3GUTB

Crystal structure of a higher-order complex of p50:rela bound to the hiv-1 ltr
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
312
structure length
312
Chain Sequence
b'GPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGVCTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHSDLAYLQAEGGGDRQLTDREKEIIRQAAVQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription factor p65
publication title Structural basis of HIV-1 activation by NF-kappaB--a higher-order complex of p50:RelA bound to the HIV-1 LTR.
pubmed doi rcsb
molecule tags Transcription/dna
total genus 60
structure length 312
sequence length 312
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2009-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00554 RHD_DNA_bind Rel homology DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gutB02
2.60.40.340 Mainly Beta Sandwich Immunoglobulin-like Rel homology domain (RHD), DNA-binding domain 3gutB01
4E0RB 3G04B 2ZSVB 5JOEA 4W6YB 1X5JA 2YKLL 2VXUH 3GMQA 3HAEH 4PB9L 2JCCF 4HH9B 5GIRB 1NUGA 5HHXL 4AH2B 4FA8A 4ODSL 5SWSD 3VD7A 1LEGB 1Q9WA 1WF5A 1FFOB 4OLZL 5IFJA 1EDQA 2M8XA 4NNPL 3VFSA 3KPPA 2BZDA 1CLZL 3T1FB 3GSVB 1LD9B 2YD8A 2A9NH 2CGRL 3NA4A 5DXWA 4RWHA 2FATH 5B8CC 4G7YL 1S7QA 3IDNA 5AG9A 1QKZL 1RJLA 4MA1B 3MQIA 1PJ9A 3MA9L 5I73B 4HUXA 1G7LA 2YRPA 4XGZA 3D85D 4OLVL 4Z7VB 5IB3B 2F5AL 4Z76A 5J13B 4HFWA 4GFTB 4HK3N 4F80A 1DQTA 3C8KA 2ZOLA 1XF2B 5DMKA 2AERT 2EECA 3O2VL 4D0BB 1MJJA 1LO3L 32C2B 4NBXB 1JMZA 4JFDA 1E6OL 4WWKD 3SKMA 2FH8A 1L4IA 3TN0D 4OGXH 3CPLA 2MCPL 1JV5A 1VFMA 5IP4A 2LAAA 3NFSL 3GKWH 1NL0H 5J3HD 2FHBA 2BP3A 4DGVL 2VWEC 1AY1L 1BQHA 1JK8A 1JNJA 1XCQB 2VR4A 4GRWH 1S9VB 1DLHA 3ROOB 4QTHB 3EO1B 5H2BA 2O61A 1VADB 2WP3T 3QP3A 2BDNH 2Z31A 3T0EB 2PW2B 5IB1A 2G75B 3ZL4L 2WQRA 3WFEL 2VWEE 4P3CH 4OB5H 4KRPB 2XZQH 2JJUA 4MJIB 4G6KH 4ZUSB 1YJDH 1OW0A 1UZ6F 5CHNB 5E5UB 1BM3H 1ZEAL 4XPFL 5J9PA 4TVPH 5E5RB 1U91B 2K7PA 4WU7B 4G5ZL 3E2HB 1PEWA 4P59H 3BUYB 3FZUD 2R0LH 3KPLB 2HT3D 3JVGC 1IGML 5K9OB 3AROA 5CWSA 1JGLH 2HJLB 3JWOH 4K8RD 1T5XB 3QO0B 4LRNH 1QP1A 5EBMB 4OCNC 3DX7A 3U1SH 1Z5LA 1OVZA 1AQKL 3CDCA 4PRNA 4XWGH 1C8PA 5DD5L 2HWZL 3QUYC 4YDJA 1A6VH 1IC7H 3U9PL 1G7IA 4KAQL 3K2UL 4X6FB 2VN7A 4IDLA 1J0HA 4OV5A 1DE4A 3KPNA 5E8OB 5GRUH 3ZE2F 5D1XB 4MA7L 2VE6A 4KK5D 1E4KA 2QSTA 3ET9F 4Z7UB 1BREA 4M3KB 3DO3A 3MBXH 4RGMB 3UX9B 4LNRB 3IU3B 3IXTA 3MV7E 5I9QC 4QCIB 5C09B 3U46B 4HD9A 4EUPH 1EK3A 5CIPB 2EDRA 4Q6YA 5D6CB 5E9DE 1J05B 2BSSB 4CMMB 1R0AH 4BELD 3ARYA 1JRHH 3DMMD 4HDIB 2VISA 1UWGL 3Q6GL 2HTKC 1KEMH 3PWNA 4KRPD 4GW4A 5E8PB 3HUJE 4A6YA 4GQPH 5I6XC 4GAGL 4JFOB 2X4SA 4YHIB 3P2TA 4Y5YA 1IGCH 1VGKB 3RTQC 1TPXC 4NQDB 4RX4A 1VFOA 1VFBB 3DSNA 3B9KA 1U8IB 3QUML 3RVWC 1JFQL 1EHNA 3KGRA 2AVGA 3SE9L 1CD0A 4M1DH 1HINH 2VDRL 3FN0H 2G9HA 1YN6B 3R0MA 1AI1H 4K7FA 5E00B 3VFUA 4HS3A 1L6XA 2DTMH 3MRBA 3PDGA 4ZSOB 4YXHH 1UEMA 4U1KB 1YMMB 4FZ8L 1JPFB 3MLSH 2H26B 5D1XD 1F2QA 1U92B 1DBJL 4OM1H 3CFCH 2X10A 4UB0H 1A4KA 2OL3H 2VITA 4QRPB 1X5HA 3MV8B 2D7OA 5B8CA 2W60A 2NY5L 3VFRB 5EA0H 1B4RA 1WBYA 1FIGH 4U6XA 4H25A 4JFZL 1ZTXL 3L1OH 4O9HH 3MNZA 3RX7A 4A2LA 5EG6C 4XC1L 1WZMA 4X9IA 3WO4B 3QHTC 2H32H 4HQQH 5FV2A 4UDUB 4R9HA 4U0RB 4NKDA 3O3BA 4PGBA 1WGOA 2B20A 1YEGH 2XACC 4N0YL 2IFFL 4ZMAT 5ICYB 2E7LC 4PJ8B 4DEPC 3OKDB 3ULVC 5H35A 2DQHH 5I66B 4QHUA 3DV6B 5INDA 1CL7I 3UJJL 4NBZB 1I1YB 1T04B 5I76B 5I75C 4HC1A 5JTWA 3ULVE 4FFVC 2VAJA 1KGCE 2HT4D 4XNMA 5C86A 4FQJL 5DMGD 3LRGA 4QYOA 4J12A 2XKNB 3KXFB 4YFEA 3G6AB 1VCAA 5C0FB 2JJSC 1ZT4B 2ESVE 2C3WA 2WW8A 1K4DB 1YMMD 1EXUA 3F7RA 1N2RA 2IG2L 1A02N 1BECA 1PKQE 2F53E 3UJIH 3STLA 4ODUA 4RAVB 5GRXG 3WUWA 1D5IL 4LDOB 2YHGA 3I3BA 3MV8D 4Z77B 3VW3L 4QHMA 2CRMA 2QEJA 2V7NB 4KZDH 4POUB 5CJOH 4L8BA 1XH3A 3GSOA 2MOVA 2NNAA 1UCBH 3JVGA 4UIKL 1X7QA 3GSUA 3WHXB 4JZNB 5SWZE 5IBLC 3U6RA 1CE1H 1T1YA 3JXAA 4TRPH 4BFGA 1MLCB 3ECBB 5DJYA 2AK4B 4PJ8D 1D5ZB 3EDEA 3QEQB 1BZ7B 3GI9L 3QUYA 3DI3B 4Y8AA 1V05A 4M6NL 3LN4B 4JO4H 4HEME 1F8TH 3DUSB 3MV7A 5HYSA 3D18B 4BH8A 5JPNB 3IFLH 4HAFA 5E9DA 4OCXL 2YPKA 4ZUVB 3MOAH 3IKKA 3WFZA 5F9JB 3DV4B 3HUJA 4PPTA 2EDEA 4KKBC 1MCLA 5HDQL 4R4NC 2VQ1B 1RZKL 2DICA 2FJHB 4K94L 2LTQC 5ESQB 2FBJL 4Z6AT 3IRZA 2HN7B 5E6YA 2E27L 2AJUL 3X14B 4EN3C 4QWWC 4AT6A 1FCGA 3K1DA 3GGWB 1RSFA 5LBSH 1U3HC 2MJWA 1A7NH 2Z8RA 2XTJC 2ATKA 2FL5B 3QCTL 1ORQA 1ZLVH 3RTQA 4PTTB 3S36L 5C70A 2CKBL 3S37X 4AMKH 1T3FA 2DI9A 3QUXC 4ESKA 1RIVH 3MLXL 3KPMA 5JR1H 2XTJE 1PW3A 4PRPB 3WIHL 3RWDB 4EEEA 1U8LB 3U0WL 5DMIL 3QEQD 3FT2A 3K4DA 4JO3L 1PYWB 1QBML 4FQPA 5CINL 3CSYB 1HK6A 4OM0H 5DK3A 4Y4KB 1AXSB 4ORZC 1UM5H 4GG8A 2NXZB 1D9KC 4YDLB 2R23B 4IOFC 2R8SH 4D9LL 3C5ZB 5EU5A 2V2WB 1YECH 4P9HH 4MD0A 3CMOH 1UA6H 4X7CC 4D0DA 3FAXA 3RWCA 4MX7B 1A3LH 1S8DB 1K8IA 3TYGH 1IEHA 2E7LA 4I18C 1ZHBB 2D7MA 2XQBH 4Y2OA 3BDBA 2DM4A 3D69A 3FTGB 1KCVH 4JFPA 4FQQA 3ZDXF 2OTWA 4HKZB 1T0NA 1YDPA 2IBGA 1X5GA 3MC0A 3O3AB 1RZJH 3VXQA 4HWEL 1X4ZA 2Y25A 3MRQA 1BMGA 1XIWC 2ESVA 1UXWA 4GMSH 3ZO0A 2Z8WC 4NNXA 3WFCL 1J18A 1XF3A 2WINA 3VH8A 2XN9D 1PKQA 1EHAA 2W9DL 2F53A 3MGTA 3U4BL 2A6IA 2JJSA 1ZHLA 4JM2C 4M61B 4X8XA 