FT 3QB7C 3QZWG 1JZ8A 4LCWB 2EYRB 3AS1A 3Q6FA 4S1RH 1F13A 3OKLA 3G5XB 4LPTA 4NO0D 1HTYA 3GTNA 12E8L 1EZVY 3NIGE 1OAJA 2DWEB 1CI3M 1KJMB 1MCBA 3HBZA 2F54E 4NN6B 1LO3H 1X5KA 4QKTA 3SDXF 5BS0B 2H0FA 1EAPB 5JQ6L 1YA5A 4XC1H 4GUCA 4Y9FA 1ZEAL 4GXFA 5DD1L 2P5EB 1PEWA 3GIZL 5CP7B 4NNYB 3NPSC 4YDLC 5EBGA 4HEPG 1NEZG 2FD6H 1A3LL 5H94A 3V6FB 1GTFA 3DMMA 3O4LB 1JMZA 1H5BB 1TTAA 2C9VA 4YPGB 3UPCA 2J6EL 3T0EB 1WTGT 1PZUB 1O7DC 2CKBH 4N5ED 3QZBA 3RTQD 4D9LH 3BEVB 3QQ4B 4KROB 4OY9A 4U1GB 4ZFOB 2OCJA 1BFOB 4LGSB 1YYLL 3CLFH 4J1UA 4FQHA 4N0UB 4A39A 4AM0Q 1XR8B 5C0FA 5I6KA 4KNUA 4X6EA 3O0RL 2VAAA 1L0QA 2AJVH 3M07A 4FQQA 2XZAL 3D0VA 4ZOBA 2BIOA 4N2IA 2PETA 3OKMA 3Q6GH 4JN1L 5JOPD 3ML8A 2E7LC 5FYLH 2VYRE 3ETSA 3T6ZA 4Z77A 5I76B 5HYQA 1A7QH 1D6EA 1VFOA 3C5ZB 1CLOH 2PMZA 3OJMB 1DBJH 5GJSH 1YJDC 4FFWD 3IMRA 4YR6B 5IF0A 1A4AA 4HFWB 4L1SA 1VFAB 4ZG1A 2AJXH 3JUYA 1IAMA 5EEUA 3NACH 3QCVH 1MNUL 1NPJA 5DQJB 4YFLF 2A83B 4KI5D 1HSBB 2MPAL 1AG0A 1ETZB 3WIHH 1P5UC 2V9UA 3Q9QA 2J4WH 4FZ8L 4PR5A 4HBCL 3V6ZB 5SWZB 3AREC 2BDNL 2F7PA 1OXYA 2IQAB 1T1XB 2A77L 4PJ7B 1KJVA 2HUHA 4ZXBB 4BV1A 1SUHA 1U8IA 4KKLD 3E9TA 1UKSA 3GS0A 4WI7A 2FE0A 1T0MA 4P4RB 1N5YL 3X3FL 2B3IA 2NR6A 1EHXA 3L9RA 3NSYA 1TDQA 1PDKA 4RNRB 7TAAA 1RXLA 2WLIA 1NCDL 4BUGA 3CFQA 1WZAA 5E1GA 2FJFB 1DFBH 1T5XB 4R26H 2Y06L 1SBBA 3GXFA 2JELH 3E1F1 3H0TA 4FQIL 4Y2NA 4JO1L 4HJTA 3RVXD 1MFNA 3OJ2C 4HJ0C 4XNUH 3HI5L 1HILB 4G42B 5KYUB 5B7EA 2WLMA 3FQ2A 3O8XA 2DYPD 2VLJD 2JI3A 2YFNA 2E9JA 3FUHA 1JZDC 3PWPD 5DVKA 1FGVL 3IPBA 3K6FA 4MDJB 1AQHA 4XN1A 3HJEA 3QIUA 1KG0A 3QARA 2BVPB 4GEJA 4MWFA 5HI3D 4EN3C 4ZS7H 2H2SC 1OGPA 3FU7A 5GS3A 1WICA 4AYEC 1HE7A 2LGNA 4Y7OC 3UJJH 3IVKB 1OCRB 4XCEB 2XG4B 2FLMA 4AK2A 5HDQL 2OSLB 4F2MB 1S7QB 3QNXB 3GM0A 4RGOH 5D7LD 4D3CL 3GHEL 2WVVB 