3UTZB

Endogenous-like inhibitory antibodies targeting activated metalloproteinase motifs show therapeutic potential
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
219
structure length
217
Chain Sequence
EVKLVESGGGLVKPGGSLKLSCAASGFAFSTYDMSWIRQTPEKRLEWVATISSGGSYTYYPDSVKGRFTISKDNARNTLYLQMSSLRSGDTALYYCTRFRYDGWYFDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metalloproteinase, light chain
publication title Antibodies targeting the catalytic zinc complex of activated matrix metalloproteinases show therapeutic potential.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 44
structure length 217
sequence length 219
chains with identical sequence C, F
ec nomenclature
pdb deposition date 2011-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3utzB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3utzB01
4PRAB 1JP5A 5IB5A 1TETL 1HI6B 3HRZA 1YMMA 2XWJB 5FO9A 5C07E 1CF8L 2FO4B 5FCUL 4ZNEE 1AQKH 3D69A 4CU6A 2ZUUA 5C0FB 1ZLUK 5CMAB 2JF1A 3QH3B 3OF6D 2D4FA 4IRSD 3MODH 1XCTA 5HGAA 1WAAA 3QIUD 4HKBB 1R5IA 4JHWL 3CZJA 4YBLB 4F7EB 1A6ZA 4ZUVA 3T0BA 2CSPA 3EYOA 4LSVH 3RQ3A 1I3GL 3S88L 3KYKL 3WL9A 4HJGB 2BJML 2NY2D 1S3KL 3PWPE 1NGZA 5A2KH 1FNLA 1BQHA 3NCYS 2AKRA 5C07A 3PDDA 2FGWL 3MLSH 1IGYB 3JWDH 3REWA 3IJYA 1F90L 1J1XH 3RVWC 3G5VA 4KUCD 4W4OC 1LD9A 5BS0D 5C7XL 3I85A 1A1NA 4QXUH 4DGIH 3U82B 3D39E 3QXUA 2MQ0A 3Q6GL 3L3OA 1PKQE 2RCSH 1D9KA 4XNUH 2NY7L 2VITB 4F57H 4XXCA 1F8TH 2AV7A 5CSBA 5ESVA 4PFEA 2V9RA 3JTTB 1R3KB 1KB5H 3JXAA 4IDJL 4MLSA 1PX4A 5DJ6A 5T3ZL 3MUY1 2VDNL 4MNHA 1JYWA 1X5FA 4HCRL 1A4JB 4J6RH 5D93C 5GZOD 1NKRA 1HHKA 5C0CD 3WXWL 2P8MA 1CD1A 2V5YA 3D39A 4NKIL 5B3JE 3BP5B 1M7DA 4OZ4B 1IGJA 3SCMD 3D3VA 3ARTA 4EVNB 4MD0A 1RHHB 4TTGA 4LVEA 4BQ8A 2BSRA 1B0RA 3UZVB 3TA3A 1ZK9A 4W6YB 5C08E 5TH2A 2EXYD 1I1AC 4UQ2B 4WHTB 4JFFD 3V6ZB 1JGDA 5DC0A 4WI6A 5EWIH 4Y4FA 3Q5YA 3X3FH 4NJAH 4M62H 4PJAE 1WZ1L 5IROC 1E4XL 1DBJL 3WEXB 5DMKA 2A73A 4XVJL 4RGND 3QXDA 5DZNA 3TVMA 4I9WE 5E8OB 5F96L 4PB0L 4QXWA 1ZEAL 4X4YB 1IKNA 5DK0B 3P3YA 1U3HB 3AAZB 2Z8WC 2WUBH 1OM3H 4KKNA 2NY6D 3ES6A 5C08A 2MQCA 4LP4A 4ERSH 2QSVA 5D7JA 1WCQA 5F9WC 5TGBA 1MJUL 3THML 3V5KA 4XTRC 1F02I 2IADB 4LSUH 1KJ2L 1DE4B 4O5LL 4TUKH 3OKNA 4YBQD 3O2VH 4JG0L 2AK4A 2NY5L 5HYJD 3HMXL 4XP6L 3HS0B 1M7XA 1CU4L 4PJEA 1BFVL 4KVNH 2Y23A 3TP4A 3HB3C 3U0PA 3TYFA 3CFCL 2X05A 4RFNB 2YRLA 3LKSA 3NBNA 5FV2A 5D6CA 3UTSB 2FJGB 1VERA 4X5WB 3BP4A 3WSQL 1CD8A 5FAAA 2AI0L 1DQMH 2LE9A 1RVFH 5CGYC 2B1HH 4L8CA 4D0DA 5HI5C 1FL5A 4MJIB 2J6EH 3NTCL 4MDIB 1K4CB 4NCDA 4MA3A 2XN9A 3S4SG 5MEQB 1KT2B 3BKJH 3TO2B 1EA9C 3CSBA 4OCWL 5KVGL 3GSUB 5I1JH 4HWEL 3UO1L 1MHHA 4RGOL 1B0GA 3MZGB 4OBSA 5GS0D 2DM3A 5CP7B 4EDXB 4MQ7A 1P4IL 4Y88A 4XWGH 1KACB 4G9DA 5SWSB 3ZE1E 4L4TE 1V7MH 3LEXB 4OD2B 2W0FB 3MRIB 3LRSA 3VWKB 2MPAH 4LCYA 5MI0C 4UIMB 1B4JL 2KUTA 3RU8H 5L6YH 5DJ0B 4F7MA 4GOSA 1MRCL 2JIXA 1S7TB 5GRXG 2VOTA 2OMNA 1GPOH 3S5LG 3ALXA 7FABH 4R7NB 4YGAB 4Y4KD 5E9DB 1E4XI 2D0HA 1D5ZB 4QTHA 1KIQA 2BHYA 2NY5C 3QDHA 1T1YA 4X7DC 3L1OH 2V2WA 1QBML 4PTUB 4CNIA 4L4TA 2D03H 1AY1H 1AXIB 4BZYA 4AT6B 3OKEA 2Q8AL 2QHRH 4EQ2A 4LDEB 2DBLL 5I1IL 4NZDA 3ZKND 4G3YH 2GW5A 4LIQH 3WS6A 1AGCA 1D3CA 1DFBH 2E7MA 3BEWB 3D2UB 3X14B 4LPXA 1KTLA 3BIBX 3QFJB 5AWNH 3GSVA 1NGQL 1CBVL 5EN2B 5CJXA 2XA8L 5F3HA 2VAAB 3DOSA 3WIHH 4DCQB 4I0PB 4NKMB 4OT1H 5M94B 2FD6H 3VFWB 2ZUVA 4JFPB 1CFTB 3LPGA 2FL5A 3U2SA 2AJ3A 4WO4C 4PJ9C 5DJZB 3VFSB 3ZT5A 5FB8A 1FIEA 1GC1H 3R8BB 3LS4H 4NN5B 1UB5A 1KLFA 2CIIA 1AQKL 1MCLA 3KDMB 1KGCD 3FT4A 3UZQA 4PJFA 1OQOA 1YDPA 2VDRH 3MODL 4OM0L 3X3GH 4F15C 1A1OA 1Y6NR 5KVFH 4H1LA 5IBLC 2NZ9C 5DD6B 2PTTA 3ZE0E 1QBLH 3QDJA 3ORJA 2P4AB 4GS7B 4MXVE 3UYOD 5HPMA 1DANU 2BNQA 2WV3A 1HHIB 2ZSVA 1QZ1A 4P46A 3CUPB 3MLSL 3P0VH 3JWDL 1P9MC 3ARGC 1WWCA 5C9KA 1J1XL 3T0ED 3T65B 2YEZA 4UINH 3ZKQD 5JW4N 4Y7MA 5D1XC 5BXFA 4FXKB 3OKDB 5CKAA 4QXUL 4DGIL 2ERJB 1SJVA 1S78D 4M6OL 1OGTA 5FM8A 4WV1B 3VFTB 3WS3B 5ID1A 1CXLA 1JPGB 2RCSL 1F8TL 3PL6A 1FL3B 3QIBC 3ZL4H 4GRLC 4EZMA 1KB5L 4GMTH 4WW2A 3AM8C 4DGVH 1TQBB 3LMJL 1AD9A 3IXTA 3LS5H 4FOMA 3GRWH 4J6RL 32C2A 5SWQB 3N06B 1YN6A 2F53D 1MCWW 2UZIH 1F13A 4QRPD 5D7SH 4NCC1 4HUUA 1WIOA 3O6MH 4PLOB 3MREB 4M7ZC 1MCIA 4PJIB 3DX7B 4KK8C 3FO1B 4FQCH 3RTQD 1JHTA 4OV5A 3FRUB 5HHOE 3IRZA 1LHZA 3T2NH 3DO7B 2PW1A 5ITFB 4HH8A 1U36A 3H9YA 2JJTA 1UCTA 2A83A 3FCTA 5EWIL 3WUWA 4QRQA 2HT4C 4NQCD 5B39A 3K7UA 3X3FL 4NJAL 4M62L 2X10A 3S96B 4PJGE 1T1ZB 3NCFB 5FIEA 5J6HA 1TZHA 5IBUB 3RVUC 5DA0B 1S7SA 2UZXB 3W0WB 4NN7B 2DM2A 3JWDC 1X6NA 1KJMB 4UT9H 2HKHH 4ODBD 2ARJA 2P5WB 1EEZA 2WUBL 1OM3L 3G5XB 3Q1SH 3ULVE 1NUFA 3LDBB 4LKXA 3CH1A 1YQ2A 5GGTA 2R2HB 3I6GA 4QRRB 4ODSH 2DQTH 4RBPH 1G0DA 4RAUB 3EFDH 4U1KA 4LSUL 1OY3B 4GAJH 4WEUD 3V6OC 3EDJA 1A14H 3BOVA 1I8IB 4TUKL 3O2VL 3CAFA 5DJAA 4NRZB 1PZ5B 1NGYA 2VLLB 4KK9D 3L3GA 1UZ8A 4YDVA 4S1DD 5L8KB 2CDGA 4UNUA 4NKDB 1ZA3A 3B5TA 1IAOB 1TJGH 4KVNL 4HUWB 3RIFF 3DV6B 5DJ8B 2EICA 3FOMB 2FIKA 4A6YB 4IOIA 3DGGA 5D96B 4P5KA 1DQML 1RVFL 2B1HL 1ZLWK 1KULA 3LKOA 2FEEL 2J6EL 4PLKD 1MHEB 4LRNH 2KPNA 5IWLA 4J4PD 1AC6A 1TNNA 4PJBF 5GGSB 5I1JL 