3D0LA 3SDDC 2DQIL 3ARVA 3GRWH 4LASH 3MREA 4X98B 1F4WH 1Z9SA 1KCRH 4Y4KD 5I8OL 4PJGF 4UV7H 5INCB 2X44D 3CCHA 4R3SA 4RDQF 5SWZA 2CSPA 4PJCE 1J10A 3OF6A 2I24N 3C5ZD 5IEHA 4NFCA 3QXAB 5IVXF 1OGAE 4G9DB 1KLGA 3DGGB 4XAWH 3JTSA 3WIIL 1UB6A 3QT2A 2OQJB 5D2NB 5ID0A 3SDAB 2YPLD 1RHHA 1KN4H 4YHML 3IDIB 5IQ7H 2X70A 2CLVA 5KVGH 2ZSWB 2R1WA 1OTSC 4GJTB 1QSEE 1UACL 4LCIH 4UT7H 4XPTL 4XHJC 1M7IB 3FQNB 4GT7A 1DEEB 4ZG1A 5I1KL 1HXYB 3OPZL 4JANA 2F19L 3V0AC 4DUXA 1OGTA 4I0CC 4YFLF 5F7FA 2VLJE 4S2SB 1MIMH 1NGYA 5KSBB 4LQFL 15C8L 4POZC 4Y88A 5DO2C 4E5XB 3LEVH 3KDMA 5ABDE 1NMBL 1XGPB 2ADGB 4OT1L 1Q0XL 4WEBL 2ZUXA 2CR6A 2Q20A 3O4LB 1AGDA 1C16A 1R3LB 3QPXL 4EN3A 3MBEC 1G7QB 1Z3GL 5I8CA 1OB1B 4L8CB 4FFZL 5HYJB 1U3HA 3C08H 4DFIA 5F6HJ 3WFBH 1CGWA 4EDXA 4J8RB 4IIQB 3GSQA 5T5FL 5IMOA 4MCYA 1X9QA 4OFIA 5BZDA 4Q6IB 1IEAA 3QXDA 1NSNL 3FMGH 4MNHA 2L4OA 3QUXA 4P57B 3I2CL 5IROC 5E94A 4L3CA 4WFFD 1F6LL 3SDAD 1CG9B 3MRIB 5FUCC 3VD5A 1VA9A 2QHRH 3I50H 4MWFB 2IMNA 1S7TB 3ARFD 1DVFC 5DEGA 1LO2L 5AD0A 1KIRB 1TJGH 4M62H 4NRZB 1RJZB 3RY6C 5FYKU 5FV1L 5FUCE 2NY3B 1F3DJ 2EC9T 4F3FB 4X6EA 3ARWA 5F97E 3L5XH 2CLRA 3HB3D 1D9KA 2AEIT 5LXGL 3G08B 4ZAKC 2H9GA 2W59A 3KNBA 2EEDA 2DQCH 3HE6C 4NN7B 3BIAX 1WLHA 1P84J 2XXMB 4PJBF 2N56A 4HKXA 4ALAL 4RISL 2DD8L 4LLWA 1H5BC 1L0QA 1OAUH 5HGBA 1G0DA 5HYJD 5EOCJ 2YA1A 1Z0MA 4AEHL 3S5LA 4I18A 1TMCB 1FZKA 1G7MB 4ZUWB 3SQBA 3UTSD 4RDQG 1EZVX 4RFEB 4YXLH 3CDGA 4LLYA 3L5WB 1A1OB 1FYTE 2B2XL 4H1LA 3CFDB 2ZJSL 2GSGB 1OP5H 5HVHB 1XIWA 3CSPA 4WI9A 1PBYA 3U48A 5I1AB 5E8NB 1SJHA 4JVUA 5EB9A 2D4DA 4GS7B 4HPYL 5ECJE 4X4XB 3W9DA 2IH1B 3EHBC 4LLVA 5EU6E 4P46D 5GGRY 5FHAH 5E8DL 3DI2B 4NNYB 3RX5A 4JM2A 3TV3H 2IPKA 4PJCA 2VDNH 1W0VB 3QIWB 3SDDA 3ZYJA 4R97C 2K1MA 1OGAA 3MROA 2VUYA 3MLTB 3WFHB 4PJ5D 2F5BL 5GISL 4O5LH 4LSUL 1IQDB 5BXFA 3VE0A 5JO5A 5F88B 4H26B 1FBIL 1IAKA 1MWAB 4PRIB 3C8HA 3THML 1FFPA 3L3JB 3QO1B 4OCWL 1NC4B 1DUYA 2DQDL 4HAGA 1QSEA 2Z4QA 2ZUQC 3IF1A 4LLDB 5JLZA 5BRZB 2CJUL 1RZFH 1I7ZB 3RVVD 3IRPX 3HPLB 1F3JA 5M95B 2VLJA 2B4CH 2X1PA 3RZCD 1RFDH 4LMQE 2PUQT 1JZ7A 4BFEA 5C71A 2OK0H 3O6KL 4DN3H 1MNUH 2VABB 3NTCH 1ED3A 3BWAA 3FO1A 4ZODA 2J8UE 5FDYA 1GGUA 1NC2B 1QZ1A 4X9HA 5EZOH 5GGUB 4K55A 5GGSY 5LAXB 1G9MC 3GIZL 5I1EL 2J6EH 1NCAH 3IDXL 4Q7DA 5BVJA 3MUJA 2I60H 3V5DA 5EIIA 3H42H 1JHKH 2CR3A 4JN1L 3MBEA 3K4ZA 1B4JL 4FQXB 4Z8FH 3BZ4A 4H0HB 4P2OB 3WXWL 5LWYL 2O5ZL 5D6DC 1ETZA 1GSMA 3BH9A 3TO2B 3ZTNL 3ZDZE 1UEYA 3FN9A 3TH2T 2B1AL 4JY6B 1NC4D 2BK8A 5C0GA 1NBZB 5IROA 5JHDE 4APQB 3KYMB 4DTGL 5BRZD 5I1LA 4HXAH 3C09B 5LGJB 2UZIH 1N26A 3O3EB 2CIKA 1WEJH 3BDYH 3BP4A 4Y0GA 4HZLA 5B4MD 1GGIL 4FN0A 3RZWA 1DVFA 4OFVA 1I1FA 3BPCB 2UY7A 1JE6A 2R4RL 3RY6A 1HXMA 1G9NH 3BQUC 1IC4L 4AJ0A 4PYHA 4Z7OF 1T5WB 1CQYA 4S0TD 4OZGE 3ILQD 3RA7H 4FFYL 5FGCB 1UB5B 1PZUB 4IDJL 2QHLA 1NC2D 4G43B 4MNQE 4ZAKA 2AJXH 4IMLB 4HSQA 2PTUA 1A22B 3HE6A 2FWOB 2FIKB 5F3BB 3LKPB 1T7ZA 4MXQC 1NGWA 3R8BB 3BW9B 3KG5A 2ICEB 3T0XA 1H5BA 1FYTA 4Y4FB 1VPOH 4S1SL 3GSWA 3NZHL 4P2OD 2FX9H 3JTTA 5CFHA 4X8JB 4PJ9C 1NUNB 5DA0B 2NY7H 1BOGA 1JGVH 2VDMH 2EDYA 1W0WA 2NZ9C 1WVZA 2BMKB 1BVLA 1J7VR 1JPTL 1G7HB 2WSKA 1YPZF 2D3VA 1R5IA 1MF2L 2PTTA 4ERSL 5EU6A 2J7LA 3WJLC 2HVKB 2FZ3B 4XT1C 1P69B 4GW1A 3K3QA 3V5KA 1HIML 3BI9X 3WEXB 3OR7A 5DSCB 3QAZC 4OLUL 2VLMD 5IM7B 4OI7A 1S7SA 4XP6H 3QIUC 4N8CL 2VMFA 2V5YA 2DLEA 3FO9B 3TYFB 3V7AE 4XCCH 2DQJL 5JIPA 2CUHA 2GKIA 1YA5A 3SO3B 1X44A 5F9DC 1HNGA 5C0AD 4UV4H 2BY1A 1CICD 2HJKA 2V5RA 3TH3T 3ZYIA 2AXJA 3JUYA 4UDTB 4JM4L 3SDXB 1N0XH 3V0VA 4PREB 4XP5L 2YK1L 3RWEB 5D5ME 2XIDA 4P2RA 3EDFA 1QA9A 1XGTA 1QFWH 2D7QA 1DFBH 3U7AA 4M93B 1ZHKB 1CFQA 2J8UA 4HWBA 2APWA 5DFVD 1MCPH 1NDMA 4U1GC 2AKRB 2VXVH 3D3VE 4KH2A 2OZ4L 5I30H 3T65B 3TBSA 4I77H 3GHBL 2OX5A 3C6LD 3ROLA 1T6VN 3FOLA 2IANB 3CMGA 4M48H 3QULA 3HLAB 2XG5A 5IHUL 4DGIL 4HG4J 4G8EA 4XX1E 3LKOA 2E5EA 4F7TB 4M5ZH 3GEWB 5HDOA 5GSRB 4WFHE 3CFIC 1S78D 1CGYA 4I2XB 1ITBB 1U8JA 3CVHB 1U8MB 5HGDB 3D6GA 5KOMC 1LO4L 1H3TA 3SE8L 5ISZE 1KTRL 5JHDA 1FYHB 3FFDA 5D6DA 2P5EE 2RQ8A 5BO1H 3S36X 3B2VL 2J5LB 1EGJH 3OKYA 4HJ0C 4NQCE 2A9ML 1LE9A 3VFVB 1JWSB 2OMBA 4H8WH 4LIQH 1FCCA 4ZPVB 4LLUA 2HMIC 3HRPA 4PR5A 3H7BB 2IADA 4X6CB 5DA4A 5C6TL 4EXKA 5ERWB 5FKPB 4K8RH 3B2UD 1PD6A 5D7JC 4DUVA 3MRJB 3V6FA 4OZGA 3UBXB 5C07E 5BJTB 4OZIF 2VRAA 3X17A 5IFHH 2QKIB 1WTGT 1EEUA 5I2IA 2OP4H 4MNQA 5ESAB 4GSDL 4ZOAA 4KROC 4YX2H 3BQUA 4QTIL 1V3MA 2V2XB 1ADQH 1U8HB 2AV7A 1FAIH 2FB4H 4JFXB 5J1TC 3MRDB 2OR9H 5I1JH 1FVCA 3O4OC 3G9AB 3QZWG 3VXNA 4EVNB 1EJOH 3CVIL 3JZ7A 4NT6A 1G6RH 2CPCA 4NHUB 2AJYL 1G6VK 3FQXA 3RIFF 5EBGA 3W0WB 4G8IB 1N64H 2UWEE 3GNML 1IVLA 3O2DA 1T20B 4NM4H 4PY8J 3D39B 5FIEA 1P2CA 1YYLL 3S3SA 3HNVH 1FHGA 1PQZB 4Y4HB 3V4VH 3JV6B 4HS8H 2V5SA 2EYTB 4PJ9A 5I8KL 4P5MA 1INDL 3EYUL 3O8XD 4WIQA 3UBXG 1KLUB 1ZLSH 1U8NB 4NZRL 5F1NB 1AGCB 5E2UL 4PY7A 4CUCA 5EORH 4HUKB 4NUGH 3GJFK 5TDNB 4XPGL 1EO8H 3H9SE 4M03A 5CMAB 4WU5B 2ZUWA 1KCUL 3WJLA 3ESVF 4PJAF 3B6SA 4YZFE 4A2MA 4CVZB 1OAQL 1RU9H 4QRTA 3T4AA 4O58L 5IFAL 4Y19E 2DWDA 4IJ3C 3BP6A 4LHUB 2NY2B 5AAWA 5IG7B 4N0FB 3QIUA 3TVMD 4ZXBB 4EQ3A 1M05B 1U8QB 3MZGB 3ARTA 4NRXA 2X6MA 4JQVA 