3GUTB

Crystal structure of a higher-order complex of p50:rela bound to the hiv-1 ltr
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
312
structure length
312
Chain Sequence
GPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGVCTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHSDLAYLQAEGGGDRQLTDREKEIIRQAAVQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords Transcription factor p65
publication title Structural basis of HIV-1 activation by NF-kappaB--a higher-order complex of p50:RelA bound to the HIV-1 LTR.
pubmed doi rcsb
total genus 60
structure length 312
sequence length 312
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2009-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00554 RHD_DNA_bind Rel homology DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gutB02
2.60.40.340 Mainly Beta Sandwich Immunoglobulin-like Rel homology domain (RHD), DNA-binding domain 3gutB01
3HE6D 4QYOB 3KAAA 5EC1B 3QPQC 1ZEAL 3LKRA 1F13A 4NN7C 2AKRA 3PL6A 4EDWH 4P9MH 2N7AA 3LEVL 4OAWB 1UH2A 2JB5H 5I1KL 5IQ9B 4ZAKC 5K9JH 4LLWB 4XCEA 1V7ML 5IB2A 1XR9A 2VABB 2EYTB 2HJKB 4OGXL 3W82A 2XG5A 4LLMA 1ZLUH 5I17B 4IRZL 3AU1A 3RVUC 1QYGH 5BJTB 3S36L 1FFPB 1I4FB 3RZCC 1QA9A 1OSZB 4KRPC 2V17H 4NC1E 3QEUB 1VACA 1U6AH 5HGBA 4LDLB 2WBJB 5I66A 5J1TC 3DSNA 2MSPA 2BP3A 4BSVA 3IJHB 1ORSB 4UTAL 4R9HA 3GIVA 1HEZB 3RAJH 3DTXB 5J0BA 5I1HH 4J4PC 3RPKA 2JCCB 4NQDB 3CCHB 1EGJL 1P6FA 2VZ1A 3JWDL 5KW9L 4NC2B 4KRMB 4O4YH 1A7PH 2NW3B 2LVEA 5BZDB 1VDGA 2PTUA 3VWKC 5I74B 3GI8L 1ADQH 1W2KT 2VQ1A 2PO6B 2ICWB 1ZKAA 3VRLE 3D69B 3MRBA 1JMZA 5IG7A 4PRAA 2GJ6A 1C1EL 5SWZD 2XWJB 4GG6F 3V8OA 1JV5A 1QSEB 5J9PA 4EUPG 3O0RL 3C5SB 3BFOA 4ONGH 3UJTL 3WIIL 2LU7A 4EDXA 5I6XC 3AREB 4UTBL 1ZHBA 4IS6A 4M1DL 1M7DA 4X7EC 3ZL4L 5MEQB 2A6JB 3SJVB 1GYAA 3H9SB 1A4KB 4ZFZA 1DBKH 5F97E 3PDOB 1UWGL 4ERSH 5M94B 1G6RH 1LP9A 3MACH 4O2CA 1B0WA 1RK0B 5GRVL 1E6JL 2B1AL 1CQKA 3LKOA 1S9KC 5JXAL 4PJ7A 5BRZB 4GRLD 3L1OL 4OFPA 1MCEA 1MH5A 5D7IB 3EUUA 2Y7QB 2ENSA 5D2LA 4PJ9C 2VC2L 1Q9LA 5LAXA 3HE6A 1FZOA 4L9DA 2D03H 4XBEH 5DFWH 4JG0H 3T08A 2X9XA 2HMID 1NLBL 5DC4B 1NEZB 5CUSH 1FLRL 3QCTH 3QG7L 3GSQA 4HH9B 3V7MA 3PABB 3X3FH 2GW5A 3FONA 3ROLB 4M7KH 4PJFA 1MQ8A 3CDCA 4PRIE 2RCSL 3BWAB 2XXMB 1SBSL 2FRGP 3QHZH 4TYUA 2ADIB 2O5ZH 4MZ3A 3NIDE 1CD1A 1R3JA 3PG2A 2HLFC 4X6EA 3JWNC 1QSZA 5AZ2H 3MBXL 3ULUH 1P4BL 3HZMA 5AEAA 5D70H 3EHBC 2AJZB 4PRPB 1PG7X 1R5VB 1TZGL 2CXKA 3V0WH 4WW2A 3WXVL 2CR3A 4JKLA 2UY6A 5MERA 3WS3A 2DQDH 1TXKA 1MVUA 2QQQA 1CICB 3MLSH 3MOBL 2DTMH 3L7EA 4LLDA 4LP4A 2GFBA 4Y16D 3INUL 3ZKQD 3DJ9A 3MCG1 3OKMA 2BERA 2PYEE 4LKCA 1TJHL 4NJAL 1KGCE 1OT1A 1TTGA 3FFCB 1UA6L 4C57C 2VDRH 2XNAB 5SWZA 5FO9A 4U05A 4R97C 3RIAF 1L7TH 3NIFF 3R4DA 1FJ1A 2GK0A 2HJFB 5GGTH 4HUKB 1LD9B 4WWKD 3EYOA 4BQCA 1TPXB 2NX5D 1AFVH 1Q9WB 3E8UH 2YA0A 1HE7A 2AQ2A 4XWGL 3K3QA 4G9DB 4JN1L 1I3RA 5I8KH 3GSUB 1U58A 1JZ3A 3HLAB 3VFGH 4BKLB 3T8XB 3NBNA 2R23B 3FAXA 3MR9A 5F96H 3S6CA 3SOBL 3VWJD 2F9BT 1EVTC 1FZJB 3TT3L 3M8OH 4R26H 5CZKA 2C3GA 4GRLA 1KB5L 4JDZB 2UVEA 4PLOB 2F19H 4HUVA 5F7YC 5I1CL 5F7LB 4BFEA 3W9EB 3OHXB 2XKNB 1ZA3B 1U42A 2P8LA 5ID1A 4AG4H 1FIGH 2IH1B 1A6ZA 4XPBL 4HWZA 2ZZUT 1T4KA 1Q0XL 3PL6C 5AYUH 3R8BB 1G0DA 3RTQD 3JZ7A 1Z9MA 3REVB 1X4YA 1GPOH 1MNUL 2EIEA 3U46A 4Y1AE 5C9JB 4OQTH 1P5VA 1OPGL 4UU9A 5DLML 1A5FL 4FNLH 3NTCL 4JPVL 3RIFF 4XBGA 3CFCL 3OKLB 3NFNB 3P73A 1FL5A 3TYFA 1FNAA 5JOPD 4CN4A 2B5IB 2L7JA 1RJZB 3B83A 4Q6IC 4PJCF 1K3ZA 3HR5B 1A14L 3TJHD 2AJXL 2AJUL 4Q9RL 1MWAB 1RUMH 1H3UA 3TLRA 3V95A 5JW5B 3TC9A 4IRSD 1MJJA 3SKOA 4KI5E 2P5EE 5GS0D 4NWUL 3O11A 2A6DB 5JMOC 3ILPB 1P1ZB 2VDLL 4M48H 3GMRB 3T4AA 3CDYA 5C0BD 2OYPA 3D39B 1I8KA 1R3IH 1KN4H 3O2DA 4NRZB 4HKZA 5LWYL 5FM5O 2AXGA 4O58L 4KKLC 3VFRA 4Y16A 3MV01 3MRIB 5KAQF 3SQOH 4Y19E 5GQBA 1D5ZA 2OQJA 1DP0A 5EU6B 1OM3H 3ZTJG 3RNQA 3GMNA 5C07D 5D8JL 2PUQT 2WW8A 3X14B 4MA7L 4P2RE 3BPNC 3R8QA 4WWKA 1DN0B 3H42L 4I48B 1RUQL 4JVUA 4MJ6A 2LABA 4ZSOE 3GMOB 2NX5A 2Q76B 5FDWA 3E6FB 2EKJA 4H26B 2VSDA 1RZFH 3LS4L 1IC5H 4MCYA 5CSBA 4RQQB 1CK0L 3RGVD 4K3EH 4LCWB 3S34H 4UOW0 3VWJA 4PJGB 3ULUF 3QRGH 1M7XA 4D9QD 1RZJH 1AY1H 3MA9L 4R7DB 3UDWA 5FF6B 1OTSC 5F1KC 5CBAB 2ZJSL 2Z93B 1U3HD 3WE6B 1J1PL 4BJLA 2FX9L 2VLRE 5DR5L 1P7KA 4ZQKB 3T0WA 3MV9E 2G60H 3DECA 1EUUA 3GSVA 1W8OA 3DRQA 3ARBD 1T5XA 3O9WC 2E7HA 2VLJE 3RTQA 2H1PL 2R0ZH 5DD0L 2Q86A 5F72S 5KS9F 4EUPA 3UC0H 1CLOL 3EO9L 3LKSA 4JJHA 5BVPH 3LQAC 1DSFH 2E27H 3QDME 4OIIL 1G0YR 3JV4B 1FNGB 1I8IB 1A6TB 2BNQB 4I3RL 4WO4B 3IU3A 3WFEH 1TVHB 2EDOA 1WLHA 2H9GB 1J12A 1D9KB 1JK8B 5ICYB 4HIEA 2DQIH 1CFTA 3IFPA 2XTJC 4YDVB 1LVEA 5GIRB 4IRSA 4WJ5B 2EDRA 4R3SB 4QRRD 1BIIB 1FFOB 4GW1A 4PRNA 4PTUA 4V2CB 3OG6B 3VXRE 4J1UA 2PR4L 3MLRH 4WW2C 1OAKH 5F89B 5C0BA 1H8OA 1KG0A 2I5YH 1TITA 4GRMB 4MD5B 3QA3B 1QBMH 4QGTA 4KXZI 4MB5A 1A6PA 3C5ZC 1CWVA 4RA3A 5INCB 4KJPD 3S35H 5KSAD 1X5AA 3C6LC 1KTLA 1A47A 3KWWA 5CKGA 5C07A 3HI1A 3CXDH 4D9RD 4NO5A 1CTOA 4RMSA 4CGTA 1KXTB 1FVEA 4LCCA 3QG6B 1K6QL 3I2CL 3TYGL 3ZSTA 1FO0A 1FGVL 3PWJA 2OMBA 5CD3A 4I2XA 2GTWB 1VFAA 4AMKL 1WWCA 4JG1H 5DVNA 5JORB 4UOJA 3JTTA 3MRJA 