1G9NC 4GB9A 1KJ2H 1SXSA 3KYOB 1WCBA 1IIIA 1PS3A 2HT4D 3QEQA 1QSVA 1DYZA 5AKTA 4FS0A 5I6XC 2LVCA 2WVSA 2EDLA 4M5ZH 4PRHB 4UM8B 1MW3A 4DCQB 4G8GD 1E5BA 4KHTL 1ZHKA 1CD1A 4NZFA 4BCXA 4LEXL 3TEXA 5IOPA 3VFWB 4X9BA 3LPFA 3N1FC 3L3IA 3QUYA 5FPIA 2B8OT 4PCSA 5AENA 5DRWB 1NICA 2YWYA 4XP4H 5IM7B 4HMCA 1MCRA 1RZKH 2VXTL 4NEHB 4IGBD 4GI9A 5SWQA 5L88H 1KV3A 2ILLA 1O6TA 2F8VA 4KTGA 1UD3A 3GMOA 3HAEB 2DY2A 4BHUA 2DTML 3NSFA 1H3WM 5C70A 3U0PA 3BFOA 2X3AA 3TBYB 1VCAA 2IMNA 3ZPDA 4X7TB 2X4NA 3TP4A 3KMDA 4PWHA 1S3RA 3RKPA 5GGUA 2CBOA 3LIZA 1DZ0A 1R5VA 3STLB 3QQ3A 2GK0A 5I16A 2ADFH 3LS4L 4Y9CA 3VXRE 1XH3A 3RWJB 4NQSB 4HVBA 5DD3H 3JTTB 5L8KB 1AGCA 1LXMA 3D05A 2VZVA 1DQDL 3FQUA 3OKOA 4R2GD 3UYRL 5CN1A 3BGFB 3I9PA 2YC1A 3I75A 4NN7C 2Z93A 4JAMA 1HVXA 3FT2A 3LV3A 4ADIA 4IBQA 5HJDA 1J8HD 3N40P 4KGLA 1E5ZA 1DVQA 2GITA 2Z9TA 2YN3A 4Z8FL 5DD6B 1NQBA 1KENL 4U6XB 5CP3A 4FNTA 3LHAA 1WBXB 5CEYB 4G43A 4L1TA 4XMLH 5C0DA 1Z9SB 4F9PA 1J1OL 3EUUA 3L4YA 3C08H 2VXQL 5AW6B 4F8NA 2EQDA 4KKBD 1J12A 3L8QA 4PJEF 4Y5XA 2JMRA 2BP5M 3KGRA 3CSBA 4JRXB 4NOBA 1MH5A 4W9IC 4XHJD 3ZDXF 1V27A 5JLZA 5EEXA 2R69L 2UZXA 4WHDA 3IDXH 3DO3A 1SJHA 4LASH 3RP1A 3WTWA 2QLYA 43CAA 4GRLA 3MNVB 2BP0A 1KTLB 4OD2B 1HHGA 1YQVH 1GA2A 2YD6A 4L8SA 4LPUA 3DO4A 5JHDD 1CF8H 2FGZA 2IH1B 3GZOA 3IDYC 3PWUB 4YSEA 4CDHA 2OMZA 2ZNWA 2BNRB 1R33A 1IEBA 1ZSDA 1T2XA 5EBWA 3U9WA 3HB3D 3QUZB 5FUZL 4JFPB 3L6FA 5DT1H 4FNPA 3S37L 1WT5C 5DUPL 3ZE1B 1C5CL 1EXGA 3GSVA 3NCWA 3ZDZF 1BZDA 2J57A 4MXQD 2X4UA 2IV9A 1B4JL 1UJTA 4TNWF 4ZUSA 1MWAL 3SKOA 1JGIA 4U1KA 3MBXH 4JQVC 5SX4I 3ULUE 4PJBF 1U8JA 3N44F 5DLLA 1WBZB 5KANI 1UJ3B 3EJCA 4PG9B 5CCKL 5ID1A 3L7EA 3KLAB 1U8OA 3KW8A 2BINA 3DARA 4U49A 4A38A 2AJYL 3TCLB 4KZDH 3AAZA 1E4JA 2ESVE 3D69A 4N0FB 3ATAA 2M1KA 2N0MA 5FB8B 1CGYA 2BOBB 