3QHZL 4HIJB 1KN2L 4X5WB 3TP4A 2O5XH 4F7EA 4HMEA 3W81A 4HUVA 2F54E 1GC1H 1RK1B 2BX5A 4LGRB 5D5MA 3CXDL 4JO1H 3EDDA 2EYSA 4EIGB 5E4EC 4ZS7L 3WSQL 5IKCB 2A0LC 1FVDB 3PQYE 4IOIB 3PNWB 3W0WD 4X9FA 2KZWA 5HXMA 1DR9A 1VGEL 2CIIB 4LVOC 4UUJB 4NBYB 2JIXB 4H5SA 5E1AA 4BZ2H 1DBML 5E6ID 4W4OC 4AIOA 1D5XB 1LQSR 5JXAH 4F57L 3D3VA 5DQDH 4CL7A 2ATPA 4LHUG 1F4XL 4CRPA 4UAOB 1VENA 5I16A 4U1JB 5ITFB 3VXTB 1QRKA 4BKLB 3DRTB 2PF6A 5TE6L 2GFBB 4K7PH 2X7LA 4FMKA 4LOUC 4OD1H 1JPGB 4IRSB 4Q97A 2CDFA 3MRNB 3M1BB 4UTAL 1J0YA 4PD4K 2A6DA 3D9AH 1RJCA 4U33A 1AP2A 3PHOA 4LSPH 5CKAA 5DD1L 5DJ6A 1NBYB 4KK9C 5ISZA 3V4PH 5TQ0L 6FABL 2VH5L 4LHUD 3D5OF 2N1KA 2P5EA 3QDAA 4ZXBD 2HKFH 1KV3A 3NIGE 4NQCA 5EZIH 1NAKL 4JKPH 1EV2E 1UXSA 4JHWL 4NQVA 3QFJE 4N1HB 3DSFH 4J3OC 4PJAB 3LCYA 3P77B 2PO6D 3OXRB 3S96A 4EI6A 1F58H 4GKZB 5EUOF 1E4JA 3PWUB 4JPIB 2NY1B 3B3IA 3A6BH 5C07A 5FHBH 4OBSA 4LVHB 3BE1H 1VERA 4WW2B 1AJ7L 2JIXD 2HJFB 3FAWA 1BD2E 5LCVH 5CEXB 4XNZC 1TZIB 2NX5D 4MDIA 2KPNA 1NGQH 1QNZL 4LF3B 1Q9OB 3OKNA 1K6QH 1KOAA 2DLFH 1IAII 4TNVF 3ZT7A 4CVWA 4NN5C 2A38A 3PL6B 5I1HL 1JJUA 4RIRA 5GS0L 2UVEA 4GW5A 1T0PB 1ND0A 5HHOB 1AD9A 2UWEA 2BSTA 3LEXA 3IJHB 5GQBA 3TT1L 1XGRB 4PRDA 3NIFE 1I7RA 2X1XR 2DQFA 5T3ZE 3I6LD 3WIFA 4KDVA 1BQLH 1HE7A 4PB9H 3U0TA 1FZOA 1M7DA 2HFFA 3H9SA 3C2SA 4P0DA 4GXUM 4J4PC 1UM4H 3U83A 4IBLT 1NFDE 3AB0C 4Y19A 3V2AR 2NY1D 3V95A 2FSEB 3OB0H 4I0PC 4YE4L 3WLBB 4K9EC 3HRZA 5GGQH 5FO9B 1NJ9B 4OLZH 4NNPH 2CRYA 3T2QA 1CLZH 5FCUL 4N0CD 4CU8A 5FM5O 1MLBA 5HSFA 4RA3A 2CGRH 4Y2DD 1YZZA 2R2BB 4FXGA 4G7YH 2FJFB 4M5YL 4LEXL 4L3AA 4OZFH 1QKZH 3QJHB 5EC1B 3P9LA 2R0WL 2BOCB 5EUOB 2F54A 4LAQL 3HPJA 3PP3H 4OLVH 1IC5L 2F5AH 4TTDD 3QUZC 1T1ZA 2Y1VA 1A6TA 3QBTB 5FYLE 2AXHA 5JNYA 2WBWB 3K4AA 3PQYA 4JDVA 2FGWL 5DJCB 1AGBA 4RBPK 4XXCC 5HHOD 3O2VH 4KI5F 1RUMH 3KLDA 3O45B 3L3DB 1FJ1A 2QTEA 3OB0K 2MCPH 5L6YL 1ITCA 5TPWL 3BEWA 3NFSH 5DEFB 1N5AA 1I8KB 5LVEA 4NYLA 4DGVH 3BYTA 3A67L 1AY1H 1S7RB 4YJZL 4H88H 4NO0B 3TJHD 3G5YA 1H3XA 4W4OA 4MYWB 1A1MB 3Q3GA 3ZL4H 3B5GA 1M6OB 3PP3K 5FYKE 3ZLQC 4PRHB 3WFEH 2DDQH 1BFOA 2CLZA 4RQQA 5TJWK 1XFPA 1MCJA 3Q5OA 1FLRL 1OSPL 4GKSA 5JOFB 3DHMA 2IAMC 2VNCA 3LDBC 5EBLB 3SDYL 4JGUA 1HILA 3B9EA 1HHKB 4G5ZH 1OLZA 3HZVA 1LNUB 4P3DA 5GGVL 1FL3A 1PSKL 1IGFL 3QH3B 4L4TD 4U1LA 5CP7A 2EDNA 4XZUB 3QFJA 2HFEA 4HJGB 2DJ4A 2P5WB 4D8PA 4WUKH 2VLRB 2RAMA 1KPRB 1YMHB 2LV4A 1MHPH 4HUNB 1LHZA 4GXVH 4OTXL 3L6FB 1AQKH 1WICA 1CK0H 1MH5B 3FQRB 1ZHNA 4U2ZA 5TF0A 1PLGL 3FB7B 3JUZA 3HC3H 3P9MA 4KAQH 3K2UH 3SGJC 1G7PA 5EUKB 3RKDC 3JV4A 5ALCL 4ZDHB 1BD2A 4MA7H 4X7TA 4KV5F 1B2WL 2DBJA 1KJMB 4U1IA 3BPLB 3W5MA 1WCQA 5IEKA 3GO1L 1HQRB 4FQHB 5EBWB 1D5BA 1Y6KR 4AM0A 5CD5D 1JPST 3NCJL 1S7UA 3ARSA 3V5HA 3T0AA 4PRHD 3OJDA 3WMSA 1UWGH 3Q6GH 3DVFA 4KZEL 1TJHH 4RAUB 1JUFB 3GBNL 4XCYA 2ZNXA 3T0EC 3OGCA 4LEOB 3GB7B 2ZUYA 1MRFL 1OTUC 4XMPL 4PRBB 4EXPX 4HHAB 3CU7A 3QEUB 4NQEB 2FO4A 5MEPA 5JXED 1PFCA 4MQXD 2CMRH 1BOYA 2Y06L 4N8VB 3SJVB 3T0EE 3VGEA 5JW5A 3QUMH 5L0QC 1YEDB 4U3HA 2P5WD 1WTLA 3E2HC 3IJSA 2VLRD 3MMEA 4A6YL 4HKBA 2BVQA 4IMKC 5IV2A 3BVNB 4M4RA 1T4KB 3SE9H 3GMRA 1NFDA 4MJIE 3MX0A 2VDRH 4LARL 5GGVY 2EH8H 4LCCB 3QNYA 1T1XA 4NN6B 2IH3B 4X99A 5C7XH 2Q3AA 4EDWL 1RZIA 1KYOJ 1QLFB 4J4PA 3T09A 1I9RL 1QHPA 1KF9B 4M7ZB 4XVTH 4CBPA 3CFKA 4Q2ZA 4S10A 1DBJH 3FFCE 4I0PA 2AJSL 4X83A 1CFTA 3KPRD 3P4NB 1ONQA 3RAJH 43CAA 4M8QA 4F37K 3G5VA 2I26N 4ELKA 1U8OB 4C56B 1DBKL 3H9ZA 4JFZH 1CI5A 1C7SA 4KI5D 1ZTXH 3ARDD 43C9B 3HI5L 3AMLA 4Z5RB 3GMMB 3U30C 5HHMB 3BKML 3QUZA 5DJDA 3T77A 3D2UB 3MLUL 4N0YH 3LQZA 1HN1A 3BUTA 4Z7UE 4XXCA 4MNGB 4NQED 4MJ5A 3DX8B 4UQ3B 3QI9B 5IUSA 1JHTA 4OBRA 3V4UL 3MCKB 5ESVB 5T3XD 3UJJH 5IF0A 2NTFB 1C12B 3TF7C 4U1HB 1KPUB 1S9WA 4JLRB 1QACA 1TVHA 4WTZG 4HWZA 1KB5L 4FQJH 2W91A 3VFMA 5DJ0B 1Q9LA 4FNLL 4E0RA 3MGOB 1ROWA 3I6GB 1A5FH 4HC1L 1H8SA 4NQDE 3ZHLA 5F7NC 2ICWB 4G8GB 2OR7A 5J8OA 2Y9RT 1RD6A 4PJIB 4PGCB 2IAMA 2XY2A 4M7JL 3QQNA 3VW3H 1KIQA 3NPSB 4LKXA 4OF5A 4U6TA 3T1FA 3GSVA 2ICES 5HHMD 2XFXB 3O6ML 4MCZA 4XP1L 3IU4L 4RAHA 1DQDL 3X12B 4FG6D 2ADIA 1Q9WB 5I18L 4U0RC 5IB3A 3U2SA 3RUGE 4QRPE 3SGJA 5KTEL 3KPPB 3QI9D 1YY8B 3AM8C 5C6WH 4DCQB 4E9LA 4JRXE 2RB8A 4UTBL 5CJ8A 3IDNB 1MCCA 3MRKB 4OCXH 4HIXH 4XGZB 4M6AA 3HE7D 1V5JA 4Z76B 4HFWB 4KQ3L 3UP1A 3IDYC 1QG3A 1RZKH 4POYA 3C8KB 2ZOLB 3ZKND 5DMKB 5DGQA 5K9KB 2FBJH 3UPRB 2VAAA 1S9VA 4Y89A 1MJJB 3ROOA 3EO1A 3S98A 1VADA 4JFDB 3OXSA 5CEZL 4G8GD 3T0EA 3SKMB 3MCLH 3PJSA 4PLJC 3CPLB 1JV5B 4ZS6C 1V7NL 4ZFOB 3LSOA 4BFIB 3VRJA 3EO0B 1AD0A 3VRIA 3QCTH 1QVOA 4MJIA 2P49B 4ZUSA 1BQHB 1JK8B 1FO0A 3KXFE 2APVA 4ONFL 3MOBL 2CKBH 4GO6B 5H2BB 2O61B 1U91A 3BRFA 3GMPA 1I3VA 4IMKA 5DJ8A 3WIHH 1MELA 3U0WH 4OCLC 3HNSL 3FFCA 3HI6L 4KJWC 1NUFA 4JO3H 2HJLA 2H6PA 1QBAA 5CINH 5J9PB 2CD0A 3PHQA 3VXUE 4TSBL 1IGYB 3LPFA 1ZANL 2KH2B 4U2YA 5ANME 4XWOC 2PETA 3ZHDA 1N7ML 4R0LB 2XXCB 3P40A 4G8FB 5CWSB 1BAFL 2DOCA 1FPTH 5E8OA 1CDYA 2AK4E 3DX7B 1QOKA 3MRRB 4ZD3L 3B43A 1BQHG 2VB5A 4PRNB 4MA3B 5KJRL 4Z7UA 3F6LA 1W72L 4YDJB 1U3ZA 3IU3A 4O4YL 4K71B 5L8KB 1YJDC 3U46A 5IW1B 4OV5B 1DE4B 4CMMA 1J05A 2BSSA 2AK1L 2VE6B 2IGFL 3ZYZA 2QQKL 3LKNA 1WIUA 