3QCVH 4IOFD 2AK1H 3EW3B 3RGVA 3BGFC 2Y07L 1CE6A 2YZ1A 5I8EA 3VFTA 1HXMB 2KZ1B 4XGZA 1EHAA 4F9LC 4P57A 4MAUH 3OL2A 1U8PA 2OL3H 2NLJB 4GRLC 5KOMC 3RHWK 4BSJA 4Z7UE 5EPMB 5JDSB 3NCFB 1U3HA 3BPCB 4ZUSA 3BWUC 1IAII 3EYVA 4AEHH 3OJDA 4DGYL 1KCSL 1UZ6E 3BP6B 5IMMA 1SY6L 1BOYA 1LDSA 4P5KB 3ARBA 3VXMD 4N0CC 4WFEE 4Z78B 3MRMB 5BV7L 2EKSA 4GKSA 3X17A 2Z8RA 4YHYB 3CVHB 2IH3B 5IEHB 1I3UA 3RUGB 4TSAH 2DQHL 5T33L 5CS7A 1YEKH 3SKMB 3MGOB 5GZOD 3VDBA 1BZ7A 1YJDC 4MB3A 4HF5H 1IGMH 3E2HC 4P4RA 2CKBA 3HC4L 1YN7B 3NACL 5CBEA 2GT9A 2NXZD 4MQSB 1ZHKB 1I9EA 1IQDA 2FSEA 3TP4A 3QAZC 3H7BB 4ZO8A 4ZPVB 4ETYA 1U3JA 4WUUD 5DJ8A 1MIEL 3FCTA 3ZE0F 5HHXL 3HPJB 3RKPA 5CAYB 4QTIL 1E4XL 1KPRB 1T1XB 4XCNA 5K33A 1NBZB 4XVSH 4LPCA 2ITCA 4QRRA 4N9OB 2YKLH 5F9OH 5J8OA 5DJ6A 1UENA 1GC1C 3TO2B 3BO8B 3LQZB 2NY4B 5J12C 2FECL 1E4JA 3WO4C 1ED3B 2ZUXA 3DX7A 3EFDL 3EFFA 4XCYB 5HJ3B 3CFEB 1AR1D 1Q1JH 2YS4A 3N85L 5IWLA 4HXBH 5HGAB 2AJSL 5KSAA 3HFMH 2V9RA 2O61B 3ARZA 1IM3A 1I7TB 4ETQB 4H25B 1YPZE 4POYA 5KVFH 3D3VD 1ZANH 2R4SL 3BIBX 5IT2H 3MLTB 3LDBC 5DHXB 2NY5C 4L9LB 1BQSA 4APQD 2D4DA 3RDTC 1IFHH 4HDIB 4JO2H 3W2DL 3DO3A 2CLVB 1IEAA 1IKFH 5E2WH 3TVMC 2XZCL 3VWJC 5BS0B 4HC1H 1TETH 2LVCA 3UDWC 4U2ZA 3MV7E 1S7XA 2BVOA 1F3RB 2P7TA 2FGWL 3QXAA 4FQHA 2WINB 3QUKA 2YD8A 3QUYD 1KF9B 3VMNA 2UWEE 4TPRL 5F88B 4NUJA 3LRHA 5TDNA 3ZHLA 2D7PA 3LKQB 4X7DC 3VXMA 4G80A 5ESAA 1HHHB 3ARQA 4U7MA 3L95A 1M6OB 4LAQL 43C9A 3EYSL 4CU6A 2R1YB 4NCC2 3UYRH 1J5OL 3OAUH 4Z7VF 5IHZB 3AS2A 4HS3A 3TPUB 3X13B 4IRJC 1ZWIB 1X7QB 2BY3A 4XPGL 3STZB 5CLWA 1TCRB 2FR4A 4R8WL 2Z92B 1OGAB 4XAKD 3DNKA 4C59B 4P2QB 1I9JH 1ZLSH 3W9DA 1B4JL 1A6UL 2ARWA 3F58L 3FB8B 4IIQA 4XNUL 4R2GB 5LXGL 1EFQA 2ZNXA 4WUUA 1XF3B 1B0GA 3DYOA 4NKDB 2X70B 1VGKA 1Z6JT 3BN9D 3ZTNH 2A6IB 4KJQD 5DQ9B 5EZLA 3PWPE 4Y5YC 2DS4A 2HKFL 1N3NB 5EIIB 5EDXA 1M05B 2BOBB 1HHKA 5FCSH 3K81A 3QJHA 1RJLB 2ZCLH 3S8WA 2BRRH 1U8HB 1JGLL 1OAYL 1A9EA 1QPXA 1NCAH 1NLDH 1NSNL 1QRKA 1XGRA 1ZLVK 2PKDA 1FN4B 4Q74A 5D72H 4G43B 3P4NA 3UTTD 5HDQH 4LGPB 3DUSB 1NGYA 1NCBH 3ZZ1A 4LEOB 4FHBD 2AK4D 1Q9OB 3UO1H 2FO4A 4GKZA 5BO1L 1WWWX 1BM3H 1J88A 3GKWL 1G7HB 3RI5K 1MFAL 3UBXG 3U4BH 5F6IB 5IGXH 4LCCC 1MHCB 1T66D 4WCYL 2AEPH 3D3VA 4K7PL 4XNXL 5CHNB 2EH8H 2XI9A 4OGYH 1BVLA 4APQA 2EO9A 1HZHL 4OZHA 5DT1H 4JFZH 3S5LG 5LGHH 1FO0H 4LCIL 4PRDB 3RGVC 4L4VD 1RIVH 5J11B 2EYRB 3VA6A 3BEWB 4OCYL 3SE3C 4TQEL 1BEYL 2DQEL 4P4KC 5MI0B 4OLXH 1RJYA 1NMCC 2MQ0A 5JNYA 5K93A 1S9WA 3MXWH 3G6JB 1PG7H 1QD0A 2N1KA 4WNQB 3QUYA 1NGPL 4NYLB 4P9HH 5GS1B 4YIQA 3ARBC 4JCLA 2K3TA 2V5RA 3LPFA 4U1MB 4M03A 3DBXB 1PSKL 4X6FB 4MA8L 5B21A 5E94A 1J8HB 1JPFA 5HD8D 3WUZA 1I7RA 5LJYH 3MRCB 4AEFA 2LAGB 4K2UH 4KVCL 4LNRB 2W9EL 3SGEI 2WBWB 1QFUH 4JANB 4HBQA 3E0GA 5HYQB 1S7QA 1IC1A 4U6VH 4KTEH 3UJIH 3P11H 1YEDA 1QLFA 3TO4C 2XWBA 3BI9X 4W4OC 4HMDA 3F7VB 1S7UB 4Q0XH 4OLWH 5CGYC 1QQDB 2DRUA 4KK5C 4WEUD 1MCOL 3VH8G 5IHBA 4D94A 1EERB 1RI8A 2R8SH 3BGMA 1FBIH 3O2VL 5I9QC 4KZEH 1RV6X 1X3DA 1K8IA 2HWZL 3TV3H 4ONFL 3FOLB 5CJBA 4MNHA 3E3QC 3V6ZB 1I7UB 1XEDA 3N0PB 4OGZA 5T3ZD 3UJJH 1BQUA 1AGEB 2PTTA 4GQ9L 4NGHH 3D48R 2F8OA 4C58B 1CFNB 4L29A 4L4TE 5EWIH 5I8OH 2VIRB 3UTTA 3MRHB 4P3CL 4JHAH 5IM7B 5IWLC 1PYWA 5F9AC 3BDBA 5ECJE 2AK4A 3WFBL 3GRWL 4NRYA 2VKXA 1JPTH 5CKAA 4LLUB 3FKUS 2W0FA 2XOTA 2EYSA 4YPGA 4F7CA 4KV5F 2HYMA 25C8H 4RAVB 2IWGA 3I9GL 1E28A 3OAZK 3DV6B 1FV1A 3FO9A 1C7TA 4MD4A 2X4QA 1TQBC 2UYLB 3Q48A 5B8CB 1V3KA 5IB5B 4L4VA 43CAB 2EDFA 3L3JA 2EXWC 2AV1B 4RISL 1C7SA 1I1FB 4OGAD 1BHGA 4P49A 1BAFH 1QO3A 4C56D 2W07A 1PX4A 5FGCB 2E3VA 3QQ3A 4HAGA 4N0YL 4M7JL 3KJ6L 1H0DB 1T2JA 3ARGC 5EO0B 5ALCH 1IGFH 1EXUA 4TUJB 2A73B 3W0WD 5T3XD 5JTWA 1L0QA 3S37L 3NFSL 5DUPL 2VAAA 4E42A 4LSQL 3VD9A 3CFJB 3ARTA 3EYFA 4YHKH 4QXUL 5I75C 4JFHE 4WI2A 4X80L 2BX5A 3ZTJH 1NC2B 2C7UB 2OP4H 5L88L 1J10A 4KKBD 5A2KH 3EYUH 3VFSA 1P2CA 4QWWD 5DJ0A 5I1GH 3IGAA 5FDYA 1TNMA 5HHMD 5KTEH 2BHUA 3BXNB 3PHQB 4GSDH 1RHHA 2BSTA 2CIKA 3I6LE 4YHOH 3U0WH 1M71A 3BP7B 5KVEL 3MRKA 4OCXH 3T04D 4E0RA 1G84A 3U2SA 4XMLL 5F7UA 4DUWA 4Z76B 2BVQA 3KYKH 4IIQC 3KPLA 3K8LA 4WFFD 5J56B 4RWYL 4XHJC 2BJMH 3CFKB 4DTGH 2F8XC 3NPSC 1CVRA 3J7HA 2BHZA 2VQUA 2QV2A 1MREH 4HGKC 3MCKB 4NPYB 4U1NB 3G6AA 2VUOA 1Q9KA 4HHAA 5D7LE 5GJTL 3S96A 3THML 4J3OC 5K9KB 2DQFB 5CLTA 1NAML 3L3HB 4P23D 1FVDB 2B0SH 1EAPA 2F53E 4QEGA 3WDIA 5D1XD 5BOPA 1GSMA 3B9DA 3P0VL 1YECL 4PJIE 1YA5A 4HIHB 4IJ3C 3MRQB 5CP3A 3OMZA 1UJ3B 1GZQB 2DL2A 3LPGA 1DUZA 3QUMH 5EBMA 5KSVA 2QQKL 4OZGA 3BPLC 4JB9L 1T80A 4KUCD 4KKAC 4G7VH 4KMTL 4M9PA 5E8DH 3UPRA 2NXYB 4KTDH 3RVVC 3TJEL 2NR6C 2IFFH 1A6AB 4O2FA 1HDMB 1XFPA 2ZSVB 3HZKB 5JUEL 3QUZB 4PG2A 5HY9B 2R1WA 4LLAA 1U8OA 2PETA 3QWOB 3EOBB 4OZ4B 3IAQA 2EC8A 4LNVA 4HUWA 2JJSC 3GJEB 4YZFE 4NQED 3DURA 1P84J 2W0KA 4KFZC 4Y4KA 2VL5B 5E2TH 1WT5A 4J8RB 5I73C 1VERA 4C56A 1U9KA 4X7SH 2ARJQ 3VXTA 5J6HB 4HIIB 2JIXA 4YXKL 1Z9LA 4MAYC 5F7FA 1G0XA 2MJWA 1WCQA 2CIIB 2YOCA 3W0WA 1AP2B 5C2BL 1MHPL 5J06A 2OI9C 4NHUB 3KXFE 3UBXA 1G7PB 3GK8L 4M62H 3ZDYF 4EVNA 4YGVB 3GJFB 5DMKB 1NEZG 5IMKB 4M6NL 1FPTH 1SYVA 2R0LH 3QH3B 1IJ9A 5ESQA 5IHUL 1FE8H 1UXWB 7FABL 1N0XH 3P4MA 1OQXA 3S5LA 2I07A 