2XNAA 2EDFA 4IMLA 3G08A 5EU6D 4Y2DB 4XWGL 3OXSA 2PXYD 5IW1A 5ERWA 1V7ML 3MMEB 1UJ3B 2CD0A 4W4NA 2MPAL 5DD0H 2ZOLB 2YUVA 5IB1A 2XKSA 1MEXL 2EDBA 3NPZB 1ZHLB 4JY4B 1QFHA 3RU8L 5L6YL 1FVDB 3FKUS 4FQJH 3FRPG 3EIFA 3TO4B 4JQIH 1BHGA 4APQB 5F7UA 1GPOL 3TLRA 7FABL 4YUEH 5HHMB 3NIGE 2XV6B 3RJQB 3DRTB 5B4MC 3L1OL 3OR7B 4YDIH 2D03L 3OXRB 1AY1L 1OWWA 4WHYH 1U91A 2QHRL 1D5BA 4G3YL 1VEMA 3P9WB 4LIQL 4EN3A 1FJ1B 5I73B 2I9TA 1DFBL 1GCFA 2JCCB 4KGLA 3LKPA 5AWNL 2ADGA 1RIVH 4FHBD 4HQQH 3DRQA 3ZMRA 3OB0K 3WIHL 3QFDB 4IHOA 2YA2A 4OT1L 2AVGA 2FD6L 4LLYB 5D7LB 5IBTH 1RJLA 4CN4A 4HZLA 1U8PA 4DK3A 1GC1L 1X7QB 1PX3A 5J3HC 3KPRA 3LS4L 5C0BB 4YWGH 1GSMA 2GY7B 5HGDB 3BH8A 2ADIA 4MQXC 4U6YB 5H35B 4P23C 3V7AG 2QLVB 4X6CF 5FDYA 4ZXBD 2OSLB 3ILQD 3QDGD 2VDRL 3X3GL 5KS9A 5KVFL 4MD5A 2YD4A 2FEEI 2IH3B 3DHJA 1SEBA 4MAYB 1QBLL 3NACH 4BQ6A 3V79C 2OI9C 4LP5A 4MB5A 2VZUA 2XTJB 3P0VL 4JRYE 3PGFH 2B1AH 3SKJH 5HD8D 5GRYA 1MVUA 3IDYB 2N1KA 4XAKD 5E1HB 3WIFB 4L3CB 4W4OA 5TDNA 4NO2A 2EXWC 1ZWIA 3O9WC 3F6IA 4LLMB 4UNTA 4CBPA 4YHZH 1J1PH 4HK3J 4NIKB 3ZL4L 1PJ9A 4GMTL 5DRWB 2PYEE 1FZMB 4R4BB 3N50A 3QDAA 3LS5L 4P2OB 1F4YH 2H6PB 3GRWL 4O02H 1XF2B 2UZIL 5F1OB 1YPZF 4CJ0A 3RDTD 5D7SL 1FCGA 3O6ML 3T2QA 1NLDH 1GC1C 3ZKSD 5JHDA 4ZPVB 5CIPA 5IHZB 1TPXC 4FQCL 4XHJC 4J3UA 3IS1X 2UWEE 4C56B 3T2NL 2YD5A 1MIMH 5FFLA 2NXYD 1I7ZA 1YN7A 4X7TB 5IR1A 1VHPA 2R23A 3LQMA 2PYEA 4HK0A 3O6LH 1NL0H 4Z7VF 3E6FA 4O4YH 5FCSH 1A6TA 3O45A 3L3HB 1Q9LB 4TVPH 3QUYC 1L4IA 2X4RA 5IROA 5EUOF 4J1UA 1BX2A 2HKHL 2UWEA 3FB6B 4UT9L 1QA9A 4PRHD 3O4LE 5F7DA 1ZSDA 3Q1SL 1KN4H 4HPOH 4UOW0 2COQA 2D3VA 3ARFC 4ODSL 5FO7B 3VXME 2BVQA 2DQTL 4F9PA 1Z9SA 2HLAA 2VJXA 5IQ7H 3RL1A 4PJ5A 3F62A 5D2NE 3EFDL 3V2AR 3FT3A 4GAJL 4Y5VC 1A14L 2NZIA 4OZIB 1G7HA 3UDWC 3CXHJ 3MV8B 3ULSA 3U7AA 1NC2D 5J11B 1NBZA 2F54D 5CJ5A 5GSVB 1C7SA 1GZQB 4IOFD 3S5LA 3DXAA 4IIQB 4HCRA 1TJGL 3G6AA 2Q1EA 1K4DB 2ORBH 2HT2C 3LAFA 1MCPH 2CJUH 4NQED 4FQ1H 1A7RH 3D85A 5C86A 4FFVC 1OW0C 3RJDA 1A3LH 1ZOXA 3DIFA 3BW9A 2IPTH 1G9EA 3VFUA 4JFYA 1G7QB 4LRNL 2DTMH 3WJJA 3SGKA 3BH9A 1ED3A 4GAGH 1KJVA 4HJ0C 2FWOA 4WENB 1E4KA 1JZ4A 3INUH 3REVA 5KSAD 3KYNB 1ORSA 2GT9B 1W0WB 4JHZA 4PPTA 1F2QA 4M02A 1MOEA 1Q9KA 1MCSA 1T04B 5DD0L 4LLDA 4Z0XA 3PF2A 3BKCH 3PWLA 3V5DB 4FQJL 5C2UB 1S7UA 5FA3B 5I74B 3MTRA 2BVEA 4JQIL 2I5YH 5SWZD 3N1QC 4OD1H 4YUEL 1FDLH 3DBXB 4L29A 2ATPB 3SJVE 3JZ7A 4EIGB 3TBWB 5DEFA 1KJ2A 4MA7H 4QT5A 1TDQA 1JRHH 1QHOA 1HK6A 4YDIL 1BQSA 3H8NA 1B88A 4K3JH 4LRIA 3LB6C 4QXTA 1ZVSA 5C09E 4G42B 3PQYB 2VDQH 1UXSB 4B0MM 2I9LB 2OLDA 4I2XB 2H2PC 5FKAB 3AY4C 1V3MA 4Y5YB 3HG1B 1RIVL 4HQQL 3GIZH 3M8OH 4LDLB 2CO6B 4DUXA 3SJVA 3E6HB 1D5MA 1S7VA 3MJ8A 2Q87A 4KJWD 3ECBA 3ESVF 2WNGA 3BAEH 3HNVH 3CX5K 4NM4H 5FA4B 3IDGA 5JIKA 4HMEA 5IBTL 4QKXB 1X6LA 3QYCA 4XBGB 2R15A 4X98A 5C09A 3AB0B 5DDHB 2DB8A 4YWGL 4UOW1 4MB4A 3PDOB 2A77H 3KJ4B 4JFEE 1AGEA 2PNDA 4ZQKB 3DMMC 1ZAGA 3H9ZA 1BJ1J 3NACL 3RGVD 2PR4H 4PJXF 5EBLB 1OT1A 3BESR 4ONHA 3QSKB 3H9SD 3U36A 1LDSA 2YZ1A 1OVZA 12E8H 4Y89A 3PGFL 4ZUSA 2B1AL 3SKJL 4P48A 3BZFA 2NX5E 5HHNA 3ARGA 4KMTH 1S9VB 1T20B 1UENA 1U8LB 3OHXB 4JFEA 3B6SA 1LEIA 1W0VA 4JRXA 1AI1H 3HPJA 4NNYA 1E28A 3I6KB 3V4UH 4YHZL 1LNUA 1J1PL 1RZGA 1U2CA 2WBJB 3T3PE 1U93B 4X6DE 1U8IA 3MLUH 5F93C 5EIIB 2NY2B 3ULUH 5DJCA 3OG6B 4O02L 1F3DJ 5GGUB 1P4LB 5E8PA 3QO1A 4YXLH 4WU5A 2NX5A 3DVGB 4WI7A 5FGCE 3T8XB 2UY6A 1FRGH 4JFQA 3PXHA 1NLDL 4LSTL 3RUGA 4Z7OE 2BSTA 1HH6A 3QULB 1UJTA 1MLCA 5IFJA 3BQUD 2GAZA 3UBXB 1MIML 3L5WA 2QADC 5TPWH 1FVEB 1QD0A 3SDCC 3NIFE 4PJIE 3O6LL 1NL0L 3IF1A 5JMRA 4BQ9A 4D94A 4MJ4A 4O4YL 3LPWA 2YC1B 4HIIB 4TVPL 2AAVA 2AJYH 1EXUA 4XPBH 3PIQB 3T2OA 2RB8A 1QYGH 4JM2D 3F5WA 1KN4L 4HPOL 3JBG7 5BZDB 4HGKC 4PYGA 4IRJC 4JFFB 3SQOH 1T89A 3QZWG 4JZJC 3TN0B 5IQ7L 3KXFD 3FO2A 5D5ME 3DETC 2VSCA 2QHLA 2BRRH 4WFED 3F7YA 4FQXC 3P4OA 2C3WA 2CUIA 4KHXH 2D4DA 2EEAA 4NWUL 1KB5A 5MP6H 3FRPA 2DIJA 3RL2B 4RMRA 1WCBA 4Z77A 3QEQD 5DEGA 1CWVA 1F42A 3O2WH 2NY6B 2QEJA 4AYFA 2ORBL 3WJLC 1MCPL 2CJUL 5IB3A 2A6DA 4FQ1L 5E5RB 4AIZA 1LP9E 1A7RL 5L8JB 4P59H 2VR5A 5D5MA 1A3LL 3B9KB 5D7IB 4N8VG 5JORB 5D8JH 1UEMA 2OR7A 3BPCA 3FTGB 2IPTL 3HE7B 3OR6A 4KJYB 1ZHNB 1P84J 4POZC 3QIWA 4XCNA 2DTML 1GRWA 3MV7E 3M1BA 4GAGL 5HYEA 1YY8A 3C6SA 1JE6A 3INUL 1CFSA 5GS1C 2V2TB 5F1SA 4WWID 2NY3C 3MYJA 2MOVA 5LXGH 1QFWH 2IBGA 5I9QB 1ZLVH 4OFPA 1LP9A 1A6AB 1U8NA 5F6IC 3PWVA 3MNVA 4GRWE 5LGHH 1EGJL 4KMQA 5IVOA 2X89D 2AJZA 3BIKB 4OLYH 1I8LA 5T5NF 3MA7A 3S98A 3FQUB 2O26U 1INQB 3BKCL 1DZBA 2X1WL 2Z93B 2I5YL 3FB8A 2X4PA 1WC7B 1JHLH 1DL7H 4OD1L 5F21B 1FDLL 1FE8H 4FQIH 1JRHL 3DARA 4ESKA 3S9DB 4HUXB 4L8SC 3UROR 2JTDA 4U0QB 4KROD 3VD5A 3E2HC 4K3JL 5E2WH 3ZYIA 1NFDF 1I7UB 1SHMA 4PJ8A 5JMOC 4GKSA 3G6JB 1FCCA 3WN5C 2GJZB 2VDQL 5GSRA 1S9KC 4YFDB 3HAEA 1KNOA 3MJ9H 1I8KB 2WP3T 2KQNA 1QSEA 5HSFA 5C0AE 3VU2A 1BZ9A 3M8OL 5TQ2H 4N0CD 1AR2A 5A40E 3BAEL 2JCCE 2WSKA 3HNVL 4NM4L 1II4E 3A67H 3G5YA 3KPOB 2HJKB 3LD8B 5IQ9A 1G9MH 2AEPH 3O3DB 3U4EB 3PWJB 4UIKL 3TWCH 2V2XA 4WTWA 1UADC 1M7IA 3GMRB 5H8DA 4HKXB 5DJYB 4PJHE 4AM0A 3SDAA 2A77L 3TNNB 1FZKB 4P23A 4XCCH 5C0BE 4R0LB 3SKUD 3EYQC 