3OGOE 1K8DB 3S88H 2YPVL 2ZOKA 1UENA 4WENB 4X6BB 1XGQA 3IXTB 1CXLA 1BVZA 2Z31D 4QRQB 4HWEH 4YHIA 4OQ1A 4OKDA 4R90L 4FP8L 3DETD 4YBQD 2BRQA 1CF8H 3W9EB 1VGKA 4QHNA 4NQDA 3WFCH 2VISB 3PWNB 1U8IA 4GW4B 3PWVA 1HWGB 1J0JA 5A3ID 1UWXH 1BIIA 3U4BH 5E99L 1XR9A 3IDMA 1RUQL 2ZUVA 2X4SB 1YN6A 4Y5YB 2I9LA 2WWKO 1NBQA 4ODVH 5I8OH 2P7TA 2ZG3A 3B9KB 4QNPE 4U6VH 4PRPE 5E1HB 4MZ2A 4U1KA 3OKMB 2K9UA 3V6OC 5MHSE 5T5NF 1IRAY 2G9HB 2VDOL 5D1QB 2ZPKL 2NXZC 3V6ZB 3RUGA 4K7FB 4LNVA 4YDLC 4QRPA 3VFUB 4HS3B 4ZO6A 1VEMA 2GY7B 4YHMH 3V6OE 4JRXA 4Z0XB 1JZ2A 3W11C 5FUOH 4HJJH 3R06B 1UACH 2ICWI 5GZNC 1XCTA 3M8OL 2QR0A 3INUH 3AM8A 2VITB 5I1KH 2BC4A 3J8F7 5B8CB 2W60B 3OPZH 5F96L 4D9QD 1WBYB 4U6XB 4H25B 4LSSL 1KFAL 2AJ3B 3MNZB 5D71L 4LQFH 15C8H 3V79C 5LJYH 4NKDB 3S6CA 3O3BB 3UC0L 1RURH 3TA3D 3WNPA 3HUJF 4OT1H 4I9WE 4WEBH 3G9VA 2YD9A 1KJVA 2XKNA 3RWHA 3KXFA 3ZE1E 2WBKA 1Z3GH 3HC0A 4RX4D 1YEHH 5C0FA 5A2IH 4OKVA 2A73B 5INDB 4OIBA 5FOBB 5IB5A 5F8QC 4OI8A 1UGNA 1DQML 4CU6A 4XNMB 1D7FA 1P4BL 1TETH 4QYOB 3KR3L 4XAKE 1GVIA 1YUHA 2VZ1A 4RAVA 5IESL 4JFFE 1JNLL 3VXUA 1RZGA 5D9SA 1A3QA 1EXUB 1N2RB 2YN5A 5GSVA 1QSFE 1WAAE 5ANMA 3ZSTA 5D2NC 3WHXA 3STLB 1OAYH 4ODUB 5E70A 2Y6SC 2YXFA 1LO2H 5FA3A 3ECBA 2G2RA 2AK4A 4LPVA 1SBSL 4QHMB 4L8BB 1XH3B 3GSOB 5C9JA 5D2NE 3RIAF 3MRMA 3D18A 1KIPA 1OP9A 1UKSA 2IBBA 2P4AB 5LXGH 5JPNA 4YWGH 4PGJA 2GQHA 4FXLA 4E42B 5F9JA 1JZ3A 5IVOA 4RISH 2DD8H 1X5ZA 5F1SA 3K8MA 1BZ9A 1F13A 1OQOA 4BH8B 4ACPA 4AEHH 1CR9L 3OX8A 2HN7A 2X1OA 2PXYB 5KSBE 4X6DE 4P3WA 1GXEA 3NZ8B 2YPKB 4HUUA 3EJYC 2C26A 4OGXL 4Y5VC 5T5NG 3WUWG 3ULVF 3UYPA 3HZMA 3HUJB 4IIQC 5I9QB 3GKWL 4Z18A 5DHVH 4FXKB 3O4LE 2Z8VC 4RFNC 3WDIA 2V2TA 5CBEA 4AT6B 1IEBA 3WKNA 1NGZB 4P5TC 4PRPA 3VWKB 5E8DH 4MMXC 3RWDA 3BIBX 2X5PA 4P3CL 4OB5L 3HFMH 2ATKB 2FYYA 2XZQL 2FECL 1VSCA 3FQTA 1ORQB 3RTQB 1TPXB 4L3EB 1PYWA 2Z91A 4FQ1L 1T3FB 2F5BH 5GISH 4TVPL 5MP6H 5HYSG 4LSUH 2GW5A 3WCYA 1FGNH 1AHWC 2NY3C 4J3UA 4EUPA 1FBIH 5IK3B 4P59L 1YYMH 4U7SA 3V6OA 1AXSA 3THMH 1S9KC 4L29A 1ZLUH 4OCWH 2DQDH 3QUYD 3EYFA 1JGLL 4LRNL 3HA0A 3JWOL 2R23A 2CJUH 4D2NA 4W70A 3U1SL 2QQQA 4NN7C 3MV7D 4KJPC 4XWGL 3MR9A 3JWDC 5E9DD 1RIHH 4MX7A 3CFEB 1QSVA 3CDFA 4GG8B 3E8UH 2X4OA 1S8DA 5GRJL 1ZA6A 3VFWB 3L3IB 5GRUL 2R2CA 1D6EA 3KAAA 4YPJA 3TWCL 5EU5B 4AEIH 2NPLX 4DVRL 4RMRA 1TTFA 1KJ2A 3FTGA 2RCSH 2ZUUA 4MD0B 3UTPE 3MBXL 3DGCR 4LSQH 4OZHE 1NQBA 1H3WM 1CBVL 3RHWF 2HTKD 3RWCB 3O3AA 4XTRC 1FRGL 4R4FH 1ZLUK 2VZSA 1MIEL 4I13B 3DNKA 1UJ3C 2HVJA 3GIZH 1UQSB 1R0AL 3VWJA 3IDXH 1JRHL 2WWMC 4GS7C 5EPMA 3D69B 5A2KH 4JFPB 4JN1H 3RTQD 3MXVL 1CGXA 1B4JH 1T0NB 1YDPB 1WFNA 4JFFA 3VXQB 1T03L 3WXWH 5LWYH 3MRQB 2O5ZH 3RVWD 3CFJA 5I75B 2ESVB 3LZFH 3QIWC 1UXWB 3OZ9H 3P4OA 1IGCL 4NNXB 4RMTA 4P9HC 1XF3B 1E4WL 2B1AH 3VH8B 1QSFA 1WAAA 5IHZA 3ZYOA 5I17B 5TQ2L 1WZKA 4TVSa 4DTGH 1I1CA 3UMTA 1ZHLB 4D9RE 5FGRA 7CGTA 3FN0L 2BNQE 4G9DA 3MREB 1E4XH 4YC2B 5D2NA 1GGIH 3P73A 1V7ML 2E7HA 3CCHB 3RWGA 4R3SB 3IDIA 4ZO8A 2NW2B 4PRIE 5GRYA 5SWZB 2R4RH 4YHOL 2ZSWA 1IC4H 4OM1L 4Q74A 4PJXB 4R26L 1BX2A 4UB0L 5FO7B 4QEGA 1UB6B 2OL3L 3G5ZA 3FQNA 1DEEA 1HXYA 1VDGA 5ID0B 4FFYH 4PLKC 5EA0L 4IDJH 1BJ8A 1NCUA 2X70B 3RI5F 2CLVB 1JYWA 2A77H 5KSBA 5DJ2A 5DWUH 3MACL 4X6DA 3ULVD 2R1WB 1KGCD 4E5XA 4DW2H 2YD3A 3VFGH 2ADFL 5DQ9A 2ADGA 4S1SH 3NZHH 5GGRB 1II4E 4JANB 3O4LA 3DVIA 5BVPH 1OGTB 1R3LA 4FFVD 1G7QA 4L8CA 4FQXC 1BZQK 3Q6FB 4Y5VA 3HS0B 4DGYL 4PGZA 4TNWF 4IIQA 2F53D 5DJAB 5JW3L 3RL1B 5B39A 2QADC 2F8OA 1QBLH 2NXYC 1C16B 1CVSC 4EN3B 5I8CB 1P4LB 4P57A 3IFOB 4APQC 4P5TA 1U3HB 4OLUH 1CG9A 2XTJB 3GSQB 3MRIA 5SWZD 3OF6D 2W65B 5IMOB 5BZDB 5JHLL 4JM2F 4PJCF 1IEAB 2HFGL 4MWFA 3RIFK 3QXDB 4B5EA 2NY4B 3BP7B 4XPAL 3QUXB 4TUOA 1I7TA 1RJZA 1KTLB 4L3CB 1AHWA 4KGJA 2Y5EA 3OKOA 5D70H 5IBLD 3FKUS 4G7VL 4F3FA 5CJOL 1R3JA 2L7JA 3U79A 4XP4L 3F5WB 4XNUH 4F58H 1EUTA 1F5WA 1JN6A 4JM4H 1HZHH 2UVFA 3ARPA 4PLNC 1B6UA 1IT9L 3G08A 1SVZA 5DEGB 1RMFL 2YK1H 5AD0B 1RIUH 4TUJB 1WFTA 3GJEB 4JO4L 4X6EB 4XP9L 1JMXA 4OZHA 4RGNB 5FGCE 4Y4FC 3WE6B 2CLRB 4LP5A 1D9KB 2AEPL 4KKBD 2H9GB 3M17A 3Q5TA 4R4ND 2PR4H 3EDKA 4XBPA 3IDJA 3UYRH 5CZVL 2OZ4H 1SYVA 2EIEA 4RFEA 1GIGL 1YEFL 3L5WA 3MOAL 1AH1A 4HKXB 4EN3D 3HN3A 4QWWD 1MREH 5DEZA 5IHUH 4B7IA 1UJ3A 1U3HD 2A83B 4KU1A 5E8NA 2EICA 3S5LB 2XTJD 2N7BA 1BP3B 1TDQA 5J12B 3CDGB 1A7NL 3MRHB 5BV7L 1Q0YH 3SE8H 3MJ8A 1NLDH 3ULSB 3QUXD 2EDXA 1XIWB 3QIWA 4NDMA 1LEKB 4G3YL 4PG9A 3B2VH 1YEJL 3PHSA 1SJHB 2Y23A 2BNQA 2YUVA 2YXMA 4ODBD 4RMUA 3RWJA 3WFHA 2J88L 3QUKA 1IQDA 4WO4B 5F88A 2MTPA 1MWAA 4PRIA 4PJCB 5C6TH 5TE7L 3UCRA 3L3JA 1PG7L 3QO1A 3SDDB 3X3GL 5HYFA 4B41A 4FZEL 1OGAB 3MROB 4JHAH 3T2NL 2OI9C 4YNYA 5EULV 3H6JA 3S5LG 1I7ZA 1D9KD 4GSDH 4IOFD 5E95B 1IAKB 12E8L 3HPLA 4QTIH 3SDXE 1UM5L 1DUYB 2LE9A 3B9DA 4H1LG 3IF1B 2Y72A 2ORBH 2M26A 1A64A 1URLA 5SWQB 3KLHC 2AJYH 3CMOL 1U36A 4U6HA 1F3JB 2VLJB 3E6FA 3U7YL 4WHCA 4B7LA 3RNQB 5GGUA 3U0PB 3MLWL 1YYLH 1P4IL 3CZFA 2H2SC 4PJ7E 1XIWD 1INDH 1KCVL 3O3DB 3EYUH 1K3ZA 2IANE 4NZRH 4GUPA 3V52L 4FQXA 1ED3B 1RZJL 4XPGH 2X9XA 4WFEE 5KSVA 3TO2A 4TNVK 4JM2D 4DFHA 3F7PC 4I2XE 1OAQH 4TQEL 4QHKI 4JY6A 5L2KB 3SDDD 4GOSA 4O58H 3MBEB 1OGAD 3RP1A 