3L7FA 2HG5B 3PHOB 4MXVE 3K2UH 2JELL 4YAQA 3KPTA 3T77A 1KJMB 2GY5A 4NO3B 3J8F7 5FA3B 4P3DA 2O5YH 4K9EC 5SV4A 5E8NA 1EA9C 1T04B 3HCVA 4K3DH 1JN6A 1CXKA 4K8RC 1TJIH 4QXTA 5FEBA 3KPMA 4OZFG 4NNPH 1S7WB 2YD7A 2O93L 5FUOL 3OKOB 2BNRE 4UIKL 1WJ3A 2IANE 1JPSH 3KLHD 2BDNL 1BLNB 2RFXA 3O3EA 4P23A 1I3VA 2CO6B 4G9FE 4RMQA 2ZSWA 3IDYC 5EG6C 1BQHB 1AD9A 1JP5A 2GCYA 3WN5A 3I50H 1RPQA 3OXSB 3QCUH 3H3PL 5EN2A 1U41A 3V7AE 4NNXA 3BJLA 3QIWB 4NM8L 5HHOD 3U30B 5JZ7C 3VFMA 1JMXA 5EZJA 3P9MA 2H45A 3L3GB 5ERWB 1FL3B 2WBJD 4NQTA 1G9MC 2CDGA 2VDOL 4X6CE 4O2EA 3FN3A 5GSVA 3O2WH 3VH8A 5F7DB 5EC2B 5AD0B 1GAFL 1RVFH 3BQUB 2XQBL 4M61A 4JM2C 4ORGB 3DYPA 2DWDA 3GO1L 4NQDD 2PYEB 4NQEA 4GLRI 5C0CE 3U7AA 3SY0A 2X2YA 4XPFH 5EOQL 5JOFA 1N59B 1WWBX 1JRHI 1U2CA 1YEFH 3B5TA 2YHGA 3QJFB 2V5MA 4MXQC 3VGGA 4UDTB 4LPUA 4UV4L 3WKMH 4OFKA 5JXEC 4HKBB 2D7OA 3VXQA 5DDHB 3VD5A 4LVOC 4JY6B 5HD8C 1AD0A 4YE4H 3MOAH 4RAUA 4XC3L 1YY8A 3ARED 1RD6A 1LO3H 2QSVA 1WCBB 2JE8A 3KS0H 3H3BC 3HZVB 3SJVD 3H9SD 3U0PA 4R0LB 1JUFB 4U1IA 2D0FA 4NQXA 4Y8AA 5SWSE 2X4TB 5IJKA 3OX8A 5C7XL 3ABZA 5BRZD 5ITFB 5B39B 1YNTA 2AQ1A 3DVGB 1NCUA 4GKNA 1J0IA 3MNVB 5FA4B 2IALA 2NY7L 5A16A 2VDKL 1D5MB 3C8KB 4DQOH 2YD6A 4K7FB 3V5DB 4B53A 5EC1A 1JF1B 4S11A 1YN6B 4OAWA 1N5AB 1YNLH 4LLWA 4BQ6A 3QFJB 4OV6F 2EYTA 2HJKA 2LTQC 3SE9H 3H9YA 1WIPA 2AXFB 4KH2A 3MGTB 1QR1A 3BISA 4FFVC 4M6OH 5BJTA 1FFPA 1I4FA 3MRFB 5IK3B 5GPRA 1OSZA 2ADJB 4OM0L 3QEUA 4Z77A 4I0KA 4MHHI 5C08B 5HHOA 5I16A 3ZKXC 2FGZA 2WBJA 4QT5B 2PCPA 2ZPKL 3SEPA 1KT2A 4HGWA 4G7YH 1VFBB 1ORSA 1DQLL 3PP3H 4M5ZL 3BEVA 4JVPA 1HEZA 3V52L 2EZ0C 5ILTL 1WBYA 3P0YH 3FQTB 4MQ7A 4JN2B 1BBJB 1QBLL 2JCCA 4Y19B 4NQDA 3CCHA 4U1SA 4Y4KC 1CICD 2DLHA 2NW3A 3BZDA 5BZDA 1CDHA 4FQXC 1ZT1B 4MMXC 4P2RB 3ZDZE 1OP5K 1WWAX 2ICWA 3DO7B 5CZVH 2X9WA 3QDGE 2YPLD 1QFHA 1N7ML 3D69A 5DQJB 1AGFB 3FFCD 3G6DL 1JNNL 2FH6A 4ZSOB 1A3LL 3UTSB 4S0SD 4RGOL 3QQ9C 5L6YL 3C5SA 3CLFH 5T3XH 3KVQA 4TNWK 2QHLA 3AREA 4KKBC 2OLDA 1C5BL 4AIOA 4Y5XC 3SJVA 2FX7H 2XXCB 3ZSSA 3H9SA 3PE9A 3DV4B 3RL2B 1A4KA 3P3YA 1UCBH 4GAJH 1RFDH 2Y06L 5DFVC 2VLRB 3PWVB 4FZEL 4L5FL 3MV9B 1RK0A 4PJEF 1HH9B 4BELD 1F3DJ 2VZTA 5BRZA 1JHKH 1FNEA 5KVDH 1UACL 2R29L 5D7IA 1LILA 1IAKB 2Y7QA 2VLJB 4JFXB 2DLFH 2BRQA 4Y8DC 3LQAL 3IYLW 1W72L 4HZAA 3VG9B 3CDGB 4M93C 1E4WL 2P43B 1MFDH 3VI4F 1CFQB 4YHZH 2BMKB 4HT1H 1XR8B 3QDMB 1MCSA 2P5WD 3D6GA 2CLZB 5DEFB 2N7BA 5FYJD 3OGCB 3GSWB 3SKJH 2DM4A 5LVEA 4RFEB 2Q6WB 2HJLB 2DTSA 1IEBB 4P23C 3QIUC 1NEZA 3GSNL 3RFZC 3LB6C 3PXJA 4HH9A 4ESKA 3PABA 3T3ME 2VDPL 3ROLA 1AXIB 1TQCB 5FUZL 2ED8A 2QSTA 3B43A 3KHQA 4JZNA 3TIDA 1U8MA 3BWAA 5J6GA 5C09B 5MHSE 1AQDA 2ADIA 1KELL 3RX5A 3ZKND 4F58L 5FHBL 3E3QE 3WIHH 1EO8L 1PQZB 3MODH 3VXRB 3QDHA 1UGNA 3DETC 3FN0L 1KCLA 4X99B 2OXGA 4KU1A 2AJZA 5D9SB 5H37G 1R5VA 4OZFA 1CF8L 1K3IA 5DQDH 5FOBB 3TZVC 3BKYH 2XRAL 3WDJA 3D39D 4ODUB 1IM9B 5TH2A 1X5KA 1PFCA 2NYYD 1CICA 1OLZA 3RY4A 1BJ1H 1UWXK 4HWBL 1BZ9B 4C4KO 4XP1H 4WV1C 5EU6D 2JK5A 4NT6A 3FFCA 2VDML 4YHMH 2XNAA 1F45A 2CUIA 4LEXL 2HJFA 3MRLA 1ZK9A 2YK1H 4X5WA 3RX8A 4N5EC 5HGGS 5T1KB 1Q9WA 1OD7A 3BH9B 5D71H 4P5TB 4G9DA 2XFXB 1EDQA 2F54E 3KYOB 5IEKB 1AJ7H 1F8TL 2R23A 4NM4H 1KIQB 4LCWD 1HINL 4XZUA 4JO3L 4TUKL 1FZJA 5JHDE 1HSAA 4LPYA 5HYSB 4MB4A 4JRXE 4MQTB 4LSRL 2BSRB 5GGVH 4NHCL 5BMFL 3LSOB 3OHXA 4S1SH 2XKNA 3MYZA 3LIZH 1TZIB 2Q7YB 3QEQE 2NZIA 3P30L 1YJDL 2J8UA 4H5SB 5LG1A 2IH1A 5C1MB 5EFIA 3P2TA 3BAEL 5KOVC 2QQLH 2R4RH 4G42B 2D31B 2P5WA 3Q6GL 1OAXL 5HYIA 3O6FC 5AZEL 3MJ9A 5ACMA 3S36X 1BWMA 5C9JA 1WFTA 1QLEH 4GOSA 3L5WB 4I18C 3AMLA 1AI1H 2VDNL 2AXJA 4JLRB 2ED9A 4R96B 5J57B 2BNQD 4NN7B 1FL6B 3OKLA 5GJSL 5KANG 3NFNA 4EXPX 4WO4D 4PPTA 1XGTB 4M6MH 3JV0A 5IB1B 5J3HC 1BECA 2D7MA 1DANT 5KG9B 3KDMB 1NCCL 1GC1L 4XWOD 3RBSA 1V7NL 1S9YB 4I1NB 4LSTH 3O2DL 3HHRB 4KK8C 1MWAA 1MRDL 3R0NA 1MCPL 4S1RL 5JW5A 3KNBA 4G3YH 3EIFA 4ONHB 3VI3F 4KRPB 3RI5F 5CGTA 1QFPA 1NAMB 3AY4C 2A6DA 3ILPA 1P1ZA 4J3UA 3GMRA 4MNQB 1C5CL 3D39A 1XF5B 5DI8A 3S4SB 5TPWH 4NRZA 1CE1H 1YMHB 3L6FB 5GZNC 5DO2D 3FQUB 2PO6C 1ACZA 2NY5L 3MRIA 1YPZB 1JBJA 5A2LH 5EU6A 3F5WB 4XPHH 3U4AA 3FTGB 1DL7H 1BFVL 2H26A 2J88L 4KPHL 3X14A 2BNUB 5DVKA 4JFEE 3FO0L 1BVKB 1DN0A 4I48A 3AREC 3GMOA 5FV1L 2Q76A 4I4WB 3UTZB 3E6FA 5HI4D 4H26A 1S7TB 3AROA 5JA8B 4RX4D 1NBYB 5A2FA 4CRPA 2YRPA 4U0QB 1AKJB 4RQQA 3FZUC 4MA3B 2GUOB 3K1KC 1BBDL 1OAUL 2DQUH 4LCWA 4PJGA 4DUVA 3DUHA 5DEZA 4O02H 2EC9T 2UWEB 3VXNB 3NIGF 3VXPB 5E95B 4MX7A 2BVUA 5CBAA 2Z93A 3CVIL 5IP4A 5IQ7L 2WWMD 5IVXA 4IBLT 4ZQKA 5DJ2B 1DQMH 1C16B 3OTTA 2X1PA 1A7NL 5IIEB 1JZ5A 4M1CD 1INDL 2YXMA 5B3NA 1IAIH 2FD6H 4I0PD 4LIQE 4LASL 1HHGB 4PJXA 3SDYH 4PJ9B 1GGBL 4UQ2B 4NZTH 2ZUQC 1LHZA 4FQQB 3JV4A 1FNGA 1I8IA 1A6TA 2BNQA 4M5YH 5SWQA 4WO4A 4YDLB 4Z5RB 2I9TA 3O4LE 4BK5A 3QNYA 5GS0L 1JYWA 2AGJH 1VSCA 3D0LB 4I5BB 1CU4H 3CX2A 1WZKA 1DLFL 3PWPB 1WGOA 4HS8L 4Y4FD 2H9GA 4JRYE 5JQ6H 1JK8A 3V6OE 5ICYA 3HMXL 2FB4L 2C4FT 3CFDB 3B2VL 4YDVA 4WJ5A 4RMTA 4N0UA 1BIIA 1FFOA 5E9DE 2HRPH 1KJ3L 1K4CB 4PY7B 3D25A 3TBYB 1HKFA 5HI3C 4OZFH 3U1SH 2VERN 1RIUH 4GRMA 4MD5A 5HSFA 4DN3L 3N9GL 3IDXH 1H3TA 2O5XH 5EU3A 4TSBL 5D7JB 1YC7A 1YY9C 