4OZGA 4ISVA 1F4HA 4GQ9H 5HY9B 4UTBH 2PR4L 5L7XH 3UPRA 3IFLH 2BMKA 4GW4A 4CW1A 2ESVD 12E8L 3T3MF 4QGTA 1EFXD 4JPIB 1I9RH 4ZAKA 4KMTL 1REIA 2R69H 5DLMH 2DLIA 2UVEA 2K9UA 1OOAA 3IVKB 4QHUA 5IK3A 1AI1L 3LQZA 1HINH 5A2FA 3V4UL 4I48B 4JB9H 3U46A 3GKWH 5T1DH 5BJTA 3O9WA 1VFBB 5FYJD 2Z4QA 3MLUL 2VWEE 1P7HL 2R0KH 4TPRH 4QHNB 5F9AC 4DWHA 2Q3AA 1EEQA 5FM5O 2SEBA 1QACA 3WHXA 4N0UB 4P5TD 1CLCA 3ULUL 2RJMA 4CDGC 3SO3C 4OLUH 1JRHI 1XF5B 3H6JA 5E08H 4YXLL 1WIPA 3GMMB 1JNLH 3K8LA 2WP3O 2EDWA 3T0EB 1WFOA 2XPGB 2C4FU 1WUNT 4GG6E 5GRVL 1FRGL 1FG2B 5E8DH 5JTWA 3HZMB 5HGBA 4OQTH 3U4AA 4NDMB 4MNQE 2W1NA 2FX9H 5K59F 3F7RA 4JN2B 1FNEB 3CVHB 4C83A 5DRZA 4PRPE 2Y72A 5TPWL 1ZT7A 1YEJH 3KS0H 5DTFA 2VR4A 2AEQH 4JKWA 1MFNA 1Q94A 1EIBA 3KPMB 1BFTA 1WAAF 1FZJB 3L3JA 4OTXH 4XRCA 5J6GA 1GZPA 4LVNB 1ONQA 2AJYL 1PGRB 5AZ2H 3RIFK 3L6FB 3MRCB 3RZCA 4YBLC 3LRGA 4N0YH 2GCYA 3S6CA 3VI3E 2APVA 1QYGL 4JPWL 4PRPA 2X41A 5T1LD 3O6FB 4BH7A 3ZKMC 5JR1L 4S0SD 1HYSC 3QNZB 1CR9H 3SQOL 1EFQA 1RIHH 4QTIH 4ZUWB 2CRYA 3OWEA 3ARFA 1YUHA 4KRPD 5LGJB 1ZT4B 3GSNB 2F5BH 4Y16A 3PHOB 1MWAB 2I60H 3RGHA 5IOPB 2LABA 4UTAH 3NFSH 2QQNH 3TCXA 3ARBB 3PJSB 4Y5VA 4OF7A 3BDXA 1GGBL 4H25B 4K8RH 3TCLB 3GSQA 3UDWA 3ULUC 1X4XA 2NNAA 4M9OA 4WUUD 5MP6L 2IMNA 1HHHA 2RBLA 1WBXB 3CFKB 4BM7A 3TH3T 4PREA 5I16B 5FYKL 1JL8A 4OLXH 2G2RB 2A0LC 2V7NB 4D0BA 2V5SA 2AV1A 3O2WL 4JFZH 2JJUA 1W72B 3VE0B 1XR9A 3MLZH 4XCEB 4P59L 4W70A 5LAXB 1F3JA 1X5GA 4KKBD 5JW4Q 5D71H 5D8JL 1QRNE 4K9EH 5ACLA 4B41A 1UVQB 4EI5D 3DHMA 2YPVH 3CFEB 2XKNB 5EO9B 1CXIA 5JNYB 4A6YH 5T33L 1R24B 2R4SL 3QEHB 3VFMB 3O3EB 5IVXA 3LN4A 1A47A 3V7MA 5SV3A 5LXGL 1QFWL 3Q3GB 1S7RA 2N56A 5CBEB 4M5ZH 2OMBA 3RWJB 1UKQA 2UYLB 3FT2A 5LGHL 2VLME 3TH4T 3Q48A 1FN4B 1QRNA 1A4KA 1OTTD 1V05A 4OLYL 4PLJC 4KV5E 4QGYA 1XH3B 3VCLB 3GSRA 5AUMB 4Z7QE 1JHLL 1DL7L 1U3HC 4XCFH 3DTXB 4YO0A 1UM5L 4NN6B 3HI6H 4YX2H 1FE8L 1VGKB 5FGRA 5EUKB 4FQIL 4JJHA 4Q6IA 5JIIA 4PJAF 4HH9A 4GKNA 5E2WL 3RWHA 5IVZB 1OD7A 5FEBA 1DLHA 5DGQA 1LDPL 5GS2D 4CGTA 1H3XA 4W68A 4A2LA 1K5NB 3QXVA 3C5JA 2P8LB 3IS0X 3C8KB 3MJ9L 5TDPA 2BSSA 4ZNCD 4NO0D 4PJEF 3AY4A 5TQ2L 2HFFA 4IRZH 5E5MA 4NO3A 4CMMA 1VFOA 3TBYB 2OYPA 3NCMA 2PO6D 3GJFA 3QQ3B 4RFNC 3A67L 3HG1E 1NBYB 3ILPB 5C0EA 1ACYL 2EEDA 2Y7QB 1GOFA 1LVEA 4LPYA 4NNXB 1RJZA 1G9ML 4O51B 4UQ3A 1LO2L 2ICWB 3TWCL 4BUGA 4YZFE 2APFA 5EB9A 4MS8C 4RRPG 3RNKA 4XCCL 4XX1E 2IPUK 5D4QA 4OKVA 1RK1A 2E9WA 3BDYH 4QHLA 3EGSB 3VXSA 5DZLA 1DEEB 1TCMA 3DMMA 3FFDA 4GQ9L 3BZEB 3CSPA 3B2UC 4JFDB 4UTBL 4AQOA 5L7XL 5LQBH 3IFLL 3LKNB 5A16A 2AP2A 3VWKC 5DRNB 3WXVH 2ZKHH 1A9EB 3LHPH 3QEUB 3QQ9C 4LHJB 3X11B 4DFIA 5EFIB 5GRJH 2YN5A 2A6KA 2Y07H 1I9RL 4HLJA 3MRQA 4HGMA 2R69L 5DLML 3S7GA 5F89B 3C5SB 2MKWA 1R6VA 3GSOB 3QDGB 1HINL 3R1GH 5BRZB 1MLBA 2JKXA 3O41B 4JB9L 3GKWL 4U2ZA 4YHKH 5T1DL 5CEXA 4ZUTA 1G0YR 1UWXK 2EYSA 2HVKA 5IM7B 5CINH 5FK9A 5HGHA 5I8KH 4GMSH 4DK6A 2R0KL 4TPRL 3T4AB 3SDXA 3RVTC 5DVNA 4G7YH 4KU1A 4OLUL 5C0ND 5JOFB 3QZWA 4JO1L 4M8QB 5E08L 2BXYA 3UJJH 2H2SD 1JNLL 2BVUA 1NH6A 3P4LA 1T2QH 4L3EA 1RUPH 5EZIH 1U95A 4D9RD 4Y19E 5E8DL 5T3XD 5T1KB 3MRGA 1G9MC 1AHWB 3RP1A 1AJ7H 3BN3B 4LU5H 2E5EA 4OQTL 4YHPB 4I0PC 1T03H 1IGMH 5DJDA 5EIQA 4P4KA 1NSNH 3CXDH 4Z7UE 4YDJA 5BS0E 3EHBC 1YEJL 4IRSA 1OF2B 1OGAB 2AEQL 2IPKB 2ITCA 4NN5C 5A3IC 5DI8B 3QIUA 2NY4D 2C3VB 3IJSA 2NTFA 4LAJH 4TSCL 5IHUL 4PJFF 2LFGA 1YMMD 4S1RH 4N8VA 4DUWA 5JOEA 3P4MA 1A1MB 1NAMB 4OTXL 4Y19A 2OQJA 3RDTB 3D87B 3SY0A 5AZ2L 4DKAA 2JJSC 4XH2A 5ENWA 5JXEC 4G80B 4PP2A 4PGCA 4N0YL 3FQTA 3SKOB 4JE4B 4Z7UA 1U92A 4GS7C 5C0CE 4WNQB 3S34H 3D9AH 1ZANL 3A6BH 1GGTA 2NXYB 5SX4I 2CH8A 3EW3B 1FYTD 1CR9L 3KHQA 4QTIL 1J1OH 2R9HD 1S7QB 1JUFA 3EZ8A 1N4XH 2Q7NA 5C07D 2F5BL 2CLVB 1SYSB 1K8DA 3NFSL 4UTAL 2C26A 2QQNL 2ERJC 1SYVB 1X5IA 4K94H 4P4RA 4JFFE 2NQCA 3QI9B 3O3AA 2X4NA 4K8RL 4FQXA 1QSFD 4L9LB 4WV1C 3C9NB 1RD6A 4MXVF 3P9MA 3UTOA 4WEMB 2P7TB 4WW2F 3RWIA 4LSPH 4OLXL 5DS8A 4LCCB 5CBAB 1D9KD 4JFZL 3G5ZA 4F7CA 1TQBC 4G6AD 4K3DL 4NQDD 3MLZL 4RGNE 4CVZA 2V7HB 2FYYB 4LF3B 4M4RA 2C3XA 3MRPA 1K3ZA 2CK2A 3BRGC 1LE5B 4H26B 5D71L 1WJ3A 4BFEA 4K9EL 4GW1A 3CLEH 1DVFB 2BY1A 2D0FA 3QDMB 2YPVL 3KVQA 4A6YL 1AKJA 3D39D 4X5XB 5DFVC 5MEOB 2NYYC 3L9RA 5D7IE 3D3VD 3LKRA 5B8CA 2F54B 2G9HA 2WZPD 3IFOB 3F7QA 3HZVB 4WI3A 2FHBA 2R2BB 4OIBA 3MR9A 1ZLSH 2A6IB 3TA3D 4M5ZL 5F7HA 5HYJE 3OV6A 1NC4B 43C9B 1X4YA 4WIQA 4NQEB 2DWDA 1KIRA 4OI9A 4Y4FD 3TIDB 2YPLA 1Q9OB 3AUVA 4ZFZB 3ZDXE 5EC2A 2R0ZH 1DN0B 3EYFA 4NN7C 2GJ6B 1N5AA 1JHKH 4XCFL 3TVMD 3DYPA 3HI6L 5EO0B 4YX2L 5MERB 3LDBC 4HDIB 5BCAA 5C70A 2R8SH 4H0IA 5BW7C 2F74B 2UUDK 1JN6A 3VRIB 1XGPA 4K8RC 4RSVA 3ROLA 2FEDD 1RJCA 4HD9A 5D7JD 4ZUUB 2FB4H 4PJBB 3V5HA 3WKMH 1MFBH 4OF6A 5AD0A 3VA6A 3C8HA 3MLYH 4XXDA 3EYVA 2I26N 1BOGB 1F11A 3DLQR 1NEZG 2H45A 5DHYA 2AK4D 2DKMA 2GJJA 2OX5A 3ULVF 1J8HB 5EO1B 1PFCA 5SWZB 4LKCA 3G6JE 4IRZL 1U8OB 3BGAA 4K9EC 4I4WB 3LPFA 4JAMB 4K7FB 2DAVA 4B50A 1WBYB 2VLKA 4IM8A 5D96C 3HCVA 1LO5A 4PGEA 1W8NA 3KLAB 3VXQA 4Q9RH 3EZJB 5IBUG 3BO8B 3F7VA 2HMIC 2DRUA 2YSSB 4R3SB 1JWUA 2YPKA 2KZWA 5HJ3A 3VXUA 2XN9D 2DDQH 3BXNB 1ZLWH 5EOCH 1EGJA 2VUOA 3BDYL 