3GUTB

Crystal structure of a higher-order complex of p50:rela bound to the hiv-1 ltr
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
312
structure length
312
Chain Sequence
GPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGVCTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHSDLAYLQAEGGGDRQLTDREKEIIRQAAVQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription factor p65
publication title Structural basis of HIV-1 activation by NF-kappaB--a higher-order complex of p50:RelA bound to the HIV-1 LTR.
pubmed doi rcsb
molecule tags Transcription/dna
total genus 60
structure length 312
sequence length 312
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2009-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00554 RHD_DNA_bind Rel homology DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gutB02
2.60.40.340 Mainly Beta Sandwich Immunoglobulin-like Rel homology domain (RHD), DNA-binding domain 3gutB01
1V5JA 1R3KA 1JZ8A 4PJGB 4PV8B 5C2UB 2XQYK 1SBSL 1T03L 3R1GH 4P2OC 4JPKL 1GGCL 1UVQA 2H1PL 4BZYA 3QYCA 2NZ9C 5E4IA 3WXWL 5CBAB 1Z6JT 1FV1B 4PJIE 3G6JA 4YLQT 3T4YB 4KKLC 4HWEH 3GMOB 1BVKA 3GHBL 1MCKA 1MLBA 3EYOA 4Z0BH 3V7AG 1H0DB 4B7LA 2BNRB 1U3YA 5F70A 1QEWB 3TYFA 4NIKB 3I02B 1YNLL 3GB7A 3GI8H 3QIWA 3BP5B 4OQTH 4JDZA 2Y4SA 1WBZB 3B9KB 3O41B 3S96A 3HAEH 1QFWH 4YHML 1UGNA 2P8LB 5F1NB 4BFEA 2Q3ZA 3K80A 4M61A 3WN5A 1FGNL 1U8JA 2HKFH 1F11B 1KIQA 5MI0C 4LLWA 2GYSA 4P5KA 3CK0L 3I3DA 1ZGLA 4H1LH 3T8XA 1WZMA 4OLWH 4ZQKA 1LEGA 1JNJA 1JBJA 3UZEA 1B2WL 4HT1H 1NGQL 1BM3H 1CFNA 1U58B 3SKNB 5HDQH 3NVQA 4TUOB 2AV1A 1ZHKB 4G8EA 1MJUL 2ADIA 4XPTH 3WLBB 2CKBH 1NC2B 2NXYC 5EIVA 5AG8A 2JJSC 4Y19E 2XNAB 1SEQH 4ZD3H 4MA1C 3IU3B 1WZKA 5T1MB 5AG9A 3WJJC 2VLRE 2YBRA 3HE6A 4YFLF 1T2QL 1U8KB 1JP5A 3O81A 5CJBA 3HC3H 4P4RA 4TSBH 4LU5H 3M8OH 1HHHB 3H3PH 4Z0XA 4G6KH 1WZ1L 3QDMD 5HHVH 1DVFC 3SE9L 4LCUB 4ZS6C 4IOIB 3MJ9L 4CAGA 4LGSB 2ZG3A 1AI1L 1AGFB 1IKNC 1XGYL 3PWPB 5HI4C 3C60A 4I0CC 1NFDB 4KI5E 1AIFB 1DQJB 1R3LB 4S11A 3VXQB 1KN2H 4ZXBB 1BBDH 4R26H 5IMMB 4JN1H 4UOW0 5CZXC 1UURA 3ARGA 4DKAA 2X4RA 3ZTNH 2VDQL 4OD1L 2AV7B 2DYPB 4NQDE 4QXGL 5DRZA 4NO0D 4PJFB 3PNWB 5FO8A 5HHQA 3QUKB 4CN6A 2MCG1 2FX9H 2VIRB 3T0EB 3SE3A 1EA9C 2DD8H 4U6TA 5JTWA 4JO1H 1WCQA 5C0FB 5KN5B 5IT2H 1YEFL 3S35X 3FOMB 2X4TA 4WO4C 4WRLA 4EDXA 3I9GH 1KNOB 4Y2DB 4YGVB 5IR1A 3O4LD 1J0IA 3RTQA 3U4AA 1HQRB 2Y1VA 4PJGF 4S1SH 1HI6B 3BWAB 5CJXA 4QTHB 5BO1H 5JPMA 3BXNB 4FMFA 1U8QB 3O6LH 4IJ3C 3LKPB 3WS3B 1XGUB 1HDMB 3TBYB 1YPZB 4F2MA 3MLYH 4I1NB 5IB3B 2WBWB 3NZHL 5GSRA 4JJHA 2VDOH 1AO7E 4ZUSB 5BVPL 4HWNA 3JWNC 2WK2A 1K4DB 3VH8G 2G2RA 1X5IA 2H6PA 2AK4D 4GG6B 1MIEL 3NA9H 5F72S 1QRKA 1FHGA 1XGRB 2HJKB 2ED8A 1N5AA 1BGXL 4NUGH 4X6DA 4Z7OE 5FDYA 1FJ1B 3FHQA 1ES0B 2XFXB 2DM7A 4NNPH 4X4XA 3EDDA 1GIGH 3S4SB 3R8QA 5IB1B 2C3VB 1I9JH 1FYTE 4FNLL 4YPJA 1F3JB 1A7PL 2W91A 3CUPB 3I2CL 4JHAH 4GAYA 3RWEB 3OXSA 2YXMA 5IMKB 1TQBC 1RUQL 5DJAB 2QQNH 2IMMA 4M8VA 4P9HH 5ILTL 1LK2A 3FT3B 2AABL 4L29A 1HCFX 3PIQA 4FQLH 3EHBD 2HMID 1QRNB 5KJRH 5ID0B 3K7UA 4OD3L 5J6HA 4UIKH 4U3HA 1MI5E 2MCPH 4E5XB 3GRWL 4OUUB 1AHWC 3BI9X 1A6ZA 1X5ZA 1MQ8A 3L3KA 4WW2B 2P45B 3TC9A 1OF2B 2Y07H 2APTA 4Z76A 2MSPA 4KK5D 3IDGA 1JHKL 4OZFG 4YHIB 2VDLL 2PO6D 4DAGH 5HY9B 1NFIA 3P77A 1BVLA 5GGUB 2V5SA 5K9OA 2WIIB 1UQSB 3PG2A 3TCLA 4L3AA 2RGSA 1DANU 4CMMA 4P2QE 3CC5A 2QJDA 5ESAB 2WBJA 3IJSB 4JRYB 4RIRB 2CDEB 1NCAL 2C1OA 1TNMA 5FECB 3IFOB 5GS0D 2G9HB 1J5OL 1J8HB 3PWNB 2UWEB 3O3BA 1INDH 5ISZA 4LDEB 3HN3A 4JM4H 1JI2A 1EAPB 2AJSH 3H0TA 4HIHA 3JWOL 4X6BB 4YHNA 1IGJA 4PJFF 1NEZG 5FGRA 3P0VL 1JF6A 1BWMA 1CDJA 4GRMB 4LF3B 4JRXE 3VFNB 2KUTA 1BQLL 2BC4B 1JL8A 3LKRA 1OAYH 4JG0L 4JEGB 3F7VB 4M6OH 5IFHL 4MXQD 4AH2A 5JR1L 2IQ9H 2PN5A 2CXKA 5TDOA 1JFQH 2EDXA 4ZNCD 2AXGB 4NO3B 3QUMH 4P99A 3ZSSA 2VUYA 3C2AH 4HUVA 3K2UL 1YPZF 1C08A 2C5DC 4ZFZA 3HNTL 4QT5A 4R90H 5EZIH 3SJVA 3LVEA 1HHJB 1AGDB 2GITB 4OBSA 1EDQA 4BKLA 1UXSA 3IXAA 4MMXC 2OJZL 4GRLA 1A8JH 2CKNA 2N4IA 2QHRL 4NOFA 4PRPE 3T2NL 3SQOH 4AIXA 1KLUB 1N0XL 1WAAE 4D8PA 4XRCB 3ZKMD 4WY7H 1UEYA 1BD2B 2W59A 1T7WA 3OKLB 3FKUS 5FOBA 4OFYD 4Z7NF 3U4EA 1KG0A 1ZHBA 2ITDB 4LSPL 4PP1D 3MJ7B 3GSUA 4Z7QE 3OBAA 3JVGA 3RZCB 1T3FA 2DF3A 5JMOC 2VQUA 2XXCB 3WMSA 5B39A 1RZGB 4XH2A 3D85D 2HJFB 3QZWA 2VN7A 3CJJA 3C9NA 1YMME 5FYKD 4UTBL 4EI5B 1V05A 2EIZA 5EWIL 5I16A 5JPNA 1RPQA 4ZFGH 1MH5B 1JTPA 5T3ZL 2X9XA 5I1JH 4GQ9L 4I18A 4WU5A 3CH8A 5C09A 1S7UB 4N0RA 4NKOA 1UWGH 1QO3B 3K46A 4WW2F 2NY5L 3EFDL 3O6KH 3LY6A 3I50L 1QZ1A 2GT9A 2IADB 5CD3B 1CGXA 2EC8A 3JWDH 1OAXH 1NDMB 4OCRH 4HFWA 2DWDB 2R29L 1EZVY 3ULVD 4NNYA 4JAMA 4ORGA 4FZEL 1QSFD 1NFAA 4GRWE 3ULUL 2R2BB 3NACL 4POZD 3VG0H 1SM3L 5INDA 1TJGL 4AENA 3BW9B 5B3NA 2CK0L 3UBXI 4X8XA 4FQXA 2C3GA 2W9EH 1I9IH 3WHXB 4KQ3L 3HFML 1A6VH 2Z93B 1QLRA 2BVPA 5C08B 2HJLA 3IJYB 2FR4A 3SO3B 4NHCH 1R0AL 1A6TA 2Q6WA 2UWEF 3V6OE 3NIDF 5D4QA 2VLJE 1U91A 2BNQA 4M1GH 3CMOL 4I4WB 2ATPA 2X4PB 3PDOA 2XG4A 3EFFB 4ETYA 1QFWM 5DVKA 4G8IA 5ACZB 3GUTB 4J3SA 4RISH 4IIQA 2QR0A 3EHBC 2XTLA 3MCLH 1DBJL 2HMIC 1XIWA 4FZ8L 1KN4H 5IW1B 4ODWA 5J12C 4LK4A 4X7CC 4OM1H 2DQTL 