1NBZA 4APQA 3KYMA 3G5XA 3BH9B 4LASL 3F12A 1F4WL 4MLIA 4Y7MA 1M7XA 2AI0L 1MCFA 3B9VA 3QHZH 1KN2H 1A14L 1QSED 4X6CE 3MNVA 1DSFL 5I1LB 3B5HA 4LHQB 4NKOA 4GRLC 2XKSA 3BP4B 4HZLB 1IGIL 5IQ9A 2VLJD 1OTSD 3MJ9A 3TCLB 1UB5A 1DVFB 3FHQA 1H15B 4XHJD 4IMLA 1I1FB 5IQ7L 1NGXB 2GK2A 1Z2KA 2E8YA 2XPGA 4J23A 2FWOA 3AS0A 2FIKA 1IFHL 2BNRE 4LCIL 3AU1B 4Y4FA 4POZD 3EOYG 4M9PA 5IW3A 4Y4HC 5DO2D 3SCMB 4JFEE 2VR5A 4ZAKB 3OHXA 1YQVH 1R5VB 4NKQB 1YNKH 3ZKQD 5T3XH 3HE6B 3RKPA 2J8UF 1JBJA 1MIML 1G84A 4O2EA 4UTAH 1G7HA 3D39E 1NGWB 2XY1A 3LEVL 3MBED 1TVDA 4F7MA 3GUTB 1FYTB 1Z6JT 3JV0A 4JFYA 5DD1H 5F7DA 2HVKA 3GSWB 1JI2A 1WUNT 1CFSB 2VH5H 1ZA3B 2MKWA 3L5HA 1BOGB 4NZDA 3QB7C 1NAKH 4I5BA 4P99A 3WEXA 4JHWH 1BVLB 3MGAA 3C08L 5IM7A 2NY2C 3WFBL 3ZDZF 2PTTB 3TGXA 5EU6B 1CFNA 3H9HA 5GS2D 1BJ1H 1ZVHA 2PW1A 3QXVA 3OR7B 3BSZH 3S34L 1DVFD 4EBQH 3GSXA 3C6SA 1PY4A 4R97B 3SDXA 5DRZA 3T0VA 3KYKL 2QJDA 3DXAA 2JB6A 1TJGL 4OZGF 2UYLB 4LL9A 5I1HH 4ZAKD 2IJ0C 4HBQA 3HE6D 1GOHA 3ARBC 1RPQA 3V0VB 4UAOC 1JZ4A 2EDWA 3DRQA 1CDBA 1KXQE 1FYTD 3TT1H 1F4YH 1NKRA 4P2RB 4PJ7A 1S7XA 4IRSC 1XGTB 2XRAL 5D8JL 3GMNB 1IBGL 4KTEL 5DK2A 2J8UB 4F7TA 5H94B 1NDMB 1CVRA 5EU6D 3HG1E 4I2XA 4KQ4L 5KANI 3CVHA 4YXLL 1XMWA 4P2CG 1U8MA 1SJEB 4GG6E 3FOLB 3FOMA 1S5IL 4HS6B 3SQOL 3FO0L 3QULB 3S35L 4YE4H 4G8EB 2N4IA 3BT2L 3EHBD 3EGSA 3VFVA 1CYGA 4ZPVA 5F89B 1U8JB 3SBWC 4UT6L 2G5RA 1KT2B 1N3NB 4PV8A 4LVHC 4X6CA 4WW2C 5JHDB 3FFDB 5ERWA 3H0TB 5FKPA 1IC5H 3ABZA 4WHDA 3FL7A 3L3KA 2EEBA 1T2JA 2JELL 3MRJA 1WISA 3BH8B 3AREC 3OBAA 2FGWH 5EN2A 5AWNL 5J89A 4PR5B 1WT5C 3PL6C 2AV1A 2IADB 1IZKA 2V2XA 4GRLA 4GKOA 5D5MF 1A7PL 2BNRA 4AY0A 1FQ9C 3A67H 4JGMA 1QBBA 3K2MC 4ODXA 4KMLB 3BXNB 4JFEA 4F2MA 1Q8MA 4LBEB 5JUEL 3TBWA 4RSVA 2XWBB 2AV7B 2VDKH 5DVKA 1FE8L 3RVTC 3OKKA 1T20A 1QO3A 3D39A 4ETQA 2VXSL 1H0DA 5JA9A 1PQZA 3MYZA 1FLRH 1OSPH 1RFDL 4Y4HA 3VXMB 2EYTA 4NT6B 3QDME 1FG2B 2BRRL 4ISVA 4DN3L 3SDYH 3FQXB 1U8NA 2HLFC 4M6OH 5EIQA 4OGZA 2XI9A 5JW4M 1UH2A 5GGVH 1IGFH 4D3CL 1CN4A 1X5AA 1NFAA 4K23L 5TDNA 1TVBA 5EZOL 3DURA 1NMAL 2J6EL 5HHNA 5JHDD 2I60L 4LVNC 4P5MB 1ZE3C 3LQAC 4PD4J 4XRCB 4OTXH 4KK8C 4PY7B 4Z8FL 3OTTA 1F97A 5IG7A 4N0FA 5J57B 5CSZA 3QEGL 5F1OB 3B6SB 2QL1A 4CMHB 1U8QA 4M43L 4QRTB 2IBZY 3T4AB 1B2WH 4PTUA 2QBWA 5F7HA 3F7QA 4KUZL 5DD3L 2R56L 1INEH 3BP6B 4HXAL 1GHFH 2DLTA 3QIUB 5GJTL 3TCXA 2UZIL 5D93C 3BZFB 5D7KE 1WEJL 2R2EA 4MNQD 5EO9B 4GMTL 3BQUD 4ZQKA 3D0VB 4NRXB 4U1SB 2CIIA 3H3KA 4HUVB 4KZEH 1KXVC 3GBNH 4FQIL 4LCWD 3QQ4B 4NZUH 5D5MB 4L4JA 5ACMA 2EYSB 4XMPH 3VD4A 2EDTA 3ARBA 2Q8AL 4OQTL 1IC1A 2PYFA 4MXQD 3VXTA 5ITFA 2Y06H 3TJEL 2AJXL 3DRTA 1ACZA 2OYPA 2UWEF 4H5SB 2GFBA 3V7AG 4PG2C 4IRSA 2AQ1A 3HG1A 3MRNA 3I02A 4A6YH 3D3VB 4PJ9D 2FRGP 1J12A 4GG6A 2ATPB 1WQVT 5T3ZL 3QRGH 2NZ9D 1NBYA 4D0CB 1UH4A 3MLRL 4ODHH 1P9MC 2FX9L 2YUWA 3K81A 4EDWH 1QR4A 1JGVL 1VHPA 2CDFB 1I9RH 3HR6A 2R1YB 3W2DL 4YZFF 1AP2B 1HHGA 3OXRA 2YZ1A 4FS0A 1AXTL 3D1MC 3VGBA 3CU1A 2P5EB 3QIUD 4YIQB 5C2BL 1DBKH 1I75A 3BPLC 3SBWA 3HI5H 1LP9E 4NQVB 1IGTB 5TF1L 3S96B 4WW2A 3A6OA 3BKMH 5LGKA 2GYSA 1TZIA 3MLUH 3LV3B 4HK0A 3AREA 3TZVC 2LQRA 1Q9OA 5C07B 4XX1G 1WT5A 3PL6A 1CWVA 1IM3A 1WITA 3AVEA 3V4UH 3PWPB 1EUUA 3MLVL 3D3VD 1WK0A 1ES0B 5IWLC 3O2WL 4LHJB 1KB5H 1RQ5A 2X4UA 3OKNB 1J86A 2CRZA 3IJHA 2HP4A 1YC7A 4FNLH 3O3UN 4OGYL 4KROB 3QDMA 3UTTE 1QFWL 5FO8A 1DFBL 1RUPH 4OAWA 4XVJL 4HC1H 4WFHD 4LCCC 5FYKL 3I75B 2IMMA 4OSUL 3SJVE 2UWEB 2GTWA 2Q76B 1MCPL 2BSTB 4PJEB 1ZKAA 3LEXB 4WVRA 3J7HA 5ISZD 1I7RB 5E08L 1DQLH 2P5ED 3QXUA 4M7ZC 1IL1B 5EU3B 4F8TA 2DQFB 2HA1A 4NKIH 4NQCD 3BAEL 1H3PL 4HIHB 5FO9A 3U0TB 1KCSL 1FZOB 2E9IA 3NIGF 2HFFB 1GZQB 4G42A 3H9SB 3MYJB 4GAFB 4M5ZL 3UO1H 1TCRA 2DWEA 2R2BA 1RV6X 2FJFA 3AC0A 4XP1H 2BHUA 1TXKA 4HJ0D 2X41A 3OG6B 3QWOA 3GJFA 5SX5H 5EC1A 2BVPA 2BOCA 4AL8L 5I18H 5C07D 3HRZB 1CDHA 1CL7L 5KTEH 2HMID 4PV9A 1MLBB 4C56E 3RWFA 3N0PB 4FXGB 5DJCA 1W2KT 5D7JD 4UTBH 1L9MA 3V8CA 3L3DA 3P9LB 3CLFL 3DTXA 4IJ3B 2MQ3A 5BOZG 3HPJB 4M8VA 2AQ2A 1TZGL 1T1ZB 4MQ7B 2GJZB 5FOJA 4KQ3H 1A6TB 2H3NA 1I8KA 4KROD 3SKUD 5JNYB 4ORGB 1WBZA 4ZYKA 2HT2C 4NO0A 1NCCH 1V8HA 4YX2L 1NPUA 4CGTA 5ICXA 3AS1A 1V7NH 3BEWB 1ADQL 2FB4L 1FAIL 5CP3A 5E4EB 1SM3H 1N5AB 1JZ6A 3NIFF 4NYLB 4HGMA 3U4AA 4KJQC 4ONFH 2JK5A 4LVOB 1CXEA 1OOAA 3G5YB 3EZJB 1Y6NR 4PG2A 3H9SD 2P46B 5A2JH 2GJJA 5F93C 1WJ3A 3NPSC 4NM4L 4PUBH 1BFOB 2CLZB 4PJIE 4XZUA 1SHMA 3HNVL 3UZVB 4Y19D 2HRLA 4HJGA 3HNSH 1NFDF 4FQLL 4HS8L 1P9MA 5DRWA 4LFHG 3TEUA 1JGEA 1HILB 3L6FA 3WN5A 3HZVB 4XCEA 1HCVA 4P3DB 5EORL 1FL3B 1IKFL 3VA6A 3FQRA 2YSSA 1EO8L 4BYHA 1LP9A 1N7MH 1UYWH 4AEEA 2F54D 1AR1C 1BAFH 3BZEB 4ZD3H 4GAJL 1KJMA 5J0BA 4XBGB 2GSIA 1KEGH 3PQYD 4FQHA 1UWEL 1G7PB 3JV4B 3KJ4B 3GDBA 2L7UA 2AK1H 4X7TB 3TZVA 2A0LD 2IGFH 4U1IB 2QQKH 1T7YA 1GC1L 1JUFA 3O9WC 5IEKB 2ITDA 5EIVA 5JPMA 2YPVH 4LEOA 1ZWIA 4JO1L 4ZUTA 1D5BB 1NH6A 1JZ5A 1CD9B 4HHAA 3UTTA 1S7UB 4R90H 4XNZB 3TBTA 4JQIL 3V5HB 1XGUB 5E6ZA 1M71B 5IWLA 3OJDB 4JG1L 4MZ3A 4MXVE 3SJVA 4N8VA 2WUBH 1AO7B 1FFQA 4XCYB 1YEDA 2BJMH 3EYOA 5IB4B 1T89C 4N0UE 4DOHE 3TFKC 3BVNA 4RGOL 2LU4A 1RUQH 5DQDL 4LOUD 2DM2A 3CLEL 4OFPA 2FO4B 5MEPB 2UUDK 3DWTA 3GI8L 1NAMA 