4OF3A 4Y2DC 4D0CA 1KTDA 4HLZH 1FAIH 5LQBL 1O7SA 1UJ3C 3K46A 1PQZB 1SMAA 4HJJH 3O3BA 3WXVL 2ZKHL 3VD3A 1JV5A 3JVGC 4HS8H 2CLZB 3LHPL 5EBMA 1P7QB 1E27A 1MCJA 5GRJL 4HWUA 2Y07L 2LU7A 1QNZH 3TO4C 3GSXA 4APQC 5C9JB 3ARZA 5AEAA 2FECL 3EFFB 1FH5H 2JIXD 2YK1H 5IUSA 1AQDB 3ZYOA 4MAUL 1AIFA 1G7PB 3R1GL 4FRWA 4I18B 5MEPA 4JGJA 1DBAH 2CUHA 4YHKL 2NR6D 1DR9A 5CINL 3RGVB 2ICEB 1KGCE 5I8KL 4GMSL 3OKKB 1KCRH 5FGBC 1OWRM 1AGDA 2J12B 3MRBA 4G7YL 2BVOB 5E8EA 5I73C 2DL9A 2WANA 2IANE 3PGCA 4PGDB 5JQ6H 3UJJL 2Z31B 3T0WA 3TESA 2Y25A 3OJDA 3NIGF 2RFXB 1T2QL 5EZIL 1RUPL 5DHVB 1JZ2A 1PAMA 2D7QA 2DI9A 3L5XH 5DK3A 1AJ7L 4XNMB 4LU5L 1MI5B 1T03L 2JK5A 2OL3H 1IGML 5FM5M 5HI4C 3FQRB 3RWCA 1IL1B 3TNMB 3WNMA 1UB6A 4IJ3B 1UFUA 1NSNL 3CXDL 4PB9H 2ZG2A 3MLVH 4YLQT 2W60B 5IJVA 5DMYA 1Y18A 3OB0H 3W11D 3MFGB 3IDMB 3V4PH 3VWJD 4PRAA 2IANA 3C2AH 4GT7A 1HI6A 1KBGH 2PW2B 4S1RL 1OLLA 5L8LB 2FO4A 1WZLA 1A7BA 5HVHB 5KS9F 5C0FA 2VAJA 5ID0B 1G1YA 3NFNB 3L7FB 4G6MH 4R7DA 1KYOJ 4L8BA 3GHBH 5MENE 5J1SC 2VB5A 5F7WC 1ZVYA 2PYFB 4MAYC 3G6DH 1YPZB 2F53E 3S34L 4F7EA 5GJSH 3A6BL 4QRPE 4TVSa 3QDJD 5IF0B 2VISB 3PWUA 4JZOB 2H32A 5E70A 4AG4H 5JPMB 2XTJC 1VGEH 1J1OL 2BNQD 5FKPA 3QUXA 1N4XL 2X1XR 1KIPA 4WJ5A 3QPQD 2F5AH 3IDYC 1T3FB 1CDYA 2HTKD 4NHCH 3EKCA 4K94L 2VWEC 5MENA 1QSZA 5GGSY 4GG8B 4NQCE 4RNRB 2DQEH 4S11A 2DKSA 4UBDD 1RUKH 3ABZA 4LSPL 4OCXH 3WFEH 4Q58C 4E41A 3BN9C 1NBVL 5TE6H 4TTDD 3PL6D 1R3KA 4P2OC 1MUJB 5DQ9A 2BOCB 2X7LA 4YFLI 1T21B 1VENA 1N3NA 3CLEL 4TSBH 4X7FC 4QHKI 2C5DC 2J8OA 4D8PA 3RWFA 1YNKH 3MCG1 3BP5A 4OZ4A 1HSAB 1RHHA 2R4RH 4YXKH 4U6HA 2IFFL 5CSZB 3QEQB 1ZLSL 1ODAA 4RISH 4BFIA 3VGFA 3VXOB 1HH9A 2W91A 2HT3C 3OGCB 3L7EB 2EH7H 2NY1D 3TBVB 3QHFH 1T7VA 1G7LB 2AQ1A 1MFCH 2GK0B 4ELMB 4K2UH 4LMQI 2UWEF 2VR9A 2R0ZL 4QRSA 1HZHH 1ULVA 5KW9H 1SEQH 1JHKL 2DWEA 3STLB 1C7TA 5DVKA 3BZ4B 1X44A 4RRPA 5DK0A 1QEWB 2X4QB 2R8SL 3D5OF 4K94C 4X7CC 4HWBH 3DURA 2NPLX 2FB4L 3WKML 1MFBL 3BSZH 4M3JA 1BF8A 3ARRA 4PJCE 2W0PA 4KDTA 5DEZA 5EU6E 4AEIH 3TIEA 2WW8A 5J11C 2IAMD 3O11A 2VN7A 1RV6X 3L3DA 4LSQH 5JXAH 3ARQA 2YUXA 1R3IH 2FHCA 3HS0A 4IIQC 3SOBH 2K7PA 2P47B 2BRQA 4QOKA 1CICB 4OIAA 4JLRA 4OUUB 3AXLA 4KI5C 2GFBB 1XGRB 3KWWB 2OK0H 1MREH 3UTSA 1GH7A 1HDMA 4Q9RL 1FLTX 4HIHB 3DUUB 3MC0A 2VDOH 5TFSH 1TVHB 4MDIA 1K4CA 3ARUA 2XFXA 1I9EA 4MNGA 3RKDC 2DDQL 4E42B 5EOCL 3IDUA 4GAYB 4TSAH 3GSUA 3WDIA 2EEBA 5F88B 5DYOA 3SGJA 4KJPC 1FAIL 4PJDE 1CXFA 3CIQA 3KPLB 3AU1A 4HJJL 4TUOB 4HS8L 2MMXA 4FP8H 2WBKA 1N0LA 1NCWH 5JA8B 1QNZL 5I74C 1IAIM 4KGJA 1I3RA 5LVEA 1FH5L 2YK1L 3LQAH 4KI1A 7CGTA 4K3EH 3IGAB 1H5BB 5E9DA 2LQRA 5GIRA 1DBAL 2O5XH 3U6RB 3EO0A 5IG7B 4LLWB 1BIIB 2H8PB 3VFGH 3EJYC 5HTSA 5C2BH 4PTUA 1KCRL 5M95B 3LEYH 4S0TD 3KLSA 3QDGE 1KTRL 1LO3H 5H37G 5JQ6L 1BZ7A 5D1QA 4PJXB 3VFRB 4EN3D 1EFXB 2VO5A 4Y5YC 5HI3D 3DROB 2X9YA 4MX7A 3MLPA 5ANME 3X14A 2EH8H 3L5XL 4OGXH 3QFJA 1U2HA 4UDUB 5I2IA 4HPYH 4XVUC 2FSEB 1TTUA 3FQWB 3PE9A 1JPST 1XGYH 3FN0L 5I17B 2X4TA 4PB9L 5HHPB 3MLVL 1J05A 4JFPA 4WWKC 3AB0C 4G6KH 4XPAH 4NUJA 5DJZA 3V4PL 5CZVH 3C2AL 4C58B 3PNWB 1I3VA 1KBGL 3KPRD 2EYTB 1NKOA 1OTUD 3CVHH 1K8IB 4CN1A 4HIXH 4RMSA 4FTVA 2WLZA 1HXMB 3KJ4C 5I19L 3B9EA 8FABA 4G6ML 2ZUSA 3AS2A 3GHBL 1X5AA 5F6HJ 5ICXA 4M4PA 1XEDA 3G6DL 1YY9D 1XCQB 4U1JB 5DD6A 1HXYA 3KPQA 1X3DA 4KRLB 1T22B 5CD5C 4AG4L 4NQSA 1VGEL 2X4SB 3MNWA 1PEWA 1JFQH 2EYRB 3CUPA 1DQQA 4X8JA 3NCCB 5FYJU 3ARYA 3I3DA 2F5AL 2HFEB 5A1AA 2EIZB 4NHCL 4P2YA 3UTPD 4U6XA 2LU3A 2EC9T 3OKDA 4L1HA 2ITDB 4C4KT 2DQEL 5I1LA 3GSNH 1BD2A 4OCXL 1MWAH 3UC0H 3VFTA 3WFEL 4M7LH 3WS3A 4ODUA 2WBJC 4ZS7H 2YWYA 5ELIA 4CVWA 3ALWA 1FL3A 2NY2C 5ESAA 3ZTJH 5IKCB 4LARH 1RUQH 4MJ6A 5TDOB 3FHQA 3DX8B 1YC7A 4PRHE 3QUMB 1OP3K 3HLAA 1AO7A 5SWQA 3RUGF 4Q97A 1MPAH 1W72H 4HLZG 1BVLA 4TSBL 1T0MA 4P2RE 1F4AA 1MCQA 1NEZA 5K9KB 2AJSL 3PXJA 1ACZA 1T5XB 4X6DF 3DVNA 1Z9MA 5JHDD 3FO1A 3GSWA 4YXKL 2R4RL 1PG7X 1NDGB 3RNQB 3EAKA 2XWTA 2VZTA 1UH3A 2W92A 2ATKA 4YC2B 2R0LH 1IMHC 3UPAA 5FO8B 1YEDB 4RISL 2VLRB 4QF1A 2F54E 4MWFB 2EH7L 4PRHA 3QHFL 3B3IA 2F8OA 5GZOC 5IIEB 2JB6B 1MFCL 3S96A 3RBSA 4K2UL 1T1ZA 1WTGT 4P2RA 1C16A 4EI5B 4W81A 4NQEE 1HZHL 3MBEB 4Z76B 4ZTPH 3UBXI 1SEQL 5LGKA 3NIFF 4ONGH 1OB1B 5FGSA 3BD5A 4JDZB 2I25N 4TQEH 1KCSH 2P5WA 4J8RB 4HXBH 5EOQH 2EXYC 4HMDA 4HWBL 5C1MB 3TN0C 1NC2A 3AMLA 2R2HA 3MOBH 1Y0LA 3QNYB 3BSZL 5FF6B 3LSOB 1XMWA 4PJ5D 4JKKA 5E2JA 2FDBP 1HHGB 2YD3A 4XTRD 2IMMA 3G04A 1I8IA 2L0DA 4AEIL 4X6BB 3CFDA 5I8CA 4PJBE 4LSQL 3MLTB 5JXAL 1R3IL 1T4KB 5C0GB 2E6QA 3SOBL 3UBXG 1D6EB 1I7TA 2D9QB 4M9PA 2NY6C 4IMKC 5T3ZD 3DXAD 3QXWA 5D5MF 4PIRF 1XR8B 4X9IA 3GUTB 4MSWB 3BHBB 1T1WB 1ZV5A 2QKIB 5DJXB 5SWZE 3AREB 3B9KC 3DV6A 5JDSB 2OK0L 1MREL 5FUCE 3D85D 4N8CH 4A6YA 3HB3D 4OBRA 1JK8B 5I8OH 2QTEA 4M7KH 3HE7C 5KSAA 4YBQC 4X4ME 3DX9B 1G7JB 2EDEA 4OFIA 4JQXA 1ZMYA 2VDOL 3FB7B 5D1ZB 5HYSB 4LPUA 4NKOB 5E95B 5TFSL 3E8UH 1HQ4A 1NFDB 5CGYD 3W5MA 1A6UH 1XGTA 2DQFB 1TQCB 1LP9F 2D0GA 4TSAL 2OTUA 1DUZB 4OAWB 5I9QC 2PO6B 3MRJB 4R97B 3EBAA 43CAA 2LAAA 4Y2DA 2Y36H 1I7RA 4OSUH 1CTNA 1UJ3A 4FP8L 3U83A 1FO0A 1CDBA 1C12B 1DDHA 4HWZA 3JVGA 1NCWL 2GITA 1NGPH 4TNWK 1H3GA 