4N8CH 4GAFB 4RGMB 3VMOA 4PJ5D 3RRQA 4XP6L 4RA0C 2YXFA 2IQ9H 1YEGL 2CDFA 1FNSL 4L3AA 3A6CH 3QG6A 3MREA 3GHEH 2HTLC 1MY7A 1TPXC 4Z7NF 2Z0BA 2GTWA 4NZRH 4DN4L 12E8L 1RZKC 2LFGA 1KLGA 4RX4A 1GGTA 3UZEA 4DGIL 3C2AL 2XA8L 3MFFB 2ZCKL 5BS0D 1OWRM 4Z7WF 3TBSB 1EBPA 1CR9H 1HXMA 2MHAA 1E0OB 4LSUL 4LLYB 2HFGH 1UM4L 3MLUH 3V79C 4XRCB 2NLJA 4P0DA 5IBTH 4X6DF 3WFCL 5JDSA 2IPTH 5E0QA 3MRRB 4F8TA 5DHVA 3NIFE 5FUCC 4PGBB 4CMHB 3UYPA 3MRDB 4JY4B 2CK0H 3H0TB 2I60L 6FABH 1Z5LA 3GI9L 2YSSB 3MRMA 2J4WH 2CKBL 3HRZB 2B1HL 1PJ9A 3CK0H 2IH3A 3CVHA 5IEHA 1DFBH 4ORZC 1WSST 2Y6SD 5FGBA 4DW2L 4XCFL 3F65A 4JY5H 3K8KA 3D1MC 3SKMA 4O51B 1JNLH 3GM8A 5DTFB 3MJ9H 1CGTA 4GMSL 1JFQH 1FG2B 3MLWH 1NCDH 1OHQA 1IGIL 4P2QD 4NQSA 2B5IC 2DD8L 1YN7A 2C3WA 2F58L 1MAMH 2P49B 3F12B 1XGUA 1ZHKA 1S3KH 2P8PB 2EDBA 2ILLA 1VCAA 3K2MC 3VW3H 3H7BA 4ZPVA 4R2GD 1F2QA 4JVWA 2Q3AA 3HPJA 3MCLH 2E5EA 3B8SA 1G9NH 1KPRA 1NBZA 5DZNA 1EFXB 3QQNA 3VXSB 1J1XL 4L4TB 1NMBH 3TO2A 2ZWLT 3BO8A 5CJQH 3ZDXF 4HUUA 3BIKB 2QEJA 2BVPB 1ED3A 4YHLL 2A83B 4ZFFB 4H8WH 5HYJD 5IROC 3CFEA 4FFYH 4ZTOL 4O5LL 1JHTB 4DVRL 5HGAA 4JZJC 1GIGL 1J8KA 4QF1B 4WWID 2WNGA 2OR8A 1D6VH 4PJCE 4PJ5A 2YD1A 1MCFA 4MDJA 2UVFA 5TE4H 1UEMA 3GSXB 1MRCL 4ETQA 4H25A 4S1QH 3AMKA 5E03A 4I9WD 3CXHJ 3MLTA 1I9IL 1YQVH 5J13B 2DKSA 2ADGB 4L9LA 4U1JA 1KJ2B 2CO7B 1ERNA 4BZ2L 3OKEA 4HFUH 1EGJA 4YBLB 2E7LC 2CLVA 5CIPB 5FHAH 1KEGH 1FNLA 4XP4L 2Z91B 5FAAA 1MOEA 4NWTL 5BS0A 1SJEA 4OQ1A 3SDAD 1RQ5A 5I2IB 2Q8AH 4NKMB 4CDHA 2VE6B 2WINA 2Z9TA 3ARPA 1BMGA 1CDJA 1EJOH 1F58L 4D0DB 1HKLH 2GAZB 3OSKA 5F88A 4PJHF 5HHPB 1G1YA 5E8OA 4OFDA 4X9IA 1HHHA 4H0HB 1J8HD 4WFHE 3I84A 3GIZH 1ODAA 2JJTA 3VGAC 2R1YA 4GBXC 4U6HB 3ZT5A 5I1LB 4JHZA 5KSBA 3O9WB 5DJZA 3TPUA 3X13A 1U8IA 4QHNB 1IQWL 3CFBA 1ZWIA 3STZA 5D7SL 4WO4C 3ULVH 3QZWG 4P2QA 1MJ7L 2AABL 1OP5H 4G6KL 3SGEH 4KAQL 4HUMB 3FQXB 1NMAL 4XWOC 3GSRB 1IBGH 1W72B 4RZCA 1LDPH 1CDBA 1D9KC 2H6PB 3FB8A 2G75B 1X5ZA 3OQ3B 2CDEA 4NKDA 2X70A 5DQ9A 1MPAH 4M00A 1VENA 5EIIA 1BX2B 1M05A 2BOBA 2GJZB 4WHYG 4PJIB 4KHXL 1RJLA 3GSNB 4FQJH 3RVXD 4YWGL 5EORH 3HMWL 4G6AD 2DLIA 2VJXA 4Z95L 5DZOA 4QY8B 4P9HC 4L8CB 1FN4A 4LSDA 3Q1SH 3RA7H 4LGSB 4G43A 5E8PA 5C6TL 1AE6H 1FC1A 5DO2C 5HYJA 4UNVA 4YHIB 5IFHL 1KEML 3DUSA 2B4CH 2J8UF 4KVNH 4X5LA 1I8LA 5JW4N 1WICA 2KH2B 3BN3B 3EOTH 4TTDC 2YUZA 2AW2A 1CGSH 5GISL 4JAMB 4OLVL 1CXHA 1V3JA 1MHCA 4ELMA 4A6YL 3CNKA 3BT2L 1BGXL 5C0DB 4LPWA 4UINH 1GGCH 4K71B 3MYJB 1LGVA 4YHPB 2E8YA 4HV8A 4LOUC 1H15B 4P2OB 4MGXA 1LO0L 4PRDA 2OR7A 2EYRA 1FGNH 4ZS7H 4G6FD 4GAYB 1G7LA 3NCJH 4HK0B 4ZNEA 5DC0A 1G9EA 3O6ML 2FJHB 3QO1B 4R4ND 3V9FA 4PLKC 5DRNB 3KXFB 3MQIA 1VEPA 1QVOB 5E6ID 3G6JA 5JMRA 4WNQA 4NYLA 4FQCL 3BGFB 4CN1A 4ENED 5GS1A 1URLA 4WY7H 4ZO9A 4ZFGH 2X5PA 4LIQL 4U1MA 3DBXA 5DHVH 4YHYC 3NZHL 1J8HA 2CH8A 1UZ8B 1A0QL 2C9AA 1KXVC 1NC2D 3MRCA 4GW5B 4NO2B 2ZG1A 4RDQF 5FGBC 3FHQA 4JM4L 5F7MC 1AXTH 4K9EL 5FYLH 5TF1L 3WJJA 1BQHG 4CU7A 1CFBA 1RIHL 1OB1B 3V4UH 4XAWL 4OCRH 4K8RL 2HH0L 2QKIB 3PGDA 3U9PL 3NH7H 4JANA 4XCCL 3MV8D 4DFIA 1UWXH 4EI5C 5HYQA 5TDPB 4YXHH 2ATKA 2XWTB 1MSPA 5E56A 1BQLL 4HKXB 3G5ZB 4JQIL 3F7VA 1NGQL 1S7UA 2X4UA 2OSLB 1QQDA 35C8L 1CLZH 3FRUB 2BNRB 3KLDA 1WUNT 4QHLB 5TE7L 2IANB 3E2HB 4GW4B 5HYFA 1FAIH 4EI6B 4NRXB 3U7WL 5JIPA 3V6ZA 2DLGA 3QUXC 1ZEAH 5C0ND 4PGCB 2NY4C 1AGEA 3LEVH 4IMLB 4ZPTA 5C0RL 1YEJH 1CT8B 5I1KH 2ZG2A 1F6LL 3D9AL 1CFNA 5IVXF 4X4MA 4PJ8C 1V7MH 4XB7A 5IVZB 4YGAB 1G9ML 4LRNL 1OSPH 2VIRA 5D1QB 1MHEB 2ZCHL 5DGQA 3I85A 2ICEB 5JW4R 4IRZH 2X40A 4QRQA 4U1HB 3U6RA 3WO4B 3ARVA 4WI3A 3S36H 1D5XA 3STLB 4LLUA 4PJXF 3ZE0E 3ULVF 4GUPB 2P24B 4CNIB 1IRAY 4ZO6A 1LO5A 1AC6A 3DV6A 3QUZD 5C0CB 4FQIL 4Q6YA 2DIBA 1NUNB 1HI6B 2UYLA 2X4SB 5B8CA 5C71A 1HIMH 1WZ1H 4YC2B 1XZ0B 2WK2A 43CAA 5K9JL 2IGFL 4MA1B 3WHE1 4KQ3H 4XP9L 1DQDL 3LDBB 2MCPL 4AL8L 3JWDH 1JPST 1YC8A 2BZDA 5D96B 4F80A 4CMMB 3RDTB 1QSEE 3FQNB 3LPWA 2OZ4H 1T0MB 3GI8H 5EO0A 5E6IA 4TUJA 2A73A 3TVMB 2OJEB 3HUJF 2V17L 5BCAA 1UXSB 4NJ9L 1XIWB 3H7LA 4JKWA 4DCQB 3QXDB 1LEGA 1F4XH 4UNUA 2BFVL 5E99L 1RULL 3SDXF 2JJTC 1K4DB 2WQ8A 1NC2A 4OFVA 1X5JA 2C7UA 5SWSB 5C0EB 1P7QB 2IAMB 3WIIH 4GJTB 4RSVA 4ISVA 1YUHA 2VMFA 4R6UA 3VDAA 4M1DH 1VGEL 3ZL4H 4LSPL 3PHQA 3BXNA 1BFOB 2QSCL 1MCNA 2LV4A 3EZJB 3BP7A 1A7PL 1UVQB 3AC0A 5KVMC 1B6UA 4PYGA 4KROB 3MPCA 1CCZA 5T3ZL 2B1AH 1IMHC 5JXAH 5L7XH 4IRJB 3L3DB 4KGJA 9CGTA 3CFKA 5ISZE 2XZQH 4BQBA 2VDQL 2VC2H 2Z8VC 2A74B 3MCKA 2FX8H 5EIQA 3BRDA 4Z7VE 1P4LB 5K9KA 2DQFA 5HHNB 1A64A 1S5HB 3UROR 4PRID 4FOMA 1KENL 4KRLB 3ESVF 1NLBH 3MJ7B 3DSFL 3QWRD 2A9NL 4HIHA 4UUJB 1KSRA 3QG7H 5I19L 3GB7B 3RNKB 3MRQA 4NFCA 4S2SA 4U0RB 3MACL 1UJ3A 1GZQA 2ORBL 3WNMA 4EEEA 1I8LC 3OR7B 3PIQA 2WIIB 3QZWA 3UAJC 4OI7A 3O3AA 5CJ8A 5F6IC 2BCKB 4JFOB 4X5XB 5JIHA 4PRPE 2RCSH 4K94H 1B4RA 1RK1B 1SBSH 1T7XA 4KDWA 2X4PB 2ZOKB 1A6AA 3O81A 1HDMA 2ZSVA 2UZIL 5DRXB 3QUZA 3QP3A 3MBXH 3GBNH 3LRSA 4G5ZL 2Y36H 3QWOA 4OZ4A 4JG0L 1P4BH 2AEQL 4RCAA 3KGRA 3ARFB 3GJEA 4JFDD 5J11C 3FFDA 1EEZB 1LO4H 2PYED 5JHLL 1TZGH 2DWEB 1KGCD 4L8DB 3QCTL 5MI0C 1JGEA 2VL5A 3WXVH 4J8RA 3X11B 4RIRB 2NY0C 1PD6A 4XXCA 5E00B 2Z31C 4R7NB 3I75B 4HIIA 1REIA 4M7KL 