2IH3A 2YBRB 4MQTB 3QFJD 4KK9D 4OD1L 4RZCB 1QLFA 2IALA 4M1GL 1W8NA 3GSRA 4HKBB 2BVQB 4JZJC 5IV2B 3GMRB 1NFDB 4LSPL 5C0BE 3DARA 2VDOH 4R0LC 4R2GB 2ZPKH 3QNYB 1FNGA 1T1XB 3P4NA 4M4PA 2W1NA 5JOPE 4X99B 1YC8A 5DJZB 4C56A 3MUZ1 1BD2D 3CFKB 3AB0B 4Q2ZB 3DSFL 1EBPA 4I0PB 4RNRB 1XF5A 3BGFB 3N1MC 3FO2B 1BPVA 1CFTB 3D2UA 43CAB 1ONQB 2DQUL 4M8QB 3G5VB 3H7LA 4KC3B 4ELKB 4OLWL 3A6BL 4O2CB 4LSSH 1KFAH 1W8OA 1U42A 5DURB 3DX8A 3HNTH 3C5JA 4UQ3A 5D71H 5J56B 5DLMH 5C8JA 3MCKA 5CILL 3IJYA 5DJDB 5CUSL 3SE4C 5KZCD 3UC0H 3SGDH 5E4IA 2V9QA 4JLRA 3X13A 3LQZB 3UTZB 4MB3A 5IR1B 5T3ZD 2DLFL 4MJ5B 3HZKB 2EXWC 2FEEL 1JHTB 3MGOA 3I6GA 5IF0B 3BP5B 2NY5C 2ICWA 5BW7C 1EEZA 2Z35A 4HWZB 4OZFA 1CDIA 1IMHC 3IETA 4PJIA 4PGCA 4QXWA 3VFMB 1Q9LB 4FOMA 1MHCB 1HH6A 5BS0B 1JNLH 4K7PY 5IOPB 1KYOK 2R2HB 1BQLL 4J4PD 3T2OA 5D1QC 1G7JB 1GOGA 1QFUH 1S3KH 4XPBH 3GM8A 35C8H 4I0PD 2IAMB 2XFXA 3LDBB 5MEOA 1UM4L 5ACLA 3X12A 1L0YA 5IIEA 1SBSH 1KIQB 2MQ0A 5FYLD 1CGSH 1HHIA 2VSCA 5GGQL 4LKXB 5GXBB 1V3KA 1YY8A 1ZXQA 4DCQA 2WAHA 1O7VA 4EI5B 4MCZB 3QUZD 4LCUB 3N9GL 5K59E 2G60L 2DMKA 3MRKA 5DVLA 1JGUH 2ADIB 4MMZC 2XT1B 5LGHH 2IBZX 5T1LB 3U2SB 1TTUA 4PY8I 4Z7UF 2F15A 4J3WA 2Y5TB 4K3HA 2ILLA 2DMBA 3RGVC 1CR9H 5K9KA 3UPRA 1X5LA 5CZKA 5FYKD 3LVEA 3VI4E 4X4ZA 1RUML 3O9WA 1BBDL 1MHEB 1NCDL 4NO5B 2VL5A 3PP4L 3FB6B 4ZFOA 4BFIA 4N0UA 2YA0A 3EO0A 4OF7A 2VAAB 4H88L 1IAIM 3OXSB 3C2AL 1MCNA 3OJVC 3PJSB 3BYYA 2IAMD 1T89A 3LSOB 4H1LH 3CD4A 3VRJB 2DDQL 5J6HA 1AD0B 3NCCB 3VRIB 4DN4L 1QVOB 3U36A 5HDBF 3RI5K 5C0BA 1FO0B 5E5MA 4S1DC 4FQ1H 1ZVSB 5L0QB 3BO8A 3GMPB 1OCWH 1IGYA 4JZJA 5DJ8B 4K94C 1J0IA 1X4YA 5F7EL 4YR6A 1L7TH 2BSED 4HUWA 4R0LA 3FFCB 4WUKL 1A9EB 4G8FA 3W39A 4NQUA 4QXTB 1MHPL 5F7LB 2H6PB 3WD5L 1ZGLM 3PHQB 4TNWK 2P43B 3BJLA 3MRRA 3RKDD 1KXTB 4GXVL 4LP4A 3RUGF 4J6RL 2JJTC 4MA3A 4JCLA 1CK0L 5CLTA 5A43C 1N0LA 3WS3B 3IT8D 2C3HA 2Q86A 3HC3L 4R7NA 3QNZB 5BMFL 2P42B 4XVUC 4ELME 5GRJH 5IW1A 5IBTL 1I7UB 3QUMA 4W81A 1LE5A 1FC1A 3TWCH 2PXYC 1L6ZA 1OD7A 4DVRH 5MI0C 1K8DA 1KC5H 2E7BA 4X6BA 3WHE1 2E6JA 1CBVH 4OJFH 3U30B 1FRGH 1WBXA 4QRQA 3T0ED 1MIEH 2EEAA 3SE4A 1DUZB 4F7CB 1YY9C 2XWJA 4U05A 3RBGA 2V7HA 3W9EA 1OTUD 1LDSA 3E3QC 1TJHL 3LKNB 3WJJC 5ENWB 1MRCH 2EIBA 3VFOB 1KPVB 4MJID 2Y07L 2ZOKB 3MXVH 1XGQB 1MAML 3VWKC 3QDGE 1QRNE 1T03H 1R5WA 1T22A 2D0HA 3E3QE 3L9RA 5A1AA 5BW7A 1X5YA 4QHNB 3TC9A 2CMRL 3IGAB 1E4WH 3IKCB 3PWVB 4YEEA 1I8IA 3EO9H 5FCSH 3K74B 2YUZA 1BIIB 5TQ2H 3VMNA 1XR9B 3IDMB 1FV1A 1MCWW 3OKMA 3UZEA 3X11A 1G1CA 4LSTL 4UBDC 2EH8L 5D1QA 4L3EE 2I9LB 3V6ZA 2DIBA 3L5IA 5JA8B 2CDEA 5C7XL 1A6ZB 2P7TB 4WW1B 1V7MH 3QIBC 1U6AH 5IBUB 1TITA 1JF1A 4N1CA 1EIBA 4XVTL 4Z0XA 4YHOH 2X1QA 2WLZA 3HKFA 1R6VA 1MUJA 1CGTA 3R06A 4MD5A 4R26H 2P1YA 3IXAA 3RUGB 3RAJL 1GGCL 2EO9A 1MJ8L 5C09D 5IGXL 1HWHB 4QHKJ 1H3VA 2AJ3A 4JRXB 4JFQB 3MACH 2XG4A 1LK2B 4G9FB 1GGBH 1XCTB 2NZIA 2QR0B 3NFNA 3WDHA 3H3PL 2ADFH 2EKSA 3UXFA 3UDWC 2BC4B 4QHLB 3RGVA 1NANI 2GITA 3NCYS 4NQDD 2DBLH 2LVCA 3LH2L 4KTDH 4NUJA 2A73A 5IBUG 3L3HB 4DGYH 5FOBA 4KKAC 5JW3H 3NCBB 3IDYB 4M1CC 3BRGC 4M7LL 5I1IL 5KSUB 4ONGH 5CJXC 4LQ1A 1KJVB 2PCPA 1O7SA 3RWHB 1T80A 3SY0A 1NEUA 2WV3A 5H8DA 3HC0B 4OKVB 3AS2A 1CGVA 5D72H 4OD3H 1A5FL 4JO2L 4JY5L 5IB5B 4NCDA 1BWMA 2HLAA 3UAJD 4QNPF 3OJMB 5JHLH 4KDTC 2HFGH 4YC2C 2DI8A 1YUHB 2COQA 4WHYH 4XPAH 4XPHH 4QRPD 4N90E 5HHPB 3VXUB 1RZGB 1KENH 4G7VH 5D9SB 1EO7A 3OAYH 5DUPH 4GRMB 4XP4H 1QLEL 5GSVB 5ANMB 4ELMA 5HPMA 4NWTL 1ZT1B 1IT9H 1RMFH 5FA3B 2OM5A 2C3XA 5HDLA 3FT4A 5BZWB 2G2RB 2JJTA 4PJXE 1JYVA 2RIKA 4TPRL 3VXSB 4E42A 3P0VL 4FTVB 1F3DH 5E2TH 1OQXA 5C9JB 4XP9H 3MRMB 5CCKH 4GRWB 2CKBA 4BZYA 5KSAC 4TSCH 1KIPB 2AEPH 3EYVA 2PXYA 5CZVH 2XYCA 2X89D 4GQ9L 4HIXL 5AYUH 5HGGS 4JVWA 2EDQA 3NZ8A 1GIGH 1HH9B 1YEFH 3KXFD 2J4WL 5GRVL 1BZ9B 1FH5H 5B3NA 3QDGA 1QRNA 4FXKA 5DMYA 2W9EL 4PLJD 3KYNB 3ZE1F 4ZS6D 2ADJB 3WFDL 5EOCH 4S1QL 1I8MA 2HRPL 4QXGH 1MQKL 3OX8B 3QFDB 1BLNA 3WJJA 2E7MA 1NGZA 5DT1L 3MCLL 4HUUB 3G6JE 4N5EC 3HZMB 5BV7H 1Q38A 3VWKA 1GZPB 2R9HC 3B83A 4G3YH 5F7MC 1INQB 2V2TB 3WDJA 1YEJH 4TN9A 3VXUD 4L3EA 5CBEB 2NY4C 3MLYL 4HLZG 1IEBB 2J88H 3SOBH 4KJWD 1LO0H 5I1CH 1QUNA 5D4QA 4TTGA 1WAAF 4J3SA 5IK3A 5HYIA 5ITBL 5TE7H 1A7QH 2FYYB 1PG7H 2AK4D 2FHFA 3IFNL 3VG0L 4I3SH 4MSWB 5TDPB 3X3GH 3IAGC 3FQTB 3O0RL 4FZEH 2WANA 1IGJA 3T2NH 1HCFX 2Z91B 4XWOD 4JGJA 3QIBA 3PGDA 3L7FB 2R0KL 4EUPB 12E8H 1MWAL 1OAZL 5T33H 4LPXA 2I07B 4L29B 3CFEA 4YBLC 3BKYL 4RGNC 2AP2A 3VFWA 3EYFB 3L3IA 1ZLVK 4KKLC 1FPTL 4CKVX 1I4FB 5DDHA 3ZTJG 3MR9B 1EMTL 1KG0A 5L2JB 4RGNE 3WLWD 3U7YH 4PJDB 4JDTL 2X4OB 3RQ3A 5KSBF 1ZA6B 3MLWH 5B38B 1D6VL 1UQSA 1DJSA 2DLIA 1P4IH 2Y36L 3F58L 1D6EB 3UDWA 5DRXB 1V3LA 1B0GA 4K3JH 1KJ2B 1FNSL 2VDPL 3S88L 1IJ9A 5J12C 3SGDI 1TENA 2E9JA 4NM8H 3ZZ1A 3V52H 3SKOB 4EUPG 3O2DH 2HVJB 3MNWB 1CF8L 4PRPD 3VWJB 2UZXB 1HI6A 4TQEH 5CJXA 4MDJA 5EPMB 5MHSD 1F11A 4DKEH 3BD5A 1DLFL 5C0IA 5I17A 5C0JA 4WO4C 4OCRH 3LN9A 4NP4L 1JPSH 4JFFB 2NY0B 3SDCB 3CFJB 3MJGX 1A1NA 1MEXH 3P9WB 3P4OB 4YHZH 4LKCA 1Z9OA 2CKNA 3FN3A 3OKEB 2RHEA 2XWTA 4K7PX 3MUY1 2AI0H 2QLVB 4ODVL 4KDTA 4WI4A 2RFXA 1QSFB 4TYUA 5IHZB 3S8WA 1A14H 4U6VL 1DDHA 2NXZD 1SEQH 