3C6LD 1QP1A 3STLA 3BZEB 1QFPA 2HT3D 1IAMA 5A2LH 1WT5A 5F8QC 4RGMC 3UJIH 1OGAD 4X5XB 1P4LB 5LGHL 4YHLH 3U0PA 1FYHB 1D5XB 4KK5C 4WHYH 5JNYB 3RVUC 3HE7C 4RZCA 2FSEB 4PJ7E 2ENSA 2PO6C 5L8LB 4J3TA 4JFXB 3U30C 5IMOA 1Z0NA 1DDHA 3DSNA 3OAUL 3QUYA 5CUSL 4KJQC 4F3FA 3MLWH 5K9JL 2NXZB 2IH3B 3NFSH 4UQ3B 2IANE 1ADQL 3L6FA 1DL7H 4RAUA 4HKXB 1FL5A 1WBYA 5E1AB 3MRGA 3B4NA 3BEVA 5FYLD 1HILB 2YOCA 4U1NA 4HUUA 4UMGA 4YFLI 5GS0C 1JYNA 1Y18B 3MV7A 3P0YL 2DQUH 4AEFA 5MP6L 3MLSL 2FATL 5DLML 4Y0GA 5GGTH 1AGCB 1WCBB 3FRPA 3LKQA 4OIIL 4XZUA 5E94A 2D7TH 2CRIA 1RMFH 2R0ZL 4XP9H 1WBXA 1MCWW 3F5WB 4HXBL 4TSCH 4Y1AA 5JHDE 3L3GB 1CZ8L 4X4YB 3TH2T 4P59L 1QD0A 4OLXL 2YRPA 1Q9KB 3CFDB 3OV6A 5F89B 4UIMA 4HK0B 3G5YA 15C8L 4MXQC 4XCNB 3ZYZA 1FFPB 4L3EE 1J9CT 1LO4L 4NYLB 2FHCA 1T5XB 4QHLA 4NO5B 5DQ9B 3WIHL 3HC4L 4G8GD 3V6FB 2MPAL 1CF8H 1DSFL 2NX5B 1KJ2A 1R3HA 2GY7B 4RAHA 1E0OB 2J4WL 3ROLA 2ZSWA 1HSBA 3QH3A 2X05A 1LHZA 5HVFB 4Y2OA 3B8YA 4ZOAA 5DI8B 5T5NF 3TIDA 4C54A 5HJ3B 1A7RH 4RFNB 5GS3A 4AQOA 4OFKA 4Y4FD 4Q6IC 4Q9QH 4WWKB 4LLDB 5GHWL 5C2BH 4G9FB 2FD6L 5GS1B 5KSVA 3EOAB 3LN5B 4MJIA 1MWAA 1OGTA 4XHQA 2YR3A 3Q6GH 5DK3A 5C0DA 1CT8B 3ZKMC 3RIFK 2XZZA 1EJ6A 4NNXA 1H3UA 5EZLA 4YX2L 2HKHL 2FB4H 3HR5A 4HPYH 4ORZC 4ODHL 4WW1B 1S7RA 4MA3B 1GHFH 1P7QD 3S98A 4YQXH 3MRJB 4CKVX 5E7BA 2A6IB 1B4JH 4O9HL 4YAQB 2VXVH 2Q76B 4FG6D 1H9VA 4JFPB 3FO0H 4UOW1 4XBGA 3QXWA 2QSVA 3EDFA 4G6AD 4L5FL 1U8NB 1F2QA 3QEQD 2UYLA 2EE3A 4P2CG 3GJFH 4PB0H 4XP1H 3VDCA 3QDHA 1FC2D 1OPGH 3OKEA 1HK6A 3DXAA 4C57C 4QRSB 5E99H 1VEOA 5F7LB 5EO9B 1GC1L 2VDMH 1V7NL 2HWZL 4R96B 2RFXA 2CO6B 2UZXB 4P4KA 4R7NA 5CGMA 2DL2A 5CWSA 2CLRB 3GIVA 4JFDE 5T1KB 5EO0B 4OGAD 4GG8A 2OMNA 5C0AB 1UFUA 3CSPA 4PG2A 5T3XE 4G7VL 1VFBA 1X5LA 4M6NL 3SGEH 3O6FD 4PB9L 4LPCA 5BRZA 4G6ML 1TCMA 4U6VH 2VDPL 1S7TA 3U7WH 5HVHC 4POZC 1IEHA 5BS0A 5E8PA 4QHUA 2VN4A 2E8ZA 4E9LA 3ULVL 4W4OA 1OP3K 4HIIA 4TVSa 5CSZB 4PJHA 4PRIE 2HLFD 2XPGB 1VACA 5SX5K 1MRFL 3P73B 1OHQA 3KHQA 1MUJB 4KTEH 3O9WA 2DWEA 4XP5L 2PCPA 4Y5VC 5CBEA 1DBKH 4GUPA 5CCKL 3VJ6A 1FORH 4OF0A 4U1MA 1YEDB 2PW2B 1T0PB 3VWKD 3NFNB 2Q87A 4FQ1L 5DA0B 1O7VA 1KPUB 5HGHA 2OR7A 4LCWA 2ORBH 1OB1B 4RGOH 2Q20A 1CLYH 3CSGA 4YDKL 4O58H 1VA9A 2J3SA 2QKIA 4XMLH 1KUMA 5ALCL 1RZIA 4HQQL 3WNMA 3HZYA 2HT3C 5E5MB 4JM2B 4JPWL 2DMBA 1MRCH 4Y19D 4U6XB 4QLRA 4ZFFA 2OZ4A 2YA0A 2P8MB 5JW3L 2VLRD 1ORQA 1H15B 2DJ4A 3MGOB 4YK4B 3MV9E 1JTOA 2XZCH 2P42B 5B8CA 1F13A 5IGXL 1GRWA 4OKVB 5SWZB 2A0LD 1UJ3C 2PXYB 3I75B 3RY6A 2BSRA 4KJYA 4NKMA 4GAFB 5D72L 4YXLH 5IHZA 4P23C 5L2JB 2DKSA 4IRSD 3MRKB 2D4FA 1FGVH 4N8VB 3GEWB 3BMWA 4O2FB 3QWRD 3AAZB 1A4KA 4KI5D 4LKXA 2P5WB 3DBXB 3QCUL 2NY2D 3BKYL 4AEEA 1ZHNA 4PJBA 4O2EB 1EV2E 3OF6A 1XFPA 1PLGL 4ODUA 4HJJL 1H3TA 3KR3H 1UUSA 1A9EA 2BCKA 1FCGA 4C56B 3OTTA 1PG7X 1CDGA 1XGQA 3K2MC 3RGVB 3HR6A 4YDLC 1S9KC 4TVPH 3ET9F 3DV6A 2VMFA 4K8RL 2IGFL 4KXZI 4LSQL 2W0KA 5A2FA 1ZANH 3CXHJ 3CZFA 3E6HA 2APWA 3SY0A 3QULA 3BD4A 3D48R 4FQCL 3WIFB 5I73B 1M7XA 3CFKB 3PWPE 2V5TA 1NFDE 1B0RB 5HHOA 4NQUA 1S5HA 2FL5B 5LAXA 1MLCB 2OQJB 4B7IA 1G1YA 2EKSA 4K3JL 4WUUB 12E8L 4Y4FC 1FVCB 5EC2B 3SO5A 4DKDC 1DBAL 1AO7D 3D2UD 5DRWA 3QAZB 3IETA 5JOFB 2XN9A 4UT7H 4ZTPL 1CK0L 2DQIH 3V4UL 5CHNA 3HUJE 2Z92B 2R2HB 4OB5L 1P1ZA 4EXPX 1S5IH 1XH3B 5D1XA 1A1OB 4Z7VA 4RRPG 3WV0A 4NKDB 1ND0B 1JNLL 4DZBB 4R0LC 4LVOC 1EZVX 4LPXA 2CJUL 5CZVH 5L88H 5EB9A 3BKMH 4QYOB 1QHPA 2F5AH 5EUKB 5KSBE 3HI5H 25C8H 3H7BB 5C7XL 5ANMB 1S7WB 4ZDHA 3MO1A 4NQEB 4PYGA 3O3EB 4FG6C 3O8XD 1FYTD 1FFRA 2F5BL 4PJ5A 5DD1H 1FNGB 5HVGB 5IFAH 3BYYA 5L2KB 3IDJB 5EBMA 3F7QA 5D6CB 5EU6B 2WQRA 4G6AC 4H20L 2A73A 4Y5YA 1L7IH 2Y36H 3FZUD 1UCBH 1ONQB 4GG6E 5DXWA 5FYKU 2DQFA 1WUNT 3F7YB 4MZ2A 3CFCL 4GW5A 4GXVH 3WIIH 1RJYB 1D9KA 1MI5D 3G5XA 4G6FB 4JM2F 3IDMB 4WNQA 5TPWL 1JV5A 1EGJL 1XCTB 5C1MB 5TE4L 1JWMA 2YUZA 5KW9H 1H3XA 4U4BA 4LP4A 4OGAC 4KROB 4NHUB 3V4PH 1RZJC 1YEEH 3ESVF 3O6FC 4WJ5A 3U6RA 4J3VA 4J3UA 2R2EA 1WWAX 3LIZH 2F53A 1JWSA 2Y6SD 1TETH 3ZE1F 4TQEL 1P4IL 2SEBB 3OKKA 1I9EA 4K7PL 4PJ9A 5IM7A 5AYUL 2HLFC 2N1KA 3R06B 4DUWA 4P2QD 2VSDA 4GOSA 1Z3GL 43CAB 4OAWB 1R24A 5DVMA 3S34H 3OJDB 1ACYL 1T21B 1PY4A 2YUVA 4TPRL 1CGSL 5BMFL 2BVEA 7CGTA 4GJTB 2VXUH 3L5HA 1BFOA 2BVOA 5D70L 5DO2C 3ARBB 3MRIB 5I1CL 4OTXH 5FHBL 2MHAB 3G04B 4H26A 2V2XA 5HYSB 3DRTB 3BDBA 5DD0L 1G9ML 4IRJA 5FA4B 4FMKA 5GZOD 5HDOA 3VD4A 2IF7A 3RWGA 4LCIL 2BFVL 4X7FC 4N0UA 5EUOB 5AZEH 1CR9H 1FH5L 4NN7B 5DFVD 1G7IA 4JRXD 5D7LA 2P5EA 4TRPL 1N64L 4NWUH 1HQ4A 3VGBA 4ETQB 3L95B 3UC0H 3MLVH 4P2OA 1NCTA 2EE9A 3FO1A 3IDNB 1XCQB 4Z95H 5KVEL 3CFJA 1SJVA 5I76A 1DANT 1UXWB 5I18L 3SQBA 1JZ2A 3LD8C 3MYZA 4Z78A 1J8HE 1BJMA 1GVIA 3O45B 1JIBA 5E8NA 1G9NH 5HI3D 3NIDE 4KRPB 1MAML 2OTWA 1NMBH 2IPUG 2F8XC 1CE6B 1TIUA 4NC1E 3VD7A 1RZKC 2A0LC 5DJ0A 4IMKC 4A6YA 1S7XA 2ICWJ 3MRFB 4F8QA 4Z6AT 4LSTL 4PRPD 4IRSC 5F1KC 3CDYA 1NGWA 1NBZA 2H32A 3OKDB 1OAUL 3UO1L 4B53A 1AKJD 2O5ZL 1TVBB 1S9VB 3CVHB 1CLZL 3BZFB 1Y0LA 1GGTA 5ERWB 2NY2C 1CFVH 1QG3A 3PF2A 4UB0L 1CVSC 2BSTB 5GGSB 2FGWL 4TUKH 1RK0A 3O2WH 3WFHB 3LZFH 4RX4A 3S37X 1S78D 4LLVB 5C0BB 3FQWA 5JW4M 3HNSH 2YD3A 1GXEA 4WV1B 3MPCA 5DS8A 4ELKB 3ZT5A 