3P9LB 1BECA 3PDGA 5CS7A 4JDVA 4XCYB 3GMQB 4NQUA 4K07A 3TO4A 4APQA 3LQAL 3CXHK 4K3EL 3B4NA 4GRWF 3KYAA 2O5XL 2Y1VA 3SE3C 4XHQA 1FFPA 1HNFA 3H9HA 4UU9A 3VFGL 3T09A 5C2BL 5IB4A 3OR7A 3LEYL 3OAYK 5JHLH 1JPFB 1UXWB 3FN9A 1S8DB 1A9BB 1LO3L 3OPZH 5FGBA 1KXTB 4DZ8B 2J8HA 3MRNA 4ODXB 2Y4SA 4X6CE 4HIEA 1IFHH 1FJ1A 3STZB 1NCAH 4IS6B 2CR6A 3VXPB 3H9SE 2EH8L 1G7IA 5CZKA 4OGXL 5GZNC 5I66A 5IGXH 4HPYL 1TZIA 3IDNB 1R5WB 1XGYL 2VKWA 4WW1B 3D18B 1CFVH 4BK5A 4PJ7A 5HHQB 3BYYA 5EU7E 5DA4A 4LLYA 5D7LA 3LD8C 1M05A 3HPLB 3F12B 4G43A 4G6KL 2GTWA 3DPBA 4XPAL 1IJ9A 3H7BB 4LGPB 3UMTA 5IW3A 5C09D 5CZVL 1V5JA 3NIDF 2GUOB 4FZ8H 4YPGA 5FOBB 3CVHL 4HIXL 2BY3A 3GMNA 2HJFA 1JTOA 1N26A 5H35A 2WM0A 3WNPA 1QLEH 3TFKC 2OSLA 4R0LC 5IMLA 3BVNA 1L0YA 1JTTA 1X4ZA 1QPXA 1FG9C 2EKJA 2H9GB 2IH3A 1BFSA 5DSCB 1NAMH 1SJEB 2BDNH 3HZKB 5TF0A 1P5UA 5IBLD 3HC3H 4XNQB 3LQAC 4LLAA 2R1WB 4QWWD 4XAWH 3VFNB 5KVEH 3PGDB 1JFQL 1Q8MA 1FSKB 4S2SB 4ZDHB 3SKMA 5EZLA 5IB5B 2AK1H 5EIVA 4YHLH 4R8WL 5FO9B 1IEHA 2VZVA 3HR6A 4NQVA 5KSUB 2F19H 3ARGD 4U1MB 5DF0A 4FN0A 4JFED 4N5EC 2EE6A 3U4BH 1R3LB 2V5MA 4JRXD 4NT6B 3GSNL 5J0BA 1XCTB 3UC0L 5HGAB 4M7LL 1R5IB 4ZS7L 1F4XH 1M6OA 4Z7VE 1A6ZB 4ZUVB 3EYOB 4LARL 1RUQL 2ZP0T 2F58H 1WITA 1MFAL 3BQUA 4R4BA 3WL9B 1P53A 3WFHB 5IW6A 1ITBB 4ORZC 4P2OA 3CSYA 2H6PA 3KYOB 3T0EC 1BQHB 1IGTA 2JE8A 2AKRB 1MPAL 5C07B 1P6AB 1W72L 3REWB 3UEZA 4KVCH 3IJYB 1LGVA 4OFVA 5EUOE 1S78C 3S97C 1LD9B 1VEOA 3T0XA 1PG7H 5IEHA 4ZYKA 3MLRH 4ZPVA 3KXFE 1VFUA 2AQ3A 2OTPA 4C56A 1R3JA 3L3OB 4DEPB 5DO2C 1D9KB 2R0LL 2AV7B 1PLGH 4HSQA 5ESVB 4GG6F 4CN6A 2DJSA 5E00A 4MNHB 3QEQE 4LVNC 3BYTA 4QXGH 4U1NB 1ETZA 1Q9LA 3NCEB 4X9HA 1HHKB 4FFYH 4D9QE 4ZTPL 1CD1B 5GGQH 1Z9LA 3I02A 2MTPA 1P1ZA 3IDJB 5HGGS 3D39B 4ONGL 4H0GA 4OF0A 2JELH 1IGJB 3D3VB 1U3ZA 3RVUD 3O6FC 4TQEL 1KCSL 5D9SA 4MD0B 1UC6A 4HXBL 1BJMA 5EOQL 2WWKO 2BSRB 1B0RB 3E1F1 1DCLA 1WWWX 3GJEB 3MOBL 1NGXB 4ONOA 1JGDB 1MJJA 3B9AA 2WINA 3HTLX 2XKUA 4Y4FB 3ARBC 3MXWH 5DQJA 1MCNA 2DJUA 5GRZA 4ZSOA 4LNRA 5JQHC 3MRFB 1V3KA 2AS5M 1JZ8A 1JNNH 3ZSTA 2A73B 4ENED 2HG5B 2B4CH 5GGVH 3BZDA 4K55A 3HA0A 4IIQA 1ZE3C 4HKZA 1TCRB 1PSKH 3IFPB 1K2DA 4JM4H 3ES6B 5C08B 1MH5A 2W0KA 1QBBA 2Q6WB 1HSBA 5D7JB 2Y5TA 3V5KB 5I8OL 4M7KL 2HLFD 1EBPA 1IEBA 4PJAB 3S36X 5IVXF 3E8UL 1L7TH 4WTZG 4S1DC 1XGUA 3QIWD 3FMGH 1XGQA 1WZMA 4HBCH 2VXVH 1A6UL 2X89A 1KENH 1IM3B 3BP7B 4GUPB 4QYOB 1DANT 1KLUB 3T4YA 5CP3A 5KTEH 4N1HB 2Y36L 4G6JH 2DYPB 4PJEB 3CMGA 4OSUL 5K9JH 3U0PB 3AGVA 3SQBA 5E2VL 1N59A 2FZ3B 3R4DA 3CFJA 5EZJA 1GGIH 5D6CB 1AR1D 1NGPL 2YD9A 2DMKA 3BP4B 4PLKC 4MMZC 1RU9H 5FXCH 1ADQA 5IMKA 4NFBA 2HP4A 4NN6C 4WI2A 4MA3B 2XN9B 2A1WH 4U1HA 4MA1C 4M1DH 4LK4A 3SPVA 4NSKA 1B0GB 4MDJA 3ZT6A 5JHLL 3OL2A 4OGYH 4MQ7B 5B4MD 4G9DB 1HWGB 3FAWA 3OPZL 4PJ8D 2KKQA 2B8OT 3LRSB 2NCMA 2E7LC 1IFHL 4GLRH 1NCAL 4AMKH 2I9LA 1T1XB 3I3EA 4XI5C 4Y5YA 4F7MB 4F7TA 1UQSB 5IGXL 1QSED 4RGMB 2ESVE 3O3UN 1P84K 4HK3N 3IAGC 3TPKA 1CFVL 5E4IA 1FV1A 2Z0BA 5FA4A 1QFPA 1RAMA 5DHVH 4QTHB 5C3LD 1KIQB 1T1YB 2V2WB 4CNIB 4L4TB 1ZHKA 4X9GA 4AK1A 4LPWA 4G8FA 4A2MA 5DDHA 4FZ8L 5EH1A 1U6AH 1AGFB 1JF1A 1CN4A 5FYJE 1AGCB 4V1DE 1CFBA 1QLEL 2DOCA 3HRPA 3SDAD 1T2XA 4I5BA 3S8WA 4O2EA 1KTLB 4P23D 5FYLH 3GSVB 4DAGH 4JKPH 3H3KA 1BVZA 1SBSH 5F3BB 1NAML 2BDNL 5I15H 1R0AH 3MYZA 1H3VA 4YHIB 4FQ2H 5EBLA 2ICWI 3HC3L 3P73B 2YHGA 4UAOB 3QCTH 2FL5B 4YZFF 3U2SB 1A2YB 2AJ3B 1L9NA 5KVEL 1PW3A 1CLOH 1QRKA 1CGYA 5JW3H 5JIPA 2AK1L 1C5BL 4YHLL 1UB5B 3SE4A 1T5WA 2CIIB 2F19L 4V1DA 4Z7WA 4ZAKD 1U8LA 3KPPB 3OHXA 2HRPH 3FT4B 3U4BL 4PJFB 4QLRA 1A3RH 4XB7A 4XP9L 1YDPB 2OXGA 1A1OB 1IC1A 1F4XL 2PTTB 2EXWD 3O9WD 2WBJA 3RFZC 2ENYA 1U93A 3JSSA 4ZOCA 3BI9X 3B5HA 1ZKAA 2F58L 5EIIA 1UWXH 4P46B 5GGUA 5HD8C 5GPRA 1KXQE 1P4LA 1VCAA 4TULH 4G5ZH 2CLRA 3MGTB 4KVCL 4XVTH 1KUMA 3T8XA 1AHWC 2MNUA 3FQXA 3E0GA 4H5SB 5BXFB 1PG7L 3MLRL 1YEEH 1OGTB 2GYSA 5ID1B 1EHXA 3VJ6B 1PLGL 1JTPA 3PL6B 3O0RH 4WUUE 3VW3H 4WW2B 3O2DH 1K9TA 1AD9B 3IXTB 4CADA 1YA5A 5T1LA 3SEPA 3RDTC 4ELKA 4QXGL 32C2B 3WNNA 1VEPA 1N6UA 1YN6B 3BPLB 4FFYL 5B3NA 4Z7UF 5E24E 4G6FB 3FONA 5GGQL 1C5CH 3QHTC 1JCKA 3MRLA 5DZOA 1QFOA 1RPQA 2JELL 2ZG3A 2NXYC 3KPNB 1NGWB 4OV5B 2DM4A 4PRPD 3QHZH 2H3NA 1MCDA 3P4NA 4JJ5A 2PW1B 5BZDA 4WUUA 5TQ0H 4H0HB 3FCTB 3V6FB 5F8RC 3TN0A 5F8QC 3ARFD 2NY1B 3CDYA 5B39B 1AGBA 3MXWL 4Y16D 3QI9C 4L9LC 4EUPB 5J6HB 1TZHB 1JNNL 1RY7B 5KJRH 1H3WM 3QO0A 4LCCC 1S7SB 2B4CL 3MJ7A 5GGVL 3NFPA 3BRDA 5HHOB 1EEZB 2Z35B 4PY8J 1PSKL 4OIIH 4JM4L 1PVHA 3UX9B 4OKDA 3BWUC 4LLUA 3I6GB 1ZLVK 3PWNB 3B9KA 1DVFC 3S36H 1SVCP 5JORA 4FFVD 3HE7A 3ZHDA 1CL7H 5L2KA 1L7TL 4BH8A 1N6VA 2HTLC 3JV4B 3FMGL 1NGYB 1MFEH 4HBCL 2VXVL 1KENL 3L3GB 3WNOA 4M1CD 1CE1H 4YDVB 5ISZE 1QBAA 2CDGB 4XPHH 2HA1A 5DJ2B 2VQ1A 4KQ4L 5KTEL 1ZA3B 4L8DA 4YHNA 4YQXH 3R0MA 4ZG1A 3QCVH 4G6JL 1A6AA 5E6IA 5K9JL 4M00A 4MJ5A 2ZSWA 5GHWH 2DKUA 1U8KA 1GGIL 1AXSB 2FIKB 3EYUL 4P3DA 3MV9D 4P5KB 3RKPA 1RU9L 1CDJA 4HWBA 4PG2C 3WO3B 3MV11 3TT3L 1WC7A 5ISZA 4FS0A 2A1WL 4I3RH 5E2TH 4CL7A 4M1DL 3RWGA 4YFEA 4MD4A 2XNAB 5E94B 3SE3A 4P3CH 4LPCA 3MUJA 4IMLB 2YD1A 4NO0A 1T0NB 1HCFX 3ZDXF 4OGYL 2X44D 4V2CB 5IW1B 4FFWD 