3UTZB

Endogenous-like inhibitory antibodies targeting activated metalloproteinase motifs show therapeutic potential
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
219
structure length
217
Chain Sequence
EVKLVESGGGLVKPGGSLKLSCAASGFAFSTYDMSWIRQTPEKRLEWVATISSGGSYTYYPDSVKGRFTISKDNARNTLYLQMSSLRSGDTALYYCTRFRYDGWYFDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Metalloproteinase, light chain
publication title Antibodies targeting the catalytic zinc complex of activated matrix metalloproteinases show therapeutic potential.
pubmed doi rcsb
source organism Mus musculus
total genus 44
structure length 217
sequence length 219
chains with identical sequence C, F
ec nomenclature
pdb deposition date 2011-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3utzB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3utzB01
3DOSA 3B6SB 5JXAH 1A9EA 1MCJA 2MCPH 2OI9B 4MXQC 4ZNEE 1TNMA 4LCWE 1Q8MA 4HSQA 1ZTXL 1HHHB 4LOUD 1T3FA 2IANB 4P23B 4HMEA 4C56B 3TYGL 3QNXA 2R8SH 3OXSB 3LCYA 5BVPL 2VAAA 5DK2B 5ID1A 2BJML 1QHPA 2C3VB 3AMLA 2R0ZL 5BRZE 3QFJD 1JUFA 4LSUH 2YWYA 3LS5L 1I7UB 4KZDH 3ESUF 1F2XK 5HHQB 3FFCB 3FQRA 1DUYB 1EHAA 4JR9L 3PJSB 5DYOB 3QHZL 4M4RA 3LZFH 4CJ0A 3RRQA 1XR8A 3CH8A 1I75A 4F7EA 4RZCB 5C0CE 5GHWH 5EBMB 1WCBA 2DI7A 5INDB 2OXGA 3WUWA 1H8OA 2H1PL 1BZ7A 3GGWB 2A77H 1MPAL 4AQ1B 1DVFB 2V7HB 1B90A 2I26N 3D25A 2AS5M 2Y6SD 3DXAE 4KJYB 3RAJH 2BOCA 5E94A 1YYML 4ZQKB 5JLZA 1S5IL 4H20L 4J1UA 3QWOB 1R5VA 5T1MB 1S7UB 2YK1L 4LGSB 2CH8A 4PJAB 1G6VK 2NXZD 4PJDB 4Q6IB 1K8DA 3RWGA 5TDPA 5J13C 3MA7A 4JLRB 5B8CC 1I3GH 1EHLH 2ADFH 4N8CH 4WHYG 5DQJA 5HI3D 2DRUA 2O93L 4BQ6A 1CICB 5DUML 1WGOA 5ALCH 4NZJA 3BRDA 2UY6A 4X4YB 1YY8B 4JPKH 4HUKB 1LGVA 5FDYA 4R4FH 2LU4A 1WWAX 1LEIA 1GC1C 4AL8H 1NAMA 4MNQD 2X9WA 1UJ3A 1ZANL 4OLUL 4QF1B 3QI9A 3TZVC 4EXKA 5F97E 3KG5A 1EEZA 1JIBA 3LKQA 4OCRH 5GGRA 1KEMH 5EH1A 1RAMA 3QIUC 5I1JH 1T80A 2WW8A 1AQKH 5C08B 2XI9A 4MXWL 3V0WH 1WQVT 3ULVD 1D5BB 4Y1AB 2P7TB 1AGDB 4Z0XB 2DBJA 4XCEA 1UM6H 4OZIA 1MQKH 1CG9B 2Q8AL 1JF5A 3QXAA 4LF3A 4X6DB 3ULSA 5JA8B 3VWJB 2X4UB 4YGAB 5I8CA 2EDQA 5ANMA 4XVSL 1CIDA 5TJWK 5D70H 5ILTL 1N4XH 2ZUSA 3NZ8B 4G8GD 1TNNA 3OXRB 3OKNA 2AXJA 3V5DA 1U2CA 1RURL 4IRJB 1A4JA 2Z31D 4WGWB 1CGYA 2V2XA 3H2WA 3V7AG 1NAMH 1A7PL 1LEGA 3PGDA 5HHXL 1Q38A 4BZ2H 5ITFB 1H0DA 5HYEA 5SX5K 1N59B 2HMIC 4PFEA 5I66B 1G84A 5KN5A 1LWRA 1UH4A 4M7ZB 4J7RA 5AD0B 3OSKA 2NXZC 5EORL 1I9RH 3VD4A 1E4XH 4P46D 5D7LD 5JIHA 1RU9L 4DEPC 1YEGH 4LQFL 2EKJA 4LVHB 4D8PB 3G6AA 3NZHH 5EBWB 4F3FB 2C3GA 4EN3D 4KPHH 2JB6A 5ALBL 3OKLA 3G9AB 1T7YA 4GW4A 5EN2A 4LSRL 2V5TA 4MLSA 3DX9B 1NLDH 4FFWD 5JORA 1AJ7L 1M7XA 1CE1H 2A6DA 4P2OD 1J11A 3OPZH 1OWWA 3W5MA 3RVXD 3RY6C 1R6VA 3TYFA 5HVWA 1UFUA 3T4AB 1D5MA 2MFNA 1BFOB 2GHWB 3HG1D 5IK3B 3SE3C 3SHSA 2HT3D 5HI4D 1B4JL 3QXUA 1OB1B 1LP9A 3QAZC 2HFTA 1D9KD 1FCGA 5HGBA 3OMZA 1EGJA 3ULVC 1YNTA 2HRPH 5F21B 2WSKA 2HN7B 4LHQB 3X12A 4FFYH 4B0MM 3BX7C 2WINB 3O11A 4EUPG 2X4OB 2R1XA 5ICXB 5T33L 4DCQA 1EJOL 5HVHC 1CD8A 2AK4B 1A7QH 2OK0L 4PGZA 4PJ5E 1A6VH 3O45A 2QSCL 1VGEL 3MACH 1Z3GH 2A73A 2FSEA 1PLGL 2X4SB 4BH8A 4PLKD 5ESQA 2YA1A 2V5RA 4ZOEA 2KDGA 1MEXL 2OJEA 2NY4B 3IKCA 4FFVD 2YXFA 4L9LA 1RZGB 1AHWC 1T89C 3KPSB 2HLFD 1A6ZA 1CWVA 2F58H 5DFVC 3ES6B 1E28A 4J23A 4HC1A 3P9LA 3BUYA 4L4TD 2W0LA 3ZE2E 5EU4B 3WFDH 1NGPL 4JM2C 4PJHA 1WFUA 2YPLE 5JMOC 4PGEB 4JHAL 4R96B 4JDTH 1EGJH 1IEBA 2AEPH 1QFUH 3IFOB 4JY6A 4XNZB 4JFXA 2BRQA 4XWOD 2F8OA 5DGQA 3HNVH 5SWZB 4RX4D 2Q76A 3VFWB 1LVEA 2DKSA 5H37G 3BIBX 2XNAB 4GAGH 3TBVA 3QJFA 4BFIA 4GW1B 3CMGA 4PJ7A 2IH1B 4ISVB 4AENA 3C2AH 4PREA 4KVCH 1G7QA 1T5WA 5B39B 1M6OB 2A74A 2F53A 4S1RH 3ZE2F 1DQLH 4H8WC 1DTUA 3C09B 4Z7UB 4KHTH 3GI9H 2VTFA 4HC1H 5JIIA 4NP4L 2CIKB 3TPUA 1NGYA 4NBZB 4EUPB 3ARVA 5D7JC 2HJLB 5KZCD 3Q3GB 1WBZB 3L3HA 4U0QB 2VISA 4CN6A 2XFXA 3QRFM 2ED7A 1XH3B 4QRQA 3TM6A 5SWSD 3FONA 2XZCL 4FQ2L 3HE7B 2FIRT 7FABL 1DEDA 5L8JB 5EZOH 3QYCA 2YD9A 2IGFH 2XICA 5E2VL 1PKOA 3QDGA 1A0QH 4HIJA 3S37H 5DT1L 5JDSB 4AG4H 5EU7E 5GGRY 4YK4B 1DQJB 2P47B 2NY5C 4M1CD 3ZHLA 3IU3B 2AVGA 1X4YA 2GJ6A 3GI8L 3JWDH 3ZDZE 2BSTA 4O5LH 1KB5A 2OJZL 3V8OA 4XHJC 5FDWA 2R1WB 2VN7A 1GSMA 3BZ4A 5LVEA 5F7LB 1RULH 4Y16C 2QR0A 1QA9A 5C0IA 3CMOL 1T4KA 4NJ9H 1T21A 3CZFA 4M7LL 1RPQA 1TITA 1U92A 4NQEE 2P8MB 3UMTA 2AW2A 3HR5A 4UDUA 4HF5L 2GTZB 4QLRA 1ZE3C 2Z91A 4JM4L 1BQHG 1YMME 4JRXA 3MR9B 3OX8A 3OB0K 3QG6A 3MGTB 4RGNC 5ADPH 1AO7A 1FNGB 2F54B 2VZSA 1YJDL 3NVQA 3OHXA 2GIYA 3L5JA 3NN8A 4WI6A 5BV7C 2EE2A 3ZDZF 5I6XC 4HKXA 4HWBL 1XGPB 3EO0A 1FNAA 2YSSA 3AB0C 4NQVA 3AS2A 5F7HA 5GGUA 4FQLH 3DX7B 4R7NB 1KB5H 4X4XB 3GBLA 3GBMH 1C7TA 2W9DL 5DD3H 5DA0B 3TNNA 1W0VB 2BDNL 2I27N 4NM4L 1RZJC 5AUMB 3U1SL 3QZWA 4BSWB 2X4RA 1G0XA 1IC7L 4P2RB 5ENWA 3WS6A 4MMXC 4G6FD 1RVFH 5ESAB 2J8OA 3OL2A 5DZLA 3I6KB 1R3LB 3ZE1E 4PRID 4PRAB 3E2HB 5I1CL 4KVNL 3EFFB 1WUNT 3HPLA 3G6JA 4C83A 4LCIH 1M1SA 1VHPA 1OQOA 3KPOA 4MQ7B 1U8HB 3L3IB 4WVRA 1FNLA 2VC2L 1U8OA 4OZGE 1RI8A 4PRPD 3KPNA 3UTTE 4QXUH 1CLOH 3OKOA 4X6CA 4ELMB 5HYSG 5CD5C 3LD8B 4M6OL 3NH7L 4NHCL 4EI5A 5CHNA 1FZJA 3I02B 1WBXA 1K6QH 1JTPA 