1DE4A 1IQWH 5D7JB 4BH8B 1MCOL 2MFNA 4OCYH 4YHYB 3O3DB 4CVXB 1YMMD 2GHWB 1AR1C 1HEZB 3Q1SH 4Y4KB 4KAQL 2ADJA 3SKOB 1NPUA 4WTWA 5IB5B 4ONOA 1PKQB 3VWJB 2JJSA 1FC1A 4EUPB 2IBGA 1NAMA 3GSXB 1FLTX 2J5LB 3WJJA 4PJDB 2PYFB 5CP3A 3QDJA 4YC2C 4WHTB 4U0RC 5IB2A 1Q94B 4KUCD 4POUB 3PDDA 1MHHA 3MRCA 1A7NL 1N6QL 2OYPA 1SBSH 2HP4A 1N5YL 1T03H 1DVFA 4JPKH 5EH1A 1JNHA 4NGHH 3KYKH 1LO5B 1D3CA 2XTJE 3IAQA 3LQAC 5J8OA 1IKNA 3GHBH 3MMEA 4BSVB 4D0BB 2CR3A 1FNFA 1M7DB 1U8MA 4MB4A 4YDVA 5JZ7D 5DHVH 4GH7B 4OZGA 3G6JE 1A4JA 4HAGA 1LQSR 2GFBB 1YNLH 2YKLL 3MRRA 3UBXG 2ADGB 5EO1A 5GGRB 5E9DA 5GSVA 4YHMH 4KRLB 1LO3L 1B6DA 2VLJD 3CX5K 3FZUC 3DIFB 2BP3A 1FGNH 2IFFL 4WO4A 1GSMA 2DQHH 3B5HA 4MA7L 3CK0H 1HE7A 5EUOF 3D18B 1ETZB 4WFGE 3BIKA 4X83A 5ETUA 1B2WH 5BXFA 1NCDL 1NGQH 2YA1A 2EEAA 3D25A 4F7PB 2VR9A 4M7KH 3QO0A 1EMTH 3EDEA 2XWBA 5C08E 3CDFA 4GKOA 5DYOB 2VWEE 2AJUL 3DVFA 3WEXA 2ZZUT 4X98B 3W39B 4MJ6A 2Z8RA 2Y6SC 5ID1A 1JZ5A 2JCCF 2FJGA 4J4PD 1NLDL 3SEPA 2OLDA 1RIHH 3IRZA 5ESVA 2E8YA 4FP8L 2WQ8A 1WZ1H 2CIKA 4HZAA 5IESL 3IFPB 1ZHLA 1JZ3A 1I4FB 2IAND 3TN0D 4CJ0A 4KMLB 3SE9H 1K85A 1QSVA 1K6QL 2YD8A 3ARDD 3MJ9H 4P5MB 4YO0A 4HDIA 4YXHH 4OV5B 1U8PB 4JZOA 1F42A 1XGYH 4X4MA 1KJVB 2DLGA 1PAMA 4NKIL 2CUMA 4RNRA 3RRQA 1QFUL 3OGCA 5DJCB 5HPOA 1W72A 3E1F1 5AUMB 5GZOC 3DUHA 2A2QT 2GTWB 2VDNH 1QQDA 4YDJA 2DBLL 3FB6A 3L3OB 2VDQH 4ZUVB 4OD1H 5JHDD 5DFVC 2VABA 4QXGH 4HJGB 1A2YA 4WU7B 3TZVB 5ITBH 2NTFB 3GNML 3EDJA 1KB5A 2FECL 3HA0A 1AHWA 4L3ED 3OKMB 4AT6B 1IT9H 4ONFH 4PJDF 2EDDA 1T04B 3PJSA 4UU9A 5H94B 1EFXB 5EG6C 1QLFA 5HI3C 1M05B 5IG7B 2X4UB 3ILPB 5C6TH 5CP7B 5HDBE 1BVZA 1KIRA 2AJ3B 4UNTA 2HG5A 1LP9A 1C16B 4GMSL 3NZHH 4GRWH 2AJXH 4JZNA 3BHBB 4AMKL 2W9DL 1YECH 4M7JL 3P2TA 5H35A 3G5VB 1MIEH 3LDBC 4YHOL 3ZDXE 4OFIA 3QFJB 4PJCA 2ZUUA 4KMQA 1BGXH 4JFHE 2NX5E 2EDHA 1S78C 1U8LA 1YDPA 3GSNL 5I9QC 2FLBT 4KKNA 4PYHA 5KSAD 4DGYL 3BFOA 4G9DA 3HTLX 3SCMD 1W8OA 5I15L 2VDRH 1H5BC 4FNLH 3I2CH 1A7PH 4G9FE 3WLWC 4Q6YA 1FFOB 3V9FA 1RAMA 1DP0A 4X9HA 1NDGA 3W9DB 1P7KA 1RUQH 1N59B 2F19L 2HLAA 2JB5L 3MNZA 2VLLB 2YPVL 3TEUA 4X6CB 2MKWA 5ILTH 2AABH 3QEHB 3BQUD 1AXSB 1T1ZB 3OL2A 3BMVA 3BP6B 4OF7A 1MPAL 4IS6A 1B88A 1OQXA 5K9QI 3NFPA 2JELL 3K74B 4LPVA 4RMTA 3HNVL 3GRWH 3QDMA 4JFDD 3MRNB 3KVQA 5IIEA 4BZ2L 5MERB 5T3XD 1YN7A 3H2WA 4HEPG 2E9BA 4PTUB 5TQ0L 4CW1A 3QQ4A 1JHKH 4C4KO 4KRNA 2VDLH 4V2BA 5JZ7C 1LEKB 5GGQL 4PRID 1GYAA 3BUTA 5JLZA 1RZFL 2VQ1A 3UTZA 3KJ6L 1B4RA 2D7MA 3WDJA 4F7MB 5FCUL 2WWKO 2D7QA 1VEPA 6FABL 1NCAH 3HS0B 3C5ZB 4X6EB 1ZA6B 1CYGA 3PGDA 3VXOB 2VKXA 1T20B 1FO0B 4L9LC 3LPWA 3GJEA 4I48B 5EIIB 2D0FA 1SJEB 2WNGA 1SJHA 3EKCA 3IDXL 5HYEA 5IHLB 2BNRD 2X1WL 4HWBA 3MRHA 4PGCB 3DLQR 5D5MB 3W2DL 1E6JL 3MXVL 1IZKA 5ISZE 2FECI 4K7FB 4C55A 2ED7A 1MCNA 3QUMA 1BQLH 4M9OA 4ZAKB 2CLZA 4JG0H 4LRNH 4DEPC 3FTGB 3OQ3B 5DFWH 2X7LA 4M93C 5IFHH 5BJTB 5JR1H 5ACLA 5JO5B 4D94A 2CDFB 3EGSB 2AK4A 3LKSB 4JFYB 2GSIA 3MV9D 1MQKL 1FNAA 5EBLA 1LE5B 4M8QA 3K2UH 3RIFF 5IBTL 3HNTH 4F15B 3TH4T 1G0DA 1KPVB 2FCBA 3ARDC 2X4OB 1BFSA 2OJZH 1YY8B 1I8LC 3C5JA 2Q86B 2QHRH 3T2NH 3CDCA 1T7XA 3QNZB 2JB6A 1N0XH 4PREA 4M62L 4ZFOL 4F58L 3GJFK 4DVBA 4FQIL 3ARSA 1NQBA 1FG9C 3P9LB 1VGKB 4LSPH 3UTSE 5K9KA 1IC1A 2H3NB 5E6IC 4RMVA 3WO4B 4BQBA 9CGTA 4NQXB 4DKFL 3QXUA 3W82A 1TZIB 2NY6D 4JFEB 3VXSB 1TPXB 4X6CF 4UTBH 1LVEA 3PWPD 4OZIB 3S6CA 2OBGA 3C09C 3S4SG 4ZXBD 1HSAB 3CU1A 2FO4B 3WHE1 3HE7A 3V0WL 5T3ZH 1QR1A 1UWXH 2PO6A 3BYTA 2IJ0C 4Z7WB 5I66B 3VH8A 3TESA 3FQXA 3VFVA 2YUWA 3OXRB 2H9GB 3LN4A 2NY5H 3EFDH 4GMTL 3I50H 3K8MA 4GAGL 5C09E 4H1LB 3I6KB 2R29H 1JMXA 2YSSB 1I3RB 4BSWA 4F80A 3ULUH 4Y2DD 3NACH 3VXPA 1SM3H 4TNVK 4WEBH 4JZJB 1TJGH 4DGVL 5MEOA 4K3HA 1I8KA 2CK0H 5KANI 5EOCL 5KSAC 1CFQA 3MOAL 4HK3N 2CKBB 4KQ3H 4RBPK 4HIXL 3SCMC 3U7YL 1G7QA 4EN3B 4HUKB 2EYRB 1SMAA 5CEYA 1Q9OB 4O2CB 1X44A 1IGTB 1NUGA 3RWIB 3PQYE 4RFOL 3CCHA 3CMOH 3QQ3B 5IF0B 1NCCL 3P4MA 1LEIB 1IGMH 1Z9MA 3BD5A 4FFZH 5FO9B 3BQUC 2BNQE 5I1DA 1DBJH 2IQAA 4FZ8H 2PKDA 2R1XA 3FB5A 1CDUA 4OZFA 4LGRB 3U9UA 3U79A 1PEWA 4Q6IA 1V3KA 4J6RL 4B0MM 5L2KE 5LGHH 5EU6E 1KXVC 1QNZL 2Y7QB 4R4NC 3LRSA 3MUJA 4TULL 4LHJB 1A7OL 5DZLA 1OM3L 1EO5A 3LRHA 3MJ8A 8CGTA 4ZODA 4QTIL 1T22A 3GKZA 3ARPA 4JY4A 4XNUL 5TJWK 3GB7B 3QIWB 3VMNA 4NO2B 2QSCL 4NN6B 3OAUH 4OFYA 5CUSH 5IVNA 2PR4L 4Y5XB 1IQDB 5K9JH 3ZE2F 1ZT4B 1FL3A 3KNBA 5T1LB 1V3JA 4LSDA 5F9WB 1MFNA 4AM0B 1NCUA 4OCWH 1AJ7L 1ADQH 4B41A 4MZ3A 1PQZB 4ZO9A 1XGPA 4X7EC 4EZMA 4HS3B 1P5UA 3D85A 4EI6A 1NEZA 5TDPA 1ZGLB 4E41B 2LU3A 3P0YH 5MP6H 3MLSH 2FATH 5DLMH 2BDNL 3HZMA 3MLPA 1XZ0B 2FZ3B 4OIIH 1CFNB 3L3DA 2R0ZH 1G6VK 3UYPA 4PRDA 1P2CA 3QNXA 2WW8A 3HPLA 5DJ6A 4FQJL 4HXBH 5BW7C 2X4NA 3LEYH 1CS6A 3O2DL 1T4KA 5J9PA 3B6SB 2ARJB 4P59H 4JG1L 3B9KC 4OLXH 4OZIF 1ORSA 4OLZH 3H3KA 2ZJSL 15C8H 5IFJA 2EH7H 4HUMB 1LO4H 1FNLA 1EH9A 3PHOA 3HC4H 2GQHA 1J8HD 1FFQA 1QSFA 2MPAH 4P4RB 4MNGA 4PY8J 1DSFH 3DROA 3MLTA 4MNQB 5C0EB 2J4WH 3AXLB 3QEGL 3MV11 2G5BA 1OAQL 1HZHL 4O4YL 4F7CB 1TVHA 3X13B 4AEIL 3IF1B 3OG4B 2E9JA 3AMKA 3N85L 4OCMC 2FD6H 3E8UL 2GY5A 5D7SH 4Y5VA 1CFTA 3S35L 1C5DB 1ZWIA 1MREL 4MQXD 2A6JA 4QXTA 3V0VB 3U0TA 2YEZA 5FGBC 2Q8AH 3U2SB 