2B4CC 5GGRA 2DQDH 5ERWB 1JYNA 3TYGL 2UUDH 4KFZC 3M17A 2GJZA 5BO1H 5IB1B 4AMKL 4NRXB 5IT2H 1I8KA 4PV8B 3NVQA 2QSCH 1WF5A 3C8DA 2H2PD 2PCPA 3DI2B 3ALPA 1IAIH 5L88H 2GI7A 4AEEA 3KPOA 1ND0A 3IKCB 4L4VB 4DVBB 3O3DA 3U4EA 1U91B 1U6AL 4WFFD 1D5BB 1PG7W 5D7KD 2YXMA 5ESQB 5JIHA 3G9AB 1MJ7H 5FYJH 4EN3B 2I9TB 4RMWA 3VRJA 4HKJA 3RWEB 4NZUH 2LAGB 5FYLL 4R0LA 4DAGL 4JKPL 1SBSL 3VXSD 1IARB 1ROWA 1Z6JT 5I15L 4LOUD 2J1KA 5HY9A 4D9RE 3DMMD 1KPRA 1R0AL 4FQ2L 2VLJE 3CK0H 4LFHG 3QCTL 1I1CA 1RJLB 3H2WA 4HAFA 4XWOD 4HZLB 1PD6A 4PBXA 5LG1A 5DMGC 1U8PB 5AZEH 2M8XA 3KPRB 1NCNA 4JGUA 3HFMH 3MNZA 3NZ8A 5D2LA 3BH8B 5CEZH 1H15B 3O81A 5E7BA 2HRPL 3IVKA 5K59E 4I18C 5M7QA 1A3RL 4AQ1B 4C55A 1YMME 1Q0YH 3RGVC 4RQQB 2VLJA 4O2CA 1VFBA 4XMPH 4E0RA 3RX5A 2QR0A 4IDLA 2ZWLT 4BELD 4KMLB 2Z31C 1VADA 1WAAE 1XF5A 4G8IB 1VA9A 4TULL 4G5ZL 5ADPH 3GMMA 4KDWA 4XVTL 4CDHA 3O6KH 2P8PB 4L3ED 1FYTE 1YEEL 4GLRI 4IJ3C 3QUMH 4P57A 5TDNB 1J9CT 3QPXH 4NO2B 4JN2A 4P4KD 3CVHA 1S9XA 3M45A 3VFVA 4M6AA 5FUZH 4KKCD 1QSFE 3A6CH 3O0RL 3RX7A 4OCLC 4KQ3L 5GGVY 3VW3L 3O2DL 5DVLA 1Y6KR 5HVHC 2C4XA 4JRYB 3T1WA 1FNSH 4Y19D 1FYTA 4NQDE 1MCOH 1C5CL 2A9MH 4KWUA 4Z0BH 4WTZA 4R9HA 3MRCA 5E4EB 3VGBA 5CIPB 4OCMC 2WIIA 3O6FA 1QSFA 1YN7B 4HF5H 1Q72H 5IR1B 5TQ0L 4WCYH 4GKOA 2PYEB 3K4ZA 3D3VE 4HK0B 4ZUWA 2BP3A 5CLWA 5KSBE 1B4RA 3GSNA 1YECH 5IOPA 3E6FB 1A6TB 2FJHA 4NQDA 3ARBA 1FVCA 1J87A 4FQXD 5KJRL 1NQBA 5EU3B 1WBXA 4ODHH 4PTTB 1T0PB 4J1UB 1BX2B 2UWEB 2V7NA 1QA9B 3BEVA 5DVMA 5CD3B 2E7HA 5JLZA 5F7DB 3VE0A 1ZSDB 4AY0A 1F5WA 4XCEA 4F58H 5EG6C 3DV4A 5KSBA 1KN2H 2BVQB 4PRDA 3S36L 4JY6A 3RL1B 2EE3A 1E6OH 2J8UE 3CGTA 5IJKA 1CL7L 3CFEA 2XKNA 1G7HB 1I4FA 1MFEL 1AKJD 3ULSB 1CE1L 1MCCA 4POZD 1HOCA 1NBZB 4XPHL 3ZKXB 3S5LB 1Z0MA 3C09B 3O4LB 3EDFA 2AK4E 1H0DA 4Q9BA 5C6WH 3QCVL 5J8OA 3G6AB 2UYLA 2NY3D 4TVPD 1QSVA 4IOSD 4XBPA 3VXMB 1FN4A 4LCUA 1A21A 5D2NB 2J8UA 2YPLD 4XZUB 3DIFB 1OARH 4LAQH 2AEIT 3BW9B 4PJEE 3VCLA 4R96B 2XWBA 3VFUB 5AUMA 3BKMH 4JFYB 4K23H 2GIYA 4FQQA 3P0GB 4I3RL 3BH9B 1ED3B 5E2TL 1M4KA 3GM0A 5J57B 1VGKA 2X42A 5EUKA 1CG9A 4LBEA 1KJVB 2FWOB 2ZUWA 1EO8H 1QFWM 1LILA 1MF2H 4EBQH 3N1PC 4XP5H 2XN9E 1URLA 4RFEB 2DQDL 1U8MA 2ICES 3WHE0 3ZYZA 3VH8B 4MCZA 1Q9KB 5BO1L 4LLDB 4Y4HA 4Z0XB 2BXZA 3TZVA 1EVTC 3STBA 2CDFA 5IT2L 2E7LA 1CDGA 5JW4R 1LE9A 2B2XH 2W9LA 3PWLB 2QSCL 3CZFB 4HFWB 1CICC 3I75A 2V17H 3TBYA 1IAIL 1NCDH 2R2EA 4OGZA 5DEFB 1DUYA 3QQ3A 4DKDC 1U8HB 4PJCF 3OKOB 3ILPA 2CIKB 2Y7QA 4X80L 4NNXA 3BKYH 4O51A 4LPVA 1DBBH 2VLKD 3NCYP 4QXTB 1ZVSB 2ICWA 4R26H 5ICZA 2C7UA 5FYJL 2J4WH 3BJ91 3IDIA 1SM3H 4O9HH 1MCHA 4NBYB 3OSKA 4N1EA 4NZUL 3PV6B 4GJTB 3RBGA 3VXUD 3AC0A 3EGSA 1HIMH 3SJVB 4P5MB 1D5MB 3NAAH 3QUZA 1KPVB 4JFDA 2M26A 1FQ9C 5ADOH 2BFVH 2ZJSH 3CK0L 5D6DA 3IDGB 5T3XH 1OTSC 2AJXH 5JW5B 3HZYB 4ZFFA 3FFCD 4AENB 4X98B 5C09B 5KN5A 3ZZ1A 5AZEL 5FECA 4NZTH 3UCRA 5EFIA 4U4BA 5BVJB 1CGWA 1YEGH 2BHUA 3L95A 1KC5H 5I1AB 2X70B 1FNFA 1QQDA 2X1QA 5CEZL 1UT9A 1A7NH 1H5BC 4PJDF 5CLTA 2IBZY 1J11A 3E3QC 1AGEB 1WBZA 2V5TA 5BRZA 1Q0YL 1H3UA 5JA9A 4U1LB 3MFFB 1Z3GH 4PY7A 4HS3A 1S9WB 4XMPL 1R5VB 3ZHKA 4JEGB 2QJDA 1LWRA 4PJFE 3T4AA 1CFQA 4QNPE 3ZDZE 1OSZB 4R4NC 4YEFA 5JW4M 4UI2A 5JO5A 5INDA 2GSIA 1VB9A 4NHUA 2OTWB 5ADPL 3EO9H 3NMEA 3O6KL 2W9EH 3QDJE 5DFWH 4ZFOA 3UTTE 5T1KA 3MCLH 3VWJA 2NW2A 1DTUA 1JI1A 1T66D 1AHWA 2BNQE 1ZHBA 4I8DA 4JFEB 4YHPA 2O61A 5F71A 3QCUH 3TBSA 3QUML 1LEIB 1XIWA 2UVFA 3N85H 2Q3ZA 4NNYB 3QPXL 3VFPB 1NJ9A 1RZGB 1ZS8B 2XZQH 4U7MA 2M1KA 5FUZL 1OGAA 3A6CL 1DQJA 4TNVK 1U8IB 3WYRA 3MLXH 1IAII 2C3VA 4L4VD 2IAND 4S1QH 5DJCB 3MRKA 1INEH 1FNSL 5E8PB 3QO1B 1NAMA 4LSVL 2NX5B 4J3SA 3UTTA 3X12A 1MRDH 1MCOL 2A9ML 3WHE1 4JFQB 4Z0BL 4IBLT 3RUGB 2BSTB 4G80A 4LHQB 2R1YA 5IFJB 3SKOA 2GAZB 4ZO9A 1FFQA 1X5XA 3QJFB 3L5WB 3ARDB 4HF5L 1JGEB 1Q72L 3S37X 4X6DB 4WCYL 2YD2A 3ZKMD 2MCG1 1S7QA 1HYSD 2D7TH 3QUXD 4Z18A 2XXMB 3IF1B 1YECL 4XNUL 4HS6A 3D0VA 4F57L 2LV4A 2CLVA 3C6LB 5FGCB 2EDQA 1MY7A 1SYVA 5MEND 4L9LA 5CHNA 3C9NA 3UJIH 1U8JB 1EXUB 2X2YA 3MPCA 2EDOA 4XMLH 4ODHL 3ULUD 4E41D 3P77A 5CBAA 3F5WB 3GMPB 1IC5H 2GHWB 4F58L 1XF3A 1I9IH 4RAHA 1G7MB 1KN2L 4H26A 1E6OL 3FO2B 1BP3B 1DVFA 4EIZC 3QDMA 4PS4H 3ARXA 5FHAH 4S1SH 4HUVB 3F7YB 4OCSH 1N0XH 1OP3H 4POUB 3P4OB 4X5XA 5IVNA 4X9FA 1KYOK 3IXAA 4JHAH 2P24A 4YC2C 1BZQK 5EC1B 4Z77B 5E2UH 5DEGB 4D2NA 2XQYK 1EEYB 1NC4A 43C9A 3GJFK 4NM8H 4UV4H 4LVOB 3PHSA 4F33A 1XF4B 5D5MB 5EU4A 4EI5C 5C8JA 3MBEC 1OARL 4N9GA 4LAQL 4ERSL 3SBWA 4OCNC 3BPCB 4PLJD 1DN0A 3OR6B 1G84A 3BKML 4K23L 4UOJA 3K4DA 3QIWB 4KZEH 3PP4H 4JREB 5EO0A 1WEJH 3PG2A 4JPVH 2F74A 1YY8B 3C6SB 2IAMA 1CFSB 1EO8L 3MYJB 4M7JH 2AQ2A 3BD4A 4EBQL 2AXGB 1LP9B 4XMKH 3VGHA 4CU8A 1U8NB 1OTTC 2A2QT 2C4FT 3HR5A 3MNVB 4NFCA 3WNKA 2Y06H 5E56A 2PUQT 2KBGA 3FO9A 3K2UH 1SY6H 5FYKD 2VDKH 4YAQA 3MA7B 1MIEH 2B2XL 1J8HA 3VG9B 3Q6FB 2G5BA 2W65B 2X4PB 2X09A 3FHAA 2I27N 3MV7B 2V17L 2Y9RT 2CO7B 1NCDL 2IF7A 4I4WA 1WFUA 3NN8A 3DX6A 1NDMA 4JAMA 3AREC 4QOKD 3BE1H 5DRXA 1DBKH 4NC2B 4K7FA 3QWRD 3WO4B 2OS7A 2NLJB 1KTKE 4OF8A 5E8NA 4GRWB 3BKJL 4WFGD 1WBYA 2GKIA 1DBBL 4EI6A 5J12B 4B7LA 3UTSD 5J13B 3ARSA 4PJ8B 5D1ZC 3KLAA 