3VXME 5HDOA 1LNUB 4PG9A 2WBWB 4QTIH 1U58B 3NAAH 3MBEB 1DEEA 5DQ9A 1HNGA 3SKNB 2FO4B 1GZQA 3ZE1F 4RIRB 3FO2A 4KI5E 2W65A 5KS9E 1XFPA 1DL7L 3IDIB 1KLGB 2QKIB 3PHOB 3ZDYE 5E70A 5I74B 4MCZA 1ES0A 4QRPA 5I1AB 1TTGA 5F6HJ 5IB2A 1XCTA 4OZGF 4X6FB 5I19L 5F3BB 1HKLH 3QXDB 3VXOB 1K85A 1MFDL 5MEOB 2F15A 1RJLB 3KNBB 5HD8D 4MJ6A 4Z95H 4K7PY 1KCUH 2W1NA 3NPZB 1VFBA 2VR5A 1F4XL 1CD1A 4QHLB 1T20B 3BKMH 3ZT7A 3LKRA 4JN1L 1P6AB 5CLTA 4I9WD 4XCYA 4WFEE 2CR3A 2AJXL 3HI5H 3OKEA 2Q7YB 4KI5F 3BP6B 5KS9F 1A9BB 3EYSH 1J7VR 3ZDYF 3L3OA 3VW3L 4G5ZL 4RWHA 3O3EA 1IGCH 4YDVA 3KHQA 4PR5A 3ARBA 4M9OA 3DX8A 5JNYB 1X4ZA 2ICWI 1I9IH 3GSOB 3WXWH 1HOCA 4QY8B 4OGAC 1KJ2L 5IW3A 5BJTA 2DLHA 3ARXA 5DRWA 1MVFA 5LXGH 1Z9OA 1KULA 3LHPH 1ZLUK 3VWKB 2XQBH 1EEYA 4OBSA 4IHOA 4WUKL 3S35L 1PEZA 3VXUB 2DWDA 3VXNB 1J1OL 5JPMA 5J1TC 1MHCA 1I8IB 2Q3ZA 5E1AB 5T1LB 3L3JB 4KRPD 4HUXB 5JOFB 4HV8B 5I73B 2VN4A 1GHFH 3KPRB 2AJZA 3ZO0A 3EOBB 5K9QI 1CXIA 3GM8A 1KGCD 3SDCB 5CSBA 4GG6E 1XIWB 2YS4A 1EH9A 1Q94B 1X3DA 3VFGH 3MLRL 2OR8A 4NZTL 1GGUA 3T09A 3EYUH 1UJ3C 3JV6B 4JGJA 1FFQA 4XC1L 4P4KA 4QYOA 3QI9C 3RIAK 4NKIL 1YPZA 3QIWA 1NFKA 2P5WB 4EQ2A 1RIHL 5B4MD 4WI2A 2X4PB 4WJ5A 3CFBA 5HPMB 5TPWH 1UB6A 2PETA 4ZUVA 1P7KA 2G2RA 5J4MA 3MLSL 3GSXA 3EHBC 5HHME 5FO8A 1J5OH 4WU7B 1VFAB 4G3YH 4KDTA 1KNOA 5HY9B 2C3HA 1NCBL 5D1ZD 4YHNA 1UWEH 3BEVB 4U1LA 1Y6NR 1MFEL 5H94B 4ZPVA 4XRCA 2YC1B 4JG1L 1AY1L 3TO2A 4DKAA 1QLFA 4XX1E 3B9VA 5DD0H 1UB5A 3MLZL 5D96C 5ISZE 4ZS7L 4NNXA 1MHHB 4QNPE 1KC5H 4FZEH 3MNZA 1S7SB 2DBLL 5J11C 2IPKA 4G6ML 4PGDA 3RNQB 3MRDB 1KYOK 1QEWB 2IBZX 1Q1JL 2MOVA 4NRYA 1GRWA 4FQ1L 2W60B 4JAMB 4GMTL 3EAKA 4O2FB 1EXUB 2NR6C 4UT7L 3SO3C 1AGCA 2VLRA 1BBDH 3V4PL 3WIHL 1KTRL 1K5NA 4D2NA 5FKPB 1CD0A 1DBMH 5FHAL 2X7LA 3QPXH 4BKLA 3CUPB 4DOHB 4BUHA 3WD5H 3B3IA 1UWXH 3TBSB 3HZMA 4OUUB 3X11B 1U91A 4WY7H 3HB3D 3IFLL 1A4KB 2CKBH 1URLA 5D1XD 1FDLH 2Y25A 4L8SB 4YHZL 5AZ2L 2ZUWA 3NOIA 3DYOA 1RY7B 5SV3A 2EZ0D 2M8XA 4QNPF 4U1GC 3AU1B 3MRKB 2F74A 4FQXB 2H9GB 3CXDL 3QUKB 4RISH 3S4SB 1HK6A 3QPQC 2CMRL 4PLOB 1YUHB 5EUKB 3FB8A 1Y0LA 3KXFE 4DTGL 4UTAH 4Z0BH 4KI1A 2P42B 3K81A 4HFWA 1JGLH 2B4CC 2EDKA 2DD8H 2JELH 4U49A 4L5FH 6FABH 2DLFH 1JHLL 2V2TB 4AM0A 4IBLT 3SGJA 1AR1C 4GAFB 1QPPA 3BW9B 4LSVL 4R8WH 4RDQF 5FM8A 4YHMH 4KK5D 2O5XL 3IF1A 3O3AA 1JI1A 2C1PA 4QO1A 3QCUL 3MMEB 4ZXBD 4JKLA 5DHVB 2ZUUA 3EYVA 4U1MB 4CRPA 4TOYH 2YD2A 1A1MB 5K93A 3OAYH 1C7SA 3ZL4L 5DK3A 3QO0B 5GS2H 3QFDA 3BPOB 3B6SA 1CTNA 1J8HD 4N90D 1FVCA 5DWUL 5C6WH 5D6DA 4L9LC 1YNKH 5J6GA 2VZ3A 2IANA 4P23A 4JZJA 1JFQH 4PRDA 2M26A 1XR9A 1M7IB 1MVUB 4OLXH 4C56A 3OXSA 1XGYL 3I6LD 1KJ2B 1BQLL 5DK2A 3ESVF 4GXVH 4X8JA 3VMNA 4BZ1L 2P43B 5I30H 2C3VA 2NXYB 3CSYB 5FGRA 4BFBD 2AJSL 3AXLB 1YDPB 4P3WA 5HYJE 4GQPH 2ZG1A 3BOVA 2ZWLT 5I18L 2BC4B 5HHVL 2AV7B 1R0AL 1DUYA 1QFWI 3GZKA 4UBDC 5DYOA 3C08H 3UTPD 3FO1B 1LO2H 3C60B 5FOBA 4JFFB 4MD4B 4GO6B 1Z5LB 3BN9C 3CAFA 4RZCA 5INDA 1LE9B 3FB7B 1RUQL 3KPPB 2W91A 1HDMB 2JJTA 5HJ3B 2DM2A 3S36L 3CPLB 2NCMA 3TVMB 4PJBE 4EKXA 3FJTA 3JWDC 4K55A 3QA3B 4NQSB 4KJYA 1G7JB 5CBEA 5MEND 5J12C 1E6OH 2VB5A 3O2WL 2XZAL 1S7UA 4LEOA 4HK3N 2VXTH 1OGTB 4PJDA 1U93B 1OARL 3O41B 4JLRA 1GGCL 2J5LC 1ZWIB 2ORBL 1II4E 3ARDB 4NO5A 5BOPA 2GSGB 1DR9A 2E27L 5I76B 4I4WB 1P4IH 4LNRB 4PJBF 1CLZL 4MD0B 4ZYKB 1BREA 4X4YA 1YY8A 2OYPA 4XBEL 5J57B 1HHGB 3OB8A 5D8JL 5T3XD 3GRWL 3TN0D 4QF1A 3EYOB 3NCEB 2GFBA 3FRPG 1IQWH 4WW2B 4KJQD 2CPCA 4Z7VB 5I8KH 3W9EA 1B6UA 4UB0H 2QBWA 1YECL 1NCWL 3HI1B 3LEYL 3O2VL 3UJTH 1WIPA 5JQHC 1MWAB 2GUOB 4ODTL 4Y0GA 5IVNA 4JDZB 3F6IA 1CG9A 3PWPD 4ZAKB 4X6DA 2X4UA 4OZFB 1GL4B 3RVVD 3UXFA 3L5XL 5DMKA 1AGBA 1FORH 5ECJE 5EIQA 3BD3A 3FHAA 1DBAH 2OXHA 2Z8SA 4NO0B 3VXTA 4ETQB 1L7IL 1AP2B 4IRJA 3OGCA 3MA9H 3RPIB 2DQFB 3FL7A 2IH3B 4V1DA 4ZUWB 1IZJA 1FYTB 4R9HA 4D9RD 1CD9B 2APBA 5J6HA 2ED9A 5ITFA 2WZPD 4YUEH 3UTQB 2DQIL 1FQ9C 2F19L 3D3VB 3IB4A 4JM2F 2HYMA 5E8NA 1U42A 5BZWA 1JPFB 3WS6C 4XMLH 3LV3B 4PJ8D 3DVNB 3Q2CA 4C59B 4JFPB 5IV2B 1KELL 2XYCA 2P48B 5T1KA 3V6ZA 5KTEH 2BK8A 4F3FA 1IRAY 1JWUB 1DBJL 1CK0L 2DL2A 3B9EA 2R69H 4R4BB 4OIIH 3DX9A 1F90L 4F57H 4OFVA 1XGUA 5C0AB 2OQJB 3SEPA 1LE5A 1UGNA 4EI5C 4X4ME 3X17A 3T4AA 2WBKA 2XPGB 1NGQH 1A6PA 3PL6D 3ILQC 1MFAH 5IK3A 1ZHNA 5HGDA 3PQYA 1F11A 2XXMB 3UYRH 1OB1A 3D39A 4NPYB 4N1CA 4WHYH 4Z8FH 3V4VL 5IMMB 2VKXA 3EKCA 1KTKE 4I3SH 5C7XH 1W72L 2EDLA 5BMFL 3DI2B 3WHXB 4DZBA 3PWNA 1U8JA 3G5ZA 2QEJA 2P44B 4XNYH 3B2VH 4TVPH 3JUZA 4HS3B 3CCHB 4M43L 5ICXA 1NGXB 1RK0B 2AK4A 3SE9H 2VXUL 5C09A 3MRCB 1SBSH 3CK0H 4NN7B 4ORGB 5CEZE 5CD3B 1IGFL 5J8OA 4RGNE 1PBYA 2IADB 5LG1A 4DGYH 5IMOA 4WFFD 3WV0A 4XP6L 3ROOB 1R3KA 4W6XB 3ES6A 4AMKL 2A83A 1JHKL 3GMPB 1ZTXH 4NBYB 1H3WM 3IS1X 5KG9A 2WUCL 3FHQA 4I48A 4LCWB 5I1LB 2FCBA 3NCYS 4PGEA 3TYGH 4R96A 4FRWA 4G8IB 5BVPH 1WWWX 2BJMH 2P5EE 1YNLL 4KMTL 3ARBC 2EYSB 2R0ZH 3IFOA 3ARWA 4NQDB 2FLBT 3LS5H 4RNRB 5SWZA 4RBPK 3M17B 3VFWA 3FB6A 5IM7B 1VKXB 2XNAA 3T08A 4MQSB 4JR9H 3LKSA 4X9FA 4GW1A 4Y7MA 3QHZH 4TTGA 2IH1A 3WN5B 4ISVA 4Q9BA 1DSFL 3MJ9L 5B39A 4WHCA 4M7JL 1C12A 4TVSa 4Z7UA 2FH8A 3OR6A 5C0CB 3O3DB 2H1PH 2L4OA 1OP3H 2DLIA 4DWHA 