3I3BA 4A7TA 3MRIB 5JHAA 4PD4K 3HE7C 4B7IA 2B5IC 1CDIA 3TV8A 2ITDA 5A2JH 2MNUA 3N41B 5KYXA 2ETWA 5CNHA 3ZT6A 2YD5A 1NL0L 3BN9C 2IGFL 4C83B 3IJEB 2IDCA 4JFDA 2IH3B 5CUSH 1MDAA 1F18A 4WFED 2F5AL 1MFUA 1A7RL 1E90A 1BFSA 5FHBL 3IJ9A 3FH7A 4M6OH 4F33B 1D3CA 1JD7A 1NBZA 4TUJA 3ARED 1CTMA 2R7EB 1FNGB 3BHBA 2DQCH 4YHIA 5IHZB 2JIXA 1QRND 4LMQE 3OSKA 4PJ5D 4ZUVA 2EEXA 5C8JB 1PG7W 3S8GB 3NIFF 1MHPH 4CVZB 5CD5C 1SY6A 1HKLH 1SEBB 2VDMB 2EKSA 4F2FA 3JV0A 4GBXC 3QHFL 1X6NA 2PTVA 1F00I 1SDAB 5KSUA 4BRJA 5E7FA 5ITBL 1CD9B 4JRYD 3ZE0F 1OB1B 1RSFA 5D5MA 1WAAA 3F7YA 2F6AA 5C2UB 2VM3A 4UNUA 5EO0A 3EXJA 3CZUB 1DTUA 4FQ2H 2VZ3A 3P9MB 3D39A 3WL9B 4X8XA 1QI3A 3EOBA 3GXPA 3SD2A 5DEZA 3FQXA 4Z3HA 3EDEA 4L8DB 1UZ6F 1EJOH 3SE9L 5H37G 2X09A 4IKNA 4ANWA 4BKSC 2NZ9D 2XZCH 3UTTA 1HH9B 5DJDA 4LQFH 1S9XB 1P4IL 3AQDA 4XBEH 5EU5A 1S9YA 2VL4A 3PU7A 5F9OL 3UGEA 2QQKH 5IHUL 1E9PB 4NQDB 1PLCA 4XE5B 2WK2A 2EC9U 2O26U 5L6YL 1ZS8B 1E2WA 2EILB 5IQ9A 3GSQB 3FTZA 2WQRA 1A5FL 4ODWB 4DK6A 4ES9A 3QDJB 4ECNA 1JN6B 2HH0L 4HWUA 4G8FB 2ZX6A 3D87B 4KKAC 4I88A 4EN3D 2EC8A 3HPJA 2J2ZA 1A6ZB 1BGXH 1JPFB 1JWMB 2YK1L 3CVHH 2BVOA 4E0RB 2IALA 3ARYA 3JVFC 4I2XE 4K3JH 3VO0A 3DOIA 3VM5A 4FTDA 1C5DA 4PWGA 5C6TL 1U41A 3SDYH 4JKPH 3NIDE 4O58H 2W65A 3NZHL 5EFIA 3H55A 3FCSB 1QWUA 3VGHA 2A9ML 1Z9LA 4OFVA 5FCUL 4ZPTA 4RCAA 3BP4B 1F4YL 2PXYD 3MBEB 5F3FA 2FQFA 4B5EA 2CHZA 5D7IA 5HYFA 2BFVL 3KPOA 3KLQA 2X4PA 3TA3A 3QPQD 3GMPB 5GGVH 5CCJA 1JNJA 2EJ1A 4B9KC 1BJ1J 5I1HH 1FO0A 1F6AA 4IBZA 4MD0A 1RUAH 3ZW3A 1T83C 4P2RE 2WXJA 4O2FB 4GUQA 3QHZL 2IANB 5IK3A 5EO9B 1SEQH 3IXTB 4DOHB 4AUUA 4O4YH 2CKNA 3KWTA 4IKKA 4OZ4B 3MZTA 2BIMA 3GI9H 1JF6A 3GUTA 3NEXA 3IETA 5JPNC 2YHGA 3WFZA 2WZ6A 3MLTA 3PDOA 4AXWA 1D5BA 1G94A 1JTOA 3HMXA 3SY6A 1B0WA 4WW2F 1BA9A 4ZW6A 5LN8A 