4NPYA 4MJIE 4S2SA 3ARGB 3HLAB 4GQPH 3TBVA 5DD3L 1WIUA 4YX2H 5T5NG 2HKHH 1C1EL 3GSQB 5B4MD 2F9BT 4ODHH 2WLZA 4P2RA 5FO7B 2BVQA 3AS3A 4U1KB 4QRRA 3BAEL 4O9HH 2UZIL 2BHUA 2J7LA 4M48H 3LHPL 3IDIA 3N9GL 4R9HA 2V2TA 3U82B 2NY6C 4DGIH 3DETD 3CNKA 4L5FH 4PLKD 5IR1B 1ZEAL 2DQCL 1OGAA 2EICA 4X0KB 3QXTA 2A9NL 4ZXBC 4KXZH 3MNVA 2VITB 1Z9LA 5IEHB 3EO1B 4ALAL 1QTYT 1AFVL 5F88A 4DOHE 1O0VA 4OT1L 1KTKE 4U6HA 3UAJC 4F2MB 5GRJH 5C0BE 1GC1H 2GUOB 2ENYA 2HWZH 4UZGA 1UJ3A 3DXAE 3RZCD 5ECJE 2H6PB 2XTJD 4NN5B 1JGDB 4P23A 1Q9LB 4I2XA 4RGNB 3V8CA 4LSRL 5GS2H 4PRHB 4UDUA 2JTDA 4G7VH 4M6NH 2CMRL 4NJAL 3REVB 4PB9H 3DX7A 3TWCL 4EI5D 4G6MH 4MDIA 3OR6B 4RMQA 3DMMA 1N5AB 4Y2DC 4W70A 3MODL 1PKQE 35C8L 1AGBA 5FK9A 5C0ND 3QA3B 4XCFL 3X17A 1D7FA 3I3BA 2ZUTA 4G8FB 1MRFH 3BOVA 3ZDZE 4U33A 2FWOA 4JQVC 4YGAB 3KLHD 2JK5A 4XP5H 3LN9A 3OXSB 4HUWA 3VXTB 5CCKH 1GZQB 1N2RB 1F8TL 2A74B 3SE8L 2XKNA 1K8DB 1E4KC 1RY7B 2CSPA 1C5CL 4FQ1H 1IZJA 3PIQB 1IBGL 3ME0A 4NSKA 4G8GA 4WFGD 5D7IA 5J6HB 4L8DB 4LLUA 2LU4A 4YDKH 2BMKA 1VGEH 4AIZB 5DEFA 4HQQH 4LCWE 4Y4FA 4M1DL 1S7VA 5C08D 4CDHA 3HMXA 4JPWH 2R8SL 4Z76B 1PSKL 4ZUWB 3IDGB 8FABA 1KELL 2OJEB 3RL1A 5JW3H 3L5XL 3FQTA 1BVLB 1DQLL 3OJVC 1GJIA 4M03A 4R0LA 3TCLB 3T1FA 4PP2A 4KKAD 5FM5M 4HIEA 4JFQB 5FKAB 4GW4A 5LBSL 3VRIB 3C6SA 4ZSOA 4HBCH 1P7QA 4OSUL 2PTTA 4PJEA 4BSJA 4ZO8A 3U46A 2C1OB 5D72H 3GM8A 3CVIL 2HFGL 2KBGA 2ZWLT 3O2VL 4PD4J 4WW2C 4JPVL 4KZDL 3WJLC 5TFSL 3QCUH 5FB8B 2BRRL 3U9PL 3QEQA 3BKYH 3BH9A 4FTVA 2P8PA 4HIHB 4XVTL 3C60D 5HVWA 4S0SD 1PLGH 4NJ9H 3GSVB 4HJJH 5DJYB 3DHJA 1ZE3C 1SYSB 2Q7YA 2VKWA 3DO3A 4ZUUB 5TH2B 2NXZD 3M17B 4XBPA 4EIGB 2VR4A 4OF3A 4BH7A 3PP3H 4P2YA 2QQLL 2V7NA 1JUFB 4XNYL 1RU9L 4L8CB 1FSKB 5HHME 1K8IB 4LSQH 4K8RH 1N8ZB 4ZTOL 1Q9WB 3WCYA 3MA7B 3LKNA 2D0HA 1F3DJ 4PJIA 4HH9A 4FQCH 4WI8A 3O6FA 43C9A 4HUVB 1YNKH 4XCYB 2XKUA 1IGCL 1UM5L 3L7EA 2O5XL 4Z18A 2YPLE 1A0QL 4L3CA 2VL5A 3MBEB 4NC1C 1X6LA 3VFGL 2OTUB 4K3JH 2Y72A 3IXAB 2MKLC 3PUCA 12E8H 4XXDB 1SYVA 3HPJA 1OD9A 3QG6A 5I1KH 1BECA 2XQYG 3H9HB 4MGXA 3UJJL 4MCYA 1CK0H 1F3RB 1INQB 1PX3A 4CADB 3V4UH 2F54E 4X6DF 3IXTA 3SDAB 1IRAY 4OB5H 3FQNA 3Q3GA 4PGEA 4V1DB 5E00A 2IPKB 4JFHD 2CJUH 2NX5D 3U4EB 1KG0B 4OQ1A 3JSSA 3OZ9L 5B4MC 4XVJH 3CLEL 4Z7VE 5C7XH 4JR9H 4M3KB 1CBVL 2XWJA 4XX1E 1VESA 3T0BA 3QDGB 4WWKD 4G9FD 4HEME 3X3FL 5DC0A 3QNYB 2BNUA 2Z31B 1A14L 3DETC 4PLKC 3FRUB 1AGEB 4IDLA 3FT2A 2B4CL 4Y19A 5I1EL 3RAJL 3V5HA 4PJ5E 5I16B 5JPNB 3B5GA 5FYJE 5I8EB 4K8RC 2OL3B 3ZMRA 4N9GA 4P3DA 2MOVA 4NKOB 3QQNA 4CVUA 2UY6A 5EPMA 4DN3L 5TPWH 3X14A 5E08L 2AGJL 1EGJH 4HUXA 2GT9B 5EU5A 4I3RH 5TE4H 4IMKA 5K9QG 3CFBB 3RZCC 4HFWB 2XTJC 5IW3A 3U0WL 4JAMB 2AXFA 4IRSA 2BJML 1EX0A 4EI5C 1KOAA 2WLYA 3QWRA 3FB8B 3GMQB 5FV2A 5JW5A 3WL9B 5C0NC 1P4IH 3B9AA 2ZCKL 1G6RA 3O11B 3QISA 1CVRA 5HPMA 2FO1A 3PABB 4I0PB 2O61B 4ZPTA 4JB9L 1CD9B 4JPIB 2HJLB 2X6MA 1MCHA 1Z3GH 2Y06L 3C8DA 3KLHC 4G3YL 1FZJB 2PTUA 1ACYH 5BMFH 1U91B 1YEIL 4TPRH 1CGSH 3NBNA 2ZUQB 4OGZA 1RVFL 4P46B 4YR6B 4LBEA 4HFUL 5J56B 4MVBD 2FRGP 4ONHB 5D70H 2XKSA 3QCTL 4PLOB 4S1QL 3QXDB 5GRVK 5I1CH 1JJUA 3BGFB 5FHBH 4ZPVB 1AD0B 1AXIB 2XOTA 3I85A 2QR0B 4H25A 4OLYL 5DD0H 3L3HA 1G9MH 4R4BA 4JN2A 3TA3B 4LCIH 2AI0L 5ISZD 2BFVH 2DLTA 3V52L 1X5KA 4CL7A 3EO9L 1XF3A 3KS0H 1EK3A 4N8VG 4DW2L 5IWLC 1FH5H 5JORA 4NP4L 1FVDB 1IVLA 2X4QA 1N64H 5L6YL 5B38A 4J1UA 4M02A 3U0PB 3SO3C 3KPOA 3VRJA 2VWEC 1AO7A 3D2UA 4ZS7L 1YN6A 4LVHB 3NIGF 4U1IB 4MXWL 3WS6C 2E6PA 4RZCB 3HZKA 4QRUA 3BO8B 1PYWA 3G5ZA 5I18H 1TJHL 3O6MH 5JHLL 3NGBB 5FOJA 3EJZD 4X7TA 1MAMH 4KKAC 3GMRA 4DN4L 5GRUL 5D5ME 3ZYIA 2VE6B 2DLFL 5EU3B 2LAAA 1WBYB 4LSTH 2I07B 5JXAL 1T0MA 4X8JA 1FYTA 2RIKA 3GJFB 4U1NB 4HUUB 3DI3B 1OAUH 3IVKB 3MV7B 3UO1H 3ARED 2O5ZH 2D2OA 4GRLD 1CLZH 3GMNB 4F7TA 4X80H 4W6XB 4XZUB 2QADD 4UB0H 3VG9B 3OG6B 2FGWH 5GIRA 1UEMA 2X41A 2ZKHL 3VXRB 2R4SL 3GMMB 4NQCB 1NGZA 3UTSD 5AAWA 3REWA 4J8RA 2YD1A 3LEXA 2NXZC 1XR8B 5IVXE 3LRGA 3BRDA 3FFCB 4OCNC 4UIMB 2AJVL 1HXMA 4WEUD 1A6UL 5IK3A 5LG1A 5E8DL 5I1GL 4U1GB 1R3HB 3AUVA 1JGVL 3UP1A 2AJZA 3QH3B 4OD2A 1KCRL 2JJTC 5FHAL 1W8NA 4IMLA 4PRBA 1HNFA 1D6VL 2F74A 1FAKT 5FV1L 1UZ6F 5DWUH 5FA3B 3PWVA 1A7NH 1N6QH 1VADB 3TBSA 4RRPA 3MROA 2NY0B 4P2QA 1N5YH 1MJ8L 4R7DA 2X70A 5DHVA 4XMKL 5C09D 2WUCL 5KAQG 2EIDA 4JO2L 3OB8A 3MFFA 3D0LA 4L4TE 2Z9TA 3LSOA 3VXSE 4JFEE 5F1SA 5SX4I 1S7QA 1LK3H 4OZIE 2VLME 1LNUA 3WFCL 2Z91B 4I5BA 5EA0L 1M7IB 4LQFL 4X4ZA 2P24A 3WKML 2YKLH 4XBGB 4RFNC 5KANG 4Z7WE 4FQ2L 5EIQA 5BQ7A 2ZOKA 4OZGE 4FQXD 1D5BA 4WWKC 5JDSB 5GS1C 2Q8BL 1I7TA 3G6AA 2EDNA 1LO3H 4HGWA 2UYLB 3PQYD 2NY4B 4PJAE 2K7QA 4YE4H 1ZOXA 2IFFH 1PGRB 2GK0A 4MA7H 1FZMA 1HN1A 4DCQA 2XYCA 4QCIA 1H8NA 2BNQD 1F4HA 3KXFB 4NRYA 2RFXB 1NCDH 4C83B 5I8KH 1BREA 3GIVB 1K2DA 3N1GC 2VXQL 1XIWD 3UPCA 1DEEA 2XY2A 5DD6A 5L2KD 5HYSG 3BDXA 1G7LB 4PRPA 5EU6D 1JHLL 1X4ZA 3MLRL 5J1AA 1GL4B 4QGYA 2AJUH 2OSLB 1WAAA 2DL9A 1TFHA 4UDTB 5CJQL 4HIIB 5A16B 1MJJB 4XB7A 32C2A 4U2YA 3RA7H 5IW6B 5DR5L 1NLDH 4NQVB 4MCZA 2YD7A 2EDOA 4FP8H 5E8OB 5IESH 4JY5L 1KTLB 3ISWA 5DDHA 1K6QH 2GJ6B 3VFRA 4IBLT 3EYVB 2CXGA 5BZWB 2BY1A 1H5BA 1LILA 5BV7B 4MVBC 1EBPA 4GKZB 2ERJB 4D2NA 