2NW2A 1DSFH 4V2BA 4ZO7A 1MCKA 2Z93B 4OIIH 4PJXA 4HX1B 1MCOH 4XNYL 1MY7A 1J11A 5FO7A 1IGIH 3W11D 2B7DT 3P73B 5GZND 2H8PA 2X42A 4KY1L 3RWGB 3LPWA 4L9DA 4OCMC 4RA0C 1GL4B 1FC2D 2JTDA 1IFHH 4I9WD 4HJJL 5FUOL 4R7DB 4MAYB 1EFQA 1BX2B 2X05A 3INUL 3G5ZB 4CU7A 5KSAA 3K7UA 1TQCB 3QQ9C 3LN5B 2OTUB 5GGRA 4OZHF 1DQJB 4WEUD 3T3PE 4CNIB 1J9CT 5DJ2B 4X6DB 2Q1EA 3Q6FA 1OF2B 3HS0A 5HI4C 4N1EA 5DJAA 3G6JA 4XAKD 2B39A 3RL1A 1RURL 2KUTA 3CH1B 5DQ9B 4JFFD 3FONA 3RBSA 3P4LA 4ZPTB 1N5YH 3BFOA 4MS8C 1P4LA 1YEHL 3IFOA 2AJZA 4Y5VB 1QSFD 5C9KA 2W65A 2GHWB 5B39B 5L2KE 4RFNB 1TETL 2FDBP 5FDWB 4YLQT 4G6AC 1U8PB 3BP7A 5I74B 4P5TB 2NY6C 1KTLA 3S34H 2EDLA 2Y6SD 1A7BA 2FECI 4HT1H 4UMGA 2DQTL 3F5WA 4ZFFA 2B5IC 5TH2A 5IW6A 3KYKH 1OAYL 4G80B 4YHKH 2C1PB 2KDGA 4WJ5A 2VLKE 4TUOB 1I7TB 4P2YA 5GGSA 3WS6C 1AHWB 3F62A 3OKOB 4TUJA 5DHVA 4CVXA 1R3JB 3FCTB 3GJEA 2KL6A 3CGTA 3QQ3B 1JN6B 1MAJA 4FQCL 2MMXA 1CXIA 2GUOA 3WE6A 4ZUUB 3SCMC 1B6DA 4U0QB 5B39G 4YWGL 1IAMA 2BVOB 4B0MM 5F7KC 1TJIL 4Z78B 3O4LD 3QZWA 2XRAH 1QPXA 4OZHB 5GPRA 5D8JH 2XV6B 3EJYD 1IBGH 4KTEH 2JB5L 1UUSA 2A83A 5F1KC 4FABH 3L95A 3M17B 3TNNB 4XBPB 2AAVA 3IDJB 2NMSA 1SYVB 5JIIA 4KQ4H 2BOBA 3KPOB 5DI8B 3VFNA 4QGYA 2W07A 2X4RB 2YA2A 3MRHA 2GCYA 3SQOH 1S5IH 3FQUB 4K3DL 2FR4B 1JRHI 3FO0H 5A16B 3S35H 3ULSA 4P5TD 1LEIA 1UJ3B 1LEKA 3BT2H 3ZKMC 4IRZL 3C60C 1OP3H 3L3GA 4TOYL 3CVHL 1IKNC 4X4ME 1IAIL 3ZDYE 3MPCA 4WO4A 4UT6H 4QOKE 3MJ8B 4J2XA 2BVYA 4P49A 3HFML 4NDMB 5DVOA 4PG9B 4I1NB 2H41A 1CZ8L 2NY3D 3AXLA 3SN6N 3T2PA 2JELH 2BNQB 2DMCA 4L9LB 3RWJB 5MP6L 3OV6A 4HGWB 4XVSL 5AWNH 5FYJU 3QUKB 3UZQA 1FGNL 1O5DT 1GCFA 2AXFA 2ZWLT 1YYML 3V7MA 4K07A 3A6CH 3VGDA 2R0ZL 1OP5K 4KJPD 2D7PA 1A7PH 5JMRA 2EDBA 3UTPD 4YNYB 5AG8A 5SWQA 5JUEH 5ICZA 4JY4B 1RIHL 1FE8H 3E8UL 2V5TA 3RNQA 3U0PA 4HCRA 2VXSH 3ARGB 4X7FC 4XTRD 4UZGA 4P2RE 4FQ2L 4AEIL 3TPUB 2RCSL 3O3DA 2BRRH 4BQBA 4U6HB 4LSQL 1A6AB 3E6FB 2WWMD 4Z95H 5E2JA 4JHZA 4YQXL 4R4FL 4D3CH 4K23H 5JORA 3IAQA 2Q3ZA 1MFCH 1B9ZA 1NMAH 3TH4T 4CADB 1PY9A 3CZFB 1MCSA 3KPQB 5L2KA 3QIWD 2KBGA 5I1GL 4D9RD 5EOQH 1T6WA 2BNQD 4GUPB 3QEGH 1WCBA 3LZFL 5KSVB 3OZ9L 4DUWA 4PRID 3WBDA 4M43H 2QADB 5JW4Q 2AJVL 3BKCH 2NXYB 3LHPL 1E28A 1U41A 4NOFA 3TO4C 4AQ1B 4KUZH 5DD3H 2R56H 3GBML 3G5XB 2VLKA 5GJTH 5FUZL 2F8VA 3F12B 3LY6A 2GT9B 4GMTH 1E4XL 1I8LC 2C9AA 5D96B 3K46A 2XA8L 3TCLA 1L7IL 1H15A 3SDXF 3AUVA 3MNVB 4PJFB 1J8HB 1NGXA 4FQIH 2VQUA 3WS6A 3AFLA 4PLKD 5DR5H 3UYOD 4NKOB 4CJ0A 4P4KC 5CGTA 3WV0A 2Q8AH 5IQ9B 3AU1A 4KRMB 4OQTH 1T21A 2YZ8A 2ENSA 5KVDL 1WZ1H 3SCMA 1I1AC 3TJEH 4F9PC 1R5VA 1KBGL 4RRPA 5JQ6L 2A77L 3VMPA 5J4MA 5DWUL 2XPGB 5MENE 1JYXA 4KKCC 2IPUK 2YMXH 2E6PA 1BJ1J 4PJ7F 4DW2L 2KQNA 2QQLH 3VFGL 3VXME 5T3ZH 3GUTA 3KHQA 4FQXD 4OIAA 1CFSA 3MLRH 1UKQA 1ZA3A 3CXHJ 1A8JH 4I3RL 3LQMA 5BQ7B 5BVPL 3OHXB 1NEZA 2F58L 3ARRA 4ZTPH 1NBVL 5FF6B 1F90L 2QADD 4O2EB 3W2DH 4XCNA 1DQQB 4X4MA 4F7MB 4C83B 4Q9QH 1AXTH 4U31A 4JFYB 3FRPA 4APQD 4QOKA 5F7DB 5C0CB 3DYOA 2KZ1B 4CMHC 3KJ6L 2FX7L 5DMJB 1ZLWH 1QBLL 2YD2A 5C2BH 3C60A 4CN4A 4I5BB 4YDIL 5D7LE 1IKNA 4OZ4A 5H37G 2NQCA 5TF1H 4K9EH 1CFNB 3H9HB 4X6CF 3ELAT 4ENEC 1A6WH 3PDDA 4JQVC 4XNQA 1JVKA 3VI3E 1EJ6A 25C8L 5EDXA 2VTFA 2PW1B 3BMVA 2UYLA 3MV9B 4W6WB 5C0EA 2YD5A 5TDOA 5D70L 3F65A 1ACYH 4C4KO 4F8QA 5HVFB 4XNUL 1N6VA 3GSXB 3C6SB 2VXTL 4F58L 1AGFB 5DRZB 1HZHL 3MLVH 1MSPA 2AEWA 3O2WH 3DXAB 4HV8A 2JB6B 2OI9B 3OR6B 4Y4FD 3S7GA 4AYFA 1RIUL 4WTXA 4DVBB 5KOVC 4OGYH 1NLBL 4KUCF 3QSKB 2EDDA 4XVJH 3GMNA 1C08B 3ALXA 5FYKH 4OSUH 3DRQB 4TUKH 5H94A 2WBJC 2PR4L 3UYRL 1NMCB 4PJ7B 1S7XB 5DZLA 5E08H 1SJEA 5D7IB 3B8YA 5JW4N 2GJ6E 2P24B 4HS6A 1MREL 5ADPH 3BAEH 1H3PH 4Z0BL 1KCSH 5DK2B 3CNKA 4BJLA 1WFOA 4WRLA 3G6DL 3O6FB 5GGTA 5GS0C 5F89A 3MSPA 3UTQA 5K9QI 1U8KB 1KT2A 1N3NA 1Q0YL 3FOMB 1Z9LA 1S7VB 4WDIA 4AL8H 1NLDL 3HZYA 3QG6B 3H0TA 5GZOC 3KPSB 4UOW1 1CL7H 1AC6A 4M6ML 4X9GA 4HWUA 3EGSB 1UKTA 1YEIL 3BH8A 2A6JA 2IQ9L 1DBBL 1F4HA 1B90A 5E2WL 3TO4A 3QDJE 3MO1A 4PV8B 2BSRA 3RJDA 3CLFH 1FGVL 4OCSL 3STZB 3EZ8A 1TZGH 3L3KB 1Y0LB 4NQSB 2FH6A 1I8LA 3K1KC 3R0NA 1IAOB 4JHAL 1SY6A 3S37L 5EN2B 2EDFA 4JJ5A 3SHSA 3PWPE 3BXNA 1ZGLB 2WP3O 2CUMA 2AV1B 4LBEA 4NO2A 3CZJA 2XWBA 4P4KA 4GRLB 4QLRA 3KLHD 5MENA 2XTLA 2BNRB 1WC7A 4PFEA 2IAND 2ORBL 4ODXB 3VXMA 1HSBB 3DX6B 1I1AA 4Z7QE 1EFXA 4BUGA 4X4YA 5DTFB 4F9PA 1FG2A 4JFEB 4F2MB 4ZFGH 4WFED 2C3GA 3KYAA 2H2SD 2A6KA 3TBWB 4UOJA 4ONHB 3GK8L 2RBLA 1N6UA 3AMKA 3OKKB 1QO3B 4PJEE 4ETQB 1H0DB 3WNOA 4IS6B 1FO0H 4FQLH 4GG6F 2VKWA 4ISVB 1QFPA 2FBOJ 2P8PA 3KPRA 4XRCA 1GH7A 4X7SH 3HMXA 3CIQA 1IKFH 2MFNA 5D7LA 4HIIB 1TVBB 1KULA 3CDYA 3DURB 5CSGA 3MODH 5AAMA 5HHNB 3K8KA 2NW3A 4GAJH 1U58A 1I1RA 4IM8A 4C59B 4NZTH 1N8ZA 1TNMA 5CSZB 2AXGB 4QGTA 5DK0A 3FB8A 4WCYL 1UWEH 1SJVA 3BZFA 5DD0H 5EO9A 2Q7YB 4BSVB 3SKJH 3D0VA 4WW2F 4GRLD 4U1SA 4PTUB 2O5YL 4YEFA 1F6AA 4PS4H 4LLMB 3QQ4A 2Q7NA 4X80L 1S9XA 2HG5A 3KHOA 3CK0L 4KUCD 4JFED 2R2EB 4MVBC 2X9YA 1Y18A 5CIPH 4JQIH 4MHHI 4ZQKB 4WV1C 3RPIA 5C6PB 1WFUA 1A0QL 1XZ0A 4JG1H 3D39D 1B88A 2X1WL 1GOFA 2XOTA 4Y4HD 1NKOA 3OWEA 4TSAH 1X5IA 4C54A 4RGOH 2K3TA 1OY3B 3VXPB 2VZUA 1HEZA 1BF2A 4UILL 3ARBB 3CLEH 2GJ6A 3ARUA 5ALBL 4MB4A 