5ALBH 5J1TC 3MKGA 4WUUB 4UIMB 3SGJA 4Z3JA 1IMHC 3MR9B 3BSZH 4KNTA 1T80A 3UAEA 1QSFD 4JCLA 1WP6A 1U2YA 2UXFA 4HEME 2XQ0A 4FFVD 2PWFA 3ZKMD 2V7NB 3E8UH 4K8RC 1G4RA 2JI1A 1XAUA 3DIVA 4UF7C 3HE6C 1THAA 4JRWA 4QTIH 2WAHA 2E6JA 3H9HA 3EZ8A 2DKSA 4YFLI 4QRTA 4UILL 2YGOA 2GSMB 4NBYB 4AM0B 5D9SB 3F3HA 4UOW0 5E08H 4P2QB 4UAOC 1V3MA 2RTTA 3BZEA 4IMLB 5C7XL 1LO2H 15C8L 1IAKB 1ACYL 5C0AA 4RLDA 1XDTT 2Z0UA 5G5DA 2R1XB 3BWSA 1OAYL 3BFQG 1HZLA 1MN4A 1P2CA 2XN9D 1HCYA 1MLBA 3QQ9D 3ULSB 1N8ZB 2DBJA 4MS8C 1HIMH 3QUXA 5IHHA 2BXYA 1G7LA 3BRFA 5HGHA 1SXAA 4M3JA 3CFKA 3AMLA 5B8CB 1X9RA 4P9HC 3FSAA 3U36A 5E24E 2OPCA 3WAJA 4YEEA 1Y6MR 4Z7UB 3BPLC 1KB5A 1ZT7B 4N2HA 1TPXC 2F2HA 1JHKL 2YWZA 3NK4A 1B88A 1SOQA 1T2QH 5INDB 3WS3A 1AI1H 1EDQA 2YGPA 4TTDC 3LN4A 5E8NA 4AENB 5HVFB 3VYPA 1DEEB 3DTDA 2HKHL 4XPFH 2H8PA 2QVFB 3NCYP 4LGPB 2VN7A 4FFZA 2A6DB 3P2BA 3ZTNL 3D18B 4Z7VF 5KOVC 2I69A 3ULVC 3V0AC 2WNXA 4JB9L 5BPPA 2G5RA 3MRLB 1P6AB 3UZEC 2YPVL 4MJHA 4J3WA 4OLUL 3P9WB 5I19H 5DMYA 1AYOA 1L7IH 4MCYB 3VFUB 3EH3B 3C5JA 4IIQB 3L5WA 1JAEA 4WGKA 2GI7A 3OKDA 4H0HB 4HXAH 3SO5A 4XXDA 2JELL 4Z7WB 4IW4C 1BOGB 1U6AH 2YXMA 4MA7L 3LKSA 1L4IA 1MI5D 3BVNB 3V4VL 4MQSB 3DV6B 3A6BL 2WBJA 2QADB 1UZ8B 1DLFL 1S2EA 1PZ5A 4GEIA 5EUKB 3BZDA 1KYDA 2NNCA 4JG1H 3VQ1C 2DQIL 1JZ7A 4YVNA 3GMMB 2ZOWA 4M7LH 2X4OA 5C0JA 2VZ1A 2YAPA 4Y2DB 4AVHA 4DT2A 3TASA 1JZ2A 2LFGA 4XNQA 3ULUL 1I1AA 2UWEF 3TYFA 2IVFC 2MTAA 4YBQD 2HAZA 5D1ZB 2KLSA 3HRZB 1Z5LB 3LJ3A 3PUUA 2EDFA 1KSRA 4GRWB 2C9QA 3HZMA 2AHIA 1JZ5A 3SYAA 4GMTH 2MNWA 4GBXD 3OGOE 1AJ7L 2WTRB 3CUPB 2FHFA 4L29A 5AB0A 2YD9A 2BC4A 3VU1A 2W80C 5HHOD 3GD1C 3R06A 5JW3H 1EBAA 4J4PC 5FA4B 2E59A 1IZKA 1JCVA 1WCQA 1FF5A 1EUUA 5TE4L 2WTPA 3A23A 2P5WA 4OZHF 3T65B 1OM3H 4NRYA 5B38B 4G8EA 2OJEA 2WVUA 5D1XB 3SE3C 5DEFB 