1U8HB 4IM8A 1QFUH 3QIBB 4JO4H 3UTTB 1PFCA 3CAFA 2QKIB 4L8SB 1ZKAA 2DBLH 1KYOJ 1RFDL 1UWXK 5DHYA 5I17B 4OZHB 3P11L 4PV9A 3Q2CA 4LNVA 5JUEL 1UYWL 4NZTL 4CU7A 3GNMH 4LOUD 4ZFFB 2AEIT 4HX1B 4YHPA 5DTFA 4P57B 1FRGL 5J3HD 3RNQB 3TNMA 1X5AA 3MACL 1W2KT 3FQUB 2A38A 1YYML 1YNTA 2OK0L 1A22B 3EJZC 4XGZA 3BVNA 3LQZA 4TNVF 4NKMB 3K8KA 3SGKC 5DJDA 5MEPA 5L8JB 5B3JE 4NKQB 4EUPG 2E9IA 3T77A 3QWOB 1XF2A 4AMKH 3AREC 5EOTA 3D3VA 2W9DH 2VLJA 1AQDB 1FAIL 2EIBA 4MJID 5IMLB 1EEYA 4KPHL 4UINH 4YHOH 4L9LA 1IAOA 2PYEB 4S10A 4ODUB 1T0NA 5I1AA 2Y5EA 3RVXD 1UKTA 4LNRA 4YK4C 4KV5F 1KCSL 4ZYKA 4MNQE 4WHDA 2ZNXA 3GSNH 4HIJA 3QUXB 3UXFA 4DGYH 1AQKH 2PXYC 4ELMB 4K7PX 1MF2H 1BZ7A 4H0GA 5I15H 3BPCA 3E6HB 1PZ5B 3U36B 5MEQA 3QULB 2BERA 1S8DA 4FXGA 4J7RA 3VXNA 1AC6A 2F19H 5HHOB 1A3LL 4K94H 5F21B 2JB5H 2E7LC 1UM4L 3U7AA 4QHNB 4PJ7A 1QLEL 3EJYD 4N9OB 1IGFL 3TNNB 4S1DD 2PW1B 3RDTB 4JCMA 1ZT7B 3VI3E 2R23A 1QHOA 5C0BD 1T1YA 3EAKA 1MPAH 3P4LA 3KPQB 1HHKA 4HHAA 2JELH 1DZBA 1RZ8A 3DXAD 1U0QA 4X7SH 3HNVH 3UPRA 1M6OB 2A6DA 5D7JD 3ARDA 3BN9D 1MCPL 3FMGL 2V7HA 4QEGA 3T65A 3SDXB 3CFEA 4BZ2H 1XF5A 3ZE0F 1I8LA 4YEFA 1WGOA 4KMTL 4MD5A 4PJHF 4O51A 4Y4KD 3UTQB 2FJFA 3QDME 5TQ0H 4GBXB 5IQ7L 5DVNA 2GJZB 3PV6A 2HH0L 3IRPX 3UBXA 3DUSB 3VWJD 2H8PA 3L3JB 2VR5A 4NT6B 4TSAL 4MD0B 2YD2A 5IEKB 2A9ML 5GGQH 4EEEA 5BOPA 3MO1B 1NC4A 3QI9B 3CH1A 1GH7A 2ESVA 3ARYA 3KJ6H 3K0WA 2QEJA 5FCUH 2D31A 1U3ZA 5E6IA 3GBNH 5C9JA 5HYFA 1R3JB 3QAZC 2XWTB 3O9WD 5EZJA 3JBG7 4RGNE 5INCB 4GW1A 1KF9B 4PRHE 1U92B 1NH6A 4QGTA 1WEJL 3KLAA 3IDXH 4Z8FL 3BEWA 4OZHF 3T0WA 2DJUA 4GKNA 3KPSB 1YEGL 4K94C 4WNQB 3W2DH 3MXVH 1OD7A 4OKDA 4MHHI 3U4BL 3VMPA 3VXMB 4YFEA 5TE6L 1YEJL 3M07A 4XC3H 4RFEB 4K2UH 5I8CB 2KZ1B 1HYSD 4FQHA 3QO1A 3U6RB 1DBBL 2M8XA 1ZLSL 2XI9A 2NY3B 1MRDL 5KVFH 5DJXB 2I27N 3VGFA 3B2VL 4DTGL 2DIBA 1KENL 4RWHA 1HIMH 1DN0A 3MRBA 3TPUA 3MR9B 4GS7B 5IBTH 1BX2B 4MJ5A 2YPKA 2W0FA 4LAQL 3VA6A 4KRMB 2AAVA 3FO9A 4K23L 5KSAA 5JIIA 4NQSA 5FEBA 3DO7A 3NA4A 1F58H 2D3VA 3IKCA 3QEUB 4JLRA 3SCMA 4PJBF 2R9HD 3A6BL 4OI9A 2GAZA 5IV2A 2V2XB 3BUYA 4XX1G 4D0CA 3W9EB 1NCWL 3KYMA 3TO4D 4KJWD 5KOVC 1DQQB 4M62H 4NUJB 4F58H 3CXDL 1K3IA 4FQIH 5FF6B 3GMLA 4ELMF 4NWTL 2OP4H 3BQUA 4NRZA 2EXWD 1KTDA 4RA0C 5D7LB 5DUMH 3KYOB 4HG4J 2YWYA 3VRLE 1JTTA 5E2WL 4QOKB 2MNUA 4LOUC 5HHMD 3WFEL 4G80B 4LGPB 5F3HA 1DTUA 4JFDA 2J6EA 4DKFH 3F7PC 3GGWB 3CFJB 5CIPB 4DK6A 5J3HC 5IB4A 4Z78B 1IGYB 5L9DL 5E8NB 3ARBC 5M95B 2YPLD 3V0WH 3S37L 3VFOB 5DJ0B 4LMQI 2EH8L 4PRIA 5D2NB 4NN7C 4QRTA 2VDKL 3ALWA 3VI4F 1Q8MA 2H32B 4PJGA 4PV8A 3MTRA 4GMTH 1KJ2L 4GAGH 1F4YL 2F54D 4K3EL 3OX8A 5E2JA 2YD6A 2VQTA 3QHFL 2I5YL 2L0DA 1IAIL 5CBAA 2J8UB 1FV1A 3T4YA 4BFIB 3GMOA 3RVXC 4IOFC 1EFXD 4DGVH 1H0DA 2BNRA 1MWAL 3GMPB 4DUXA 5EOCH 3MOAH 1VPOL 4ENED 4QWWD 5A2KH 1YEHL 4XT1C 1IGIL 2H45A 4HIXH 5BW7A 5F93C 3BP5A 1WBZA 1JGUL 2NXYB 4M43L 3B9KA 3O41A 1FNEB 2V9TA 2GCYB 4RMRA 4PJ5D 2OCFD 4K9EL 4MA1B 1NAMB 5FYJD 1Z9OA 5F1NA 3KPLB 1VEMA 2W9LA 1NCCH 4HMCA 5JW4N 4V1DE 1F11A 4UNUA 4S1DC 2HRPL 3MV9A 4BM7A 2NW2B 4NC2B 3ZDYE 4DWHA 4MS8D 2EYSB 4WV1C 2FYYB 4HK3J 3QRGL 3J8F7 4ZOEA 1NANI 1JPSH 5CKGA 3VFWB 4NRXB 5D7JC 3BN9C 1ZSDB 3N1QC 1CDBA 1MY7A 3QDGE 1ZHKA 4ZMAT 4MAUL 3QR2A 4YHYC 3P4OB 1R5IB 1QNZH 4Y4KC 1NC2A 2WWMD 5DGQA 3RIAK 4YDVB 3VWJC 5EZOL 1R6VA 1A7OH 1ADQA 1T2XA 1OM3H 4R4FH 2J5LC 5FGBA 1A4JB 5CEZL 5T1MA 4QTIH 4XNUH 5FGCB 4AJ0A 3EUUA 5DMYA 1U8KA 2PR4H 2CQVA 4LASL 1HHHA 4MJ4A 5GSVB 1AJ7H 3NOIA 4LCUA 3OJMB 3PP3K 5M7QA 4PY7B 4IOIA 3GIZL 1E4WL 1PZUB 1RULL 3MV8B 1AGFA 3PE9A 4XNXL 3PWPA 3RJQB 2BDNH 1OSZB 1NFDA 2JJVA 1AIFA 2BZDA 1DQJA 3VXQA 4ZXBA 1BQUA 4I13B 3OSKA 5AAMA 5IMMA 5HYQB 1PBYA 2QQKL 1J05B 1CICB 4FQJH 1TCRB 3O2DH 5BV7L 2GTZB 4LEOA 2AV7A 3SPVB 4JG1H 3EYUL 4XP4H 4PJFA 3MBXL 3PNWA 3QUKA 3WEXB 4MXVF 2ZJSH 3HUJA 4MAYB 2VIRA 4PJXB 5ID1B 1NUNB 5KN5A 4WI2A 2AEWA 3FOMA 3L5WB 1U2CA 4EOWL 1KNOA 4Y2DA 4YGVA 5ESVB 3D5OF 1T1WB 5KSBA 1HQRA 3QEGH 2EO1A 3V8OA 1OAQH 2Y5TB 1HZHH 3O3UN 5IHUL 1HI6A 2R0LL 3BWAA 4MNGE 4QTHA 5KVDL 2OZ4L 4AEIH 3BXNA 2CGRL 5I8OL 1JE6A 3N85H 1F00I 4HW6A 3LKPA 3WS3A 1XGUA 3E8UH 4JQVA 1HDMA 3TBYA 4ZAKD 5IB3A 3HG1B 1AH1A 3S35H 1MREH 3DX9B 4XNMB 4ZUSA 3HAEG 3HRPA 3BP7B 3H9SB 3TO4C 1K4DA 4KJWC 2W65B 1W72B 2F15A 4GG6A 1E4KA 4PGBB 4AL8L 5DD3H 1JYXA 3ECBA 1C1EH 2ZCLL 4Q9RL 2HJKA 2EXWC 3W0WE 2IH1A 4H1LG 4FXKB 1X3DA 1FJ1A 3VFTB 3BAEH 5F7WC 2XFXA 2UZIH 2VAAB 1IEAB 3S4SA 5J11B 4HKBB 3LHPH 1EHLL 3D9AH 4P2RE 1U95B 3N9GH 5IB1A 3PGCB 4QRRE 1D5MB 3PJSB 1F3JA 3CUPA 1ZEAH 2DQCH 4UU9B 3RWEA 4QKXB 1TJIH 4R3SB 1PJ9A 1QLFB 4KUZL 2A9NH 3FOLB 1ZLUK 5DJAA 4LLYB 3QQ9D 3T3MF 4HPOL 1W0VA 3FT3A 1AFVH 1K9TA 4OT1H 3VXRE 4LLQB 4OLUL 4U7SA 1JZ4A 1WICA 4JZNB 3KJ4B 2JJWA 2E7MA 3FFCE 4LDOB 3Q5YA 4L4TD 3KYNB 4LSRH 4OUUA 3VXSD 4JFED 3MX0A 2CMRH 1DVFD 3IS1X 1HHGB 3TWCH 1BZ9A 4WW2A 1OF2A 2VLMD 1I7UB 3WJLA 3SDCB 3MODH 4JO3L 3WUWB 35C8H 3GI9H 1INEL 2IPTL 4YHIA 4HCRA 4XCFH 3ZTJH 4XCEB 5HY9A 4ENEC 1KLGA 3OHXB 4QWWC 1D5ZB 4PGDB 5GGUA 2WV3A 5AWNH 3QB7C 5K93A 1UQSA 1T6VN 5CZXD 1HKLL 5SX5H 1P7KB 4XPAL 1E28B 5ESAA 3IJSA 1BAFL 1F8TH 3SE8H 4RIRA 4M4RA 2CDEA 4M7ZC 3I6GB 2HFFB 2V17L 3TJHD 5FECA 3IGAB 