4QHKI 3INUH 2CIIA 5GS1C 2DI8A 1AP2A 3UTQB 5DUML 3CSGA 3IAPA 1K2DB 4NJAH 3QHZL 2DYPB 1UA6H 4NHUA 1G7PA 4X9FA 3DVNA 4LARH 2P46B 4F15B 4X8JA 1EH9A 2EO1A 4PJAF 1GZPA 3GJFA 4YGVA 2G2RB 4QHMB 5DMKA 5AZ2L 2DLTA 2W65B 3ILQC 3QH3A 4HEPG 3O6KH 4OD3L 5LQBL 4LU5L 2R69L 2DOCA 4XWGH 2OTUB 1KPVB 1G6VK 3IDIA 2IADB 3F7RA 5E4EB 2HG5A 3PHOA 1DCLA 2LQRA 1NGWB 3AVEA 3OXRB 3MLSL 4PS4L 4PUBL 3I3DA 3SOBH 3TFKC 2H32H 4NO3A 4M9OA 5FA3A 2R2CA 3TT3H 4UIMA 4Z18A 3L5XL 1CDGA 1T04A 3RVWD 1KB5H 5H2BB 4OCLC 1KTRL 4Y1AD 1CD9B 3WLWC 1N6UA 4K23L 5I1CH 1DZBA 5IF0B 1S7WA 3N1QC 3BH8B 1SJVA 3OKOA 2V2TB 3HZYB 2A77L 1Q0XH 1LE9B 3RVXC 1U8NA 3S3SA 3KPQB 2GTZB 3DGGA 1MNUH 4PRIA 2V5YA 4H88L 4HK3J 5JPNB 4WI9A 1IGYA 1BQHA 2BHYA 3QWRA 4YXLH 3HG1B 1OPGH 5DLMH 4F9PA 5ADPL 5F96L 4JPVH 1RMFH 2VR9A 4B41A 5IESL 3CFCH 3MROB 3OXSA 3F7YA 4QRPB 3CX5K 1MF2H 4KI5D 2P5ED 3A6BL 4CN6A 1KJVA 1AGCB 5KSBF 3L3GA 5ERWA 1FL3A 3EJYC 1DANU 4PR5A 4LF3B 5HPOA 5F7DA 2AJXH 5EC2A 5AD0A 4Q9RH 4MLSA 3NAAH 2GITB 1DJSA 5C0JA 4XVJL 4ORGA 1BD2E 4GAGH 5B8CC 3JWOL 3TN0B 1E6OL 2FO1A 4Y19D 3OR6B 3CDFA 3O8XB 3SGKC 2PYEA 2QADB 2IEPA 3Q5OA 4NWUH 3L5HA 5HYSG 1H8NA 3KR3L 2VDLH 3RY6C 3IJSA 4XPTH 2VL4A 4E9LA 4KQ4L 4WEMB 1EO7A 2ESVE 3NA4A 4HMEA 1VFOA 4P2RD 4X7CC 2EDXA 5LWYH 1N59A 1TQBB 4U3HA 4O58H 1D5IL 5D5MF 3QJFA 4ZFOL 1UM6L 3B9KD 2X44D 4ODHL 4GKOA 4KV5E 2F54B 1YEEL 2I9LA 5DDHA 2VLLB 2VZVA 3LAFA 2FHCA 4MA7H 4JY6A 5E7FA 1RUML 1ZAGA 3MV11 3B2UD 4R90L 3H42H 2E7CA 4FZ8L 5JHDB 3CD4A 1G7MB 3HZVA 1CZ8L 3AAZB 1CFSB 2EDNA 1KYOK 3LS4H 4R0LA 1JUFA 2VLRD 4EJ1C 2A0LC 3MV9D 1CK0H 2X4TA 5FCUL 4OZIB 4ELMF 1R3IL 3VXUE 3QEQB 2NQCA 3MA9H 3DVGA 4BZ1L 2VLJD 3H3KA 3MNVA 5FA4A 3FB7B 4XNQB 3C8KA 1J1PH 1WAAF 2X05A 3PUCA 2FX9H 4DGVH 5DR5H 4Y1AA 5ESVB 4AEIH 4K7FA 3OAYH 1KB9K 3QDMD 5I71C 4LKXB 5KBNC 3CSPA 1N5AA 2Y72A 1EVUA 4YNYA 2H1PH 3S4SG 5DD0H 3VCLA 4UDUB 1RZFL 2FIKB 2O26U 3K0WA 3RIFK 1CLOH 4NC1C 1F97A 1MCWM 3EO9H 4JFQA 4OCMC 2AXFA 4NBXB 5C6WH 3MGTA 1J1OL 3IF1B 2E9BA 4OIIH 4XVUC 1DEEB 3EOYG 1UJ3C 3LN4B 1SM3L 3S7GA 1JGVL 3MRFA 4I3RH 4OJFL 3IVKA 1A2YB 4I0CC 1HCVA 2ADJA 4G8IB 3W39B 2IC2A 3LHPH 5FYKE 1P5UA 2P5EA 1UB5B 4V1DE 1DEDA 1H8SA 5TE6L 4PJBF 2NXYC 4QT5A 4IJ3B 3WL9A 2QTEA 1VFBA 3T3PF 4D9QE 5CSZB 1T20B 2D3VA 2C3HA 3FQTA 2C4FU 4JN2A 4YDJA 1BFTA 4L3EE 1BBJA 4B7IA 1LEIB 3UPAA 4L8BB 1JGDB 4Y19A 2JLLA 1IM9D 3KPSE 2JF1A 3BZ4A 4HIXL 4W6WB 5E6YA 1U95B 3PXHA 3BP5B 3EJJX 1ZT1A 2FLRT 4WHYH 4P2RA 3ARDB 4JFEB 3DO7A 1DE4B 4QHUB 5DQJA 1AGFA 2FCBA 1A1OA 5GGUA 4WGVB 4ZSOA 3VRJB 3QFDB 1KTDA 2Q1EA 3QO0A 2WSKA 2C26A 2R0KH 4G8FB 2MQ3A 3REWB 4MAYB 4OI8A 1K6QH 3I2CH 3TYGH 3WNKA 5I15L 4P5TD 5F7EL 1UADC 1UH4A 4AMKH 3V5KB 1JWMB 5I1AB 3DV4A 2ZOLB 2P42B 3RL2A 3GJFH 1A8JH 3MLRL 4LVEA 1RU9L 1OAKL 3T0XA 3T0EE 2HVJB 2VLRA 2FEDD 4E41E 4Y2DB 2H2PD 4GG6B 3MV9A 2XIDA 2B7DT 2Y07H 2I5YL 1HH9A 3EJZC 4JE4B 1G7JB 2IQAB 2W60B 1LK3L 4WFED 5DMYA 1PX3A 1IAKA 2NY2D 2VLJA 4JFXA 3S35L 4N8PA 3K4AA 2APXA 3CDGA 2Q8BL 4JREC 3RUGE 4DGYH 5CEXB 1KCSH 4L3CB 4P46C 1PZ5B 1CFQA 1SY6H 2BMKA 2A6KA 1XR8A 3QDMA 4AIZB 1Z0NA 3L5JA 4NKIL 2CLZA 1CFVL 5DEFA 3SCMD 5BV7H 4WU5A 3GSWA 4PBVC 4TOYH 4RFEA 3NFPB 3HAEH 5DHYB 4EQ3A 3QPQD 3P4LA 4F9PC 3SGJA 5MEPA 2C3VB 3LY6A 2DQHH 5T33H 4JRYB 1N26A 1EHLH 4ODWA 4BQ9A 3WNPA 5I8CB 1CXLA 2PN5A 3HNVH 2XZAH 5CINL 1CXIA 2DMKA 2OL3L 1I3GL 2OBGA 3QIWC 1MEXL 5H35B 3U30C 4Z8FH 1UKSA 3IT8D 3NZ8B 3LN5A 1SVCP 3IDYB 4HKJB 5E9DB 3NACH 5IB4A 4CADA 2NZ9C 1PQZA 3VXRA 3CU1A 4X99A 3BQUC 1MIEH 5FO8B 2J8HA 4KRPD 3FO1B 5D9SA 5HHXH 4QTIH 1E4XH 5FXCH 4RNRB 5CD5D 5FOBA 3ZYZA 3BESR 1BZQK 5BXFA 4ODUA 1IM9A 2ADFL 3DIFA 1A4JB 3KJ4C 2OR9H 2HT3D 2PW2B 4H1LB 1BZ9A 4WHDA 3EFDH 4JM2B 1FYHB 1DQJA 4YK4B 5CJ5A 1DBAL 2KDGA 4HF5L 4J4PD 1RZKL 2Z8WC 1IGML 1NBQA 4ZDHB 3GRWA 4XMKL 3H9HA 1N64L 3N85H 5DJAB 3DI2B 2AJSH 4RMRA 1UB6A 4MNGE 4XNYL 2VN4A 5F1NB 3MRGB 3PP4L 2AEIT 5HDBE 1QNZH 1ACYL 1OVZA 3L3KA 1MI5E 3BH9A 4LCUB 3MV7D 1F02I 4P5TA 3ZHKA 2ZKHL 3KYOA 4UB0L 2YKLL 5F9OL 5IEKA 2E8ZA 1AKJD 4Z7UA 3VFWB 4R0LC 2WUCL 1KIQA 3W2DH 5EUOF 4LBEB 2NPLX 4FFZL 1NUDA 2EDTA 2XZCH 1YEHL 4JQVA 5E6ZA 1EEUA 5HYSA 3B6SA 2D7TL 3RQ3A 3KYAA 3SKNB 2BSRA 3D85B 4HXBL 2FGWH 4ODXB 5I1IH 4JJ5B 3LSOA 1CLCA 4JHWH 1KV3A 1TZIA 2Q7YA 1EUTA 4H5SA 3T0DA 3BZFB 4TPRH 3BUTA 4G42A 2D31A 5IT2L 1OGAE 4GQPH 3KS0J 2LAAA 4IDJL 3HE7B 5F3BA 4PJ9D 4LAQH 2WANA 3L5WA 5EBGA 2EDEA 2PW1B 3EYSH 4KZDL 5DJYA 4JLRA 1J5OH 4R96A 3I6GB 4KRNA 4XPAL 1ITBB 1XGTA 1WBXB 5EIVA 1LK2A 5DK0B 2EICA 3CIQA 5IB1A 3PQYB 2YC1B 2FEEI 4R8WH 5KG9A 1LEKB 1U3ZA 1I1CA 2CR6A 1SJHB 3PWPD 1F90L 1NFIB 1YDPB 5MENE 4LRIC 3JV5A 2LU4A 3F58H 1HOCB 4QTHB 2K9UA 4XNUH 2Y25A 3BGAA 4HIJB 4KKCC 4ZUTA 5LXGH 3HRPA 3C2SA 3KYMA 5L2JA 3QDJE 1AHWB 4AENB 1AH1A 1NAMA 1KOAA 3OKDB 2HKFH 2HLFD 1MJUL 1QRNE 2AJYL 1A6VL 2XTLA 3HC3L 1UFUA 4PJCB 2QHRL 3S4SA 4BFIB 1JGLH 1OAYH 1G6RB 2OTWB 1YMHA 3EHBD 3L6FA 4N90E 3FQUA 5D7JD 1YPZA 3OZ9L 4J4PA 1NFDF 3DLQR 4FTVE 3F5WA 3DX8B 3FTGA 3PWNB 5E08L 5B3JF 4PBWD 1JZ7A 3O3BA 2BNUA 2BSSB 4FQXB 5BO1H 1ES0A 3LKNB 1MIMH 4M7LL 1FZMB 15C8L 5J1AB 1NDMB 3UTZA 2IBGA 4I4WA 4K7PH 1W0VB 1ZV5A 1SEBB 4XNXH 1S7TA 5DJCA 3MV7A 4LPXA 4MJ5B 4PREA 1NBYA 1INEL 