2LLGA 3WE1A 5KWYC 1E4XL 1MHHA 2Y7QA 4FRWA 4PRPA 1LO5A 3KYKH 3TO4C 5DFTA 1JPTH 3GEFA 1IBGL 4XB8A 4KDTA 1JNHB 4UV4L 1IBYA 4Q89A 3ZLQC 2V9RA 3OGCB 4L9DA 4HKBB 5T1LD 5DURD 5ESVB 5EBLA 1FGNH 1N2RB 2Y72A 2FJHB 2V8LA 1MIEH 3KR3L 4OV5A 1P7KB 3TF7C 4DP1X 1I9RH 3K2UL 4NQVA 3FULA 2BSRB 3MV8D 3SQOH 3ZY7A 5J89A 2APXA 3DHPA 3ABGA 3ZTEA 35C8H 3IMSA 2VOTA 2B4CL 1KGYE 1U21A 2IFFL 4G3YL 3WELA 5JIPA 1N5AA 1YEHL 1WHOA 7FABH 4HIPA 1IM3A 1P0SE 4OV6F 2V5RA 3S2AA 4Q52A 4FQXA 5IVXE 5E4AA 3VI3E 4ZFGH 5MI0C 1QQDA 2GJPA 1X5MA 2IBZY 1UGKA 2EYSA 4X5WB 2DWTA 4WGVB 1JMXA 1XGRB 1Y0LB 2CDGA 2GFBB 2XVLA 1A9BB 4XMZA 4JFXA 1UH4A 1S8DB 2Q6WB 5DJAA 3MRBA 1EEQA 1CXEA 5A7BA 5EV7A 3V0WL 1OF0A 5IMOA 4EIUA 1OP3K 4QHLB 5GS1B 3SGEI 4G70B 3RPIA 2NXZB 4H44C 2R8SL 4YSTA 3NFNB 5C08B 1M7DA 3MHZA 3PIQA 3PPSA 4JDTL 2WVTA 3QULB 4G7VL 2DQEH 3B7UX 3WEAA 5BVJA 1OAXH 2DQFB 4D9QE 3TURA 3DO7A 1JPGA 1QO3B 4LKCB 3C09B 5BVPL 1XSKA 4WRLA 3MCKB 4JREB 3NDYE 2QHRH 4ZW8A 5ACMA 2FEJA 4HIHB 5LWYL 1YPZE 2FQDA 3ARGB 5ICXB 2X6AA 1I85C 4K3GA 3UMNA 3J2PA 3FPYA 3BPNC 2J43A 1K85A 4FXKA 1Y6NR 2LAGB 2GC7C 5TDNA 2O72A 1X5JA 4LOFA 1W2KT 2YPLA 4PJXF 5ADOH 4GT7A 4JFUA 4ZX3A 3WD5H 3IPEA 2LTQB 2DLTA 4KH9A 5KSVB 5HYSG 1IVTA 3BWAA 3L16A 2WXLA 4C47A 2MOQA 4OI7A 2BRQA 1OARH 1K2DA 1L9MA 4M4RB 2F8IA 4LLMA 5MEQA 2QVTA 1XB6A 2PWDA 2FHCA 3C75A 4MS8D 2VDPL 4HH9A 4NUGH 1SNRA 3ZJAA 4YXKH 4ZSOB 4RGND 3PY9A 5F1OB 3UJTH 1JYNA 4DUWA 4JY5H 3K71A 4WU7A 4HUKB 1CLVA 1AQDA 1MEXL 3S35H 5I15L 2ZSVB 3G08B 2I25N 3HUJF 1PLAA 3LKNB 3W0WE 1A1NA 1BFTA 3SE4C 4JS7A 1AE6H 3S35X 2EDYA 1MJJA 2V6HA 4Y1AA 5B39G 3WNIA 4L4TE 4KUCD 4MYPA 2YD3A 4MDIA 2K4WA 4HZLB 1HESA 3EFDH 1YEGL 1JDCA 2OW7A 2DQCL 3V0DA 2MQGA 2EXWC 4YSSA 3K6NA 2IQ9L 4A7QA 4ERSH 1SLWA 4PRID 4LESA 5C0BE 1FN4B 2WAQA 1ORSA 1SXNA 2EUZA 3BWUC