1IM9D 3PP4L 5EN2A 1C5CH 1IBGH 1SMOA 2G9HA 1J8HA 4BQCA 3PWNA 2UWEA 2DMCA 2E27L 1LE9B 1EAPA 1CQYA 1EIBA 4OFDA 1NBYB 4M00A 1MCRA 4MSWB 4X6BA 2APXA 3MRPB 3ARRA 4M1DH 2DQJL 4PJXF 4GRMA 4EN3D 1FO0H 4LF3A 5SV4A 3ILQD 2R8SH 3S36L 4ONGL 1MCJA 4Q0XL 3F7VA 1KELH 4CNIB 2WWMC 5C0CB 5A1AA 3L5XH 4KKBD 1DQLH 1JGLL 3QIUD 3AROA 1T80A 2AXGA 3UTZB 4NO3A 5DURB 3RX7A 4ODSL 1OVZA 4PG9B 5LBSH 1SJXA 3PGFL 3KXFE 5D2LB 4NO0B 2DM3A 2VZSA 1FG2B 4OGYL 2GITA 4YUEL 3CVIH 1JHTA 3C5SB 5CAYB 1JNNL 2AEPL 1X9QA 3O2VH 2COQA 3AU1B 4JPVH 4KZDH 2O5YH 5TFSH 3U9PH 3O4LB 1QYGL 1KLUA 4YNYB 3MRHB 3LOWA 3HB3D 4XVTH 4XRCA 1BD2A 2VH5H 4XPHL 3VD3A 3OKLA 1H8OA 3BKJL 3H9ZA 4FTVE 2HTLD 4TVPE 1R5VB 5DD5H 3BKCL 1C5BH 1X4XA 1WIOA 2ITDA 1A5FL 2QQLH 3QPXL 3MJ7A 4NFBA 1RU9H 1UKQA 3FONB 4OM0L 3RZCA 2ITCB 4ZTOH 5EC1B 2AK4B 1NSNL 1RZGA 2B7DT 1YA5A 1TDQA 4E41D 1DLFL 2GSGB 4EI5A 3BPOC 3OAYH 3GSOA 1IGCH 1UM5H 1LP9F 2O5XH 4Q9BA 1A0QH 3A67L 3C2SA 3FFDB 3BPLB 1ODAA 4NDMB 3STBA 3UTTE 1MH5A 3VFGH 3V79C 3B5TA 2ZUVA 5F9DC 5JA9A 1C8PA 1V3MA 1EJOL 1S7SA 3T3PF 1S7UA 4F57L 1Q0YL 1QO3A 1YJDC 3MLZL 1I8MB 2BXYA 4ZAKC 2IAMD 4PJCF 5SV3A 1MSPA 2IADA 1CDHA 3TCXA 4PREB 1LDPL 5JQHC 3OJ2C 4A6YL 1TTFA 2DWDA 5BZDB 5CKAA 2V2WB 4YBHA 4JANB 3GK8H 3D69B 4MNQD 2R2BA 3OZ9H 2AQ2A 3DVGA 3ZKSD 3CLEH 1T83C 2PUQT 1LO2L 3BW9A 5BVJA 1CBVH 5IWLA 1QOKA 1UJTA 2D4DA 4HKZB 2C3XA 3X3FH 1CIUA 4RGMB 5C08A 3IJYA 1QA9B 5D1QB 5C8JA 1N7MH 3FL7A 1PX4A 2B4CH 5I1EH 4EDWL 3WS6A 1FN4B 1CWVA 5K59F 1MHEB 2PO6B 3QQ9C 2M1KA 4I4WA 2X4PA 3EFFA 2PYEE 2FIKB 3FQXB 3VFVB 3GUTA 2I26N 5J6GB 2YRLA 1XF1A 4Q9CA 5E08H 2AGJH 5DMJB 4I0KA 4KHXL 2EDJA 4JFZL 1I1FB 3WO4C 1NAML 4ODTL 5EU4B 4NCC1 3U0WH 1KJMB 3BZEA 1NKRA 2BJMH 1FE8L 4YHZL 1TPXC 3FQRA 3DHMA 4H0HB 2D7PA 1CCZA 1G7MB 4X5XA 1P4LA 4PR5B 1P84J 4TYUA 5C0RL 3DV4A 4EVNB 3BSZH 1WZLA 5JNYA 3DVNA 1Z0MA 1HWHB 2ZCKH 2FSEA 2KL6A 5SX4H 4LSVL 5D2LF 4FABL 1ED3B 5MENB 1JF5A 1A6AB 3GM0A 4JB9H 4JFXA 1FVEB 1CDYA 1BJ1H 3GI8L 3P0GB 1U3HB 4KDWA 1I1AB 4G3YH 2CUIA 2IH3A 4KGJA 1A7BA 4AG4H 1FLRL 4HC1A 2GW5A 1BOGB 1YEIH 1DLHB 4UQ3A 1BQHB 1RVFH 4RGND 4HFUH 4ZUTA 1GZPB 4HF5L 4HKXA 4PRHD 3SDXE 3S7GA 3TJHC 3QCTH 1G7PB 4S1QH 1HILA 4ERSL 5FYJU 1Y18A 2YN5A 4OLYH 2JJTA 4JZJC 2AXHA 3CLFL 3JV0A 3CU7A 5GRVL 2MTPA 5F6HJ 1AGCA 1RIVL 2AI0H 1WCBA 3V52H 3EO9H 4U1SB 4DW2H 4UV7L 1BM3L 5HGDB 3ULUF 3KG5A 5HDQL 5EFIB 1P6AB 3F5WA 5L6YH 4EN3C 1C12A 3ILQC 3L3GA 3T0AA 4ZS7H 4MXWH 1Q9KA 1JZ6A 3CFDA 1SEQL 4HK0A 2ADFH 2EO9A 4XCNA 4KKBC 1FFPA 3S3JA 1TJHH 4NYLA 1T5XA 1T22B 5JHLH 4NO5A 5DQ9A 3LEVL 1MFBL 3QIUC 3HC3L 2R2CA 3V6FA 2NX5A 1FL3B 1RHFA 3KNBB 2VXTL 4DN4H 5GRUH 3KPSE 4RDQF 5TE7L 2DLFH 4CMHB 3VXME 2WBKA 3MOBH 5DI8A 5HHVL 4Z9KB 4KGLA 5DFTA 5D9SB 3RL2B 4CGTA 1N3NB 3D85B 2YMXL 4LLDA 4WWKA 4G9FA 5GS1A 5L7XL 5FCSH 4OCSL 2WUBL 4WI9A 4PBWD 3QUZB 1QUNA 2HRLA 1L0XA 1CT8A 3HB3C 1P2CB 1BIIB 1EEUA 2P48B 2R4SH 5C6WH 2B2XL 1AD9B 1T4KB 4NN6C 3QCVH 2HTLC 4Y5XC 2WINB 4WW1A 1EEZA 2I60L 4MA3A 3OWEA 4WTXA 2AJVH 3A6OA 2FX9L 2W60B 2A6IA 4YAQA 2Q76A 4JFPA 2DD8L 1W72L 1A6UH 4JO1L 2YN3A 1CD1B 3MOQA 2E6JA 1U8NA 2R0KL 3I9GL 1JGVH 1A6WL 4QHKJ 1WVZA 1KCRH 5FHAH 3DGGB 1QBAA 1MCEA 2DI9A 4LRIC 4WHYG 3WXVL 1HXYB 1D6VH 4S1SL 2P49B 5C07B 1KB5L 5BO1L 1SY6A 1JWUB 5TF1L 3RVUD 3HE7D 4QRSA 4YPGB 1ZLVK 5J7CC 2XXMB 3ULSB 5I74B 5F7FA 5GRWA 3TJEL 1MJ8H 5EO9A 4Y5VB 3O3AB 4XMKH 2WUCH 4JY6B 2IAMC 1ZWIB 3HRZA 2B1AH 3RNKB 4QOKE 4KJQD 2VYRE 2C3WA 4JO2H 5E24E 1OT1A 1BMGA 2CLRA 4FN0A 1IILE 5T1KA 5EO0A 4NPYB 4S2SB 4J3XA 5C0AA 4F9PC 3TBVB 3ZL4H 4LCYA 2GKIA 4PLNC 4G6JH 4MXVE 2ARWA 2ZG2A 3F7RA 3CPLB 3WFCH 5EA0H 5HBBA 4LQFH 5DUBB 3MBED 3WKMH 5F7NC 1M1SA 4XPFH 4NNPL 5CSZA 4XPBH 3DURB 1E4XL 4FQ2H 2XPGA 3C6LB 5D2NE 2OM5A 4NM8L 1CGUA 1F5WA 3P73A 2Q8BH 1MUJA 1X5JA 4P9HC 1KT2B 4XHJD 1FIEA 3GBLA 4BJLA 1QACA 3SDAD 1NGYB 4V1DD 3MUGB 2QQNL 1YEDA 2NY7L 2PW2A 3JZ7A 3NFNA 2J8UE 4FQLL 1WC7A 1KPUA 5KJRL 3QJFB 2KQNA 1OB1A 1JK8B 4H88L 2MCPL 2G75B 3SGKA 4W68A 4XP6L 6CGTA 3A0OA 3QDGD 2EDKA 4D0DB 2Z31D 3MLRH 2UUDK 3AREA 2B5IC 5CJQH 4U6XA 4K3DL 1CL7L 3RKDD 1I85C 4LKCB 5DR5H 5KS9E 1H15A 3MGOA 5I19L 4Z7UE 4XVSL 3UTSA 2DDQH 4KDVA 2PXYA 1PDKA 2XKNB 4OIBA 1DQMH 4QHMA 4NN5C 2OXHA 3OKOB 4RGNC 4DQOL 5L2JA 3MRKA 4RQQB 1D5IH 1EBAA 4N8VA 3RPIB 4EIZC 4NSKB 4O2FA 1WISA 4G8GB 3AAZA 3DBXA 3NN8B 4N5UA 1IKFL 5JW4R 2E7LA 3EYFB 3V5KB 1J87A 1RFDH 2AVGA 5FGCE 1WITA 3P11H 2F58L 5DK2A 5JUEH 1UYWH 2NW3B 3ULVF 4NZTH 3VD9A 2IG2L 5AD0B 5CMAB 2OMBA 4HWBL 1DJSA 1FRGH 4EQ3A 5SWSB 4BQ8A 1U2HA 1BVOA 3MACH 5A3ID 3MV8E 3IJHA 3FN0L 3JV6B 1PW3A 2AXJA 4TOYL 3CFKA 3QUML 4HIEB 2OK0H 3RU8L 2FL5A 4ZSOB 3TA3D 2ICES 4PJEB 1S9XB 2OQJA 3UPAA 1PG7H 1ZVYA 1MCQA 4P5TB 3N1MC 1FVCA 3RHWK 2DS4A 3RUGB 5EC2A 2DLIA 3L9RB 4KTDL 2JLLA 2CLVA 5I75B 3QEQB 4QY8B 2DJSA 3PQYA 5T1DH 1VENA 4N68A 1FAIH 2Z92A 2R2HA 4PJXE 1ZT1B 4KPHH 5F7DB 2F8VA 1XH3A 1A1OA 4NKDA 5HGBB 1ND0A 3D3VE 1E4XI 5D6DC 4DZBA 2Q7YB 1KCSH 3W0WD 2FHBA 4QYOA 5IVOA 5EUKA 4BH7B 2JIXB 4FS0A 4G42B 4KK9D 5I71B 1OP5K 3H7BA 2FJHA 2V7NB 4KHTH 5E6YA 1VFAB 3TT1L 2NNAA 5ANMA 1J0JA 2BY0A 1JYWA 4P2RD 2J2ZA 1DUYB 3F62A 3O3EA 4O5LL 1NJ9A 4QRRD 3EIFA 4KK8D 1FNGA 4ZNEE 5L2KA 5EU6A 5D6CA 3BZ4B 2ICWB 