4D0CA 3GI8H 5CJQL 4N9GB 2PYFB 1N59B 4KKNA 1YQVL 2WBJA 1YNKL 1DL7L 5T3XL 3DYPA 3HG1B 4M1GH 3I02B 2R1YA 5SWSB 5DC9B 5KS9E 3NIDE 3EOBA 4GG6B 2BFVH 4P48A 4OD2A 2NY2D 3M07A 1ZMYA 3QA3A 4YIQA 2Q6WA 3OAUL 5F44A 3Q0HA 5IB2A 3P11L 1ORSB 3ETBF 1OWRM 5L8JB 1X5FA 4E41E 5I8EA 1IGTA 1HHGB 3QDJA 2N7AA 3GM0A 4PBWD 3MUHL 3ALWA 3KJ4C 1HQ4B 2DQUH 3BEVA 3LV3A 4NCC1 2X4NA 4OLWH 2YUXA 1QQDA 3TA3C 1U0QA 3BSZL 3FT3A 3BESR 4URTB 1AQDA 4EBQL 4YHPB 3PWPA 2V5MA 5DQJA 5MERA 4Z7NE 2BXZA 2H2PD 5CILH 5CUSH 1MVFA 1ES0A 1N4XH 2YR3A 4HK0B 3DX9B 3AREB 4AIXA 3ARBD 4JPWH 2ZKHH 3CFBB 3N06B 3RGHA 1IM3B 2D9CA 1AIFB 2ZUSA 3BGAA 3P0GB 5GRWA 4YGVA 4IRSD 3HG1D 2GTZA 3I75A 5ADOH 1AO7E 2ZCKH 4HFUL 3QCVL 2Q76A 2X4UB 4WI5A 4PJEA 5TFSL 1ODAA 2EIDA 1F4YL 1CDCA 2EYRB 4AENA 1I3UA 1NGPL 3QDMB 1IL1A 5EU3A 5FO8B 4ZTOH 3LEYH 4OAWB 4HIHA 1UZ8B 4R2GC 2VYRE 1OAXH 3ULUL 1GZQA 2GTWB 3MYJA 3HI1B 3DIFA 4R4BA 2CO6B 3RDTC 4M9OA 1RZ8A 1JWUA 5JDSA 3EJZC 2V17H 3BGFC 4NQXA 1D3CA 3MLZL 4FFWC 4G42B 5F9WB 1TCRB 2DWEB 2LU3A 1LP9F 4LVNB 2D0FA 2JJVA 4UINH 4IHOA 3N9GH 1OAKH 2G60H 3BISA 3P4MA 4MB5A 3QWOB 3GJFB 5HD8C 3ARED 5D7SL 2BVPB 3SE3C 2ZG1A 4PV9B 2DI7A 4MQ7A 2GJZA 3PL6D 3RWFB 4LPTA 1G6RB 4HLZH 4ORGA 5C0DA 1BBDH 3DMMB 4Y5XC 3DTXB 1NCDH 2YC1B 2FCBA 1KCKA 3PP4H 1F4AA 3REVB 2CK0L 3O81A 1KELH 5D93B 1R24B 2H3NB 3BKJH 3HC4L 3QDMD 4F7PB 1WBZB 4WV1A 4Q9RL 5FM4A 4ZYKB 3RVTD 2JCCB 2DKUA 3C2AH 2W0PA 5ICXB 1BJMA 2VDKL 4ZFOL 4DN4H 2HLFD 5KS9A 1NUDA 3VG9B 4M3JA 4NGHH 2IFGA 3ZTJH 3FB5A 2JK5B 5BS0E 2YD6A 2WIIA 4Y8DC 1T2QH 4M6OL 5IHLB 2XZAH 3U7WL 3CUPA 4G6ML 2CH8A 3RY4A 3QNXA 5F7EH 3VXRE 4E41A 4KK8D 4JDZA 3VGGA 4RMWA 4EI5C 4P5KB 3BZEA 3T3ME 3WD5H 1EA9C 5DRWB 1RZ7L 2RR3A 4PP1C 1SVCP 5E0QA 1JGEB 4I4WA 4XBGA 4J6RH 5D7KD 3WN5B 4XCEB 1EZVY 2YSSB 3F8UB 2YWYA 1LP9B 1C5BH 5BMFH 4YHYC 3IAPA 3QPQD 5CEZE 1WIPA 5IBTH 1WWAX 2A1WL 3TM6A 2NR6C 5IMMA 3TA3A 2GSIB 1INEL 2UV3A 4HW6A 1GHFL 1I9JL 4YO0B 4NO0D 2FEDD 2IQAB 5FECA 4LDLB 5J6GA 3ZE0E 1JIBA 1XGUA 2CDGA 4BH7A 1M71A 4MAUH 3TZVB 3LPGA 5GHWH 1AO7A 1KJ2H 2L0DA 3C5SB 2ERJC 2ITDB 5JPMB 4NZUL 5E56A 4BK4A 1ZWIB 2Y07H 5FYJE 4ZUTB 5IB4A 1MAMH 2I5YH 4JRYE 1Y6MR 3UTTB 3CSBA 3TBTB 5C92A 2PYEE 2NLJA 1LGVA 1CLYL 2YBRA 1QFWI 2B8OT 3ULUF 1I85C 4OFYA 4RZCA 3EYOB 3LRHA 4Y1AE 4PJIF 1KTKE 1BVOA 1M4KA 3N1GC 1ZOXA 3DBXA 4ODTL 3QRGL 4LSTH 5LG1A 3PG2A 2AEQL 3IS1X 4JB9H 4ODHL 1NAMB 3HMWL 2Q8BH 1NCNA 5DJZA 2YEZA 1PZ5B 4L4VE 4F15C 2IALB 4DAGL 3GSRB 3RDTA 1LDPH 4RNRA 1LK3H 1KB5A 2DKMA 3FO2A 5C1MB 1C1EH 1FNGB 1VFAB 1OHQA 1GGCH 1MJ8H 5IGXH 3I3DA 2XZZA 4O2CA 1OSZB 4N8VG 7FABH 1MY5A 3TZVD 3SO5A 3SE3A 3FJTA 3BPNC 1XF5B 3H3PH 4IOSD 3UTZA 5DGRA 5E24E 3UTTD 5IR1A 1KIUA 3C5JB 3HZKA 3ARZA 4Y5XA 3LH2H 5C8JB 2X4PB 3SJVD 1CDGA 3VGAB 4LCYA 2I9TB 4OUUB 3IJYB 2DM3A 4MXVF 3BP5A 5DUBB 5HGHB 1DZBA 3CC5A 5F70A 3X13B 4M7LH 3OJ2C 1JNNH 5I1IH 2BY3A 5I0DA 2VDLH 1CIDA 2XNAA 1XR8A 1MHCA 3I9GH 5GJSL 5HY9A 5BS0A 2XZCH 1R3HA 5JZ7C 1RUPL 5IOPA 2DN7A 3QYCA 3KLSA 2R2HA 3HR5B 4JO2H 4JY5H 1K2DA 1NCWL 4M00A 4WFGD 3GSNA 1QEWB 2WUCL 3LMJL 1EEZB 1G7JA 2Z35B 1CD1B 4OZFB 1ZAGA 3VXRA 3IETB 4DZ8A 1EHXA 1HH6B 1DQLL 3BN9C 3L5JA 4C56D 4NKIL 2HTLC 2AGJL 1QLEH 2FD6L 3QCUL 1N6QL 3UO1L 4JG0L 3BD3A 2KQMA 4LGSB 4EI5A 4LU5L 5MEOB 4NWTH 4ZOCA 4DK6A 4LCUA 3D2UD 5IIEB 4TPRH 3NOIA 4UIMA 3P0VH 2DJUA 4EOWL 1AE6L 1HHIB 1UG9A 5T1LA 1G0YR 3PV6B 4YHNB 2VOTA 2Y5TA 1KNOA 4KJYB 4YUEH 1BWWA 4QY8A 4F37F 1CTNA 2VDQL 4OZFG 1T2XA 4G9FE 4GQ9H 5EC2B 1MHEA 3JWDH 4NO5A 1CFBA 3WXVL 2HT2D 5DD6A 4NHCH 3FB6A 3NCMA 2J4WH 1XGYL 2W9EH 4JRYA 3WFDH 4S1QH 2HRPH 1LO5A 1MQ8A 1MQKH 2PYEA 1NCCL 1A7RH 3ULUD 3O9WB 5DT1H 2VL5B 1P7QA 2XN9B 4KJQD 1TFHA 4Y1AA 5LQBH 3QG7L 1SM3L 4N0UB 4DOHB 5FM8A 4WI8A 2OTPA 3FQWA 4OF8A 4XB8A 1W72A 3MLYH 4JEGB 5A40E 1ZVSA 1I85A 2R39A 1TLKA 1FIEA 4L4VA 1VESA 2BY0A 4JKWA 3RL2B 5ITBH 4PUBL 5GRVK 4YAQA 1ULVA 5J6HB 5GS1C 3U4EB 5DZOA 3IFNH 3U36B 3VG0H 5C0BB 4NKMA 3O0RH 5E5MB 1A9EA 4QXTA 1FNHA 2ITCA 2G5BB 2DM7A 3BO8B 1AR1D 3V9FA 2YPLB 2R0KH 4JZJB 3MV01 1OWWA 4NO3A 1MWAH 1OAZH 3VXOA 3WS3A 1K4CA 5I1DB 5EU4A 4YR6B 3QXTA 4BSWB 3QNZA 1ZSDA 3BKYH 3BMWA 4HUWB 3O6LL 1UYWL 1R3IL 5K59F 4O02L 3RVUC 1WIOA 1I7UA 3W39B 5E7FA 3VCLA 2ED9A 5I15H 1AKJA 3VXSE 4FTVE 4JR9L 1KEGL 4MJ4A 1EMTH 5DJXB 3AY4C 1PAMA 4M02A 2Q86B 4GRWE 4R7NB 4JFDD 1Z9MA 2ID5A 3O9WD 3WKML 1HNFA 4JDTH 1MVUB 1DUZA 2B1HH 2DQGL 3QUMB 3VI4F 4F7CA 4XC3L 1D6VH 2Y36H 3F58H 4UT9L 5EO1B 1LE5B 3UJTL 1CT8A 3VDCA 4GLRH 1JL8A 1FNSH 2QSQA 5ENWA 3OL2A 1MCDA 1KPVA 2VDPH 3VFOA 1I9IL 1MOEA 2W92A 1WBXB 3N1PC 4TVPE 2DJSA 3JWOC 5FKAA 3C9NA 2XWJB 5T1KA 4V2CB 2V7HB 3TFKD 2FEEI 3IGAA 3ULVL 2WUBL 3IKCA 1DLFH 2YD4A 2BJML 3LKSA 5C0BD 1X6NA 4NP4H 1UFUA 4XI5C 5HGAB 2O93L 1C7TA 2F74A 4ZOBA 1R5WB 1T22B 1OT2A 4WI3A 5C0RL 3NABH 5JOPD 4OGAC 3DYMA 3L9RB 1RJYB 4U1MA 4WUUE 2AW2A 1A6ZA 4WW1A 1DBAL 2HKHH 1I8IB 1J5OL 1YNLL 3ARFB 3MLPA 1FV1B 5KAQF 1OTTC 3X11B 2OBGA 1OM3L 3AAZA 1A3RL 2NYYC 4XNYH 1NCTA 1ZK9A 2CDEB 1RUAL 5F6IB 3F7YA 2SEBB 4KY1H 4GBXC 4W4NA 1UWXK 1JF1B 1MFAH 2R1XB 4ELMF 4YK4B 4JFQA 1OT1A 4AK1A 5ETUA 2JLLA 3TIEA 2EC8A 1MUJB 1LK2A 1GPOL 4G9FA 4MD5B 3DVGB 2Z92B 5B21A 1QYGH 3AGVA 3DUHA 3LRSB 3IXAB 4HXBL 2F9BT