5GGSA 1MPAH 2VLRD 4EUPA 3QJHA 1ND0A 3GNML 3ORJA 1YYMH 3O6LL 4ZFOB 3Q3GA 3OWEA 4K8RL 1WBZA 2VZ1A 1S5IH 2ARJA 4H20H 1JRHI 2YK1H 4X7SL 2ADGB 1XH3A 5GS2D 2BVQB 1KJVA 2VR4A 3QQ9C 4NUGL 1ZLWK 1A3LL 4XNXL 1EO7A 1OOAA 2P4AB 1FL3A 2QQKL 4YHKL 4P4KC 5DC9B 3WJLA 3QIWC 4ZMAT 4LMQE 2VLMD 5DUMH 3MV9B 4DKDC 1DQJA 1AGFA 4YDLC 4GG8B 2VXSL 3EGSB 3TIEB 1I7ZB 1T1ZB 3IU3A 5FA3A 4POUB 1PZ5B 4FS0A 3PWVB 4P5MB 4PP1D 3CVHL 2H32A 1MFNA 3NPSB 5F7NC 1ZANH 4XNUL 3ME0A 4OLUH 3I6GA 5ACLA 2VLKD 2ICWB 3A6BL 4KDTC 3GSNB 3P9WB 4GBXD 3P4NA 1F4HA 1OTSD 4IRSD 3TIDA 3EDEA 1MCEA 3Q5OA 3EOAA 2P8MA 4MXWH 4WWKD 2VH5L 5C0RL 2GTZA 4HBQA 4PJ9A 3MGTA 1FNGA 3GSWB 1JHTB 2Q8AH 2F54A 1MNUL 1VPOL 1J9CT 4WI5A 1T1YB 4B5EA 4XVSH 1NFDA 1P4LA 3IAPA 4MSWB 3AGVA 4HW6A 5ILTH 5D2LA 3DMMA 4P5TD 1RZKL 1Q9OB 4WTWA 1CT8B 1RURH 3DX7A 4A2MA 4F15B 3UTSD 4LHJB 4EXPX 2PTVA 2H32H 1KOAA 1A7PH 1I4FB 3WNKA 2NY0C 5GZND 5C3LD 5ID0B 1W0VA 3DI3B 2CIIB 4LCYB 5HHXH 4MA1C 4FNLL 5AUMA 5F9WB 4BSWA 5H37H 4O51A 1MLCA 2E7LA 2FYYB 4N8VG 1W72B 4BZYA 5EORH 3EFFA 3WNPA 1RU9H 4AEIL 5A1AA 4LQFH 3L3IA 2MJWA 3UBXG 5TDOB 4P99A 3BXNB 3M1BB 1WBYB 1JWSA 1VENA 2PCPB 5ALBH 1UH3A 4CVXA 4ELMA 4F37F 1DDHA 5JHDB 3V4UL 4ODBD 2BVEA 3H0TB 4LSRH 1QR1A 4CDGC 3ARUA 3O4LA 3AREB 5HGAB 3TP4A 1S9VA 3SGJC 3GMQB 1AJ7H 4OUOA 1U58A 3H9SD 1GJIA 4TUKL 1I1AD 3OKKB 4JDVB 5D6CA 2B1AL 1R5IB 3SKNA 2FECI 1QBLL 1WTGT 4HFUL 3RPKA 1B4JH 4LHUD 2L0DA 2O26U 4OZIE 1ZT4B 1MCCA 5C0JA 2H8PB 2D7PA 4EDXB 5JDJA 4Y19D 5ANME 5GS1B 1HZHL 1K2DB 4UV4L 4X6FA 4X7EC 5D6DC 5F3BA 2Q8BL 3VRIB 4W6WB 4LLUB 5F8RC 1E4KA 2X9YA 5MEOA 4P23C 5H35B 5T33H 1RJLA 4JZJC 1EJOH 5FYLE 5HHOD 4J8RA 1N7ML 4NT6B 2OK0H 1H3TA 3QRGL 2W0PA 1JGDB 2N1KA 2QSCH 2YR3A 1VGEH 4XCCL 1PLGH 3QQ4A 4QHLA 5DUPL 4RSVA 1T20A 1OSPL 4JRYD 3KDMB 3IJHA 4UT9L 1EDQA 1MEXH 5FM5M 5JIKA 2Q7YA 3PGCB 4J3WA 3T2NL 3BP6A 4PY8I 4WTXA 1A9BA 3WLWD 4FN0A 4OZIF 2X4TA 4H25A 1UXWB 4F9LA 1NGPH 5EZLB 3SPVB 5FGCE 1A7RL 1JBJA 4JHAH 5GGQL 3U36A 4Y2DB 2JJTC 4J3UA 1T1WB 4YO0A 1T7ZA 1J0JA 3ZSTA 3RVUD 4XGZB 5J3HC 5ERWA 1KB9J 4XAWL 5GGSY 3MRRB 3VWKA 2UZIL 5DEFB 3FT2B 1AE6L 3B2UC 2C9AA 5DJXB 4MDIA 3DVIA 5T3ZD 4QHKJ 1PVHA 2MTPA 3IDJB 1LP9E 1F45A 1HHIB 5E1AA 4JVWA 1BGXL 5T1LA 3L3JA 5IW6B 4HUXA 5MEPB 5JOFA 3VE0A 4HV8A 3BH9B 2HVKB 3KPRA 2DS4A 1IEAB 4NP4H 1MCLA 5FO7B 4F7CB 4UOJA 4F8TA 5L0QC 3FO9A 3SDCA 3ARGD 4OZHB 1XIWA 3WEXB 4BUGA 1Q94A 5EU6B 2E7BA 1MI5A 5CP3A 3VXRB 1QQDA 3J7HA 5B38B 3JTTA 1U3HD 1OGAD 1BD2B 3JV6A 4M03A 2PW1B 2XZCH 4FQ2H 4WI9A 1KPVB 4LPVA 7FABH 3RDTA 2B5IB 4YWGL 1HSBA 2X4PA 5E2VH 5HPMA 2EXYD 1NANI 1LP9F 4XNQA 3RKPA 4Z7OE 5DT1H 4YBLC 2AERT 2OCFD 4HWBA 2J4WL 4LCCA 25C8L 5L2KB 5BVJA 2VRAA 5KVFL 4WU7A 3E6HB 1U3ZA 3GI8H 4PJHE 1BFSA 3UJIL 1IAIL 1MJUL 2OJZH 4H26B 1RQ5A 2R56L 3BEVA 4YHIA 3O4OB 2OX5A 5CP7B 5H94A 1VFUA 1RJYB 4FXKB 2YC1A 3P11L 3IETB 5TFSL 3CMOH 4ZNCD 4RA3A 1J0IA 4KQ4L 4WUUD 2BMKB 2NYYC 3GHEL 5T1DL 3RA7L 4M7LH 2FR4B 5MP6L 5IKCB 4IRJC 3CIQA 5CP3H 1CDYA 4G8EB 4OM1L 1T0MB 4MJID 5D1QD 1NGZA 4WGVB 1XF1A 4HF5H 4PJ7E 1MHHA 5FFLA 2HLAB 3SJVA 1I1YA 4NQEB 4JM4H 1S7SA 4U1HB 3U46B 2ESVD 1FGNL 4Z7OF 3RNQA 3MRDA 2HH0L 1YEDA 2F53E 1V7NL 1IGIL 1RZ7L 1YMMB 4LCUB 1YJDH 5T5NF 4M7ZC 3LB6D 3KLDA 1TTUA 1NDGB 4PJHF 4P2QA 4QT5B 2W60A 3MQIA 4JAMA 4HWBH 4O2FA 2EO9A 1EXUA 3LY6A 4LVHC 2X09A 3I2CL 4YPJA 2Z35B 4RRPG 5FKPA 3WHE1 5FA4B 4H88L 4LPYA 1DLHA 2ITCB 3TBSA 1KYOJ 2IC2A 2W9DH 3X11A 1Z0MA 2BDNH 4NM4H 4OV6F 5D7IA 5EPMB 4LIQE 5A2LH 3U1SH 2UY7A 4L8SA 3L3GB 1IC7H 4OQTL 3NCYP 4DGVL 1HXYA 3ARRA 3OG4B 4PJ7F 2AXFA 3MRKA 3RVTD 4Z5RB 2VLJE 3QDGE 4GS7B 1H5BB 2H9GA 3MX0A 3QUKA 5I1CH 2VKWA 4KVNH 5FYKU 4N0FB 2IBZY 3GSRB 5EUKA 4P59L 4L4VD 4I2XA 1BM3L 1HYRC 1WZLA 2Z8VC 3SDXA 4M7KL 1CBVL 5KSAD 3QNYB 2GJ6E 1OTUD 3PP4L 5C0DA 2VC2H 3E0GA 2WWKO 5BOZG 4FP8L 4JKPL 4QTHA 1CGSL 2HFGL 4M6OH 1I9JL 3NH7H 3MMEA 4NHCH 5E6IA 3BPLB 2ZG2A 1R3HB 1EZVX 3RNKB 2X4NB 1MF2L 1A1MA 3VXMB 2CD0A 5DJ8B 3GEWB 2Y9RT 1E4JA 4GOSA 3QO0A 3UAJD 1OSZA 4POZD 1ORQA 2WWKT 3BYTA 4JRXE 3EYQC 1AO7E 4PIRF 5CEYA 1DL7H 4AY0A 4K71B 2VSDA 3DYPA 1M7IA 5I19H 4YBQC 1KJ2A 2G5BB 2VIRA 2BNQD 3C5ZB 5DUBA 1I1RA 1MFDH 3RZCD 2A9ML 3CSYA 1MJJA 3OF6D 4DK3A 2ZPKL 4CNIA 1N5YL 5MEQA 1ZSDB 2BC4A 1F4XH 3WFHB 4UQ3A 2AV7A 2ICCA 1RZ8B 1QSFD 4GSDL 4OM0L 4UIMB 4JN1H 4EVNB 3FO1A 5FF6A 3C60A 4PJ9D 4JFFA 4MD4A 4PGJA 2E7HA 1Z5LA 2AJXH 2R9HC 3QB7C 3OB0H 5MHSD 3SDDA 1T6WA 5JZ7C 5C86A 3VW3H 1YN6B 1LE9A 1QYGL 3FB7A 4D9QD 4OCYL 4G5ZH 4LMQI 2YPKB 3G6JE 1HDMA 1QNZL 3M07A 3H7BB 2QSQA 3F7QA 3FT4B 4U1JA 3I9GL 3V5KB 2JIXB 3NIFE 1ZHLB 4X6CE 3KYOA 1IC5L 1JGUL 1FL6B 1KJ2H 1INDL 5DMYA 1VACB 4O4YL 1WEJL 4D9LL 1ZA6B 3KLHC 1Q0XL 4X9GA 3O41A 3SGDH 4OLWL 4GJTB 4WUKH 1G7LB 3D0LB 3MNVB 5E4IA 2FH6A 5H2BA 2EDHA 3ARDA 3S35H 3D2UA 2GSGA 1J1OH 5GZOD 2ICES 5DJ2B 5CGTA 5EOQL 1MCRA 4Y4KD 3GMNB 3G6JF 4OZ4B 4OCXL 3S5LB 4QRPE 4NQUA 5BZDA 3WJLC 1A3QA 3WIFA 5F96L 5KOVC 1CXLA 4ZYKA 2QADD 3NIFF 1HHGA 2ZG3A 4YK4C 3RWCB 4X6CF 1FNFA 2IPTL 4KK8C 5C8JB 3EYOA 4GRMB 4YPGA 2E7CA 4GRWH 3MLRH 2G75B 4NZTH 4WW2A 4GG6B 1ZVYA 5DS8B 5B3JE 5E6YA 4WO4B 2RGSA 4XC1H 2P24B 4APQA 5I2IB 4NKIH 5FCUL 3VDCA 5J0BA 5TDNB 2B2XL 3LOWA 