3X11A 1A3LH 2H26B 1UM4H 1QLEH 1ONQA 4ZFGL 1IGFH 4NCC2 4JFOB 3RIAF 3UROR 1UWEL 3VXRD 3SKMA 1UZ8A 4NQCD 4XB8A 5DZNA 3PXJA 3HPJB 5E8EB 5KSUA 3JUYA 5JXED 3JWDC 2R69L 4JVPA 4N5EC 4XNZC 3F8UB 2DTMH 3TT3L 1RJYA 1OARL 3IDMA 3FFCD 4APQD 3FMGH 1WWBX 1MCPH 1XCTA 1JN6B 1FSKC 2C1PB 4PGEB 2AKRB 5A43C 4LARL 5E00B 1N4XL 5F7HA 2OL3H 4U1JB 4W81A 1WFTA 3VWKB 4NHUA 3DX6A 2HH0H 3V4VL 3T2OA 4P23D 3VG0L 4TSAH 2E7HA 3P3YA 3ARFB 3N0PB 2XWJB 3DMMD 5I6XB 3SDYL 3MBEC 1I9IL 3Q5TA 3LH2L 3G6DL 3R06A 2BNUB 3DGCR 5I30L 3NCCB 1X5XA 5GS0L 1TLKA 4NHCL 43CAA 3FT2B 4OAWA 2ESVE 4XHJC 2DAVA 5D7IF 3OJDA 2NY1D 3SDAC 1T21A 4M1GL 3UJTH 2HFEB 4F7EB 2VLRB 1J1OL 4S1RH 4ZO6A 3SDDB 3GSWA 1WEJH 1IAKB 3ARBA 4Z8FH 1J0KA 5HHPA 3VFMB 2MHAA 3G04A 5EPMB 1YEGH 4UT9L 5HYSA 4OFPA 4MB3A 3U4BH 5FA4A 3NH7L 1KN4L 2V5RA 1KC5H 4WENB 5TE6H 3SE4C 3M1BB 3PWUB 1E27B 3BN3B 3QXAB 1YEJH 1MIML 5EUOA 4RWYL 1CU4L 4BUGA 4QNPF 4BFBD 4LDLB 1DBBH 3H3BC 1RSFA 2Z31C 3EOYG 3V6BR 4ETQA 3QP3A 3L95A 4X6FB 2NY4D 3ALXA 1NANH 4J2XA 1MRDH 2NY2B 4MQ7B 3IDNA 1XCQA 3B2VH 5GISL 5CILL 3RKDC 1ZGLM 5C9KA 4PJEF 1PG7W 1FNSH 3O45A 5DQDL 4NQDB 3KXFD 5K59E 3RUGF 4K23H 1CE6A 1BOYA 3QFDB 3VW3L 3LKOB 1AXTL 4E0RB 3MRFA 4WGWB 4LIQL 1L7TL 5JMRA 2MWCA 3LMJL 3P4NA 3A6BH 3CX2A 3OKDA 4K55A 4P9MH 1CFSA 1NL0L 1TVBA 3Q6FB 1S9VA 3CVHA 1G7JA 3BZFA 5C0CE 3CXDH 5ERWA 3BP4B 4U1HA 3P9MB 1NUDA 2BSTA 4NWTH 3C87A 3HCVB 4FTVD 4QRQB 1FL6B 4TVPD 4XP9L 3RQ3A 1M71B 2R1YA 4LLVA 4XAKE 4Z77B 5C0BA 5B38B 4TSCL 4UUJA 4PJIF 3KPOB 5TGBB 5FYKL 3C8HA 5E2WH 4WV1A 2GJ6D 4WFEE 5FIEA 1YMHB 4J3OC 4ELKA 3CGTA 5D7JA 3X12B 2ZUQC 4P46C 1PYWB 1TMCB 1SHMA 2Z0BA 3O3DA 4CVXA 5GRXG 2VISB 1HEZA 1XF4B 1XR9B 4LP5A 4Y4KA 5EOQH 5A3IC 5T3ZE 5L9DH 3SKOA 5IB5A 1FZKB 1TQCB 3BGFC 3DYOA 1PKQA 3VWJA 4EUPA 3QIBD 3UTTD 3S37H 5I1LB 3GSXA 5JOEA 1F90L 3IKKA 3TA3C 2EH8H 2PYFA 1HHIB 1A7RL 1OTTD 5CGYD 3O8XB 4WHTA 3LV3B 2HT4D 1FYTB 2VUOA 1UB6B 4Y16B 1KJ2H 5HHNB 4M5ZL 1F4YH 4K3EH 5GPRA 3ULUE 1EUTA 4XAWL 3QHFH 3FCTB 4PJGE 2I5YH 1DFBL 4K07A 4KDTC 3NGBC 1NGZB 4BSVA 4D0BA 1M7DA 1B90A 4LSUL 3EOTL 1GOGA 1MI5B 5DO2D 1VPOH 4KK9C 1IGIH 4TUJB 4MD4B 3FO0L 1XT5A 2BNRE 1JPST 4RBPH 4N8PA 4YEEA 4AYFA 5F1IB 1J18A 4KK8C 1JGUH 5GGRA 3V6ZB 4X9IA 3PL6B 4IMLB 5J06A 1KB9J 2F74B 1NGXA 2IBZY 4GKSB 1RIUL 4KVNL 3STZB 5LGJB 3QG7L 2PYED 5J89A 4LLMB 4W6WB 2HRPH 3UTPE 1D6EB 3D18A 1WTLA 2N7BA 2WP3T 4JJ5B 5JXEC 1ETZA 5DC9B 4R7DB 1J7VR 2X70B 3ZHDA 5ICZB 1EO7A 1CFBA 3QRGH 5ACMA 4YFDB 5DJ2B 4KI5F 3JTTB 4F7PA 1N26A 4APQC 2HT2D 2X40A 3LSOB 1S7QB 4MAUH 4GFTB 4F9LC 3MRLB 4U1GC 5DYOA 4XMPL 5EZOH 4I5BB 4MA8L 3TO4A 4WGVB 5GGRY 4X98A 5CEZH 3KAAA 3W39A 1LD9B 4X5WA 1NMAH 1T6WA 3DMMC 3RDTD 4NC0B 3BX7C 5BQ7B 4JRXB 1UB5A 4JFFB 1BFTA 3RGHA 4KTEL 5FYLL 1LGVA 3IFPA 1I4FA 1VKXB 4HKJA 5C0JB 5JQ6L 3KPNB 2A1WL 3KPMB 5D96B 3GIZH 4P5MA 1E4WH 4K71B 2NY1C 1RULH 5E4EB 1FZMB 3L3IB 4OV5A 1U8PA 4GBXD 4XNXH 2OXGA 5DZOA 1KJVA 1UA6L 4PTTB 1BF2A 4KVCL 1KPRB 4PUBL 4PFEA 1AR1D 3OAYK 4QO1A 3RWHA 2ORBL 2YPLA 5DJCA 2EDLA 4G43B 5AUMA 1EPFA 3M45A 2QQKH 5MENE 2V6HA 3FAXA 4WUKH 3L3OA 5BV7H 1WFNA 4ZUVA 4P0DA 5F9JB 3EYUH 4HJGA 4LCCB 4U6YB 4WU7A 1NUFA 1AKJB 2NTFA 2QBWA 2VAJA 2F54A 2NY4C 4Z7OF 2D9CA 3GSNB 3LDBB 32C2B 3OKMA 1ZAGA 4BUHA 4AT6A 4EOWH 4PJFE 2EDBA 4MCZB 5L0QB 1T04A 5D93C 3T0EE 3NZ8B 4Y4HB 3HMXL 1EFXA 5I9QB 3KPSD 5DDHB 3VXMD 5IG7A 5IHUH 2X4UA 4IHOB 4MYWB 2OZ4H 5CP7A 4NBYB 3TYGL 4XC1H 2CGRH 5I8OH 2WZPD 2AJ3A 3ZLQC 4I3GA 1IM3B 1F6FB 1CG9B 1YMMB 1C16A 5H2BB 3RBSA 2G5RA 2XQBL 1W0WA 2FH8A 3BHBA 4WDIB 2NY3D 1BLNB 1NMCB 1YPZE 3G5VA 2ZCHH 1CTOA 3QT2A 3F12B 3N1PC 4AL8H 3Q0HA 3MNWB 2MQ3A 3INUL 3H42L 2ZCLH 4DZ8A 3CFIC 4UILL 3TFKD 4KQ4L 5DSCB 2YA2A 1EHXA 4YHPB 5DTFB 5CFHA 2R1WB 2VLKB 4I9WE 4M4PA 1EHLH 1BEYL 2N7AA 3KLDA 4KU1A 5ICYB 1OTUD 1FFOA 3WE6B 2ERJC 4KUZH 3W9DA 4FRWA 4Z7NE 1MFAL 4XGZB 3TH3T 1S3KL 3ZKXB 3QIBC 2VLLA 4HPOH 4OCXL 1IEBB 5DQJB 2BOBA 5MEPB 3Q5OA 1B3JA 2X5PA 1AXSA 1T1ZA 1OTTC 4OLUH 5CGYC 5C0IA 2HT4C 5J0BA 1RZJL 5EOTB 4QOKD 3RI5K 2XZQL 2DQIL 4DVRL 1SVCP 3MRNA 1II4E 1QRNE 5MERA 3DX8B 5I1AB 4HWUA 3L1OL 4PTUA 4JO3H 3RWCB 2IPTH 2F5AL 2R39A 1G7HB 1QBML 2CD0A 3HI5L 5DJZB 3TO2B 2DMKA 5C07E 1BZ7B 3JV5A 3BPCB 1K3ZA 3K4AA 2K9UA 3PWJB 3MUY1 1HKLH 4DEPB 4F7MA 4M93B 1BAFH 2FEDD 4HH8A 2Y36L 3HS0A 2V17H 3CMGA 4X6EA 3NPSB 2EDTA 3ARWA 2C7UB 3VGAC 3VXOA 1FO0A 2R23B 4JRYE 4I48A 5EIIA 4ODBD 2W0LA 2E27H 1T1YB 3AB0C 4U1LB 2AW2A 4HHAB 4FQQB 3UZVB 3C08L 5DRXB 3B9DA 1FCCA 3SOBL 5D5MA 3P30L 3TN0B 2IANB 3QUXC 1A1MB 1WAAF 2UWEE 1KSRA 3CFEB 1XF5B 4Q7DA 4K7FA 2DQJH 2HT2C 2XA8L 3MLUL 4O51B 4ZFOB 1V7MH 3V4PL 2JCCB 4ZAKA 5ESQA 4U0QB 5I2IB 4Q0XH 5DJ8B 3WKNA 5F97E 3FTGA 5BJTA 4X99A 3JUZA 5JO5A 1JGLH 1RZKL 1FFNA 3EGSA 3LKSA 5F3BA 1ZTXH 4JFYA 4Z7QF 2EKJA 3CH1B 4XCCL 3RDTC 2CIIB 1S9WB 5E2UL 4BK4A 4Z5RB 2BVYA 4ODSH 5JHDB 2FX8L 3PGFH 5IROC 1T83A 1ZVSA 5C9JB 5IVXA 1KPVA 3JV4B 4OGYH 3S34L 4YUEH 1K5NB 1HINL 4L3EB 2NLJB 4NFCA 2X4OA 4YHKL 5IBLD 1G6RL 2VXUL 1JNNH 2AEPH 4MWFB 4WTZG 2XZAL 4GBXC 1QYGH 3IFNL 4GKNB 4MX7A 4BYHA 3WLWD 3MC0A 3LAFA 4JGJA 4ACPA 5FM8A 4XPHH 3BKJH 3EJJX 1T1XB 1J0ZA 4JVWA 5AZEL 4JREB 3QI9C 1HH9B 5ITFA 1OOAA 3BKCH 3P9LA 1VGKA 1BD2E 2DBJA 