2JB6B 3WV0A 1AKJA 5GRUH 4MA3A 2GUOA 5J1SC 4LCIH 5IHLB 2UWEA 3RWGA 3VXPA 5D72L 3GFUA 4OCYH 4FXGB 2DIAA 4TQEH 1BEYH 5HDQL 4Y5XB 1U2HA 3FQRA 2DM3A 1RZIA 5DD6B 5DJ2A 5IIEA 5IGXL 1S78C 3QNXB 2E6QA 1IGCL 2YEZB 3HR6A 4D8PB 1ETZB 4DAGL 1C08B 2AEPL 1BVZA 1PSKH 1T03L 1I8MA 1NFKA 5GGSB 4MA8H 3E6HB 5JW3H 4PGDB 3WIFB 3WSQL 4M93B 4PJ9A 3NVQA 3DROB 4UQ2A 3QXVA 3MFGB 4K3HA 4O9HL 4FQQA 1PKQB 4KVCH 3AXLA 2W9EH 2WQRA 4PJEE 2ZUYA 4LSVL 1KLUB 2XKSA 5CILL 5F6HI 3RX7A 2EDQA 5F1IB 4ODVL 5BW7C 1JE6A 5FYKL 3K4ZA 4OLXL 3D0LA 3PWLB 1T1YB 3QIUB 4WDIB 3PWPA 5KS9B 1T6VN 1FRGH 1CDCA 1PG7L 1K8DA 2NY6C 1BFSA 3VI4E 4P9HL 5JW4Q 3P4OA 4HPOH 1MCOH 5EOCL 3TEUA 1ITCA 2BOCB 1EFXD 3O2VH 4L4TD 2GJJA 2HWZH 4ONFH 5JW4M 2W1NA 1QFWM 1K4CA 4PY7A 4GG8A 3LRGA 1HHIA 2CMRL 5ETUA 2DM7A 3B9EA 4GQ9H 4QNPF 3AM8C 4WI6A 3U0TB 5GGRB 1MLBB 5D7JA 3G5YB 1D6EB 3UJIL 1HN1A 4PLJC 3TZVB 3R1GH 4P3CH 2FL5B 3VMPA 4PB9L 3VFUB 5DEGB 5A2JH 4YBHA 3WFBH 3FOMB 4PGEB 4Q0XL 4QGYA 2IPKB 5E2UL 4Y88A 1MUJB 5I1EL 3F62A 4UAOB 4JKPL 5T1DH 2F74A 2C3XA 3MFFA 3BHBA 4WI8A 2YPVL 1JWSB 3TBSA 2H2PC 1HQ4B 1C5DB 3TT1L 4JQVC 4LLYA 4RISH 3LEXA 4XRCA 1XR9B 5EWIL 5FKPB 3BD3A 1H3XA 1G9NC 4P59L 1F11A 4JHAL 1NGXA 4ZFOB 4F37K 3MRRA 3PJSB 4JCMA 4JFHD 4N0YH 4ZO7A 3AU1B 4WHTB 2NTSP 2VITA 3KJ6H 4PGBA 1ZSDB 5ELIA 3MRDA 4JY4A 1QA9B 3O41A 1OTSD 2YSSA 1AXSB 3S37H 5DUPH 3SDDC 3K80A 3DVFA 3HRZA 4H8WC 2OJZH 3I6LD 4PTTB 4YFLI 4OF3A 1ULVA 3V7AG 5JIIA 4QXUH 2VYRE 3O9WD 4BSVB 5L88H 4O51A 3GIVB 5DTFA 3QB7C 4BYHA 1QG3A 4Z6AT 3MA7B 1FG2A 5EBWB 3O6FB 5CJXC 2MCG1 2DI7A 5IJVA 4DZBB 2AV7A 5KVEH 5LGJB 3HS0A 4I18B 3LCYA 3GNMH 4KY1L 2P8PA 4XMLH 4ZD3H 1IGFL 5T1LB 5D7LD 1OW0C 3A0OA 4OLZL 4RWYH 1EJ6A 2F53D 4Z0BH 3BRGC 1EFXA 1R0AH 8FABA 3MJGX 4L4TA 3C60B 4Q6IA 1GRWA 5CD5C 3WEXA 5IW1A 4HLJA 2MMXA 2OP4L 3BIKA 5HHQA 3HNTL 3T1WA 5GJTH 2BVPA 3THMH 2XTJD 1ZHBB 5C3LD 2A83A 2HT3C 3G9VA 4Q9CA 4ZFFA 3NN8B 5KTEL 2WAHA 1JHTA 3FHAA 1KC5L 1F5WA 4ZOAA 5ADOL 5MP6H 4ZYKB 1A7QL 1YECH 4QF1A 4GS7B 2IG2L 8CGTA 3EOAB 3LKOB 1NCWL 2FYYA 3GSXA 5DMIL 3LVEA 2V5TA 1DBBL 2DAVA 4KTYA 3G04A 3C5ZD 4JB9H 4YBQD 2HVKA 1NC4B 3VI3E 4KMTH 2ADGA 3C6LD 4QRTB 4XVTL 3RJQB 2HTKC 1MREL 5LAXB 5EO9B 1CIDA 4TSCL 3MUGA 1FZOB 5JUEH 4LCYB 5CIPA 2RAMA 2Z91A 4JPIA 1U36A 4Z0XA 1LNUB 5I2IA 4MS8D 2D4FA 2VE6A 5KJRL 3KXFD 4BH8B 4U4BA 4MDIA 2QR0B 3TCLA 4D0DA 4YXKH 5C6PB 1B2WL 1P7HL 5HHPA 1WIOA 5C2BH 1MHPH 3K8MA 1R3JB 2P8MB 3GK8H 2VXQH 4U6HA 1GCFA 4GRWH 3UTOA 4UV7L 2P1YA 4M6NH 3O9WA 4N0CD 3HZMB 1DR9A 4QHNA 3JSSA 5E1HB 1X5GA 4LSSL 5JO5B 7FABH 4OBRA 4YDLC 3NIGE 1KFAL 2VH5L 5E2TL 5E7BA 5ISZB 2VOTA 1P4IH 2NNAB 1XF2A 3OJMB 3WS3B 1YMME 3QEGL 4YPJA 3GSRA 1Q38A 3L7EB 2JELH 1W72A 2VNCA 2ZUQB 3QXUA 1R6VA 2EDJA 2BNRD 4YO0B 3LEYH 3P9LB 3OKMB 4Z7VB 2IAND 4LKCB 5D7LA 4Z7UF 1JL8A 3WLBB 1YNKH 2F53A 4G9FD 3WFHB 1BX2A 2ZUVA 3WFDL 1FJ1B 4PJIA 2GK0B 3MNWB 1QHPA 3GSNA 3AB0C 1VA9A 5FUOH 1U92B 4UIKH 3U9UB 5C0FB 1NANH 4YHIA 1I3RB 1I1RA 5D7JC 3C09C 4RGMC 2OL3B 1FFNB 5DJXB 4P5MA 2A1WL 4U7SA 2MWCA 3H3PH 4R4BA 3T1FA 5E2VL 2FBOJ 3C5ZA 1FH5L 4NBYB 4HGMA 5C0DA 5C0AE 3MYJA 3C6LA 3S3PA 2VDOH 5C0CD 4YHPA 1T2QH 1KCKA 3HPLB 1GAFH 3UBXI 1A6ZB 2XQBH 5E5MB 1I75A 5I76A 2XN9E 3GO1H 3S97C 3KPPA 4HWBA 3TH4T 5JOEA 4FXKB 4LLVB 2OX5A 4F7MA 3RDTD 1CL7I 2E9JA 1ORQB 5DRNA 4U49A 3KXFA 4XBGB 3MLZL 1QVOA 3TVMD 5D6CA 1FL5B 3TYFB 4CMHC 1UQSB 5JDJA 3FRPA 2W9DL 5DMGC 1XIWD 4F9LA 4CKVX 3ULSB 1FSKB 1F42A 1UZ8A 4OCSL 2EECA 5CEYB 3QHFH 3VRIB 2NW2B 5SWSD 1HK6A 4GW5A 1P7QD 1RVFL 4NO2A 4IOIB 5ICXB 1KLFA 4XC3H 3MZGB 1OB1A 3IB4A 1HNGA 1Y0LB 3QI9B 4Z7WE 3SKOB 4N0FB 3U36B 2QKIA 5KZCB 2V2XB 1BOGB 5L0QB 4X6DE 5AWNH 1JJUA 4KROD 1DUYB 5D93B 4PJDF 4HKXA 3G5ZA 3ZHDA 5C7XH 2F5BL 3O4OB 4IRJD 1KUMA 2OSLA 4KK9C 3P0GB 1RSFA 3FRUA 3DI3B 1YEFL 2BNRA 4JR9L 4Y16B 4QHLA 4NN6B 3QFJE 2OQJB 2IANA 4BFGA 2NY7H 2VDKH 4HD9A 5A3IC 4GW4A 3BOVA 3GMNB 3WKML 4MZ2A 4EI6A 4NRXA 4IMKC 4G9FA 2GSIB 4B0MM 2KPNA 2X4OB 4IMLA 1F4HA 5ALBH 5FDWB 5IVZA 4X9HA 5C08E 1WITA 4HFWA 5D1QA 1AO7E 3IRPX 4GRWF 5CEZE 2PF6A 2JJUA 4K3GA 4X6CA 4HBCH 5TF0A 4OM0H 1BD2B 2ZG3A 1GGIL 4GUPA 5HVHC 2P24A 4CNIA 2EE6A 4D9LL 1ZVYA 3U7YL 4DQOL 1FORL 4ZOEA 4F7TB 4HUXB 4HQQL 5J13C 1P7KB 4JZJB 5ID0B 3DRQB 3Q5TA 4OM1L 1T5XB 2PXYB 5C0CA 2ESVB 4YBLC 2H8PB 3ZDXE 1HI6A 1DQLH 2X4SA 3ARFD 4M5ZH 3V52H 5ILTH 1WEJL 3QDGD 2Q86B 1QBLH 2VN7A 4TUOB 2CD0A 5D2NC 4ZG1A 3UTSE 3NGBB 3RDTA 3ALXA 3FQNA 3RWIB 5DYOB 3TVMA 4LVHB 2OJEA 5HDLA 2DICA 1N7MH 1A02N 1UXSA 2COQA 4LL9A 4P4KD 3ZO0A 4DK3A 1XIWA 5TFSL 3V0VB 1JNNH 4KC3B 3EAKA 4DCQA 3QXDA 1A3LH 1T3FA 3CZFB 1CGXA 1K4DA 4BK4A 3A67L 1R5WA 5SWSA 5C0EA 1P7QA 4NKOB 3BKJL 1DQQA 5KVGL 1LQSR 4XH2A 3VXUB 4Y5VC 1C5BH 2C4XA 3EDKA 4K94C 1QOKA 1JZ8A 1R3LB 1UVQA 3VGAB 4GBXB 2DIJA 3K7UA 2M2DA 4FZEH 5CP7B 1KG0B 4JPWL 1G1CA 3FT3B 4JHBA 1DDHB 3PGCA 4IRJA 4PJHE 1UACH 2R29H 3EGSB 4Z7OE 4NUGL 3LQAH 3C9NB 1E4WH 3KWWB 4LVNC 2R39A 4FABL 3HI1B 3TO4D 1NL0L 5CGYD 4KK5D 1P4LA 2YPLE 4JPKL 5HHNA 1S5HA 1MCBA 4B5EA 5C09E 1VFAB 2FX7L 1OT2A 3RU8L 4Y5YA 2F5AL 3GSNH 3IDMB 1UCBL 3IKCB 3OB0H 3PWUA 2W91A 4UUJA 3MRJB 1N2RB 3GB7A 4V1DB 3GBLA 1OTTC 1CE6B 2VDPH 2WIIA 3CMOL 4XGZB 2VQTA 5FUZH 1U3YA 4JFOA 4X5XA 