3HI1A 1RIHH 2BNRB 1MAJA 3MV8A 3BO8B 5FYKE 2X05A 4X9BA 2GUOA 3DURA 2X41A 2VDQL 1SVZA 1S8DB 1IJ9A 3MLSH 4ZAKA 1WCQA 5ICZA 4U7SA 2QJDA 2RHEA 3M8OL 1CXEA 2FJHA 5F7UA 2YUWA 3WIHA 2A0LD 4PP2B 1L7TL 1NCBH 2VITB 1AP2A 1MFEH 4UAOB 2DOCA 4NUJB 5KJRL 2DQFA 1SQ2N 1QSZA 2IH3A 4FQPA 4JG1H 3JBG7 5B3JF 2ZSVB 3DMMC 1AY1H 2DI9A 3RQ3A 3A6CL 1JPST 1LO5B 3MLZH 4XCNB 2NX5A 3O2DL 4ZS7H 1J1PL 4TSCL 2NY3C 3B4NA 2F8XC 5L6YL 2DBLH 1E4XI 3HC4L 1P7QA 4G6MH 1JPFA 5BS0D 3QUXA 3LV3A 3SCMA 1PX4A 3DVNA 1XEDA 5FAAA 3TNMA 2E7LC 1Q1JH 3C87A 5C0FA 3KYMB 1UKQA 4JFPA 2PYED 4FQ1H 3Q6GL 4GMTH 1S9KC 2ZUYA 2VLLA 4S1DC 1JMZA 4UT7H 4Z7WA 4XAKD 1JWUA 3NACL 4PGBA 3FRPA 3L9RA 3HCVB 3V4PH 4LKXB 3WIHH 1E6JL 5I1EL 5FHAH 5IROA 5IB5A 1QSEA 3VFMB 1AKJA 2OQJA 4KWUA 2V2WA 5J13B 4ZO9A 3IFLH 3U9UA 5B8CB 3CGTA 4WDIB 1YPZE 1DN2A 4XB7A 3B9KB 1U36A 1VFOA 4YHZH 4M4PA 4BFEA 5AZ2H 3B9DA 3OAUL 3SDAB 2X40A 3WXVL 1IT9L 4K07A 3NCMA 3LN9A 1S78D 2VQ1B 4J12A 3P40A 3CXDH 4LPTA 4NPYA 2CMRH 1FO0B 5E6ZA 4DTGH 3T0EB 4F58L 1D3CA 3D18B 4ZUTB 4PS4L 4D0CB 2VUOA 2Y5EA 3DGCR 5IMLB 3CFDA 1JHLH 1MI5D 4LSVH 4Y8AA 1B4RA 1NGXA 1RK0A 1QO3B 3TH3T 2O5XH 3WJJC 3RWJA 3QCUH 3MRCA 4PPTA 2FBJL 5IMKB 5CD3A 1E4KC 4NZDA 3B5TA 4DUVA 1YPZF 2H2PD 2IADA 4OLEA 43C9B 1MCDA 3QFJB 2BX5A 3ZL4H 4E41D 3CU1A 3W5NA 3U7AA 1CS6A 2IFGA 4ZFFB 5DWUH 3GMRB 5ICYA 2DIBA 4TPRL 2FX8L 2JCCA 1CQYA 5I1LA 4X9IA 1XGYH 3REVA 4PRBA 3VA6A 4F9LC 4Y4HD 1BQLH 1K3ZA 1SEBB 4BZ1H 4OIAA 3RGVD 4O2EA 2AJSH 1A22B 3PWJB 1AXSB 2UUDH 4NQDA 2YOCA 3S97C 4RNRA 5IF0B 3M17A 1FFRA 2AEWA 5HYJB 1VKXA 5IM7A 5I18H 3BDYL 1OPGL 1KG0B 5HHVH 1R0AH 4XVUD 3LDBB 1OAUL 3ULUL 4JZNB 2VE6B 3WN5A 8CGTA 1BAFL 2NXZB 3GKZA 3QDMD 3VWKC 3G9VA 5ETUB 5C0ND 3SY0B 3ARZA 3DTXB 2DYPD 1RUQH 3EYFB 4QGYA 3O3DA 4HBCL 4GLRI 4MNGA 2L7UA 2IAMA 3GRWA 3S36H 2VZUA 1S78C 5A16A 4QRRD 1SJHB 2D4DA 2CQVA 4PJBB 5HI5D 3QSKB 1MH5A 4ZFOA 2GJZB 5GS0C 5J06A 3O2WH 3V6BR 2XZAH 3OKYA 2ADGA 3C8DA 1XAUA 4ZPTB 3R8QA 3SDCC 4MNQB 1OARH 1XIWC 2A6JA 2GYSA 1D6EB 3ECBB 5CILL 4G9FA 3DHJA 4F7PA 3P4OB 3TO4A 1GGCH 1FBIL 3HAEB 1WISA 3UPRB 2ORBH 5E9DA 4HS6B 3KWWA 2VYRE 3WCYA 2VDKL 3QAZB 1KPRA 2E27H 3RDTC 1CGTA 3IFNL 3MV9A 5E5RB 3O6KL 5IESL 3TIEA 2ZUVA 3MROB 3BZEB 3OJDA 2IANE 1CLZH 1MCNA 4YHOL 3WFZA 3PWVA 4LCCC 4XBEH 4C56E 4NOBA 1FFNB 2DQUL 4Z76B 2K7PA 3PXHA 4HXBL 5D8JH 5HVHB 4OCNC 5EC1B 3GRWH 5F1IB 4X0KB 5CBAA 4CADA 3H3BC 5E00B 2VL5B 3OG6B 3H8NA 5HGHB 1S5HA 2AEIT 4G8GB 4OFIA 1NUNB 3FFCE 3GB7B 4KRNA 1IAIM 3NA4A 3LKNA 5CJBA 3ALXA 1YECH 2OL3L 2R0LL 1NCWH 3LEYH 4NO2A 4F7TB 3O2VH 3H9HB 3SE8L 4HULB 1CXFA 1FNSL 4KMLB 4ODTH 1JHTA 3IXTA 5EO9B 3PGFL 4JM2B 3IVKB 3FZUD 4I0KA 3PUCA 3L5XH 3HA0A 4G8FB 1L9NA 2YWZA 1JNNL 5D5MA 1N64L 5I17B 1CDUA 4P46B 3MLTB 1V3JA 2C4XA 5D7LB 4OF0A 2ICEB 4URTB 1L7IH 2IPUK 3FCTB 1ULVA 1NCUA 4P0DA 2NW2B 2G5RA 4U31A 2HG5B 2NTFB 4EN3B 3VD7A 1I4FA 1MY7A 4R26L 4PJDE 4YDJB 1PY9A 4LCYA 2NZIA 3L7FA 1A47A 1HHJB 1FGVL 2DQIH 4M3KB 2F19H 3OV6A 4ODUB 2FYYA 3CVIL 1W72A 2DM7A 5IW1B 2H2SC 4L8SC 1IAMA 3MRQB 4KAQL 4KU1A 3H9ZA 4FZ8L 4I0PD 3HG1B 4M7LT 1HN1A 1CGWA 1KELH 1RUAL 4IDLA 3LKPB 3T2PA 5F93C 4K2UL 1TCRA 1U8MA 3ARTA 3M1BA 1WBYA 5F7KC 1QRND 1DBJH 3K2MC 1CK0H 5DR5L 4N0YL 3FQWB 3AREA 5HGAA 1F90H 3GMQA 4PJDF 5A2KH 2D31B 1E0OB 1UH2A 4I5BA 4HGWA 4JDVA 2NY6D 1ZHKB 1R5IA 5ACMA 3W82A 4E5XB 5E6IC 4MS8C 5F3HB 3GO1L 2IQ9L 2OMBA 4YFLF 4JFED 4QEGA 3V4VH 4Q0XL 5C07D 4ZG1A 1ZT4A 1OAQL 4X6DE 1VEPA 2H8PA 4FQQA 1W72H 3BPOC 3QEHB 5DURD 4XMKL 5BMFH 4OKVA 5TGBB 4V2CB 5DVLA 2HVJB 4WFGD 3VRIA 2NZ9D 3B5HA 4Y16B 4M43H 5H35A 1NBZA 35C8L 5KW9L 5GSVB 4LDLB 1J0ZA 1NEUA 3J8F7 4MAYA 2VXUH 4V1DE 1IGFH 2NXYC 1YMHA 1HYSC 5FM4A 3NCBB 3T8XB 3KDMA 1U8KB 2DJSA 4XPFL 3W0WD 5C6TL 5EUOA 1ZT7A 3MJ9A 4M6ML 5HHPB 2ADJB 4XP6H 2LV4A 1U8NA 4MNHB 3U0TA 4YC2C 4AMKH 1JHKH 3C60C 1T2QL 4X6DF 3FN0L 3UBXA 1FZOB 1HHKB 1NMCB 3VH8G 4TVPE 3SDDC 5EZLA 2WUCH 3SPVA 2H6PB 4DVBB 5CZXC 2DMBA 1GIGL 3JSSA 2ZCLL 3P4MA 5GGVL 1S9XB 1T1WA 1YNLH 4KMTH 3KYKL 1BLNB 1IE5A 1TLKA 4MWFA 4NC1C 4XGZA 5ABDE 3RX7A 1PKQB 1SM3L 2BVYA 2YHGA 4GKOA 3MV01 3JTSA 2AJ3B 4A6YL 3PNWB 3QEGL 3EJYD 4BYHA 5DEFA 1M05A 1CLCA 1EBAA 4MX7A 2WWMD 1GGYA 1LO3L 2VDRL 2XKNB 4UV7L 5C0BD 3BPCB 2V17L 3UZEA 3OQ3B 1KTDB 2H45A 1DSFH 3PQYE 3IDJA 3D39E 3MJ9H 4ELKB 4M7JH 5I16B 1U41A 3ARDC 4XBGA 4Z6AT 3CVHA 3SKOA 5IW6A 3TT3L 1CU4L 4XH2A 5MEPA 2BSRB 3GIZL 5EZIL 1QKZL 1IEAA 4F7CA 4HPYL 3GNMH 1J18A 1KCSL 4NCDA 4OZHA 3O6LH 4K8RH 3V7AE 3WEXA 5EU6A 2GITB 2AK4E 3VXRA 1AKJD 4Y88A 2XWBB 4X7SH 2KKQA 5C09E 1BD2A 1F5WA 2CXGA 3MREB 3ZHKA 2PW1A 3GSVA 2NY7L 4FMFA 4M1GL 2W9LA 4NUGH 3DX6B 2O5ZL 1A3LH 4WW2C 4XNXH 2OZ4L 1N0XL 4NWTL 4PRHD 1TJIL 4MQXC 2QQKH 2QL1A 4YHKH 2XWTB 4APQC 1EMTL 5IGXL 1RUPL 1IEHA 3H7LA 3FAXA 5L2KA 1NKOA 2VXSH 3E6HA 3MCG1 2D7TL 3BWAA 3I3DA 4ZAKC 3CVHH 1BP3B 4RAVB 4XNUH 3QNXB 2EH8L 3QT2A 3A6BH 3VFUB 4MJ5A 5SWZE 1UXSA 1JUFB 1BBJA 3O9WD 4G8EA 4LLQA 2LABA 3DRQB 5CGYC 5DMGD 2VH5H 3QEQD 5C0RH 3FQRB 3DUUB 2HLAA 1ZMYA 2A6KA 1F3DJ 3U46A 4WTZA 1CFSB 4N9OB 3CD4A 1DUZB 4G6FB 4LCUA 1MNUH 1VPOH 4Z7UE 4F7EB 4PJIA 1NDGA 1WCBB 4NN6C 3LPWA 1F6LL 4PRIB 1X5ZA 1EFXA 1CGUA 3QUXC 3AMKA 3SCMC 1BZ7B 2XN9D 