5JDJA 3K1KC 3QO1B 3SN6N 3WDIA 3QPXH 4HZLB 2EDQA 3RWJB 4S0TD 3KDMB 3KPPB 4OM0H 1FDLL 1YUHB 5DEZA 1Z2KA 5K33A 1U8OB 2HVJB 1NSNH 1G9NC 3CDGB 4L4TA 4NQXA 3I6LE 2ICEB 3HI1B 1J86A 3VXSA 4JFEA 3MV8D 1DLFH 4HV8B 1GGCH 1HH6A 2H1PH 4OZIA 2EE6A 4MJ5B 4UBDC 3WXWH 4OQTA 3A67H 3G08B 3FO9B 1HSAA 4PPTA 2FO4A 5IOPB 4HLJA 4BFGA 2ICWI 3TF7C 3DO7B 5DRNB 4UQ2B 1EJOH 3HAEA 3IKCB 4JLRB 1CICD 3P9WB 4Z7WA 3SCMB 4F57H 2X44D 1Q0YH 3LQAL 3BIBX 5CIPH 1QVOA 3OXRA 3MLZH 2H9GA 4GSDL 3KWWB 4PJAA 1HYRC 4MAYD 1LDPH 4H1LA 2NY3C 3I6KA 2EYTB 5SWSE 4A6YH 5SWQB 3D3VD 2A83A 1IM9A 2YSSA 1I3RA 4HS6B 3WNLA 1KTDB 3HZVB 2CDGB 3IAGC 3GDBA 4GS7C 4JZJA 4P3CL 2H32H 3TFKC 3HNSL 1GCFA 1AR2A 1JI1A 4ODXB 5E95B 5F3HB 2CKBA 2XY1A 4U7KA 2OR9L 1IQWL 5D7KE 4TNWF 3HI6L 5CLWA 4PJ7F 3WUWG 3HHRB 4EN3A 4H5SB 2EYRA 3PHSA 1Q9OA 1OTUC 1RHHB 4MNHB 1IGTA 3L7FB 4EDWH 4RMWA 3MUZ1 3RWIA 1X6NA 1MJUH 3H9SD 3AVEA 5IF0A 3QQ3A 2EDFA 4PRIB 1LEIA 4RAVB 5IQ9A 4QRTB 3B3IA 3QIUA 4HGKC 4L8BA 5FO9A 2X9WA 1BJ8A 3PHQB 1PEZA 2C26A 4KHXH 1T2QH 4JFZH 3OX8B 1EO8L 1RUPL 3ARVA 1NAMH 4ODTH 4NGHL 4YJZL 3KYKL 3GBML 1U41A 4LPTA 5CP3H 5HTSA 1FE8H 4YHZH 4WCYL 1F6LL 3VFSB 5C0RH 2Y7QA 4N0YL 3WFBL 1AI1H 2UVEA 2BHYA 1I8IB 2QHLA 3QWQB 3WNNA 3GO1L 2B0SL 4LSVH 1KIPB 4FABH 1EEQA 3ZKQD 2Z35B 5D2NC 4NO2A 2DLEA 2OR8A 4Y5XA 1IQDA 1YY9C 3O0RL 1ZT4A 5T1LA 1NC4D 1S9YA 3QSKB 2ESVD 1FLRH 4AM0A 2FEDC 3N06B 1LO0L 5KVGL 1TTUA 4HF5H 1UM6L 3DWTA 3QHTC 5E6ID 3UYRL 4EKXA 3MGTB 1C7SA 1PQZA 1WFOA 5GXBB 4HS3A 3MV9B 2DQHL 2H2PD 4ERSH 4LHUB 2APVA 4E41A 3SDCD 3UZQA 4F33A 1JRHL 1YEFH 3CLFH 4LRIA 1SQ2N 1HOCA 1RIVH 1XZ0A 4MDJB 3KPRB 1ITBB 1QSEB 2FZ3A 3RWDB 4UV7H 3L5JA 3MRDB 1BBJB 1DN2A 1EHNA 3GSRB 3OKNB 3VE0B 4M7KL 4LPUA 4D9RE 1EMTL 4QF1B 4PGJA 3B6SA 2ARJA 2IAMA 5BCAA 2O26U 4YIQB 3UTOA 3RHWF 3MRQB 2LV4A 5CJ8A 1I3UA 5ALBL 4R97B 1VFMA 4F9PA 5BVPH 1MOEA 3LEVH 1MFBH 4MNQA 2ZSVB 1UG9A 2VXTH 1RIHL 5C0EA 3AXLA 5TE7H 4F7CA 2VO5A 3X13A 3IF1A 4R2GB 3V0AC 2NY6B 2YMXH 5IBLC 4YXHL 3MCG1 5L7XH 4JHBA 4OCSH 2WUBH 1BHGA 1BFVL 4WI3A 1C5DA 5C0CD 4E42A 2BX5A 3V0VA 3KPTA 1I7RB 2LE9A 5ICXB 2EXYC 3BH8B 2R56L 4NM4L 3U2SA 4RDQG 1K4CA 2VDNL 1UKSA 2J8OA 3HLAA 1U8IB 2B2XH 3OPZL 4XAKD 1FQ9C 3GSQA 5DURD 4LEOB 1G0YR 3HMWL 2I60H 4N8CL 5C3TA 2HN7A 5DK0B 4WFED 5FO7A 5ITBL 4U1KA 3HUJB 3MREB 3TBWB 4PBVC 4J12A 4OD3H 1W72H 2CRMA 5T3ZD 4JHWL 1B0GB 1IT9L 4ONFL 5CLTA 2R0KH 3TBTB 3D39B 1A6WH 1IL1A 4X0KA 3S9DB 5KSBB 5TDNB 3WXVH 2VITA 1KB5H 1CXFA 1I85A 4R4ND 5C6TL 5IEHA 3EO1A 4HLZH 5T33L 5TF1H 4GXUM 1CICC 1MHCA 3TJEH 3BGMB 2AJXL 3D0VB 2GUOA 3ULUD 5EU7E 1F6AA 1YECL 3VMOA 4MAYC 1JGDA 1Q9LA 2ATKB 3K1DA 1JPGB 4PRHA 5KTEL 3ECBB 3REVA 5J57B 3MRMA 1L0QA 3OR6A 1LWRA 3S36X 3VCLB 5FDWB 2IH1B 4QRPB 1IC4L 5DEGA 5C0AE 5HYJB 3QA3A 1J5OH 2PNDA 4HG4K 4BQ6A 5IVZB 1E4XH 4NM8H 1JGEB 4G8FA 4L4VB 2VDRL 4HWZB 3VXUB 3JWOH 2RJMA 3P0VH 2FX7L 3DTXA 3VXTA 1JRHI 5FXCH 1GZQA 3S5LB 1N2RA 5EBWA 1QSZA 2A74A 2DQGL 1K8DA 3B9KD 5C0GB 5JOPE 1JF1B 2NY7H 1W0VB 4DKEL 4N0FB 3TVMB 3UTPD 5FUZL 2AERT 1BQHG 2A6KB 4L8DA 4H88H 4JDTL 2I9LB 5F7EL 1FZOA 5C6PB 4ISVB 4AIZA 4XP6H 5J11C 1R5WB 1MNUL 1BZ9B 4PJ8B 5D1QD 1U93B 4NOBA 3DJ9A 1CDCA 2Y9RT 4ZUWA 5FKPB 1OCWL 3SKJL 1QKZL 4K3DH 2OJEA 1CL7H 1MVUB 1KLGB 1NC2D 5D6DA 1JPFB 3IDYC 5I19H 4M7LL 2I9TB 4XVSH 2K3TA 4JFQA 5FKAA 1DCLA 3VRIA 1KXTB 3KJ4C 1NFDF 4DQOH 3AC0A 2BOCA 3ZE1E 4MB5A 5EN2B 3E3QE 1ZA3B 3JWOC 5SWZE 4V2CB 2B8OT 5AYQA 5GGVL 2B20A 2H2PC 3RVWD 3AGVA 3NCFB 3LQMA 4I3SL 4WEMB 3SDCC 5FB8A 1IKFH 2IALB 3BRGC 1J88A 3MGAA 2ZG1A 3V5DA 5D1ZB 1DBML 4D9QE 5MEND 3RFZC 2P5WE 3GSVA 3HUJF 5F96L 3MA9L 1R3IL 5EWIH 5DJYA 4ZUUA 2F58H 1SYSA 5TH2A 4JFFE 5DMKB 1U3HD 2C4XA 1I1AD 1T5WA 2IG2H 3M17A 4GQ9H 3DSFL 4LRNL 3UAJD 4HWBH 4YDIL 1JUFA 5KSBF 4L8CA 2DYPD 1K8IA 1H3PL 1N8ZA 4C56E 1Q9WA 3MA7A 4H8WL 2QLVB 3FN0H 5CZKA 3T0ED 2H2SD 4TOYH 1AY1L 3LPGA 3RU8H 4XCYA 1ZK9A 4IEFB 4FZEH 4NZRL 3T4AB 2CRYA 5LKNA 5IHBA 2H41A 3MBEA 3DUUB 3O4OB 5IJKC 2OTUA 1MELA 1JHTB 4XXDA 1GGIL 4GG6F 1RJZB 4X9BA 3TIEB 1NGPL 3DRQB 3S88L 1ZLWK 3HFMH 3H9HA 4KTDH 4X9GA 3ZT6A 1INQA 4CADA 3UYOD 4WUUE 2P7TA 3SDAA 1QR4A 3QJHA 1J1PL 3MZTA 1R0AH 2K1MA 3VGDA 4V1DA 2Z8SA 5IKCB 4YWGL 2IPKA 1A1NB 4LVEA 2DB8A 4XVUD 2ZOLB 3TT1H 3SE4A 1F4AA 1GGBL 4YBLB 4I9WD 4PRNA 1R3KB 2XTJB 4O5LH 5ELIA 2KKQA 3QDGA 4U3CA 1UVQB 5ANME 3QNYA 2Z31A 4D3CL 2DQTH 3GSOB 3FRUA 4NQEE 4W4NA 1AGEA 1F4XL 3QUZD 3G6JB 5I8EA 2KZWA 1BVKB 3EYOB 1MLBB 1QFHA 2NY5C 1S7SB 1UWEH 1UH4A 2OL3A 1HKFA 2J6EL 5HYIA 5T3XL 2R69H 5GS2D 3TT3H 3TYFB 1OARH 2FNBA 3RVTD 1MEXL 4GAJL 4JDZB 3ULUC 1QRND 1J10A 3CFBA 2VLKE 4LARH 1N4XH 1PKOA 3S96B 5GGTA 2VNCA 3V4VH 3RY4A 4L9DA 4G5ZL 4M61B 1KCLA 3DVGB 4WEBL 3WN5B 3FB8A 1U8JB 1KIQB 1KIUA 3GMQA 4I77L 4LLWB 5BVJB 1NLBL 3WL9A 3VGHA 4P5KB 3BPLC 1REIA 5C07D 3SDYH 5KZCB 3T8XB 3O11A 3PABA 4ZQKB 4I0PA 3FN9A 5J1TC 2YZ8A 1LEGB 3LH2H 3G6DH 2O61A 1QBBA 4JPIA 5C8JB 5I30H 5GS0H 2W1NA 4KFZC 1QBLL 4XWGL 3U83A 1CE1L 5E70A 4OLEA 1FZJA 2AV1B 3IDUA 2P44B 4G8EB 2ADIB 1CZ8H 4P46A 4YR6A 4JHZA 1J1OH 3MYJA 4KWUA 1J1XL 4JRYD 4ONHA 1IGML 4FFZL 3QXDA 3MJGX 4ZPVA 1AD0A 1EHAA 5JIPA 4UT9H 2DICA 2YK1L 1F4WL 2YBRB 3HE6B 3NH7H 3WIHH 1H3GA 5ABDE 1GGYA 2HTKD 3TA3A 2VTFA <