4GKSB 5ICYB 3WDHA 5GSRB 2EDRA 2J4WL 3HAEB 1CQKA 3GB7A 5E7FA 5A2IH 5FV1L 1SM3L 1TQCC 4O9HL 4N8PA 3D0LB 4RDQF 1Z2KA 4GXVH 4JPKH 2H41A 4J7RA 1BZ9B 2P45B 1HIML 2PO6C 3OZ9H 4R97C 3NAAL 4JQVC 5ADOL 2BFVL 2ZJSL 5T3XL 5EZOH 2AJXL 5SWSD 1ORQB 3G5YB 2YA1A 1IZJA 1BFOB 5IQ9B 3RHWF 1P7QA 1DP0A 4NZTL 1YEGL 5I1CH 4QO1A 1KC5L 2V2XB 3QQ9D 4OZFB 4U1IA 1M7IB 5C9JA 1ZA6A 2VL5A 5F7KC 1A7NL 2XY1A 3EFFA 1AQDA 3SDAB 5T5NG 5C0AB 1RZJH 4MGXA 3KPRE 1NMAH 5E9DD 1Z3GL 1NFIA 4ISVB 2NY0D 2E6PA 4JFOA 1OCWH 3UPRB 1LEGA 1DEDA 3HE6A 1P7KB 2BVOA 1MFDH 2BMKB 5KS9E 4GW4B 1NMBH 4CW1B 4F9LC 2Z31A 3OAYH 5D1QD 6CGTA 3EO9L 4M7LT 1JWMB 2G60H 2W9EL 4OGAC 5DHVA 4ZAKB 4PJHB 2YOCA 3MCLL 4PGBA 4PJ7F 1EHAA 2GTZA 3QFJD 4XNMA 1MI5A 4XBEH 3QCUL 5DWUH 1YYMH 3N85L 4QHUB 5IK3B 1IL1A 3LQZB 3TNMA 1CZ8H 3QWOA 3VI4E 3UTPE 3U46B 2XZQL 5BJTB 1L7IH 5C0NC 3MLXL 1KCKA 3EHBD 2HAZA 4GBXB 2SEBB 4RMQA 2BNUA 4S1QL 3WHXB 2H2SC 2PW2A 1INEL 1OAXH 4FTVD 5CWSA 5ID0A 4YBHA 1MRDL 3CDGA 2UZYB 5HGBB 5GJTH 1J86A 1M71A 1VSCA 3RPIA 3RVVD 2PF6A 2DIBA 1RUAH 1Y6MR 1YPZA 1EUUA 3D6GA 1MCFA 2NTSP 4UINL 5JXED 3S37H 3C60B 1JZ3A 4C83B 3CDFA 5DRZB 2VISA 4ORGA 1LMKA 4NC1C 5C0IA 1FSKC 4JZOA 2OP4H 1U0QA 2BCKA 5DTFB 4NOFA 5JHDE 4YFLF 2ARWA 3ET9F 2D7TL 3FN3A 1Q94B 4NO5A 2X1PA 5KSVB 1T3FA 4AL8H 5L2JA 4GG6B 1J0HA 3L3JB 1V3JA 4XRCB 5CJQH 4DGVL 1GZPB 4LCIH 3UJIL 1JPSH 4GG8A 2EKSA 1YMHB 4M5YH 4XMLL 3WFZA 2NW3A 4MNQB 1BD2D 3RZCB 1QVOA 1SVZA 2GCYB 3WFDH 2ID5A 4EUPH 4PRPB 4JGMA 4BH7B 2WQRA 1IC5L 1MUJA 1I9IL 1EO5A 2BOCA 3SDDB 3BX7C 1T21A 1YUHB 4YDLB 4AIXA 1AO7D 4OI7A 2HH0H 4Y16B 1TZGH 4PS4L 5FHAL 4S1SL 3FZUC 5BV7B 2G5RA 4OCSL 1N0XL 2APTA 1QLRA 5GGTH 1I1AA 5DD5H 1HSAA 4PJ5E 3O2DA 3CDCA 1UH4A 4FA8A 4DEPC 4JHAL 1HHHB 1D9KC 2MHAB 2Z9TA 3KNBA 4PBVC 4PREB 2M2DA 4G6AC 4UB0H 1YC8A 4JM2F 4D0BB 2IEPA 5E2UL 2AV1B 1MAMH 5C6TH 3VXOA 4NM8L 2EO9A 4UV4L 1TTGA 1UM4H 3C5ZB 3OGCA 5DC4B 5F7YC 4KKLD 4WHDA 3S4SA 2R2CA 3TBVA 3T2PA 3VGAB 1F3JB 5T3ZE 4JZNA 3DXAE 1GXEA 4ELMA 2GK0A 1AFVH 1BJ1H 3NGBB 3F65A 3ULVH 4IEFB 4NZJA 4P2RD 4P49A 2I07B 5B21A 1S5HB 4KZEL 3PP4L 2O5YH 1RJYB 2Z91B 2X4QA 4JVPA 2P5WD 1WEJL 4JPVL 2HYMA 5I1KH 3V95A 2OR8A 1PYWA 4M7JL 5I76A 1S7RB 4XMKL 4Y4FC 1WZKA 1EBAA 4QRRD 3FT2B 1BQHG 3D25A 4KPHH 2Y06L 1QRNB 1A4KB 3K2UL 1SY6L 3VXTB 2VDKL 1YNLH 1MIEL 1HE7A 3K2MC 1F97A 3GSRB 1IKNC 3IAQA 1F3DH 2YRPA 2K3TA 1CICA 1YEIH 1CT8B 3PV7A 2FEDC 3BE1L 5J06A 1DBKL 4Q2ZA 5D7JC 2PKDA 4Q6IB 3SGEH 4OUUA 1DQTA 4GKNB 2P5EE 1OAQH 2CDEA 3VFOB 3UTZA 1DLHB 3TPUA 1EX0A 4PLNC 5J9PB 4WU7A 4HIHA 1PY4A 2YS4A 3C5JB 3O8XB 4OV6F 5TDPB 2BSSB 4GXVL 4E42A 2HMID 4Y1AE 4GAYA 1G1CA 2HFFB 3OZ9L 1I75A 4NO3B 4CMMB 3VDCA 2BNRA 5F88A 2MSPA 2OJZH 2A74A 3GJFB 1FZOA 1PEZA 1UWEH 5EZOL 4Y0GA 4Y2DD 2P5EA 3EOBB 4LQFH 1RJZB 2YKLH 5I1CL 2ARJQ 3IU4H 2QQQA 4PRBA 2EDJA 2IALA 3HMXA 5ALBH 2Q86A 4KRNA 3TO4D 4Y1AA 4APQD 4GKZA 1RZJL 3IGAA 4P2CG 3EOYG 3RNKB 5J1TC 1NMAL 2OZ4H 5HHMD 4OKVB 1RK1B 3U6RA 1N8ZA 1MHCB 4LLWA 1BIIA 1QLFB 3KPSA 3FFDB 1OCWL 1WISA 3HMWH 4HWNA 2QBWA 5A16B 5JPNA 3GNMH 4M61A 1MFDL 1NMBL 1JZ6A 4PJXA 2A6JB 3MZTA 1EUTA 2G60L 1FFOB 3MRQB 4RGMC 4WWKB 4G8EB 3N1GC 4O58H 3IRPX 4UDUA 4XBEL 4WO4A 4PJ9A 5DWUL 1YYML 4LQ1A 3WD5H 5IMMB 2EDNA 3DUSA 5I17A 1CZ8L 1MLBB 1ZGLA 1YEKH 3FAXA 5CEXB 4ZUTB 5D7LD 2HVKB 2EYSB 5FK9B 5HGHB 4JKLA 3W39A 1L7IL 1S9YB 5E99H 4FFZH 1MCKA 3IJHA 4JRXE 4F2MB 3PNWA 1EMTH 4MCYB 1WFTA 2EYTA 3WS6C 1K8IA 3QZWB 1OAXL 1ZT1A 3IYLW 4HAGA 5BOPA 1HXMA 4RWYH 3EJJX 5H94B 4L3EB 2WMPA 2RGSA 5GJTL 5L0QB 1CE6A 4JO3H 1H3PH 1XCQA 4U1JA 1RUAL 4XPGH 3MROA 5DJDB 1BBJA 1P9MA 4MAYD 3S37L 4UAOC 3W11C 4P4KB 4YDJB 3U48A 1KG0A 3VGGA 3DI3B 1CFNA 2XOTA 2OP4L 5D1XA 4IRSB 3RUGE 1RZJC 1NAKH 3RVXC 4Z7WF 2R29H 2ITCB 2WUCH 3P0YH 2EYRA 5CIPH 3WE6A 3QIUB 5IEKA 3KLHC 2YN3A 3IJSB 2NTFB 2XTJD 2FH6A 3QJHB 4RAVB 5F7NC 2P42B 4AL8L 1JWSB 2OJEB 3P4MB 5CJQL 4Y19B 3WUZA 1CXKA 4LCIL 2OQJB 3QIBA 4GRLA 1JPSL 4F80A 3SY0B 3AM8A 4M5YL 1F4YL 2OL3B 4Q0XH 4XH2B 4MXWH 2W9DH 1O7VA 4PGCB 4GH7B 2Q8BH 2AXHA 3WFDL 2DICA 3FQTB 1RURH 1B2WH 4Z7UB 5INCA 1U92B 1FL6B 4HC1H 3HNSH 5F44A 5BS0B 5IKCA 3EOAA 4O2FA 1C08A 4P46C 3P40A 3UPCA 3KYMA 4P2OD 3QPQC 3VXNB 2E3VA 4U3XA 3BRFA 1TZGL 4YNYA 5H2BA 5GGTL 3EO1A 5DD5L 5C7XH 3O3AB 4UBDC 2Q20A 3LCYA 4PYHA 2GEEA 3LY6A 1B9ZA 3HC4H 3P9MB 1NDGA 4MXQD 2E7BA 3RWIB 3PL6C 4C56D 4UB0L 1MNUH 5C0CB 1XT5A 5DS8B 4YE4H 2EDXA 4PR5A 4WW2C 1MAML 1A64A 4WHYG 1U41A 5C6TL 5HYQA 5FO8A 2VLRA 3SCMB 4CVZB 1UM4L 2CR3A 4MWFA 4RFOH 3T0DA 3MRPB 3BPLC 1AFVL 2HT3D 3ULVL 4GW1B 4GW5A 3U0TA 1HYRC 2F9BT 3MBEA 3TF7C 1BOYA 4QCIB 2O5YL 1AKJB 1IQDB 1OB1A 4OD3H 4JDZA 3VDAA 3L9RB 5B8CB 2DQCH 1ES0B 1B6DA 5I1KL 2JJTC 3N0PB 4PRNA 3OJVC 3V6OA 1FNGA 5C71A 3MLWH 2IQAA 2NY1C 4RGNB 4YHOH 5E6ZA 3ROOB 1IQWH 1KIRB 1A0QH 3P30H 4KPHL 1FGVH 5E5UB 2YPLB 1HHGA 5DHXB 4RMUA 1U58A 2B7DT 4LLQA 1YNLL 4YJZL 2FR4B 4D9QD 3EJZC 4KH2A 3MV8D 3R0NA 1CLZH 2DI8A 4UILH 1N5AB 4U1SA 3MOAH 1D6EA 4HGWA 1NCBH 4N0FB 1YEIL 1XR8A 4HIJA 4KC3B 3GUTA 1IAKA 1SMOA 2VABA 5HYJB 1JN6B 1XGPB 3V7AE 1GGYA 3LV3B 1OAQL 3JV0A 1N64H 3THMH 1Q9WA 4KI5D 3DJ9A 3V5HB 3T77A 3W82A 5AD0B 1E4JA 4XXDB 3EYVB 2E27H 2MJWA 3MRHB 3GDBA 1F11B 