5JTWA 5E2TL 1G9NL 1RZKH 4PB0L 3D25B 1KN2L 2Z35A 2BOCB 3PXJA 5FA4A 1DCLA 1JF1B 3HUJA 4HUUB 4PRPB 1UEYA 2Y1VA 4UNTA 3MLWL 1H3XA 1N6QL 3TBWA 4J1UB 3X13B 1R5VB 3QCTL 5EPMA 4FNLH 2EXWD 3L3GA 1PG7L 3HHRB 4RMQA 3U9PL 2J8UA 4Z5RA 1H5BA 3L5HA 1X5LA 3TV3L 1PEWA 1TQCC 3VFRA 3BVNB 5DQJB 2BVTA 2X1WL 1PSKL 4AEIH 4Z7UF 4PG2A 3FTGB 3QNYA 3L3KA 3RIFF 5IBUG 4PGCA 4L8BA 3MO1B 3PDGA 4OGZA 1IM9A 5DEZA 3IS0X 3V4UH 3TBTA 1FPTL 1V05A 5DJ0A 3Q1SL 1YY9D 3FO0L 2GY7B 1R3HA 3Q48A 3RNKA 5DRXB 2X4NA 1EEZB 1B88A 3LKQB 5E9DD 5DJ8A 4TUKH 5GGRB 2B1AH 4RMTA 1IGYB 4LU5L 1G7IA 2BHYA 1CL7I 3EO9L 4Y4FD 3H42L 1QBLH 4HFUH 3MC0A 4U4BA 2DLTA 2E3VA 4G7VL 2I60L 2F54E 3VDAA 3BISA 5ESVA 5JHLL 4M5ZL 4XCEB 4OZIB 3TLRA 2ERJC 3Q5TA 1HZHH 1NFDE 4LF3B 3QUYA 4UV4H 2Q8BH 2V5SA 5D2LE 5ANMB 1HH9B 1T2XA 4RRPA 4YHYB 1QOKA 2VAJA 2HA1A 3NFSL 1BJMA 4HJ0C 4IMKA 3EZ8A 3LEVL 1N7MH 3QRGH 1EZVY 4JO2L 3V5DB 1QBAA 1WC7B 4XCCH 1KFAL 1A4JB 5D96B 4Z18A 1MCOL 5DUPH 1AFVL 1RZ8A 4IS6B 1OSPH 1LEGB 4LFHG 2GCYA 1JP5A 2EECA 4UIMA 4UT9H 3C8KB 3PGDB 2BY0A 5CUSL 3F62A 4L3CA 1H0DB 4KXZH 3MRMB 1DFBL 3FN3A 1G0DA 3T2NH 3OKDA 4JQIL 1U0QA 3ARFD 1RIUL 1YN6A 4PTTA 5I8EB 2JJVA 3WN5C 3R1GL 2H3NB 1K4DA 4EJ1C 1FHGA 4HS8L 3CDFA 3SO3B 3FT4A 1NC4A 1A7RH 3UTZB 2FZ3A 5GGQH 1XMWA 3V5KA 2JIXA 5D2LF 1ZHLA 4ELME 3G6AB 4NRXA 5FM5O 2IAMC 3MUGA 1M7DA 4XPHL 1TQBC 2C1OB 2JJUA 1VACA 3O4LE 4XAWH 3HZKA 3IAGC 1ZA6A 1ITBB 5EN2B 2D3VA 2UZIH 3HE6D 5JORB 4U1GB 2MQ3A 1AE6H 3VG9B 1DVFD 5BO1L 3D0LA 2EE6A 3W39A 3GMLB 1KIPB 2R1YA 1D5MB 4JE4B 1A02N 4LK4A 3TO4C 5DJ2A 3HRZA 3GMNA 1YZZA 2NW3A 1BGXH 1KT2B 1XT5A 1LP9B 3OTTA 1K9TA 4RGMB 5IEHB 3FOLA 4LVOC 5HDLA 5HGBB 5EOCL 3RWCA 1SMOA 4ELMF 5TE6L 5C8JA 2G75A 2FHBA 3O11B 5F6HI 1X9QA 3ELAT 2R1XB 5D1ZB 5DS8A 3NPSC 4Z78B 3SKMB 3I3EA 2P24A 5I2IA 1WITA 4H5SA 3O45B 3ZKMC 4HMDA 2A73B 4RWYL 4YWGH 5T3XL 2BNRA 4BH8B 4HIHA 4XI5D 5DO2C 4Z7QE 4L9LB 1EHNA 1S8DA 2J4WH 3MJ8B 1A6ZB 25C8H 1P5UA 4BELD 4KFZC 4YFLI 5KVFH 3P9LB 1I3RA 3BUYB 4IM8A 3B5GA 1F6AA 1DE4A 5C08D 3JUYA 4K23L 3UJIH 1IAIH 1MJUH 2VITA 2R56H 1FVDA 4P9HL 4Y1AD 4UI2A 3MFFB 1IEBB 1Z9LA 1MAKA 5DJAB 4N5ED 3P11H 5TFSH 4NHUA 1GYAA 4KQ4H 4OQTA 1JTTA 2ZSVA 1CDBA 4JY6B 3GHEH 5T1DH 3RA7H 4JFXB 1JZ6A 5MP6H 3VWJD 4X5LA 4F15C 3RL2B 1LO5A 4Z9KB 1QFPA 4OM1H 4XCNA 1XGRA 3S96A 1QP1A 5GSRB 2IEPA 1A6AB 2ZZUT 3TBVB 3QJFB 4Z7QF 4JY5L 1FGNH 3SN6N 5F9WC 2KH2B 2HH0H 4D0DB 1N2RB 1V7NH 4NQCA 1IGIH 1RZ7H 3VCLA 1SBBA 3KYMA 2A74B 4L3ED 3N9GL 3KPRE 5GRWA 1WZMA 4GXUM 3RL1B 1PW3A 4C4KO 1B0WA 4ENEC 5JPNA 1NGYB 2XT1B 3I2CH 2DKMA 4N1EA 2GJJA 3V7MA 2R2HB 2XG5A 4H88H 5FYJU 3L3HB 1OP5K 2VISB 2XFXB 4WDIA 3B9KA 4QRQB 3O6FD 2FX9L 1T2JA 4OQTH 3SDAA 3AREC 4DGVH 4ZXBB 1W2KT 2P46B 3EDDA 3LH2L 4HD9A 3SDYL 2XTJD 3UO1L 2VQ1A 2JKXA 4D3CL 4C4KT 3GMOB 1FO0A 4P59H 1BM3H 3T0EA 4HIJB 3QDJA 1JNLL 4M7KH 1CBVH 1JYXA 4IEFB 4D0CA 3PP4H 5EIIB 2VDML 5LAXA 2GJ6B 4K7FB 3MFGB 4FP8H 4JKPH 5GRVL 2BSTB 1QO3A 1CGSH 3BRGC 2HFGH 3CX5J 5FDWB 3FB5B 1I9JH 3VRLE 4E42B 1T22B 3BZ4B 5IMKA 4YXKL 5A3IC 4KJPC 4QWWC 5C0IB 1D5ZA 1MF2H 4MAYC 43C9A 3QFJA 2BVPA 3CZFB 3SE4A 4BJLA 5LQBL 5LWYL 1U92B 3SJVE 4NNPL 2WK2A 1TETL 3P0VL 2DIJA 4B50A 2Z91B 4FOMA 4LSTL 4JRXB 3OX8B 3QG6B 3BMVA 3IRPX 4YXLL 4X80L 4GW5B 4WEBL 1GZPB 4P2QE 1MIEL 2UWEB 1IKNA 1F3DH 2V9QA 2NY4D 4WNQB 4HKXB 2DF3A 4D0BA 1SEBA 3KPSD 4M1DL 2A9MH 2WAHA 2YSSB 3PWJA 2ZPKH 4K8RC 4NQVB 3VRLF 1AXSA 1N5YH 3R0MA 3LQZA 4S11A 4YHLL 5IF0A 1DN0B 3EOTL 3MOAL 2HT2C 5MENB 4NGHL 5D7IE 4GSDH 4OM0H 1PQZB 3TNNB 2VE6A 4QOKD 3HI6L 3QZWB 1M4KA 2X4RB 4L4JA 3SY0A 4OSUL 5FHBL 1U8QB 3DTXA 1PGRB 1QYGH 2HTLC 3HMXL 4I2XE 4WV1A 4OCYH 3SDXE 1QNZH 3PIQB 2Y36L 1QD0A 4DN3L 2I9LA 3RWEA 2XTJC 3HPLB 3BKYL 3G6JB 3I9GH 2ENYA 2I07A 1RHHA 4KUCF 1MREL 1IC5H 4N9GA 1JGUH 3CFEA 4X6CB 4AEHL 1INDH 1SJVA 1Z6JT 2CO7B 1X5YA 4O4YH 1WEJH 4MNQA 3TN0B 4D9LH 1J86A 4O02L 3ECBA 1D6EA 5D7IF 5CHNB 1Q0XH 4KJWC 3P4OA 4TUJA 4OLWH 5E0QA 4PG9B 3HAEA 1JZ3A 3BH8B 4U3CA 1ZGLM 1FZKA 3OGOE 4G42A 1DEEB 5DQ9B 3LS4L 1IGML 5EOQH 1ITCA 2XY2A 3MROA 4OCXH 3CH1B 2DQCL 2MKLC 4X5XA 5F96H 4DN4L 3LN4B 4QRPB 1FFNA 3HE7D 3KPQB 1DJSA 2OR9L 4FQJL 4Q7DA 5IB2B 3PWPB 1XCTB 2IPTH 5EC1A 3S37X 4CMMA 4OT1L 5FYJE 2N4IA 1A1OB 3RFZC 1SY6L 1JZ7A 5E00A 4YFDB 5DFTA 4UT6L 3ZYJA 3O2DA 4G8GA 3GB7A 4IOFC 4UINL 1P4BL 1IKFL 5FCUH 2Z31A 3V2AR 3OZ9L 2B2XH 5EBLB 1CD1B 4JFFE 1CFQA 3H9HA 3NCCB 4BA8A 3BUTA 3LKRB 8FABA 1XF5B 4XCYB 2VDQH 4WW1B 1NEZG 3IVKA 4YH6A 3M8OH 5DQDL 1EO8L 4XZUA 4W4NA 1MJ7L 1T83A 3HFML 3GJFK 2AGJL 4P46A 1L7TH 3MLTA 4GRWE 4NC1E 5D7LA 4PJ8B 2ICEA 4PR5B 2X42A 1U6AL 2WMPA 1Q0YL 3FCTA 2NW2A 3QO1B 4WHTB 5KJRH 2NTFA 4EN3A 3F65A 1HOCB 3F7YA 5BJTB 3A6CH 2EE9A 4HKJA 5DRWB 4K3JL 3W11C 5D7SL 3O2DH 1J1PH 4TSCH 3WIIL 4F7MB 4AJ0A 3K46A 5L6YH 3HC4H 4IHOB 1DQQB 2YA0A 4P2OA 3MRQA 4KTYA 1F13A 5FK9A 2XXCB 2DWDB 1KIUA 3RZWA 4MVBC 3PL6B 3DROA 5JPMB 3HG1A 2QV2A 1U95B 1MHCB 4GS7C 1H5BC 2G9HB 3Q6GH 2KQNA 4GRWF 3QH3B 4P2RD 4WRLA 1D9KA 1A7OL 4R4ND 4PG2C 4PJXB 3NACH 2HT4D 1E6JH 5I1EH 4JFHD 4DZ8B 1JYNA 4YQXL 4KKBC 3MUHL 4XX1G 4OQ1A 3KR3L 1A21A 2OR7A 4LLYB 1HKFA 3OAUH 4JQXA 3WXVH 1IT9H 1ZHKA 4QYOB 4E5XA 3QIWB 3MV8E 1T66D 1UCTA 4QCIB 