1ZMYA 3HMXA 4P57B 1SYSA 1IZKA 4TRPL 5F1OB 2DM2A 1U8PB 4AH2B 4NBZB 4LPTA 2ICWI 4H0IA 4Y4HC 1KELH 4F58H 4L3EB 4ZUSB 4YBQC 1EO8H 2ZOKA 4HZLA 5GRJH 4K71C 3KPSB 3FN0H 5DRXA 5IMMB 4HT1L 4P2OC 4PRHE 3ARFA 3O8XD 1AGDB 3WXWH 2QADD 3QDGA 2DWEA 4L8DA 1KNOB 4NO0B 1A6WL 3ETBF 2XRAH 3X11A 4RIRA 4MS8C 5E00A 1NFAA 4R7NA 1S7VB 3GZKA 3I75A 5FM8A 2IMMA 4JFFE 1IE5A 4HWBH 2EXWD 3UTQA 1K2DA 3SE3A 4PBXA 4P4KA 3L3IB 4DVBB 2F54D 5CBEB 3MODL 2J5LB 3ARGD 2FSEB 2G2RA 3T0EB 2W65A 3CZJA 3VFNB 5DJ8B 4E41B 1ZS8A 5JHDD 3BMWA 4LQ1A 5GRXG 2V5SA 3NA9L 4JRXD 4HSQA 4XCNB 4D3CH 1CGUA 2ITCB 5K9QG 3T2QA 2OTUA 1KPVA 2APBA 2EDHA 2IADA 4XXDA 4ZS6C 3W81A 1F8TH 3UEZA 1NGWA 2DQGL 3BE1H 3TIEB 3OXRA 3UXFA 1HINH 3QEQD 1V3MA 1UT9A 3OKYA 4TUKH 2XY2A 1TLKA 1UC6A 1NDGB 3NCCB 1JIBA 5H2BA 1C8PA 4WU7B 4LSRH 1CDUA 2B39A 4EI5B 1QR4A 4ZOCA 4YHML 4NHCH 3NCBB 1XCQB 1MJ8L 4Y0GA 5BMFH 5IF0A 3BH8A 3SDCC 3AS1A 5DD3L 3TO4A 3P30H 1YJDH 2MQCA 1IM3B 2YRLA 4W4OA 3UYOD 1LE9A 3KPQA 3C87A 4XHJD 1OTUC 3Q6GH 4H1LG 2D2OA 1OAXH 5D71L 5AZEH 5JPNA 4XTRD 5JLZB 2CQVA 4YLQT 5D1QC 1LP9F 2R2BB 3QUXB 2BY0A 1GOGA 4NN5B 3I3BA 3MROA 4PJ7F 5GJSH 1ZHLA 1S7RA 3SE8L 5HHVL 4CVXB 1S7XB 2E7BA 4LLQA 4PJ8B 4AQ1B 4J7RA 2P7TB 1AGCA 1NCCH 5D2LF 1GC1H 4FQ2L 3FQWB 3QXAB 1BF2A 3QUKB 4MNQE 5L9DH 3LIZL 3SN6N 2EDYA 5IKCB 1T7ZA 4DKFL 3O2DH 1Q94B 2GITA 1MCPH 4PP1D 4S1RH 5TDNB 4ZUWB 2QQLL 3Q5YA 4G80B 5ESAB 2D0GA 5FB8A 2OXHA 4YC2C 4KKAD 4MA1C 3O8XA 3RVVD 1FCCA 2NR6D 3X12A 4OT1H 43C9B 4OB5L 5D96C 1MFBL 4RMUA 1J18A 1C5CH 4MNGB 4PJFF 4NZJA 4HS3B 4HUNB 4NZUL 1SVZA 2NY5H 1Q8MA 4JFYA 2FR4B 3ZE1E 3ULVE 4HJJH 1MI5B 1XIWC 1BFVH 3W9DB 2J88H 2F54A 2NXZB 4OI9A 4LSTL 2VLLA 4KPHH 4N8VG 1T2XA 5TQ2L 3EZ8A 4C83B 4MAYD 1M1SA 3ARGA 5EU5B 5KN5B 1F4YL 3FO0H 2IAMC 5JHDA 2GIYA 4XNMA 1G7MA 4WW2F 3AAZA 4MJIE 2Z4QB 1CFSA 1ONQA 4JRXA 2DDQH 1I1AC 3PP3K 1JPGB 2P44B 3HN3A 1OAUH 4KROC 1CE1L 4NQVB 3QEQA 4YZFF 1JZ4A 1CXEA 1UJTA 1X5YA 4LAJH 4TVPE 3QUMB 4EUPH 3HUJE 3CVIH 3P4NB 3Q0HA 4XNQA 5IBUB 1AIFB 3CPLB 5IQ7H 5ESVA 3TBTA 5JR1H 1FCGA 3SDXE 4ZMAT 1A7NH 4LKXA 1V5JA 4YX2L 3O4LD 3BKCL 4MJ4A 4K8RD 4LASH 1DBML 4UDUA 3GMLA 4APQB 5CEZL 2EIZA 4NNYB 2JTDA 4JRYD 5IB3B 5MENB 2DQUL 3BRFA 3ES6B 4QXGL 4U0RC 3IDGB 3LN4A 3LZFL 1GXEA 2APWA 1RAMA 4Q9BA 2Y5TB 3W39A 5GS0H 3QDJB 2EEDA 1UB5A 3DX9B 4MXVF 3SE4C 4JEGB 1DLFH 4HS8H 1U91A 5DD5L 3HMXH 1WK0A 2FB4H 1QRNB 5ENWB 5ITBL 3K46A 5CSZA 5AAWA 1T20A 2VISA 3Q6FB 1IAIL 5JZ7D 4LHJB 1FFRA 3ARFC 1LE5B 3QPXL 5E94B 4FTVB 1I7RB 5CWSA 3SDYL 2P45B 5DGRA 1KJ3H 4I3SH 3C5JB 3BP5A 1OLLA 3ARSA 1TVDA 5FYLE 4JM2D 5F7NC 1F2XK 4N1EA 3RWDB 2CRIA 1S5IH 4DN3H 3N9GH 5FGSA 2JJSA 4QHUA 4TSBH 4OUOA 3ZKMD 5EOTB 3VRJA 1CU4L 4A6YA 3QFDA 1HNFA 4XP6H 2NY0B 3RWFB 1QLFB 4FG6C 5EUKA 1YEGH 2Z31B 4HK3N 4F15C 1FNSH 3DGCR 2XWBB 2EIDA 4X7FC 3O6LH 1Z2KA 5TQ0L 3REWA 4MAYA 5E1AB 3MGAA 4F37F 5IOPB 4X7TA 4MXQD 1OAZL 1IC7L 4P2YA 4DN4H 12E8H 3V5KA 1JWMA 5I1AA 1HHJB 1OARL 1ZHNB 2ZOLA 2ZUSA 5JXED 4X6CF 2HRPL 4GMTL 3H8NA 5E4EC 4DGIH 3C2AH 2PYFA 2XA8H 2ZCKH 3U1SL 3DX6B 3B4NA 1IC4L 2YD4A 4LSUH 2IQAA 2W60A 3IJYA 5IW6A 4EBQL 4MXWL 3WFCH 2QBWA 5HDOA 1NUFA 5CZXC 5FK9A 2IQ9L 5CEXA 4L3CA 1PZ5A 2CLRA 4WI5A 5EU4B 4PJAE 5BZWA 4AIZA 3GHEL 2I60H 1OWWA 1XMWA 4XX1E 1XGPA 2CUHA 4PJEB 4MJ2A 4NZRL 2CKBH 1MFEH 2DMCA 4YPGB 3O4LA 2DQCH 5DHYA 4KUZL 4CBPA 2VR4A 4YDKH 2MPAH 1Z3GH 1FV1B 2AVGA 2W0LA 4XCFH 2C3VA 4UILL 4Q2ZB 4JRYA 5HGHA 3V6OA 1CR9L 3TF7C 4L4VB 2R0WL 4GMSH 2HFGL 1YYML 5JPMB 1IGIH 4PV8B 5H35A 3CH1A 3L3OB 2DD8H 2IPTL 3NZ8A 3IDJA 4HCRL 3VXSE 2BXYA 4HKJA 5E9DA 5F3HA 5EZIH 4ELKB 4FFVD 1X9QA 3LV3B 5EO1B 2D9QB 3FO1A 1T1ZA 1U8KB 3QSKB 1FVCB 3LN9A 2VAAB 4RNRA 3TN0C 4E42B 3MC0A 3O8XC 3Q2CA 2QADC 5FKAB 4F3FA 1A4JA 2H2SD 1CGWA 4U1LB 1KCUL 4H1LA 4G8EB 2EZ0D 4LQFL 4JM2A 5DJ0B 1BWWA 2VZUA 4YHLH 4UMGA 3LS5H 3IGAB 1NCDL 3NCYP 3OKKB 3PNWB 4ZDHA 1NBVL 4ZTOH 4O5LH 1RHHB 1IILE 2BSTB 5DJAA 2M26A 3MRKB 4Y4KD 3T09A 1GIGH 1MAML 1FYTE 4E0RB 3M45A 4FQXD 3VW3L 5F1NA 3SQBA 4OKDA 2JIXD 3MRGA 4GH7B 1MHHA 1MRCH 3KPLB 1JGUL 2AJ3B 4JDVB 1G9NL 4D0CB 6CGTA 4LCUA 1RUAH 3HB3D 3V2AR 5D2NE 3RL1B 1CQYA 4NIKB 4XNZB 2HT4D 3ARUA 3NCEB 3VFWA 1NMBL 2CKNA 5JXEA 4U6YB 3QQ9D 2V6HA 1F4AA 4J6RL 2PNDA 4HHAB 3CC5A 4EIZC 4XP4H 3KPRE 3W11C 3EO1B 4DK6A 4H8WL 4NQCE 1OCWL 3GEWB 4UI2A 1UWEH 5D5ME 1O5DT 3SKNA 2YMXL 4WFHD 4ODXA 4JJ5A 5DFVD 3ZDZF 4JO4L 5EBMB 5KSVB 3MSPA 2CXGA 2ITDB 4S1QL 3UTPE 1ZLWK 5SX5K 3RBGA 4N8VA 1MCQA 4XBPB 1ZOXA 3UPRB 3HE7A 1FLTX 4LDOB 2FJGB 3IFOB 3DRTA 2PW1A 3C08L 1KCVH 1MLCB 4XTRC 5HGDA 3I6GA 3IDNB 3VE0B 2R1WB 3GMMB 3BZEB 1U8OB 5I71B 1R5IB 3LOWA 4HUWB 1IQWH 4PD4K 1WBXA 5DK0A 5D7SH 2YC1A 4Q9QL 4DKEH 3QIUD 1LEKA 5GSRB 1SJHA 3LB6D 1MJ7H 1WAAE 2AABH 4G6KH 5DVMA 1YDPA 4KAQH 1NMAH 4Z7QF 1HKLL 2VAJA 4BUGA 5KANI 1HOCA 2UY7A 2VLKE 4HIJA 1INQA 1NPUA 1UYWL 1AHWA 5C0IB 4PP1C 2Q87A 4OCWL 2ARJB 3O3DB 5DZLA 1I9RL 7CGTA 3OKDA 1IAOB 3UBXB 3X3GL 4EVNB 2B2XL 3DETD 4XMPL 4KHXH 1RHFA 4UBDC 4PJCA 4YWGH 4XI5C 3HMWH 1F3JB 2OTWA 3LKPA 4WUKL 5ESQB 4Z95H 3ISWA 3ARDC 3JVGA 4M7ZC 5DVOA 4X4ZA 5C6TH 3TZVD 2I07B 1KEMH 3DX8A 2J8OA 3PWNA 4HLZG 4MVBC 4PJBE 4FQXA 4YAQB 5EA0L 3T2NH 5GGSY 3LKNA 1NAKL 5IMLA 1T0PB 2Q3ZA 1S9VA 4OLVH 