4NKOA 2D31A 5DHYB 4LHUG 2KQMA 2DQFA 2A38A 4LKCB 1OL0A 3MOQA 1XZ0A 5BZWA 2IJ0C 3HI1B 3DYOA 3ULVC 1JI2A 4W6WB 3RKDD 4OAWA 2OJZL 3DYMA 3QG7H 1UWEL 1S7XA 2OCFD 1QSEE 3SKNA 1TJHH 4KJPD 2ED7A 3CFCH 4QRTB 4LQFL 3H0TB 3MUGB 5B39G 2FH8A 1U8QB 4NRYB 2YKLL 4NYLA 4AZ8A 3QG6A 4MA7L 3HCVB 4U2YA 1LO5B 4EUPG 4PGEB 3VXQB 3IU4L 1VACA 3GMQA 5ALBL 5IWLC 1JWUB 2YPKB 3NOIA 1HILA 2RIKA 5C0DA 1IVLA 2OZ4L 2FLBT 2V5RA 1CDUA 4M6NH 5CSGA 4TN9A 3HMWL 3NIDE 4HHAB 4RGOH 3OKYA 1AP2A 2VN4A 3HHRB 3GIZL 5IMOA 3EJYD 3GNML 2JJVA 3O3BB 1OAUH 1JV5B 4OZGE 4Y4KB 4ODXA 3BP6A 5EBMB 2YBRB 3BGFB 4X7EC 1E27B 3U7WH 3MCKB 4ODVH 2FATH 5KG9A 2FJFB 3QQ4B 2LU4A 1DQLH 3CSGA 2J6EA 3QA3B 3GSXB 4RMVA 4P2QA 4MQSB 4O58L 5TF1H 3IDNA 4KK5C 3GIVA 4BA8A 1TVBA 3FL7A 1P69B 3WD5L 4I77H 3PHQB 1AIFB 3N9GH 2IH1A 1YEKL 2V6HA 3BPOB 2AABH 4BJLA 1CYGA 4CKVX 1D6VH 3H7BA 5E99L 1LK2A 4FFZL 5IB2A 1AGDB 3MRBB 1EMTL 4BSVA 2ZZUT 4EN3C 2H26A 5HI3C 3SGEI 3PGCB 3CLFH 2YMXH 4LIQE 2DN7A 4RWYL 3BIAX 2A9NH 1RZ7H 2B0SH 1L9MA 5C0JB 4JO3L 1H3PL 2H9GA 2JK5B 3GMLB 4XPGL 1C5DB 1EZVY 5B22A 1CVSC 1EAPA 1SQ2N 4ZOBA 4AH2B 5IJVB 4KJQD 1Y18B 2XA3A 2R1WA 1NAKL 5D2LF 2R29L 3VFNA 3PGDA 2WUCL 3P0YL 4ZDHA 5CD5D 1IC7H 4I13B 4FQHA 2IANB 4PRIE 3LN5A 3GI9H 5GXBB 5KSUA 4U1MA 4V1DD 2EDYA 2KL6A 1CS6A 4R7DB 4L8BB 1YY9C 2PTUA 1R3LA 4NT6A 2FRGP 4Q0XL 3WMSA 3WIHA 4OM0H 4MXWL 2W9DL 2FCBA 5TE7H 4M93B 3GGWB 2Q8BL 1OT2A 1S7WA 1RURL 1B2WL 3TJEH 2YR3A 4HC1L 3HNSL 5F9OH 1CXEA 2WBJD 3UZEA 3PWUB 5AG8A 2H32B 3WFHA 1IZKA 4PRIA 4MVBC 1JJUA 1K6QH 3KYOA 5FKPB 3QUXB 3WLWD 1GAFH 4ZNEA 2AXJA 1KIPB 4WJ5B 2G75B 5MENB 3O4OB 3W9EA 3QNXB 3C2SA 4M6OH 3HC4L 1DBMH 3RPKA 2F53B 1MNUL 4E41B 2ILLA 4YE4L 8CGTA 5ITBH 2DMBA 2VUYA 3QXAA 4QRPB 2VNCA 4XPBL 4WGVB 3QUKA 2WBWB 1IGCH 3PWPA 3QUYA 1TLKA 3JV6A 4RFOL 1KCUH 1BF2A 5DQ9B 1X5YA 3I6LD 3LMJH 3RTQB 4MB3A 2EE9A 2X7LB 3VRLE 4XC1H 4X6EA 4U1NA 1N3NB 1I85C 3MQIA 1HEZA 4EXPX 5E4EC 2ENSA 4D8PB 3RWFB 3L5IA 3IDJA 3JV5A 4NQCB 4OD3L 3R06A 2BRRL 2DQCL 3K1DA 3MRDA 4JFHD 4U6HB 1PKQA 2MKLC 1UWGH 4KHXL 5EBWA 3MLWL 5FUOH 3MSPA 3GJEA 1NGXA 4YHOL 5E6YA 4BFIB 1IQWL 3TN0D 1HH9B 1A0QL 5IVXE 3P30L 2Q76A 3MRMA 3GRWA 1FGVL 1VKXB 4PP1D 1CGUA 4JFXB 3DO3A 2Y6SC 3MRFA 4HT1H 1CLZL 2LVEA 4JANA 4QRSB 4UILL 1Z9OA 1AC0A 2HG5A 2FX7H 4DVRH 2DWEB 4UUJB 5F1KC 3MOAL 3RHWK 5IHBA 1OW0A 1NCBL 4F7PB 5ACMA 3MV9E 2ZUQB 5J1AA 5KSBF 4M8VA 1N2RA 1TCRA 3IFPA 1F00I 1EH9A 2OBGA 5HVFB 2Q6WA 4F9PC 4RZCB 3DURB 1N64L 5JZ7D 5ETUA 3B9KD 4PJAA 2E27L 4OCRH 3KJ6H 3HE7D 5K93A 2FIRT 4YR6A 1B3JA 4CJ1A 5L2KD 4N68A 4GRWH 3MGOA 5AYQA 3TIEB 4N90D 3ZKXC 3O11B 3L3DB 1IM3A 3BP7A 4GUPA 4KUZH 1UCBH 4QYOA 3C09C 1KLUA 3MV9A 2VZOA 4YIQB 3HAEH 5F9JB 3QG7L 2J8UF 4QOKB 4OFYA 2DYPA 4JLRB 5E6ID 5D2NC 1TJHL 3AXLB 2FZ3A 4MA1B 4PJCB 1HDMB 4G9FE 5EU6B 2PXYB 3WJJC 3SGKC 2P49B 1JF6A 2XFXB 5ISZD 4NPYA 5FYKU 4MNGB 2XT1B 1E4KC 4WFFE 5JOPD 5D7KE 1KOAA 4M6NL 4OZFH 3ARPA 1SY6A 5DYOB 4D9LH 3BD3A 4BKLB 3K1KC 1JNHA 4NQXA 3WLBB 5ALCH 1A5FH 3AU1B 4Z5RA 1OAUL 4OZHE 3VXSE 1NMCB 1EERB 3F7PC 1MCRA 3U7WL 4ODVL 1CK0H 5CEYA 3MV01 4PG9A 2FATL 1MEXH 4G9FA 1DQLL 1T1XA 1UQSA 1I3RB 2AEPL 5AG9A 5TF1L 1HHJA 4Q74A 3BISA 4I77L 5GZND 4X4XB 2DQIH 3N9GL 2BX5A 1IM9A 3IU3B 5GIRB 2AABL 2AXFA 3EO0B 2NY0B 2BC4A 1MQ8A 4UT7H 4PJDB 4LRIC 1D6VL 4JO4H 4QHMA 5IV2A 4OZHA 1IKFH 2VL4A 3KGRA 1RZKH 4LVHB 1JBJA 1N6QH 1AGFA 3TBTB 3CLFL 1BZ7B 1F3RB 2YMXL 5D1QB 3QT2A 3F6LA 4DKEH 1MSPA 2A9NL 4MX7B 3VXRE 2W59A 4FXGA 3SDXE 1RZ7L 2B0SL 5BQ7A 3X13B 3PP3H 1QFWI 2JB5H 2VMFA 5I2IB 3TFKD 4AJ0A 3CFBA 5F3BA 4JY5H 4RA0C 4YHIA 2X4TB 2ADJA 4L3EE 5F1NA 1YNTB 1J05B 3P73A 4ZXBB 2LTQB 2C3GA 1A2YA 3VH8G 3V4VH 3CPLA 4NUJB 3VMNA 1IC7L 3FB5A 3HUJE 4M43H 3OKLB 3IDXH 1KPUB 3GI9L 5FDWA 3I50H 4FTVB 2BOBB 3KPPA 3VXRA 5ANMB 4OLEA 8FABB 2YUZA 3GI8H 5ICXB 5TE7L 4N5ED 1H9VA 2GY5A 2YZ8A 1WK0A 3BUYA 2KH2B 3TJEL 2VLJD 5F9OL 1HXYB 4QWWC 3KPQB 4U1GB 5EBGA 3IETB 4NQSB 3HUJA 4LEOA 2FX9L 3MNWB 1K6QL 2R1XA 1O0VA 2HJLA 5AAWA 4B7IA 1DQQB 4X8JB 1GAFL 3QEGH 3MGTA 3AVEA 4XNZB 1QO3A 4O00A 5F1IA 4ZS6D 4WEBH 4U6XB 4H5SA 3SDCA 4EOWH 2HN7B 4R2GD 5I71B 4M6MH 4QNPF 2DJ4A 3ZDZF 5I1LB 5F70A 1DBML 1BD2B 1E4WH 2APXA 3PABA 4ODUB 5BV7H 5ITBL 3VJ6A 1A7PH 3NPSB 5ESAB 1IGCL 5DO2D 4MJ6B 1KCUL 5F9DC 3T0AA 1WVZA 5DUBB 1NUNB 4XC1L 3EUUA 1G6RB 3HLAB 1AO7B 4EQ3A 1F6LL 3UAJC 1BVLB 3U1SH 1T0MB 1RIHL 1NEZB 2VXQH 4IRJA 3CC5B 4LHUA 4JZJA 3DVNB 3WKNA 2I60L 2BY2A 1J10A 3GSWB 3KPNA 1NGWA 3ARDC 2VYRE 4DW2H 3O6FD 1UWGL 2XWTB 3BFOA 2ATKB 5FUOL 1B6UA 3KAAA 3V6FA 5CUSH 4QF1B 1J8KA 4PRHB 3C6LC 3B3IB 2CRZA 3RI5F 1Z5LB 4X99B 4EUPA 3ARBD 4Z78A 4P2RB 4HT1L 4TVPE 1C16B 3WJLA 2XG5A 3MA9H 2VSDA 2FX7L 4DVRL 4HX1A 9CGTA 2YPLE 4LCWE 1JZ7A 1R3HB 5HHOA 5K9OB 1T2JA 2Z35A 1L6ZA 3BUTA 2E6JA 2UY7A 5FOJA 2V9TA 1T89C 1RZ8B 4PV9A 1XF1A 1NC2B 4OFKA 4TOYH 1Y0LB 1CXHA 3PWNA 4PJGA 4OCRL 3KJ6L 5GS1A 3G04B 4X6FB 1BVKA 4ENEC 3JV4A 2BSED 3CFDB 3GMOA 3RWDA 5I8CB 2E7CA 3ZLQC 3CNKA 4KUZL 1UCBL 4LCWA 5DJ2A 1I7TB 1DJSA 1UM6H 1J0JA 2X4OA 4GRMA 5T1MA 4LVOC 4X0KB 3Q2CA 2C1PA 2HLFC 1AXSA 4ZD3H 1L0QA 3GBMH 2AJVH 3LKQA 1T80A 1MY5A 3GJFH 5KSAB 3QIWC 2ICCA 4M48H 4L8SA 4JREC 1HQ4B 1A6VH 2VLKE 1XGTB 4POYA