1NEZB 4WHDA 5F3HA 4WJ5B 3CFBB 1UB6B 5FGBA 4F58H 3MPCA 1HEZB 1JWMB 2NTSP 3DUSB 5TGBA 3FQXB 4PS4H 2HVJA 4ONFL 4K71C 3MBED 4L4TA 4RDQG 3EJJX 4ZTOL 5A2FA 1KNOB 5GSVA 3ROLB 4YHNB 5JW3L 3QUYC 1AIFB 4U1LB 4WW2F 3NGBB 3E6FA 1MLBB 2FBJH 4ZPVB 4QRTA 4XRCB 4TUOA 2CKBB 5AG8A 4X99B 4G6AD 4FG6D 4U05A 3VRJA 1U8KA 4IMKC 5JOPE 4KRLB 3BDBA 2NX5E 4MGXA 4UNUA 5IFHL 4W4OA 4HJJL 4RX4A 1MCKA 1X5IA 5AZEL 1QFWM 5CEXB 4FXLA 4ERSL 3DGGB 5EFIA 1HHKA 2YUVA 2FX8H 1NPUA 4TPRH 5DHYB 4NWUL 4HDIB 2BFVL 4Z7WE 2EDOA 4JFDD 4M93C 2ILLA 4KK9C 2PXYD 4EZMA 1BLNA 4JPWL 1K3IA 2VLRB 3RKDC 1MCQA 3I75B 3F58L 3AUVA 1QSEE 1YEEL 4MA1B 3MRFB 2J6EL 1PKQA 3BDYH 1OPGH 4PJFB 3PNWA 3RTQD 1HILA 2OS7A 2AABL 3HZMB 4MYWB 3U6RA 2FO1A 4IOSD 2WP3O 1OAUH 3ULUH 3BPCA 1BAFH 1S7XA 1UCBL 5SWSA 3MJ7B 1N3NA 4ZO8A 1FNEB 2D0HA 2GY5A 1BWWA 2JF1A 4M6NL 5I16A 2F74B 3C6SB 3CFCL 4M3JA 4HBCH 2BSRA 1BPVA 1A7NL 1Y0LB 4Z7WF 4R2GD 5T3ZL 2WP3T 1MIML 3VXUD 1SJEA 4AM0B 3INUL 3PG2A 1AD0A 3HPJB 3IF1B 2C1PB 3BYYA 2ZKHL 5CILH 1INEL 2FEEI 4OFYA 3DX6A 2VLKB 1KCKA 3EYVB 1FBIH 5EC2A 3H6JA 4H8WL 4GBXB 1BZQK 4AIZB 4D94A 2XWTA 4IRSB 4M61B 3O8XD 3Q6FA 2VDKH 2HKHL 3TCXA 4WWKB 3IFNH 3VH8A 3QFDB 3O6KH 1TENA 5IESH 1FN4A 3SBWA 4JHZA 1FVCB 2JCCE 5I1KL 4YHOH 4DW2L 3VGGA 5J6GB 2DQUH 4LHUG 2P5WD 4HXBH 4JZJB 1ZHBA 4PRDB 1XR9B 4RAVA 5KOMC 3ZKQD 4NQDE 4X8JB 3VFUA 3UX9B 1VA9A 4EQ3A 1KCRL 1R5WB 4P5TB 4UAOC 4PJCB 1H8NA 2YD5A 4PLJD 5J7CC 3UTSB 3DRQA 5HTSA 3FT3B 2OL3H 2R0LH 2NY5L 3DUUA 3RVWC 4HG4J 3O0RL 1S7QA 3SE8H 4LLAA 3OBAA 4KKAC 5FCSH 1CFSA 5FOBB 1FNSH 1OTTC 3IGAA 1DUZA 3PGFH 3T0AA 1JZ2A 2JCCF 5A2JH 3QULA 4PRIA 2Q1EA 1JNNH 1N64H 2ADIA 1K4CB 2XWJA 2WNGA 4PJGB 4ZD3L 5C9JB 1OL0A 4FXGA 4EBQL 2X70A 2VNCA 3ZKNC 1CFTB 1P9MC 3O6ML 5CBEB 1JF1A 4HUUA 4PRPA 1PZUB 4R26H 5IUSA 4HGKC 3X13A 1JE6A 4R2GC 4LEOB 1V5JA 5EZJB 4G9FE 1CZ8L 3TGXA 4PUBL 5ADOL 1JV5B 1FGVH 2Z0BA 1X5JA 5E9DE 4M8QA 1FJ1B 5BV7L 2R2BB 3S7GA 3CVIH 3QP3A 5DVMA 3B9KC 1AXTL 1MCIA 4KAQH 3SDAC 3MV9E 3BVNA 3QIBD 4NO5B 4YXHL 5J1AA 3TJHD 4FZ8H 1QUNA 3FTGA 4KH2A 2Y06L 1RUAH 1C5DA 5L0QB 4PLNC 4L29A 4K2UH 1XF2A 3MO1A 3QNZB 3T0EC 1BIIA 4JG0L 3MRPA 4C57C 4F37K 2Z93B 5DR5H 2DTML 4Q2ZB 4Y19B 4N0YH 3AC0A 4FQXD 4I3GA 1P84J 3IFPA 2MQCA 1BOYA 2OBGA 4K94L 2GFBB 4LOUC 5DRXA 2V6HA 5HHOB 4FHBD 1IGYA 1XZ0A 3B43A 5EOCJ 3W9EB 3LEXB 4HJGB 3BE1L 4YBLB 4WEUD 1EVUA 4EDWL 4MHHG 1EIBA 1MRCL 3GO1H 2IQ9H 3O3UN 3T1FA 3SE4C 1N6VA 4Q0XH 3TH4T 3VXSD 4Z7NE 1OAQH 3U4EA 4XMKH 4CBPA 1MCHA 1A6WL 2CUHA 5D5ME 1AQDB 4CAGA 1CFVL 5DMKB 1HH9A 1AGBB 2YD4A 4BQCA 35C8H 1DZBA 5KW9H 5D4QA 1REIA 5D7KD 4ZUUB 2XQYG 2NY2D 4KQ3L 3VXTB 1UZ8B 5GXBB 1IKNC 2Q3AA 3AS0A 1WC7A 5F9OL 3DVFA 1CXKA 1YEIL 3OGCB 5INCA 4IS6A 1CDCA 4XPFH 4V1DB 4ZUSB 1AR2A 1QG3A 4M6MH 2Y6SC 3C8KA 2AI0L 5C6TH 4ESKA 5J6HB 3MBXL 2UV3A 2D7QA 3MRMA 5EBGA 1IQDB 2PO6D 3ZDXE 3LDBC 1C5CL 4NKMA 4N0RA 5I8EA 1NJ9B 1T2QH 4Z7NF 5I75B 3FN0H 4WI8A 5E8NB 2H3NA 5BZWB 3EIFA 4P2YA 1HE7A 5TF0A 2W92A 2XA8L 5D5MF 2DM3A 3RJDA 3UTZA 1GIGH 4WV1C 2ZCLH 2HJKB 4UDTA 5GGVH 5JHDE 1DQDL 5T1KB 3V6ZB 2OM5A 3CSBA 5E5UB 3KYKH 5HI3C 43CAA 2C1OA 2VQTA 2OZ4A 1QLEL 2RBLA 1SM3H 3K1KC 3LRHA 3ARGB 3SGDI 4A6YH 3QEGH 3SGKA 1TDQA 5E2WL 3ZSSA 3TVMD 2LTQB 1XGUB 3F7PC 1U8PB 4HK3J 1Z9MA 4UV7H 4XHQA 1LO3H 1MAML 2VDRH 3B8YA 2V17H 1MFCL 1LE5B 3GMLA 3NFPA 1KIPA 2RAMA 15C8L 1ACYL 4MA7L 5HGGS 3TA3D 3ZDXF 2JK5A 1ZHNB 5HGDB 3PQYB 3RY5A 1F11B 1D5XB 1KT2A 3D39B 3TT3H 1CU4H 5IEHA 3GIZH 1KACB 5EZIH 1QKZH 2OSLA 3MOBL 2R4SL 4HPYH 5DJCB 4LBEA 1KCSH 4DZBB 5SV4A 3QUZD 3PWNB 3T0DA 1U8JB 3G5ZB 1YEHL 3CSPA 1VEMA 3PP3H 5D1ZA 4I18A 3OR7A 4O58L 4Z78A 3SKMA 4J3OC 2NY7H 4M1GH 4G6JL 5C09B 5CJ8A 3SKUD 2EDBA 2O5ZH 4FTVD 5EUOE 2OZ4H 1N0XH 4NWTH 2NY2C 4WUUB 1TJIH 2E7MA 3BQUD 1EMTH 5IMOB 5TF1L 5IGXH 2Z31C 5D72L 1RUPH 1DANU 3C2SA 3MJ8A 1R3KB 1BFVL 2A83B 3L1OL 2ESVB 4LLMA 2D7TH 1BZ9B 1G6RL 1JZ8A 1KLUA 2CLVB 5KG9B 5DJ6B 4I48B 3CLEL 3MFFA 2EH8H 5DJAA 1T83C 1XF3A 4N0UB 3ULUD 4P46C 4XVJL 4IRZL 2IG2L 1T04A 1IFHL 2UVEA 4OF7A 4TTDD 4KKLD 3D85D 4LGPB 3RL2A 3LRSA 1UG9A 5EUOF 2BP3A 4EN3C 5GSRA 3FB6B 4U1IA 1A6AA 3LKSB 4NO0D 2EC9U 1NBVL 3P9MA 5D1XA 1G7MA 5I1IL 3R8BB 4D0DA 1N2RA 2FRGP 5F7DB 4FFWC 3IKKA 2R2CA 5E5MA 1P5VA 1C12B 4P2OC 5DDHB 2EEBA 4MJ4A 3RVXC 4QHKI 3W81A 2EDFA 3OR6B 3C6LD 4HKBB 1RUKL 3RL1A 5E2TH 1G9NH 5GGSB 3STLB 3RUGB 1B0RB 4OZHE 2HT3C 5FYLL 5KSAB 5JOEA 4P5KA 3D3VD 3QJHB 1W0WA 4PB0H 1KN2H 5HI4C 3U30B 5EU6E 1NBQA 1ND0B 4RQQB 5KSUA 2R2HA 5K33A 3VXRE 2VABA 1D9KC 1I7RA 3MLWH 2WBJD 1BD2E 2ARJB 1N6QH 3QCTH 1DLFL 3DPBA 3CLFL 1PG7H 3U9PH 1GGBL 1KJVB 3QHFL 5JR1L 4ZXBA 1BWMA 1H15A 3QEUA 3GMOA 3TV3H 1FL3B 3BAEL 4JQXC 5CWSB 1U8IA 1OLZA 5GRZA 1PSKH 5L2KE 3G5XB 1DQML 1AGFB 4PLKC 5EIIA 1J8HA 1TVHA 2W0FA 5F9AC 4FFVC 5FA3B 5HXMA 5FGBC 4RFOL 4K7FA 1MY5A 3DNKA 4OZHF 5IHZA 2A9NL 2HLFC 5DZOA 1NH6A 1FPTH 1UACL 3FB5A 1J0YA 2H32B 3Q1SH 4WFHE 4NNYB 4E42A 1T22A 2EIEA 3FO0H 4OGYL 5IVOA 1HQRB 3TFKD 3I6GB 4OFYD 4G6KL 3RZCB 5DK0B 4IIQA 1OF2B 3P4NB 4YR6B 1GPOL 3TIDB 2LQRA 2RFXA 5HYFA 4LU5H 1X5AA 4N1HB 3EO9H 3PABA 3EOAB 3H42H 4M6AA 2B4CL 4XWOC 5HVFB 1QHOA 4G7VH 2HKFL 2I60H 3FAWA 3MYZA 4PJ9B 4PRNB 2XOTA 4W4OC 3B8SA 4XC3L 