1NDMA 5INDA 1X4ZA 1JN6B 1ZA6B 1V05A 4FQLL 4A6YH 1XCTB 3MUHL 4ZUVA 3TBWB 1SEBA 1BGXH 2DJUA 1AGBB 1C12B 5EBLB 3KPMB 3R06B 2E6PA 4N9GB 2YR3A 1LO0H 3SGDI 4Y2DC 4N5ED 4ODTH 1XGQB 4TVPL 3TNMA 3Q1SL 1TVBB 1RJCA 1QBBA 2X89D 3VG0L 2AI0L 4Y5XA 2ZSWB 4ZUUB 3O6MH 5D1XB 3WDHA 1A1MA 1VKXB 4BH7B 5DD6A 1IVLA 1W8NA 3WD5L 4FMKA 4OSUL 4FQCH 1T89C 3IXAA 3QNXA 4NNXB 2EEAA 1WZMA 4PP2A 3W5MA 4LIQH 4UT6L 2V7HB 4I77L 3VFMB 1I85C 5EZJB 3E6HA 3NZHH 4PV9B 3WIFA 1A0QH 4O2EB 3DROA 2IPUK 4JREB 5AG8A 3VH8B 5GGRY 1YMMB 4P46B 4JM4H 4K9EH 4M61B 3I6KB 4KHTL 4XAWH 3V6OC 1MFCL 4K8RH 3CU7A 3O6FD 1NKRA 5F1IA 3U9PH 4NFDA 2WLYA 1QFWL 4BZYA 3QIUA 1U8QB 3SY0B 1I7ZA 3F7PC 1BQLH 5T1MB 2VSCA 2IPUG 1ZT7B 3O45B 5B22A 5T1LD 1RZ7L 5JOFB 4JQIH 3T65A 1NGQH 2GEEA 3M17A 2V9TA 1JYVA 3WNOA 5J3HD 3FAWA 4RMWA 1XH3B 2V7NA 5TE7H 1MCWW 4YEEA 5L2KE 3L9RA 4M3KB 1XAUA 2LU3A 3U7WH 3OPZH 4KK8D 5FYLL 4RAUB 3MMEA 5C0RH 1CBVL 4K3JH 4YK4C 3D9AH 5GGRA 1MLBA 1JTTA 1VFMA 1D6EA 1FAKT 4YFDB 4LRNH 5HI5C 2ZCHH 3TZVA 3ZKMC 4JKMA 2OCFD 5C0AB 3VFUA 1FNHA 3OX8B 3KJ4B 2FBJL 1P9MC 2AEWA 3FOMA 4PGEA 5AYQA 5GZND 2IPKA 2PO6D 5IFAL 1OGTA 2EIBA 1MUJA 1RZGB 4WV1A 1NC4D 2XN9B 3MV8E 1A3RL 4DZ8B 3MLXL 3K4DA 5ICZB 4OQTA 3T0AA 1QSED 3IS0X 4AQOA 2APTA 1QSFE 2EH7L 4FQIH 4YQXL 1JWSA 1YEJL 1HQ4A 1C5DA 2IGFH 1MFNA 5E24E 5MEOA 4XP9H 1DQDH 1OSPL 2X89A 5FKPA 2HRLA 2MCPH 4AL8H 3MLYL 4WEBL 1AQKL 3IXTB 4IOSD 4ZFOA 3FZUD 3PJSA 3DMMC 1J9CT 4D0BB 1QR1B 4KKNA 5C70A 4WHTA 4HS6B 2BVEA 1ZSDA 2FDBP 4YR6A 1ZGLB 2OK0L 4YHNB 3T2PA 1N6VA 1Y6MR 1AXSA 4NJ9H 4Z7WB 4Z77B 5HHOB 5I16B 2HN7A 1TZHA 4GXUN 4OZHF 4PTTA 2WP3O 1OP9A 4PRBA 3HE7C 4YH6A 2BFVH 5E99H 1RULH 1HH6B 4X6DB 4QYOA 2PCPB 1SHMA 1KT2B 2CRYA 4HGWB 1N5YL 5EUOE 5L8JB 4XC1H 2YD5A 3BEVB 1HIML 1WZ1L 1WBYB 3JTSB 3MA7A 4N5UA 4JFPB 4MQ7B 3G08B 1VGEH 2HFEB 4KQ3L 5DA4A 3DUUB 5EBWA 3O6FA 4LSPH 5IQ9A 4U1SB 2QSCH 1YYLL 5ISZD 1HQRB 4DZBA 5C2UB 2NTFB 5LGJA 4KDTC 2VABA 4PIRF 4I18A 2J3SA 4F57H 2OZ4L 2M1KA 5T3ZH 1U8LB 5I17A 5T1LA 1QKZL 1J87A 5ACLA 4OLUL 2VLME 1P53A 1AHWC 2X6MA 3FO2B 4POZC 3V4PL 3MLVL 1CS6A 2RIKA 2IMNA 3HI5L 1F4XL 5T5FH 3C60A 2VDQH 5CP3H 1N0LA 1AO7B 32C2B 4F7EB 4CU8A 1NCTA 2L0DA 2DMBA 2GKIA 2H2SC 3IJHA 3MO1B 4PRPD 3NN8A 1KENH 3DTXA 1J0JA 3FT4B 3JVGC 4RWHA 3DSFH 1KJ2L 3AY4A 4FQ1L 2A9NH 3CLEH 4ZYKA 4YFEA 5I19H 3EOAA 2ORBH 3F6IA 5HI3D 4Q97A 5I30L 3STBA 1EEYB 4POUB 5L7XL 4YFLF 1FNEB 4GO6B 2PO6A 2GSGB 3BD4A 4AT6B 1YY9D 1NC4A 4A2LA 2XZQL 4QRTA 3HB3C 2DQJL 5DXWA 5M95B 2XWJA 2C1OB 1L0YA 5EO9A 2GHWB 2UZIH 2VXUH 2FX8L 2HT4C 1QSEA 4LCYA 5GHWL 2HKHH 4U6XB 4G5ZH 2YPKB 1KBGH 3EDJA 5CJOH 2HTLD 3VFOB 2AEQH 2AJVL 3QNZB 5A40E 2E9WA 1LNUA 5JHLH 5E5RB 1NFDE 5MEQA 2A6JA 2EE2A 3BPOC 4BH8A 2QR0A 5B3JE 3PDOA 2QQNH 3DVIA 4OF5A 3TIDB 3TWCL 4JZNB 5D1ZB 1U8MB 1CL7H 4K94L 4P3WA 5DUMH 5J6GB 2WMPA 1AQDB 3ULUC 4G6JL 5ACZB 2P8MA 4JM2F 5IVOA 3GBNL 4YUEL 2Y36L 3QISA 4EQ2A 2VXTH 3QI9D 5KZCD 3B5GA 4OD3H 1LO4L 4OZFB 5JO5A 5LQBH 4LU5H 2R69H 1XF1A 4PJHB 1KIRB 5ISZA 2NNAA 3MJ8B 5TH2B 4PS4H 4PUBH 1B9ZA 4OF8A 1LO2H 4ZXBB 4YO0A 3P9LA 4JFDE 3L5XH 4Z7VA 2ZUUA 1CGYA 4TULL 2JK5B 2YPLB 3QIBC 4NT6B 3EBAA 3VGHA 3WLBA 4UQ3B 1MVFA 4K23H 3WFHA 1JWUB 4LARL 3HG1E 1JRHL 3MNWA 3MRLB 3FMGL 3AS0A 2NY6B 1GOHA 4X5WB 4PY8I 1U92A 2J12B 2A77H 4QRPE 4WGWB 3O6KL 3U9UA 5C0FA 4PRPA 2W59A 4H88H 1JI2A 2OL3A 5ADPH 1FFNA 5DJXA 4XZUB 1T22B 5IESH 2IBBA 4U1GB 2ENYA 4M43L 1HSAB 4P48A 1BD2D 4OCNC 4PRHB 5K59F 3A6BH 4UAOC 2UUDK 2PXYD 3EDDA 4HJ0C 2ESVD 3HPLA 2J8UB 3QULB 1H3PL 5EFIB 5E5MA 2F8VA 2AERT 1LD9A 4XVJH 4JFFB 2P5WB 3JWOH 1EMTL 1E6OH 4QNPE 1MY5A 4FXKA 4LLVA 4YXLL 3KR3H 5I18L 5F93C 1ORQA 2VWEC 3GSUA 3VDCA 4KQ4H 1RUKL 1OF2B 3HLAA 1RMFL 4BKLA 3T8XA 1CI5A 3HNSH 3PDGA 3QT2A 4OZGF 5GGQL 1UQSA 3RVTC 1D5IH 1MF2L 4ODSL 3ULSA 3PGFL 4QCIB 3TNNB 1Q72L 4OTXL 3VA2C 1UM6H 4HW6A 1EHNA 4JDZA 2DBLL 4ODHH 5CEYA 1YEEH 3VRIA 1SJXA 2NW2A 3W9EA 4OZIE 4IOIA 5ICXA 4YDIL 3NAAL 1ZA3A 1RUPL 3VXUD 4QRSB 3KNBB 4R90H 4KK6D 2NY1C 4RGNC 4GAGL 1Y0LA 1TJGL 3QI9A 4FZ8H 4N0FA 3U36A 3TESA 3BDXA 3LH2H 1E27B 1CZ8H 2V2XA 1BOGA 3SDDB 3REVA 1B0RB 4F33B 4XPTL 1Z9OA 4GBXD 5DD1H 5F9JB 1DUYA 2DQTL 5FCUH 5DI8B 5GXBB 4CDGC 3CX5J 4UNTA 3QR2A 3I3EA 2WUBL 4AM0B 2XKUA 4WI4A 4BZ1H 3ESUF 4HPYL 3GHBH 2H26B 1RJZA 4UT9L 2GSIA 3C60C 4RFNB 4G8GE 4LPVA 3HR5A 1D9KD 1E4XI 2X4OA 1PLGL 1JNHB 3VD7A 3IU4L 5FYKD 4HC1A 1RZJC 2FECI 3ELAT 3N1FC 2KBGA 4V1DD 3IFLL 1X6LA 3VGEA 2OTPA 4GS7C 5KSUB 1J1OH 2V2WB 1SM3H 2BY1A 1JGVH 4OJFH 5DMJB 4MX7B 1U0QA 2WP3T 1BD2A 4M1GL 5IROA 1D5BB 4JDTH 2ZUWA 4L3ED 4HXAL 5J4MA 4DGVL 4AEIL 1HWGB 4HUXA 4F7TA 5GRVK 5IVXB 4JZJA 3KPSD 3NMEA 5TE6H 5ID0A 4S1DC 1JF5A 4RFOH 1ZLWH 2HFTA 3U83A 2PXYA 3CMGA 3HE6C 4TTDD 2ESVA 5SX5H 2H8PA 5HPMB 4WFGE 2FATL 4BSWB 1KYOJ 1L4IA 5C0GB 1JHLL 4NO0D 4TUOA 4JRWA 4PJXB 2YUXA 4G6ML 4HIXH 3ZT7A 4LOUD 3EO0B 5IBUG 3RWIA 4ZTPL 2E7LA 5SWQB 5DYOA 1N4XL 1IT9H 4NQUA 4M6AA 2WLZA 2I9TB 3QRFM 3QNYB 4FS0A 4R7DA 4KUCF 3LHPL 4X4YB 1A9BB 5FF6A 3V0VA 1KB9J 3CZFA 4MJIB 4PLKD 3WE6A 3T0ED 4IDLA 4AJ0A 4GG6E 4E41D 1F4WH 4NKOA 1H9VA 4HLZH 5D4QA 4Y7MA 5I15H 3VXUA 4FFWD 5F7EH 1T21B 1T0NB 5EU7C 3ZKSD 4N0UB 1ZTXH 3HUJB 2VZSA 1R3LA 1VESA 1RU9H 3V6FB 4GBXA