1OQXA 5JHLH 4M5ZH 4GW5A 1GZPA 3UPAA 4E0RA 4MA3A 2UWEA 4WNQA 1NMCC 4OLVL 1NFDB 1P4LB 5J9PA 3JV0A 3NFSH 5D2LB 4YDKL 5F72S 3LEVH 3DMMB 3HUJE 5IQ7L 5JO5B 3DETD 4JO2H 3U0WL 1DN0A 4KK6D 3KPMB 1KFAH 1MCOH 5MENA 1AFVH 5AYQA 4LCWD 1F6FB 2NY3B 1PQZA 4YEEA 1GH7A 3VFNB 1I7TA 5CUSH 2J8UE 4RA0C 1IARB 3MJGX 1TXKA 1DFBH 1SYSA 4O51B 1MLCB 1U8QA 4JQIH 1RIUH 1FSKB 4XP4L 5F9DC 2NY1D 2I9TA 3R1GH 3UYOD 4C55A 4K7PL 3JV4B 5BRZD 3PIQA 1X5KA 4OB5L 4HS8H 3STBA 4FFZL 4NJAL 3HN3A 1IILE 3T0BA 1UKSA 5SX4I 1HINL 4P3CL 4XPHH 3P73B 4ZOAA 1JWSB 1V3LA 4BQBA 4CVXB 3HUJF 5CAYB 2DJUA 1DDHB 2QADB 2XZZA 4M1CC 1SJXA 3NBNA 1V8HA 3TN0A 5DVNA 1PDKA 2XZQL 1QR1B 3O4LB 1S9VB 2CDFB 5BO1H 3BH8A 5SWQB 1UZ6E 3AROA 1ZOXA 5LBSL 2FEDD 5D6CB 1BQHB 3DXAD 3WMSA 3CH1A 4OFKA 3LN4A 5C0JB 5EOCH 3KPQA 3PWPA 3SBWC 2GK0A 4U6XA 5TE6H 1A1OA 3LPFA 4YEFA 3LVEA 2W9EL 2MHAB 4AIOA 4N0CD 1JGEA 2A1WL 4J8RB 4YFEA 4LIQL 5F9JB 1MHPL 2DDQL 4AEFA 5EBLA 1UZ6F 3QQ4B 4RWYH 2ITDA 5T3XH 2CLZA 5DMJB 5IVZB 3IJHB 3CSGA 1XF5A 5FGSA 2IALA 3PHSA 1BVKA 4WW1A 4J4PA 3HMWL 2IWGA 1X6LA 1QBBA 3N0PB 3QG7L 4BSJA 2X4TB 4H25B 4F33A 4WWID 2MPAL 1JN6B 1HCVA 4K23H 3QUML 4PJ8A 4QHNB 2Z8RA 2C3WA 4ZS6D 4P9HH 4PY8J 4XVTL 2PYEB 5HYSB 3U36B 3QO1A 4WHTA 5HDQL 2DKUA 3S88L 4BM7A 4UMGA 4YO0B 5T5FL 5F1OB 4DGIL 5ERWB 1FAIL 1JMXA 4XPGL 3MUJA 1KN4L 4F7MA 1M71A 4ZDHB 2B1HL 4JY5H 1DQQA 2XACC 3MZTA 4MDIB 5T5NG 3IDGA 1LK2B 3L3DA 2FGZA 1JPGA 3PL6A 1N8ZB 1U95A 5DI8B 2G9HA 1TZHB 3N9GH 3KYNA 4MCYB 3QH3A 2HTKD 3VE0B 1RIVL 4PJXA 2R0WL 1KIQB 2E9IA 4DZ8A 3U2SA 3FO9B 3GHBL 2ID5A 12E8L 3QCVL 1KXQE 4JCLA 1MI5B 4LLYA 1QQDB 1VGKA 3JTTB 2FX9H 4CU8A 2BNUA 3F7VB 5JW4M 2AKRA 2BNRE 3LH2H 1NFIA 4RFEB 3RGHA 3SDYH 1QSVA 2GW5A 4QCIA 3UO1H 5HD8C 3RDTB 1NEZA 5EA0L 4D3CH 1HSBB 4JO4L 1T1XA 4S2SB 4ONGL 1B2WL 1O7SA 5JW5B 4XNQB 5CZKA 4E41B 1JNLH 1F4WL 3C9NA 3N06B 2ZSWB 4FQCL 1HEZA 4LCCB 1JWMA 3DUSA 1OLLA 3FQXA 4W81A 1JJUA 2AQ1A 5AAWA 5BVJB 1KJ3L 2VDMH 6CGTA 4L9DA 3RU8L 4TSBL 5IVXA 2YZ1A 4YHIB 3ROLA 3QWRD 1AIFA 4GMSL 4JO3L 4BQ8A 5I1GL 4LFHD 4GG6F 4KUZL 1MLBA 2LAAA 4YXKH 4YHYC 4Y4HB 2CKBA 5I1HL 4X99A 3RGVB 5J89A 2VR9A 5FO9A 2WANA 3I50L 3PV6A 5LQBH 4X4ZA 3HMXA 5LWYH 4YDIL 4NNPH 1NGZB 1TETH 5CEXA 3P30L 3P0VH 4IJ3B 2APVA 1I1YB 3SJVB 1A3RL 3DGGA 4NQCE 4LSTH 5KBNC 4OAWB 4JGUA 4YXLH 4X80H 3QDMB 5DHYA 1YEDB 4WEBH 5EWIL 4PJ5D 4HDIA 1MIEH 5EO0B 4HH8A 3MSPA 5A40E 32C2B 4P2QB 1FH5L 4HZLB 4M1DH 3G08A 3JWOL 1JK8B 3TJEL 3I75A 5ISZA 4QRRB 4YHLH 3DO7B 4DQOL 3MOAH 3EOTH 3MRFA 4CMHB 4KRPC 4PJFA 4LARL 1DLHB 4NGHH 4U1KB 3IXAB 1I3UA 4YLQT 4CVZB 4HLZH 4XBPB 5D7IB 5FYKL 3HI6H 2YPLD 3MJ7A 3UTOA 4Y2DD 2GAZB 4ODHL 1FNEA 4X5WB 3WFBL 3IDXL 1HXYB 3ABZA 1Q72L 4P49A 1LDPL 2AXFB 4OSUH 4DUXA 1OWRM 4YIQB 5FHBH 3VG9C 3D0VA 5CINL 3HMXH 3T0EE 3C6SA 3QDJE 3K80A 1J12A 4NCC2 2CK2A 2Y36H 4DN3H 4I2XB 3UBXI 1EJ6A 3BKYH 3SDXB 1SY6A 5B4MC 2Q20A 2ZOLA 1I1CA 3A67L 4RGMC 1MREH 5C0DB 1V7ML 3WNMA 3KJ6L 4AEHH 4QTHB 1VEOA 4JN2B 3OAYK 4XTRD 3HPJA 3DYMA 4O02H 5E2UL 5EB9A 5IBTL 2VLKA 3QFJE 1RZIB 5E6IB 5D1ZC 4I18C 4GBXA 5F1KC 4AIZA 1ZEAL 2F5BL 1CFNB 5CJ5A 4IRSA 4M61A 1PJ9A 4TYUA 3LS4H 3IU4L 1IGMH 4WWKA 1MUJA 1OSZB 1ORQB 5IT2L 3EJZD 5TQ2L 3RX5A 2DQCH 5CEYB 1F42A 4Y5YA 4DN4H 4P57B 4YAQA 4XNMA 1BJ1J 3ARPA 2OR9H 4FQJH 1DBBL 4KGJA 1G9NC 4OT1H 2VIRB 4LSSL 3AY4A 5E8DL 4OF6A 1SY6H 3MRIB 5DUBB 4YNYA 4UT6H 1MJJB 1R5WA 4KROD 4P5TA 3E8UL 2Q6WB 3MRHB 4M5YL 3FQUA 4PJCA 4UINH 4CNIB 1P4BH 1IKFH 5MEQB 3UTSA 3MNWB 3OZ9H 3FT3A 4POYA 5FKAA 4G7YL 4UQ3B 3RWDA 3NCJL 3HS0A 4YC2B 1N0LA 5FF6B 3GMMB 4ZTPL 2JJWA 3O81A 4AYFA 2FL5A 5K9OA 4X6BA 3P0YL 1PX3A 3SDDB 4PB9L 3HRPA 3HB3C 3HC3L 3OAZH 5DQDH 3PHQB 1EO8H 5D1XC 1MJ7H 3HFMH 2AGJH 4JREC 2B7DT 2AQ3A 2EZ0C 1K4CA 4JFZL 4PJGA 1KPUA 4I0PB 5C9JA 1U6AH 4U1JB 4NQED 5JQ6L 1Q0YH 4GRWB 1CFTA 2AJVL 3F6LA 3KYOB 1YMMD 4MNQE 5EZJA 1I9EA 2F8VA 3CNKA 3ZYOA 4JHBA 4TRPL 2VZOA 1G9ML 4K3JH 4NDMB 2GSIB 5D7SH 4DKEL 1NL0L 1JV5A 3T3ME 3WIIH 1FJ1A 1JF6A 2R2BA 4KK5C 4TULL 3H9SA 5H2BB 1I1AA 2NY6B 3D2UB 4ZXBC 3ULVE 1MCSA 4BFGA 4OLZL 2BRRL 4LHUA 5FEBA 4JFEB 3QNZA 5BZDB 5IB1B 3WIFB 1A7OH 2Z93A 4CW1A 5DURB 4Q2ZA 4Y19A 5DRZB 1TIUA 3PWUA 4FQIL 3FKUS 4YQXH 3F7RA 4JFOA 4ZFZB 4YPGB 4G8GE 3ETBF 3KR3H 4U6YA 5HHOA 3DWTA 1CL7L 3TCLB 2FIKA 3T3MF 1FNHA 4APQB 4ODSL 3LEXA 4HJGA 5F88B 1BF2A 2EIBA 1VFMA 2PR4L 4IIQC 4JRYA 3V6FA 3UTTD 4BH7A 3W0WB 3MV8B 4MZ3A 3ULVF 3QR2A 3DURB 4KC3B 5E24E 3MXWL 1OD9A 3STZA 4UU9A 5DC4B 5ICZB 3VXMD 2P45B 2E6QA 1AQDA 2FJHB 3F5WA 3LQMA 4ONFH 5D7LE 1SYVB 1WZ1L 4ZTOH 1F3RB 2GEEA 4HLJA 5E8OA 5AWNL 5GRYA 2J6EA 4ZUUA 5F8QC 5JW3H 1UZ8A 4J2XA 4CN4A 2X9XA 5LJYH 1WFTA 4KI5D 4CU7A 2R0KL 3O3BB 2UZYB 4ZUSA 1RMFL 5GPRA 4KXZI 5IFHH 1XGQB 4ODWB 2JB5L 4HJJH 4KKCD 1TZIB 3C5ZD 5AZEH 4J4PD 2NX5B 1LK3L 4XP5L 3SGEH 2HFEB 1IQDA 3NCFB 2B39A 1RFDL 3VI3E 4EEEA 4ERSH 1NJ9A 5C0BB 1P7QB 4NN6B 4YE4L 3VGAB 3HG1E 1ZLVH 3G5VB 3QUXB 3SCMB 4NWUH 2EDNA 3TNMB 1UA6L 5C0FB 2BFVH 1U9KA 3X3FL 2HJKA 1OCWL 3MCKA 3RY4A 4QHUA 4B7IA 1BEYL 1UVQB 2VLLB 2CDEA 4Z7WB 4ZO7A 4JPWH 4WFED 4PGBB 3L9RB 2X44D 3F58H 1YEEH 3FFDA 2J6EH 3ARGA 2CUMA 2AABH 5IB5B 1QSEB 4ALAL 1EAPB 1U8PA 1AKJB 3MRGB 2V2WB 3U9UB 3TN0C 5CZVL 1C08B 1U3HA 1OGAA 1UCBH 1TTFA 4J3SA 1TQCB 5KVDL 1XGTA 2VO5A 3VI3F 2VDLL 2PNDA 2QQNL 4KJQC 4M6NH 4OGXL 3MRLA 1D5XA 4PRHB 3CFCH 2QHLA 1A7NH 5F89A 2ENSA 4U3HA 3K8KA 5DFWH 5DJCA 4L4TE 3S35X 5I15L 5T3ZH 1EERB 1MIMH 3CFDB 3FOMB 3BWUC 3INUH 4HWZA 3RWJB 1L0XA 3RVVC 2ZKHH 1INEH 2X1OA 4H8WH 4WUUA 2DN7A 5L9DL 1ETZA 3O9WB 4MJIA 2HKHH 5D1QA 1H9VA 3T3PE 3DECA 3QEQB 4LKCB 2ERJB 5FUZL 4HIIB 4WO4D 5I1KH 2ESVA 5ICYB 1BZ9A 4J4PC 4DW2H 1FRGL 2CLVA 2JCCB 1MELA 5DJ6A 5I9QB 3N1GC 5BW7A 1F4YL 5D2NA 4GKNA 3REVB 4PV8A 4MXQD 4N0UA 4PRBB 4PJ8C 1KCRH 4O2EB 3DBXB 2YD7A 5GRUL 1PKQE 1D5IL 3VA2C 1N26A 2VXVL 3IYLW 5HHMD 3BT2L 1BQUA 1NCDL 2FD6L 2NY5H 2I24N 2EKSA 1KV3A 3O0RH 5SWSE 1OP3K 3T3PF 5F7DA 4YGVB 2Y4SA 1ODAA 5DDHA 3BESR 4HKBA 1YEKL 4MNGB 4L4VA 5AAMA 2IAMB 3PL6C 3STLA 3RUGA 1B0RA 2PKDA 4ZD3H 1TQBB 4JJ5A 5KSAA 4U6HB 4EBQH 5A16B 5ISZD 1E4WL 4RQQA 1JPTL 3O6MH 4S1QL 1MH5B 5LCVL 4Q9QL 1ZK9A 2GI7A 1RZFL 4U1SB 2XY1A 4EIGB 1CZ8H 4PUBH 1KSRA 5ADOH 2A6JB 1AGEB 4G9FB 1JL8A 4F7PB 3TO4B 4QRUB 5BV7H 3BHBB 5IEKA 1AXTH 5E9DB 5CWSA 5LGJA 4YXHH 3KWWB 1A6TA 3G5XA 4LVOB 1KPRB 4Y4FB 3KYAA 4X7CC 2Y06H 3DSNA 1KENL 4M00A 1IC1A 3RIFK 3OJDB 4JFYA 2BVOB 2DQHL 4JG0H 2LFGA 5IG7B 2DTMH 4G80B 1IAOA 4NNYA 5IR1B 1HQRA 4K94H 2BNQA 5CBAB 4CADB 2PYFA 3RZCA 5DK0A 1BJ1H 3KXFD 1C5BL 1OF2A 3OF6A 1OT2A 1S3KL 1S5HB 3NGBC 3BP4B 4YR6A 4JPIA 1LO4L 2MQ0A 3LKNB 4G9DB 3BE1H 4RAUA 3WS3A 5E1HB 3TZVD 4EDWH 1MFBL 1MRCH 1I8LA 1QSFA 4NO2B 4R7DB 3B83A 4PRNA 4H0IA 3RBSA 2CR6A 3QIUD 1G7HA 3IXTB 1CR9L 3SQBA 2M2DA 4PRIE 5CKGA 1IAKB 1A6WH 5KSBA 3ARFB 4Y5VA 2EDXA 4TNWF 4CUCA 1CE6B 1CFVH 4IOIB 3VD9A 5D5MB 5JA9A 5EG6C 1QACA 1JVKA 2Y5TB 4KQ3H 4PRPE 5JO5A 3KPMA 3IDYC 5F9OH 4JY4B 3N1PC 1YEIH 1WJ3A 3GFUA 3VFNA 2AI0H 4N8PA 4WI3A 4HWUA 4FA8A 3L7FB 3MBXH 2OTWB 5JIPA 4I1NB 4NM8L 3HE6B 1ZA3B 3BIKA 1C5CH 3JV4A 2PTTA 2M1KA 5HYJD 9CGTA 2XA8H 3PF2A 3VG0L 2HMID 5E7BA 3FQNB 4Y4KA 1WAAA 4WCYL 1DQDH 1TCRB 1U8MB 3P73A 4NKDB 1H3UA 5F7EL 3S36X 1QLEH 1E27A 5E2WH 2YN5A 4MAUL 2CDFA 4PP1C 5SWQA 1MAMH 2R4RL 4I5BB 4HGWB 1MFCH 4HT1L 1BQHA 2FJFA 15C8H 1ACYH 1JPSL 4MA7H 4GBXC 4I9WE 1G6RA 4JKMA 1OTSC 2D9CA 4IRSC 2EH7L 4H1LG 5JW4Q 4WWKC 1TPXC 4FQQB 1NCAL 2R4SH 3MOBH 1S9WA 4OKVB 5ITBL 4Y5YC 3QQ3B 1YEHH 2VDNL 2ZCHL 1NBZB 4O58H 2MHAA 3TF7C 3MLXL 4MAYB 2OTUB 5DXWA 5F9JA 2YPVL 3NIGE 4G6JH 3AY4C 4I8DA 4GKSA 1YMHB 5DJZB 4TN9A 1ZVHA 3IJSB 4P5TC 5IVZA 1I8MB 4U6TA 1NC2D 3ILPB 5EUOB 1ZT7B 5TF1H 1JYVA 5D72H 4N8VB 4OCLC 1U8NB 5KAQG 3QHTC 5GZNC 3U0TB 3WLBB 1BFVH 2BY1A 3L1OH 3UBXB 5BS0A 1JN6A 1G6RH 4LLWA 4WEMB 4QHNA 3UEZA 3C5SB 3CLEH 2PF6A 3BSZL 5DFVD 3EO1B 2PYEA 2HFFB 5HYSA 3P4MB 4L3EB 3CFJB 4HXAL 5C6PB 3MGAA 2YD6A 4XVJH 4IRZH 2FWOB 4JM2D 2IG2H 1IFHH 1KGCE 4MWFB 3NIGF 1EV2E 5C71A 1FG2B 5CJOL 2D9QB 5K9KA 3JTSB 4TNVF 4ZDHA 3WNLA 2F5AL 4JZOB 1NBVH 1ORSA 1M05B 5SX5H 4MX7B 5I1IH 3O6FB 4K3DL 4HUWB 2UYLB 4JCMA 1LK2A 3DJ9A 4HCRL 4H1LB 1N8ZA 5DI8A 2XTJB 3MV7A 2BSSA 2DQJL 1TZHA 3GIVA 1I1AC 4MCYA 4XBGB 3CVHB 3SKOB 4XH2B 1RUKH 1AC0A 1KIQA 4GKZB 5FYLH 4LAQL 5DRNB 4AK1A 3WNOA 2J2ZA 3T4YA 1DLFH 3CLFH 4OLYL 1GGBH 3F7VA 3QHFH 5JR1H 1CVRA 1O5DT 4RFEA 3GSVB 5D7JD 5B39G 5TE4L 2VXQL 4NSKB 3V0VB 5JW4N 1MRFL 3BAEH 4S2SA 3TESA 1ZS8B 5CIPA 5JW5A 4E41A 1I85A 2ZSWA 1DQMH 5IJVB 4OBRA 1NAKL 4DFIA 5F7WC 1N5AA 1T5XB 4RFOH 4OD1L 3MUY1 3BWAB 4NFDA 2A9NH 3RI5F 1BJ8A 1L0QA 5KANG 3WLWC 1UACH 2ATPB 4PBVC 4OGYH 1KJMA 1GOHA 3DO3A 1HQ4A 4Y4HA 3UYPA 4G6KH 3W9DB 1QFOA 3ZYZA 3RGVA 1KCLA 3GJEB 4MJ5B 1UXSB 4XHJD 1GPOH 1OAZL 1NCCL 1BBJB 2E6JA 4LLQB 2JLLA 4Y16D 5GRXG 2B4CH 2V9TA 2QQQA 1F4AA 3RVUC 2A6KB 3AAZA 2HKFH 3QWQB 4OAWA 4QOKB 4Z77B 1CYGA 4XC3H 1QFHA 2ZP0T 3QDMA 4LLDB 5CMAA 2NQCA 5M94B 1OVZA 1UJTA 5CEZD 5CIPH 3MCLL 5EO0A 1FCCA 5I75C 4PJIB 2CLRA 2ZOKA 32C2A 4HZLA 2DYPA 4RGND 3TWCL 4OLVH 2X2YA 1EFXB 3UZQA 3V52L 5I1DB 1JK8A 2K1MA 1FYHB 4YDKH 5IQ7H 4QRRA 4O00A 3U0WH 3DO7A 1FFPA 3GDBA 3HUJB 4U1KA 3IXAA 2EYRB 3TBWB 4CVZA 4XBPA 4M8VA 3ARGC 2GAZA 4NKQB 4X5WA 3BEWB 1H3VA 5E8PB 2LTQC 5HYQB 4YIQA 3V9FA 2J8UB 4P3DA 4GLRH 4XP4H 1I3VA 2P5ED 1U3HC 4K7PH 3VFRB 4OB5H 4FFZH 4NJAH 1J8HE 4N90E 3BZFB 2ZJSL 3L3KB 4PGCB 2EXYC 1HINH 1EK3A 4L8BB 4P3CH 3MRBA 1AD9B 2DI8A 1IM9B 5BXFB 5FB8A 3I6LE 4JN2A 2FEEL 2AXGB 5EULV 3TBTB 1I1FA 5DJ0B 5H8DA 3GUTB 2XZQH 2VLJA 4N5UA 2YKLL 3IDUA 1RZIA 4OKDA 5CD5D 1CFNA 5LBSH 5DEGB 5L7XL 1G7IB 1ZV5A 3ALWA 3UTPE 3RWHB 3CU7A 3QUMA 5I0DA 5GS0L 4P57A 4GUPB 1TMCB 5D1QC 1T7WA 4LSQL 5ESVB 2UWEE 4B41A 4XB8A 3QUYB 5C0EA 4XMPL 3RX8A 2EIDA 5ACZB 3MRIA 5I0ZA 1X6NA 5E4EC 2A38A 2W9EH 2QSTA 5BW7C 3LB6C 5E56A 1X5HA 2A1WH 5D2NC 2Q6WA 3MRHA 3KPLB 4OI7A 5MENE 4LIQH 1FIEA 1MHPH 3MNWA 2DDQH 5DD1L 2GCYB 3S8WA 3GMMA 1KTLB 3WL9A 1AH1A 3HMWH 4L3CB 1KEGL 2IMNA 3KLAB 3OKDB 4ZSOA 1K8IA 3BD4A 1HH6A 3PHQA 5IJKA 3QG7H 1NLBL 3LSOB 4PTTB 5JUEL 2EIZA 4LNVA 2MPAH 2UWEF 4M93B 1K4DB 3QUMH 3RVTC 2YBRB 4I0PA 1CF8L 1NC4B 4GQ9L 2VOTA 4XVTH 2WIIA 2FZ3B 3RWFB 5CCKL 4NRXB 3EBAA 5HDQH 1KIRA 3S88H 3BGMA 2DM4A 3MUGB 1M7DB 5T5FH 1QRNA 4K94C 2BXYA 5T3XE 5KSAC 4MZ2A 3U30C 1OTUC 4DGIH 1FAIH 4XXDA 2C26A 3HZKB 2D2OA 4NDMA 2GSIA 4XPGH 1KN4H 3WYRA 2B1HH 4OGAD 5IIEA 3W39B 5IB3B 3DV6A</